data_1LD8
# 
_entry.id   1LD8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LD8         
RCSB  RCSB015854   
WWPDB D_1000015854 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LD7 'Human farnesyltransferase with FPP and inhibitor compound 66'        unspecified 
PDB 1JCQ 'Human farnesyltransferase with FPP and inhibitor compound L-739,750' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LD8 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Taylor, J.S.' 1 
'Terry, K.L.'  2 
'Beese, L.S.'  3 
# 
_citation.id                        primary 
_citation.title                     
;3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            45 
_citation.page_first                2388 
_citation.page_last                 2409 
_citation.year                      2002 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12036349 
_citation.pdbx_database_id_DOI      10.1021/jm010531d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, I.M.'          1  ? 
primary 'Gallicchio, S.N.'    2  ? 
primary 'Abrams, M.'          3  ? 
primary 'Beese, L.S.'         4  ? 
primary 'Beshore, D.C.'       5  ? 
primary 'Bhimnathwala, H.'    6  ? 
primary 'Bogusky, M.J.'       7  ? 
primary 'Buser, C.A.'         8  ? 
primary 'Culberson, J.C.'     9  ? 
primary 'Davide, J.'          10 ? 
primary 'Ellis-Hutchings, M.' 11 ? 
primary 'Fernandes, C.'       12 ? 
primary 'Gibbs, J.B.'         13 ? 
primary 'Graham, S.L.'        14 ? 
primary 'Hamilton, K.A.'      15 ? 
primary 'Hartman, G.D.'       16 ? 
primary 'Heimbrook, D.C.'     17 ? 
primary 'Homnick, C.F.'       18 ? 
primary 'Huber, H.E.'         19 ? 
primary 'Huff, J.R.'          20 ? 
primary 'Kassahun, K.'        21 ? 
primary 'Koblan, K.S.'        22 ? 
primary 'Kohl, N.E.'          23 ? 
primary 'Lobell, R.B.'        24 ? 
primary 'Lynch Jr., J.J.'     25 ? 
primary 'Robinson, R.'        26 ? 
primary 'Rodrigues, A.D.'     27 ? 
primary 'Taylor, J.S.'        28 ? 
primary 'Walsh, E.S.'         29 ? 
primary 'Williams, T.M.'      30 ? 
primary 'Zartman, C.B.'       31 ? 
# 
_cell.entry_id           1LD8 
_cell.length_a           178.134 
_cell.length_b           178.134 
_cell.length_c           64.461 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LD8 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'protein farnesyltransferase alpha subunit' 44864.840 1   2.5.1.- ? ? ? 
2 polymer     man 'protein farnesyltransferase beta subunit' 48822.406 1   2.5.1.- ? ? ? 
3 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1   ?       ? ? ? 
4 non-polymer syn 'ACETIC ACID' 60.052    2   ?       ? ? ? 
5 non-polymer syn 'ZINC ION' 65.409    1   ?       ? ? ? 
6 non-polymer syn 'FARNESYL DIPHOSPHATE' 382.326   1   ?       ? ? ? 
7 non-polymer syn 
;(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRI AZA-CYCLOOCTADECOSINE-9-CARBONITRILE
;
435.477   1   ?       ? ? ? 
8 water       nat water 18.015    691 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAAX farnesyltransferase alpha subunit, RAS proteins prenyltransferase alpha, FTase-alpha' 
2 'CAAX farnesyltransferase beta subunit, RAS proteins prenyltransferase beta, FTase-beta'    
3 sucrose                                                                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
A ? 
2 'polypeptide(L)' no no 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   THR n 
1 5   GLU n 
1 6   GLY n 
1 7   VAL n 
1 8   GLY n 
1 9   GLU n 
1 10  ALA n 
1 11  ALA n 
1 12  GLN n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  GLY n 
1 18  GLN n 
1 19  PRO n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  PRO n 
1 24  PRO n 
1 25  GLN n 
1 26  PRO n 
1 27  HIS n 
1 28  PRO n 
1 29  PRO n 
1 30  PRO n 
1 31  PRO n 
1 32  GLN n 
1 33  GLN n 
1 34  GLN n 
1 35  HIS n 
1 36  LYS n 
1 37  GLU n 
1 38  GLU n 
1 39  MET n 
1 40  ALA n 
1 41  ALA n 
1 42  GLU n 
1 43  ALA n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  VAL n 
1 48  ALA n 
1 49  SER n 
1 50  PRO n 
1 51  MET n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  PHE n 
1 56  VAL n 
1 57  SER n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  PRO n 
1 62  SER n 
1 63  TYR n 
1 64  VAL n 
1 65  LEU n 
1 66  TYR n 
1 67  ARG n 
1 68  ASP n 
1 69  ARG n 
1 70  ALA n 
1 71  GLU n 
1 72  TRP n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASP n 
1 77  PRO n 
1 78  VAL n 
1 79  PRO n 
1 80  GLN n 
1 81  ASN n 
1 82  ASP n 
1 83  GLY n 
1 84  PRO n 
1 85  ASN n 
1 86  PRO n 
1 87  VAL n 
1 88  VAL n 
1 89  GLN n 
1 90  ILE n 
1 91  ILE n 
1 92  TYR n 
1 93  SER n 
1 94  ASP n 
1 95  LYS n 
1 96  PHE n 
1 97  ARG n 
1 98  ASP n 
1 99  VAL n 
1 100 TYR n 
1 101 ASP n 
1 102 TYR n 
1 103 PHE n 
1 104 ARG n 
1 105 ALA n 
1 106 VAL n 
1 107 LEU n 
1 108 GLN n 
1 109 ARG n 
1 110 ASP n 
1 111 GLU n 
1 112 ARG n 
1 113 SER n 
1 114 GLU n 
1 115 ARG n 
1 116 ALA n 
1 117 PHE n 
1 118 LYS n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ASP n 
1 123 ALA n 
1 124 ILE n 
1 125 GLU n 
1 126 LEU n 
1 127 ASN n 
1 128 ALA n 
1 129 ALA n 
1 130 ASN n 
1 131 TYR n 
1 132 THR n 
1 133 VAL n 
1 134 TRP n 
1 135 HIS n 
1 136 PHE n 
1 137 ARG n 
1 138 ARG n 
1 139 VAL n 
1 140 LEU n 
1 141 LEU n 
1 142 LYS n 
1 143 SER n 
1 144 LEU n 
1 145 GLN n 
1 146 LYS n 
1 147 ASP n 
1 148 LEU n 
1 149 HIS n 
1 150 GLU n 
1 151 GLU n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 ALA n 
1 158 ILE n 
1 159 ILE n 
1 160 GLU n 
1 161 GLU n 
1 162 GLN n 
1 163 PRO n 
1 164 LYS n 
1 165 ASN n 
1 166 TYR n 
1 167 GLN n 
1 168 VAL n 
1 169 TRP n 
1 170 HIS n 
1 171 HIS n 
1 172 ARG n 
1 173 ARG n 
1 174 VAL n 
1 175 LEU n 
1 176 VAL n 
1 177 GLU n 
1 178 TRP n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 PRO n 
1 183 SER n 
1 184 GLN n 
1 185 GLU n 
1 186 LEU n 
1 187 GLU n 
1 188 PHE n 
1 189 ILE n 
1 190 ALA n 
1 191 ASP n 
1 192 ILE n 
1 193 LEU n 
1 194 ASN n 
1 195 GLN n 
1 196 ASP n 
1 197 ALA n 
1 198 LYS n 
1 199 ASN n 
1 200 TYR n 
1 201 HIS n 
1 202 ALA n 
1 203 TRP n 
1 204 GLN n 
1 205 HIS n 
1 206 ARG n 
1 207 GLN n 
1 208 TRP n 
1 209 VAL n 
1 210 ILE n 
1 211 GLN n 
1 212 GLU n 
1 213 PHE n 
1 214 LYS n 
1 215 LEU n 
1 216 TRP n 
1 217 ASP n 
1 218 ASN n 
1 219 GLU n 
1 220 LEU n 
1 221 GLN n 
1 222 TYR n 
1 223 VAL n 
1 224 ASP n 
1 225 GLN n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 GLU n 
1 230 ASP n 
1 231 VAL n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 SER n 
1 236 VAL n 
1 237 TRP n 
1 238 ASN n 
1 239 GLN n 
1 240 ARG n 
1 241 TYR n 
1 242 PHE n 
1 243 VAL n 
1 244 ILE n 
1 245 SER n 
1 246 ASN n 
1 247 THR n 
1 248 THR n 
1 249 GLY n 
1 250 TYR n 
1 251 ASN n 
1 252 ASP n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 LEU n 
1 257 GLU n 
1 258 ARG n 
1 259 GLU n 
1 260 VAL n 
1 261 GLN n 
1 262 TYR n 
1 263 THR n 
1 264 LEU n 
1 265 GLU n 
1 266 MET n 
1 267 ILE n 
1 268 LYS n 
1 269 LEU n 
1 270 VAL n 
1 271 PRO n 
1 272 HIS n 
1 273 ASN n 
1 274 GLU n 
1 275 SER n 
1 276 ALA n 
1 277 TRP n 
1 278 ASN n 
1 279 TYR n 
1 280 LEU n 
1 281 LYS n 
1 282 GLY n 
1 283 ILE n 
1 284 LEU n 
1 285 GLN n 
1 286 ASP n 
1 287 ARG n 
1 288 GLY n 
1 289 LEU n 
1 290 SER n 
1 291 LYS n 
1 292 TYR n 
1 293 PRO n 
1 294 ASN n 
1 295 LEU n 
1 296 LEU n 
1 297 ASN n 
1 298 GLN n 
1 299 LEU n 
1 300 LEU n 
1 301 ASP n 
1 302 LEU n 
1 303 GLN n 
1 304 PRO n 
1 305 SER n 
1 306 HIS n 
1 307 SER n 
1 308 SER n 
1 309 PRO n 
1 310 TYR n 
1 311 LEU n 
1 312 ILE n 
1 313 ALA n 
1 314 PHE n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 ILE n 
1 319 TYR n 
1 320 GLU n 
1 321 ASP n 
1 322 MET n 
1 323 LEU n 
1 324 GLU n 
1 325 ASN n 
1 326 GLN n 
1 327 CYS n 
1 328 ASP n 
1 329 ASN n 
1 330 LYS n 
1 331 GLU n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 ASN n 
1 336 LYS n 
1 337 ALA n 
1 338 LEU n 
1 339 GLU n 
1 340 LEU n 
1 341 CYS n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 ALA n 
1 346 LYS n 
1 347 GLU n 
1 348 LYS n 
1 349 ASP n 
1 350 THR n 
1 351 ILE n 
1 352 ARG n 
1 353 LYS n 
1 354 GLU n 
1 355 TYR n 
1 356 TRP n 
1 357 ARG n 
1 358 TYR n 
1 359 ILE n 
1 360 GLY n 
1 361 ARG n 
1 362 SER n 
1 363 LEU n 
1 364 GLN n 
1 365 SER n 
1 366 LYS n 
1 367 HIS n 
1 368 SER n 
1 369 THR n 
1 370 GLU n 
1 371 ASN n 
1 372 ASP n 
1 373 SER n 
1 374 PRO n 
1 375 THR n 
1 376 ASN n 
1 377 VAL n 
1 378 GLN n 
1 379 GLN n 
1 380 GLU n 
1 381 GLU n 
1 382 PHE n 
2 1   MET n 
2 2   ALA n 
2 3   SER n 
2 4   PRO n 
2 5   SER n 
2 6   SER n 
2 7   PHE n 
2 8   THR n 
2 9   TYR n 
2 10  TYR n 
2 11  CYS n 
2 12  PRO n 
2 13  PRO n 
2 14  SER n 
2 15  SER n 
2 16  SER n 
2 17  PRO n 
2 18  VAL n 
2 19  TRP n 
2 20  SER n 
2 21  GLU n 
2 22  PRO n 
2 23  LEU n 
2 24  TYR n 
2 25  SER n 
2 26  LEU n 
2 27  ARG n 
2 28  PRO n 
2 29  GLU n 
2 30  HIS n 
2 31  ALA n 
2 32  ARG n 
2 33  GLU n 
2 34  ARG n 
2 35  LEU n 
2 36  GLN n 
2 37  ASP n 
2 38  ASP n 
2 39  SER n 
2 40  VAL n 
2 41  GLU n 
2 42  THR n 
2 43  VAL n 
2 44  THR n 
2 45  SER n 
2 46  ILE n 
2 47  GLU n 
2 48  GLN n 
2 49  ALA n 
2 50  LYS n 
2 51  VAL n 
2 52  GLU n 
2 53  GLU n 
2 54  LYS n 
2 55  ILE n 
2 56  GLN n 
2 57  GLU n 
2 58  VAL n 
2 59  PHE n 
2 60  SER n 
2 61  SER n 
2 62  TYR n 
2 63  LYS n 
2 64  PHE n 
2 65  ASN n 
2 66  HIS n 
2 67  LEU n 
2 68  VAL n 
2 69  PRO n 
2 70  ARG n 
2 71  LEU n 
2 72  VAL n 
2 73  LEU n 
2 74  GLN n 
2 75  ARG n 
2 76  GLU n 
2 77  LYS n 
2 78  HIS n 
2 79  PHE n 
2 80  HIS n 
2 81  TYR n 
2 82  LEU n 
2 83  LYS n 
2 84  ARG n 
2 85  GLY n 
2 86  LEU n 
2 87  ARG n 
2 88  GLN n 
2 89  LEU n 
2 90  THR n 
2 91  ASP n 
2 92  ALA n 
2 93  TYR n 
2 94  GLU n 
2 95  CYS n 
2 96  LEU n 
2 97  ASP n 
2 98  ALA n 
2 99  SER n 
2 100 ARG n 
2 101 PRO n 
2 102 TRP n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 TRP n 
2 107 ILE n 
2 108 LEU n 
2 109 HIS n 
2 110 SER n 
2 111 LEU n 
2 112 GLU n 
2 113 LEU n 
2 114 LEU n 
2 115 ASP n 
2 116 GLU n 
2 117 PRO n 
2 118 ILE n 
2 119 PRO n 
2 120 GLN n 
2 121 ILE n 
2 122 VAL n 
2 123 ALA n 
2 124 THR n 
2 125 ASP n 
2 126 VAL n 
2 127 CYS n 
2 128 GLN n 
2 129 PHE n 
2 130 LEU n 
2 131 GLU n 
2 132 LEU n 
2 133 CYS n 
2 134 GLN n 
2 135 SER n 
2 136 PRO n 
2 137 GLU n 
2 138 GLY n 
2 139 GLY n 
2 140 PHE n 
2 141 GLY n 
2 142 GLY n 
2 143 GLY n 
2 144 PRO n 
2 145 GLY n 
2 146 GLN n 
2 147 TYR n 
2 148 PRO n 
2 149 HIS n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 THR n 
2 154 TYR n 
2 155 ALA n 
2 156 ALA n 
2 157 VAL n 
2 158 ASN n 
2 159 ALA n 
2 160 LEU n 
2 161 CYS n 
2 162 ILE n 
2 163 ILE n 
2 164 GLY n 
2 165 THR n 
2 166 GLU n 
2 167 GLU n 
2 168 ALA n 
2 169 TYR n 
2 170 ASP n 
2 171 ILE n 
2 172 ILE n 
2 173 ASN n 
2 174 ARG n 
2 175 GLU n 
2 176 LYS n 
2 177 LEU n 
2 178 LEU n 
2 179 GLN n 
2 180 TYR n 
2 181 LEU n 
2 182 TYR n 
2 183 SER n 
2 184 LEU n 
2 185 LYS n 
2 186 GLN n 
2 187 PRO n 
2 188 ASP n 
2 189 GLY n 
2 190 SER n 
2 191 PHE n 
2 192 LEU n 
2 193 MET n 
2 194 HIS n 
2 195 VAL n 
2 196 GLY n 
2 197 GLY n 
2 198 GLU n 
2 199 VAL n 
2 200 ASP n 
2 201 VAL n 
2 202 ARG n 
2 203 SER n 
2 204 ALA n 
2 205 TYR n 
2 206 CYS n 
2 207 ALA n 
2 208 ALA n 
2 209 SER n 
2 210 VAL n 
2 211 ALA n 
2 212 SER n 
2 213 LEU n 
2 214 THR n 
2 215 ASN n 
2 216 ILE n 
2 217 ILE n 
2 218 THR n 
2 219 PRO n 
2 220 ASP n 
2 221 LEU n 
2 222 PHE n 
2 223 GLU n 
2 224 GLY n 
2 225 THR n 
2 226 ALA n 
2 227 GLU n 
2 228 TRP n 
2 229 ILE n 
2 230 ALA n 
2 231 ARG n 
2 232 CYS n 
2 233 GLN n 
2 234 ASN n 
2 235 TRP n 
2 236 GLU n 
2 237 GLY n 
2 238 GLY n 
2 239 ILE n 
2 240 GLY n 
2 241 GLY n 
2 242 VAL n 
2 243 PRO n 
2 244 GLY n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 HIS n 
2 249 GLY n 
2 250 GLY n 
2 251 TYR n 
2 252 THR n 
2 253 PHE n 
2 254 CYS n 
2 255 GLY n 
2 256 LEU n 
2 257 ALA n 
2 258 ALA n 
2 259 LEU n 
2 260 VAL n 
2 261 ILE n 
2 262 LEU n 
2 263 LYS n 
2 264 ARG n 
2 265 GLU n 
2 266 ARG n 
2 267 SER n 
2 268 LEU n 
2 269 ASN n 
2 270 LEU n 
2 271 LYS n 
2 272 SER n 
2 273 LEU n 
2 274 LEU n 
2 275 GLN n 
2 276 TRP n 
2 277 VAL n 
2 278 THR n 
2 279 SER n 
2 280 ARG n 
2 281 GLN n 
2 282 MET n 
2 283 ARG n 
2 284 PHE n 
2 285 GLU n 
2 286 GLY n 
2 287 GLY n 
2 288 PHE n 
2 289 GLN n 
2 290 GLY n 
2 291 ARG n 
2 292 CYS n 
2 293 ASN n 
2 294 LYS n 
2 295 LEU n 
2 296 VAL n 
2 297 ASP n 
2 298 GLY n 
2 299 CYS n 
2 300 TYR n 
2 301 SER n 
2 302 PHE n 
2 303 TRP n 
2 304 GLN n 
2 305 ALA n 
2 306 GLY n 
2 307 LEU n 
2 308 LEU n 
2 309 PRO n 
2 310 LEU n 
2 311 LEU n 
2 312 HIS n 
2 313 ARG n 
2 314 ALA n 
2 315 LEU n 
2 316 HIS n 
2 317 ALA n 
2 318 GLN n 
2 319 GLY n 
2 320 ASP n 
2 321 PRO n 
2 322 ALA n 
2 323 LEU n 
2 324 SER n 
2 325 MET n 
2 326 SER n 
2 327 HIS n 
2 328 TRP n 
2 329 MET n 
2 330 PHE n 
2 331 HIS n 
2 332 GLN n 
2 333 GLN n 
2 334 ALA n 
2 335 LEU n 
2 336 GLN n 
2 337 GLU n 
2 338 TYR n 
2 339 ILE n 
2 340 LEU n 
2 341 MET n 
2 342 CYS n 
2 343 CYS n 
2 344 GLN n 
2 345 CYS n 
2 346 PRO n 
2 347 ALA n 
2 348 GLY n 
2 349 GLY n 
2 350 LEU n 
2 351 LEU n 
2 352 ASP n 
2 353 LYS n 
2 354 PRO n 
2 355 GLY n 
2 356 LYS n 
2 357 SER n 
2 358 ARG n 
2 359 ASP n 
2 360 PHE n 
2 361 TYR n 
2 362 HIS n 
2 363 THR n 
2 364 CYS n 
2 365 TYR n 
2 366 CYS n 
2 367 LEU n 
2 368 SER n 
2 369 GLY n 
2 370 LEU n 
2 371 SER n 
2 372 ILE n 
2 373 ALA n 
2 374 GLN n 
2 375 HIS n 
2 376 PHE n 
2 377 GLY n 
2 378 SER n 
2 379 GLY n 
2 380 ALA n 
2 381 MET n 
2 382 LEU n 
2 383 HIS n 
2 384 ASP n 
2 385 VAL n 
2 386 VAL n 
2 387 LEU n 
2 388 GLY n 
2 389 VAL n 
2 390 PRO n 
2 391 GLU n 
2 392 ASN n 
2 393 ALA n 
2 394 LEU n 
2 395 GLN n 
2 396 PRO n 
2 397 THR n 
2 398 HIS n 
2 399 PRO n 
2 400 VAL n 
2 401 TYR n 
2 402 ASN n 
2 403 ILE n 
2 404 GLY n 
2 405 PRO n 
2 406 ASP n 
2 407 LYS n 
2 408 VAL n 
2 409 ILE n 
2 410 GLN n 
2 411 ALA n 
2 412 THR n 
2 413 THR n 
2 414 TYR n 
2 415 PHE n 
2 416 LEU n 
2 417 GLN n 
2 418 LYS n 
2 419 PRO n 
2 420 VAL n 
2 421 PRO n 
2 422 GLY n 
2 423 PHE n 
2 424 GLU n 
2 425 GLU n 
2 426 LEU n 
2 427 LYS n 
2 428 ASP n 
2 429 GLU n 
2 430 THR n 
2 431 SER n 
2 432 ALA n 
2 433 GLU n 
2 434 PRO n 
2 435 ALA n 
2 436 THR n 
2 437 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PFTA_HUMAN 1 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
;
1 P49354 ? 
2 UNP PFTB_HUMAN 2 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
1 P49356 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LD8 A 1 ? 379 ? P49354 1 ? 379 ? 1   379 
2 2 1LD8 B 1 ? 437 ? P49356 1 ? 437 ? 501 937 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LD8 GLU A 380 ? UNP P49354 ? ? 'cloning artifact' 380 1 
1 1LD8 GLU A 381 ? UNP P49354 ? ? 'cloning artifact' 381 2 
1 1LD8 PHE A 382 ? UNP P49354 ? ? 'cloning artifact' 382 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer                   . 'ACETIC ACID' ?             'C2 H4 O2'       60.052  
ALA 'L-peptide linking'           y ALANINE ?             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ?             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?             'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE ?             'C3 H7 N O2 S'   121.158 
FPP non-polymer                   . 'FARNESYL DIPHOSPHATE' ?             'C15 H28 O7 P2'  382.326 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ?             'C6 H12 O6'      180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ?             'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE ?             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?             'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ?             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ?             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ?             'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE ?             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ?             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE ?             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ?             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ?             'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ?             'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE ?             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ?             'C9 H11 N O3'    181.189 
U49 non-polymer                   . 
;(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRI AZA-CYCLOOCTADECOSINE-9-CARBONITRILE
;
'COMPOUND 49' 'C26 H21 N5 O2'  435.477 
VAL 'L-peptide linking'           y VALINE ?             'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION' ?             'Zn 2'           65.409  
# 
_exptl.entry_id          1LD8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_percent_sol   60.95 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG8K, NH4OAc, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-02-29 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'yale mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1LD8 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             31.02 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   88092 
_reflns.number_all                   88092 
_reflns.percent_possible_obs         81.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        26.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.91 
_reflns_shell.percent_possible_all   26.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LD8 
_refine.ls_number_reflns_obs                     87133 
_refine.ls_number_reflns_all                     88092 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               2579340.41 
_refine.pdbx_data_cutoff_low_absF                .000000 
_refine.ls_d_res_low                             30.85 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    80.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1840000 
_refine.ls_R_factor_R_free                       0.2020000 
_refine.ls_R_factor_R_free_error                 .003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4385 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.7 
_refine.aniso_B[1][1]                            0.31 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.63 
_refine.aniso_B[1][2]                            1.96 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .403211 
_refine.solvent_model_param_bsol                 49.8462 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JCQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LD8 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.28 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5877 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         81 
_refine_hist.number_atoms_solvent             699 
_refine_hist.number_atoms_total               6657 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        30.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      .77   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.64  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.01  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.61  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             4399 
_refine_ls_shell.R_factor_R_work                  0.4530000 
_refine_ls_shell.percent_reflns_obs               25.9 
_refine_ls_shell.R_factor_R_free                  0.4540000 
_refine_ls_shell.R_factor_R_free_error            .030 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             229 
_refine_ls_shell.number_reflns_obs                4628 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 SUCROSE.PAR       SUCROSE.TOP 'X-RAY DIFFRACTION' 
5 ACETATE.PAR       ACETATE.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LD8 
_struct.title                     
'Co-crystal structure of Human Farnesyltransferase with farnesyldiphosphate and inhibitor compound 49' 
_struct.pdbx_descriptor           
'protein farnesyltransferase alpha subunit (E.C.2.5.1.-), protein farnesyltransferase beta subunit (E.C.2.5.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LD8 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'alpha-alpha barrel, inhibitor, ftase, pftase, fpp, caax, ras, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 65  ? ALA A 73  ? LEU A 65  ALA A 73  5 ? 9  
HELX_P HELX_P2  2  SER A 93  ? ASP A 110 ? SER A 93  ASP A 110 1 ? 18 
HELX_P HELX_P3  3  SER A 113 ? ASN A 127 ? SER A 113 ASN A 127 1 ? 15 
HELX_P HELX_P4  4  ASN A 130 ? LEU A 144 ? ASN A 130 LEU A 144 1 ? 15 
HELX_P HELX_P5  5  ASP A 147 ? GLN A 162 ? ASP A 147 GLN A 162 1 ? 16 
HELX_P HELX_P6  6  ASN A 165 ? ARG A 180 ? ASN A 165 ARG A 180 1 ? 16 
HELX_P HELX_P7  7  GLN A 184 ? ASP A 196 ? GLN A 184 ASP A 196 1 ? 13 
HELX_P HELX_P8  8  ASN A 199 ? PHE A 213 ? ASN A 199 PHE A 213 1 ? 15 
HELX_P HELX_P9  9  ASN A 218 ? ASP A 230 ? ASN A 218 ASP A 230 1 ? 13 
HELX_P HELX_P10 10 ASN A 233 ? THR A 247 ? ASN A 233 THR A 247 1 ? 15 
HELX_P HELX_P11 11 ASP A 252 ? VAL A 270 ? ASP A 252 VAL A 270 1 ? 19 
HELX_P HELX_P12 12 ASN A 273 ? GLN A 285 ? ASN A 273 GLN A 285 1 ? 13 
HELX_P HELX_P13 13 GLY A 288 ? LYS A 291 ? GLY A 288 LYS A 291 5 ? 4  
HELX_P HELX_P14 14 TYR A 292 ? SER A 307 ? TYR A 292 SER A 307 1 ? 16 
HELX_P HELX_P15 15 SER A 308 ? ASN A 325 ? SER A 308 ASN A 325 1 ? 18 
HELX_P HELX_P16 16 ASN A 329 ? GLU A 347 ? ASN A 329 GLU A 347 1 ? 19 
HELX_P HELX_P17 17 ASP A 349 ? ILE A 351 ? ASP A 349 ILE A 351 5 ? 3  
HELX_P HELX_P18 18 ARG A 352 ? HIS A 367 ? ARG A 352 HIS A 367 1 ? 16 
HELX_P HELX_P19 19 LEU B 23  ? ARG B 34  ? LEU B 523 ARG B 534 5 ? 12 
HELX_P HELX_P20 20 THR B 42  ? SER B 61  ? THR B 542 SER B 561 1 ? 20 
HELX_P HELX_P21 21 GLN B 74  ? LEU B 86  ? GLN B 574 LEU B 586 1 ? 13 
HELX_P HELX_P22 22 THR B 90  ? ASP B 97  ? THR B 590 ASP B 597 5 ? 8  
HELX_P HELX_P23 23 SER B 99  ? LEU B 114 ? SER B 599 LEU B 614 1 ? 16 
HELX_P HELX_P24 24 PRO B 119 ? GLN B 134 ? PRO B 619 GLN B 634 1 ? 16 
HELX_P HELX_P25 25 HIS B 149 ? GLY B 164 ? HIS B 649 GLY B 664 1 ? 16 
HELX_P HELX_P26 26 THR B 165 ? ILE B 172 ? THR B 665 ILE B 672 1 ? 8  
HELX_P HELX_P27 27 ASN B 173 ? LYS B 185 ? ASN B 673 LYS B 685 1 ? 13 
HELX_P HELX_P28 28 ASP B 200 ? THR B 214 ? ASP B 700 THR B 714 1 ? 15 
HELX_P HELX_P29 29 GLY B 224 ? GLN B 233 ? GLY B 724 GLN B 733 1 ? 10 
HELX_P HELX_P30 30 HIS B 248 ? LYS B 263 ? HIS B 748 LYS B 763 1 ? 16 
HELX_P HELX_P31 31 ARG B 264 ? LEU B 268 ? ARG B 764 LEU B 768 5 ? 5  
HELX_P HELX_P32 32 ASN B 269 ? ARG B 280 ? ASN B 769 ARG B 780 1 ? 12 
HELX_P HELX_P33 33 CYS B 299 ? GLN B 304 ? CYS B 799 GLN B 804 1 ? 6  
HELX_P HELX_P34 34 GLY B 306 ? GLN B 318 ? GLY B 806 GLN B 818 1 ? 13 
HELX_P HELX_P35 35 HIS B 331 ? CYS B 343 ? HIS B 831 CYS B 843 1 ? 13 
HELX_P HELX_P36 36 ASP B 359 ? GLN B 374 ? ASP B 859 GLN B 874 1 ? 16 
HELX_P HELX_P37 37 VAL B 389 ? ALA B 393 ? VAL B 889 ALA B 893 5 ? 5  
HELX_P HELX_P38 38 GLY B 404 ? GLN B 417 ? GLY B 904 GLN B 917 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? C GLC .   C1  ? ? ? 1_555 C FRU . O2  ? ? C GLC 1    C FRU 2    1_555 ? ? ? ? ? ? ? 1.471 sing ? 
metalc1 metalc ?    ? B ASP 297 OD1 ? ? ? 1_555 F ZN  . ZN  ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.534 ?    ? 
metalc2 metalc ?    ? B ASP 297 OD2 ? ? ? 1_555 F ZN  . ZN  ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.026 ?    ? 
metalc3 metalc ?    ? B CYS 299 SG  ? ? ? 1_555 F ZN  . ZN  ? ? B CYS 799  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.381 ?    ? 
metalc4 metalc ?    ? B HIS 362 NE2 ? ? ? 1_555 F ZN  . ZN  ? ? B HIS 862  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.080 ?    ? 
metalc5 metalc ?    ? F ZN  .   ZN  ? ? ? 1_555 H U49 . N33 ? ? B ZN  1001 B U49 1003 1_555 ? ? ? ? ? ? ? 1.966 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 89  ? ILE A 90  ? GLN A 89  ILE A 90  
A 2 GLN B 88  ? LEU B 89  ? GLN B 588 LEU B 589 
B 1 HIS B 375 ? SER B 378 ? HIS B 875 SER B 878 
B 2 MET B 381 ? ASP B 384 ? MET B 881 ASP B 884 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 89  ? N GLN A 89  O LEU B 89  ? O LEU B 589 
B 1 2 N SER B 378 ? N SER B 878 O MET B 381 ? O MET B 881 
# 
_database_PDB_matrix.entry_id          1LD8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1LD8 
_atom_sites.fract_transf_matrix[1][1]   .005614 
_atom_sites.fract_transf_matrix[1][2]   .003241 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .006482 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .015513 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 55  ? 27.678  159.057 -17.281 1.00 48.24 ? 55   PHE A N   1 
ATOM   2    C  CA  . PHE A 1 55  ? 27.463  160.532 -17.188 1.00 48.02 ? 55   PHE A CA  1 
ATOM   3    C  C   . PHE A 1 55  ? 27.214  160.989 -15.755 1.00 47.12 ? 55   PHE A C   1 
ATOM   4    O  O   . PHE A 1 55  ? 28.080  161.608 -15.132 1.00 47.43 ? 55   PHE A O   1 
ATOM   5    C  CB  . PHE A 1 55  ? 26.281  160.955 -18.069 1.00 49.15 ? 55   PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 55  ? 26.663  161.291 -19.487 1.00 50.14 ? 55   PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 55  ? 25.706  161.761 -20.381 1.00 50.81 ? 55   PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 55  ? 27.980  161.162 -19.923 1.00 50.92 ? 55   PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 55  ? 26.054  162.103 -21.692 1.00 51.46 ? 55   PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 55  ? 28.340  161.501 -21.230 1.00 51.50 ? 55   PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 55  ? 27.374  161.973 -22.117 1.00 51.57 ? 55   PHE A CZ  1 
ATOM   12   N  N   . VAL A 1 56  ? 26.027  160.684 -15.238 1.00 45.39 ? 56   VAL A N   1 
ATOM   13   C  CA  . VAL A 1 56  ? 25.666  161.067 -13.880 1.00 43.41 ? 56   VAL A CA  1 
ATOM   14   C  C   . VAL A 1 56  ? 24.994  159.909 -13.146 1.00 41.99 ? 56   VAL A C   1 
ATOM   15   O  O   . VAL A 1 56  ? 24.064  159.288 -13.661 1.00 41.42 ? 56   VAL A O   1 
ATOM   16   C  CB  . VAL A 1 56  ? 24.715  162.282 -13.885 1.00 43.46 ? 56   VAL A CB  1 
ATOM   17   C  CG1 . VAL A 1 56  ? 24.413  162.719 -12.461 1.00 43.37 ? 56   VAL A CG1 1 
ATOM   18   C  CG2 . VAL A 1 56  ? 25.344  163.419 -14.663 1.00 43.85 ? 56   VAL A CG2 1 
ATOM   19   N  N   . SER A 1 57  ? 25.475  159.636 -11.937 1.00 40.44 ? 57   SER A N   1 
ATOM   20   C  CA  . SER A 1 57  ? 24.955  158.558 -11.102 1.00 39.12 ? 57   SER A CA  1 
ATOM   21   C  C   . SER A 1 57  ? 23.700  158.959 -10.325 1.00 37.75 ? 57   SER A C   1 
ATOM   22   O  O   . SER A 1 57  ? 23.419  160.144 -10.147 1.00 37.44 ? 57   SER A O   1 
ATOM   23   C  CB  . SER A 1 57  ? 26.039  158.105 -10.123 1.00 39.41 ? 57   SER A CB  1 
ATOM   24   O  OG  . SER A 1 57  ? 25.526  157.179 -9.184  1.00 40.87 ? 57   SER A OG  1 
ATOM   25   N  N   . LEU A 1 58  ? 22.960  157.957 -9.857  1.00 36.19 ? 58   LEU A N   1 
ATOM   26   C  CA  . LEU A 1 58  ? 21.730  158.170 -9.099  1.00 34.98 ? 58   LEU A CA  1 
ATOM   27   C  C   . LEU A 1 58  ? 21.929  158.954 -7.809  1.00 34.04 ? 58   LEU A C   1 
ATOM   28   O  O   . LEU A 1 58  ? 20.999  159.590 -7.321  1.00 33.35 ? 58   LEU A O   1 
ATOM   29   C  CB  . LEU A 1 58  ? 21.079  156.825 -8.764  1.00 35.18 ? 58   LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 58  ? 20.097  156.242 -9.781  1.00 35.40 ? 58   LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 58  ? 19.987  154.741 -9.585  1.00 36.20 ? 58   LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 58  ? 18.742  156.912 -9.619  1.00 35.39 ? 58   LEU A CD2 1 
ATOM   33   N  N   . ASP A 1 59  ? 23.134  158.898 -7.252  1.00 33.27 ? 59   ASP A N   1 
ATOM   34   C  CA  . ASP A 1 59  ? 23.420  159.610 -6.015  1.00 32.74 ? 59   ASP A CA  1 
ATOM   35   C  C   . ASP A 1 59  ? 24.207  160.898 -6.233  1.00 31.31 ? 59   ASP A C   1 
ATOM   36   O  O   . ASP A 1 59  ? 24.514  161.607 -5.278  1.00 31.32 ? 59   ASP A O   1 
ATOM   37   C  CB  . ASP A 1 59  ? 24.192  158.709 -5.052  1.00 34.75 ? 59   ASP A CB  1 
ATOM   38   C  CG  . ASP A 1 59  ? 23.529  157.361 -4.862  1.00 36.90 ? 59   ASP A CG  1 
ATOM   39   O  OD1 . ASP A 1 59  ? 23.623  156.519 -5.783  1.00 38.58 ? 59   ASP A OD1 1 
ATOM   40   O  OD2 . ASP A 1 59  ? 22.908  157.146 -3.797  1.00 37.88 ? 59   ASP A OD2 1 
ATOM   41   N  N   . SER A 1 60  ? 24.535  161.199 -7.485  1.00 29.53 ? 60   SER A N   1 
ATOM   42   C  CA  . SER A 1 60  ? 25.290  162.410 -7.799  1.00 28.23 ? 60   SER A CA  1 
ATOM   43   C  C   . SER A 1 60  ? 24.483  163.670 -7.488  1.00 26.59 ? 60   SER A C   1 
ATOM   44   O  O   . SER A 1 60  ? 23.272  163.708 -7.693  1.00 26.00 ? 60   SER A O   1 
ATOM   45   C  CB  . SER A 1 60  ? 25.690  162.411 -9.274  1.00 28.70 ? 60   SER A CB  1 
ATOM   46   O  OG  . SER A 1 60  ? 26.514  161.298 -9.571  1.00 31.01 ? 60   SER A OG  1 
ATOM   47   N  N   . PRO A 1 61  ? 25.150  164.725 -6.995  1.00 25.57 ? 61   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 61  ? 24.434  165.964 -6.675  1.00 24.76 ? 61   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 61  ? 23.719  166.595 -7.872  1.00 23.83 ? 61   PRO A C   1 
ATOM   50   O  O   . PRO A 1 61  ? 22.697  167.256 -7.707  1.00 23.52 ? 61   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 61  ? 25.532  166.861 -6.095  1.00 25.13 ? 61   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 61  ? 26.765  166.381 -6.789  1.00 25.40 ? 61   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 61  ? 26.594  164.875 -6.742  1.00 25.24 ? 61   PRO A CD  1 
ATOM   54   N  N   . SER A 1 62  ? 24.238  166.375 -9.077  1.00 23.06 ? 62   SER A N   1 
ATOM   55   C  CA  . SER A 1 62  ? 23.619  166.950 -10.267 1.00 22.61 ? 62   SER A CA  1 
ATOM   56   C  C   . SER A 1 62  ? 22.666  166.005 -10.997 1.00 22.27 ? 62   SER A C   1 
ATOM   57   O  O   . SER A 1 62  ? 22.242  166.292 -12.118 1.00 21.90 ? 62   SER A O   1 
ATOM   58   C  CB  . SER A 1 62  ? 24.692  167.442 -11.243 1.00 22.46 ? 62   SER A CB  1 
ATOM   59   O  OG  . SER A 1 62  ? 25.359  166.363 -11.873 1.00 23.15 ? 62   SER A OG  1 
ATOM   60   N  N   . TYR A 1 63  ? 22.323  164.884 -10.369 1.00 22.23 ? 63   TYR A N   1 
ATOM   61   C  CA  . TYR A 1 63  ? 21.404  163.929 -10.989 1.00 21.84 ? 63   TYR A CA  1 
ATOM   62   C  C   . TYR A 1 63  ? 20.045  164.582 -11.234 1.00 21.87 ? 63   TYR A C   1 
ATOM   63   O  O   . TYR A 1 63  ? 19.518  165.277 -10.368 1.00 22.37 ? 63   TYR A O   1 
ATOM   64   C  CB  . TYR A 1 63  ? 21.211  162.705 -10.092 1.00 21.90 ? 63   TYR A CB  1 
ATOM   65   C  CG  . TYR A 1 63  ? 20.259  161.672 -10.667 1.00 21.59 ? 63   TYR A CG  1 
ATOM   66   C  CD1 . TYR A 1 63  ? 20.680  160.765 -11.642 1.00 21.40 ? 63   TYR A CD1 1 
ATOM   67   C  CD2 . TYR A 1 63  ? 18.933  161.603 -10.235 1.00 21.39 ? 63   TYR A CD2 1 
ATOM   68   C  CE1 . TYR A 1 63  ? 19.805  159.811 -12.170 1.00 21.32 ? 63   TYR A CE1 1 
ATOM   69   C  CE2 . TYR A 1 63  ? 18.048  160.654 -10.758 1.00 21.44 ? 63   TYR A CE2 1 
ATOM   70   C  CZ  . TYR A 1 63  ? 18.492  159.762 -11.722 1.00 21.76 ? 63   TYR A CZ  1 
ATOM   71   O  OH  . TYR A 1 63  ? 17.627  158.815 -12.226 1.00 21.32 ? 63   TYR A OH  1 
ATOM   72   N  N   . VAL A 1 64  ? 19.484  164.351 -12.414 1.00 21.61 ? 64   VAL A N   1 
ATOM   73   C  CA  . VAL A 1 64  ? 18.183  164.901 -12.775 1.00 21.64 ? 64   VAL A CA  1 
ATOM   74   C  C   . VAL A 1 64  ? 17.232  163.761 -13.131 1.00 22.08 ? 64   VAL A C   1 
ATOM   75   O  O   . VAL A 1 64  ? 17.619  162.831 -13.840 1.00 21.74 ? 64   VAL A O   1 
ATOM   76   C  CB  . VAL A 1 64  ? 18.295  165.839 -14.001 1.00 21.46 ? 64   VAL A CB  1 
ATOM   77   C  CG1 . VAL A 1 64  ? 16.903  166.276 -14.458 1.00 21.30 ? 64   VAL A CG1 1 
ATOM   78   C  CG2 . VAL A 1 64  ? 19.145  167.057 -13.656 1.00 21.32 ? 64   VAL A CG2 1 
ATOM   79   N  N   . LEU A 1 65  ? 15.994  163.833 -12.644 1.00 22.62 ? 65   LEU A N   1 
ATOM   80   C  CA  . LEU A 1 65  ? 15.002  162.803 -12.950 1.00 22.89 ? 65   LEU A CA  1 
ATOM   81   C  C   . LEU A 1 65  ? 14.790  162.782 -14.458 1.00 22.94 ? 65   LEU A C   1 
ATOM   82   O  O   . LEU A 1 65  ? 14.837  163.823 -15.109 1.00 22.96 ? 65   LEU A O   1 
ATOM   83   C  CB  . LEU A 1 65  ? 13.667  163.110 -12.267 1.00 23.44 ? 65   LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 65  ? 13.640  163.200 -10.742 1.00 24.85 ? 65   LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 65  ? 12.218  163.511 -10.284 1.00 25.25 ? 65   LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 65  ? 14.122  161.897 -10.137 1.00 24.38 ? 65   LEU A CD2 1 
ATOM   87   N  N   . TYR A 1 66  ? 14.549  161.600 -15.014 1.00 22.88 ? 66   TYR A N   1 
ATOM   88   C  CA  . TYR A 1 66  ? 14.343  161.482 -16.449 1.00 22.50 ? 66   TYR A CA  1 
ATOM   89   C  C   . TYR A 1 66  ? 13.162  162.304 -16.953 1.00 22.97 ? 66   TYR A C   1 
ATOM   90   O  O   . TYR A 1 66  ? 13.186  162.798 -18.082 1.00 22.66 ? 66   TYR A O   1 
ATOM   91   C  CB  . TYR A 1 66  ? 14.176  160.009 -16.842 1.00 21.31 ? 66   TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 66  ? 15.493  159.268 -16.865 1.00 20.74 ? 66   TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 66  ? 16.096  158.842 -15.683 1.00 20.07 ? 66   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 66  ? 16.170  159.047 -18.068 1.00 20.30 ? 66   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 66  ? 17.341  158.217 -15.693 1.00 19.93 ? 66   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 66  ? 17.418  158.423 -18.089 1.00 20.52 ? 66   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 66  ? 17.996  158.012 -16.896 1.00 20.28 ? 66   TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 66  ? 19.228  157.398 -16.904 1.00 20.81 ? 66   TYR A OH  1 
ATOM   99   N  N   . ARG A 1 67  ? 12.134  162.456 -16.124 1.00 23.09 ? 67   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 67  ? 10.972  163.232 -16.531 1.00 24.44 ? 67   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 67  ? 11.315  164.716 -16.690 1.00 25.03 ? 67   ARG A C   1 
ATOM   102  O  O   . ARG A 1 67  ? 10.522  165.480 -17.240 1.00 25.51 ? 67   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 67  ? 9.822   163.069 -15.528 1.00 24.37 ? 67   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 67  ? 10.075  163.617 -14.126 1.00 25.02 ? 67   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 67  ? 8.739   163.809 -13.398 1.00 25.84 ? 67   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 67  ? 8.882   164.304 -12.029 1.00 26.23 ? 67   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 67  ? 9.037   163.531 -10.959 1.00 26.83 ? 67   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 67  ? 9.070   162.209 -11.088 1.00 27.37 ? 67   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 67  ? 9.157   164.079 -9.757  1.00 26.56 ? 67   ARG A NH2 1 
ATOM   110  N  N   . ASP A 1 68  ? 12.499  165.112 -16.222 1.00 25.30 ? 68   ASP A N   1 
ATOM   111  C  CA  . ASP A 1 68  ? 12.943  166.504 -16.319 1.00 25.70 ? 68   ASP A CA  1 
ATOM   112  C  C   . ASP A 1 68  ? 14.050  166.705 -17.347 1.00 25.97 ? 68   ASP A C   1 
ATOM   113  O  O   . ASP A 1 68  ? 14.508  167.827 -17.552 1.00 26.69 ? 68   ASP A O   1 
ATOM   114  C  CB  . ASP A 1 68  ? 13.447  167.019 -14.965 1.00 24.70 ? 68   ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 68  ? 12.350  167.112 -13.925 1.00 24.48 ? 68   ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 68  ? 11.217  167.480 -14.292 1.00 24.12 ? 68   ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 68  ? 12.624  166.835 -12.737 1.00 24.75 ? 68   ASP A OD2 1 
ATOM   118  N  N   . ARG A 1 69  ? 14.478  165.626 -17.992 1.00 25.90 ? 69   ARG A N   1 
ATOM   119  C  CA  . ARG A 1 69  ? 15.545  165.711 -18.983 1.00 25.95 ? 69   ARG A CA  1 
ATOM   120  C  C   . ARG A 1 69  ? 15.019  166.056 -20.371 1.00 26.17 ? 69   ARG A C   1 
ATOM   121  O  O   . ARG A 1 69  ? 14.151  165.371 -20.909 1.00 25.88 ? 69   ARG A O   1 
ATOM   122  C  CB  . ARG A 1 69  ? 16.323  164.392 -19.025 1.00 25.14 ? 69   ARG A CB  1 
ATOM   123  C  CG  . ARG A 1 69  ? 16.918  164.005 -17.679 1.00 24.87 ? 69   ARG A CG  1 
ATOM   124  C  CD  . ARG A 1 69  ? 17.872  162.825 -17.793 1.00 23.89 ? 69   ARG A CD  1 
ATOM   125  N  NE  . ARG A 1 69  ? 18.329  162.382 -16.478 1.00 24.05 ? 69   ARG A NE  1 
ATOM   126  C  CZ  . ARG A 1 69  ? 19.327  161.527 -16.278 1.00 23.72 ? 69   ARG A CZ  1 
ATOM   127  N  NH1 . ARG A 1 69  ? 19.984  161.019 -17.310 1.00 23.72 ? 69   ARG A NH1 1 
ATOM   128  N  NH2 . ARG A 1 69  ? 19.666  161.180 -15.044 1.00 23.84 ? 69   ARG A NH2 1 
ATOM   129  N  N   . ALA A 1 70  ? 15.563  167.119 -20.953 1.00 26.55 ? 70   ALA A N   1 
ATOM   130  C  CA  . ALA A 1 70  ? 15.137  167.571 -22.272 1.00 26.86 ? 70   ALA A CA  1 
ATOM   131  C  C   . ALA A 1 70  ? 15.376  166.524 -23.355 1.00 26.93 ? 70   ALA A C   1 
ATOM   132  O  O   . ALA A 1 70  ? 14.571  166.383 -24.273 1.00 27.04 ? 70   ALA A O   1 
ATOM   133  C  CB  . ALA A 1 70  ? 15.853  168.872 -22.635 1.00 26.92 ? 70   ALA A CB  1 
ATOM   134  N  N   . GLU A 1 71  ? 16.478  165.787 -23.248 1.00 27.33 ? 71   GLU A N   1 
ATOM   135  C  CA  . GLU A 1 71  ? 16.794  164.765 -24.243 1.00 27.40 ? 71   GLU A CA  1 
ATOM   136  C  C   . GLU A 1 71  ? 15.854  163.562 -24.153 1.00 27.28 ? 71   GLU A C   1 
ATOM   137  O  O   . GLU A 1 71  ? 15.953  162.631 -24.953 1.00 27.44 ? 71   GLU A O   1 
ATOM   138  C  CB  . GLU A 1 71  ? 18.246  164.291 -24.091 1.00 28.36 ? 71   GLU A CB  1 
ATOM   139  C  CG  . GLU A 1 71  ? 18.532  163.539 -22.796 1.00 29.11 ? 71   GLU A CG  1 
ATOM   140  C  CD  . GLU A 1 71  ? 19.024  164.437 -21.679 1.00 29.72 ? 71   GLU A CD  1 
ATOM   141  O  OE1 . GLU A 1 71  ? 18.557  165.592 -21.580 1.00 30.37 ? 71   GLU A OE1 1 
ATOM   142  O  OE2 . GLU A 1 71  ? 19.873  163.979 -20.885 1.00 29.92 ? 71   GLU A OE2 1 
ATOM   143  N  N   . TRP A 1 72  ? 14.946  163.583 -23.180 1.00 26.89 ? 72   TRP A N   1 
ATOM   144  C  CA  . TRP A 1 72  ? 13.985  162.495 -23.003 1.00 26.96 ? 72   TRP A CA  1 
ATOM   145  C  C   . TRP A 1 72  ? 12.540  162.963 -23.141 1.00 27.72 ? 72   TRP A C   1 
ATOM   146  O  O   . TRP A 1 72  ? 11.611  162.172 -22.979 1.00 27.80 ? 72   TRP A O   1 
ATOM   147  C  CB  . TRP A 1 72  ? 14.154  161.843 -21.627 1.00 26.17 ? 72   TRP A CB  1 
ATOM   148  C  CG  . TRP A 1 72  ? 15.298  160.880 -21.538 1.00 25.58 ? 72   TRP A CG  1 
ATOM   149  C  CD1 . TRP A 1 72  ? 16.593  161.162 -21.199 1.00 25.13 ? 72   TRP A CD1 1 
ATOM   150  C  CD2 . TRP A 1 72  ? 15.250  159.476 -21.810 1.00 25.18 ? 72   TRP A CD2 1 
ATOM   151  N  NE1 . TRP A 1 72  ? 17.353  160.017 -21.244 1.00 24.70 ? 72   TRP A NE1 1 
ATOM   152  C  CE2 . TRP A 1 72  ? 16.554  158.967 -21.615 1.00 25.15 ? 72   TRP A CE2 1 
ATOM   153  C  CE3 . TRP A 1 72  ? 14.231  158.596 -22.202 1.00 24.98 ? 72   TRP A CE3 1 
ATOM   154  C  CZ2 . TRP A 1 72  ? 16.867  157.615 -21.798 1.00 25.28 ? 72   TRP A CZ2 1 
ATOM   155  C  CZ3 . TRP A 1 72  ? 14.542  157.250 -22.384 1.00 25.57 ? 72   TRP A CZ3 1 
ATOM   156  C  CH2 . TRP A 1 72  ? 15.851  156.775 -22.181 1.00 25.74 ? 72   TRP A CH2 1 
ATOM   157  N  N   . ALA A 1 73  ? 12.354  164.242 -23.451 1.00 28.24 ? 73   ALA A N   1 
ATOM   158  C  CA  . ALA A 1 73  ? 11.016  164.820 -23.582 1.00 28.81 ? 73   ALA A CA  1 
ATOM   159  C  C   . ALA A 1 73  ? 10.168  164.253 -24.720 1.00 29.10 ? 73   ALA A C   1 
ATOM   160  O  O   . ALA A 1 73  ? 8.939   164.304 -24.666 1.00 29.37 ? 73   ALA A O   1 
ATOM   161  C  CB  . ALA A 1 73  ? 11.127  166.340 -23.729 1.00 28.56 ? 73   ALA A CB  1 
ATOM   162  N  N   . ASP A 1 74  ? 10.818  163.708 -25.742 1.00 29.82 ? 74   ASP A N   1 
ATOM   163  C  CA  . ASP A 1 74  ? 10.114  163.161 -26.899 1.00 30.42 ? 74   ASP A CA  1 
ATOM   164  C  C   . ASP A 1 74  ? 9.424   161.819 -26.658 1.00 31.10 ? 74   ASP A C   1 
ATOM   165  O  O   . ASP A 1 74  ? 8.634   161.371 -27.488 1.00 31.02 ? 74   ASP A O   1 
ATOM   166  C  CB  . ASP A 1 74  ? 11.088  162.998 -28.059 1.00 31.39 ? 74   ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 74  ? 12.165  161.983 -27.758 1.00 31.65 ? 74   ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 74  ? 12.171  160.910 -28.394 1.00 32.79 ? 74   ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 74  ? 12.995  162.256 -26.867 1.00 32.26 ? 74   ASP A OD2 1 
ATOM   170  N  N   . ILE A 1 75  ? 9.726   161.163 -25.544 1.00 30.85 ? 75   ILE A N   1 
ATOM   171  C  CA  . ILE A 1 75  ? 9.097   159.876 -25.268 1.00 30.93 ? 75   ILE A CA  1 
ATOM   172  C  C   . ILE A 1 75  ? 8.300   159.926 -23.970 1.00 30.42 ? 75   ILE A C   1 
ATOM   173  O  O   . ILE A 1 75  ? 8.762   160.470 -22.965 1.00 30.07 ? 75   ILE A O   1 
ATOM   174  C  CB  . ILE A 1 75  ? 10.153  158.742 -25.201 1.00 31.65 ? 75   ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 75  ? 9.454   157.382 -25.109 1.00 32.44 ? 75   ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 75  ? 11.072  158.951 -24.014 1.00 31.41 ? 75   ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 75  ? 10.403  156.196 -25.196 1.00 32.51 ? 75   ILE A CD1 1 
ATOM   178  N  N   . ASP A 1 76  ? 7.091   159.372 -24.006 1.00 29.90 ? 76   ASP A N   1 
ATOM   179  C  CA  . ASP A 1 76  ? 6.227   159.357 -22.834 1.00 29.95 ? 76   ASP A CA  1 
ATOM   180  C  C   . ASP A 1 76  ? 6.549   158.173 -21.937 1.00 29.53 ? 76   ASP A C   1 
ATOM   181  O  O   . ASP A 1 76  ? 6.727   157.053 -22.411 1.00 29.35 ? 76   ASP A O   1 
ATOM   182  C  CB  . ASP A 1 76  ? 4.755   159.284 -23.249 1.00 30.84 ? 76   ASP A CB  1 
ATOM   183  C  CG  . ASP A 1 76  ? 4.321   160.478 -24.074 1.00 32.05 ? 76   ASP A CG  1 
ATOM   184  O  OD1 . ASP A 1 76  ? 4.526   161.622 -23.620 1.00 32.65 ? 76   ASP A OD1 1 
ATOM   185  O  OD2 . ASP A 1 76  ? 3.770   160.271 -25.175 1.00 33.15 ? 76   ASP A OD2 1 
ATOM   186  N  N   . PRO A 1 77  ? 6.627   158.407 -20.621 1.00 29.11 ? 77   PRO A N   1 
ATOM   187  C  CA  . PRO A 1 77  ? 6.929   157.329 -19.679 1.00 28.79 ? 77   PRO A CA  1 
ATOM   188  C  C   . PRO A 1 77  ? 5.757   156.354 -19.600 1.00 28.53 ? 77   PRO A C   1 
ATOM   189  O  O   . PRO A 1 77  ? 4.607   156.748 -19.774 1.00 28.63 ? 77   PRO A O   1 
ATOM   190  C  CB  . PRO A 1 77  ? 7.153   158.076 -18.370 1.00 28.79 ? 77   PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 77  ? 6.181   159.224 -18.485 1.00 29.12 ? 77   PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 77  ? 6.401   159.681 -19.911 1.00 28.88 ? 77   PRO A CD  1 
ATOM   193  N  N   . VAL A 1 78  ? 6.049   155.083 -19.351 1.00 28.22 ? 78   VAL A N   1 
ATOM   194  C  CA  . VAL A 1 78  ? 5.000   154.076 -19.248 1.00 27.62 ? 78   VAL A CA  1 
ATOM   195  C  C   . VAL A 1 78  ? 4.866   153.603 -17.805 1.00 27.42 ? 78   VAL A C   1 
ATOM   196  O  O   . VAL A 1 78  ? 5.715   152.874 -17.295 1.00 26.92 ? 78   VAL A O   1 
ATOM   197  C  CB  . VAL A 1 78  ? 5.296   152.865 -20.149 1.00 27.78 ? 78   VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 78  ? 4.276   151.756 -19.888 1.00 27.71 ? 78   VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 78  ? 5.247   153.291 -21.609 1.00 27.70 ? 78   VAL A CG2 1 
ATOM   200  N  N   . PRO A 1 79  ? 3.792   154.030 -17.124 1.00 27.13 ? 79   PRO A N   1 
ATOM   201  C  CA  . PRO A 1 79  ? 3.553   153.643 -15.731 1.00 27.33 ? 79   PRO A CA  1 
ATOM   202  C  C   . PRO A 1 79  ? 3.370   152.134 -15.598 1.00 27.25 ? 79   PRO A C   1 
ATOM   203  O  O   . PRO A 1 79  ? 2.963   151.463 -16.545 1.00 26.59 ? 79   PRO A O   1 
ATOM   204  C  CB  . PRO A 1 79  ? 2.269   154.396 -15.376 1.00 27.27 ? 79   PRO A CB  1 
ATOM   205  C  CG  . PRO A 1 79  ? 2.298   155.588 -16.293 1.00 27.86 ? 79   PRO A CG  1 
ATOM   206  C  CD  . PRO A 1 79  ? 2.763   154.974 -17.591 1.00 27.43 ? 79   PRO A CD  1 
ATOM   207  N  N   . GLN A 1 80  ? 3.681   151.604 -14.422 1.00 27.31 ? 80   GLN A N   1 
ATOM   208  C  CA  . GLN A 1 80  ? 3.508   150.183 -14.171 1.00 27.90 ? 80   GLN A CA  1 
ATOM   209  C  C   . GLN A 1 80  ? 2.048   149.966 -13.777 1.00 28.75 ? 80   GLN A C   1 
ATOM   210  O  O   . GLN A 1 80  ? 1.537   150.641 -12.887 1.00 28.85 ? 80   GLN A O   1 
ATOM   211  C  CB  . GLN A 1 80  ? 4.431   149.730 -13.037 1.00 27.53 ? 80   GLN A CB  1 
ATOM   212  C  CG  . GLN A 1 80  ? 4.110   148.350 -12.472 1.00 26.20 ? 80   GLN A CG  1 
ATOM   213  C  CD  . GLN A 1 80  ? 5.136   147.895 -11.458 1.00 25.45 ? 80   GLN A CD  1 
ATOM   214  O  OE1 . GLN A 1 80  ? 6.215   147.421 -11.819 1.00 25.09 ? 80   GLN A OE1 1 
ATOM   215  N  NE2 . GLN A 1 80  ? 4.814   148.053 -10.178 1.00 24.98 ? 80   GLN A NE2 1 
ATOM   216  N  N   . ASN A 1 81  ? 1.371   149.041 -14.445 1.00 29.82 ? 81   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 81  ? -0.023  148.775 -14.114 1.00 30.86 ? 81   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 81  ? -0.149  147.606 -13.146 1.00 30.46 ? 81   ASN A C   1 
ATOM   219  O  O   . ASN A 1 81  ? -0.021  146.449 -13.541 1.00 30.10 ? 81   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 81  ? -0.834  148.488 -15.379 1.00 32.20 ? 81   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 81  ? -2.283  148.149 -15.075 1.00 33.58 ? 81   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 81  ? -2.920  148.785 -14.228 1.00 34.35 ? 81   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 81  ? -2.816  147.150 -15.771 1.00 34.22 ? 81   ASN A ND2 1 
ATOM   224  N  N   . ASP A 1 82  ? -0.397  147.923 -11.877 1.00 30.55 ? 82   ASP A N   1 
ATOM   225  C  CA  . ASP A 1 82  ? -0.552  146.910 -10.841 1.00 30.85 ? 82   ASP A CA  1 
ATOM   226  C  C   . ASP A 1 82  ? -2.010  146.527 -10.635 1.00 30.98 ? 82   ASP A C   1 
ATOM   227  O  O   . ASP A 1 82  ? -2.329  145.727 -9.756  1.00 31.33 ? 82   ASP A O   1 
ATOM   228  C  CB  . ASP A 1 82  ? 0.020   147.399 -9.508  1.00 30.67 ? 82   ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 82  ? 1.526   147.279 -9.440  1.00 30.71 ? 82   ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 82  ? 2.075   146.321 -10.018 1.00 29.40 ? 82   ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 82  ? 2.161   148.132 -8.789  1.00 32.61 ? 82   ASP A OD2 1 
ATOM   232  N  N   . GLY A 1 83  ? -2.894  147.098 -11.444 1.00 31.16 ? 83   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 83  ? -4.307  146.794 -11.310 1.00 31.38 ? 83   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 83  ? -5.006  147.761 -10.371 1.00 31.62 ? 83   GLY A C   1 
ATOM   235  O  O   . GLY A 1 83  ? -4.347  148.531 -9.671  1.00 31.21 ? 83   GLY A O   1 
ATOM   236  N  N   . PRO A 1 84  ? -6.348  147.736 -10.323 1.00 31.97 ? 84   PRO A N   1 
ATOM   237  C  CA  . PRO A 1 84  ? -7.139  148.622 -9.462  1.00 32.30 ? 84   PRO A CA  1 
ATOM   238  C  C   . PRO A 1 84  ? -6.977  148.383 -7.961  1.00 32.65 ? 84   PRO A C   1 
ATOM   239  O  O   . PRO A 1 84  ? -7.020  149.327 -7.171  1.00 32.77 ? 84   PRO A O   1 
ATOM   240  C  CB  . PRO A 1 84  ? -8.567  148.375 -9.943  1.00 32.29 ? 84   PRO A CB  1 
ATOM   241  C  CG  . PRO A 1 84  ? -8.531  146.931 -10.339 1.00 32.31 ? 84   PRO A CG  1 
ATOM   242  C  CD  . PRO A 1 84  ? -7.225  146.840 -11.098 1.00 32.21 ? 84   PRO A CD  1 
ATOM   243  N  N   . ASN A 1 85  ? -6.789  147.127 -7.571  1.00 32.65 ? 85   ASN A N   1 
ATOM   244  C  CA  . ASN A 1 85  ? -6.627  146.778 -6.161  1.00 32.65 ? 85   ASN A CA  1 
ATOM   245  C  C   . ASN A 1 85  ? -5.330  145.993 -6.009  1.00 32.09 ? 85   ASN A C   1 
ATOM   246  O  O   . ASN A 1 85  ? -5.343  144.774 -5.852  1.00 32.27 ? 85   ASN A O   1 
ATOM   247  C  CB  . ASN A 1 85  ? -7.807  145.924 -5.697  1.00 33.54 ? 85   ASN A CB  1 
ATOM   248  C  CG  . ASN A 1 85  ? -9.140  146.471 -6.169  1.00 34.71 ? 85   ASN A CG  1 
ATOM   249  O  OD1 . ASN A 1 85  ? -9.530  147.582 -5.810  1.00 35.67 ? 85   ASN A OD1 1 
ATOM   250  N  ND2 . ASN A 1 85  ? -9.844  145.694 -6.986  1.00 35.22 ? 85   ASN A ND2 1 
ATOM   251  N  N   . PRO A 1 86  ? -4.190  146.694 -6.044  1.00 31.54 ? 86   PRO A N   1 
ATOM   252  C  CA  . PRO A 1 86  ? -2.865  146.079 -5.922  1.00 30.51 ? 86   PRO A CA  1 
ATOM   253  C  C   . PRO A 1 86  ? -2.571  145.272 -4.660  1.00 29.19 ? 86   PRO A C   1 
ATOM   254  O  O   . PRO A 1 86  ? -3.159  145.488 -3.597  1.00 29.15 ? 86   PRO A O   1 
ATOM   255  C  CB  . PRO A 1 86  ? -1.917  147.271 -6.086  1.00 31.10 ? 86   PRO A CB  1 
ATOM   256  C  CG  . PRO A 1 86  ? -2.714  148.412 -5.536  1.00 32.10 ? 86   PRO A CG  1 
ATOM   257  C  CD  . PRO A 1 86  ? -4.081  148.162 -6.124  1.00 31.61 ? 86   PRO A CD  1 
ATOM   258  N  N   . VAL A 1 87  ? -1.654  144.322 -4.811  1.00 27.08 ? 87   VAL A N   1 
ATOM   259  C  CA  . VAL A 1 87  ? -1.208  143.464 -3.725  1.00 25.20 ? 87   VAL A CA  1 
ATOM   260  C  C   . VAL A 1 87  ? 0.315   143.532 -3.761  1.00 24.16 ? 87   VAL A C   1 
ATOM   261  O  O   . VAL A 1 87  ? 0.892   143.862 -4.802  1.00 23.13 ? 87   VAL A O   1 
ATOM   262  C  CB  . VAL A 1 87  ? -1.690  142.010 -3.917  1.00 25.57 ? 87   VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 87  ? -3.201  141.936 -3.689  1.00 25.59 ? 87   VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 87  ? -1.345  141.523 -5.319  1.00 24.76 ? 87   VAL A CG2 1 
ATOM   265  N  N   . VAL A 1 88  ? 0.955   143.234 -2.631  1.00 23.02 ? 88   VAL A N   1 
ATOM   266  C  CA  . VAL A 1 88  ? 2.412   143.306 -2.509  1.00 22.58 ? 88   VAL A CA  1 
ATOM   267  C  C   . VAL A 1 88  ? 2.921   144.529 -3.270  1.00 22.94 ? 88   VAL A C   1 
ATOM   268  O  O   . VAL A 1 88  ? 3.926   144.478 -3.981  1.00 21.53 ? 88   VAL A O   1 
ATOM   269  C  CB  . VAL A 1 88  ? 3.113   142.011 -3.024  1.00 22.18 ? 88   VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 88  ? 2.742   140.845 -2.127  1.00 21.59 ? 88   VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 88  ? 2.729   141.715 -4.471  1.00 21.29 ? 88   VAL A CG2 1 
ATOM   272  N  N   . GLN A 1 89  ? 2.203   145.635 -3.099  1.00 23.82 ? 89   GLN A N   1 
ATOM   273  C  CA  . GLN A 1 89  ? 2.531   146.890 -3.760  1.00 25.06 ? 89   GLN A CA  1 
ATOM   274  C  C   . GLN A 1 89  ? 3.669   147.616 -3.061  1.00 25.40 ? 89   GLN A C   1 
ATOM   275  O  O   . GLN A 1 89  ? 3.564   147.992 -1.888  1.00 24.80 ? 89   GLN A O   1 
ATOM   276  C  CB  . GLN A 1 89  ? 1.295   147.791 -3.809  1.00 26.77 ? 89   GLN A CB  1 
ATOM   277  C  CG  . GLN A 1 89  ? 1.524   149.124 -4.498  1.00 28.70 ? 89   GLN A CG  1 
ATOM   278  C  CD  . GLN A 1 89  ? 0.270   149.977 -4.527  1.00 30.68 ? 89   GLN A CD  1 
ATOM   279  O  OE1 . GLN A 1 89  ? -0.346  150.229 -3.491  1.00 31.67 ? 89   GLN A OE1 1 
ATOM   280  N  NE2 . GLN A 1 89  ? -0.116  150.427 -5.717  1.00 31.66 ? 89   GLN A NE2 1 
ATOM   281  N  N   . ILE A 1 90  ? 4.759   147.811 -3.795  1.00 25.23 ? 90   ILE A N   1 
ATOM   282  C  CA  . ILE A 1 90  ? 5.933   148.487 -3.263  1.00 25.36 ? 90   ILE A CA  1 
ATOM   283  C  C   . ILE A 1 90  ? 5.800   149.995 -3.453  1.00 25.73 ? 90   ILE A C   1 
ATOM   284  O  O   . ILE A 1 90  ? 5.600   150.472 -4.568  1.00 25.35 ? 90   ILE A O   1 
ATOM   285  C  CB  . ILE A 1 90  ? 7.216   148.003 -3.978  1.00 24.94 ? 90   ILE A CB  1 
ATOM   286  C  CG1 . ILE A 1 90  ? 7.292   146.471 -3.928  1.00 24.38 ? 90   ILE A CG1 1 
ATOM   287  C  CG2 . ILE A 1 90  ? 8.448   148.621 -3.319  1.00 24.80 ? 90   ILE A CG2 1 
ATOM   288  C  CD1 . ILE A 1 90  ? 8.444   145.884 -4.713  1.00 23.33 ? 90   ILE A CD1 1 
ATOM   289  N  N   . ILE A 1 91  ? 5.902   150.742 -2.359  1.00 26.38 ? 91   ILE A N   1 
ATOM   290  C  CA  . ILE A 1 91  ? 5.807   152.196 -2.430  1.00 27.37 ? 91   ILE A CA  1 
ATOM   291  C  C   . ILE A 1 91  ? 7.175   152.716 -2.853  1.00 26.90 ? 91   ILE A C   1 
ATOM   292  O  O   . ILE A 1 91  ? 7.982   153.115 -2.019  1.00 27.01 ? 91   ILE A O   1 
ATOM   293  C  CB  . ILE A 1 91  ? 5.431   152.797 -1.061  1.00 28.53 ? 91   ILE A CB  1 
ATOM   294  C  CG1 . ILE A 1 91  ? 4.163   152.121 -0.531  1.00 29.23 ? 91   ILE A CG1 1 
ATOM   295  C  CG2 . ILE A 1 91  ? 5.203   154.300 -1.196  1.00 29.14 ? 91   ILE A CG2 1 
ATOM   296  C  CD1 . ILE A 1 91  ? 2.967   152.239 -1.462  1.00 29.93 ? 91   ILE A CD1 1 
ATOM   297  N  N   . TYR A 1 92  ? 7.424   152.701 -4.159  1.00 26.25 ? 92   TYR A N   1 
ATOM   298  C  CA  . TYR A 1 92  ? 8.702   153.136 -4.717  1.00 25.98 ? 92   TYR A CA  1 
ATOM   299  C  C   . TYR A 1 92  ? 9.057   154.586 -4.420  1.00 25.81 ? 92   TYR A C   1 
ATOM   300  O  O   . TYR A 1 92  ? 8.182   155.434 -4.269  1.00 25.38 ? 92   TYR A O   1 
ATOM   301  C  CB  . TYR A 1 92  ? 8.704   152.965 -6.240  1.00 25.80 ? 92   TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 92  ? 8.205   151.630 -6.739  1.00 25.56 ? 92   TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 92  ? 6.921   151.495 -7.267  1.00 25.70 ? 92   TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 92  ? 9.024   150.502 -6.702  1.00 25.46 ? 92   TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 92  ? 6.466   150.265 -7.754  1.00 25.56 ? 92   TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 92  ? 8.581   149.272 -7.183  1.00 25.08 ? 92   TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 92  ? 7.305   149.160 -7.707  1.00 24.88 ? 92   TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 92  ? 6.877   147.947 -8.200  1.00 24.14 ? 92   TYR A OH  1 
ATOM   309  N  N   . SER A 1 93  ? 10.354  154.867 -4.356  1.00 25.81 ? 93   SER A N   1 
ATOM   310  C  CA  . SER A 1 93  ? 10.813  156.231 -4.142  1.00 25.74 ? 93   SER A CA  1 
ATOM   311  C  C   . SER A 1 93  ? 10.540  156.925 -5.474  1.00 25.72 ? 93   SER A C   1 
ATOM   312  O  O   . SER A 1 93  ? 10.319  156.257 -6.488  1.00 25.13 ? 93   SER A O   1 
ATOM   313  C  CB  . SER A 1 93  ? 12.312  156.253 -3.843  1.00 25.68 ? 93   SER A CB  1 
ATOM   314  O  OG  . SER A 1 93  ? 13.059  155.827 -4.971  1.00 25.93 ? 93   SER A OG  1 
ATOM   315  N  N   . ASP A 1 94  ? 10.548  158.254 -5.479  1.00 25.83 ? 94   ASP A N   1 
ATOM   316  C  CA  . ASP A 1 94  ? 10.294  159.003 -6.705  1.00 26.09 ? 94   ASP A CA  1 
ATOM   317  C  C   . ASP A 1 94  ? 11.349  158.669 -7.764  1.00 25.38 ? 94   ASP A C   1 
ATOM   318  O  O   . ASP A 1 94  ? 11.022  158.470 -8.932  1.00 25.47 ? 94   ASP A O   1 
ATOM   319  C  CB  . ASP A 1 94  ? 10.285  160.510 -6.401  1.00 27.55 ? 94   ASP A CB  1 
ATOM   320  C  CG  . ASP A 1 94  ? 9.780   161.346 -7.568  1.00 29.50 ? 94   ASP A CG  1 
ATOM   321  O  OD1 . ASP A 1 94  ? 8.891   160.873 -8.309  1.00 30.44 ? 94   ASP A OD1 1 
ATOM   322  O  OD2 . ASP A 1 94  ? 10.257  162.492 -7.734  1.00 30.93 ? 94   ASP A OD2 1 
ATOM   323  N  N   . LYS A 1 95  ? 12.612  158.591 -7.354  1.00 24.60 ? 95   LYS A N   1 
ATOM   324  C  CA  . LYS A 1 95  ? 13.681  158.282 -8.295  1.00 24.51 ? 95   LYS A CA  1 
ATOM   325  C  C   . LYS A 1 95  ? 13.568  156.878 -8.889  1.00 23.54 ? 95   LYS A C   1 
ATOM   326  O  O   . LYS A 1 95  ? 13.847  156.676 -10.070 1.00 22.81 ? 95   LYS A O   1 
ATOM   327  C  CB  . LYS A 1 95  ? 15.054  158.456 -7.634  1.00 25.55 ? 95   LYS A CB  1 
ATOM   328  C  CG  . LYS A 1 95  ? 15.437  159.913 -7.404  1.00 27.30 ? 95   LYS A CG  1 
ATOM   329  C  CD  . LYS A 1 95  ? 16.926  160.087 -7.128  1.00 27.90 ? 95   LYS A CD  1 
ATOM   330  C  CE  . LYS A 1 95  ? 17.348  159.449 -5.821  1.00 28.16 ? 95   LYS A CE  1 
ATOM   331  N  NZ  . LYS A 1 95  ? 18.787  159.715 -5.548  1.00 28.44 ? 95   LYS A NZ  1 
ATOM   332  N  N   . PHE A 1 96  ? 13.156  155.913 -8.072  1.00 22.77 ? 96   PHE A N   1 
ATOM   333  C  CA  . PHE A 1 96  ? 13.011  154.536 -8.537  1.00 22.30 ? 96   PHE A CA  1 
ATOM   334  C  C   . PHE A 1 96  ? 11.937  154.464 -9.618  1.00 22.16 ? 96   PHE A C   1 
ATOM   335  O  O   . PHE A 1 96  ? 12.185  153.973 -10.717 1.00 22.04 ? 96   PHE A O   1 
ATOM   336  C  CB  . PHE A 1 96  ? 12.627  153.612 -7.376  1.00 22.29 ? 96   PHE A CB  1 
ATOM   337  C  CG  . PHE A 1 96  ? 12.665  152.145 -7.727  1.00 22.43 ? 96   PHE A CG  1 
ATOM   338  C  CD1 . PHE A 1 96  ? 13.735  151.349 -7.332  1.00 22.17 ? 96   PHE A CD1 1 
ATOM   339  C  CD2 . PHE A 1 96  ? 11.626  151.561 -8.448  1.00 22.84 ? 96   PHE A CD2 1 
ATOM   340  C  CE1 . PHE A 1 96  ? 13.770  149.989 -7.647  1.00 22.39 ? 96   PHE A CE1 1 
ATOM   341  C  CE2 . PHE A 1 96  ? 11.652  150.200 -8.770  1.00 22.59 ? 96   PHE A CE2 1 
ATOM   342  C  CZ  . PHE A 1 96  ? 12.726  149.416 -8.367  1.00 22.20 ? 96   PHE A CZ  1 
ATOM   343  N  N   . ARG A 1 97  ? 10.745  154.961 -9.301  1.00 22.51 ? 97   ARG A N   1 
ATOM   344  C  CA  . ARG A 1 97  ? 9.636   154.944 -10.247 1.00 22.83 ? 97   ARG A CA  1 
ATOM   345  C  C   . ARG A 1 97  ? 9.956   155.702 -11.532 1.00 22.22 ? 97   ARG A C   1 
ATOM   346  O  O   . ARG A 1 97  ? 9.593   155.264 -12.622 1.00 22.04 ? 97   ARG A O   1 
ATOM   347  C  CB  . ARG A 1 97  ? 8.379   155.542 -9.607  1.00 24.60 ? 97   ARG A CB  1 
ATOM   348  C  CG  . ARG A 1 97  ? 7.157   155.483 -10.514 1.00 26.92 ? 97   ARG A CG  1 
ATOM   349  C  CD  . ARG A 1 97  ? 5.927   156.118 -9.878  1.00 29.79 ? 97   ARG A CD  1 
ATOM   350  N  NE  . ARG A 1 97  ? 5.605   155.535 -8.578  1.00 32.17 ? 97   ARG A NE  1 
ATOM   351  C  CZ  . ARG A 1 97  ? 5.944   156.073 -7.409  1.00 33.58 ? 97   ARG A CZ  1 
ATOM   352  N  NH1 . ARG A 1 97  ? 6.620   157.214 -7.374  1.00 34.36 ? 97   ARG A NH1 1 
ATOM   353  N  NH2 . ARG A 1 97  ? 5.606   155.469 -6.274  1.00 34.30 ? 97   ARG A NH2 1 
ATOM   354  N  N   . ASP A 1 98  ? 10.626  156.843 -11.401 1.00 21.71 ? 98   ASP A N   1 
ATOM   355  C  CA  . ASP A 1 98  ? 10.988  157.659 -12.558 1.00 21.05 ? 98   ASP A CA  1 
ATOM   356  C  C   . ASP A 1 98  ? 11.812  156.852 -13.558 1.00 20.57 ? 98   ASP A C   1 
ATOM   357  O  O   . ASP A 1 98  ? 11.487  156.793 -14.745 1.00 20.92 ? 98   ASP A O   1 
ATOM   358  C  CB  . ASP A 1 98  ? 11.777  158.891 -12.101 1.00 21.60 ? 98   ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 98  ? 12.360  159.678 -13.261 1.00 21.56 ? 98   ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 98  ? 11.594  160.335 -13.998 1.00 21.80 ? 98   ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 98  ? 13.594  159.633 -13.435 1.00 22.21 ? 98   ASP A OD2 1 
ATOM   362  N  N   . VAL A 1 99  ? 12.881  156.228 -13.079 1.00 20.13 ? 99   VAL A N   1 
ATOM   363  C  CA  . VAL A 1 99  ? 13.730  155.425 -13.949 1.00 19.59 ? 99   VAL A CA  1 
ATOM   364  C  C   . VAL A 1 99  ? 12.963  154.278 -14.604 1.00 19.31 ? 99   VAL A C   1 
ATOM   365  O  O   . VAL A 1 99  ? 13.088  154.049 -15.810 1.00 18.28 ? 99   VAL A O   1 
ATOM   366  C  CB  . VAL A 1 99  ? 14.926  154.830 -13.174 1.00 19.92 ? 99   VAL A CB  1 
ATOM   367  C  CG1 . VAL A 1 99  ? 15.593  153.731 -14.001 1.00 19.54 ? 99   VAL A CG1 1 
ATOM   368  C  CG2 . VAL A 1 99  ? 15.942  155.933 -12.860 1.00 19.60 ? 99   VAL A CG2 1 
ATOM   369  N  N   . TYR A 1 100 ? 12.162  153.564 -13.819 1.00 19.24 ? 100  TYR A N   1 
ATOM   370  C  CA  . TYR A 1 100 ? 11.425  152.435 -14.375 1.00 20.06 ? 100  TYR A CA  1 
ATOM   371  C  C   . TYR A 1 100 ? 10.255  152.796 -15.280 1.00 20.23 ? 100  TYR A C   1 
ATOM   372  O  O   . TYR A 1 100 ? 9.865   152.003 -16.140 1.00 19.75 ? 100  TYR A O   1 
ATOM   373  C  CB  . TYR A 1 100 ? 11.000  151.473 -13.260 1.00 19.47 ? 100  TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 100 ? 12.130  150.534 -12.904 1.00 19.59 ? 100  TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 100 ? 13.087  150.883 -11.948 1.00 19.19 ? 100  TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 100 ? 12.317  149.345 -13.615 1.00 19.46 ? 100  TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 100 ? 14.205  150.077 -11.719 1.00 19.72 ? 100  TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 100 ? 13.434  148.534 -13.393 1.00 19.69 ? 100  TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 100 ? 14.374  148.906 -12.450 1.00 19.39 ? 100  TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 100 ? 15.496  148.128 -12.256 1.00 19.57 ? 100  TYR A OH  1 
ATOM   381  N  N   . ASP A 1 101 ? 9.703   153.994 -15.110 1.00 20.65 ? 101  ASP A N   1 
ATOM   382  C  CA  . ASP A 1 101 ? 8.615   154.421 -15.977 1.00 20.81 ? 101  ASP A CA  1 
ATOM   383  C  C   . ASP A 1 101 ? 9.208   154.624 -17.367 1.00 20.58 ? 101  ASP A C   1 
ATOM   384  O  O   . ASP A 1 101 ? 8.574   154.329 -18.379 1.00 20.58 ? 101  ASP A O   1 
ATOM   385  C  CB  . ASP A 1 101 ? 7.993   155.727 -15.476 1.00 21.36 ? 101  ASP A CB  1 
ATOM   386  C  CG  . ASP A 1 101 ? 6.943   155.501 -14.402 1.00 22.37 ? 101  ASP A CG  1 
ATOM   387  O  OD1 . ASP A 1 101 ? 6.406   156.497 -13.878 1.00 22.56 ? 101  ASP A OD1 1 
ATOM   388  O  OD2 . ASP A 1 101 ? 6.649   154.329 -14.085 1.00 22.49 ? 101  ASP A OD2 1 
ATOM   389  N  N   . TYR A 1 102 ? 10.439  155.124 -17.414 1.00 21.03 ? 102  TYR A N   1 
ATOM   390  C  CA  . TYR A 1 102 ? 11.098  155.341 -18.694 1.00 21.36 ? 102  TYR A CA  1 
ATOM   391  C  C   . TYR A 1 102 ? 11.697  154.050 -19.239 1.00 21.52 ? 102  TYR A C   1 
ATOM   392  O  O   . TYR A 1 102 ? 11.741  153.844 -20.454 1.00 21.19 ? 102  TYR A O   1 
ATOM   393  C  CB  . TYR A 1 102 ? 12.156  156.443 -18.578 1.00 21.29 ? 102  TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 102 ? 11.540  157.827 -18.634 1.00 22.02 ? 102  TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 102 ? 10.975  158.414 -17.501 1.00 22.06 ? 102  TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 102 ? 11.438  158.509 -19.847 1.00 22.30 ? 102  TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 102 ? 10.315  159.651 -17.577 1.00 22.54 ? 102  TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 102 ? 10.781  159.739 -19.933 1.00 22.68 ? 102  TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 102 ? 10.220  160.300 -18.799 1.00 22.52 ? 102  TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 102 ? 9.535   161.494 -18.901 1.00 23.60 ? 102  TYR A OH  1 
ATOM   401  N  N   . PHE A 1 103 ? 12.152  153.173 -18.349 1.00 21.36 ? 103  PHE A N   1 
ATOM   402  C  CA  . PHE A 1 103 ? 12.694  151.905 -18.814 1.00 21.78 ? 103  PHE A CA  1 
ATOM   403  C  C   . PHE A 1 103 ? 11.562  151.172 -19.526 1.00 21.66 ? 103  PHE A C   1 
ATOM   404  O  O   . PHE A 1 103 ? 11.746  150.629 -20.617 1.00 21.61 ? 103  PHE A O   1 
ATOM   405  C  CB  . PHE A 1 103 ? 13.190  151.037 -17.656 1.00 21.86 ? 103  PHE A CB  1 
ATOM   406  C  CG  . PHE A 1 103 ? 13.575  149.646 -18.083 1.00 22.19 ? 103  PHE A CG  1 
ATOM   407  C  CD1 . PHE A 1 103 ? 14.723  149.432 -18.838 1.00 22.07 ? 103  PHE A CD1 1 
ATOM   408  C  CD2 . PHE A 1 103 ? 12.759  148.560 -17.781 1.00 21.68 ? 103  PHE A CD2 1 
ATOM   409  C  CE1 . PHE A 1 103 ? 15.056  148.152 -19.290 1.00 22.93 ? 103  PHE A CE1 1 
ATOM   410  C  CE2 . PHE A 1 103 ? 13.081  147.278 -18.226 1.00 22.15 ? 103  PHE A CE2 1 
ATOM   411  C  CZ  . PHE A 1 103 ? 14.231  147.073 -18.983 1.00 22.04 ? 103  PHE A CZ  1 
ATOM   412  N  N   . ARG A 1 104 ? 10.388  151.162 -18.903 1.00 21.79 ? 104  ARG A N   1 
ATOM   413  C  CA  . ARG A 1 104 ? 9.231   150.498 -19.486 1.00 22.46 ? 104  ARG A CA  1 
ATOM   414  C  C   . ARG A 1 104 ? 8.885   151.084 -20.852 1.00 23.07 ? 104  ARG A C   1 
ATOM   415  O  O   . ARG A 1 104 ? 8.431   150.369 -21.747 1.00 23.11 ? 104  ARG A O   1 
ATOM   416  C  CB  . ARG A 1 104 ? 8.018   150.605 -18.549 1.00 22.45 ? 104  ARG A CB  1 
ATOM   417  C  CG  . ARG A 1 104 ? 8.024   149.605 -17.388 1.00 22.74 ? 104  ARG A CG  1 
ATOM   418  C  CD  . ARG A 1 104 ? 6.755   149.716 -16.539 1.00 22.37 ? 104  ARG A CD  1 
ATOM   419  N  NE  . ARG A 1 104 ? 6.844   150.775 -15.537 1.00 22.01 ? 104  ARG A NE  1 
ATOM   420  C  CZ  . ARG A 1 104 ? 7.476   150.653 -14.372 1.00 22.59 ? 104  ARG A CZ  1 
ATOM   421  N  NH1 . ARG A 1 104 ? 8.077   149.510 -14.055 1.00 22.21 ? 104  ARG A NH1 1 
ATOM   422  N  NH2 . ARG A 1 104 ? 7.509   151.672 -13.521 1.00 21.50 ? 104  ARG A NH2 1 
ATOM   423  N  N   . ALA A 1 105 ? 9.101   152.386 -21.012 1.00 23.64 ? 105  ALA A N   1 
ATOM   424  C  CA  . ALA A 1 105 ? 8.808   153.053 -22.277 1.00 24.27 ? 105  ALA A CA  1 
ATOM   425  C  C   . ALA A 1 105 ? 9.767   152.613 -23.379 1.00 24.77 ? 105  ALA A C   1 
ATOM   426  O  O   . ALA A 1 105 ? 9.341   152.308 -24.493 1.00 24.14 ? 105  ALA A O   1 
ATOM   427  C  CB  . ALA A 1 105 ? 8.876   154.570 -22.102 1.00 23.92 ? 105  ALA A CB  1 
ATOM   428  N  N   . VAL A 1 106 ? 11.060  152.581 -23.073 1.00 25.61 ? 106  VAL A N   1 
ATOM   429  C  CA  . VAL A 1 106 ? 12.048  152.177 -24.068 1.00 27.34 ? 106  VAL A CA  1 
ATOM   430  C  C   . VAL A 1 106 ? 11.912  150.696 -24.412 1.00 28.06 ? 106  VAL A C   1 
ATOM   431  O  O   . VAL A 1 106 ? 12.074  150.302 -25.569 1.00 27.74 ? 106  VAL A O   1 
ATOM   432  C  CB  . VAL A 1 106 ? 13.494  152.467 -23.589 1.00 27.68 ? 106  VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 106 ? 13.790  151.727 -22.301 1.00 28.42 ? 106  VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 106 ? 14.477  152.057 -24.661 1.00 29.17 ? 106  VAL A CG2 1 
ATOM   435  N  N   . LEU A 1 107 ? 11.604  149.882 -23.408 1.00 28.86 ? 107  LEU A N   1 
ATOM   436  C  CA  . LEU A 1 107 ? 11.437  148.449 -23.614 1.00 30.15 ? 107  LEU A CA  1 
ATOM   437  C  C   . LEU A 1 107 ? 10.236  148.196 -24.519 1.00 31.14 ? 107  LEU A C   1 
ATOM   438  O  O   . LEU A 1 107 ? 10.323  147.453 -25.494 1.00 31.41 ? 107  LEU A O   1 
ATOM   439  C  CB  . LEU A 1 107 ? 11.227  147.736 -22.274 1.00 29.81 ? 107  LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 107 ? 11.148  146.207 -22.341 1.00 30.24 ? 107  LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 107 ? 12.480  145.661 -22.832 1.00 29.93 ? 107  LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 107 ? 10.811  145.636 -20.967 1.00 29.48 ? 107  LEU A CD2 1 
ATOM   443  N  N   . GLN A 1 108 ? 9.114   148.823 -24.184 1.00 32.31 ? 108  GLN A N   1 
ATOM   444  C  CA  . GLN A 1 108 ? 7.884   148.678 -24.953 1.00 34.02 ? 108  GLN A CA  1 
ATOM   445  C  C   . GLN A 1 108 ? 8.074   149.177 -26.383 1.00 34.70 ? 108  GLN A C   1 
ATOM   446  O  O   . GLN A 1 108 ? 7.444   148.682 -27.318 1.00 34.87 ? 108  GLN A O   1 
ATOM   447  C  CB  . GLN A 1 108 ? 6.760   149.460 -24.266 1.00 34.69 ? 108  GLN A CB  1 
ATOM   448  C  CG  . GLN A 1 108 ? 5.477   149.576 -25.068 1.00 36.39 ? 108  GLN A CG  1 
ATOM   449  C  CD  . GLN A 1 108 ? 4.377   150.291 -24.297 1.00 37.50 ? 108  GLN A CD  1 
ATOM   450  O  OE1 . GLN A 1 108 ? 3.836   149.760 -23.323 1.00 38.25 ? 108  GLN A OE1 1 
ATOM   451  N  NE2 . GLN A 1 108 ? 4.048   151.506 -24.725 1.00 37.84 ? 108  GLN A NE2 1 
ATOM   452  N  N   . ARG A 1 109 ? 8.959   150.153 -26.537 1.00 35.38 ? 109  ARG A N   1 
ATOM   453  C  CA  . ARG A 1 109 ? 9.252   150.751 -27.833 1.00 36.45 ? 109  ARG A CA  1 
ATOM   454  C  C   . ARG A 1 109 ? 10.421  150.027 -28.503 1.00 35.74 ? 109  ARG A C   1 
ATOM   455  O  O   . ARG A 1 109 ? 10.715  150.259 -29.676 1.00 35.87 ? 109  ARG A O   1 
ATOM   456  C  CB  . ARG A 1 109 ? 9.599   152.229 -27.628 1.00 38.22 ? 109  ARG A CB  1 
ATOM   457  C  CG  . ARG A 1 109 ? 9.662   153.072 -28.881 1.00 41.33 ? 109  ARG A CG  1 
ATOM   458  C  CD  . ARG A 1 109 ? 10.045  154.507 -28.526 1.00 43.76 ? 109  ARG A CD  1 
ATOM   459  N  NE  . ARG A 1 109 ? 9.887   155.422 -29.654 1.00 46.23 ? 109  ARG A NE  1 
ATOM   460  C  CZ  . ARG A 1 109 ? 10.204  156.714 -29.622 1.00 47.07 ? 109  ARG A CZ  1 
ATOM   461  N  NH1 . ARG A 1 109 ? 10.703  157.252 -28.516 1.00 47.58 ? 109  ARG A NH1 1 
ATOM   462  N  NH2 . ARG A 1 109 ? 10.018  157.471 -30.696 1.00 47.83 ? 109  ARG A NH2 1 
ATOM   463  N  N   . ASP A 1 110 ? 11.073  149.144 -27.750 1.00 34.65 ? 110  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 110 ? 12.229  148.399 -28.238 1.00 33.54 ? 110  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 110 ? 13.218  149.367 -28.885 1.00 33.00 ? 110  ASP A C   1 
ATOM   466  O  O   . ASP A 1 110 ? 13.732  149.130 -29.983 1.00 32.20 ? 110  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 110 ? 11.798  147.322 -29.237 1.00 33.88 ? 110  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 110 ? 12.946  146.418 -29.648 1.00 34.35 ? 110  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 110 ? 13.790  146.099 -28.787 1.00 34.38 ? 110  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 110 ? 13.001  146.016 -30.829 1.00 35.52 ? 110  ASP A OD2 1 
ATOM   471  N  N   . GLU A 1 111 ? 13.473  150.466 -28.183 1.00 32.00 ? 111  GLU A N   1 
ATOM   472  C  CA  . GLU A 1 111 ? 14.387  151.493 -28.656 1.00 31.24 ? 111  GLU A CA  1 
ATOM   473  C  C   . GLU A 1 111 ? 15.836  151.103 -28.385 1.00 31.04 ? 111  GLU A C   1 
ATOM   474  O  O   . GLU A 1 111 ? 16.283  151.110 -27.237 1.00 30.27 ? 111  GLU A O   1 
ATOM   475  C  CB  . GLU A 1 111 ? 14.076  152.819 -27.959 1.00 30.94 ? 111  GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 111 ? 14.860  154.006 -28.487 1.00 30.74 ? 111  GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 111 ? 14.627  155.257 -27.664 1.00 30.53 ? 111  GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 111 ? 15.502  155.605 -26.845 1.00 31.01 ? 111  GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 111 ? 13.559  155.885 -27.825 1.00 30.90 ? 111  GLU A OE2 1 
ATOM   480  N  N   . ARG A 1 112 ? 16.561  150.755 -29.442 1.00 30.85 ? 112  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 112 ? 17.964  150.378 -29.310 1.00 31.28 ? 112  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 112 ? 18.767  151.669 -29.436 1.00 30.82 ? 112  ARG A C   1 
ATOM   483  O  O   . ARG A 1 112 ? 19.265  151.991 -30.513 1.00 31.16 ? 112  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 112 ? 18.378  149.417 -30.433 1.00 32.14 ? 112  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 112 ? 17.404  148.277 -30.715 1.00 33.13 ? 112  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 112 ? 17.280  147.309 -29.556 1.00 33.86 ? 112  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 112 ? 16.381  146.197 -29.877 1.00 34.92 ? 112  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 112 ? 16.687  145.183 -30.682 1.00 34.76 ? 112  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 112 ? 17.878  145.120 -31.257 1.00 35.32 ? 112  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 112 ? 15.795  144.229 -30.915 1.00 35.04 ? 112  ARG A NH2 1 
ATOM   491  N  N   . SER A 1 113 ? 18.892  152.409 -28.340 1.00 29.85 ? 113  SER A N   1 
ATOM   492  C  CA  . SER A 1 113 ? 19.615  153.670 -28.380 1.00 28.94 ? 113  SER A CA  1 
ATOM   493  C  C   . SER A 1 113 ? 20.643  153.832 -27.275 1.00 28.79 ? 113  SER A C   1 
ATOM   494  O  O   . SER A 1 113 ? 20.636  153.106 -26.277 1.00 28.32 ? 113  SER A O   1 
ATOM   495  C  CB  . SER A 1 113 ? 18.629  154.835 -28.299 1.00 29.04 ? 113  SER A CB  1 
ATOM   496  O  OG  . SER A 1 113 ? 17.972  154.839 -27.042 1.00 28.91 ? 113  SER A OG  1 
ATOM   497  N  N   . GLU A 1 114 ? 21.518  154.814 -27.462 1.00 27.82 ? 114  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 114 ? 22.552  155.119 -26.494 1.00 27.50 ? 114  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 114 ? 21.903  155.616 -25.204 1.00 26.75 ? 114  GLU A C   1 
ATOM   500  O  O   . GLU A 1 114 ? 22.351  155.273 -24.110 1.00 26.49 ? 114  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 114 ? 23.491  156.184 -27.065 1.00 28.33 ? 114  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 114 ? 24.583  156.659 -26.118 1.00 29.55 ? 114  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 114 ? 25.478  155.537 -25.627 1.00 30.27 ? 114  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 114 ? 25.777  154.614 -26.415 1.00 31.07 ? 114  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 114 ? 25.897  155.588 -24.454 1.00 30.63 ? 114  GLU A OE2 1 
ATOM   506  N  N   . ARG A 1 115 ? 20.842  156.414 -25.325 1.00 25.65 ? 115  ARG A N   1 
ATOM   507  C  CA  . ARG A 1 115 ? 20.181  156.923 -24.128 1.00 24.86 ? 115  ARG A CA  1 
ATOM   508  C  C   . ARG A 1 115 ? 19.538  155.766 -23.368 1.00 24.09 ? 115  ARG A C   1 
ATOM   509  O  O   . ARG A 1 115 ? 19.562  155.731 -22.137 1.00 23.37 ? 115  ARG A O   1 
ATOM   510  C  CB  . ARG A 1 115 ? 19.136  157.996 -24.478 1.00 24.77 ? 115  ARG A CB  1 
ATOM   511  C  CG  . ARG A 1 115 ? 17.893  157.516 -25.213 1.00 25.82 ? 115  ARG A CG  1 
ATOM   512  C  CD  . ARG A 1 115 ? 16.898  158.671 -25.389 1.00 26.29 ? 115  ARG A CD  1 
ATOM   513  N  NE  . ARG A 1 115 ? 15.674  158.272 -26.084 1.00 26.61 ? 115  ARG A NE  1 
ATOM   514  C  CZ  . ARG A 1 115 ? 14.691  159.108 -26.414 1.00 26.84 ? 115  ARG A CZ  1 
ATOM   515  N  NH1 . ARG A 1 115 ? 14.781  160.399 -26.115 1.00 26.10 ? 115  ARG A NH1 1 
ATOM   516  N  NH2 . ARG A 1 115 ? 13.617  158.656 -27.050 1.00 26.29 ? 115  ARG A NH2 1 
ATOM   517  N  N   . ALA A 1 116 ? 18.974  154.815 -24.105 1.00 23.56 ? 116  ALA A N   1 
ATOM   518  C  CA  . ALA A 1 116 ? 18.356  153.651 -23.483 1.00 23.83 ? 116  ALA A CA  1 
ATOM   519  C  C   . ALA A 1 116 ? 19.451  152.857 -22.765 1.00 23.70 ? 116  ALA A C   1 
ATOM   520  O  O   . ALA A 1 116 ? 19.258  152.377 -21.647 1.00 23.46 ? 116  ALA A O   1 
ATOM   521  C  CB  . ALA A 1 116 ? 17.674  152.785 -24.542 1.00 23.16 ? 116  ALA A CB  1 
ATOM   522  N  N   . PHE A 1 117 ? 20.607  152.735 -23.413 1.00 23.68 ? 117  PHE A N   1 
ATOM   523  C  CA  . PHE A 1 117 ? 21.733  152.010 -22.836 1.00 23.80 ? 117  PHE A CA  1 
ATOM   524  C  C   . PHE A 1 117 ? 22.175  152.631 -21.514 1.00 24.01 ? 117  PHE A C   1 
ATOM   525  O  O   . PHE A 1 117 ? 22.410  151.922 -20.539 1.00 23.62 ? 117  PHE A O   1 
ATOM   526  C  CB  . PHE A 1 117 ? 22.917  151.988 -23.809 1.00 23.17 ? 117  PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 117 ? 24.122  151.257 -23.280 1.00 23.31 ? 117  PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 117 ? 24.072  149.886 -23.049 1.00 23.48 ? 117  PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 117 ? 25.306  151.937 -23.012 1.00 23.34 ? 117  PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 117 ? 25.182  149.202 -22.561 1.00 23.62 ? 117  PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 117 ? 26.424  151.262 -22.523 1.00 23.23 ? 117  PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 117 ? 26.361  149.892 -22.298 1.00 23.45 ? 117  PHE A CZ  1 
ATOM   533  N  N   . LYS A 1 118 ? 22.295  153.956 -21.480 1.00 23.94 ? 118  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 118 ? 22.709  154.629 -20.253 1.00 24.26 ? 118  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 118 ? 21.640  154.486 -19.179 1.00 23.43 ? 118  LYS A C   1 
ATOM   536  O  O   . LYS A 1 118 ? 21.953  154.402 -17.991 1.00 22.93 ? 118  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 118 ? 22.988  156.111 -20.520 1.00 25.53 ? 118  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 118 ? 24.255  156.351 -21.327 1.00 27.60 ? 118  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 118 ? 24.420  157.818 -21.696 1.00 29.92 ? 118  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 118 ? 25.654  158.025 -22.567 1.00 31.05 ? 118  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 118 ? 25.702  159.406 -23.130 1.00 33.46 ? 118  LYS A NZ  1 
ATOM   542  N  N   . LEU A 1 119 ? 20.381  154.453 -19.605 1.00 22.74 ? 119  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 119 ? 19.264  154.312 -18.678 1.00 22.79 ? 119  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 119 ? 19.312  152.984 -17.924 1.00 22.30 ? 119  LEU A C   1 
ATOM   545  O  O   . LEU A 1 119 ? 19.014  152.938 -16.729 1.00 21.37 ? 119  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 119 ? 17.931  154.431 -19.425 1.00 22.95 ? 119  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 119 ? 16.646  154.130 -18.642 1.00 23.89 ? 119  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 119 ? 16.544  155.025 -17.427 1.00 24.03 ? 119  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 119 ? 15.441  154.339 -19.547 1.00 24.82 ? 119  LEU A CD2 1 
ATOM   550  N  N   . THR A 1 120 ? 19.687  151.908 -18.614 1.00 22.09 ? 120  THR A N   1 
ATOM   551  C  CA  . THR A 1 120 ? 19.751  150.600 -17.965 1.00 22.03 ? 120  THR A CA  1 
ATOM   552  C  C   . THR A 1 120 ? 20.734  150.604 -16.799 1.00 22.32 ? 120  THR A C   1 
ATOM   553  O  O   . THR A 1 120 ? 20.533  149.892 -15.816 1.00 22.41 ? 120  THR A O   1 
ATOM   554  C  CB  . THR A 1 120 ? 20.141  149.468 -18.955 1.00 21.77 ? 120  THR A CB  1 
ATOM   555  O  OG1 . THR A 1 120 ? 21.471  149.678 -19.449 1.00 20.91 ? 120  THR A OG1 1 
ATOM   556  C  CG2 . THR A 1 120 ? 19.160  149.421 -20.117 1.00 21.38 ? 120  THR A CG2 1 
ATOM   557  N  N   . ARG A 1 121 ? 21.788  151.411 -16.899 1.00 22.65 ? 121  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 121 ? 22.770  151.492 -15.821 1.00 23.24 ? 121  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 121 ? 22.105  151.997 -14.541 1.00 22.60 ? 121  ARG A C   1 
ATOM   560  O  O   . ARG A 1 121 ? 22.406  151.522 -13.444 1.00 21.83 ? 121  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 121 ? 23.923  152.431 -16.197 1.00 25.47 ? 121  ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 121 ? 24.846  152.754 -15.025 1.00 28.19 ? 121  ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 121 ? 25.814  153.883 -15.357 1.00 30.57 ? 121  ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 121 ? 26.949  153.427 -16.150 1.00 33.02 ? 121  ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 121 ? 28.124  153.066 -15.642 1.00 34.04 ? 121  ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 121 ? 28.328  153.112 -14.331 1.00 34.46 ? 121  ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 121 ? 29.095  152.650 -16.447 1.00 33.70 ? 121  ARG A NH2 1 
ATOM   568  N  N   . ASP A 1 122 ? 21.204  152.967 -14.681 1.00 21.73 ? 122  ASP A N   1 
ATOM   569  C  CA  . ASP A 1 122 ? 20.504  153.511 -13.521 1.00 21.04 ? 122  ASP A CA  1 
ATOM   570  C  C   . ASP A 1 122 ? 19.483  152.510 -13.001 1.00 20.18 ? 122  ASP A C   1 
ATOM   571  O  O   . ASP A 1 122 ? 19.305  152.364 -11.792 1.00 20.12 ? 122  ASP A O   1 
ATOM   572  C  CB  . ASP A 1 122 ? 19.792  154.827 -13.869 1.00 21.11 ? 122  ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 122 ? 20.759  155.976 -14.097 1.00 21.59 ? 122  ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 122 ? 21.861  155.950 -13.511 1.00 21.35 ? 122  ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 122 ? 20.409  156.912 -14.847 1.00 21.67 ? 122  ASP A OD2 1 
ATOM   576  N  N   . ALA A 1 123 ? 18.799  151.836 -13.919 1.00 19.57 ? 123  ALA A N   1 
ATOM   577  C  CA  . ALA A 1 123 ? 17.803  150.843 -13.536 1.00 19.69 ? 123  ALA A CA  1 
ATOM   578  C  C   . ALA A 1 123 ? 18.499  149.744 -12.742 1.00 19.67 ? 123  ALA A C   1 
ATOM   579  O  O   . ALA A 1 123 ? 17.983  149.271 -11.729 1.00 19.79 ? 123  ALA A O   1 
ATOM   580  C  CB  . ALA A 1 123 ? 17.136  150.260 -14.781 1.00 19.36 ? 123  ALA A CB  1 
ATOM   581  N  N   . ILE A 1 124 ? 19.683  149.353 -13.204 1.00 19.76 ? 124  ILE A N   1 
ATOM   582  C  CA  . ILE A 1 124 ? 20.462  148.316 -12.539 1.00 20.30 ? 124  ILE A CA  1 
ATOM   583  C  C   . ILE A 1 124 ? 20.905  148.738 -11.139 1.00 21.33 ? 124  ILE A C   1 
ATOM   584  O  O   . ILE A 1 124 ? 20.874  147.936 -10.206 1.00 21.13 ? 124  ILE A O   1 
ATOM   585  C  CB  . ILE A 1 124 ? 21.703  147.935 -13.380 1.00 20.12 ? 124  ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 124 ? 21.262  147.124 -14.602 1.00 19.98 ? 124  ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 124 ? 22.692  147.140 -12.541 1.00 19.59 ? 124  ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 124 ? 22.356  146.910 -15.628 1.00 20.19 ? 124  ILE A CD1 1 
ATOM   589  N  N   . GLU A 1 125 ? 21.316  149.993 -10.984 1.00 22.21 ? 125  GLU A N   1 
ATOM   590  C  CA  . GLU A 1 125 ? 21.752  150.457 -9.674  1.00 23.06 ? 125  GLU A CA  1 
ATOM   591  C  C   . GLU A 1 125 ? 20.580  150.423 -8.697  1.00 22.42 ? 125  GLU A C   1 
ATOM   592  O  O   . GLU A 1 125 ? 20.758  150.126 -7.516  1.00 22.62 ? 125  GLU A O   1 
ATOM   593  C  CB  . GLU A 1 125 ? 22.322  151.880 -9.756  1.00 25.13 ? 125  GLU A CB  1 
ATOM   594  C  CG  . GLU A 1 125 ? 22.984  152.325 -8.458  1.00 28.73 ? 125  GLU A CG  1 
ATOM   595  C  CD  . GLU A 1 125 ? 23.650  153.686 -8.553  1.00 31.32 ? 125  GLU A CD  1 
ATOM   596  O  OE1 . GLU A 1 125 ? 24.452  153.902 -9.486  1.00 33.68 ? 125  GLU A OE1 1 
ATOM   597  O  OE2 . GLU A 1 125 ? 23.381  154.540 -7.684  1.00 32.73 ? 125  GLU A OE2 1 
ATOM   598  N  N   . LEU A 1 126 ? 19.383  150.723 -9.199  1.00 21.47 ? 126  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 126 ? 18.174  150.722 -8.377  1.00 20.91 ? 126  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 126 ? 17.773  149.304 -7.975  1.00 20.63 ? 126  LEU A C   1 
ATOM   601  O  O   . LEU A 1 126 ? 17.294  149.079 -6.866  1.00 20.09 ? 126  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 126 ? 17.025  151.399 -9.126  1.00 20.57 ? 126  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 126 ? 17.173  152.919 -9.262  1.00 20.96 ? 126  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 126 ? 16.142  153.454 -10.236 1.00 20.92 ? 126  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 126 ? 17.018  153.573 -7.889  1.00 20.72 ? 126  LEU A CD2 1 
ATOM   606  N  N   . ASN A 1 127 ? 17.954  148.354 -8.888  1.00 19.48 ? 127  ASN A N   1 
ATOM   607  C  CA  . ASN A 1 127 ? 17.646  146.955 -8.608  1.00 19.05 ? 127  ASN A CA  1 
ATOM   608  C  C   . ASN A 1 127 ? 18.476  146.066 -9.526  1.00 18.74 ? 127  ASN A C   1 
ATOM   609  O  O   . ASN A 1 127 ? 18.083  145.776 -10.657 1.00 18.58 ? 127  ASN A O   1 
ATOM   610  C  CB  . ASN A 1 127 ? 16.153  146.668 -8.797  1.00 18.73 ? 127  ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 127 ? 15.799  145.219 -8.493  1.00 18.73 ? 127  ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 127 ? 16.588  144.491 -7.891  1.00 19.06 ? 127  ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 127 ? 14.606  144.798 -8.897  1.00 18.49 ? 127  ASN A ND2 1 
ATOM   614  N  N   . ALA A 1 128 ? 19.631  145.641 -9.026  1.00 18.76 ? 128  ALA A N   1 
ATOM   615  C  CA  . ALA A 1 128 ? 20.540  144.802 -9.791  1.00 19.33 ? 128  ALA A CA  1 
ATOM   616  C  C   . ALA A 1 128 ? 19.979  143.401 -10.043 1.00 19.52 ? 128  ALA A C   1 
ATOM   617  O  O   . ALA A 1 128 ? 20.530  142.647 -10.847 1.00 19.89 ? 128  ALA A O   1 
ATOM   618  C  CB  . ALA A 1 128 ? 21.891  144.715 -9.075  1.00 19.19 ? 128  ALA A CB  1 
ATOM   619  N  N   . ALA A 1 129 ? 18.888  143.050 -9.364  1.00 19.09 ? 129  ALA A N   1 
ATOM   620  C  CA  . ALA A 1 129 ? 18.280  141.733 -9.551  1.00 18.94 ? 129  ALA A CA  1 
ATOM   621  C  C   . ALA A 1 129 ? 17.228  141.731 -10.661 1.00 18.64 ? 129  ALA A C   1 
ATOM   622  O  O   . ALA A 1 129 ? 16.601  140.706 -10.926 1.00 18.19 ? 129  ALA A O   1 
ATOM   623  C  CB  . ALA A 1 129 ? 17.655  141.242 -8.240  1.00 18.61 ? 129  ALA A CB  1 
ATOM   624  N  N   . ASN A 1 130 ? 17.021  142.874 -11.310 1.00 18.28 ? 130  ASN A N   1 
ATOM   625  C  CA  . ASN A 1 130 ? 16.034  142.926 -12.382 1.00 18.13 ? 130  ASN A CA  1 
ATOM   626  C  C   . ASN A 1 130 ? 16.647  142.344 -13.652 1.00 18.13 ? 130  ASN A C   1 
ATOM   627  O  O   . ASN A 1 130 ? 17.343  143.038 -14.393 1.00 17.66 ? 130  ASN A O   1 
ATOM   628  C  CB  . ASN A 1 130 ? 15.571  144.361 -12.641 1.00 17.71 ? 130  ASN A CB  1 
ATOM   629  C  CG  . ASN A 1 130 ? 14.368  144.415 -13.557 1.00 17.63 ? 130  ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1 130 ? 14.383  143.832 -14.643 1.00 17.65 ? 130  ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1 130 ? 13.315  145.104 -13.123 1.00 16.61 ? 130  ASN A ND2 1 
ATOM   632  N  N   . TYR A 1 131 ? 16.371  141.062 -13.890 1.00 17.89 ? 131  TYR A N   1 
ATOM   633  C  CA  . TYR A 1 131 ? 16.897  140.326 -15.038 1.00 17.53 ? 131  TYR A CA  1 
ATOM   634  C  C   . TYR A 1 131 ? 16.405  140.842 -16.390 1.00 17.33 ? 131  TYR A C   1 
ATOM   635  O  O   . TYR A 1 131 ? 17.051  140.635 -17.417 1.00 17.24 ? 131  TYR A O   1 
ATOM   636  C  CB  . TYR A 1 131 ? 16.549  138.841 -14.881 1.00 16.85 ? 131  TYR A CB  1 
ATOM   637  C  CG  . TYR A 1 131 ? 15.065  138.593 -14.745 1.00 16.75 ? 131  TYR A CG  1 
ATOM   638  C  CD1 . TYR A 1 131 ? 14.257  138.456 -15.873 1.00 16.23 ? 131  TYR A CD1 1 
ATOM   639  C  CD2 . TYR A 1 131 ? 14.456  138.566 -13.487 1.00 16.58 ? 131  TYR A CD2 1 
ATOM   640  C  CE1 . TYR A 1 131 ? 12.886  138.304 -15.756 1.00 16.09 ? 131  TYR A CE1 1 
ATOM   641  C  CE2 . TYR A 1 131 ? 13.075  138.416 -13.359 1.00 15.86 ? 131  TYR A CE2 1 
ATOM   642  C  CZ  . TYR A 1 131 ? 12.300  138.288 -14.499 1.00 16.04 ? 131  TYR A CZ  1 
ATOM   643  O  OH  . TYR A 1 131 ? 10.938  138.149 -14.395 1.00 16.29 ? 131  TYR A OH  1 
ATOM   644  N  N   . THR A 1 132 ? 15.255  141.504 -16.391 1.00 17.34 ? 132  THR A N   1 
ATOM   645  C  CA  . THR A 1 132 ? 14.707  142.047 -17.624 1.00 17.20 ? 132  THR A CA  1 
ATOM   646  C  C   . THR A 1 132 ? 15.595  143.193 -18.109 1.00 17.57 ? 132  THR A C   1 
ATOM   647  O  O   . THR A 1 132 ? 15.897  143.299 -19.297 1.00 17.36 ? 132  THR A O   1 
ATOM   648  C  CB  . THR A 1 132 ? 13.271  142.548 -17.409 1.00 16.99 ? 132  THR A CB  1 
ATOM   649  O  OG1 . THR A 1 132 ? 12.427  141.431 -17.094 1.00 16.75 ? 132  THR A OG1 1 
ATOM   650  C  CG2 . THR A 1 132 ? 12.748  143.243 -18.671 1.00 16.60 ? 132  THR A CG2 1 
ATOM   651  N  N   . VAL A 1 133 ? 16.019  144.045 -17.181 1.00 17.49 ? 133  VAL A N   1 
ATOM   652  C  CA  . VAL A 1 133 ? 16.887  145.162 -17.523 1.00 17.93 ? 133  VAL A CA  1 
ATOM   653  C  C   . VAL A 1 133 ? 18.211  144.621 -18.055 1.00 18.72 ? 133  VAL A C   1 
ATOM   654  O  O   . VAL A 1 133 ? 18.714  145.075 -19.084 1.00 18.37 ? 133  VAL A O   1 
ATOM   655  C  CB  . VAL A 1 133 ? 17.155  146.056 -16.288 1.00 17.59 ? 133  VAL A CB  1 
ATOM   656  C  CG1 . VAL A 1 133 ? 18.162  147.151 -16.632 1.00 17.16 ? 133  VAL A CG1 1 
ATOM   657  C  CG2 . VAL A 1 133 ? 15.846  146.675 -15.809 1.00 16.90 ? 133  VAL A CG2 1 
ATOM   658  N  N   . TRP A 1 134 ? 18.774  143.645 -17.347 1.00 19.15 ? 134  TRP A N   1 
ATOM   659  C  CA  . TRP A 1 134 ? 20.034  143.044 -17.765 1.00 19.88 ? 134  TRP A CA  1 
ATOM   660  C  C   . TRP A 1 134 ? 19.943  142.466 -19.174 1.00 20.62 ? 134  TRP A C   1 
ATOM   661  O  O   . TRP A 1 134 ? 20.854  142.644 -19.981 1.00 21.09 ? 134  TRP A O   1 
ATOM   662  C  CB  . TRP A 1 134 ? 20.462  141.949 -16.783 1.00 18.85 ? 134  TRP A CB  1 
ATOM   663  C  CG  . TRP A 1 134 ? 21.100  142.486 -15.539 1.00 18.17 ? 134  TRP A CG  1 
ATOM   664  C  CD1 . TRP A 1 134 ? 20.576  142.484 -14.273 1.00 17.88 ? 134  TRP A CD1 1 
ATOM   665  C  CD2 . TRP A 1 134 ? 22.392  143.094 -15.436 1.00 18.08 ? 134  TRP A CD2 1 
ATOM   666  N  NE1 . TRP A 1 134 ? 21.466  143.047 -13.392 1.00 17.32 ? 134  TRP A NE1 1 
ATOM   667  C  CE2 . TRP A 1 134 ? 22.589  143.431 -14.077 1.00 17.50 ? 134  TRP A CE2 1 
ATOM   668  C  CE3 . TRP A 1 134 ? 23.407  143.388 -16.362 1.00 17.82 ? 134  TRP A CE3 1 
ATOM   669  C  CZ2 . TRP A 1 134 ? 23.758  144.047 -13.618 1.00 17.12 ? 134  TRP A CZ2 1 
ATOM   670  C  CZ3 . TRP A 1 134 ? 24.570  144.001 -15.905 1.00 17.65 ? 134  TRP A CZ3 1 
ATOM   671  C  CH2 . TRP A 1 134 ? 24.734  144.323 -14.541 1.00 17.48 ? 134  TRP A CH2 1 
ATOM   672  N  N   . HIS A 1 135 ? 18.845  141.777 -19.471 1.00 21.28 ? 135  HIS A N   1 
ATOM   673  C  CA  . HIS A 1 135 ? 18.667  141.196 -20.796 1.00 22.38 ? 135  HIS A CA  1 
ATOM   674  C  C   . HIS A 1 135 ? 18.629  142.294 -21.854 1.00 22.38 ? 135  HIS A C   1 
ATOM   675  O  O   . HIS A 1 135 ? 19.281  142.194 -22.895 1.00 21.96 ? 135  HIS A O   1 
ATOM   676  C  CB  . HIS A 1 135 ? 17.367  140.393 -20.876 1.00 23.71 ? 135  HIS A CB  1 
ATOM   677  C  CG  . HIS A 1 135 ? 17.066  139.880 -22.250 1.00 25.77 ? 135  HIS A CG  1 
ATOM   678  N  ND1 . HIS A 1 135 ? 17.776  138.852 -22.834 1.00 27.20 ? 135  HIS A ND1 1 
ATOM   679  C  CD2 . HIS A 1 135 ? 16.170  140.291 -23.179 1.00 26.36 ? 135  HIS A CD2 1 
ATOM   680  C  CE1 . HIS A 1 135 ? 17.332  138.654 -24.063 1.00 27.13 ? 135  HIS A CE1 1 
ATOM   681  N  NE2 . HIS A 1 135 ? 16.357  139.515 -24.297 1.00 27.21 ? 135  HIS A NE2 1 
ATOM   682  N  N   . PHE A 1 136 ? 17.857  143.342 -21.588 1.00 21.72 ? 136  PHE A N   1 
ATOM   683  C  CA  . PHE A 1 136 ? 17.748  144.437 -22.539 1.00 21.92 ? 136  PHE A CA  1 
ATOM   684  C  C   . PHE A 1 136 ? 19.099  145.123 -22.728 1.00 21.44 ? 136  PHE A C   1 
ATOM   685  O  O   . PHE A 1 136 ? 19.440  145.529 -23.838 1.00 21.18 ? 136  PHE A O   1 
ATOM   686  C  CB  . PHE A 1 136 ? 16.704  145.455 -22.074 1.00 22.49 ? 136  PHE A CB  1 
ATOM   687  C  CG  . PHE A 1 136 ? 16.323  146.452 -23.133 1.00 23.74 ? 136  PHE A CG  1 
ATOM   688  C  CD1 . PHE A 1 136 ? 15.732  146.029 -24.322 1.00 24.38 ? 136  PHE A CD1 1 
ATOM   689  C  CD2 . PHE A 1 136 ? 16.560  147.810 -22.948 1.00 23.79 ? 136  PHE A CD2 1 
ATOM   690  C  CE1 . PHE A 1 136 ? 15.380  146.948 -25.315 1.00 25.13 ? 136  PHE A CE1 1 
ATOM   691  C  CE2 . PHE A 1 136 ? 16.212  148.737 -23.936 1.00 24.62 ? 136  PHE A CE2 1 
ATOM   692  C  CZ  . PHE A 1 136 ? 15.622  148.305 -25.119 1.00 24.55 ? 136  PHE A CZ  1 
ATOM   693  N  N   . ARG A 1 137 ? 19.870  145.246 -21.649 1.00 20.80 ? 137  ARG A N   1 
ATOM   694  C  CA  . ARG A 1 137 ? 21.182  145.880 -21.737 1.00 20.74 ? 137  ARG A CA  1 
ATOM   695  C  C   . ARG A 1 137 ? 22.078  145.077 -22.676 1.00 21.11 ? 137  ARG A C   1 
ATOM   696  O  O   . ARG A 1 137 ? 22.855  145.649 -23.439 1.00 21.02 ? 137  ARG A O   1 
ATOM   697  C  CB  . ARG A 1 137 ? 21.840  145.977 -20.357 1.00 20.21 ? 137  ARG A CB  1 
ATOM   698  C  CG  . ARG A 1 137 ? 23.174  146.736 -20.363 1.00 20.16 ? 137  ARG A CG  1 
ATOM   699  C  CD  . ARG A 1 137 ? 23.798  146.805 -18.971 1.00 19.89 ? 137  ARG A CD  1 
ATOM   700  N  NE  . ARG A 1 137 ? 25.088  147.494 -18.970 1.00 19.46 ? 137  ARG A NE  1 
ATOM   701  C  CZ  . ARG A 1 137 ? 25.241  148.816 -19.006 1.00 20.54 ? 137  ARG A CZ  1 
ATOM   702  N  NH1 . ARG A 1 137 ? 24.182  149.618 -19.046 1.00 20.00 ? 137  ARG A NH1 1 
ATOM   703  N  NH2 . ARG A 1 137 ? 26.460  149.340 -19.003 1.00 20.66 ? 137  ARG A NH2 1 
ATOM   704  N  N   . ARG A 1 138 ? 21.975  143.751 -22.613 1.00 20.96 ? 138  ARG A N   1 
ATOM   705  C  CA  . ARG A 1 138 ? 22.779  142.899 -23.484 1.00 21.38 ? 138  ARG A CA  1 
ATOM   706  C  C   . ARG A 1 138 ? 22.319  143.033 -24.936 1.00 21.57 ? 138  ARG A C   1 
ATOM   707  O  O   . ARG A 1 138 ? 23.128  142.949 -25.856 1.00 21.55 ? 138  ARG A O   1 
ATOM   708  C  CB  . ARG A 1 138 ? 22.713  141.433 -23.031 1.00 20.62 ? 138  ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 138 ? 23.547  141.149 -21.782 1.00 20.08 ? 138  ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 138 ? 23.734  139.651 -21.549 1.00 19.60 ? 138  ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 138 ? 22.534  138.999 -21.034 1.00 19.85 ? 138  ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 138 ? 22.139  139.042 -19.764 1.00 19.39 ? 138  ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 138 ? 22.845  139.712 -18.861 1.00 18.57 ? 138  ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 138 ? 21.036  138.408 -19.397 1.00 19.74 ? 138  ARG A NH2 1 
ATOM   715  N  N   . VAL A 1 139 ? 21.021  143.239 -25.140 1.00 22.30 ? 139  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 139 ? 20.496  143.424 -26.492 1.00 23.27 ? 139  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 139 ? 21.089  144.720 -27.050 1.00 23.73 ? 139  VAL A C   1 
ATOM   718  O  O   . VAL A 1 139 ? 21.435  144.805 -28.230 1.00 24.18 ? 139  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 139 ? 18.949  143.545 -26.503 1.00 23.53 ? 139  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 139 ? 18.468  143.981 -27.888 1.00 23.43 ? 139  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 139 ? 18.316  142.208 -26.127 1.00 23.63 ? 139  VAL A CG2 1 
ATOM   722  N  N   . LEU A 1 140 ? 21.210  145.725 -26.188 1.00 24.20 ? 140  LEU A N   1 
ATOM   723  C  CA  . LEU A 1 140 ? 21.767  147.015 -26.580 1.00 24.57 ? 140  LEU A CA  1 
ATOM   724  C  C   . LEU A 1 140 ? 23.268  146.921 -26.849 1.00 25.02 ? 140  LEU A C   1 
ATOM   725  O  O   . LEU A 1 140 ? 23.769  147.517 -27.803 1.00 24.33 ? 140  LEU A O   1 
ATOM   726  C  CB  . LEU A 1 140 ? 21.501  148.059 -25.492 1.00 24.39 ? 140  LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 140 ? 20.032  148.443 -25.285 1.00 25.03 ? 140  LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 140 ? 19.900  149.387 -24.092 1.00 25.73 ? 140  LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 140 ? 19.491  149.096 -26.547 1.00 24.79 ? 140  LEU A CD2 1 
ATOM   730  N  N   . LEU A 1 141 ? 23.987  146.180 -26.009 1.00 25.21 ? 141  LEU A N   1 
ATOM   731  C  CA  . LEU A 1 141 ? 25.428  146.022 -26.200 1.00 26.14 ? 141  LEU A CA  1 
ATOM   732  C  C   . LEU A 1 141 ? 25.685  145.512 -27.615 1.00 26.69 ? 141  LEU A C   1 
ATOM   733  O  O   . LEU A 1 141 ? 26.611  145.957 -28.294 1.00 26.61 ? 141  LEU A O   1 
ATOM   734  C  CB  . LEU A 1 141 ? 26.001  145.027 -25.184 1.00 25.24 ? 141  LEU A CB  1 
ATOM   735  C  CG  . LEU A 1 141 ? 26.177  145.499 -23.737 1.00 25.48 ? 141  LEU A CG  1 
ATOM   736  C  CD1 . LEU A 1 141 ? 26.442  144.300 -22.828 1.00 24.69 ? 141  LEU A CD1 1 
ATOM   737  C  CD2 . LEU A 1 141 ? 27.328  146.495 -23.660 1.00 24.31 ? 141  LEU A CD2 1 
ATOM   738  N  N   . LYS A 1 142 ? 24.846  144.576 -28.044 1.00 27.64 ? 142  LYS A N   1 
ATOM   739  C  CA  . LYS A 1 142 ? 24.934  143.972 -29.368 1.00 29.03 ? 142  LYS A CA  1 
ATOM   740  C  C   . LYS A 1 142 ? 24.540  144.969 -30.461 1.00 29.11 ? 142  LYS A C   1 
ATOM   741  O  O   . LYS A 1 142 ? 25.336  145.278 -31.350 1.00 28.84 ? 142  LYS A O   1 
ATOM   742  C  CB  . LYS A 1 142 ? 24.015  142.745 -29.416 1.00 30.69 ? 142  LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 142 ? 23.893  142.041 -30.760 1.00 32.79 ? 142  LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 142 ? 25.116  141.195 -31.079 1.00 34.91 ? 142  LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 142 ? 24.789  140.112 -32.112 1.00 35.72 ? 142  LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 142 ? 24.214  140.672 -33.373 1.00 37.08 ? 142  LYS A NZ  1 
ATOM   747  N  N   . SER A 1 143 ? 23.311  145.475 -30.383 1.00 28.85 ? 143  SER A N   1 
ATOM   748  C  CA  . SER A 1 143 ? 22.797  146.425 -31.366 1.00 29.20 ? 143  SER A CA  1 
ATOM   749  C  C   . SER A 1 143 ? 23.663  147.666 -31.556 1.00 28.90 ? 143  SER A C   1 
ATOM   750  O  O   . SER A 1 143 ? 23.865  148.119 -32.681 1.00 28.76 ? 143  SER A O   1 
ATOM   751  C  CB  . SER A 1 143 ? 21.385  146.870 -30.981 1.00 29.39 ? 143  SER A CB  1 
ATOM   752  O  OG  . SER A 1 143 ? 20.495  145.771 -30.969 1.00 31.54 ? 143  SER A OG  1 
ATOM   753  N  N   . LEU A 1 144 ? 24.163  148.218 -30.456 1.00 28.47 ? 144  LEU A N   1 
ATOM   754  C  CA  . LEU A 1 144 ? 24.986  149.421 -30.511 1.00 28.40 ? 144  LEU A CA  1 
ATOM   755  C  C   . LEU A 1 144 ? 26.464  149.120 -30.711 1.00 28.97 ? 144  LEU A C   1 
ATOM   756  O  O   . LEU A 1 144 ? 27.279  150.038 -30.803 1.00 28.60 ? 144  LEU A O   1 
ATOM   757  C  CB  . LEU A 1 144 ? 24.808  150.240 -29.228 1.00 27.83 ? 144  LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 144 ? 23.393  150.748 -28.927 1.00 27.87 ? 144  LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 144 ? 23.366  151.416 -27.561 1.00 27.36 ? 144  LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 144 ? 22.955  151.725 -30.014 1.00 27.42 ? 144  LEU A CD2 1 
ATOM   761  N  N   . GLN A 1 145 ? 26.809  147.838 -30.779 1.00 29.54 ? 145  GLN A N   1 
ATOM   762  C  CA  . GLN A 1 145 ? 28.199  147.431 -30.958 1.00 30.56 ? 145  GLN A CA  1 
ATOM   763  C  C   . GLN A 1 145 ? 29.089  148.115 -29.924 1.00 30.38 ? 145  GLN A C   1 
ATOM   764  O  O   . GLN A 1 145 ? 30.127  148.692 -30.258 1.00 30.12 ? 145  GLN A O   1 
ATOM   765  C  CB  . GLN A 1 145 ? 28.675  147.776 -32.375 1.00 31.94 ? 145  GLN A CB  1 
ATOM   766  C  CG  . GLN A 1 145 ? 27.945  147.012 -33.474 1.00 34.51 ? 145  GLN A CG  1 
ATOM   767  C  CD  . GLN A 1 145 ? 28.484  147.319 -34.863 1.00 36.83 ? 145  GLN A CD  1 
ATOM   768  O  OE1 . GLN A 1 145 ? 29.672  147.131 -35.139 1.00 38.33 ? 145  GLN A OE1 1 
ATOM   769  N  NE2 . GLN A 1 145 ? 27.611  147.791 -35.747 1.00 37.68 ? 145  GLN A NE2 1 
ATOM   770  N  N   . LYS A 1 146 ? 28.676  148.039 -28.663 1.00 29.76 ? 146  LYS A N   1 
ATOM   771  C  CA  . LYS A 1 146 ? 29.420  148.651 -27.570 1.00 29.40 ? 146  LYS A CA  1 
ATOM   772  C  C   . LYS A 1 146 ? 30.736  147.928 -27.297 1.00 29.41 ? 146  LYS A C   1 
ATOM   773  O  O   . LYS A 1 146 ? 30.862  146.724 -27.532 1.00 29.41 ? 146  LYS A O   1 
ATOM   774  C  CB  . LYS A 1 146 ? 28.572  148.655 -26.294 1.00 29.35 ? 146  LYS A CB  1 
ATOM   775  C  CG  . LYS A 1 146 ? 27.211  149.326 -26.439 1.00 29.05 ? 146  LYS A CG  1 
ATOM   776  C  CD  . LYS A 1 146 ? 27.332  150.799 -26.816 1.00 29.63 ? 146  LYS A CD  1 
ATOM   777  C  CE  . LYS A 1 146 ? 28.065  151.595 -25.751 1.00 29.79 ? 146  LYS A CE  1 
ATOM   778  N  NZ  . LYS A 1 146 ? 28.127  153.048 -26.084 1.00 29.86 ? 146  LYS A NZ  1 
ATOM   779  N  N   . ASP A 1 147 ? 31.717  148.676 -26.802 1.00 29.21 ? 147  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 147 ? 33.025  148.124 -26.470 1.00 29.10 ? 147  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 147 ? 32.837  147.182 -25.282 1.00 28.42 ? 147  ASP A C   1 
ATOM   782  O  O   . ASP A 1 147 ? 32.530  147.631 -24.178 1.00 28.10 ? 147  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 147 ? 33.978  149.256 -26.089 1.00 30.14 ? 147  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 147 ? 35.392  148.775 -25.858 1.00 31.40 ? 147  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 147 ? 35.604  147.914 -24.978 1.00 31.00 ? 147  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 147 ? 36.298  149.265 -26.563 1.00 33.55 ? 147  ASP A OD2 1 
ATOM   787  N  N   . LEU A 1 148 ? 33.027  145.884 -25.507 1.00 27.80 ? 148  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 148 ? 32.839  144.895 -24.451 1.00 27.33 ? 148  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 148 ? 33.860  144.938 -23.323 1.00 27.22 ? 148  LEU A C   1 
ATOM   790  O  O   . LEU A 1 148 ? 33.573  144.497 -22.212 1.00 27.16 ? 148  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 148 ? 32.782  143.491 -25.056 1.00 26.88 ? 148  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 148 ? 31.631  143.288 -26.044 1.00 26.64 ? 148  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 148 ? 31.624  141.854 -26.546 1.00 26.05 ? 148  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 148 ? 30.306  143.629 -25.368 1.00 26.40 ? 148  LEU A CD2 1 
ATOM   795  N  N   . HIS A 1 149 ? 35.051  145.461 -23.593 1.00 27.20 ? 149  HIS A N   1 
ATOM   796  C  CA  . HIS A 1 149 ? 36.062  145.552 -22.547 1.00 27.32 ? 149  HIS A CA  1 
ATOM   797  C  C   . HIS A 1 149 ? 35.626  146.631 -21.565 1.00 27.49 ? 149  HIS A C   1 
ATOM   798  O  O   . HIS A 1 149 ? 35.881  146.541 -20.363 1.00 27.16 ? 149  HIS A O   1 
ATOM   799  C  CB  . HIS A 1 149 ? 37.430  145.882 -23.151 1.00 28.22 ? 149  HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 149 ? 38.017  144.756 -23.946 1.00 29.29 ? 149  HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 149 ? 38.354  143.545 -23.380 1.00 29.42 ? 149  HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 149 ? 38.293  144.645 -25.267 1.00 29.88 ? 149  HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 149 ? 38.812  142.735 -24.319 1.00 29.80 ? 149  HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 149 ? 38.786  143.378 -25.472 1.00 30.08 ? 149  HIS A NE2 1 
ATOM   805  N  N   . GLU A 1 150 ? 34.948  147.647 -22.084 1.00 27.63 ? 150  GLU A N   1 
ATOM   806  C  CA  . GLU A 1 150 ? 34.453  148.728 -21.245 1.00 27.99 ? 150  GLU A CA  1 
ATOM   807  C  C   . GLU A 1 150 ? 33.352  148.137 -20.357 1.00 26.74 ? 150  GLU A C   1 
ATOM   808  O  O   . GLU A 1 150 ? 33.271  148.433 -19.166 1.00 25.86 ? 150  GLU A O   1 
ATOM   809  C  CB  . GLU A 1 150 ? 33.877  149.848 -22.118 1.00 30.22 ? 150  GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 150 ? 33.849  151.216 -21.456 1.00 33.79 ? 150  GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 150 ? 35.237  151.835 -21.342 1.00 36.15 ? 150  GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 150 ? 35.342  152.985 -20.859 1.00 37.83 ? 150  GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 150 ? 36.224  151.172 -21.736 1.00 37.42 ? 150  GLU A OE2 1 
ATOM   814  N  N   . GLU A 1 151 ? 32.508  147.296 -20.948 1.00 25.84 ? 151  GLU A N   1 
ATOM   815  C  CA  . GLU A 1 151 ? 31.421  146.663 -20.204 1.00 25.62 ? 151  GLU A CA  1 
ATOM   816  C  C   . GLU A 1 151 ? 32.003  145.746 -19.122 1.00 25.53 ? 151  GLU A C   1 
ATOM   817  O  O   . GLU A 1 151 ? 31.441  145.620 -18.033 1.00 25.77 ? 151  GLU A O   1 
ATOM   818  C  CB  . GLU A 1 151 ? 30.522  145.865 -21.158 1.00 25.26 ? 151  GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 151 ? 29.288  145.235 -20.509 1.00 24.33 ? 151  GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 151 ? 28.277  146.251 -19.984 1.00 24.37 ? 151  GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 151 ? 28.518  147.473 -20.094 1.00 23.37 ? 151  GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 151 ? 27.229  145.819 -19.456 1.00 24.18 ? 151  GLU A OE2 1 
ATOM   823  N  N   . MET A 1 152 ? 33.133  145.112 -19.423 1.00 25.02 ? 152  MET A N   1 
ATOM   824  C  CA  . MET A 1 152 ? 33.782  144.235 -18.455 1.00 25.10 ? 152  MET A CA  1 
ATOM   825  C  C   . MET A 1 152 ? 34.223  145.037 -17.235 1.00 24.86 ? 152  MET A C   1 
ATOM   826  O  O   . MET A 1 152 ? 34.124  144.561 -16.104 1.00 24.62 ? 152  MET A O   1 
ATOM   827  C  CB  . MET A 1 152 ? 34.996  143.539 -19.082 1.00 25.67 ? 152  MET A CB  1 
ATOM   828  C  CG  . MET A 1 152 ? 34.668  142.261 -19.851 1.00 27.08 ? 152  MET A CG  1 
ATOM   829  S  SD  . MET A 1 152 ? 34.180  140.876 -18.762 1.00 28.06 ? 152  MET A SD  1 
ATOM   830  C  CE  . MET A 1 152 ? 35.777  140.323 -18.168 1.00 27.76 ? 152  MET A CE  1 
ATOM   831  N  N   . ASN A 1 153 ? 34.716  146.253 -17.467 1.00 24.66 ? 153  ASN A N   1 
ATOM   832  C  CA  . ASN A 1 153 ? 35.151  147.109 -16.368 1.00 24.02 ? 153  ASN A CA  1 
ATOM   833  C  C   . ASN A 1 153 ? 33.926  147.483 -15.542 1.00 23.00 ? 153  ASN A C   1 
ATOM   834  O  O   . ASN A 1 153 ? 33.998  147.622 -14.322 1.00 22.45 ? 153  ASN A O   1 
ATOM   835  C  CB  . ASN A 1 153 ? 35.817  148.386 -16.893 1.00 25.23 ? 153  ASN A CB  1 
ATOM   836  C  CG  . ASN A 1 153 ? 37.052  148.104 -17.724 1.00 26.23 ? 153  ASN A CG  1 
ATOM   837  O  OD1 . ASN A 1 153 ? 37.765  147.131 -17.488 1.00 27.59 ? 153  ASN A OD1 1 
ATOM   838  N  ND2 . ASN A 1 153 ? 37.324  148.971 -18.693 1.00 26.41 ? 153  ASN A ND2 1 
ATOM   839  N  N   . TYR A 1 154 ? 32.800  147.652 -16.223 1.00 22.05 ? 154  TYR A N   1 
ATOM   840  C  CA  . TYR A 1 154 ? 31.551  147.993 -15.559 1.00 21.87 ? 154  TYR A CA  1 
ATOM   841  C  C   . TYR A 1 154 ? 31.067  146.836 -14.682 1.00 21.38 ? 154  TYR A C   1 
ATOM   842  O  O   . TYR A 1 154 ? 30.789  147.025 -13.501 1.00 21.41 ? 154  TYR A O   1 
ATOM   843  C  CB  . TYR A 1 154 ? 30.478  148.331 -16.598 1.00 21.72 ? 154  TYR A CB  1 
ATOM   844  C  CG  . TYR A 1 154 ? 29.077  148.417 -16.028 1.00 22.32 ? 154  TYR A CG  1 
ATOM   845  C  CD1 . TYR A 1 154 ? 28.731  149.415 -15.116 1.00 21.97 ? 154  TYR A CD1 1 
ATOM   846  C  CD2 . TYR A 1 154 ? 28.094  147.500 -16.403 1.00 22.26 ? 154  TYR A CD2 1 
ATOM   847  C  CE1 . TYR A 1 154 ? 27.441  149.499 -14.593 1.00 22.14 ? 154  TYR A CE1 1 
ATOM   848  C  CE2 . TYR A 1 154 ? 26.795  147.576 -15.884 1.00 22.31 ? 154  TYR A CE2 1 
ATOM   849  C  CZ  . TYR A 1 154 ? 26.480  148.579 -14.982 1.00 22.43 ? 154  TYR A CZ  1 
ATOM   850  O  OH  . TYR A 1 154 ? 25.207  148.672 -14.469 1.00 22.27 ? 154  TYR A OH  1 
ATOM   851  N  N   . ILE A 1 155 ? 30.973  145.638 -15.258 1.00 21.19 ? 155  ILE A N   1 
ATOM   852  C  CA  . ILE A 1 155 ? 30.492  144.482 -14.504 1.00 20.57 ? 155  ILE A CA  1 
ATOM   853  C  C   . ILE A 1 155 ? 31.434  144.135 -13.354 1.00 20.99 ? 155  ILE A C   1 
ATOM   854  O  O   . ILE A 1 155 ? 31.008  143.606 -12.326 1.00 19.67 ? 155  ILE A O   1 
ATOM   855  C  CB  . ILE A 1 155 ? 30.293  143.249 -15.424 1.00 20.30 ? 155  ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 155 ? 29.376  142.229 -14.740 1.00 20.53 ? 155  ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 155 ? 31.633  142.599 -15.743 1.00 20.46 ? 155  ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 155 ? 27.991  142.766 -14.375 1.00 19.96 ? 155  ILE A CD1 1 
ATOM   859  N  N   . THR A 1 156 ? 32.715  144.452 -13.527 1.00 21.17 ? 156  THR A N   1 
ATOM   860  C  CA  . THR A 1 156 ? 33.709  144.199 -12.492 1.00 21.57 ? 156  THR A CA  1 
ATOM   861  C  C   . THR A 1 156 ? 33.360  145.023 -11.253 1.00 21.63 ? 156  THR A C   1 
ATOM   862  O  O   . THR A 1 156 ? 33.338  144.507 -10.131 1.00 21.29 ? 156  THR A O   1 
ATOM   863  C  CB  . THR A 1 156 ? 35.128  144.584 -12.977 1.00 22.24 ? 156  THR A CB  1 
ATOM   864  O  OG1 . THR A 1 156 ? 35.553  143.668 -13.995 1.00 22.19 ? 156  THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 156 ? 36.119  144.547 -11.819 1.00 21.83 ? 156  THR A CG2 1 
ATOM   866  N  N   . ALA A 1 157 ? 33.078  146.306 -11.463 1.00 21.51 ? 157  ALA A N   1 
ATOM   867  C  CA  . ALA A 1 157 ? 32.725  147.194 -10.361 1.00 21.44 ? 157  ALA A CA  1 
ATOM   868  C  C   . ALA A 1 157 ? 31.383  146.789 -9.751  1.00 21.14 ? 157  ALA A C   1 
ATOM   869  O  O   . ALA A 1 157 ? 31.205  146.831 -8.537  1.00 21.07 ? 157  ALA A O   1 
ATOM   870  C  CB  . ALA A 1 157 ? 32.664  148.638 -10.850 1.00 21.23 ? 157  ALA A CB  1 
ATOM   871  N  N   . ILE A 1 158 ? 30.443  146.394 -10.600 1.00 21.12 ? 158  ILE A N   1 
ATOM   872  C  CA  . ILE A 1 158 ? 29.119  145.986 -10.138 1.00 21.04 ? 158  ILE A CA  1 
ATOM   873  C  C   . ILE A 1 158 ? 29.178  144.759 -9.224  1.00 20.72 ? 158  ILE A C   1 
ATOM   874  O  O   . ILE A 1 158 ? 28.578  144.750 -8.147  1.00 19.91 ? 158  ILE A O   1 
ATOM   875  C  CB  . ILE A 1 158 ? 28.188  145.683 -11.334 1.00 21.35 ? 158  ILE A CB  1 
ATOM   876  C  CG1 . ILE A 1 158 ? 27.835  146.987 -12.057 1.00 22.21 ? 158  ILE A CG1 1 
ATOM   877  C  CG2 . ILE A 1 158 ? 26.924  144.972 -10.858 1.00 21.34 ? 158  ILE A CG2 1 
ATOM   878  C  CD1 . ILE A 1 158 ? 27.088  147.994 -11.197 1.00 22.58 ? 158  ILE A CD1 1 
ATOM   879  N  N   . ILE A 1 159 ? 29.900  143.729 -9.654  1.00 20.12 ? 159  ILE A N   1 
ATOM   880  C  CA  . ILE A 1 159 ? 30.019  142.511 -8.859  1.00 19.97 ? 159  ILE A CA  1 
ATOM   881  C  C   . ILE A 1 159 ? 30.734  142.781 -7.533  1.00 20.62 ? 159  ILE A C   1 
ATOM   882  O  O   . ILE A 1 159 ? 30.359  142.230 -6.499  1.00 19.95 ? 159  ILE A O   1 
ATOM   883  C  CB  . ILE A 1 159 ? 30.758  141.403 -9.650  1.00 18.89 ? 159  ILE A CB  1 
ATOM   884  C  CG1 . ILE A 1 159 ? 29.903  140.969 -10.845 1.00 18.41 ? 159  ILE A CG1 1 
ATOM   885  C  CG2 . ILE A 1 159 ? 31.043  140.208 -8.747  1.00 18.08 ? 159  ILE A CG2 1 
ATOM   886  C  CD1 . ILE A 1 159 ? 30.566  139.937 -11.747 1.00 17.72 ? 159  ILE A CD1 1 
ATOM   887  N  N   . GLU A 1 160 ? 31.758  143.632 -7.564  1.00 21.68 ? 160  GLU A N   1 
ATOM   888  C  CA  . GLU A 1 160 ? 32.491  143.977 -6.349  1.00 23.17 ? 160  GLU A CA  1 
ATOM   889  C  C   . GLU A 1 160 ? 31.507  144.525 -5.314  1.00 24.14 ? 160  GLU A C   1 
ATOM   890  O  O   . GLU A 1 160 ? 31.613  144.228 -4.128  1.00 24.65 ? 160  GLU A O   1 
ATOM   891  C  CB  . GLU A 1 160 ? 33.557  145.042 -6.639  1.00 23.25 ? 160  GLU A CB  1 
ATOM   892  C  CG  . GLU A 1 160 ? 34.803  144.550 -7.360  1.00 23.18 ? 160  GLU A CG  1 
ATOM   893  C  CD  . GLU A 1 160 ? 35.727  143.736 -6.466  1.00 23.64 ? 160  GLU A CD  1 
ATOM   894  O  OE1 . GLU A 1 160 ? 35.575  143.798 -5.225  1.00 23.65 ? 160  GLU A OE1 1 
ATOM   895  O  OE2 . GLU A 1 160 ? 36.621  143.046 -7.005  1.00 23.88 ? 160  GLU A OE2 1 
ATOM   896  N  N   . GLU A 1 161 ? 30.549  145.325 -5.776  1.00 25.10 ? 161  GLU A N   1 
ATOM   897  C  CA  . GLU A 1 161 ? 29.544  145.921 -4.897  1.00 26.41 ? 161  GLU A CA  1 
ATOM   898  C  C   . GLU A 1 161 ? 28.444  144.954 -4.466  1.00 25.98 ? 161  GLU A C   1 
ATOM   899  O  O   . GLU A 1 161 ? 28.015  144.978 -3.316  1.00 25.86 ? 161  GLU A O   1 
ATOM   900  C  CB  . GLU A 1 161 ? 28.895  147.129 -5.576  1.00 28.31 ? 161  GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 161 ? 29.798  148.345 -5.691  1.00 31.98 ? 161  GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 161 ? 29.168  149.463 -6.506  1.00 34.54 ? 161  GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 161 ? 29.759  150.566 -6.549  1.00 35.98 ? 161  GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 161 ? 28.090  149.239 -7.106  1.00 35.76 ? 161  GLU A OE2 1 
ATOM   905  N  N   . GLN A 1 162 ? 27.982  144.117 -5.392  1.00 25.22 ? 162  GLN A N   1 
ATOM   906  C  CA  . GLN A 1 162 ? 26.919  143.156 -5.098  1.00 25.39 ? 162  GLN A CA  1 
ATOM   907  C  C   . GLN A 1 162 ? 27.301  141.771 -5.619  1.00 23.90 ? 162  GLN A C   1 
ATOM   908  O  O   . GLN A 1 162 ? 26.783  141.319 -6.640  1.00 23.68 ? 162  GLN A O   1 
ATOM   909  C  CB  . GLN A 1 162 ? 25.607  143.614 -5.751  1.00 26.71 ? 162  GLN A CB  1 
ATOM   910  C  CG  . GLN A 1 162 ? 25.237  145.059 -5.425  1.00 29.26 ? 162  GLN A CG  1 
ATOM   911  C  CD  . GLN A 1 162 ? 23.857  145.447 -5.920  1.00 30.48 ? 162  GLN A CD  1 
ATOM   912  O  OE1 . GLN A 1 162 ? 22.848  144.910 -5.464  1.00 32.09 ? 162  GLN A OE1 1 
ATOM   913  N  NE2 . GLN A 1 162 ? 23.806  146.387 -6.856  1.00 31.22 ? 162  GLN A NE2 1 
ATOM   914  N  N   . PRO A 1 163 ? 28.212  141.079 -4.911  1.00 22.60 ? 163  PRO A N   1 
ATOM   915  C  CA  . PRO A 1 163 ? 28.689  139.743 -5.282  1.00 21.90 ? 163  PRO A CA  1 
ATOM   916  C  C   . PRO A 1 163 ? 27.705  138.582 -5.110  1.00 21.40 ? 163  PRO A C   1 
ATOM   917  O  O   . PRO A 1 163 ? 27.881  137.532 -5.726  1.00 21.13 ? 163  PRO A O   1 
ATOM   918  C  CB  . PRO A 1 163 ? 29.938  139.577 -4.419  1.00 21.83 ? 163  PRO A CB  1 
ATOM   919  C  CG  . PRO A 1 163 ? 29.578  140.320 -3.177  1.00 22.05 ? 163  PRO A CG  1 
ATOM   920  C  CD  . PRO A 1 163 ? 28.913  141.573 -3.712  1.00 22.84 ? 163  PRO A CD  1 
ATOM   921  N  N   . LYS A 1 164 ? 26.686  138.760 -4.273  1.00 20.40 ? 164  LYS A N   1 
ATOM   922  C  CA  . LYS A 1 164 ? 25.695  137.707 -4.055  1.00 20.24 ? 164  LYS A CA  1 
ATOM   923  C  C   . LYS A 1 164 ? 24.452  138.035 -4.869  1.00 19.91 ? 164  LYS A C   1 
ATOM   924  O  O   . LYS A 1 164 ? 23.438  138.485 -4.340  1.00 19.81 ? 164  LYS A O   1 
ATOM   925  C  CB  . LYS A 1 164 ? 25.354  137.595 -2.566  1.00 20.58 ? 164  LYS A CB  1 
ATOM   926  C  CG  . LYS A 1 164 ? 26.507  137.065 -1.718  1.00 21.33 ? 164  LYS A CG  1 
ATOM   927  C  CD  . LYS A 1 164 ? 26.029  136.641 -0.334  1.00 22.65 ? 164  LYS A CD  1 
ATOM   928  C  CE  . LYS A 1 164 ? 27.120  135.894 0.428   1.00 23.55 ? 164  LYS A CE  1 
ATOM   929  N  NZ  . LYS A 1 164 ? 26.594  135.291 1.693   1.00 24.43 ? 164  LYS A NZ  1 
ATOM   930  N  N   . ASN A 1 165 ? 24.547  137.791 -6.169  1.00 19.23 ? 165  ASN A N   1 
ATOM   931  C  CA  . ASN A 1 165 ? 23.471  138.102 -7.094  1.00 18.89 ? 165  ASN A CA  1 
ATOM   932  C  C   . ASN A 1 165 ? 23.704  137.272 -8.355  1.00 18.67 ? 165  ASN A C   1 
ATOM   933  O  O   . ASN A 1 165 ? 24.817  137.238 -8.880  1.00 18.31 ? 165  ASN A O   1 
ATOM   934  C  CB  . ASN A 1 165 ? 23.529  139.607 -7.388  1.00 18.80 ? 165  ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 165 ? 22.686  140.016 -8.568  1.00 18.94 ? 165  ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 165 ? 22.868  139.517 -9.678  1.00 19.07 ? 165  ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 165 ? 21.762  140.945 -8.340  1.00 18.10 ? 165  ASN A ND2 1 
ATOM   938  N  N   . TYR A 1 166 ? 22.661  136.598 -8.835  1.00 17.81 ? 166  TYR A N   1 
ATOM   939  C  CA  . TYR A 1 166 ? 22.781  135.754 -10.024 1.00 17.51 ? 166  TYR A CA  1 
ATOM   940  C  C   . TYR A 1 166 ? 22.986  136.504 -11.334 1.00 17.60 ? 166  TYR A C   1 
ATOM   941  O  O   . TYR A 1 166 ? 23.803  136.104 -12.162 1.00 16.98 ? 166  TYR A O   1 
ATOM   942  C  CB  . TYR A 1 166 ? 21.544  134.866 -10.189 1.00 17.18 ? 166  TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 166 ? 21.423  133.734 -9.195  1.00 16.89 ? 166  TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 166 ? 20.774  133.918 -7.973  1.00 16.46 ? 166  TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 166 ? 21.940  132.471 -9.487  1.00 16.89 ? 166  TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 166 ? 20.638  132.873 -7.066  1.00 17.12 ? 166  TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 166 ? 21.813  131.416 -8.585  1.00 17.48 ? 166  TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 166 ? 21.158  131.625 -7.377  1.00 17.16 ? 166  TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 166 ? 21.019  130.586 -6.486  1.00 17.53 ? 166  TYR A OH  1 
ATOM   950  N  N   . GLN A 1 167 ? 22.229  137.581 -11.525 1.00 17.89 ? 167  GLN A N   1 
ATOM   951  C  CA  . GLN A 1 167 ? 22.296  138.352 -12.759 1.00 17.73 ? 167  GLN A CA  1 
ATOM   952  C  C   . GLN A 1 167 ? 23.659  138.931 -13.107 1.00 17.88 ? 167  GLN A C   1 
ATOM   953  O  O   . GLN A 1 167 ? 24.076  138.862 -14.260 1.00 18.40 ? 167  GLN A O   1 
ATOM   954  C  CB  . GLN A 1 167 ? 21.265  139.483 -12.735 1.00 18.11 ? 167  GLN A CB  1 
ATOM   955  C  CG  . GLN A 1 167 ? 19.815  139.024 -12.715 1.00 17.54 ? 167  GLN A CG  1 
ATOM   956  C  CD  . GLN A 1 167 ? 19.413  138.394 -11.400 1.00 18.79 ? 167  GLN A CD  1 
ATOM   957  O  OE1 . GLN A 1 167 ? 19.767  138.885 -10.324 1.00 18.06 ? 167  GLN A OE1 1 
ATOM   958  N  NE2 . GLN A 1 167 ? 18.653  137.307 -11.476 1.00 18.72 ? 167  GLN A NE2 1 
ATOM   959  N  N   . VAL A 1 168 ? 24.355  139.498 -12.126 1.00 17.28 ? 168  VAL A N   1 
ATOM   960  C  CA  . VAL A 1 168 ? 25.657  140.104 -12.390 1.00 17.43 ? 168  VAL A CA  1 
ATOM   961  C  C   . VAL A 1 168 ? 26.713  139.096 -12.817 1.00 17.22 ? 168  VAL A C   1 
ATOM   962  O  O   . VAL A 1 168 ? 27.515  139.374 -13.713 1.00 17.18 ? 168  VAL A O   1 
ATOM   963  C  CB  . VAL A 1 168 ? 26.168  140.912 -11.166 1.00 17.41 ? 168  VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 168 ? 25.160  141.994 -10.820 1.00 16.95 ? 168  VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 168 ? 26.396  139.997 -9.970  1.00 17.93 ? 168  VAL A CG2 1 
ATOM   966  N  N   . TRP A 1 169 ? 26.718  137.924 -12.191 1.00 16.69 ? 169  TRP A N   1 
ATOM   967  C  CA  . TRP A 1 169 ? 27.692  136.913 -12.568 1.00 16.23 ? 169  TRP A CA  1 
ATOM   968  C  C   . TRP A 1 169 ? 27.375  136.348 -13.950 1.00 16.38 ? 169  TRP A C   1 
ATOM   969  O  O   . TRP A 1 169 ? 28.284  136.071 -14.727 1.00 16.07 ? 169  TRP A O   1 
ATOM   970  C  CB  . TRP A 1 169 ? 27.750  135.788 -11.532 1.00 15.63 ? 169  TRP A CB  1 
ATOM   971  C  CG  . TRP A 1 169 ? 28.494  136.175 -10.279 1.00 15.39 ? 169  TRP A CG  1 
ATOM   972  C  CD1 . TRP A 1 169 ? 27.956  136.618 -9.106  1.00 15.14 ? 169  TRP A CD1 1 
ATOM   973  C  CD2 . TRP A 1 169 ? 29.917  136.192 -10.099 1.00 15.16 ? 169  TRP A CD2 1 
ATOM   974  N  NE1 . TRP A 1 169 ? 28.951  136.906 -8.204  1.00 15.23 ? 169  TRP A NE1 1 
ATOM   975  C  CE2 . TRP A 1 169 ? 30.166  136.655 -8.787  1.00 15.04 ? 169  TRP A CE2 1 
ATOM   976  C  CE3 . TRP A 1 169 ? 31.006  135.861 -10.920 1.00 15.13 ? 169  TRP A CE3 1 
ATOM   977  C  CZ2 . TRP A 1 169 ? 31.462  136.796 -8.271  1.00 14.79 ? 169  TRP A CZ2 1 
ATOM   978  C  CZ3 . TRP A 1 169 ? 32.298  136.001 -10.409 1.00 15.01 ? 169  TRP A CZ3 1 
ATOM   979  C  CH2 . TRP A 1 169 ? 32.512  136.467 -9.093  1.00 15.06 ? 169  TRP A CH2 1 
ATOM   980  N  N   . HIS A 1 170 ? 26.092  136.184 -14.268 1.00 16.38 ? 170  HIS A N   1 
ATOM   981  C  CA  . HIS A 1 170 ? 25.742  135.662 -15.579 1.00 16.62 ? 170  HIS A CA  1 
ATOM   982  C  C   . HIS A 1 170 ? 26.122  136.653 -16.674 1.00 17.08 ? 170  HIS A C   1 
ATOM   983  O  O   . HIS A 1 170 ? 26.578  136.257 -17.745 1.00 17.50 ? 170  HIS A O   1 
ATOM   984  C  CB  . HIS A 1 170 ? 24.249  135.358 -15.694 1.00 16.41 ? 170  HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 170 ? 23.880  134.735 -17.004 1.00 16.08 ? 170  HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 170 ? 23.104  135.376 -17.946 1.00 17.06 ? 170  HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 170 ? 24.261  133.563 -17.565 1.00 15.67 ? 170  HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 170 ? 23.027  134.628 -19.032 1.00 16.57 ? 170  HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 170 ? 23.721  133.523 -18.828 1.00 16.79 ? 170  HIS A NE2 1 
ATOM   990  N  N   . HIS A 1 171 ? 25.915  137.938 -16.403 1.00 16.94 ? 171  HIS A N   1 
ATOM   991  C  CA  . HIS A 1 171 ? 26.250  138.984 -17.363 1.00 17.38 ? 171  HIS A CA  1 
ATOM   992  C  C   . HIS A 1 171 ? 27.736  138.897 -17.681 1.00 17.14 ? 171  HIS A C   1 
ATOM   993  O  O   . HIS A 1 171 ? 28.133  138.961 -18.845 1.00 17.35 ? 171  HIS A O   1 
ATOM   994  C  CB  . HIS A 1 171 ? 25.927  140.370 -16.788 1.00 17.31 ? 171  HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 171 ? 26.039  141.484 -17.786 1.00 18.19 ? 171  HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 171 ? 25.164  141.632 -18.842 1.00 18.22 ? 171  HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 171 ? 26.925  142.504 -17.888 1.00 18.19 ? 171  HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 171 ? 25.506  142.695 -19.550 1.00 18.51 ? 171  HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 171 ? 26.572  143.242 -18.993 1.00 18.56 ? 171  HIS A NE2 1 
ATOM   1000 N  N   . ARG A 1 172 ? 28.556  138.747 -16.644 1.00 17.08 ? 172  ARG A N   1 
ATOM   1001 C  CA  . ARG A 1 172 ? 29.999  138.649 -16.831 1.00 17.29 ? 172  ARG A CA  1 
ATOM   1002 C  C   . ARG A 1 172 ? 30.348  137.423 -17.668 1.00 17.68 ? 172  ARG A C   1 
ATOM   1003 O  O   . ARG A 1 172 ? 31.198  137.491 -18.553 1.00 17.66 ? 172  ARG A O   1 
ATOM   1004 C  CB  . ARG A 1 172 ? 30.725  138.566 -15.487 1.00 17.49 ? 172  ARG A CB  1 
ATOM   1005 C  CG  . ARG A 1 172 ? 32.236  138.694 -15.633 1.00 18.01 ? 172  ARG A CG  1 
ATOM   1006 C  CD  . ARG A 1 172 ? 32.986  138.469 -14.334 1.00 18.29 ? 172  ARG A CD  1 
ATOM   1007 N  NE  . ARG A 1 172 ? 34.420  138.627 -14.558 1.00 18.97 ? 172  ARG A NE  1 
ATOM   1008 C  CZ  . ARG A 1 172 ? 35.095  139.760 -14.394 1.00 19.66 ? 172  ARG A CZ  1 
ATOM   1009 N  NH1 . ARG A 1 172 ? 34.481  140.862 -13.979 1.00 19.57 ? 172  ARG A NH1 1 
ATOM   1010 N  NH2 . ARG A 1 172 ? 36.388  139.799 -14.686 1.00 19.97 ? 172  ARG A NH2 1 
ATOM   1011 N  N   . ARG A 1 173 ? 29.698  136.296 -17.390 1.00 17.91 ? 173  ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 173 ? 29.965  135.089 -18.158 1.00 18.32 ? 173  ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 173 ? 29.646  135.312 -19.637 1.00 18.44 ? 173  ARG A C   1 
ATOM   1014 O  O   . ARG A 1 173 ? 30.408  134.895 -20.505 1.00 17.95 ? 173  ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 173 ? 29.148  133.910 -17.626 1.00 18.89 ? 173  ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 173 ? 29.108  132.716 -18.580 1.00 19.02 ? 173  ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 173 ? 28.554  131.477 -17.901 1.00 19.59 ? 173  ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 173 ? 28.332  130.390 -18.850 1.00 20.14 ? 173  ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 173 ? 28.159  129.120 -18.499 1.00 20.51 ? 173  ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 173 ? 28.189  128.777 -17.217 1.00 20.30 ? 173  ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 173 ? 27.947  128.197 -19.427 1.00 20.47 ? 173  ARG A NH2 1 
ATOM   1022 N  N   . VAL A 1 174 ? 28.524  135.968 -19.922 1.00 18.47 ? 174  VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 174 ? 28.145  136.233 -21.309 1.00 19.34 ? 174  VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 174 ? 29.219  137.070 -22.003 1.00 19.87 ? 174  VAL A C   1 
ATOM   1025 O  O   . VAL A 1 174 ? 29.585  136.796 -23.147 1.00 20.49 ? 174  VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 174 ? 26.783  136.975 -21.401 1.00 19.48 ? 174  VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 174 ? 26.519  137.413 -22.842 1.00 19.57 ? 174  VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 174 ? 25.661  136.063 -20.929 1.00 18.65 ? 174  VAL A CG2 1 
ATOM   1029 N  N   . LEU A 1 175 ? 29.722  138.088 -21.309 1.00 20.09 ? 175  LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 175 ? 30.760  138.951 -21.864 1.00 20.53 ? 175  LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 175 ? 32.016  138.142 -22.175 1.00 21.57 ? 175  LEU A C   1 
ATOM   1032 O  O   . LEU A 1 175 ? 32.594  138.261 -23.259 1.00 21.98 ? 175  LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 175 ? 31.101  140.077 -20.881 1.00 19.68 ? 175  LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 175 ? 29.962  141.034 -20.506 1.00 19.20 ? 175  LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 175 ? 30.490  142.101 -19.555 1.00 18.99 ? 175  LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 175 ? 29.387  141.683 -21.764 1.00 18.95 ? 175  LEU A CD2 1 
ATOM   1037 N  N   . VAL A 1 176 ? 32.441  137.320 -21.222 1.00 21.74 ? 176  VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 176 ? 33.623  136.494 -21.418 1.00 22.61 ? 176  VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 176 ? 33.403  135.557 -22.605 1.00 23.00 ? 176  VAL A C   1 
ATOM   1040 O  O   . VAL A 1 176 ? 34.314  135.324 -23.396 1.00 22.81 ? 176  VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 176 ? 33.945  135.685 -20.141 1.00 22.88 ? 176  VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 176 ? 35.082  134.714 -20.400 1.00 22.72 ? 176  VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 176 ? 34.325  136.642 -19.020 1.00 22.57 ? 176  VAL A CG2 1 
ATOM   1044 N  N   . GLU A 1 177 ? 32.189  135.031 -22.734 1.00 23.56 ? 177  GLU A N   1 
ATOM   1045 C  CA  . GLU A 1 177 ? 31.856  134.144 -23.849 1.00 24.37 ? 177  GLU A CA  1 
ATOM   1046 C  C   . GLU A 1 177 ? 31.903  134.899 -25.182 1.00 24.63 ? 177  GLU A C   1 
ATOM   1047 O  O   . GLU A 1 177 ? 32.407  134.381 -26.181 1.00 24.19 ? 177  GLU A O   1 
ATOM   1048 C  CB  . GLU A 1 177 ? 30.459  133.545 -23.658 1.00 24.62 ? 177  GLU A CB  1 
ATOM   1049 C  CG  . GLU A 1 177 ? 30.395  132.400 -22.660 1.00 25.67 ? 177  GLU A CG  1 
ATOM   1050 C  CD  . GLU A 1 177 ? 28.971  132.003 -22.315 1.00 26.40 ? 177  GLU A CD  1 
ATOM   1051 O  OE1 . GLU A 1 177 ? 28.778  130.908 -21.744 1.00 27.49 ? 177  GLU A OE1 1 
ATOM   1052 O  OE2 . GLU A 1 177 ? 28.042  132.788 -22.602 1.00 26.56 ? 177  GLU A OE2 1 
ATOM   1053 N  N   . TRP A 1 178 ? 31.371  136.118 -25.193 1.00 24.54 ? 178  TRP A N   1 
ATOM   1054 C  CA  . TRP A 1 178 ? 31.366  136.930 -26.407 1.00 25.26 ? 178  TRP A CA  1 
ATOM   1055 C  C   . TRP A 1 178 ? 32.781  137.308 -26.821 1.00 25.38 ? 178  TRP A C   1 
ATOM   1056 O  O   . TRP A 1 178 ? 33.114  137.306 -28.005 1.00 25.16 ? 178  TRP A O   1 
ATOM   1057 C  CB  . TRP A 1 178 ? 30.559  138.214 -26.201 1.00 25.28 ? 178  TRP A CB  1 
ATOM   1058 C  CG  . TRP A 1 178 ? 29.077  138.027 -26.234 1.00 26.18 ? 178  TRP A CG  1 
ATOM   1059 C  CD1 . TRP A 1 178 ? 28.395  136.897 -26.591 1.00 26.23 ? 178  TRP A CD1 1 
ATOM   1060 C  CD2 . TRP A 1 178 ? 28.087  139.017 -25.935 1.00 26.32 ? 178  TRP A CD2 1 
ATOM   1061 N  NE1 . TRP A 1 178 ? 27.039  137.124 -26.532 1.00 26.58 ? 178  TRP A NE1 1 
ATOM   1062 C  CE2 . TRP A 1 178 ? 26.822  138.417 -26.132 1.00 26.39 ? 178  TRP A CE2 1 
ATOM   1063 C  CE3 . TRP A 1 178 ? 28.145  140.355 -25.518 1.00 26.42 ? 178  TRP A CE3 1 
ATOM   1064 C  CZ2 . TRP A 1 178 ? 25.624  139.109 -25.928 1.00 26.82 ? 178  TRP A CZ2 1 
ATOM   1065 C  CZ3 . TRP A 1 178 ? 26.950  141.045 -25.315 1.00 26.78 ? 178  TRP A CZ3 1 
ATOM   1066 C  CH2 . TRP A 1 178 ? 25.708  140.419 -25.521 1.00 26.84 ? 178  TRP A CH2 1 
ATOM   1067 N  N   . LEU A 1 179 ? 33.604  137.649 -25.838 1.00 25.32 ? 179  LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 179 ? 34.980  138.039 -26.097 1.00 26.08 ? 179  LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 179 ? 35.915  136.849 -26.245 1.00 26.81 ? 179  LEU A C   1 
ATOM   1070 O  O   . LEU A 1 179 ? 36.981  136.971 -26.847 1.00 27.47 ? 179  LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 179 ? 35.501  138.922 -24.961 1.00 25.77 ? 179  LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 179 ? 34.986  140.358 -24.849 1.00 25.61 ? 179  LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 179 ? 35.457  140.962 -23.535 1.00 25.34 ? 179  LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 179 ? 35.490  141.175 -26.032 1.00 25.27 ? 179  LEU A CD2 1 
ATOM   1075 N  N   . ARG A 1 180 ? 35.519  135.701 -25.703 1.00 27.53 ? 180  ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 180 ? 36.377  134.522 -25.744 1.00 28.71 ? 180  ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 180 ? 37.687  134.928 -25.078 1.00 28.57 ? 180  ARG A C   1 
ATOM   1078 O  O   . ARG A 1 180 ? 38.766  134.490 -25.477 1.00 29.30 ? 180  ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 180 ? 36.630  134.092 -27.192 1.00 30.13 ? 180  ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 180 ? 35.639  133.074 -27.713 1.00 31.99 ? 180  ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 180 ? 35.973  131.704 -27.156 1.00 34.45 ? 180  ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 180 ? 34.842  131.097 -26.466 1.00 36.43 ? 180  ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 180 ? 34.911  129.956 -25.788 1.00 36.67 ? 180  ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 180 ? 36.058  129.294 -25.708 1.00 36.75 ? 180  ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 180 ? 33.831  129.481 -25.186 1.00 36.98 ? 180  ARG A NH2 1 
ATOM   1086 N  N   . ASP A 1 181 ? 37.571  135.772 -24.056 1.00 28.13 ? 181  ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 181 ? 38.725  136.288 -23.325 1.00 27.86 ? 181  ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 181 ? 38.599  136.120 -21.805 1.00 27.55 ? 181  ASP A C   1 
ATOM   1089 O  O   . ASP A 1 181 ? 37.914  136.894 -21.131 1.00 26.94 ? 181  ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 181 ? 38.921  137.762 -23.686 1.00 28.53 ? 181  ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 181 ? 39.977  138.437 -22.845 1.00 29.28 ? 181  ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 181 ? 40.924  137.753 -22.405 1.00 29.56 ? 181  ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 181 ? 39.865  139.663 -22.637 1.00 30.40 ? 181  ASP A OD2 1 
ATOM   1094 N  N   . PRO A 1 182 ? 39.276  135.103 -21.249 1.00 27.12 ? 182  PRO A N   1 
ATOM   1095 C  CA  . PRO A 1 182 ? 39.265  134.795 -19.817 1.00 26.76 ? 182  PRO A CA  1 
ATOM   1096 C  C   . PRO A 1 182 ? 40.474  135.339 -19.063 1.00 26.12 ? 182  PRO A C   1 
ATOM   1097 O  O   . PRO A 1 182 ? 40.655  135.034 -17.887 1.00 25.74 ? 182  PRO A O   1 
ATOM   1098 C  CB  . PRO A 1 182 ? 39.264  133.279 -19.820 1.00 27.08 ? 182  PRO A CB  1 
ATOM   1099 C  CG  . PRO A 1 182 ? 40.278  133.002 -20.904 1.00 27.57 ? 182  PRO A CG  1 
ATOM   1100 C  CD  . PRO A 1 182 ? 39.909  134.003 -22.003 1.00 27.34 ? 182  PRO A CD  1 
ATOM   1101 N  N   . SER A 1 183 ? 41.291  136.144 -19.736 1.00 25.89 ? 183  SER A N   1 
ATOM   1102 C  CA  . SER A 1 183 ? 42.513  136.682 -19.136 1.00 25.78 ? 183  SER A CA  1 
ATOM   1103 C  C   . SER A 1 183 ? 42.387  137.418 -17.800 1.00 25.42 ? 183  SER A C   1 
ATOM   1104 O  O   . SER A 1 183 ? 43.354  137.484 -17.043 1.00 24.99 ? 183  SER A O   1 
ATOM   1105 C  CB  . SER A 1 183 ? 43.237  137.588 -20.142 1.00 25.93 ? 183  SER A CB  1 
ATOM   1106 O  OG  . SER A 1 183 ? 42.448  138.712 -20.487 1.00 27.00 ? 183  SER A OG  1 
ATOM   1107 N  N   . GLN A 1 184 ? 41.215  137.973 -17.506 1.00 25.25 ? 184  GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 184 ? 41.023  138.705 -16.252 1.00 25.00 ? 184  GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 184 ? 40.278  137.916 -15.173 1.00 24.27 ? 184  GLN A C   1 
ATOM   1110 O  O   . GLN A 1 184 ? 40.283  138.294 -14.004 1.00 23.55 ? 184  GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 184 ? 40.245  140.000 -16.514 1.00 25.87 ? 184  GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 184 ? 41.009  141.084 -17.254 1.00 27.63 ? 184  GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 184 ? 40.130  142.287 -17.561 1.00 28.63 ? 184  GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 184 ? 39.327  142.712 -16.728 1.00 29.07 ? 184  GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 184 ? 40.284  142.847 -18.755 1.00 29.47 ? 184  GLN A NE2 1 
ATOM   1116 N  N   . GLU A 1 185 ? 39.650  136.817 -15.572 1.00 23.98 ? 185  GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 185 ? 38.846  136.012 -14.662 1.00 23.41 ? 185  GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 185 ? 39.445  135.489 -13.358 1.00 23.33 ? 185  GLU A C   1 
ATOM   1119 O  O   . GLU A 1 185 ? 38.944  135.817 -12.284 1.00 22.36 ? 185  GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 185 ? 38.222  134.857 -15.442 1.00 23.58 ? 185  GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 185 ? 37.394  135.338 -16.617 1.00 23.37 ? 185  GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 185 ? 36.494  136.501 -16.239 1.00 24.17 ? 185  GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 185 ? 35.541  136.294 -15.456 1.00 23.86 ? 185  GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 185 ? 36.749  137.628 -16.718 1.00 24.07 ? 185  GLU A OE2 1 
ATOM   1125 N  N   . LEU A 1 186 ? 40.497  134.681 -13.433 1.00 23.44 ? 186  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 186 ? 41.082  134.122 -12.219 1.00 23.88 ? 186  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 186 ? 41.501  135.175 -11.203 1.00 24.13 ? 186  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 186 ? 41.308  134.995 -10.002 1.00 23.85 ? 186  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 186 ? 42.269  133.216 -12.562 1.00 24.29 ? 186  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 186 ? 41.923  131.999 -13.428 1.00 24.34 ? 186  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 186 ? 43.167  131.145 -13.623 1.00 24.80 ? 186  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 186 ? 40.812  131.181 -12.770 1.00 24.64 ? 186  LEU A CD2 1 
ATOM   1133 N  N   . GLU A 1 187 ? 42.063  136.281 -11.679 1.00 24.17 ? 187  GLU A N   1 
ATOM   1134 C  CA  . GLU A 1 187 ? 42.490  137.343 -10.779 1.00 23.97 ? 187  GLU A CA  1 
ATOM   1135 C  C   . GLU A 1 187 ? 41.288  138.064 -10.170 1.00 22.93 ? 187  GLU A C   1 
ATOM   1136 O  O   . GLU A 1 187 ? 41.268  138.362 -8.974  1.00 22.30 ? 187  GLU A O   1 
ATOM   1137 C  CB  . GLU A 1 187 ? 43.363  138.352 -11.525 1.00 25.49 ? 187  GLU A CB  1 
ATOM   1138 C  CG  . GLU A 1 187 ? 43.926  139.439 -10.634 1.00 28.82 ? 187  GLU A CG  1 
ATOM   1139 C  CD  . GLU A 1 187 ? 44.788  140.430 -11.400 1.00 30.72 ? 187  GLU A CD  1 
ATOM   1140 O  OE1 . GLU A 1 187 ? 45.738  139.991 -12.085 1.00 31.97 ? 187  GLU A OE1 1 
ATOM   1141 O  OE2 . GLU A 1 187 ? 44.516  141.648 -11.314 1.00 32.36 ? 187  GLU A OE2 1 
ATOM   1142 N  N   . PHE A 1 188 ? 40.291  138.357 -10.997 1.00 21.99 ? 188  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 188 ? 39.096  139.035 -10.510 1.00 21.39 ? 188  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 188 ? 38.384  138.175 -9.467  1.00 20.38 ? 188  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 188 ? 38.030  138.653 -8.390  1.00 19.69 ? 188  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 188 ? 38.129  139.327 -11.659 1.00 21.31 ? 188  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 188 ? 36.769  139.764 -11.196 1.00 21.71 ? 188  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 188 ? 36.585  141.014 -10.616 1.00 21.56 ? 188  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 188 ? 35.680  138.898 -11.287 1.00 21.54 ? 188  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 188 ? 35.338  141.397 -10.129 1.00 22.02 ? 188  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 188 ? 34.426  139.272 -10.803 1.00 21.30 ? 188  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 188 ? 34.256  140.522 -10.222 1.00 21.68 ? 188  PHE A CZ  1 
ATOM   1153 N  N   . ILE A 1 189 ? 38.168  136.907 -9.798  1.00 20.29 ? 189  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 189 ? 37.500  135.989 -8.882  1.00 20.14 ? 189  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 189 ? 38.276  135.910 -7.569  1.00 20.63 ? 189  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 189 ? 37.689  135.927 -6.486  1.00 20.33 ? 189  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 189 ? 37.387  134.576 -9.498  1.00 19.97 ? 189  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 189 ? 36.605  134.651 -10.812 1.00 19.35 ? 189  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 189 ? 36.701  133.625 -8.511  1.00 18.98 ? 189  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 189 ? 36.609  133.363 -11.609 1.00 20.10 ? 189  ILE A CD1 1 
ATOM   1161 N  N   . ALA A 1 190 ? 39.600  135.838 -7.671  1.00 20.75 ? 190  ALA A N   1 
ATOM   1162 C  CA  . ALA A 1 190 ? 40.447  135.765 -6.487  1.00 20.97 ? 190  ALA A CA  1 
ATOM   1163 C  C   . ALA A 1 190 ? 40.212  136.967 -5.572  1.00 21.03 ? 190  ALA A C   1 
ATOM   1164 O  O   . ALA A 1 190 ? 40.254  136.840 -4.348  1.00 21.38 ? 190  ALA A O   1 
ATOM   1165 C  CB  . ALA A 1 190 ? 41.923  135.693 -6.895  1.00 20.78 ? 190  ALA A CB  1 
ATOM   1166 N  N   . ASP A 1 191 ? 39.964  138.133 -6.161  1.00 21.10 ? 191  ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 191 ? 39.726  139.329 -5.361  1.00 21.37 ? 191  ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 191 ? 38.385  139.229 -4.639  1.00 20.77 ? 191  ASP A C   1 
ATOM   1169 O  O   . ASP A 1 191 ? 38.261  139.624 -3.479  1.00 20.06 ? 191  ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 191 ? 39.744  140.584 -6.230  1.00 22.60 ? 191  ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 191 ? 39.558  141.850 -5.413  1.00 24.28 ? 191  ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 191 ? 40.435  142.151 -4.577  1.00 25.78 ? 191  ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 191 ? 38.533  142.537 -5.593  1.00 25.51 ? 191  ASP A OD2 1 
ATOM   1174 N  N   . ILE A 1 192 ? 37.382  138.698 -5.331  1.00 20.12 ? 192  ILE A N   1 
ATOM   1175 C  CA  . ILE A 1 192 ? 36.063  138.528 -4.734  1.00 20.02 ? 192  ILE A CA  1 
ATOM   1176 C  C   . ILE A 1 192 ? 36.161  137.541 -3.579  1.00 20.26 ? 192  ILE A C   1 
ATOM   1177 O  O   . ILE A 1 192 ? 35.626  137.778 -2.496  1.00 19.99 ? 192  ILE A O   1 
ATOM   1178 C  CB  . ILE A 1 192 ? 35.045  137.990 -5.769  1.00 19.86 ? 192  ILE A CB  1 
ATOM   1179 C  CG1 . ILE A 1 192 ? 34.811  139.043 -6.852  1.00 19.19 ? 192  ILE A CG1 1 
ATOM   1180 C  CG2 . ILE A 1 192 ? 33.734  137.613 -5.075  1.00 19.57 ? 192  ILE A CG2 1 
ATOM   1181 C  CD1 . ILE A 1 192 ? 34.304  140.380 -6.312  1.00 19.49 ? 192  ILE A CD1 1 
ATOM   1182 N  N   . LEU A 1 193 ? 36.862  136.435 -3.813  1.00 20.82 ? 193  LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 193 ? 37.026  135.411 -2.792  1.00 21.35 ? 193  LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 193 ? 37.886  135.888 -1.631  1.00 22.25 ? 193  LEU A C   1 
ATOM   1185 O  O   . LEU A 1 193 ? 37.824  135.334 -0.533  1.00 21.64 ? 193  LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 193 ? 37.626  134.142 -3.406  1.00 21.15 ? 193  LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 193 ? 36.699  133.435 -4.399  1.00 21.22 ? 193  LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 193 ? 37.433  132.286 -5.082  1.00 20.91 ? 193  LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 193 ? 35.462  132.931 -3.657  1.00 20.65 ? 193  LEU A CD2 1 
ATOM   1190 N  N   . ASN A 1 194 ? 38.690  136.920 -1.866  1.00 23.40 ? 194  ASN A N   1 
ATOM   1191 C  CA  . ASN A 1 194 ? 39.530  137.444 -0.801  1.00 23.87 ? 194  ASN A CA  1 
ATOM   1192 C  C   . ASN A 1 194 ? 38.643  138.186 0.195   1.00 23.72 ? 194  ASN A C   1 
ATOM   1193 O  O   . ASN A 1 194 ? 39.022  138.388 1.349   1.00 23.66 ? 194  ASN A O   1 
ATOM   1194 C  CB  . ASN A 1 194 ? 40.593  138.391 -1.363  1.00 25.47 ? 194  ASN A CB  1 
ATOM   1195 C  CG  . ASN A 1 194 ? 41.597  138.818 -0.314  1.00 27.20 ? 194  ASN A CG  1 
ATOM   1196 O  OD1 . ASN A 1 194 ? 42.328  137.989 0.238   1.00 28.48 ? 194  ASN A OD1 1 
ATOM   1197 N  ND2 . ASN A 1 194 ? 41.637  140.114 -0.024  1.00 27.69 ? 194  ASN A ND2 1 
ATOM   1198 N  N   . GLN A 1 195 ? 37.458  138.587 -0.259  1.00 23.36 ? 195  GLN A N   1 
ATOM   1199 C  CA  . GLN A 1 195 ? 36.503  139.298 0.590   1.00 23.17 ? 195  GLN A CA  1 
ATOM   1200 C  C   . GLN A 1 195 ? 35.512  138.323 1.233   1.00 22.69 ? 195  GLN A C   1 
ATOM   1201 O  O   . GLN A 1 195 ? 35.080  138.522 2.366   1.00 22.47 ? 195  GLN A O   1 
ATOM   1202 C  CB  . GLN A 1 195 ? 35.767  140.355 -0.234  1.00 23.93 ? 195  GLN A CB  1 
ATOM   1203 C  CG  . GLN A 1 195 ? 36.698  141.450 -0.741  1.00 25.30 ? 195  GLN A CG  1 
ATOM   1204 C  CD  . GLN A 1 195 ? 36.076  142.305 -1.823  1.00 26.12 ? 195  GLN A CD  1 
ATOM   1205 O  OE1 . GLN A 1 195 ? 35.092  143.008 -1.590  1.00 26.69 ? 195  GLN A OE1 1 
ATOM   1206 N  NE2 . GLN A 1 195 ? 36.647  142.246 -3.020  1.00 26.54 ? 195  GLN A NE2 1 
ATOM   1207 N  N   . ASP A 1 196 ? 35.158  137.272 0.497   1.00 21.46 ? 196  ASP A N   1 
ATOM   1208 C  CA  . ASP A 1 196 ? 34.250  136.227 0.983   1.00 20.65 ? 196  ASP A CA  1 
ATOM   1209 C  C   . ASP A 1 196 ? 34.746  134.949 0.320   1.00 19.71 ? 196  ASP A C   1 
ATOM   1210 O  O   . ASP A 1 196 ? 34.426  134.669 -0.837  1.00 18.91 ? 196  ASP A O   1 
ATOM   1211 C  CB  . ASP A 1 196 ? 32.801  136.524 0.572   1.00 20.46 ? 196  ASP A CB  1 
ATOM   1212 C  CG  . ASP A 1 196 ? 31.832  135.417 0.979   1.00 21.61 ? 196  ASP A CG  1 
ATOM   1213 O  OD1 . ASP A 1 196 ? 30.623  135.565 0.698   1.00 22.69 ? 196  ASP A OD1 1 
ATOM   1214 O  OD2 . ASP A 1 196 ? 32.264  134.402 1.571   1.00 20.61 ? 196  ASP A OD2 1 
ATOM   1215 N  N   . ALA A 1 197 ? 35.540  134.182 1.060   1.00 18.82 ? 197  ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 197 ? 36.138  132.959 0.536   1.00 18.65 ? 197  ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 197 ? 35.166  131.841 0.177   1.00 18.52 ? 197  ALA A C   1 
ATOM   1218 O  O   . ALA A 1 197 ? 35.582  130.806 -0.347  1.00 18.30 ? 197  ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 197 ? 37.182  132.435 1.523   1.00 18.11 ? 197  ALA A CB  1 
ATOM   1220 N  N   . LYS A 1 198 ? 33.879  132.045 0.445   1.00 18.00 ? 198  LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 198 ? 32.893  131.013 0.158   1.00 17.48 ? 198  LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 198 ? 31.781  131.440 -0.806  1.00 17.53 ? 198  LYS A C   1 
ATOM   1223 O  O   . LYS A 1 198 ? 30.822  130.694 -1.021  1.00 17.24 ? 198  LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 198 ? 32.290  130.517 1.479   1.00 17.21 ? 198  LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 198 ? 33.352  130.052 2.486   1.00 17.48 ? 198  LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 198 ? 32.743  129.535 3.788   1.00 17.21 ? 198  LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 198 ? 33.825  129.019 4.740   1.00 16.98 ? 198  LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 198 ? 33.259  128.375 5.963   1.00 16.55 ? 198  LYS A NZ  1 
ATOM   1229 N  N   . ASN A 1 199 ? 31.907  132.624 -1.398  1.00 16.92 ? 199  ASN A N   1 
ATOM   1230 C  CA  . ASN A 1 199 ? 30.885  133.097 -2.330  1.00 16.98 ? 199  ASN A CA  1 
ATOM   1231 C  C   . ASN A 1 199 ? 30.615  132.004 -3.363  1.00 16.75 ? 199  ASN A C   1 
ATOM   1232 O  O   . ASN A 1 199 ? 31.494  131.638 -4.146  1.00 16.35 ? 199  ASN A O   1 
ATOM   1233 C  CB  . ASN A 1 199 ? 31.336  134.384 -3.019  1.00 17.58 ? 199  ASN A CB  1 
ATOM   1234 C  CG  . ASN A 1 199 ? 30.263  134.969 -3.907  1.00 17.71 ? 199  ASN A CG  1 
ATOM   1235 O  OD1 . ASN A 1 199 ? 29.923  134.399 -4.940  1.00 18.10 ? 199  ASN A OD1 1 
ATOM   1236 N  ND2 . ASN A 1 199 ? 29.711  136.108 -3.502  1.00 18.09 ? 199  ASN A ND2 1 
ATOM   1237 N  N   . TYR A 1 200 ? 29.391  131.487 -3.348  1.00 15.79 ? 200  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 200 ? 28.995  130.404 -4.237  1.00 15.12 ? 200  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 200 ? 29.087  130.751 -5.727  1.00 15.05 ? 200  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 200 ? 29.591  129.956 -6.515  1.00 14.29 ? 200  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 200 ? 27.573  129.953 -3.900  1.00 13.95 ? 200  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 200 ? 27.277  128.533 -4.324  1.00 14.74 ? 200  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 200 ? 27.419  127.474 -3.425  1.00 14.71 ? 200  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 200 ? 26.882  128.243 -5.630  1.00 13.46 ? 200  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 200 ? 27.172  126.156 -3.815  1.00 14.46 ? 200  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 200 ? 26.639  126.935 -6.034  1.00 14.24 ? 200  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 200 ? 26.783  125.895 -5.119  1.00 14.74 ? 200  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 200 ? 26.526  124.601 -5.508  1.00 13.84 ? 200  TYR A OH  1 
ATOM   1249 N  N   . HIS A 1 201 ? 28.593  131.927 -6.110  1.00 15.18 ? 201  HIS A N   1 
ATOM   1250 C  CA  . HIS A 1 201 ? 28.630  132.349 -7.515  1.00 15.75 ? 201  HIS A CA  1 
ATOM   1251 C  C   . HIS A 1 201 ? 30.058  132.479 -8.002  1.00 15.69 ? 201  HIS A C   1 
ATOM   1252 O  O   . HIS A 1 201 ? 30.371  132.125 -9.142  1.00 15.57 ? 201  HIS A O   1 
ATOM   1253 C  CB  . HIS A 1 201 ? 27.942  133.703 -7.702  1.00 15.65 ? 201  HIS A CB  1 
ATOM   1254 C  CG  . HIS A 1 201 ? 26.531  133.735 -7.215  1.00 15.95 ? 201  HIS A CG  1 
ATOM   1255 N  ND1 . HIS A 1 201 ? 25.499  133.108 -7.880  1.00 15.74 ? 201  HIS A ND1 1 
ATOM   1256 C  CD2 . HIS A 1 201 ? 25.986  134.292 -6.109  1.00 15.92 ? 201  HIS A CD2 1 
ATOM   1257 C  CE1 . HIS A 1 201 ? 24.378  133.276 -7.202  1.00 16.80 ? 201  HIS A CE1 1 
ATOM   1258 N  NE2 . HIS A 1 201 ? 24.647  133.990 -6.124  1.00 16.95 ? 201  HIS A NE2 1 
ATOM   1259 N  N   . ALA A 1 202 ? 30.916  133.011 -7.138  1.00 16.04 ? 202  ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 202 ? 32.317  133.201 -7.481  1.00 16.49 ? 202  ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 202 ? 32.974  131.859 -7.792  1.00 16.85 ? 202  ALA A C   1 
ATOM   1262 O  O   . ALA A 1 202 ? 33.632  131.706 -8.822  1.00 16.95 ? 202  ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 202 ? 33.046  133.904 -6.339  1.00 16.47 ? 202  ALA A CB  1 
ATOM   1264 N  N   . TRP A 1 203 ? 32.786  130.879 -6.912  1.00 16.67 ? 203  TRP A N   1 
ATOM   1265 C  CA  . TRP A 1 203 ? 33.372  129.563 -7.142  1.00 16.90 ? 203  TRP A CA  1 
ATOM   1266 C  C   . TRP A 1 203 ? 32.806  128.906 -8.400  1.00 17.28 ? 203  TRP A C   1 
ATOM   1267 O  O   . TRP A 1 203 ? 33.538  128.265 -9.158  1.00 16.88 ? 203  TRP A O   1 
ATOM   1268 C  CB  . TRP A 1 203 ? 33.145  128.651 -5.928  1.00 16.64 ? 203  TRP A CB  1 
ATOM   1269 C  CG  . TRP A 1 203 ? 34.113  128.912 -4.815  1.00 17.27 ? 203  TRP A CG  1 
ATOM   1270 C  CD1 . TRP A 1 203 ? 33.833  129.437 -3.581  1.00 16.97 ? 203  TRP A CD1 1 
ATOM   1271 C  CD2 . TRP A 1 203 ? 35.529  128.686 -4.844  1.00 16.91 ? 203  TRP A CD2 1 
ATOM   1272 N  NE1 . TRP A 1 203 ? 34.990  129.554 -2.843  1.00 16.62 ? 203  TRP A NE1 1 
ATOM   1273 C  CE2 . TRP A 1 203 ? 36.045  129.102 -3.593  1.00 17.32 ? 203  TRP A CE2 1 
ATOM   1274 C  CE3 . TRP A 1 203 ? 36.412  128.176 -5.806  1.00 16.73 ? 203  TRP A CE3 1 
ATOM   1275 C  CZ2 . TRP A 1 203 ? 37.407  129.022 -3.279  1.00 17.26 ? 203  TRP A CZ2 1 
ATOM   1276 C  CZ3 . TRP A 1 203 ? 37.770  128.097 -5.494  1.00 17.53 ? 203  TRP A CZ3 1 
ATOM   1277 C  CH2 . TRP A 1 203 ? 38.251  128.518 -4.238  1.00 17.30 ? 203  TRP A CH2 1 
ATOM   1278 N  N   . GLN A 1 204 ? 31.505  129.068 -8.625  1.00 17.18 ? 204  GLN A N   1 
ATOM   1279 C  CA  . GLN A 1 204 ? 30.865  128.473 -9.793  1.00 17.28 ? 204  GLN A CA  1 
ATOM   1280 C  C   . GLN A 1 204 ? 31.407  129.075 -11.085 1.00 17.56 ? 204  GLN A C   1 
ATOM   1281 O  O   . GLN A 1 204 ? 31.639  128.363 -12.063 1.00 17.43 ? 204  GLN A O   1 
ATOM   1282 C  CB  . GLN A 1 204 ? 29.354  128.679 -9.734  1.00 17.21 ? 204  GLN A CB  1 
ATOM   1283 C  CG  . GLN A 1 204 ? 28.586  127.916 -10.804 1.00 17.26 ? 204  GLN A CG  1 
ATOM   1284 C  CD  . GLN A 1 204 ? 27.096  127.903 -10.532 1.00 17.98 ? 204  GLN A CD  1 
ATOM   1285 O  OE1 . GLN A 1 204 ? 26.670  127.636 -9.405  1.00 18.18 ? 204  GLN A OE1 1 
ATOM   1286 N  NE2 . GLN A 1 204 ? 26.296  128.178 -11.557 1.00 16.15 ? 204  GLN A NE2 1 
ATOM   1287 N  N   . HIS A 1 205 ? 31.594  130.390 -11.082 1.00 17.44 ? 205  HIS A N   1 
ATOM   1288 C  CA  . HIS A 1 205 ? 32.113  131.094 -12.244 1.00 18.05 ? 205  HIS A CA  1 
ATOM   1289 C  C   . HIS A 1 205 ? 33.555  130.648 -12.484 1.00 18.21 ? 205  HIS A C   1 
ATOM   1290 O  O   . HIS A 1 205 ? 33.991  130.498 -13.626 1.00 17.91 ? 205  HIS A O   1 
ATOM   1291 C  CB  . HIS A 1 205 ? 32.077  132.603 -11.998 1.00 18.36 ? 205  HIS A CB  1 
ATOM   1292 C  CG  . HIS A 1 205 ? 32.439  133.423 -13.198 1.00 18.92 ? 205  HIS A CG  1 
ATOM   1293 N  ND1 . HIS A 1 205 ? 31.575  133.623 -14.252 1.00 19.66 ? 205  HIS A ND1 1 
ATOM   1294 C  CD2 . HIS A 1 205 ? 33.573  134.095 -13.509 1.00 19.30 ? 205  HIS A CD2 1 
ATOM   1295 C  CE1 . HIS A 1 205 ? 32.159  134.384 -15.161 1.00 19.78 ? 205  HIS A CE1 1 
ATOM   1296 N  NE2 . HIS A 1 205 ? 33.373  134.684 -14.733 1.00 19.70 ? 205  HIS A NE2 1 
ATOM   1297 N  N   . ARG A 1 206 ? 34.286  130.431 -11.395 1.00 18.08 ? 206  ARG A N   1 
ATOM   1298 C  CA  . ARG A 1 206 ? 35.676  130.011 -11.482 1.00 18.20 ? 206  ARG A CA  1 
ATOM   1299 C  C   . ARG A 1 206 ? 35.777  128.644 -12.153 1.00 18.43 ? 206  ARG A C   1 
ATOM   1300 O  O   . ARG A 1 206 ? 36.611  128.442 -13.042 1.00 17.89 ? 206  ARG A O   1 
ATOM   1301 C  CB  . ARG A 1 206 ? 36.305  129.970 -10.081 1.00 18.26 ? 206  ARG A CB  1 
ATOM   1302 C  CG  . ARG A 1 206 ? 37.835  130.053 -10.082 1.00 18.08 ? 206  ARG A CG  1 
ATOM   1303 C  CD  . ARG A 1 206 ? 38.425  130.045 -8.668  1.00 18.04 ? 206  ARG A CD  1 
ATOM   1304 N  NE  . ARG A 1 206 ? 39.887  130.049 -8.700  1.00 17.55 ? 206  ARG A NE  1 
ATOM   1305 C  CZ  . ARG A 1 206 ? 40.643  131.133 -8.863  1.00 18.67 ? 206  ARG A CZ  1 
ATOM   1306 N  NH1 . ARG A 1 206 ? 40.091  132.335 -8.999  1.00 17.54 ? 206  ARG A NH1 1 
ATOM   1307 N  NH2 . ARG A 1 206 ? 41.963  131.011 -8.925  1.00 17.88 ? 206  ARG A NH2 1 
ATOM   1308 N  N   . GLN A 1 207 ? 34.920  127.710 -11.741 1.00 18.25 ? 207  GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 207 ? 34.937  126.375 -12.330 1.00 18.33 ? 207  GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 207 ? 34.606  126.433 -13.817 1.00 18.89 ? 207  GLN A C   1 
ATOM   1311 O  O   . GLN A 1 207 ? 35.221  125.730 -14.624 1.00 19.00 ? 207  GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 207 ? 33.950  125.441 -11.618 1.00 18.12 ? 207  GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 207 ? 34.251  125.223 -10.138 1.00 17.45 ? 207  GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 207 ? 33.560  123.996 -9.576  1.00 17.22 ? 207  GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 207 ? 32.535  123.556 -10.099 1.00 17.32 ? 207  GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 207 ? 34.109  123.444 -8.495  1.00 16.05 ? 207  GLN A NE2 1 
ATOM   1317 N  N   . TRP A 1 208 ? 33.635  127.270 -14.179 1.00 18.84 ? 208  TRP A N   1 
ATOM   1318 C  CA  . TRP A 1 208 ? 33.249  127.398 -15.581 1.00 19.11 ? 208  TRP A CA  1 
ATOM   1319 C  C   . TRP A 1 208 ? 34.414  127.897 -16.431 1.00 19.68 ? 208  TRP A C   1 
ATOM   1320 O  O   . TRP A 1 208 ? 34.733  127.310 -17.462 1.00 19.89 ? 208  TRP A O   1 
ATOM   1321 C  CB  . TRP A 1 208 ? 32.068  128.361 -15.748 1.00 18.02 ? 208  TRP A CB  1 
ATOM   1322 C  CG  . TRP A 1 208 ? 31.830  128.694 -17.192 1.00 17.79 ? 208  TRP A CG  1 
ATOM   1323 C  CD1 . TRP A 1 208 ? 31.366  127.849 -18.167 1.00 17.46 ? 208  TRP A CD1 1 
ATOM   1324 C  CD2 . TRP A 1 208 ? 32.158  129.922 -17.850 1.00 17.70 ? 208  TRP A CD2 1 
ATOM   1325 N  NE1 . TRP A 1 208 ? 31.396  128.475 -19.390 1.00 17.32 ? 208  TRP A NE1 1 
ATOM   1326 C  CE2 . TRP A 1 208 ? 31.877  129.748 -19.224 1.00 17.78 ? 208  TRP A CE2 1 
ATOM   1327 C  CE3 . TRP A 1 208 ? 32.667  131.152 -17.414 1.00 18.23 ? 208  TRP A CE3 1 
ATOM   1328 C  CZ2 . TRP A 1 208 ? 32.089  130.761 -20.167 1.00 18.14 ? 208  TRP A CZ2 1 
ATOM   1329 C  CZ3 . TRP A 1 208 ? 32.878  132.161 -18.353 1.00 18.51 ? 208  TRP A CZ3 1 
ATOM   1330 C  CH2 . TRP A 1 208 ? 32.587  131.955 -19.715 1.00 17.62 ? 208  TRP A CH2 1 
ATOM   1331 N  N   . VAL A 1 209 ? 35.036  128.989 -15.999 1.00 20.20 ? 209  VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 209 ? 36.159  129.570 -16.728 1.00 20.97 ? 209  VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 209 ? 37.288  128.556 -16.894 1.00 21.27 ? 209  VAL A C   1 
ATOM   1334 O  O   . VAL A 1 209 ? 37.784  128.332 -18.000 1.00 20.71 ? 209  VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 209 ? 36.724  130.808 -15.995 1.00 21.18 ? 209  VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 209 ? 37.917  131.363 -16.761 1.00 22.60 ? 209  VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 209 ? 35.651  131.874 -15.865 1.00 22.26 ? 209  VAL A CG2 1 
ATOM   1338 N  N   . ILE A 1 210 ? 37.689  127.949 -15.784 1.00 21.36 ? 210  ILE A N   1 
ATOM   1339 C  CA  . ILE A 1 210 ? 38.764  126.971 -15.800 1.00 22.21 ? 210  ILE A CA  1 
ATOM   1340 C  C   . ILE A 1 210 ? 38.476  125.835 -16.766 1.00 22.86 ? 210  ILE A C   1 
ATOM   1341 O  O   . ILE A 1 210 ? 39.333  125.455 -17.563 1.00 22.14 ? 210  ILE A O   1 
ATOM   1342 C  CB  . ILE A 1 210 ? 39.006  126.396 -14.389 1.00 22.11 ? 210  ILE A CB  1 
ATOM   1343 C  CG1 . ILE A 1 210 ? 39.586  127.493 -13.491 1.00 22.10 ? 210  ILE A CG1 1 
ATOM   1344 C  CG2 . ILE A 1 210 ? 39.943  125.185 -14.461 1.00 21.85 ? 210  ILE A CG2 1 
ATOM   1345 C  CD1 . ILE A 1 210 ? 39.750  127.089 -12.034 1.00 22.70 ? 210  ILE A CD1 1 
ATOM   1346 N  N   . GLN A 1 211 ? 37.259  125.308 -16.709 1.00 23.94 ? 211  GLN A N   1 
ATOM   1347 C  CA  . GLN A 1 211 ? 36.883  124.202 -17.572 1.00 25.19 ? 211  GLN A CA  1 
ATOM   1348 C  C   . GLN A 1 211 ? 36.690  124.611 -19.032 1.00 25.22 ? 211  GLN A C   1 
ATOM   1349 O  O   . GLN A 1 211 ? 37.129  123.907 -19.942 1.00 24.74 ? 211  GLN A O   1 
ATOM   1350 C  CB  . GLN A 1 211 ? 35.612  123.537 -17.038 1.00 27.06 ? 211  GLN A CB  1 
ATOM   1351 C  CG  . GLN A 1 211 ? 35.257  122.246 -17.747 1.00 30.43 ? 211  GLN A CG  1 
ATOM   1352 C  CD  . GLN A 1 211 ? 34.575  121.249 -16.828 1.00 32.39 ? 211  GLN A CD  1 
ATOM   1353 O  OE1 . GLN A 1 211 ? 33.489  121.508 -16.300 1.00 33.77 ? 211  GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A 1 211 ? 35.213  120.099 -16.627 1.00 32.72 ? 211  GLN A NE2 1 
ATOM   1355 N  N   . GLU A 1 212 ? 36.045  125.751 -19.254 1.00 25.00 ? 212  GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 212 ? 35.796  126.225 -20.611 1.00 25.29 ? 212  GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 212 ? 37.060  126.648 -21.361 1.00 25.33 ? 212  GLU A C   1 
ATOM   1358 O  O   . GLU A 1 212 ? 37.185  126.405 -22.562 1.00 24.95 ? 212  GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 212 ? 34.809  127.397 -20.589 1.00 25.57 ? 212  GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 212 ? 34.515  127.983 -21.965 1.00 27.03 ? 212  GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 212 ? 33.801  127.008 -22.883 1.00 27.82 ? 212  GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 212 ? 33.753  127.269 -24.100 1.00 28.92 ? 212  GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 212 ? 33.280  125.985 -22.395 1.00 28.74 ? 212  GLU A OE2 1 
ATOM   1364 N  N   . PHE A 1 213 ? 37.992  127.287 -20.663 1.00 25.11 ? 213  PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 213 ? 39.217  127.743 -21.305 1.00 25.75 ? 213  PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 213 ? 40.453  126.940 -20.910 1.00 26.31 ? 213  PHE A C   1 
ATOM   1367 O  O   . PHE A 1 213 ? 41.584  127.346 -21.187 1.00 26.66 ? 213  PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 213 ? 39.433  129.233 -21.021 1.00 25.29 ? 213  PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 213 ? 38.324  130.108 -21.538 1.00 25.53 ? 213  PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 213 ? 37.181  130.331 -20.775 1.00 25.25 ? 213  PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 213 ? 38.406  130.678 -22.808 1.00 25.63 ? 213  PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 213 ? 36.131  131.108 -21.267 1.00 25.40 ? 213  PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 213 ? 37.362  131.458 -23.314 1.00 25.76 ? 213  PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 213 ? 36.221  131.673 -22.542 1.00 25.92 ? 213  PHE A CZ  1 
ATOM   1375 N  N   . LYS A 1 214 ? 40.225  125.800 -20.264 1.00 26.41 ? 214  LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 214 ? 41.299  124.900 -19.847 1.00 27.02 ? 214  LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 214 ? 42.418  125.595 -19.077 1.00 26.74 ? 214  LYS A C   1 
ATOM   1378 O  O   . LYS A 1 214 ? 43.583  125.521 -19.469 1.00 26.82 ? 214  LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 214 ? 41.897  124.203 -21.077 1.00 28.48 ? 214  LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 214 ? 40.863  123.620 -22.031 1.00 30.28 ? 214  LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 214 ? 41.521  122.948 -23.228 1.00 32.39 ? 214  LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 214 ? 40.488  122.568 -24.282 1.00 33.65 ? 214  LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 214 ? 39.405  121.711 -23.718 1.00 34.92 ? 214  LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 215 ? 42.069  126.261 -17.982 1.00 25.93 ? 215  LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 215 ? 43.058  126.957 -17.165 1.00 25.69 ? 215  LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 215 ? 43.284  126.193 -15.857 1.00 25.47 ? 215  LEU A C   1 
ATOM   1387 O  O   . LEU A 1 215 ? 43.085  126.736 -14.770 1.00 25.12 ? 215  LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 215 ? 42.573  128.379 -16.868 1.00 25.37 ? 215  LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 215 ? 42.280  129.256 -18.091 1.00 25.87 ? 215  LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 215 ? 41.725  130.595 -17.635 1.00 25.72 ? 215  LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 215 ? 43.558  129.449 -18.910 1.00 25.62 ? 215  LEU A CD2 1 
ATOM   1392 N  N   . TRP A 1 216 ? 43.717  124.939 -15.974 1.00 25.58 ? 216  TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 216 ? 43.943  124.076 -14.812 1.00 25.97 ? 216  TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 216 ? 45.303  124.196 -14.132 1.00 26.65 ? 216  TRP A C   1 
ATOM   1395 O  O   . TRP A 1 216 ? 45.436  123.909 -12.939 1.00 26.77 ? 216  TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 216 ? 43.761  122.605 -15.205 1.00 25.42 ? 216  TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 216 ? 42.484  122.300 -15.912 1.00 25.35 ? 216  TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 216 ? 42.278  122.274 -17.264 1.00 24.76 ? 216  TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 216 ? 41.223  121.999 -15.308 1.00 24.85 ? 216  TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 216 ? 40.967  121.975 -17.537 1.00 24.90 ? 216  TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 216 ? 40.295  121.802 -16.355 1.00 25.10 ? 216  TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 216 ? 40.785  121.877 -13.981 1.00 24.88 ? 216  TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 216 ? 38.950  121.490 -16.119 1.00 24.62 ? 216  TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 216 ? 39.447  121.567 -13.746 1.00 24.33 ? 216  TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 216 ? 38.546  121.378 -14.813 1.00 24.62 ? 216  TRP A CH2 1 
ATOM   1406 N  N   . ASP A 1 217 ? 46.305  124.613 -14.896 1.00 27.03 ? 217  ASP A N   1 
ATOM   1407 C  CA  . ASP A 1 217 ? 47.684  124.717 -14.425 1.00 27.48 ? 217  ASP A CA  1 
ATOM   1408 C  C   . ASP A 1 217 ? 48.007  125.191 -13.008 1.00 26.77 ? 217  ASP A C   1 
ATOM   1409 O  O   . ASP A 1 217 ? 48.839  124.582 -12.335 1.00 27.12 ? 217  ASP A O   1 
ATOM   1410 C  CB  . ASP A 1 217 ? 48.496  125.550 -15.423 1.00 29.05 ? 217  ASP A CB  1 
ATOM   1411 C  CG  . ASP A 1 217 ? 48.644  124.863 -16.775 1.00 30.51 ? 217  ASP A CG  1 
ATOM   1412 O  OD1 . ASP A 1 217 ? 49.276  125.452 -17.674 1.00 32.85 ? 217  ASP A OD1 1 
ATOM   1413 O  OD2 . ASP A 1 217 ? 48.135  123.736 -16.944 1.00 31.66 ? 217  ASP A OD2 1 
ATOM   1414 N  N   . ASN A 1 218 ? 47.372  126.258 -12.542 1.00 25.73 ? 218  ASN A N   1 
ATOM   1415 C  CA  . ASN A 1 218 ? 47.692  126.776 -11.215 1.00 24.97 ? 218  ASN A CA  1 
ATOM   1416 C  C   . ASN A 1 218 ? 46.593  126.691 -10.166 1.00 24.45 ? 218  ASN A C   1 
ATOM   1417 O  O   . ASN A 1 218 ? 46.747  127.233 -9.071  1.00 24.18 ? 218  ASN A O   1 
ATOM   1418 C  CB  . ASN A 1 218 ? 48.134  128.239 -11.334 1.00 25.61 ? 218  ASN A CB  1 
ATOM   1419 C  CG  . ASN A 1 218 ? 49.342  128.412 -12.235 1.00 26.52 ? 218  ASN A CG  1 
ATOM   1420 O  OD1 . ASN A 1 218 ? 50.434  127.945 -11.920 1.00 26.79 ? 218  ASN A OD1 1 
ATOM   1421 N  ND2 . ASN A 1 218 ? 49.147  129.077 -13.368 1.00 27.01 ? 218  ASN A ND2 1 
ATOM   1422 N  N   . GLU A 1 219 ? 45.497  126.006 -10.467 1.00 23.80 ? 219  GLU A N   1 
ATOM   1423 C  CA  . GLU A 1 219 ? 44.405  125.949 -9.502  1.00 23.25 ? 219  GLU A CA  1 
ATOM   1424 C  C   . GLU A 1 219 ? 44.667  125.127 -8.236  1.00 23.33 ? 219  GLU A C   1 
ATOM   1425 O  O   . GLU A 1 219 ? 44.139  125.454 -7.173  1.00 23.28 ? 219  GLU A O   1 
ATOM   1426 C  CB  . GLU A 1 219 ? 43.117  125.476 -10.181 1.00 22.22 ? 219  GLU A CB  1 
ATOM   1427 C  CG  . GLU A 1 219 ? 41.873  125.668 -9.320  1.00 21.15 ? 219  GLU A CG  1 
ATOM   1428 C  CD  . GLU A 1 219 ? 41.505  127.131 -9.084  1.00 20.63 ? 219  GLU A CD  1 
ATOM   1429 O  OE1 . GLU A 1 219 ? 42.319  128.033 -9.387  1.00 20.32 ? 219  GLU A OE1 1 
ATOM   1430 O  OE2 . GLU A 1 219 ? 40.388  127.379 -8.580  1.00 19.05 ? 219  GLU A OE2 1 
ATOM   1431 N  N   . LEU A 1 220 ? 45.475  124.074 -8.329  1.00 23.84 ? 220  LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 220 ? 45.761  123.274 -7.143  1.00 24.17 ? 220  LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 220 ? 46.610  124.098 -6.176  1.00 24.29 ? 220  LEU A C   1 
ATOM   1434 O  O   . LEU A 1 220 ? 46.467  123.985 -4.956  1.00 24.20 ? 220  LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 220 ? 46.485  121.976 -7.510  1.00 24.72 ? 220  LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 220 ? 46.705  121.019 -6.331  1.00 24.89 ? 220  LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 220 ? 45.366  120.676 -5.683  1.00 25.32 ? 220  LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 220 ? 47.398  119.751 -6.819  1.00 25.20 ? 220  LEU A CD2 1 
ATOM   1439 N  N   . GLN A 1 221 ? 47.491  124.929 -6.725  1.00 24.32 ? 221  GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 221 ? 48.331  125.792 -5.899  1.00 24.55 ? 221  GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 221 ? 47.409  126.791 -5.200  1.00 23.39 ? 221  GLN A C   1 
ATOM   1442 O  O   . GLN A 1 221 ? 47.593  127.104 -4.027  1.00 23.13 ? 221  GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 221 ? 49.336  126.565 -6.761  1.00 26.17 ? 221  GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 221 ? 50.312  125.703 -7.533  1.00 29.48 ? 221  GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 221 ? 51.092  126.503 -8.567  1.00 31.89 ? 221  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 221 ? 51.792  127.466 -8.229  1.00 32.78 ? 221  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 221 ? 50.970  126.112 -9.836  1.00 31.71 ? 221  GLN A NE2 1 
ATOM   1448 N  N   . TYR A 1 222 ? 46.422  127.290 -5.937  1.00 22.78 ? 222  TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 222 ? 45.465  128.251 -5.391  1.00 22.48 ? 222  TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 222 ? 44.670  127.592 -4.265  1.00 22.46 ? 222  TYR A C   1 
ATOM   1451 O  O   . TYR A 1 222 ? 44.441  128.189 -3.209  1.00 22.22 ? 222  TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 222 ? 44.510  128.728 -6.486  1.00 21.84 ? 222  TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 222 ? 43.546  129.790 -6.014  1.00 21.91 ? 222  TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 222 ? 44.014  131.011 -5.526  1.00 22.02 ? 222  TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 222 ? 42.167  129.570 -6.034  1.00 21.36 ? 222  TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 222 ? 43.134  131.986 -5.065  1.00 22.14 ? 222  TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 222 ? 41.277  130.540 -5.575  1.00 21.25 ? 222  TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 222 ? 41.769  131.744 -5.092  1.00 21.39 ? 222  TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 222 ? 40.905  132.703 -4.628  1.00 20.61 ? 222  TYR A OH  1 
ATOM   1460 N  N   . VAL A 1 223 ? 44.253  126.354 -4.506  1.00 22.16 ? 223  VAL A N   1 
ATOM   1461 C  CA  . VAL A 1 223 ? 43.507  125.590 -3.518  1.00 22.13 ? 223  VAL A CA  1 
ATOM   1462 C  C   . VAL A 1 223 ? 44.338  125.437 -2.244  1.00 22.41 ? 223  VAL A C   1 
ATOM   1463 O  O   . VAL A 1 223 ? 43.852  125.699 -1.142  1.00 21.88 ? 223  VAL A O   1 
ATOM   1464 C  CB  . VAL A 1 223 ? 43.131  124.190 -4.076  1.00 21.49 ? 223  VAL A CB  1 
ATOM   1465 C  CG1 . VAL A 1 223 ? 42.675  123.273 -2.952  1.00 20.74 ? 223  VAL A CG1 1 
ATOM   1466 C  CG2 . VAL A 1 223 ? 42.020  124.333 -5.116  1.00 20.71 ? 223  VAL A CG2 1 
ATOM   1467 N  N   . ASP A 1 224 ? 45.596  125.028 -2.398  1.00 23.40 ? 224  ASP A N   1 
ATOM   1468 C  CA  . ASP A 1 224 ? 46.473  124.845 -1.244  1.00 24.13 ? 224  ASP A CA  1 
ATOM   1469 C  C   . ASP A 1 224 ? 46.657  126.124 -0.436  1.00 24.17 ? 224  ASP A C   1 
ATOM   1470 O  O   . ASP A 1 224 ? 46.747  126.079 0.789   1.00 24.23 ? 224  ASP A O   1 
ATOM   1471 C  CB  . ASP A 1 224 ? 47.845  124.316 -1.677  1.00 25.04 ? 224  ASP A CB  1 
ATOM   1472 C  CG  . ASP A 1 224 ? 47.785  122.891 -2.185  1.00 26.06 ? 224  ASP A CG  1 
ATOM   1473 O  OD1 . ASP A 1 224 ? 46.914  122.128 -1.719  1.00 27.13 ? 224  ASP A OD1 1 
ATOM   1474 O  OD2 . ASP A 1 224 ? 48.619  122.526 -3.037  1.00 26.54 ? 224  ASP A OD2 1 
ATOM   1475 N  N   . GLN A 1 225 ? 46.715  127.266 -1.112  1.00 24.23 ? 225  GLN A N   1 
ATOM   1476 C  CA  . GLN A 1 225 ? 46.885  128.523 -0.397  1.00 24.78 ? 225  GLN A CA  1 
ATOM   1477 C  C   . GLN A 1 225 ? 45.652  128.855 0.441   1.00 24.04 ? 225  GLN A C   1 
ATOM   1478 O  O   . GLN A 1 225 ? 45.773  129.267 1.596   1.00 23.81 ? 225  GLN A O   1 
ATOM   1479 C  CB  . GLN A 1 225 ? 47.168  129.669 -1.369  1.00 26.51 ? 225  GLN A CB  1 
ATOM   1480 C  CG  . GLN A 1 225 ? 47.467  130.989 -0.667  1.00 29.41 ? 225  GLN A CG  1 
ATOM   1481 C  CD  . GLN A 1 225 ? 48.470  130.827 0.469   1.00 31.69 ? 225  GLN A CD  1 
ATOM   1482 O  OE1 . GLN A 1 225 ? 49.530  130.211 0.298   1.00 33.63 ? 225  GLN A OE1 1 
ATOM   1483 N  NE2 . GLN A 1 225 ? 48.144  131.381 1.635   1.00 31.94 ? 225  GLN A NE2 1 
ATOM   1484 N  N   . LEU A 1 226 ? 44.468  128.678 -0.137  1.00 23.18 ? 226  LEU A N   1 
ATOM   1485 C  CA  . LEU A 1 226 ? 43.237  128.967 0.589   1.00 22.93 ? 226  LEU A CA  1 
ATOM   1486 C  C   . LEU A 1 226 ? 42.999  127.988 1.740   1.00 22.61 ? 226  LEU A C   1 
ATOM   1487 O  O   . LEU A 1 226 ? 42.421  128.359 2.756   1.00 22.73 ? 226  LEU A O   1 
ATOM   1488 C  CB  . LEU A 1 226 ? 42.034  128.973 -0.363  1.00 23.02 ? 226  LEU A CB  1 
ATOM   1489 C  CG  . LEU A 1 226 ? 42.011  130.076 -1.432  1.00 24.07 ? 226  LEU A CG  1 
ATOM   1490 C  CD1 . LEU A 1 226 ? 40.608  130.182 -2.027  1.00 23.43 ? 226  LEU A CD1 1 
ATOM   1491 C  CD2 . LEU A 1 226 ? 42.412  131.411 -0.818  1.00 23.89 ? 226  LEU A CD2 1 
ATOM   1492 N  N   . LEU A 1 227 ? 43.438  126.741 1.585   1.00 22.97 ? 227  LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 227 ? 43.270  125.758 2.651   1.00 23.55 ? 227  LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 227 ? 44.201  126.104 3.806   1.00 24.40 ? 227  LEU A C   1 
ATOM   1495 O  O   . LEU A 1 227 ? 43.939  125.763 4.960   1.00 24.36 ? 227  LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 227 ? 43.563  124.345 2.145   1.00 23.42 ? 227  LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 227 ? 42.432  123.678 1.360   1.00 23.66 ? 227  LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 227 ? 42.852  122.278 0.964   1.00 24.55 ? 227  LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 227 ? 41.159  123.635 2.207   1.00 23.90 ? 227  LEU A CD2 1 
ATOM   1500 N  N   . LYS A 1 228 ? 45.293  126.789 3.485   1.00 25.07 ? 228  LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 228 ? 46.249  127.208 4.495   1.00 25.67 ? 228  LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 228 ? 45.621  128.330 5.314   1.00 24.93 ? 228  LYS A C   1 
ATOM   1503 O  O   . LYS A 1 228 ? 45.781  128.388 6.530   1.00 24.73 ? 228  LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 228 ? 47.533  127.708 3.829   1.00 27.69 ? 228  LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 228 ? 48.553  128.275 4.800   1.00 30.89 ? 228  LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 228 ? 49.006  127.222 5.798   1.00 33.48 ? 228  LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 228 ? 50.096  127.753 6.717   1.00 35.19 ? 228  LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 228 ? 50.507  126.712 7.702   1.00 36.22 ? 228  LYS A NZ  1 
ATOM   1509 N  N   . GLU A 1 229 ? 44.902  129.219 4.637   1.00 24.19 ? 229  GLU A N   1 
ATOM   1510 C  CA  . GLU A 1 229 ? 44.251  130.341 5.305   1.00 24.19 ? 229  GLU A CA  1 
ATOM   1511 C  C   . GLU A 1 229 ? 43.072  129.863 6.161   1.00 23.03 ? 229  GLU A C   1 
ATOM   1512 O  O   . GLU A 1 229 ? 42.852  130.367 7.260   1.00 22.94 ? 229  GLU A O   1 
ATOM   1513 C  CB  . GLU A 1 229 ? 43.786  131.370 4.265   1.00 25.40 ? 229  GLU A CB  1 
ATOM   1514 C  CG  . GLU A 1 229 ? 44.855  131.695 3.224   1.00 27.37 ? 229  GLU A CG  1 
ATOM   1515 C  CD  . GLU A 1 229 ? 44.485  132.852 2.316   1.00 28.73 ? 229  GLU A CD  1 
ATOM   1516 O  OE1 . GLU A 1 229 ? 43.291  133.001 1.981   1.00 28.56 ? 229  GLU A OE1 1 
ATOM   1517 O  OE2 . GLU A 1 229 ? 45.400  133.606 1.923   1.00 29.99 ? 229  GLU A OE2 1 
ATOM   1518 N  N   . ASP A 1 230 ? 42.318  128.892 5.655   1.00 21.62 ? 230  ASP A N   1 
ATOM   1519 C  CA  . ASP A 1 230 ? 41.186  128.337 6.395   1.00 20.62 ? 230  ASP A CA  1 
ATOM   1520 C  C   . ASP A 1 230 ? 40.936  126.916 5.901   1.00 20.07 ? 230  ASP A C   1 
ATOM   1521 O  O   . ASP A 1 230 ? 40.269  126.708 4.886   1.00 19.33 ? 230  ASP A O   1 
ATOM   1522 C  CB  . ASP A 1 230 ? 39.926  129.185 6.194   1.00 20.02 ? 230  ASP A CB  1 
ATOM   1523 C  CG  . ASP A 1 230 ? 38.792  128.777 7.128   1.00 20.34 ? 230  ASP A CG  1 
ATOM   1524 O  OD1 . ASP A 1 230 ? 38.892  127.693 7.746   1.00 20.17 ? 230  ASP A OD1 1 
ATOM   1525 O  OD2 . ASP A 1 230 ? 37.800  129.532 7.238   1.00 19.72 ? 230  ASP A OD2 1 
ATOM   1526 N  N   . VAL A 1 231 ? 41.488  125.949 6.631   1.00 19.32 ? 231  VAL A N   1 
ATOM   1527 C  CA  . VAL A 1 231 ? 41.367  124.543 6.287   1.00 19.44 ? 231  VAL A CA  1 
ATOM   1528 C  C   . VAL A 1 231 ? 39.931  124.035 6.421   1.00 19.25 ? 231  VAL A C   1 
ATOM   1529 O  O   . VAL A 1 231 ? 39.616  122.926 5.993   1.00 18.91 ? 231  VAL A O   1 
ATOM   1530 C  CB  . VAL A 1 231 ? 42.320  123.686 7.170   1.00 19.93 ? 231  VAL A CB  1 
ATOM   1531 C  CG1 . VAL A 1 231 ? 41.825  123.658 8.613   1.00 19.32 ? 231  VAL A CG1 1 
ATOM   1532 C  CG2 . VAL A 1 231 ? 42.445  122.284 6.599   1.00 19.75 ? 231  VAL A CG2 1 
ATOM   1533 N  N   . ARG A 1 232 ? 39.064  124.857 7.007   1.00 18.74 ? 232  ARG A N   1 
ATOM   1534 C  CA  . ARG A 1 232 ? 37.659  124.496 7.184   1.00 18.78 ? 232  ARG A CA  1 
ATOM   1535 C  C   . ARG A 1 232 ? 36.787  125.013 6.041   1.00 18.70 ? 232  ARG A C   1 
ATOM   1536 O  O   . ARG A 1 232 ? 35.568  124.842 6.068   1.00 18.92 ? 232  ARG A O   1 
ATOM   1537 C  CB  . ARG A 1 232 ? 37.112  125.070 8.494   1.00 17.92 ? 232  ARG A CB  1 
ATOM   1538 C  CG  . ARG A 1 232 ? 37.781  124.567 9.767   1.00 18.21 ? 232  ARG A CG  1 
ATOM   1539 C  CD  . ARG A 1 232 ? 37.064  125.136 10.984  1.00 17.22 ? 232  ARG A CD  1 
ATOM   1540 N  NE  . ARG A 1 232 ? 37.574  124.621 12.256  1.00 17.27 ? 232  ARG A NE  1 
ATOM   1541 C  CZ  . ARG A 1 232 ? 38.622  125.118 12.909  1.00 17.56 ? 232  ARG A CZ  1 
ATOM   1542 N  NH1 . ARG A 1 232 ? 39.294  126.153 12.413  1.00 16.49 ? 232  ARG A NH1 1 
ATOM   1543 N  NH2 . ARG A 1 232 ? 38.982  124.596 14.077  1.00 16.85 ? 232  ARG A NH2 1 
ATOM   1544 N  N   . ASN A 1 233 ? 37.399  125.656 5.050   1.00 18.39 ? 233  ASN A N   1 
ATOM   1545 C  CA  . ASN A 1 233 ? 36.635  126.202 3.933   1.00 18.05 ? 233  ASN A CA  1 
ATOM   1546 C  C   . ASN A 1 233 ? 36.190  125.082 3.001   1.00 17.67 ? 233  ASN A C   1 
ATOM   1547 O  O   . ASN A 1 233 ? 36.948  124.634 2.136   1.00 17.20 ? 233  ASN A O   1 
ATOM   1548 C  CB  . ASN A 1 233 ? 37.472  127.222 3.160   1.00 18.29 ? 233  ASN A CB  1 
ATOM   1549 C  CG  . ASN A 1 233 ? 36.662  127.957 2.116   1.00 18.71 ? 233  ASN A CG  1 
ATOM   1550 O  OD1 . ASN A 1 233 ? 35.689  127.422 1.582   1.00 18.39 ? 233  ASN A OD1 1 
ATOM   1551 N  ND2 . ASN A 1 233 ? 37.063  129.183 1.809   1.00 18.33 ? 233  ASN A ND2 1 
ATOM   1552 N  N   . ASN A 1 234 ? 34.946  124.645 3.178   1.00 17.02 ? 234  ASN A N   1 
ATOM   1553 C  CA  . ASN A 1 234 ? 34.393  123.552 2.387   1.00 16.26 ? 234  ASN A CA  1 
ATOM   1554 C  C   . ASN A 1 234 ? 34.378  123.826 0.880   1.00 16.28 ? 234  ASN A C   1 
ATOM   1555 O  O   . ASN A 1 234 ? 34.485  122.900 0.077   1.00 16.00 ? 234  ASN A O   1 
ATOM   1556 C  CB  . ASN A 1 234 ? 32.980  123.227 2.875   1.00 16.22 ? 234  ASN A CB  1 
ATOM   1557 C  CG  . ASN A 1 234 ? 32.512  121.862 2.421   1.00 16.66 ? 234  ASN A CG  1 
ATOM   1558 O  OD1 . ASN A 1 234 ? 33.079  120.838 2.813   1.00 16.05 ? 234  ASN A OD1 1 
ATOM   1559 N  ND2 . ASN A 1 234 ? 31.481  121.838 1.585   1.00 14.99 ? 234  ASN A ND2 1 
ATOM   1560 N  N   . SER A 1 235 ? 34.245  125.093 0.497   1.00 15.93 ? 235  SER A N   1 
ATOM   1561 C  CA  . SER A 1 235 ? 34.235  125.450 -0.919  1.00 16.08 ? 235  SER A CA  1 
ATOM   1562 C  C   . SER A 1 235 ? 35.583  125.130 -1.561  1.00 16.37 ? 235  SER A C   1 
ATOM   1563 O  O   . SER A 1 235 ? 35.661  124.827 -2.753  1.00 16.30 ? 235  SER A O   1 
ATOM   1564 C  CB  . SER A 1 235 ? 33.941  126.943 -1.096  1.00 15.11 ? 235  SER A CB  1 
ATOM   1565 O  OG  . SER A 1 235 ? 32.645  127.270 -0.631  1.00 14.73 ? 235  SER A OG  1 
ATOM   1566 N  N   . VAL A 1 236 ? 36.645  125.214 -0.767  1.00 16.74 ? 236  VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 236 ? 37.988  124.942 -1.266  1.00 17.51 ? 236  VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 236 ? 38.239  123.442 -1.402  1.00 17.26 ? 236  VAL A C   1 
ATOM   1569 O  O   . VAL A 1 236 ? 38.896  123.004 -2.347  1.00 17.16 ? 236  VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 236 ? 39.051  125.586 -0.351  1.00 17.80 ? 236  VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 236 ? 40.447  125.336 -0.905  1.00 18.28 ? 236  VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 236 ? 38.792  127.089 -0.258  1.00 18.64 ? 236  VAL A CG2 1 
ATOM   1573 N  N   . TRP A 1 237 ? 37.724  122.652 -0.463  1.00 16.54 ? 237  TRP A N   1 
ATOM   1574 C  CA  . TRP A 1 237 ? 37.886  121.208 -0.561  1.00 16.89 ? 237  TRP A CA  1 
ATOM   1575 C  C   . TRP A 1 237 ? 37.120  120.749 -1.798  1.00 16.53 ? 237  TRP A C   1 
ATOM   1576 O  O   . TRP A 1 237 ? 37.526  119.814 -2.486  1.00 16.51 ? 237  TRP A O   1 
ATOM   1577 C  CB  . TRP A 1 237 ? 37.334  120.496 0.682   1.00 16.92 ? 237  TRP A CB  1 
ATOM   1578 C  CG  . TRP A 1 237 ? 38.229  120.597 1.888   1.00 17.27 ? 237  TRP A CG  1 
ATOM   1579 C  CD1 . TRP A 1 237 ? 38.118  121.480 2.920   1.00 17.06 ? 237  TRP A CD1 1 
ATOM   1580 C  CD2 . TRP A 1 237 ? 39.378  119.785 2.174   1.00 17.20 ? 237  TRP A CD2 1 
ATOM   1581 N  NE1 . TRP A 1 237 ? 39.124  121.270 3.836   1.00 17.72 ? 237  TRP A NE1 1 
ATOM   1582 C  CE2 . TRP A 1 237 ? 39.911  120.235 3.402   1.00 17.55 ? 237  TRP A CE2 1 
ATOM   1583 C  CE3 . TRP A 1 237 ? 40.007  118.721 1.512   1.00 17.44 ? 237  TRP A CE3 1 
ATOM   1584 C  CZ2 . TRP A 1 237 ? 41.048  119.658 3.986   1.00 18.03 ? 237  TRP A CZ2 1 
ATOM   1585 C  CZ3 . TRP A 1 237 ? 41.139  118.144 2.094   1.00 17.93 ? 237  TRP A CZ3 1 
ATOM   1586 C  CH2 . TRP A 1 237 ? 41.645  118.617 3.320   1.00 17.81 ? 237  TRP A CH2 1 
ATOM   1587 N  N   . ASN A 1 238 ? 36.004  121.413 -2.082  1.00 16.71 ? 238  ASN A N   1 
ATOM   1588 C  CA  . ASN A 1 238 ? 35.217  121.058 -3.253  1.00 17.23 ? 238  ASN A CA  1 
ATOM   1589 C  C   . ASN A 1 238 ? 36.018  121.367 -4.513  1.00 17.11 ? 238  ASN A C   1 
ATOM   1590 O  O   . ASN A 1 238 ? 36.027  120.585 -5.459  1.00 17.25 ? 238  ASN A O   1 
ATOM   1591 C  CB  . ASN A 1 238 ? 33.911  121.844 -3.300  1.00 17.40 ? 238  ASN A CB  1 
ATOM   1592 C  CG  . ASN A 1 238 ? 33.068  121.472 -4.499  1.00 17.63 ? 238  ASN A CG  1 
ATOM   1593 O  OD1 . ASN A 1 238 ? 32.552  120.357 -4.581  1.00 17.62 ? 238  ASN A OD1 1 
ATOM   1594 N  ND2 . ASN A 1 238 ? 32.941  122.395 -5.448  1.00 17.11 ? 238  ASN A ND2 1 
ATOM   1595 N  N   . GLN A 1 239 ? 36.674  122.522 -4.525  1.00 17.46 ? 239  GLN A N   1 
ATOM   1596 C  CA  . GLN A 1 239 ? 37.482  122.919 -5.671  1.00 17.56 ? 239  GLN A CA  1 
ATOM   1597 C  C   . GLN A 1 239 ? 38.630  121.930 -5.836  1.00 17.69 ? 239  GLN A C   1 
ATOM   1598 O  O   . GLN A 1 239 ? 39.047  121.633 -6.950  1.00 17.82 ? 239  GLN A O   1 
ATOM   1599 C  CB  . GLN A 1 239 ? 38.045  124.323 -5.462  1.00 18.42 ? 239  GLN A CB  1 
ATOM   1600 C  CG  . GLN A 1 239 ? 38.685  124.950 -6.704  1.00 18.71 ? 239  GLN A CG  1 
ATOM   1601 C  CD  . GLN A 1 239 ? 37.667  125.354 -7.764  1.00 19.40 ? 239  GLN A CD  1 
ATOM   1602 O  OE1 . GLN A 1 239 ? 38.006  126.034 -8.740  1.00 20.92 ? 239  GLN A OE1 1 
ATOM   1603 N  NE2 . GLN A 1 239 ? 36.420  124.940 -7.581  1.00 18.60 ? 239  GLN A NE2 1 
ATOM   1604 N  N   . ARG A 1 240 ? 39.137  121.418 -4.718  1.00 18.00 ? 240  ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 240 ? 40.237  120.465 -4.767  1.00 18.07 ? 240  ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 240 ? 39.803  119.220 -5.537  1.00 18.06 ? 240  ARG A C   1 
ATOM   1607 O  O   . ARG A 1 240 ? 40.522  118.741 -6.417  1.00 17.99 ? 240  ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 240 ? 40.684  120.074 -3.355  1.00 18.28 ? 240  ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 240 ? 42.019  119.331 -3.346  1.00 18.83 ? 240  ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 240 ? 42.457  118.889 -1.958  1.00 19.74 ? 240  ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 240 ? 43.798  118.316 -2.031  1.00 21.24 ? 240  ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 240 ? 44.911  119.039 -2.096  1.00 21.28 ? 240  ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 240 ? 44.845  120.363 -2.076  1.00 20.94 ? 240  ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 240 ? 46.085  118.439 -2.221  1.00 21.47 ? 240  ARG A NH2 1 
ATOM   1615 N  N   . TYR A 1 241 ? 38.619  118.703 -5.212  1.00 17.71 ? 241  TYR A N   1 
ATOM   1616 C  CA  . TYR A 1 241 ? 38.102  117.521 -5.888  1.00 17.37 ? 241  TYR A CA  1 
ATOM   1617 C  C   . TYR A 1 241 ? 37.868  117.853 -7.359  1.00 17.47 ? 241  TYR A C   1 
ATOM   1618 O  O   . TYR A 1 241 ? 38.156  117.048 -8.248  1.00 16.83 ? 241  TYR A O   1 
ATOM   1619 C  CB  . TYR A 1 241 ? 36.778  117.060 -5.263  1.00 17.87 ? 241  TYR A CB  1 
ATOM   1620 C  CG  . TYR A 1 241 ? 36.315  115.734 -5.823  1.00 18.63 ? 241  TYR A CG  1 
ATOM   1621 C  CD1 . TYR A 1 241 ? 36.673  114.535 -5.207  1.00 18.52 ? 241  TYR A CD1 1 
ATOM   1622 C  CD2 . TYR A 1 241 ? 35.609  115.672 -7.025  1.00 18.82 ? 241  TYR A CD2 1 
ATOM   1623 C  CE1 . TYR A 1 241 ? 36.349  113.305 -5.778  1.00 19.39 ? 241  TYR A CE1 1 
ATOM   1624 C  CE2 . TYR A 1 241 ? 35.283  114.446 -7.606  1.00 19.63 ? 241  TYR A CE2 1 
ATOM   1625 C  CZ  . TYR A 1 241 ? 35.661  113.270 -6.975  1.00 19.50 ? 241  TYR A CZ  1 
ATOM   1626 O  OH  . TYR A 1 241 ? 35.373  112.060 -7.554  1.00 20.70 ? 241  TYR A OH  1 
ATOM   1627 N  N   . PHE A 1 242 ? 37.330  119.042 -7.602  1.00 17.34 ? 242  PHE A N   1 
ATOM   1628 C  CA  . PHE A 1 242 ? 37.053  119.506 -8.955  1.00 18.36 ? 242  PHE A CA  1 
ATOM   1629 C  C   . PHE A 1 242 ? 38.329  119.478 -9.802  1.00 18.52 ? 242  PHE A C   1 
ATOM   1630 O  O   . PHE A 1 242 ? 38.348  118.926 -10.901 1.00 18.53 ? 242  PHE A O   1 
ATOM   1631 C  CB  . PHE A 1 242 ? 36.490  120.931 -8.893  1.00 19.06 ? 242  PHE A CB  1 
ATOM   1632 C  CG  . PHE A 1 242 ? 36.357  121.597 -10.233 1.00 20.01 ? 242  PHE A CG  1 
ATOM   1633 C  CD1 . PHE A 1 242 ? 35.390  121.178 -11.144 1.00 20.12 ? 242  PHE A CD1 1 
ATOM   1634 C  CD2 . PHE A 1 242 ? 37.206  122.642 -10.586 1.00 19.70 ? 242  PHE A CD2 1 
ATOM   1635 C  CE1 . PHE A 1 242 ? 35.270  121.795 -12.392 1.00 20.68 ? 242  PHE A CE1 1 
ATOM   1636 C  CE2 . PHE A 1 242 ? 37.096  123.266 -11.830 1.00 20.37 ? 242  PHE A CE2 1 
ATOM   1637 C  CZ  . PHE A 1 242 ? 36.127  122.842 -12.734 1.00 20.05 ? 242  PHE A CZ  1 
ATOM   1638 N  N   . VAL A 1 243 ? 39.397  120.063 -9.274  1.00 19.23 ? 243  VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 243 ? 40.670  120.125 -9.988  1.00 20.06 ? 243  VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 243 ? 41.290  118.759 -10.275 1.00 20.64 ? 243  VAL A C   1 
ATOM   1641 O  O   . VAL A 1 243 ? 41.619  118.442 -11.419 1.00 20.67 ? 243  VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 243 ? 41.701  120.974 -9.206  1.00 20.17 ? 243  VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 243 ? 43.049  120.968 -9.930  1.00 19.99 ? 243  VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 243 ? 41.195  122.401 -9.065  1.00 20.18 ? 243  VAL A CG2 1 
ATOM   1645 N  N   . ILE A 1 244 ? 41.444  117.950 -9.235  1.00 21.11 ? 244  ILE A N   1 
ATOM   1646 C  CA  . ILE A 1 244 ? 42.057  116.636 -9.382  1.00 22.02 ? 244  ILE A CA  1 
ATOM   1647 C  C   . ILE A 1 244 ? 41.277  115.682 -10.277 1.00 22.73 ? 244  ILE A C   1 
ATOM   1648 O  O   . ILE A 1 244 ? 41.864  115.018 -11.134 1.00 22.91 ? 244  ILE A O   1 
ATOM   1649 C  CB  . ILE A 1 244 ? 42.276  115.985 -8.006  1.00 21.92 ? 244  ILE A CB  1 
ATOM   1650 C  CG1 . ILE A 1 244 ? 43.248  116.844 -7.190  1.00 21.85 ? 244  ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A 1 244 ? 42.811  114.561 -8.178  1.00 22.03 ? 244  ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A 1 244 ? 43.377  116.434 -5.737  1.00 21.72 ? 244  ILE A CD1 1 
ATOM   1653 N  N   . SER A 1 245 ? 39.962  115.617 -10.093 1.00 23.18 ? 245  SER A N   1 
ATOM   1654 C  CA  . SER A 1 245 ? 39.142  114.719 -10.900 1.00 24.13 ? 245  SER A CA  1 
ATOM   1655 C  C   . SER A 1 245 ? 39.178  115.083 -12.380 1.00 24.53 ? 245  SER A C   1 
ATOM   1656 O  O   . SER A 1 245 ? 39.015  114.216 -13.241 1.00 24.53 ? 245  SER A O   1 
ATOM   1657 C  CB  . SER A 1 245 ? 37.687  114.730 -10.415 1.00 24.10 ? 245  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 245 ? 37.072  115.983 -10.663 1.00 25.26 ? 245  SER A OG  1 
ATOM   1659 N  N   . ASN A 1 246 ? 39.393  116.361 -12.678 1.00 24.69 ? 246  ASN A N   1 
ATOM   1660 C  CA  . ASN A 1 246 ? 39.430  116.808 -14.065 1.00 25.01 ? 246  ASN A CA  1 
ATOM   1661 C  C   . ASN A 1 246 ? 40.818  116.872 -14.689 1.00 25.19 ? 246  ASN A C   1 
ATOM   1662 O  O   . ASN A 1 246 ? 40.949  117.112 -15.891 1.00 25.14 ? 246  ASN A O   1 
ATOM   1663 C  CB  . ASN A 1 246 ? 38.750  118.168 -14.206 1.00 25.16 ? 246  ASN A CB  1 
ATOM   1664 C  CG  . ASN A 1 246 ? 37.248  118.076 -14.094 1.00 25.50 ? 246  ASN A CG  1 
ATOM   1665 O  OD1 . ASN A 1 246 ? 36.673  118.296 -13.026 1.00 25.33 ? 246  ASN A OD1 1 
ATOM   1666 N  ND2 . ASN A 1 246 ? 36.600  117.735 -15.198 1.00 25.20 ? 246  ASN A ND2 1 
ATOM   1667 N  N   . THR A 1 247 ? 41.853  116.668 -13.881 1.00 25.39 ? 247  THR A N   1 
ATOM   1668 C  CA  . THR A 1 247 ? 43.215  116.693 -14.393 1.00 25.80 ? 247  THR A CA  1 
ATOM   1669 C  C   . THR A 1 247 ? 43.808  115.283 -14.407 1.00 26.24 ? 247  THR A C   1 
ATOM   1670 O  O   . THR A 1 247 ? 43.745  114.592 -15.422 1.00 26.38 ? 247  THR A O   1 
ATOM   1671 C  CB  . THR A 1 247 ? 44.116  117.632 -13.562 1.00 25.42 ? 247  THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 247 ? 43.982  117.328 -12.170 1.00 25.73 ? 247  THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 247 ? 43.731  119.089 -13.806 1.00 25.58 ? 247  THR A CG2 1 
ATOM   1674 N  N   . THR A 1 248 ? 44.363  114.854 -13.279 1.00 26.38 ? 248  THR A N   1 
ATOM   1675 C  CA  . THR A 1 248 ? 44.962  113.527 -13.178 1.00 26.50 ? 248  THR A CA  1 
ATOM   1676 C  C   . THR A 1 248 ? 43.933  112.441 -12.892 1.00 26.62 ? 248  THR A C   1 
ATOM   1677 O  O   . THR A 1 248 ? 44.111  111.287 -13.285 1.00 26.42 ? 248  THR A O   1 
ATOM   1678 C  CB  . THR A 1 248 ? 46.004  113.474 -12.049 1.00 26.78 ? 248  THR A CB  1 
ATOM   1679 O  OG1 . THR A 1 248 ? 45.369  113.802 -10.806 1.00 27.46 ? 248  THR A OG1 1 
ATOM   1680 C  CG2 . THR A 1 248 ? 47.137  114.459 -12.311 1.00 26.92 ? 248  THR A CG2 1 
ATOM   1681 N  N   . GLY A 1 249 ? 42.856  112.814 -12.208 1.00 26.40 ? 249  GLY A N   1 
ATOM   1682 C  CA  . GLY A 1 249 ? 41.842  111.844 -11.846 1.00 25.78 ? 249  GLY A CA  1 
ATOM   1683 C  C   . GLY A 1 249 ? 42.322  111.193 -10.563 1.00 25.72 ? 249  GLY A C   1 
ATOM   1684 O  O   . GLY A 1 249 ? 43.444  111.454 -10.129 1.00 25.73 ? 249  GLY A O   1 
ATOM   1685 N  N   . TYR A 1 250 ? 41.493  110.355 -9.950  1.00 25.96 ? 250  TYR A N   1 
ATOM   1686 C  CA  . TYR A 1 250 ? 41.883  109.683 -8.713  1.00 26.60 ? 250  TYR A CA  1 
ATOM   1687 C  C   . TYR A 1 250 ? 42.262  108.215 -8.912  1.00 27.54 ? 250  TYR A C   1 
ATOM   1688 O  O   . TYR A 1 250 ? 42.599  107.527 -7.948  1.00 26.83 ? 250  TYR A O   1 
ATOM   1689 C  CB  . TYR A 1 250 ? 40.762  109.767 -7.671  1.00 25.21 ? 250  TYR A CB  1 
ATOM   1690 C  CG  . TYR A 1 250 ? 40.577  111.140 -7.066  1.00 24.16 ? 250  TYR A CG  1 
ATOM   1691 C  CD1 . TYR A 1 250 ? 39.708  112.069 -7.637  1.00 23.28 ? 250  TYR A CD1 1 
ATOM   1692 C  CD2 . TYR A 1 250 ? 41.278  111.511 -5.919  1.00 23.35 ? 250  TYR A CD2 1 
ATOM   1693 C  CE1 . TYR A 1 250 ? 39.538  113.334 -7.075  1.00 23.01 ? 250  TYR A CE1 1 
ATOM   1694 C  CE2 . TYR A 1 250 ? 41.118  112.769 -5.352  1.00 23.01 ? 250  TYR A CE2 1 
ATOM   1695 C  CZ  . TYR A 1 250 ? 40.246  113.674 -5.933  1.00 22.61 ? 250  TYR A CZ  1 
ATOM   1696 O  OH  . TYR A 1 250 ? 40.086  114.911 -5.363  1.00 22.17 ? 250  TYR A OH  1 
ATOM   1697 N  N   . ASN A 1 251 ? 42.208  107.735 -10.151 1.00 28.78 ? 251  ASN A N   1 
ATOM   1698 C  CA  . ASN A 1 251 ? 42.556  106.344 -10.426 1.00 30.21 ? 251  ASN A CA  1 
ATOM   1699 C  C   . ASN A 1 251 ? 44.054  106.109 -10.304 1.00 30.39 ? 251  ASN A C   1 
ATOM   1700 O  O   . ASN A 1 251 ? 44.495  104.994 -10.033 1.00 30.86 ? 251  ASN A O   1 
ATOM   1701 C  CB  . ASN A 1 251 ? 42.061  105.929 -11.812 1.00 31.80 ? 251  ASN A CB  1 
ATOM   1702 C  CG  . ASN A 1 251 ? 40.553  105.805 -11.870 1.00 33.27 ? 251  ASN A CG  1 
ATOM   1703 O  OD1 . ASN A 1 251 ? 39.941  105.155 -11.020 1.00 33.98 ? 251  ASN A OD1 1 
ATOM   1704 N  ND2 . ASN A 1 251 ? 39.943  106.422 -12.875 1.00 34.44 ? 251  ASN A ND2 1 
ATOM   1705 N  N   . ASP A 1 252 ? 44.837  107.161 -10.511 1.00 30.68 ? 252  ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 252 ? 46.282  107.061 -10.375 1.00 30.49 ? 252  ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 252 ? 46.527  106.842 -8.883  1.00 29.66 ? 252  ASP A C   1 
ATOM   1708 O  O   . ASP A 1 252 ? 46.295  107.738 -8.070  1.00 28.83 ? 252  ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 252 ? 46.936  108.360 -10.850 1.00 32.56 ? 252  ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 252 ? 48.438  108.377 -10.636 1.00 34.17 ? 252  ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 252 ? 49.099  109.275 -11.198 1.00 36.26 ? 252  ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 252 ? 48.958  107.508 -9.905  1.00 35.56 ? 252  ASP A OD2 1 
ATOM   1713 N  N   . ARG A 1 253 ? 46.991  105.647 -8.526  1.00 28.90 ? 253  ARG A N   1 
ATOM   1714 C  CA  . ARG A 1 253 ? 47.227  105.311 -7.125  1.00 27.85 ? 253  ARG A CA  1 
ATOM   1715 C  C   . ARG A 1 253 ? 48.223  106.215 -6.405  1.00 26.90 ? 253  ARG A C   1 
ATOM   1716 O  O   . ARG A 1 253 ? 48.127  106.399 -5.192  1.00 26.63 ? 253  ARG A O   1 
ATOM   1717 C  CB  . ARG A 1 253 ? 47.635  103.839 -6.999  1.00 28.03 ? 253  ARG A CB  1 
ATOM   1718 C  CG  . ARG A 1 253 ? 46.533  102.898 -7.467  1.00 28.48 ? 253  ARG A CG  1 
ATOM   1719 C  CD  . ARG A 1 253 ? 46.812  101.425 -7.180  1.00 28.62 ? 253  ARG A CD  1 
ATOM   1720 N  NE  . ARG A 1 253 ? 45.791  100.578 -7.798  1.00 28.37 ? 253  ARG A NE  1 
ATOM   1721 C  CZ  . ARG A 1 253 ? 44.526  100.495 -7.387  1.00 28.77 ? 253  ARG A CZ  1 
ATOM   1722 N  NH1 . ARG A 1 253 ? 44.113  101.199 -6.341  1.00 28.57 ? 253  ARG A NH1 1 
ATOM   1723 N  NH2 . ARG A 1 253 ? 43.662  99.735  -8.046  1.00 28.57 ? 253  ARG A NH2 1 
ATOM   1724 N  N   . ALA A 1 254 ? 49.172  106.786 -7.139  1.00 25.83 ? 254  ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 254 ? 50.141  107.686 -6.517  1.00 25.13 ? 254  ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 254 ? 49.404  108.963 -6.102  1.00 24.08 ? 254  ALA A C   1 
ATOM   1727 O  O   . ALA A 1 254 ? 49.644  109.517 -5.032  1.00 23.62 ? 254  ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 254 ? 51.263  108.018 -7.495  1.00 25.04 ? 254  ALA A CB  1 
ATOM   1729 N  N   . VAL A 1 255 ? 48.504  109.421 -6.964  1.00 23.45 ? 255  VAL A N   1 
ATOM   1730 C  CA  . VAL A 1 255 ? 47.716  110.615 -6.688  1.00 23.26 ? 255  VAL A CA  1 
ATOM   1731 C  C   . VAL A 1 255 ? 46.791  110.369 -5.498  1.00 22.43 ? 255  VAL A C   1 
ATOM   1732 O  O   . VAL A 1 255 ? 46.707  111.192 -4.591  1.00 22.22 ? 255  VAL A O   1 
ATOM   1733 C  CB  . VAL A 1 255 ? 46.859  111.014 -7.912  1.00 23.37 ? 255  VAL A CB  1 
ATOM   1734 C  CG1 . VAL A 1 255 ? 45.924  112.167 -7.551  1.00 23.58 ? 255  VAL A CG1 1 
ATOM   1735 C  CG2 . VAL A 1 255 ? 47.767  111.424 -9.061  1.00 24.18 ? 255  VAL A CG2 1 
ATOM   1736 N  N   . LEU A 1 256 ? 46.105  109.228 -5.501  1.00 22.11 ? 256  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 256 ? 45.185  108.901 -4.413  1.00 22.05 ? 256  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 256 ? 45.914  108.832 -3.073  1.00 22.06 ? 256  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 256 ? 45.421  109.334 -2.059  1.00 21.29 ? 256  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 256 ? 44.482  107.570 -4.694  1.00 21.53 ? 256  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 256 ? 43.410  107.127 -3.690  1.00 21.43 ? 256  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 256 ? 42.258  108.135 -3.675  1.00 20.76 ? 256  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 256 ? 42.904  105.748 -4.070  1.00 20.23 ? 256  LEU A CD2 1 
ATOM   1744 N  N   . GLU A 1 257 ? 47.091  108.212 -3.072  1.00 22.54 ? 257  GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 257 ? 47.890  108.092 -1.857  1.00 22.62 ? 257  GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 257 ? 48.276  109.482 -1.354  1.00 22.09 ? 257  GLU A C   1 
ATOM   1747 O  O   . GLU A 1 257 ? 48.199  109.768 -0.159  1.00 21.65 ? 257  GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 257 ? 49.142  107.252 -2.140  1.00 23.62 ? 257  GLU A CB  1 
ATOM   1749 C  CG  . GLU A 1 257 ? 50.143  107.166 -0.993  1.00 24.58 ? 257  GLU A CG  1 
ATOM   1750 C  CD  . GLU A 1 257 ? 49.536  106.659 0.304   1.00 26.00 ? 257  GLU A CD  1 
ATOM   1751 O  OE1 . GLU A 1 257 ? 48.489  105.974 0.265   1.00 26.81 ? 257  GLU A OE1 1 
ATOM   1752 O  OE2 . GLU A 1 257 ? 50.119  106.933 1.373   1.00 26.93 ? 257  GLU A OE2 1 
ATOM   1753 N  N   . ARG A 1 258 ? 48.692  110.346 -2.275  1.00 22.07 ? 258  ARG A N   1 
ATOM   1754 C  CA  . ARG A 1 258 ? 49.069  111.711 -1.925  1.00 22.09 ? 258  ARG A CA  1 
ATOM   1755 C  C   . ARG A 1 258 ? 47.880  112.421 -1.271  1.00 21.87 ? 258  ARG A C   1 
ATOM   1756 O  O   . ARG A 1 258 ? 48.023  113.106 -0.252  1.00 21.35 ? 258  ARG A O   1 
ATOM   1757 C  CB  . ARG A 1 258 ? 49.476  112.479 -3.183  1.00 23.25 ? 258  ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1 258 ? 49.897  113.927 -2.939  1.00 24.48 ? 258  ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1 258 ? 49.889  114.708 -4.250  1.00 25.73 ? 258  ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1 258 ? 48.531  115.055 -4.667  1.00 26.62 ? 258  ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1 258 ? 48.176  115.332 -5.920  1.00 27.26 ? 258  ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1 258 ? 49.076  115.297 -6.894  1.00 26.86 ? 258  ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1 258 ? 46.919  115.662 -6.197  1.00 26.76 ? 258  ARG A NH2 1 
ATOM   1764 N  N   . GLU A 1 259 ? 46.705  112.254 -1.865  1.00 21.07 ? 259  GLU A N   1 
ATOM   1765 C  CA  . GLU A 1 259 ? 45.504  112.892 -1.341  1.00 20.95 ? 259  GLU A CA  1 
ATOM   1766 C  C   . GLU A 1 259 ? 45.091  112.345 0.017   1.00 20.59 ? 259  GLU A C   1 
ATOM   1767 O  O   . GLU A 1 259 ? 44.728  113.107 0.911   1.00 20.40 ? 259  GLU A O   1 
ATOM   1768 C  CB  . GLU A 1 259 ? 44.358  112.762 -2.345  1.00 20.58 ? 259  GLU A CB  1 
ATOM   1769 C  CG  . GLU A 1 259 ? 44.535  113.679 -3.550  1.00 21.05 ? 259  GLU A CG  1 
ATOM   1770 C  CD  . GLU A 1 259 ? 44.741  115.124 -3.128  1.00 21.39 ? 259  GLU A CD  1 
ATOM   1771 O  OE1 . GLU A 1 259 ? 43.820  115.702 -2.508  1.00 21.58 ? 259  GLU A OE1 1 
ATOM   1772 O  OE2 . GLU A 1 259 ? 45.826  115.680 -3.404  1.00 21.02 ? 259  GLU A OE2 1 
ATOM   1773 N  N   . VAL A 1 260 ? 45.156  111.030 0.178   1.00 20.92 ? 260  VAL A N   1 
ATOM   1774 C  CA  . VAL A 1 260 ? 44.789  110.426 1.452   1.00 21.06 ? 260  VAL A CA  1 
ATOM   1775 C  C   . VAL A 1 260 ? 45.743  110.891 2.552   1.00 21.83 ? 260  VAL A C   1 
ATOM   1776 O  O   . VAL A 1 260 ? 45.311  111.220 3.656   1.00 22.21 ? 260  VAL A O   1 
ATOM   1777 C  CB  . VAL A 1 260 ? 44.788  108.879 1.355   1.00 20.64 ? 260  VAL A CB  1 
ATOM   1778 C  CG1 . VAL A 1 260 ? 44.602  108.260 2.737   1.00 19.70 ? 260  VAL A CG1 1 
ATOM   1779 C  CG2 . VAL A 1 260 ? 43.658  108.429 0.438   1.00 20.11 ? 260  VAL A CG2 1 
ATOM   1780 N  N   . GLN A 1 261 ? 47.038  110.929 2.245   1.00 22.46 ? 261  GLN A N   1 
ATOM   1781 C  CA  . GLN A 1 261 ? 48.046  111.371 3.209   1.00 23.33 ? 261  GLN A CA  1 
ATOM   1782 C  C   . GLN A 1 261 ? 47.819  112.835 3.573   1.00 22.94 ? 261  GLN A C   1 
ATOM   1783 O  O   . GLN A 1 261 ? 47.875  113.215 4.742   1.00 22.62 ? 261  GLN A O   1 
ATOM   1784 C  CB  . GLN A 1 261 ? 49.454  111.213 2.622   1.00 24.80 ? 261  GLN A CB  1 
ATOM   1785 C  CG  . GLN A 1 261 ? 49.942  109.779 2.543   1.00 27.34 ? 261  GLN A CG  1 
ATOM   1786 C  CD  . GLN A 1 261 ? 50.347  109.225 3.899   1.00 28.94 ? 261  GLN A CD  1 
ATOM   1787 O  OE1 . GLN A 1 261 ? 50.594  108.026 4.044   1.00 30.90 ? 261  GLN A OE1 1 
ATOM   1788 N  NE2 . GLN A 1 261 ? 50.427  110.097 4.895   1.00 29.44 ? 261  GLN A NE2 1 
ATOM   1789 N  N   . TYR A 1 262 ? 47.576  113.655 2.559   1.00 22.65 ? 262  TYR A N   1 
ATOM   1790 C  CA  . TYR A 1 262 ? 47.333  115.075 2.768   1.00 22.77 ? 262  TYR A CA  1 
ATOM   1791 C  C   . TYR A 1 262 ? 46.143  115.274 3.702   1.00 22.04 ? 262  TYR A C   1 
ATOM   1792 O  O   . TYR A 1 262 ? 46.220  116.009 4.686   1.00 21.77 ? 262  TYR A O   1 
ATOM   1793 C  CB  . TYR A 1 262 ? 47.040  115.756 1.431   1.00 23.64 ? 262  TYR A CB  1 
ATOM   1794 C  CG  . TYR A 1 262 ? 46.670  117.216 1.557   1.00 25.49 ? 262  TYR A CG  1 
ATOM   1795 C  CD1 . TYR A 1 262 ? 47.649  118.191 1.753   1.00 26.68 ? 262  TYR A CD1 1 
ATOM   1796 C  CD2 . TYR A 1 262 ? 45.337  117.626 1.492   1.00 25.40 ? 262  TYR A CD2 1 
ATOM   1797 C  CE1 . TYR A 1 262 ? 47.310  119.541 1.877   1.00 27.76 ? 262  TYR A CE1 1 
ATOM   1798 C  CE2 . TYR A 1 262 ? 44.988  118.969 1.616   1.00 26.67 ? 262  TYR A CE2 1 
ATOM   1799 C  CZ  . TYR A 1 262 ? 45.978  119.921 1.807   1.00 27.60 ? 262  TYR A CZ  1 
ATOM   1800 O  OH  . TYR A 1 262 ? 45.645  121.253 1.914   1.00 28.96 ? 262  TYR A OH  1 
ATOM   1801 N  N   . THR A 1 263 ? 45.042  114.606 3.381   1.00 21.43 ? 263  THR A N   1 
ATOM   1802 C  CA  . THR A 1 263 ? 43.819  114.711 4.164   1.00 20.78 ? 263  THR A CA  1 
ATOM   1803 C  C   . THR A 1 263 ? 43.992  114.209 5.595   1.00 21.31 ? 263  THR A C   1 
ATOM   1804 O  O   . THR A 1 263 ? 43.530  114.848 6.539   1.00 20.94 ? 263  THR A O   1 
ATOM   1805 C  CB  . THR A 1 263 ? 42.685  113.940 3.478   1.00 20.35 ? 263  THR A CB  1 
ATOM   1806 O  OG1 . THR A 1 263 ? 42.591  114.372 2.115   1.00 18.86 ? 263  THR A OG1 1 
ATOM   1807 C  CG2 . THR A 1 263 ? 41.355  114.198 4.180   1.00 18.54 ? 263  THR A CG2 1 
ATOM   1808 N  N   . LEU A 1 264 ? 44.655  113.067 5.758   1.00 21.76 ? 264  LEU A N   1 
ATOM   1809 C  CA  . LEU A 1 264 ? 44.885  112.518 7.091   1.00 22.32 ? 264  LEU A CA  1 
ATOM   1810 C  C   . LEU A 1 264 ? 45.710  113.492 7.921   1.00 22.91 ? 264  LEU A C   1 
ATOM   1811 O  O   . LEU A 1 264 ? 45.491  113.643 9.124   1.00 23.00 ? 264  LEU A O   1 
ATOM   1812 C  CB  . LEU A 1 264 ? 45.603  111.168 7.005   1.00 22.20 ? 264  LEU A CB  1 
ATOM   1813 C  CG  . LEU A 1 264 ? 44.737  109.973 6.594   1.00 22.84 ? 264  LEU A CG  1 
ATOM   1814 C  CD1 . LEU A 1 264 ? 45.611  108.734 6.443   1.00 22.35 ? 264  LEU A CD1 1 
ATOM   1815 C  CD2 . LEU A 1 264 ? 43.653  109.735 7.647   1.00 22.29 ? 264  LEU A CD2 1 
ATOM   1816 N  N   . GLU A 1 265 ? 46.655  114.163 7.277   1.00 23.87 ? 265  GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 265 ? 47.480  115.134 7.981   1.00 25.24 ? 265  GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 265 ? 46.623  116.314 8.440   1.00 24.83 ? 265  GLU A C   1 
ATOM   1819 O  O   . GLU A 1 265 ? 46.789  116.818 9.554   1.00 24.42 ? 265  GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 265 ? 48.609  115.638 7.081   1.00 27.19 ? 265  GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 265 ? 49.536  116.620 7.779   1.00 31.03 ? 265  GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 265 ? 50.015  116.095 9.127   1.00 33.50 ? 265  GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 265 ? 50.567  114.971 9.169   1.00 35.39 ? 265  GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 265 ? 49.835  116.803 10.142  1.00 34.56 ? 265  GLU A OE2 1 
ATOM   1825 N  N   . MET A 1 266 ? 45.711  116.758 7.581   1.00 24.22 ? 266  MET A N   1 
ATOM   1826 C  CA  . MET A 1 266 ? 44.846  117.874 7.940   1.00 24.06 ? 266  MET A CA  1 
ATOM   1827 C  C   . MET A 1 266 ? 43.944  117.467 9.100   1.00 23.53 ? 266  MET A C   1 
ATOM   1828 O  O   . MET A 1 266 ? 43.666  118.266 9.990   1.00 22.77 ? 266  MET A O   1 
ATOM   1829 C  CB  . MET A 1 266 ? 44.012  118.316 6.731   1.00 23.97 ? 266  MET A CB  1 
ATOM   1830 C  CG  . MET A 1 266 ? 44.850  118.910 5.598   1.00 24.95 ? 266  MET A CG  1 
ATOM   1831 S  SD  . MET A 1 266 ? 45.852  120.345 6.117   1.00 25.27 ? 266  MET A SD  1 
ATOM   1832 C  CE  . MET A 1 266 ? 47.408  119.544 6.590   1.00 27.65 ? 266  MET A CE  1 
ATOM   1833 N  N   . ILE A 1 267 ? 43.508  116.211 9.094   1.00 23.79 ? 267  ILE A N   1 
ATOM   1834 C  CA  . ILE A 1 267 ? 42.649  115.697 10.152  1.00 24.08 ? 267  ILE A CA  1 
ATOM   1835 C  C   . ILE A 1 267 ? 43.380  115.674 11.496  1.00 24.85 ? 267  ILE A C   1 
ATOM   1836 O  O   . ILE A 1 267 ? 42.805  116.010 12.533  1.00 24.28 ? 267  ILE A O   1 
ATOM   1837 C  CB  . ILE A 1 267 ? 42.149  114.278 9.809   1.00 23.69 ? 267  ILE A CB  1 
ATOM   1838 C  CG1 . ILE A 1 267 ? 41.139  114.357 8.657   1.00 23.38 ? 267  ILE A CG1 1 
ATOM   1839 C  CG2 . ILE A 1 267 ? 41.542  113.623 11.044  1.00 23.80 ? 267  ILE A CG2 1 
ATOM   1840 C  CD1 . ILE A 1 267 ? 40.676  113.015 8.136   1.00 22.60 ? 267  ILE A CD1 1 
ATOM   1841 N  N   . LYS A 1 268 ? 44.650  115.282 11.480  1.00 25.61 ? 268  LYS A N   1 
ATOM   1842 C  CA  . LYS A 1 268 ? 45.424  115.241 12.712  1.00 26.64 ? 268  LYS A CA  1 
ATOM   1843 C  C   . LYS A 1 268 ? 45.614  116.650 13.263  1.00 26.05 ? 268  LYS A C   1 
ATOM   1844 O  O   . LYS A 1 268 ? 45.617  116.854 14.476  1.00 25.70 ? 268  LYS A O   1 
ATOM   1845 C  CB  . LYS A 1 268 ? 46.786  114.585 12.468  1.00 28.87 ? 268  LYS A CB  1 
ATOM   1846 C  CG  . LYS A 1 268 ? 46.699  113.108 12.107  1.00 31.25 ? 268  LYS A CG  1 
ATOM   1847 C  CD  . LYS A 1 268 ? 48.081  112.525 11.841  1.00 33.39 ? 268  LYS A CD  1 
ATOM   1848 C  CE  . LYS A 1 268 ? 47.991  111.094 11.344  1.00 34.53 ? 268  LYS A CE  1 
ATOM   1849 N  NZ  . LYS A 1 268 ? 49.340  110.561 10.991  1.00 36.18 ? 268  LYS A NZ  1 
ATOM   1850 N  N   . LEU A 1 269 ? 45.770  117.618 12.365  1.00 25.79 ? 269  LEU A N   1 
ATOM   1851 C  CA  . LEU A 1 269 ? 45.948  119.015 12.752  1.00 25.77 ? 269  LEU A CA  1 
ATOM   1852 C  C   . LEU A 1 269 ? 44.665  119.612 13.329  1.00 25.25 ? 269  LEU A C   1 
ATOM   1853 O  O   . LEU A 1 269 ? 44.705  120.366 14.304  1.00 24.92 ? 269  LEU A O   1 
ATOM   1854 C  CB  . LEU A 1 269 ? 46.391  119.846 11.542  1.00 26.66 ? 269  LEU A CB  1 
ATOM   1855 C  CG  . LEU A 1 269 ? 47.886  120.120 11.340  1.00 28.10 ? 269  LEU A CG  1 
ATOM   1856 C  CD1 . LEU A 1 269 ? 48.706  118.894 11.662  1.00 28.67 ? 269  LEU A CD1 1 
ATOM   1857 C  CD2 . LEU A 1 269 ? 48.119  120.572 9.905   1.00 28.01 ? 269  LEU A CD2 1 
ATOM   1858 N  N   . VAL A 1 270 ? 43.532  119.279 12.714  1.00 23.98 ? 270  VAL A N   1 
ATOM   1859 C  CA  . VAL A 1 270 ? 42.231  119.784 13.154  1.00 23.18 ? 270  VAL A CA  1 
ATOM   1860 C  C   . VAL A 1 270 ? 41.232  118.623 13.108  1.00 22.81 ? 270  VAL A C   1 
ATOM   1861 O  O   . VAL A 1 270 ? 40.417  118.524 12.191  1.00 22.57 ? 270  VAL A O   1 
ATOM   1862 C  CB  . VAL A 1 270 ? 41.743  120.926 12.232  1.00 22.89 ? 270  VAL A CB  1 
ATOM   1863 C  CG1 . VAL A 1 270 ? 40.502  121.585 12.814  1.00 22.74 ? 270  VAL A CG1 1 
ATOM   1864 C  CG2 . VAL A 1 270 ? 42.850  121.949 12.048  1.00 23.14 ? 270  VAL A CG2 1 
ATOM   1865 N  N   . PRO A 1 271 ? 41.282  117.737 14.115  1.00 22.34 ? 271  PRO A N   1 
ATOM   1866 C  CA  . PRO A 1 271 ? 40.426  116.554 14.255  1.00 21.75 ? 271  PRO A CA  1 
ATOM   1867 C  C   . PRO A 1 271 ? 38.920  116.762 14.102  1.00 21.12 ? 271  PRO A C   1 
ATOM   1868 O  O   . PRO A 1 271 ? 38.217  115.862 13.642  1.00 20.79 ? 271  PRO A O   1 
ATOM   1869 C  CB  . PRO A 1 271 ? 40.789  116.024 15.644  1.00 21.99 ? 271  PRO A CB  1 
ATOM   1870 C  CG  . PRO A 1 271 ? 42.201  116.459 15.816  1.00 22.77 ? 271  PRO A CG  1 
ATOM   1871 C  CD  . PRO A 1 271 ? 42.171  117.869 15.284  1.00 22.41 ? 271  PRO A CD  1 
ATOM   1872 N  N   . HIS A 1 272 ? 38.420  117.932 14.490  1.00 20.43 ? 272  HIS A N   1 
ATOM   1873 C  CA  . HIS A 1 272 ? 36.986  118.186 14.396  1.00 20.14 ? 272  HIS A CA  1 
ATOM   1874 C  C   . HIS A 1 272 ? 36.539  118.989 13.178  1.00 20.11 ? 272  HIS A C   1 
ATOM   1875 O  O   . HIS A 1 272 ? 35.417  119.494 13.142  1.00 20.24 ? 272  HIS A O   1 
ATOM   1876 C  CB  . HIS A 1 272 ? 36.480  118.851 15.682  1.00 20.04 ? 272  HIS A CB  1 
ATOM   1877 C  CG  . HIS A 1 272 ? 36.633  117.991 16.899  1.00 20.23 ? 272  HIS A CG  1 
ATOM   1878 N  ND1 . HIS A 1 272 ? 37.809  117.910 17.612  1.00 19.94 ? 272  HIS A ND1 1 
ATOM   1879 C  CD2 . HIS A 1 272 ? 35.773  117.128 17.493  1.00 20.21 ? 272  HIS A CD2 1 
ATOM   1880 C  CE1 . HIS A 1 272 ? 37.670  117.035 18.593  1.00 20.26 ? 272  HIS A CE1 1 
ATOM   1881 N  NE2 . HIS A 1 272 ? 36.444  116.545 18.542  1.00 21.12 ? 272  HIS A NE2 1 
ATOM   1882 N  N   . ASN A 1 273 ? 37.412  119.111 12.183  1.00 19.63 ? 273  ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 273 ? 37.055  119.823 10.962  1.00 19.23 ? 273  ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 273 ? 36.356  118.805 10.071  1.00 19.16 ? 273  ASN A C   1 
ATOM   1885 O  O   . ASN A 1 273 ? 36.987  117.889 9.546   1.00 18.49 ? 273  ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 273 ? 38.302  120.377 10.266  1.00 19.31 ? 273  ASN A CB  1 
ATOM   1887 C  CG  . ASN A 1 273 ? 38.006  120.896 8.870   1.00 19.29 ? 273  ASN A CG  1 
ATOM   1888 O  OD1 . ASN A 1 273 ? 36.885  121.323 8.576   1.00 18.95 ? 273  ASN A OD1 1 
ATOM   1889 N  ND2 . ASN A 1 273 ? 39.015  120.876 8.006   1.00 18.65 ? 273  ASN A ND2 1 
ATOM   1890 N  N   . GLU A 1 274 ? 35.045  118.962 9.911   1.00 19.03 ? 274  GLU A N   1 
ATOM   1891 C  CA  . GLU A 1 274 ? 34.269  118.023 9.112   1.00 19.46 ? 274  GLU A CA  1 
ATOM   1892 C  C   . GLU A 1 274 ? 34.632  117.941 7.633   1.00 18.46 ? 274  GLU A C   1 
ATOM   1893 O  O   . GLU A 1 274 ? 34.558  116.864 7.046   1.00 18.41 ? 274  GLU A O   1 
ATOM   1894 C  CB  . GLU A 1 274 ? 32.764  118.310 9.242   1.00 19.78 ? 274  GLU A CB  1 
ATOM   1895 C  CG  . GLU A 1 274 ? 31.915  117.397 8.360   1.00 21.96 ? 274  GLU A CG  1 
ATOM   1896 C  CD  . GLU A 1 274 ? 30.435  117.444 8.682   1.00 23.19 ? 274  GLU A CD  1 
ATOM   1897 O  OE1 . GLU A 1 274 ? 29.638  116.874 7.903   1.00 21.81 ? 274  GLU A OE1 1 
ATOM   1898 O  OE2 . GLU A 1 274 ? 30.072  118.040 9.721   1.00 25.51 ? 274  GLU A OE2 1 
ATOM   1899 N  N   . SER A 1 275 ? 35.022  119.062 7.030   1.00 18.25 ? 275  SER A N   1 
ATOM   1900 C  CA  . SER A 1 275 ? 35.361  119.072 5.607   1.00 17.51 ? 275  SER A CA  1 
ATOM   1901 C  C   . SER A 1 275 ? 36.434  118.059 5.204   1.00 17.37 ? 275  SER A C   1 
ATOM   1902 O  O   . SER A 1 275 ? 36.299  117.386 4.178   1.00 17.25 ? 275  SER A O   1 
ATOM   1903 C  CB  . SER A 1 275 ? 35.787  120.479 5.170   1.00 17.98 ? 275  SER A CB  1 
ATOM   1904 O  OG  . SER A 1 275 ? 34.674  121.361 5.132   1.00 17.46 ? 275  SER A OG  1 
ATOM   1905 N  N   . ALA A 1 276 ? 37.495  117.949 5.999   1.00 16.81 ? 276  ALA A N   1 
ATOM   1906 C  CA  . ALA A 1 276 ? 38.568  116.998 5.696   1.00 16.80 ? 276  ALA A CA  1 
ATOM   1907 C  C   . ALA A 1 276 ? 38.042  115.564 5.772   1.00 16.40 ? 276  ALA A C   1 
ATOM   1908 O  O   . ALA A 1 276 ? 38.364  114.731 4.925   1.00 16.16 ? 276  ALA A O   1 
ATOM   1909 C  CB  . ALA A 1 276 ? 39.733  117.186 6.666   1.00 16.83 ? 276  ALA A CB  1 
ATOM   1910 N  N   . TRP A 1 277 ? 37.241  115.276 6.795   1.00 16.23 ? 277  TRP A N   1 
ATOM   1911 C  CA  . TRP A 1 277 ? 36.665  113.940 6.944   1.00 16.43 ? 277  TRP A CA  1 
ATOM   1912 C  C   . TRP A 1 277 ? 35.770  113.611 5.750   1.00 16.49 ? 277  TRP A C   1 
ATOM   1913 O  O   . TRP A 1 277 ? 35.799  112.497 5.222   1.00 17.06 ? 277  TRP A O   1 
ATOM   1914 C  CB  . TRP A 1 277 ? 35.833  113.848 8.226   1.00 16.65 ? 277  TRP A CB  1 
ATOM   1915 C  CG  . TRP A 1 277 ? 36.645  113.668 9.471   1.00 16.93 ? 277  TRP A CG  1 
ATOM   1916 C  CD1 . TRP A 1 277 ? 36.930  114.612 10.414  1.00 16.92 ? 277  TRP A CD1 1 
ATOM   1917 C  CD2 . TRP A 1 277 ? 37.274  112.460 9.906   1.00 17.10 ? 277  TRP A CD2 1 
ATOM   1918 N  NE1 . TRP A 1 277 ? 37.699  114.063 11.415  1.00 17.25 ? 277  TRP A NE1 1 
ATOM   1919 C  CE2 . TRP A 1 277 ? 37.924  112.743 11.128  1.00 17.41 ? 277  TRP A CE2 1 
ATOM   1920 C  CE3 . TRP A 1 277 ? 37.352  111.163 9.379   1.00 17.13 ? 277  TRP A CE3 1 
ATOM   1921 C  CZ2 . TRP A 1 277 ? 38.644  111.775 11.836  1.00 17.44 ? 277  TRP A CZ2 1 
ATOM   1922 C  CZ3 . TRP A 1 277 ? 38.070  110.198 10.084  1.00 17.88 ? 277  TRP A CZ3 1 
ATOM   1923 C  CH2 . TRP A 1 277 ? 38.706  110.512 11.301  1.00 17.38 ? 277  TRP A CH2 1 
ATOM   1924 N  N   . ASN A 1 278 ? 34.974  114.588 5.329   1.00 16.28 ? 278  ASN A N   1 
ATOM   1925 C  CA  . ASN A 1 278 ? 34.069  114.396 4.204   1.00 16.63 ? 278  ASN A CA  1 
ATOM   1926 C  C   . ASN A 1 278 ? 34.831  114.182 2.905   1.00 16.41 ? 278  ASN A C   1 
ATOM   1927 O  O   . ASN A 1 278 ? 34.398  113.415 2.049   1.00 16.65 ? 278  ASN A O   1 
ATOM   1928 C  CB  . ASN A 1 278 ? 33.126  115.596 4.075   1.00 16.01 ? 278  ASN A CB  1 
ATOM   1929 C  CG  . ASN A 1 278 ? 32.175  115.708 5.248   1.00 16.12 ? 278  ASN A CG  1 
ATOM   1930 O  OD1 . ASN A 1 278 ? 32.050  114.777 6.040   1.00 16.51 ? 278  ASN A OD1 1 
ATOM   1931 N  ND2 . ASN A 1 278 ? 31.488  116.840 5.358   1.00 16.25 ? 278  ASN A ND2 1 
ATOM   1932 N  N   . TYR A 1 279 ? 35.971  114.854 2.766   1.00 16.60 ? 279  TYR A N   1 
ATOM   1933 C  CA  . TYR A 1 279 ? 36.791  114.717 1.568   1.00 16.39 ? 279  TYR A CA  1 
ATOM   1934 C  C   . TYR A 1 279 ? 37.425  113.330 1.556   1.00 16.79 ? 279  TYR A C   1 
ATOM   1935 O  O   . TYR A 1 279 ? 37.510  112.686 0.510   1.00 16.56 ? 279  TYR A O   1 
ATOM   1936 C  CB  . TYR A 1 279 ? 37.889  115.782 1.544   1.00 16.70 ? 279  TYR A CB  1 
ATOM   1937 C  CG  . TYR A 1 279 ? 38.781  115.723 0.320   1.00 17.04 ? 279  TYR A CG  1 
ATOM   1938 C  CD1 . TYR A 1 279 ? 38.322  116.154 -0.926  1.00 16.54 ? 279  TYR A CD1 1 
ATOM   1939 C  CD2 . TYR A 1 279 ? 40.092  115.246 0.412   1.00 17.22 ? 279  TYR A CD2 1 
ATOM   1940 C  CE1 . TYR A 1 279 ? 39.147  116.119 -2.057  1.00 17.23 ? 279  TYR A CE1 1 
ATOM   1941 C  CE2 . TYR A 1 279 ? 40.926  115.202 -0.710  1.00 17.19 ? 279  TYR A CE2 1 
ATOM   1942 C  CZ  . TYR A 1 279 ? 40.448  115.642 -1.940  1.00 18.03 ? 279  TYR A CZ  1 
ATOM   1943 O  OH  . TYR A 1 279 ? 41.268  115.608 -3.048  1.00 18.07 ? 279  TYR A OH  1 
ATOM   1944 N  N   . LEU A 1 280 ? 37.879  112.877 2.720   1.00 16.93 ? 280  LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 280 ? 38.490  111.556 2.827   1.00 17.70 ? 280  LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 280 ? 37.497  110.499 2.352   1.00 17.61 ? 280  LEU A C   1 
ATOM   1947 O  O   . LEU A 1 280 ? 37.832  109.634 1.544   1.00 18.19 ? 280  LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 280 ? 38.895  111.267 4.276   1.00 17.88 ? 280  LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 280 ? 39.556  109.908 4.533   1.00 18.40 ? 280  LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 280 ? 40.798  109.771 3.657   1.00 18.33 ? 280  LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 280 ? 39.923  109.785 6.011   1.00 18.36 ? 280  LEU A CD2 1 
ATOM   1952 N  N   . LYS A 1 281 ? 36.268  110.573 2.848   1.00 17.97 ? 281  LYS A N   1 
ATOM   1953 C  CA  . LYS A 1 281 ? 35.249  109.614 2.442   1.00 18.49 ? 281  LYS A CA  1 
ATOM   1954 C  C   . LYS A 1 281 ? 34.924  109.794 0.962   1.00 17.91 ? 281  LYS A C   1 
ATOM   1955 O  O   . LYS A 1 281 ? 34.771  108.822 0.227   1.00 17.30 ? 281  LYS A O   1 
ATOM   1956 C  CB  . LYS A 1 281 ? 33.975  109.793 3.281   1.00 19.77 ? 281  LYS A CB  1 
ATOM   1957 C  CG  . LYS A 1 281 ? 32.869  108.796 2.940   1.00 21.80 ? 281  LYS A CG  1 
ATOM   1958 C  CD  . LYS A 1 281 ? 31.804  108.681 4.046   1.00 24.01 ? 281  LYS A CD  1 
ATOM   1959 C  CE  . LYS A 1 281 ? 30.786  109.825 4.039   1.00 25.81 ? 281  LYS A CE  1 
ATOM   1960 N  NZ  . LYS A 1 281 ? 31.246  111.085 4.707   1.00 26.52 ? 281  LYS A NZ  1 
ATOM   1961 N  N   . GLY A 1 282 ? 34.834  111.049 0.533   1.00 17.92 ? 282  GLY A N   1 
ATOM   1962 C  CA  . GLY A 1 282 ? 34.511  111.346 -0.852  1.00 18.16 ? 282  GLY A CA  1 
ATOM   1963 C  C   . GLY A 1 282 ? 35.421  110.727 -1.899  1.00 18.36 ? 282  GLY A C   1 
ATOM   1964 O  O   . GLY A 1 282 ? 34.942  110.247 -2.927  1.00 18.03 ? 282  GLY A O   1 
ATOM   1965 N  N   . ILE A 1 283 ? 36.727  110.723 -1.647  1.00 18.24 ? 283  ILE A N   1 
ATOM   1966 C  CA  . ILE A 1 283 ? 37.671  110.174 -2.615  1.00 18.82 ? 283  ILE A CA  1 
ATOM   1967 C  C   . ILE A 1 283 ? 37.852  108.662 -2.545  1.00 19.31 ? 283  ILE A C   1 
ATOM   1968 O  O   . ILE A 1 283 ? 38.521  108.080 -3.396  1.00 19.22 ? 283  ILE A O   1 
ATOM   1969 C  CB  . ILE A 1 283 ? 39.062  110.849 -2.492  1.00 18.73 ? 283  ILE A CB  1 
ATOM   1970 C  CG1 . ILE A 1 283 ? 39.680  110.557 -1.118  1.00 19.46 ? 283  ILE A CG1 1 
ATOM   1971 C  CG2 . ILE A 1 283 ? 38.926  112.352 -2.713  1.00 18.89 ? 283  ILE A CG2 1 
ATOM   1972 C  CD1 . ILE A 1 283 ? 41.068  111.158 -0.924  1.00 19.36 ? 283  ILE A CD1 1 
ATOM   1973 N  N   . LEU A 1 284 ? 37.244  108.022 -1.549  1.00 19.45 ? 284  LEU A N   1 
ATOM   1974 C  CA  . LEU A 1 284 ? 37.368  106.574 -1.392  1.00 19.79 ? 284  LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 284 ? 36.043  105.823 -1.523  1.00 20.58 ? 284  LEU A C   1 
ATOM   1976 O  O   . LEU A 1 284 ? 36.029  104.623 -1.798  1.00 20.21 ? 284  LEU A O   1 
ATOM   1977 C  CB  . LEU A 1 284 ? 37.969  106.246 -0.019  1.00 18.93 ? 284  LEU A CB  1 
ATOM   1978 C  CG  . LEU A 1 284 ? 39.304  106.885 0.378   1.00 19.33 ? 284  LEU A CG  1 
ATOM   1979 C  CD1 . LEU A 1 284 ? 39.644  106.487 1.803   1.00 18.47 ? 284  LEU A CD1 1 
ATOM   1980 C  CD2 . LEU A 1 284 ? 40.409  106.454 -0.583  1.00 18.65 ? 284  LEU A CD2 1 
ATOM   1981 N  N   . GLN A 1 285 ? 34.931  106.527 -1.335  1.00 21.54 ? 285  GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 285 ? 33.614  105.892 -1.369  1.00 23.07 ? 285  GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 285 ? 33.214  105.120 -2.625  1.00 23.91 ? 285  GLN A C   1 
ATOM   1984 O  O   . GLN A 1 285 ? 32.625  104.048 -2.523  1.00 24.38 ? 285  GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 285 ? 32.530  106.927 -1.045  1.00 22.74 ? 285  GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 285 ? 32.340  107.999 -2.103  1.00 23.02 ? 285  GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 285 ? 31.477  109.152 -1.608  1.00 23.46 ? 285  GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 285 ? 30.940  109.115 -0.495  1.00 23.64 ? 285  GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 285 ? 31.343  110.181 -2.433  1.00 22.74 ? 285  GLN A NE2 1 
ATOM   1990 N  N   . ASP A 1 286 ? 33.528  105.642 -3.804  1.00 25.36 ? 286  ASP A N   1 
ATOM   1991 C  CA  . ASP A 1 286 ? 33.138  104.954 -5.031  1.00 26.73 ? 286  ASP A CA  1 
ATOM   1992 C  C   . ASP A 1 286 ? 33.736  103.560 -5.156  1.00 26.78 ? 286  ASP A C   1 
ATOM   1993 O  O   . ASP A 1 286 ? 33.053  102.619 -5.561  1.00 26.62 ? 286  ASP A O   1 
ATOM   1994 C  CB  . ASP A 1 286 ? 33.505  105.790 -6.255  1.00 28.36 ? 286  ASP A CB  1 
ATOM   1995 C  CG  . ASP A 1 286 ? 32.772  107.117 -6.290  1.00 30.28 ? 286  ASP A CG  1 
ATOM   1996 O  OD1 . ASP A 1 286 ? 31.567  107.145 -5.960  1.00 30.89 ? 286  ASP A OD1 1 
ATOM   1997 O  OD2 . ASP A 1 286 ? 33.403  108.129 -6.657  1.00 32.65 ? 286  ASP A OD2 1 
ATOM   1998 N  N   . ARG A 1 287 ? 35.010  103.425 -4.813  1.00 26.67 ? 287  ARG A N   1 
ATOM   1999 C  CA  . ARG A 1 287 ? 35.663  102.127 -4.880  1.00 26.93 ? 287  ARG A CA  1 
ATOM   2000 C  C   . ARG A 1 287 ? 35.204  101.260 -3.712  1.00 25.92 ? 287  ARG A C   1 
ATOM   2001 O  O   . ARG A 1 287 ? 35.120  100.042 -3.831  1.00 25.85 ? 287  ARG A O   1 
ATOM   2002 C  CB  . ARG A 1 287 ? 37.183  102.303 -4.850  1.00 28.57 ? 287  ARG A CB  1 
ATOM   2003 C  CG  . ARG A 1 287 ? 37.736  102.933 -6.117  1.00 31.87 ? 287  ARG A CG  1 
ATOM   2004 C  CD  . ARG A 1 287 ? 37.688  101.944 -7.279  1.00 34.96 ? 287  ARG A CD  1 
ATOM   2005 N  NE  . ARG A 1 287 ? 37.793  102.607 -8.577  1.00 37.78 ? 287  ARG A NE  1 
ATOM   2006 C  CZ  . ARG A 1 287 ? 36.770  103.177 -9.211  1.00 39.50 ? 287  ARG A CZ  1 
ATOM   2007 N  NH1 . ARG A 1 287 ? 35.557  103.163 -8.670  1.00 40.09 ? 287  ARG A NH1 1 
ATOM   2008 N  NH2 . ARG A 1 287 ? 36.960  103.762 -10.389 1.00 40.20 ? 287  ARG A NH2 1 
ATOM   2009 N  N   . GLY A 1 288 ? 34.893  101.900 -2.589  1.00 25.15 ? 288  GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 288 ? 34.447  101.165 -1.418  1.00 24.47 ? 288  GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 288 ? 35.439  101.320 -0.284  1.00 24.43 ? 288  GLY A C   1 
ATOM   2012 O  O   . GLY A 1 288 ? 36.611  100.955 -0.421  1.00 24.03 ? 288  GLY A O   1 
ATOM   2013 N  N   . LEU A 1 289 ? 34.973  101.859 0.838   1.00 23.86 ? 289  LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 289 ? 35.833  102.080 1.992   1.00 24.09 ? 289  LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 289 ? 36.530  100.816 2.491   1.00 24.09 ? 289  LEU A C   1 
ATOM   2016 O  O   . LEU A 1 289 ? 37.639  100.886 3.011   1.00 24.43 ? 289  LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 289 ? 35.032  102.717 3.135   1.00 24.18 ? 289  LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 289 ? 34.382  104.076 2.849   1.00 24.46 ? 289  LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 289 ? 33.770  104.619 4.133   1.00 24.10 ? 289  LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 289 ? 35.418  105.056 2.305   1.00 24.71 ? 289  LEU A CD2 1 
ATOM   2021 N  N   . SER A 1 290 ? 35.891  99.663  2.327   1.00 24.20 ? 290  SER A N   1 
ATOM   2022 C  CA  . SER A 1 290 ? 36.483  98.408  2.781   1.00 24.78 ? 290  SER A CA  1 
ATOM   2023 C  C   . SER A 1 290 ? 37.642  97.955  1.895   1.00 24.63 ? 290  SER A C   1 
ATOM   2024 O  O   . SER A 1 290 ? 38.324  96.984  2.215   1.00 25.03 ? 290  SER A O   1 
ATOM   2025 C  CB  . SER A 1 290 ? 35.421  97.304  2.832   1.00 24.19 ? 290  SER A CB  1 
ATOM   2026 O  OG  . SER A 1 290 ? 34.956  96.983  1.533   1.00 25.24 ? 290  SER A OG  1 
ATOM   2027 N  N   . LYS A 1 291 ? 37.864  98.652  0.782   1.00 24.80 ? 291  LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 291 ? 38.950  98.287  -0.127  1.00 25.02 ? 291  LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 291 ? 40.289  98.833  0.360   1.00 24.38 ? 291  LYS A C   1 
ATOM   2030 O  O   . LYS A 1 291 ? 41.328  98.580  -0.250  1.00 24.78 ? 291  LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 291 ? 38.676  98.816  -1.540  1.00 25.84 ? 291  LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 291 ? 37.356  98.364  -2.152  1.00 27.65 ? 291  LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 291 ? 37.237  96.855  -2.202  1.00 28.93 ? 291  LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 291 ? 35.919  96.430  -2.834  1.00 30.12 ? 291  LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 291 ? 35.734  94.953  -2.768  1.00 31.42 ? 291  LYS A NZ  1 
ATOM   2036 N  N   . TYR A 1 292 ? 40.259  99.579  1.459   1.00 23.73 ? 292  TYR A N   1 
ATOM   2037 C  CA  . TYR A 1 292 ? 41.468  100.170 2.020   1.00 23.63 ? 292  TYR A CA  1 
ATOM   2038 C  C   . TYR A 1 292 ? 41.686  99.699  3.453   1.00 24.28 ? 292  TYR A C   1 
ATOM   2039 O  O   . TYR A 1 292 ? 41.491  100.456 4.406   1.00 23.88 ? 292  TYR A O   1 
ATOM   2040 C  CB  . TYR A 1 292 ? 41.366  101.695 1.969   1.00 22.64 ? 292  TYR A CB  1 
ATOM   2041 C  CG  . TYR A 1 292 ? 41.013  102.209 0.589   1.00 22.06 ? 292  TYR A CG  1 
ATOM   2042 C  CD1 . TYR A 1 292 ? 39.681  102.357 0.194   1.00 21.52 ? 292  TYR A CD1 1 
ATOM   2043 C  CD2 . TYR A 1 292 ? 42.011  102.496 -0.341  1.00 20.94 ? 292  TYR A CD2 1 
ATOM   2044 C  CE1 . TYR A 1 292 ? 39.354  102.775 -1.097  1.00 21.69 ? 292  TYR A CE1 1 
ATOM   2045 C  CE2 . TYR A 1 292 ? 41.696  102.908 -1.631  1.00 21.61 ? 292  TYR A CE2 1 
ATOM   2046 C  CZ  . TYR A 1 292 ? 40.370  103.045 -2.005  1.00 21.95 ? 292  TYR A CZ  1 
ATOM   2047 O  OH  . TYR A 1 292 ? 40.071  103.429 -3.292  1.00 22.49 ? 292  TYR A OH  1 
ATOM   2048 N  N   . PRO A 1 293 ? 42.121  98.438  3.618   1.00 25.08 ? 293  PRO A N   1 
ATOM   2049 C  CA  . PRO A 1 293 ? 42.375  97.821  4.926   1.00 25.55 ? 293  PRO A CA  1 
ATOM   2050 C  C   . PRO A 1 293 ? 43.275  98.591  5.891   1.00 25.90 ? 293  PRO A C   1 
ATOM   2051 O  O   . PRO A 1 293 ? 43.035  98.587  7.099   1.00 26.33 ? 293  PRO A O   1 
ATOM   2052 C  CB  . PRO A 1 293 ? 42.943  96.447  4.558   1.00 25.55 ? 293  PRO A CB  1 
ATOM   2053 C  CG  . PRO A 1 293 ? 43.600  96.695  3.237   1.00 25.46 ? 293  PRO A CG  1 
ATOM   2054 C  CD  . PRO A 1 293 ? 42.579  97.554  2.531   1.00 24.90 ? 293  PRO A CD  1 
ATOM   2055 N  N   . ASN A 1 294 ? 44.306  99.252  5.377   1.00 25.91 ? 294  ASN A N   1 
ATOM   2056 C  CA  . ASN A 1 294 ? 45.201  99.994  6.255   1.00 25.94 ? 294  ASN A CA  1 
ATOM   2057 C  C   . ASN A 1 294 ? 44.537  101.220 6.877   1.00 26.12 ? 294  ASN A C   1 
ATOM   2058 O  O   . ASN A 1 294 ? 44.879  101.618 7.992   1.00 25.90 ? 294  ASN A O   1 
ATOM   2059 C  CB  . ASN A 1 294 ? 46.470  100.416 5.508   1.00 26.00 ? 294  ASN A CB  1 
ATOM   2060 C  CG  . ASN A 1 294 ? 47.276  99.228  5.010   1.00 26.89 ? 294  ASN A CG  1 
ATOM   2061 O  OD1 . ASN A 1 294 ? 47.264  98.157  5.617   1.00 26.38 ? 294  ASN A OD1 1 
ATOM   2062 N  ND2 . ASN A 1 294 ? 47.995  99.418  3.907   1.00 26.34 ? 294  ASN A ND2 1 
ATOM   2063 N  N   . LEU A 1 295 ? 43.587  101.818 6.164   1.00 25.97 ? 295  LEU A N   1 
ATOM   2064 C  CA  . LEU A 1 295 ? 42.898  102.996 6.682   1.00 26.22 ? 295  LEU A CA  1 
ATOM   2065 C  C   . LEU A 1 295 ? 42.142  102.671 7.968   1.00 25.94 ? 295  LEU A C   1 
ATOM   2066 O  O   . LEU A 1 295 ? 42.150  103.450 8.918   1.00 25.41 ? 295  LEU A O   1 
ATOM   2067 C  CB  . LEU A 1 295 ? 41.932  103.557 5.633   1.00 26.24 ? 295  LEU A CB  1 
ATOM   2068 C  CG  . LEU A 1 295 ? 41.124  104.782 6.076   1.00 26.48 ? 295  LEU A CG  1 
ATOM   2069 C  CD1 . LEU A 1 295 ? 42.061  105.860 6.609   1.00 26.85 ? 295  LEU A CD1 1 
ATOM   2070 C  CD2 . LEU A 1 295 ? 40.319  105.311 4.901   1.00 26.14 ? 295  LEU A CD2 1 
ATOM   2071 N  N   . LEU A 1 296 ? 41.492  101.514 7.996   1.00 26.78 ? 296  LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 296 ? 40.748  101.095 9.177   1.00 28.12 ? 296  LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 296 ? 41.670  100.993 10.390  1.00 29.24 ? 296  LEU A C   1 
ATOM   2074 O  O   . LEU A 1 296 ? 41.358  101.507 11.463  1.00 28.33 ? 296  LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 296 ? 40.077  99.744  8.927   1.00 27.73 ? 296  LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 296 ? 39.411  99.093  10.142  1.00 28.07 ? 296  LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 296 ? 38.399  100.043 10.768  1.00 27.45 ? 296  LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 296 ? 38.738  97.805  9.704   1.00 28.39 ? 296  LEU A CD2 1 
ATOM   2079 N  N   . ASN A 1 297 ? 42.810  100.332 10.210  1.00 31.13 ? 297  ASN A N   1 
ATOM   2080 C  CA  . ASN A 1 297 ? 43.767  100.172 11.300  1.00 33.32 ? 297  ASN A CA  1 
ATOM   2081 C  C   . ASN A 1 297 ? 44.271  101.520 11.799  1.00 33.94 ? 297  ASN A C   1 
ATOM   2082 O  O   . ASN A 1 297 ? 44.321  101.765 13.003  1.00 33.66 ? 297  ASN A O   1 
ATOM   2083 C  CB  . ASN A 1 297 ? 44.959  99.325  10.853  1.00 34.92 ? 297  ASN A CB  1 
ATOM   2084 C  CG  . ASN A 1 297 ? 44.562  97.915  10.480  1.00 36.73 ? 297  ASN A CG  1 
ATOM   2085 O  OD1 . ASN A 1 297 ? 43.920  97.211  11.261  1.00 38.60 ? 297  ASN A OD1 1 
ATOM   2086 N  ND2 . ASN A 1 297 ? 44.949  97.489  9.283   1.00 38.07 ? 297  ASN A ND2 1 
ATOM   2087 N  N   . GLN A 1 298 ? 44.641  102.396 10.872  1.00 34.99 ? 298  GLN A N   1 
ATOM   2088 C  CA  . GLN A 1 298 ? 45.146  103.709 11.248  1.00 36.85 ? 298  GLN A CA  1 
ATOM   2089 C  C   . GLN A 1 298 ? 44.102  104.511 12.018  1.00 37.37 ? 298  GLN A C   1 
ATOM   2090 O  O   . GLN A 1 298 ? 44.422  105.158 13.015  1.00 37.84 ? 298  GLN A O   1 
ATOM   2091 C  CB  . GLN A 1 298 ? 45.603  104.483 10.007  1.00 37.60 ? 298  GLN A CB  1 
ATOM   2092 C  CG  . GLN A 1 298 ? 46.669  103.751 9.200   1.00 39.34 ? 298  GLN A CG  1 
ATOM   2093 C  CD  . GLN A 1 298 ? 47.392  104.646 8.207   1.00 40.32 ? 298  GLN A CD  1 
ATOM   2094 O  OE1 . GLN A 1 298 ? 48.162  104.165 7.371   1.00 41.04 ? 298  GLN A OE1 1 
ATOM   2095 N  NE2 . GLN A 1 298 ? 47.159  105.952 8.299   1.00 40.74 ? 298  GLN A NE2 1 
ATOM   2096 N  N   . LEU A 1 299 ? 42.854  104.470 11.565  1.00 37.78 ? 299  LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 299 ? 41.791  105.200 12.248  1.00 38.30 ? 299  LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 299 ? 41.528  104.570 13.609  1.00 39.32 ? 299  LEU A C   1 
ATOM   2099 O  O   . LEU A 1 299 ? 41.227  105.262 14.579  1.00 39.19 ? 299  LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 299 ? 40.507  105.187 11.416  1.00 37.44 ? 299  LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 299 ? 40.556  105.953 10.091  1.00 36.89 ? 299  LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 299 ? 39.209  105.872 9.394   1.00 35.92 ? 299  LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 299 ? 40.932  107.403 10.361  1.00 36.39 ? 299  LEU A CD2 1 
ATOM   2104 N  N   . LEU A 1 300 ? 41.650  103.249 13.671  1.00 40.87 ? 300  LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 300 ? 41.432  102.513 14.906  1.00 42.95 ? 300  LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 300 ? 42.441  102.923 15.980  1.00 44.49 ? 300  LEU A C   1 
ATOM   2107 O  O   . LEU A 1 300 ? 42.098  103.024 17.159  1.00 44.78 ? 300  LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 300 ? 41.529  101.011 14.629  1.00 42.92 ? 300  LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 300 ? 40.307  100.136 14.929  1.00 43.33 ? 300  LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 300 ? 39.031  100.817 14.469  1.00 43.23 ? 300  LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 300 ? 40.477  98.793  14.234  1.00 43.35 ? 300  LEU A CD2 1 
ATOM   2112 N  N   . ASP A 1 301 ? 43.683  103.169 15.571  1.00 46.07 ? 301  ASP A N   1 
ATOM   2113 C  CA  . ASP A 1 301 ? 44.725  103.566 16.514  1.00 47.90 ? 301  ASP A CA  1 
ATOM   2114 C  C   . ASP A 1 301 ? 44.509  104.978 17.046  1.00 48.90 ? 301  ASP A C   1 
ATOM   2115 O  O   . ASP A 1 301 ? 44.939  105.303 18.152  1.00 49.41 ? 301  ASP A O   1 
ATOM   2116 C  CB  . ASP A 1 301 ? 46.112  103.487 15.862  1.00 48.11 ? 301  ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1 301 ? 46.502  102.073 15.482  1.00 48.48 ? 301  ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1 301 ? 46.258  101.153 16.290  1.00 48.97 ? 301  ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1 301 ? 47.066  101.881 14.383  1.00 48.90 ? 301  ASP A OD2 1 
ATOM   2120 N  N   . LEU A 1 302 ? 43.842  105.813 16.257  1.00 49.90 ? 302  LEU A N   1 
ATOM   2121 C  CA  . LEU A 1 302 ? 43.586  107.195 16.646  1.00 50.87 ? 302  LEU A CA  1 
ATOM   2122 C  C   . LEU A 1 302 ? 42.349  107.359 17.516  1.00 51.56 ? 302  LEU A C   1 
ATOM   2123 O  O   . LEU A 1 302 ? 42.223  108.341 18.245  1.00 51.71 ? 302  LEU A O   1 
ATOM   2124 C  CB  . LEU A 1 302 ? 43.432  108.066 15.400  1.00 50.89 ? 302  LEU A CB  1 
ATOM   2125 C  CG  . LEU A 1 302 ? 44.652  108.171 14.487  1.00 51.34 ? 302  LEU A CG  1 
ATOM   2126 C  CD1 . LEU A 1 302 ? 44.279  108.924 13.218  1.00 51.24 ? 302  LEU A CD1 1 
ATOM   2127 C  CD2 . LEU A 1 302 ? 45.782  108.874 15.227  1.00 51.47 ? 302  LEU A CD2 1 
ATOM   2128 N  N   . GLN A 1 303 ? 41.440  106.393 17.437  1.00 52.46 ? 303  GLN A N   1 
ATOM   2129 C  CA  . GLN A 1 303 ? 40.197  106.451 18.193  1.00 53.38 ? 303  GLN A CA  1 
ATOM   2130 C  C   . GLN A 1 303 ? 40.390  106.808 19.666  1.00 53.85 ? 303  GLN A C   1 
ATOM   2131 O  O   . GLN A 1 303 ? 39.804  107.772 20.154  1.00 53.95 ? 303  GLN A O   1 
ATOM   2132 C  CB  . GLN A 1 303 ? 39.444  105.125 18.068  1.00 53.69 ? 303  GLN A CB  1 
ATOM   2133 C  CG  . GLN A 1 303 ? 38.014  105.185 18.567  1.00 54.37 ? 303  GLN A CG  1 
ATOM   2134 C  CD  . GLN A 1 303 ? 37.268  103.888 18.336  1.00 54.87 ? 303  GLN A CD  1 
ATOM   2135 O  OE1 . GLN A 1 303 ? 36.083  103.774 18.652  1.00 55.44 ? 303  GLN A OE1 1 
ATOM   2136 N  NE2 . GLN A 1 303 ? 37.960  102.899 17.782  1.00 55.17 ? 303  GLN A NE2 1 
ATOM   2137 N  N   . PRO A 1 304 ? 41.217  106.040 20.395  1.00 54.23 ? 304  PRO A N   1 
ATOM   2138 C  CA  . PRO A 1 304 ? 41.436  106.340 21.814  1.00 54.30 ? 304  PRO A CA  1 
ATOM   2139 C  C   . PRO A 1 304 ? 41.838  107.792 22.080  1.00 54.33 ? 304  PRO A C   1 
ATOM   2140 O  O   . PRO A 1 304 ? 41.433  108.379 23.083  1.00 54.64 ? 304  PRO A O   1 
ATOM   2141 C  CB  . PRO A 1 304 ? 42.532  105.354 22.204  1.00 54.46 ? 304  PRO A CB  1 
ATOM   2142 C  CG  . PRO A 1 304 ? 42.218  104.168 21.340  1.00 54.45 ? 304  PRO A CG  1 
ATOM   2143 C  CD  . PRO A 1 304 ? 41.949  104.822 20.002  1.00 54.33 ? 304  PRO A CD  1 
ATOM   2144 N  N   . SER A 1 305 ? 42.626  108.369 21.177  1.00 54.04 ? 305  SER A N   1 
ATOM   2145 C  CA  . SER A 1 305 ? 43.078  109.749 21.330  1.00 53.75 ? 305  SER A CA  1 
ATOM   2146 C  C   . SER A 1 305 ? 42.259  110.752 20.515  1.00 53.54 ? 305  SER A C   1 
ATOM   2147 O  O   . SER A 1 305 ? 41.344  111.387 21.041  1.00 53.70 ? 305  SER A O   1 
ATOM   2148 C  CB  . SER A 1 305 ? 44.555  109.863 20.942  1.00 53.91 ? 305  SER A CB  1 
ATOM   2149 O  OG  . SER A 1 305 ? 44.766  109.466 19.598  1.00 54.07 ? 305  SER A OG  1 
ATOM   2150 N  N   . HIS A 1 306 ? 42.596  110.891 19.234  1.00 53.00 ? 306  HIS A N   1 
ATOM   2151 C  CA  . HIS A 1 306 ? 41.908  111.827 18.343  1.00 52.01 ? 306  HIS A CA  1 
ATOM   2152 C  C   . HIS A 1 306 ? 40.475  111.444 17.985  1.00 50.55 ? 306  HIS A C   1 
ATOM   2153 O  O   . HIS A 1 306 ? 40.007  111.741 16.884  1.00 50.81 ? 306  HIS A O   1 
ATOM   2154 C  CB  . HIS A 1 306 ? 42.704  112.010 17.047  1.00 53.20 ? 306  HIS A CB  1 
ATOM   2155 C  CG  . HIS A 1 306 ? 43.877  112.930 17.176  1.00 54.44 ? 306  HIS A CG  1 
ATOM   2156 N  ND1 . HIS A 1 306 ? 44.615  113.349 16.089  1.00 54.90 ? 306  HIS A ND1 1 
ATOM   2157 C  CD2 . HIS A 1 306 ? 44.435  113.521 18.260  1.00 55.06 ? 306  HIS A CD2 1 
ATOM   2158 C  CE1 . HIS A 1 306 ? 45.575  114.160 16.497  1.00 55.28 ? 306  HIS A CE1 1 
ATOM   2159 N  NE2 . HIS A 1 306 ? 45.488  114.281 17.810  1.00 55.67 ? 306  HIS A NE2 1 
ATOM   2160 N  N   . SER A 1 307 ? 39.775  110.796 18.910  1.00 48.34 ? 307  SER A N   1 
ATOM   2161 C  CA  . SER A 1 307 ? 38.397  110.390 18.665  1.00 45.85 ? 307  SER A CA  1 
ATOM   2162 C  C   . SER A 1 307 ? 37.514  111.580 18.294  1.00 44.03 ? 307  SER A C   1 
ATOM   2163 O  O   . SER A 1 307 ? 37.973  112.727 18.258  1.00 44.25 ? 307  SER A O   1 
ATOM   2164 C  CB  . SER A 1 307 ? 37.817  109.707 19.903  1.00 46.31 ? 307  SER A CB  1 
ATOM   2165 O  OG  . SER A 1 307 ? 36.484  109.284 19.672  1.00 46.57 ? 307  SER A OG  1 
ATOM   2166 N  N   . SER A 1 308 ? 36.244  111.285 18.027  1.00 41.00 ? 308  SER A N   1 
ATOM   2167 C  CA  . SER A 1 308 ? 35.246  112.283 17.656  1.00 37.63 ? 308  SER A CA  1 
ATOM   2168 C  C   . SER A 1 308 ? 34.110  111.556 16.948  1.00 35.42 ? 308  SER A C   1 
ATOM   2169 O  O   . SER A 1 308 ? 34.261  110.405 16.539  1.00 34.93 ? 308  SER A O   1 
ATOM   2170 C  CB  . SER A 1 308 ? 35.837  113.316 16.698  1.00 37.61 ? 308  SER A CB  1 
ATOM   2171 O  OG  . SER A 1 308 ? 36.145  112.719 15.452  1.00 37.37 ? 308  SER A OG  1 
ATOM   2172 N  N   . PRO A 1 309 ? 32.951  112.213 16.802  1.00 33.00 ? 309  PRO A N   1 
ATOM   2173 C  CA  . PRO A 1 309 ? 31.852  111.532 16.117  1.00 30.97 ? 309  PRO A CA  1 
ATOM   2174 C  C   . PRO A 1 309 ? 32.201  111.275 14.650  1.00 28.90 ? 309  PRO A C   1 
ATOM   2175 O  O   . PRO A 1 309 ? 31.699  110.332 14.045  1.00 27.79 ? 309  PRO A O   1 
ATOM   2176 C  CB  . PRO A 1 309 ? 30.680  112.502 16.294  1.00 31.16 ? 309  PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1 309 ? 31.349  113.840 16.391  1.00 32.13 ? 309  PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1 309 ? 32.539  113.545 17.276  1.00 32.60 ? 309  PRO A CD  1 
ATOM   2179 N  N   . TYR A 1 310 ? 33.079  112.105 14.092  1.00 27.14 ? 310  TYR A N   1 
ATOM   2180 C  CA  . TYR A 1 310 ? 33.487  111.956 12.694  1.00 26.06 ? 310  TYR A CA  1 
ATOM   2181 C  C   . TYR A 1 310 ? 34.278  110.670 12.481  1.00 24.58 ? 310  TYR A C   1 
ATOM   2182 O  O   . TYR A 1 310 ? 34.065  109.956 11.503  1.00 23.82 ? 310  TYR A O   1 
ATOM   2183 C  CB  . TYR A 1 310 ? 34.332  113.154 12.249  1.00 27.05 ? 310  TYR A CB  1 
ATOM   2184 C  CG  . TYR A 1 310 ? 33.728  114.482 12.635  1.00 28.45 ? 310  TYR A CG  1 
ATOM   2185 C  CD1 . TYR A 1 310 ? 34.302  115.260 13.637  1.00 29.07 ? 310  TYR A CD1 1 
ATOM   2186 C  CD2 . TYR A 1 310 ? 32.542  114.925 12.052  1.00 29.03 ? 310  TYR A CD2 1 
ATOM   2187 C  CE1 . TYR A 1 310 ? 33.709  116.442 14.057  1.00 30.22 ? 310  TYR A CE1 1 
ATOM   2188 C  CE2 . TYR A 1 310 ? 31.937  116.109 12.465  1.00 30.21 ? 310  TYR A CE2 1 
ATOM   2189 C  CZ  . TYR A 1 310 ? 32.525  116.860 13.471  1.00 30.47 ? 310  TYR A CZ  1 
ATOM   2190 O  OH  . TYR A 1 310 ? 31.921  118.012 13.916  1.00 31.26 ? 310  TYR A OH  1 
ATOM   2191 N  N   . LEU A 1 311 ? 35.190  110.379 13.400  1.00 23.59 ? 311  LEU A N   1 
ATOM   2192 C  CA  . LEU A 1 311 ? 36.000  109.171 13.299  1.00 23.27 ? 311  LEU A CA  1 
ATOM   2193 C  C   . LEU A 1 311 ? 35.137  107.933 13.532  1.00 22.12 ? 311  LEU A C   1 
ATOM   2194 O  O   . LEU A 1 311 ? 35.240  106.948 12.801  1.00 21.17 ? 311  LEU A O   1 
ATOM   2195 C  CB  . LEU A 1 311 ? 37.148  109.225 14.315  1.00 24.21 ? 311  LEU A CB  1 
ATOM   2196 C  CG  . LEU A 1 311 ? 38.074  108.012 14.461  1.00 25.35 ? 311  LEU A CG  1 
ATOM   2197 C  CD1 . LEU A 1 311 ? 38.344  107.373 13.118  1.00 26.71 ? 311  LEU A CD1 1 
ATOM   2198 C  CD2 . LEU A 1 311 ? 39.380  108.472 15.098  1.00 26.04 ? 311  LEU A CD2 1 
ATOM   2199 N  N   . ILE A 1 312 ? 34.279  107.999 14.547  1.00 21.34 ? 312  ILE A N   1 
ATOM   2200 C  CA  . ILE A 1 312 ? 33.394  106.887 14.886  1.00 20.59 ? 312  ILE A CA  1 
ATOM   2201 C  C   . ILE A 1 312 ? 32.436  106.608 13.734  1.00 19.50 ? 312  ILE A C   1 
ATOM   2202 O  O   . ILE A 1 312 ? 32.182  105.451 13.388  1.00 18.62 ? 312  ILE A O   1 
ATOM   2203 C  CB  . ILE A 1 312 ? 32.574  107.192 16.164  1.00 21.12 ? 312  ILE A CB  1 
ATOM   2204 C  CG1 . ILE A 1 312 ? 33.520  107.412 17.344  1.00 22.14 ? 312  ILE A CG1 1 
ATOM   2205 C  CG2 . ILE A 1 312 ? 31.613  106.045 16.463  1.00 21.23 ? 312  ILE A CG2 1 
ATOM   2206 C  CD1 . ILE A 1 312 ? 34.451  106.235 17.613  1.00 23.94 ? 312  ILE A CD1 1 
ATOM   2207 N  N   . ALA A 1 313 ? 31.904  107.673 13.145  1.00 18.56 ? 313  ALA A N   1 
ATOM   2208 C  CA  . ALA A 1 313 ? 30.986  107.532 12.021  1.00 18.34 ? 313  ALA A CA  1 
ATOM   2209 C  C   . ALA A 1 313 ? 31.738  106.938 10.830  1.00 18.10 ? 313  ALA A C   1 
ATOM   2210 O  O   . ALA A 1 313 ? 31.195  106.117 10.090  1.00 17.86 ? 313  ALA A O   1 
ATOM   2211 C  CB  . ALA A 1 313 ? 30.388  108.893 11.651  1.00 18.17 ? 313  ALA A CB  1 
ATOM   2212 N  N   . PHE A 1 314 ? 32.992  107.343 10.646  1.00 18.28 ? 314  PHE A N   1 
ATOM   2213 C  CA  . PHE A 1 314 ? 33.771  106.813 9.531   1.00 18.52 ? 314  PHE A CA  1 
ATOM   2214 C  C   . PHE A 1 314 ? 33.974  105.305 9.713   1.00 18.58 ? 314  PHE A C   1 
ATOM   2215 O  O   . PHE A 1 314 ? 33.928  104.546 8.745   1.00 18.98 ? 314  PHE A O   1 
ATOM   2216 C  CB  . PHE A 1 314 ? 35.126  107.518 9.427   1.00 18.95 ? 314  PHE A CB  1 
ATOM   2217 C  CG  . PHE A 1 314 ? 35.741  107.444 8.053   1.00 19.07 ? 314  PHE A CG  1 
ATOM   2218 C  CD1 . PHE A 1 314 ? 35.690  108.536 7.194   1.00 19.02 ? 314  PHE A CD1 1 
ATOM   2219 C  CD2 . PHE A 1 314 ? 36.350  106.275 7.611   1.00 19.42 ? 314  PHE A CD2 1 
ATOM   2220 C  CE1 . PHE A 1 314 ? 36.237  108.467 5.914   1.00 19.39 ? 314  PHE A CE1 1 
ATOM   2221 C  CE2 . PHE A 1 314 ? 36.901  106.193 6.330   1.00 19.41 ? 314  PHE A CE2 1 
ATOM   2222 C  CZ  . PHE A 1 314 ? 36.845  107.290 5.481   1.00 19.16 ? 314  PHE A CZ  1 
ATOM   2223 N  N   . LEU A 1 315 ? 34.191  104.871 10.954  1.00 18.07 ? 315  LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 315 ? 34.376  103.448 11.240  1.00 18.41 ? 315  LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 315 ? 33.115  102.675 10.853  1.00 18.10 ? 315  LEU A C   1 
ATOM   2226 O  O   . LEU A 1 315 ? 33.192  101.595 10.264  1.00 18.07 ? 315  LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 315 ? 34.689  103.230 12.728  1.00 18.34 ? 315  LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 315 ? 36.050  103.742 13.218  1.00 19.19 ? 315  LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 315 ? 36.166  103.562 14.732  1.00 19.33 ? 315  LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 315 ? 37.162  102.981 12.510  1.00 19.62 ? 315  LEU A CD2 1 
ATOM   2231 N  N   . VAL A 1 316 ? 31.953  103.230 11.181  1.00 17.58 ? 316  VAL A N   1 
ATOM   2232 C  CA  . VAL A 1 316 ? 30.694  102.579 10.839  1.00 17.60 ? 316  VAL A CA  1 
ATOM   2233 C  C   . VAL A 1 316 ? 30.572  102.472 9.319   1.00 18.06 ? 316  VAL A C   1 
ATOM   2234 O  O   . VAL A 1 316 ? 30.136  101.446 8.800   1.00 17.93 ? 316  VAL A O   1 
ATOM   2235 C  CB  . VAL A 1 316 ? 29.484  103.362 11.393  1.00 17.37 ? 316  VAL A CB  1 
ATOM   2236 C  CG1 . VAL A 1 316 ? 28.185  102.742 10.889  1.00 15.94 ? 316  VAL A CG1 1 
ATOM   2237 C  CG2 . VAL A 1 316 ? 29.518  103.356 12.920  1.00 17.52 ? 316  VAL A CG2 1 
ATOM   2238 N  N   . ASP A 1 317 ? 30.960  103.533 8.611   1.00 18.60 ? 317  ASP A N   1 
ATOM   2239 C  CA  . ASP A 1 317 ? 30.902  103.537 7.150   1.00 19.29 ? 317  ASP A CA  1 
ATOM   2240 C  C   . ASP A 1 317 ? 31.797  102.430 6.592   1.00 19.14 ? 317  ASP A C   1 
ATOM   2241 O  O   . ASP A 1 317 ? 31.450  101.783 5.605   1.00 18.80 ? 317  ASP A O   1 
ATOM   2242 C  CB  . ASP A 1 317 ? 31.360  104.887 6.582   1.00 20.70 ? 317  ASP A CB  1 
ATOM   2243 C  CG  . ASP A 1 317 ? 30.517  106.056 7.074   1.00 23.29 ? 317  ASP A CG  1 
ATOM   2244 O  OD1 . ASP A 1 317 ? 29.283  105.896 7.208   1.00 23.44 ? 317  ASP A OD1 1 
ATOM   2245 O  OD2 . ASP A 1 317 ? 31.094  107.144 7.313   1.00 24.67 ? 317  ASP A OD2 1 
ATOM   2246 N  N   . ILE A 1 318 ? 32.955  102.225 7.214   1.00 19.04 ? 318  ILE A N   1 
ATOM   2247 C  CA  . ILE A 1 318 ? 33.873  101.176 6.773   1.00 19.16 ? 318  ILE A CA  1 
ATOM   2248 C  C   . ILE A 1 318 ? 33.236  99.804  7.006   1.00 19.67 ? 318  ILE A C   1 
ATOM   2249 O  O   . ILE A 1 318 ? 33.187  98.966  6.106   1.00 19.23 ? 318  ILE A O   1 
ATOM   2250 C  CB  . ILE A 1 318 ? 35.223  101.245 7.533   1.00 18.89 ? 318  ILE A CB  1 
ATOM   2251 C  CG1 . ILE A 1 318 ? 35.994  102.500 7.115   1.00 18.57 ? 318  ILE A CG1 1 
ATOM   2252 C  CG2 . ILE A 1 318 ? 36.067  100.002 7.232   1.00 19.04 ? 318  ILE A CG2 1 
ATOM   2253 C  CD1 . ILE A 1 318 ? 37.325  102.695 7.850   1.00 18.27 ? 318  ILE A CD1 1 
ATOM   2254 N  N   . TYR A 1 319 ? 32.741  99.583  8.217   1.00 19.97 ? 319  TYR A N   1 
ATOM   2255 C  CA  . TYR A 1 319 ? 32.103  98.318  8.557   1.00 21.00 ? 319  TYR A CA  1 
ATOM   2256 C  C   . TYR A 1 319 ? 30.927  98.038  7.625   1.00 21.42 ? 319  TYR A C   1 
ATOM   2257 O  O   . TYR A 1 319 ? 30.705  96.898  7.223   1.00 20.88 ? 319  TYR A O   1 
ATOM   2258 C  CB  . TYR A 1 319 ? 31.636  98.353  10.012  1.00 21.24 ? 319  TYR A CB  1 
ATOM   2259 C  CG  . TYR A 1 319 ? 32.775  98.361  11.008  1.00 22.41 ? 319  TYR A CG  1 
ATOM   2260 C  CD1 . TYR A 1 319 ? 32.637  98.987  12.248  1.00 23.03 ? 319  TYR A CD1 1 
ATOM   2261 C  CD2 . TYR A 1 319 ? 33.991  97.737  10.716  1.00 22.95 ? 319  TYR A CD2 1 
ATOM   2262 C  CE1 . TYR A 1 319 ? 33.679  98.995  13.172  1.00 23.57 ? 319  TYR A CE1 1 
ATOM   2263 C  CE2 . TYR A 1 319 ? 35.044  97.739  11.639  1.00 23.64 ? 319  TYR A CE2 1 
ATOM   2264 C  CZ  . TYR A 1 319 ? 34.877  98.371  12.863  1.00 24.32 ? 319  TYR A CZ  1 
ATOM   2265 O  OH  . TYR A 1 319 ? 35.901  98.385  13.784  1.00 25.68 ? 319  TYR A OH  1 
ATOM   2266 N  N   . GLU A 1 320 ? 30.175  99.085  7.292   1.00 21.89 ? 320  GLU A N   1 
ATOM   2267 C  CA  . GLU A 1 320 ? 29.034  98.956  6.387   1.00 22.76 ? 320  GLU A CA  1 
ATOM   2268 C  C   . GLU A 1 320 ? 29.486  98.358  5.060   1.00 22.25 ? 320  GLU A C   1 
ATOM   2269 O  O   . GLU A 1 320 ? 28.893  97.399  4.556   1.00 22.02 ? 320  GLU A O   1 
ATOM   2270 C  CB  . GLU A 1 320 ? 28.418  100.327 6.103   1.00 24.07 ? 320  GLU A CB  1 
ATOM   2271 C  CG  . GLU A 1 320 ? 27.392  100.804 7.102   1.00 27.14 ? 320  GLU A CG  1 
ATOM   2272 C  CD  . GLU A 1 320 ? 26.985  102.247 6.854   1.00 28.76 ? 320  GLU A CD  1 
ATOM   2273 O  OE1 . GLU A 1 320 ? 27.053  102.695 5.688   1.00 29.60 ? 320  GLU A OE1 1 
ATOM   2274 O  OE2 . GLU A 1 320 ? 26.588  102.928 7.822   1.00 30.12 ? 320  GLU A OE2 1 
ATOM   2275 N  N   . ASP A 1 321 ? 30.533  98.945  4.490   1.00 22.00 ? 321  ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 321 ? 31.059  98.481  3.213   1.00 22.32 ? 321  ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 321 ? 31.669  97.087  3.327   1.00 22.32 ? 321  ASP A C   1 
ATOM   2278 O  O   . ASP A 1 321 ? 31.540  96.274  2.412   1.00 22.10 ? 321  ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 321 ? 32.102  99.462  2.671   1.00 22.12 ? 321  ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 321 ? 32.393  99.236  1.200   1.00 23.05 ? 321  ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 321 ? 31.436  99.302  0.403   1.00 22.88 ? 321  ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 321 ? 33.564  98.991  0.839   1.00 22.60 ? 321  ASP A OD2 1 
ATOM   2283 N  N   . MET A 1 322 ? 32.330  96.812  4.448   1.00 22.70 ? 322  MET A N   1 
ATOM   2284 C  CA  . MET A 1 322 ? 32.937  95.502  4.666   1.00 23.94 ? 322  MET A CA  1 
ATOM   2285 C  C   . MET A 1 322 ? 31.870  94.411  4.618   1.00 24.31 ? 322  MET A C   1 
ATOM   2286 O  O   . MET A 1 322 ? 32.031  93.399  3.934   1.00 23.51 ? 322  MET A O   1 
ATOM   2287 C  CB  . MET A 1 322 ? 33.653  95.459  6.019   1.00 24.93 ? 322  MET A CB  1 
ATOM   2288 C  CG  . MET A 1 322 ? 34.923  96.305  6.082   1.00 26.75 ? 322  MET A CG  1 
ATOM   2289 S  SD  . MET A 1 322 ? 35.774  96.161  7.670   1.00 28.38 ? 322  MET A SD  1 
ATOM   2290 C  CE  . MET A 1 322 ? 36.179  94.421  7.663   1.00 27.81 ? 322  MET A CE  1 
ATOM   2291 N  N   . LEU A 1 323 ? 30.782  94.628  5.350   1.00 24.98 ? 323  LEU A N   1 
ATOM   2292 C  CA  . LEU A 1 323 ? 29.680  93.676  5.401   1.00 26.34 ? 323  LEU A CA  1 
ATOM   2293 C  C   . LEU A 1 323 ? 29.037  93.505  4.030   1.00 28.11 ? 323  LEU A C   1 
ATOM   2294 O  O   . LEU A 1 323 ? 28.490  92.452  3.715   1.00 27.86 ? 323  LEU A O   1 
ATOM   2295 C  CB  . LEU A 1 323 ? 28.626  94.152  6.403   1.00 25.28 ? 323  LEU A CB  1 
ATOM   2296 C  CG  . LEU A 1 323 ? 29.077  94.198  7.865   1.00 24.89 ? 323  LEU A CG  1 
ATOM   2297 C  CD1 . LEU A 1 323 ? 28.055  94.957  8.696   1.00 24.58 ? 323  LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A 1 323 ? 29.252  92.780  8.386   1.00 24.88 ? 323  LEU A CD2 1 
ATOM   2299 N  N   . GLU A 1 324 ? 29.108  94.552  3.220   1.00 30.42 ? 324  GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 324 ? 28.527  94.535  1.886   1.00 33.37 ? 324  GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 324 ? 29.381  93.711  0.929   1.00 34.63 ? 324  GLU A C   1 
ATOM   2302 O  O   . GLU A 1 324 ? 28.921  93.308  -0.139  1.00 34.50 ? 324  GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 324 ? 28.417  95.968  1.364   1.00 34.59 ? 324  GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 324 ? 27.314  96.185  0.357   1.00 37.37 ? 324  GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 324 ? 25.956  95.862  0.937   1.00 38.55 ? 324  GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 324 ? 25.650  96.369  2.037   1.00 39.81 ? 324  GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 324 ? 25.197  95.107  0.296   1.00 39.65 ? 324  GLU A OE2 1 
ATOM   2308 N  N   . ASN A 1 325 ? 30.625  93.456  1.322   1.00 36.39 ? 325  ASN A N   1 
ATOM   2309 C  CA  . ASN A 1 325 ? 31.550  92.707  0.482   1.00 38.46 ? 325  ASN A CA  1 
ATOM   2310 C  C   . ASN A 1 325 ? 32.002  91.353  1.008   1.00 39.85 ? 325  ASN A C   1 
ATOM   2311 O  O   . ASN A 1 325 ? 33.144  90.951  0.783   1.00 40.55 ? 325  ASN A O   1 
ATOM   2312 C  CB  . ASN A 1 325 ? 32.774  93.570  0.185   1.00 38.47 ? 325  ASN A CB  1 
ATOM   2313 C  CG  . ASN A 1 325 ? 32.459  94.702  -0.760  1.00 38.71 ? 325  ASN A CG  1 
ATOM   2314 O  OD1 . ASN A 1 325 ? 32.259  94.486  -1.954  1.00 39.49 ? 325  ASN A OD1 1 
ATOM   2315 N  ND2 . ASN A 1 325 ? 32.398  95.918  -0.231  1.00 38.66 ? 325  ASN A ND2 1 
ATOM   2316 N  N   . GLN A 1 326 ? 31.114  90.653  1.705   1.00 41.21 ? 326  GLN A N   1 
ATOM   2317 C  CA  . GLN A 1 326 ? 31.430  89.328  2.229   1.00 42.72 ? 326  GLN A CA  1 
ATOM   2318 C  C   . GLN A 1 326 ? 32.767  89.282  2.966   1.00 42.76 ? 326  GLN A C   1 
ATOM   2319 O  O   . GLN A 1 326 ? 33.650  88.500  2.615   1.00 42.91 ? 326  GLN A O   1 
ATOM   2320 C  CB  . GLN A 1 326 ? 31.462  88.314  1.080   1.00 44.12 ? 326  GLN A CB  1 
ATOM   2321 C  CG  . GLN A 1 326 ? 30.185  88.254  0.246   1.00 46.24 ? 326  GLN A CG  1 
ATOM   2322 C  CD  . GLN A 1 326 ? 29.000  87.688  1.008   1.00 47.36 ? 326  GLN A CD  1 
ATOM   2323 O  OE1 . GLN A 1 326 ? 27.902  87.563  0.462   1.00 48.78 ? 326  GLN A OE1 1 
ATOM   2324 N  NE2 . GLN A 1 326 ? 29.214  87.340  2.273   1.00 48.21 ? 326  GLN A NE2 1 
ATOM   2325 N  N   . CYS A 1 327 ? 32.914  90.115  3.988   1.00 42.82 ? 327  CYS A N   1 
ATOM   2326 C  CA  . CYS A 1 327 ? 34.151  90.151  4.758   1.00 42.52 ? 327  CYS A CA  1 
ATOM   2327 C  C   . CYS A 1 327 ? 34.220  88.969  5.720   1.00 42.52 ? 327  CYS A C   1 
ATOM   2328 O  O   . CYS A 1 327 ? 33.207  88.324  6.002   1.00 42.15 ? 327  CYS A O   1 
ATOM   2329 C  CB  . CYS A 1 327 ? 34.234  91.448  5.561   1.00 42.48 ? 327  CYS A CB  1 
ATOM   2330 S  SG  . CYS A 1 327 ? 32.971  91.576  6.856   1.00 41.55 ? 327  CYS A SG  1 
ATOM   2331 N  N   . ASP A 1 328 ? 35.421  88.686  6.215   1.00 42.55 ? 328  ASP A N   1 
ATOM   2332 C  CA  . ASP A 1 328 ? 35.611  87.603  7.171   1.00 42.66 ? 328  ASP A CA  1 
ATOM   2333 C  C   . ASP A 1 328 ? 35.094  88.102  8.512   1.00 41.70 ? 328  ASP A C   1 
ATOM   2334 O  O   . ASP A 1 328 ? 34.996  89.309  8.731   1.00 41.82 ? 328  ASP A O   1 
ATOM   2335 C  CB  . ASP A 1 328 ? 37.095  87.250  7.303   1.00 44.19 ? 328  ASP A CB  1 
ATOM   2336 C  CG  . ASP A 1 328 ? 37.670  86.651  6.035   1.00 45.62 ? 328  ASP A CG  1 
ATOM   2337 O  OD1 . ASP A 1 328 ? 37.195  85.573  5.617   1.00 46.52 ? 328  ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A 1 328 ? 38.599  87.259  5.458   1.00 46.61 ? 328  ASP A OD2 1 
ATOM   2339 N  N   . ASN A 1 329 ? 34.766  87.177  9.407   1.00 40.46 ? 329  ASN A N   1 
ATOM   2340 C  CA  . ASN A 1 329 ? 34.265  87.541  10.726  1.00 39.16 ? 329  ASN A CA  1 
ATOM   2341 C  C   . ASN A 1 329 ? 33.066  88.478  10.612  1.00 37.57 ? 329  ASN A C   1 
ATOM   2342 O  O   . ASN A 1 329 ? 33.005  89.512  11.277  1.00 36.67 ? 329  ASN A O   1 
ATOM   2343 C  CB  . ASN A 1 329 ? 35.371  88.214  11.542  1.00 40.15 ? 329  ASN A CB  1 
ATOM   2344 C  CG  . ASN A 1 329 ? 36.605  87.343  11.679  1.00 41.39 ? 329  ASN A CG  1 
ATOM   2345 O  OD1 . ASN A 1 329 ? 36.519  86.184  12.096  1.00 42.04 ? 329  ASN A OD1 1 
ATOM   2346 N  ND2 . ASN A 1 329 ? 37.762  87.897  11.330  1.00 41.40 ? 329  ASN A ND2 1 
ATOM   2347 N  N   . LYS A 1 330 ? 32.118  88.099  9.763   1.00 36.07 ? 330  LYS A N   1 
ATOM   2348 C  CA  . LYS A 1 330 ? 30.908  88.882  9.536   1.00 35.14 ? 330  LYS A CA  1 
ATOM   2349 C  C   . LYS A 1 330 ? 30.226  89.253  10.851  1.00 33.70 ? 330  LYS A C   1 
ATOM   2350 O  O   . LYS A 1 330 ? 29.918  90.421  11.093  1.00 32.75 ? 330  LYS A O   1 
ATOM   2351 C  CB  . LYS A 1 330 ? 29.935  88.081  8.669   1.00 36.20 ? 330  LYS A CB  1 
ATOM   2352 C  CG  . LYS A 1 330 ? 28.961  88.923  7.868   1.00 37.85 ? 330  LYS A CG  1 
ATOM   2353 C  CD  . LYS A 1 330 ? 29.716  89.802  6.879   1.00 39.51 ? 330  LYS A CD  1 
ATOM   2354 C  CE  . LYS A 1 330 ? 28.780  90.445  5.866   1.00 39.63 ? 330  LYS A CE  1 
ATOM   2355 N  NZ  . LYS A 1 330 ? 28.245  89.445  4.909   1.00 40.42 ? 330  LYS A NZ  1 
ATOM   2356 N  N   . GLU A 1 331 ? 29.992  88.252  11.695  1.00 32.31 ? 331  GLU A N   1 
ATOM   2357 C  CA  . GLU A 1 331 ? 29.335  88.467  12.981  1.00 31.79 ? 331  GLU A CA  1 
ATOM   2358 C  C   . GLU A 1 331 ? 30.041  89.505  13.841  1.00 30.29 ? 331  GLU A C   1 
ATOM   2359 O  O   . GLU A 1 331 ? 29.398  90.372  14.434  1.00 29.92 ? 331  GLU A O   1 
ATOM   2360 C  CB  . GLU A 1 331 ? 29.239  87.154  13.764  1.00 33.00 ? 331  GLU A CB  1 
ATOM   2361 C  CG  . GLU A 1 331 ? 28.310  86.123  13.149  1.00 34.83 ? 331  GLU A CG  1 
ATOM   2362 C  CD  . GLU A 1 331 ? 26.933  86.689  12.851  1.00 36.78 ? 331  GLU A CD  1 
ATOM   2363 O  OE1 . GLU A 1 331 ? 26.367  87.390  13.720  1.00 37.38 ? 331  GLU A OE1 1 
ATOM   2364 O  OE2 . GLU A 1 331 ? 26.413  86.427  11.746  1.00 38.36 ? 331  GLU A OE2 1 
ATOM   2365 N  N   . ASP A 1 332 ? 31.363  89.405  13.912  1.00 28.90 ? 332  ASP A N   1 
ATOM   2366 C  CA  . ASP A 1 332 ? 32.158  90.329  14.707  1.00 27.82 ? 332  ASP A CA  1 
ATOM   2367 C  C   . ASP A 1 332 ? 32.044  91.759  14.190  1.00 26.19 ? 332  ASP A C   1 
ATOM   2368 O  O   . ASP A 1 332 ? 31.897  92.701  14.969  1.00 25.14 ? 332  ASP A O   1 
ATOM   2369 C  CB  . ASP A 1 332 ? 33.630  89.907  14.697  1.00 29.35 ? 332  ASP A CB  1 
ATOM   2370 C  CG  . ASP A 1 332 ? 34.503  90.831  15.526  1.00 31.13 ? 332  ASP A CG  1 
ATOM   2371 O  OD1 . ASP A 1 332 ? 34.309  90.882  16.761  1.00 32.31 ? 332  ASP A OD1 1 
ATOM   2372 O  OD2 . ASP A 1 332 ? 35.378  91.512  14.945  1.00 32.15 ? 332  ASP A OD2 1 
ATOM   2373 N  N   . ILE A 1 333 ? 32.124  91.912  12.872  1.00 24.28 ? 333  ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 333 ? 32.043  93.223  12.250  1.00 22.53 ? 333  ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 333 ? 30.667  93.837  12.485  1.00 21.53 ? 333  ILE A C   1 
ATOM   2376 O  O   . ILE A 1 333 ? 30.554  95.018  12.808  1.00 20.96 ? 333  ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 333 ? 32.313  93.133  10.731  1.00 22.48 ? 333  ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 333 ? 33.747  92.647  10.487  1.00 22.66 ? 333  ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 333 ? 32.070  94.490  10.070  1.00 21.82 ? 333  ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 333 ? 34.825  93.553  11.072  1.00 22.26 ? 333  ILE A CD1 1 
ATOM   2381 N  N   . LEU A 1 334 ? 29.625  93.028  12.327  1.00 20.60 ? 334  LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 334 ? 28.264  93.508  12.528  1.00 20.49 ? 334  LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 334 ? 28.073  93.983  13.966  1.00 20.68 ? 334  LEU A C   1 
ATOM   2384 O  O   . LEU A 1 334 ? 27.481  95.034  14.208  1.00 19.69 ? 334  LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 334 ? 27.253  92.402  12.212  1.00 19.96 ? 334  LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 334 ? 25.785  92.747  12.509  1.00 20.12 ? 334  LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 334 ? 25.392  94.011  11.745  1.00 20.15 ? 334  LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 334 ? 24.885  91.577  12.119  1.00 19.91 ? 334  LEU A CD2 1 
ATOM   2389 N  N   . ASN A 1 335 ? 28.576  93.206  14.921  1.00 21.00 ? 335  ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 335 ? 28.448  93.574  16.326  1.00 21.97 ? 335  ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 335 ? 29.165  94.893  16.614  1.00 21.49 ? 335  ASN A C   1 
ATOM   2392 O  O   . ASN A 1 335 ? 28.633  95.750  17.315  1.00 20.72 ? 335  ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 335 ? 29.002  92.463  17.223  1.00 24.34 ? 335  ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 335 ? 28.983  92.841  18.693  1.00 26.96 ? 335  ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 335 ? 30.010  93.211  19.267  1.00 29.17 ? 335  ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 335 ? 27.805  92.769  19.306  1.00 28.73 ? 335  ASN A ND2 1 
ATOM   2397 N  N   . LYS A 1 336 ? 30.368  95.054  16.065  1.00 21.67 ? 336  LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 336 ? 31.142  96.279  16.255  1.00 21.74 ? 336  LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 336 ? 30.360  97.466  15.692  1.00 21.03 ? 336  LYS A C   1 
ATOM   2400 O  O   . LYS A 1 336 ? 30.246  98.512  16.329  1.00 20.48 ? 336  LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 336 ? 32.484  96.198  15.518  1.00 23.42 ? 336  LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 336 ? 33.398  95.053  15.920  1.00 26.04 ? 336  LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 336 ? 34.114  95.322  17.227  1.00 27.95 ? 336  LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 336 ? 35.158  94.245  17.500  1.00 28.97 ? 336  LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 336 ? 36.143  94.131  16.384  1.00 30.54 ? 336  LYS A NZ  1 
ATOM   2406 N  N   . ALA A 1 337 ? 29.837  97.294  14.481  1.00 20.23 ? 337  ALA A N   1 
ATOM   2407 C  CA  . ALA A 1 337 ? 29.080  98.346  13.817  1.00 19.88 ? 337  ALA A CA  1 
ATOM   2408 C  C   . ALA A 1 337 ? 27.847  98.739  14.619  1.00 19.60 ? 337  ALA A C   1 
ATOM   2409 O  O   . ALA A 1 337 ? 27.569  99.925  14.795  1.00 19.65 ? 337  ALA A O   1 
ATOM   2410 C  CB  . ALA A 1 337 ? 28.679  97.897  12.414  1.00 19.08 ? 337  ALA A CB  1 
ATOM   2411 N  N   . LEU A 1 338 ? 27.113  97.751  15.116  1.00 19.71 ? 338  LEU A N   1 
ATOM   2412 C  CA  . LEU A 1 338 ? 25.916  98.044  15.895  1.00 20.20 ? 338  LEU A CA  1 
ATOM   2413 C  C   . LEU A 1 338 ? 26.258  98.759  17.200  1.00 20.26 ? 338  LEU A C   1 
ATOM   2414 O  O   . LEU A 1 338 ? 25.547  99.670  17.613  1.00 19.63 ? 338  LEU A O   1 
ATOM   2415 C  CB  . LEU A 1 338 ? 25.134  96.757  16.180  1.00 20.40 ? 338  LEU A CB  1 
ATOM   2416 C  CG  . LEU A 1 338 ? 24.504  96.100  14.944  1.00 21.00 ? 338  LEU A CG  1 
ATOM   2417 C  CD1 . LEU A 1 338 ? 23.805  94.811  15.340  1.00 21.65 ? 338  LEU A CD1 1 
ATOM   2418 C  CD2 . LEU A 1 338 ? 23.509  97.064  14.303  1.00 21.05 ? 338  LEU A CD2 1 
ATOM   2419 N  N   . GLU A 1 339 ? 27.346  98.353  17.849  1.00 20.88 ? 339  GLU A N   1 
ATOM   2420 C  CA  . GLU A 1 339 ? 27.748  99.000  19.094  1.00 21.63 ? 339  GLU A CA  1 
ATOM   2421 C  C   . GLU A 1 339 ? 28.059  100.471 18.827  1.00 20.54 ? 339  GLU A C   1 
ATOM   2422 O  O   . GLU A 1 339 ? 27.684  101.345 19.609  1.00 19.88 ? 339  GLU A O   1 
ATOM   2423 C  CB  . GLU A 1 339 ? 28.985  98.322  19.691  1.00 24.04 ? 339  GLU A CB  1 
ATOM   2424 C  CG  . GLU A 1 339 ? 28.776  96.868  20.080  1.00 28.59 ? 339  GLU A CG  1 
ATOM   2425 C  CD  . GLU A 1 339 ? 29.966  96.287  20.829  1.00 31.02 ? 339  GLU A CD  1 
ATOM   2426 O  OE1 . GLU A 1 339 ? 31.111  96.447  20.350  1.00 32.97 ? 339  GLU A OE1 1 
ATOM   2427 O  OE2 . GLU A 1 339 ? 29.752  95.664  21.892  1.00 32.98 ? 339  GLU A OE2 1 
ATOM   2428 N  N   . LEU A 1 340 ? 28.743  100.742 17.717  1.00 19.82 ? 340  LEU A N   1 
ATOM   2429 C  CA  . LEU A 1 340 ? 29.088  102.120 17.373  1.00 19.64 ? 340  LEU A CA  1 
ATOM   2430 C  C   . LEU A 1 340 ? 27.849  102.943 17.034  1.00 19.18 ? 340  LEU A C   1 
ATOM   2431 O  O   . LEU A 1 340 ? 27.763  104.116 17.401  1.00 18.71 ? 340  LEU A O   1 
ATOM   2432 C  CB  . LEU A 1 340 ? 30.085  102.154 16.210  1.00 19.32 ? 340  LEU A CB  1 
ATOM   2433 C  CG  . LEU A 1 340 ? 31.469  101.569 16.513  1.00 19.47 ? 340  LEU A CG  1 
ATOM   2434 C  CD1 . LEU A 1 340 ? 32.389  101.794 15.324  1.00 19.49 ? 340  LEU A CD1 1 
ATOM   2435 C  CD2 . LEU A 1 340 ? 32.050  102.233 17.764  1.00 19.12 ? 340  LEU A CD2 1 
ATOM   2436 N  N   . CYS A 1 341 ? 26.892  102.336 16.336  1.00 19.49 ? 341  CYS A N   1 
ATOM   2437 C  CA  . CYS A 1 341 ? 25.653  103.038 15.999  1.00 19.83 ? 341  CYS A CA  1 
ATOM   2438 C  C   . CYS A 1 341 ? 24.940  103.461 17.287  1.00 20.57 ? 341  CYS A C   1 
ATOM   2439 O  O   . CYS A 1 341 ? 24.398  104.562 17.375  1.00 20.76 ? 341  CYS A O   1 
ATOM   2440 C  CB  . CYS A 1 341 ? 24.723  102.143 15.167  1.00 19.36 ? 341  CYS A CB  1 
ATOM   2441 S  SG  . CYS A 1 341 ? 25.206  101.948 13.425  1.00 18.80 ? 341  CYS A SG  1 
ATOM   2442 N  N   . GLU A 1 342 ? 24.944  102.579 18.283  1.00 21.48 ? 342  GLU A N   1 
ATOM   2443 C  CA  . GLU A 1 342 ? 24.306  102.870 19.565  1.00 22.69 ? 342  GLU A CA  1 
ATOM   2444 C  C   . GLU A 1 342 ? 25.052  103.998 20.277  1.00 22.03 ? 342  GLU A C   1 
ATOM   2445 O  O   . GLU A 1 342 ? 24.437  104.910 20.830  1.00 21.92 ? 342  GLU A O   1 
ATOM   2446 C  CB  . GLU A 1 342 ? 24.281  101.609 20.442  1.00 24.78 ? 342  GLU A CB  1 
ATOM   2447 C  CG  . GLU A 1 342 ? 24.029  101.863 21.935  1.00 28.56 ? 342  GLU A CG  1 
ATOM   2448 C  CD  . GLU A 1 342 ? 22.628  102.365 22.248  1.00 30.70 ? 342  GLU A CD  1 
ATOM   2449 O  OE1 . GLU A 1 342 ? 22.405  102.834 23.389  1.00 33.35 ? 342  GLU A OE1 1 
ATOM   2450 O  OE2 . GLU A 1 342 ? 21.745  102.285 21.369  1.00 31.98 ? 342  GLU A OE2 1 
ATOM   2451 N  N   . ILE A 1 343 ? 26.380  103.933 20.259  1.00 21.71 ? 343  ILE A N   1 
ATOM   2452 C  CA  . ILE A 1 343 ? 27.199  104.962 20.895  1.00 21.66 ? 343  ILE A CA  1 
ATOM   2453 C  C   . ILE A 1 343 ? 26.938  106.323 20.246  1.00 20.61 ? 343  ILE A C   1 
ATOM   2454 O  O   . ILE A 1 343 ? 26.826  107.342 20.928  1.00 19.48 ? 343  ILE A O   1 
ATOM   2455 C  CB  . ILE A 1 343 ? 28.707  104.620 20.783  1.00 22.69 ? 343  ILE A CB  1 
ATOM   2456 C  CG1 . ILE A 1 343 ? 29.040  103.462 21.733  1.00 24.11 ? 343  ILE A CG1 1 
ATOM   2457 C  CG2 . ILE A 1 343 ? 29.555  105.848 21.086  1.00 23.23 ? 343  ILE A CG2 1 
ATOM   2458 C  CD1 . ILE A 1 343 ? 30.493  103.015 21.691  1.00 25.03 ? 343  ILE A CD1 1 
ATOM   2459 N  N   . LEU A 1 344 ? 26.836  106.329 18.924  1.00 19.27 ? 344  LEU A N   1 
ATOM   2460 C  CA  . LEU A 1 344 ? 26.584  107.566 18.200  1.00 19.39 ? 344  LEU A CA  1 
ATOM   2461 C  C   . LEU A 1 344 ? 25.189  108.107 18.501  1.00 19.09 ? 344  LEU A C   1 
ATOM   2462 O  O   . LEU A 1 344 ? 25.020  109.295 18.761  1.00 18.86 ? 344  LEU A O   1 
ATOM   2463 C  CB  . LEU A 1 344 ? 26.737  107.327 16.695  1.00 18.69 ? 344  LEU A CB  1 
ATOM   2464 C  CG  . LEU A 1 344 ? 28.176  107.123 16.214  1.00 18.44 ? 344  LEU A CG  1 
ATOM   2465 C  CD1 . LEU A 1 344 ? 28.184  106.460 14.843  1.00 17.84 ? 344  LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A 1 344 ? 28.889  108.470 16.171  1.00 17.51 ? 344  LEU A CD2 1 
ATOM   2467 N  N   . ALA A 1 345 ? 24.194  107.226 18.481  1.00 19.32 ? 345  ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 345 ? 22.812  107.630 18.727  1.00 20.39 ? 345  ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 345 ? 22.533  108.085 20.153  1.00 21.17 ? 345  ALA A C   1 
ATOM   2470 O  O   . ALA A 1 345 ? 21.737  108.995 20.377  1.00 20.83 ? 345  ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 345 ? 21.866  106.485 18.372  1.00 19.57 ? 345  ALA A CB  1 
ATOM   2472 N  N   . LYS A 1 346 ? 23.200  107.455 21.110  1.00 22.11 ? 346  LYS A N   1 
ATOM   2473 C  CA  . LYS A 1 346 ? 22.987  107.751 22.519  1.00 23.75 ? 346  LYS A CA  1 
ATOM   2474 C  C   . LYS A 1 346 ? 23.935  108.759 23.158  1.00 23.68 ? 346  LYS A C   1 
ATOM   2475 O  O   . LYS A 1 346 ? 23.551  109.462 24.093  1.00 22.90 ? 346  LYS A O   1 
ATOM   2476 C  CB  . LYS A 1 346 ? 23.044  106.439 23.312  1.00 25.68 ? 346  LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1 346 ? 23.076  106.602 24.827  1.00 28.79 ? 346  LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1 346 ? 21.762  107.155 25.371  1.00 31.10 ? 346  LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1 346 ? 20.615  106.182 25.143  1.00 32.80 ? 346  LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1 346 ? 20.913  104.841 25.731  1.00 33.74 ? 346  LYS A NZ  1 
ATOM   2481 N  N   . GLU A 1 347 ? 25.164  108.846 22.666  1.00 23.87 ? 347  GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 347 ? 26.115  109.753 23.289  1.00 24.59 ? 347  GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 347 ? 26.921  110.706 22.419  1.00 23.48 ? 347  GLU A C   1 
ATOM   2484 O  O   . GLU A 1 347 ? 26.946  111.910 22.678  1.00 23.12 ? 347  GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 347 ? 27.105  108.947 24.138  1.00 26.75 ? 347  GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 347 ? 28.217  109.799 24.741  1.00 30.86 ? 347  GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 347 ? 29.393  108.979 25.256  1.00 33.33 ? 347  GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 347 ? 30.385  109.591 25.709  1.00 34.85 ? 347  GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 347 ? 29.330  107.730 25.207  1.00 35.01 ? 347  GLU A OE2 1 
ATOM   2490 N  N   . LYS A 1 348 ? 27.581  110.175 21.396  1.00 22.41 ? 348  LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 348 ? 28.452  110.995 20.566  1.00 22.36 ? 348  LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 348 ? 27.883  111.782 19.392  1.00 20.98 ? 348  LYS A C   1 
ATOM   2493 O  O   . LYS A 1 348 ? 28.530  112.707 18.908  1.00 20.20 ? 348  LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 348 ? 29.628  110.141 20.083  1.00 24.35 ? 348  LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 348 ? 30.543  109.673 21.215  1.00 26.79 ? 348  LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 348 ? 31.759  108.938 20.678  1.00 29.34 ? 348  LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 348 ? 32.706  108.524 21.801  1.00 30.82 ? 348  LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 348 ? 33.279  109.705 22.509  1.00 32.62 ? 348  LYS A NZ  1 
ATOM   2499 N  N   . ASP A 1 349 ? 26.690  111.432 18.927  1.00 19.33 ? 349  ASP A N   1 
ATOM   2500 C  CA  . ASP A 1 349 ? 26.104  112.149 17.797  1.00 18.29 ? 349  ASP A CA  1 
ATOM   2501 C  C   . ASP A 1 349 ? 24.585  112.068 17.907  1.00 17.10 ? 349  ASP A C   1 
ATOM   2502 O  O   . ASP A 1 349 ? 23.891  111.708 16.955  1.00 16.30 ? 349  ASP A O   1 
ATOM   2503 C  CB  . ASP A 1 349 ? 26.604  111.520 16.490  1.00 18.30 ? 349  ASP A CB  1 
ATOM   2504 C  CG  . ASP A 1 349 ? 26.446  112.441 15.296  1.00 19.03 ? 349  ASP A CG  1 
ATOM   2505 O  OD1 . ASP A 1 349 ? 26.560  113.669 15.475  1.00 19.24 ? 349  ASP A OD1 1 
ATOM   2506 O  OD2 . ASP A 1 349 ? 26.226  111.936 14.176  1.00 18.99 ? 349  ASP A OD2 1 
ATOM   2507 N  N   . THR A 1 350 ? 24.082  112.430 19.085  1.00 16.31 ? 350  THR A N   1 
ATOM   2508 C  CA  . THR A 1 350 ? 22.656  112.364 19.377  1.00 15.75 ? 350  THR A CA  1 
ATOM   2509 C  C   . THR A 1 350 ? 21.747  113.163 18.458  1.00 15.51 ? 350  THR A C   1 
ATOM   2510 O  O   . THR A 1 350 ? 20.588  112.799 18.279  1.00 15.64 ? 350  THR A O   1 
ATOM   2511 C  CB  . THR A 1 350 ? 22.358  112.773 20.845  1.00 15.53 ? 350  THR A CB  1 
ATOM   2512 O  OG1 . THR A 1 350 ? 22.699  114.153 21.051  1.00 16.02 ? 350  THR A OG1 1 
ATOM   2513 C  CG2 . THR A 1 350 ? 23.160  111.901 21.808  1.00 15.76 ? 350  THR A CG2 1 
ATOM   2514 N  N   . ILE A 1 351 ? 22.247  114.247 17.874  1.00 15.01 ? 351  ILE A N   1 
ATOM   2515 C  CA  . ILE A 1 351 ? 21.403  115.032 16.979  1.00 15.60 ? 351  ILE A CA  1 
ATOM   2516 C  C   . ILE A 1 351 ? 20.958  114.143 15.808  1.00 15.92 ? 351  ILE A C   1 
ATOM   2517 O  O   . ILE A 1 351 ? 19.896  114.350 15.216  1.00 15.97 ? 351  ILE A O   1 
ATOM   2518 C  CB  . ILE A 1 351 ? 22.148  116.285 16.436  1.00 15.27 ? 351  ILE A CB  1 
ATOM   2519 C  CG1 . ILE A 1 351 ? 21.149  117.232 15.759  1.00 15.23 ? 351  ILE A CG1 1 
ATOM   2520 C  CG2 . ILE A 1 351 ? 23.252  115.880 15.463  1.00 15.29 ? 351  ILE A CG2 1 
ATOM   2521 C  CD1 . ILE A 1 351 ? 20.250  117.973 16.738  1.00 13.68 ? 351  ILE A CD1 1 
ATOM   2522 N  N   . ARG A 1 352 ? 21.769  113.138 15.495  1.00 16.23 ? 352  ARG A N   1 
ATOM   2523 C  CA  . ARG A 1 352 ? 21.464  112.223 14.401  1.00 16.67 ? 352  ARG A CA  1 
ATOM   2524 C  C   . ARG A 1 352 ? 21.005  110.844 14.884  1.00 16.94 ? 352  ARG A C   1 
ATOM   2525 O  O   . ARG A 1 352 ? 21.173  109.846 14.188  1.00 16.86 ? 352  ARG A O   1 
ATOM   2526 C  CB  . ARG A 1 352 ? 22.688  112.089 13.487  1.00 16.94 ? 352  ARG A CB  1 
ATOM   2527 C  CG  . ARG A 1 352 ? 22.824  113.237 12.485  1.00 17.80 ? 352  ARG A CG  1 
ATOM   2528 C  CD  . ARG A 1 352 ? 24.198  113.282 11.840  1.00 18.39 ? 352  ARG A CD  1 
ATOM   2529 N  NE  . ARG A 1 352 ? 25.163  113.985 12.686  1.00 19.07 ? 352  ARG A NE  1 
ATOM   2530 C  CZ  . ARG A 1 352 ? 25.211  115.307 12.849  1.00 18.47 ? 352  ARG A CZ  1 
ATOM   2531 N  NH1 . ARG A 1 352 ? 24.347  116.103 12.219  1.00 17.84 ? 352  ARG A NH1 1 
ATOM   2532 N  NH2 . ARG A 1 352 ? 26.126  115.837 13.652  1.00 17.65 ? 352  ARG A NH2 1 
ATOM   2533 N  N   . LYS A 1 353 ? 20.407  110.801 16.069  1.00 17.66 ? 353  LYS A N   1 
ATOM   2534 C  CA  . LYS A 1 353 ? 19.928  109.549 16.643  1.00 18.68 ? 353  LYS A CA  1 
ATOM   2535 C  C   . LYS A 1 353 ? 19.024  108.753 15.695  1.00 18.18 ? 353  LYS A C   1 
ATOM   2536 O  O   . LYS A 1 353 ? 19.170  107.538 15.579  1.00 17.15 ? 353  LYS A O   1 
ATOM   2537 C  CB  . LYS A 1 353 ? 19.173  109.819 17.946  1.00 20.31 ? 353  LYS A CB  1 
ATOM   2538 C  CG  . LYS A 1 353 ? 17.941  110.697 17.766  1.00 23.62 ? 353  LYS A CG  1 
ATOM   2539 C  CD  . LYS A 1 353 ? 17.204  110.892 19.082  1.00 26.52 ? 353  LYS A CD  1 
ATOM   2540 C  CE  . LYS A 1 353 ? 15.999  111.797 18.921  1.00 26.83 ? 353  LYS A CE  1 
ATOM   2541 N  NZ  . LYS A 1 353 ? 15.316  111.968 20.228  1.00 28.67 ? 353  LYS A NZ  1 
ATOM   2542 N  N   . GLU A 1 354 ? 18.090  109.425 15.025  1.00 17.70 ? 354  GLU A N   1 
ATOM   2543 C  CA  . GLU A 1 354 ? 17.189  108.725 14.108  1.00 18.04 ? 354  GLU A CA  1 
ATOM   2544 C  C   . GLU A 1 354 ? 17.950  108.092 12.954  1.00 17.88 ? 354  GLU A C   1 
ATOM   2545 O  O   . GLU A 1 354 ? 17.643  106.973 12.533  1.00 18.02 ? 354  GLU A O   1 
ATOM   2546 C  CB  . GLU A 1 354 ? 16.117  109.670 13.554  1.00 18.83 ? 354  GLU A CB  1 
ATOM   2547 C  CG  . GLU A 1 354 ? 14.955  109.930 14.503  1.00 20.27 ? 354  GLU A CG  1 
ATOM   2548 C  CD  . GLU A 1 354 ? 14.305  108.647 15.022  1.00 21.52 ? 354  GLU A CD  1 
ATOM   2549 O  OE1 . GLU A 1 354 ? 14.063  107.713 14.224  1.00 20.78 ? 354  GLU A OE1 1 
ATOM   2550 O  OE2 . GLU A 1 354 ? 14.020  108.581 16.235  1.00 21.93 ? 354  GLU A OE2 1 
ATOM   2551 N  N   . TYR A 1 355 ? 18.939  108.809 12.437  1.00 17.45 ? 355  TYR A N   1 
ATOM   2552 C  CA  . TYR A 1 355 ? 19.744  108.292 11.342  1.00 17.47 ? 355  TYR A CA  1 
ATOM   2553 C  C   . TYR A 1 355 ? 20.543  107.071 11.802  1.00 17.49 ? 355  TYR A C   1 
ATOM   2554 O  O   . TYR A 1 355 ? 20.563  106.046 11.124  1.00 17.29 ? 355  TYR A O   1 
ATOM   2555 C  CB  . TYR A 1 355 ? 20.708  109.364 10.836  1.00 17.02 ? 355  TYR A CB  1 
ATOM   2556 C  CG  . TYR A 1 355 ? 21.715  108.836 9.839   1.00 17.31 ? 355  TYR A CG  1 
ATOM   2557 C  CD1 . TYR A 1 355 ? 21.339  108.537 8.531   1.00 17.31 ? 355  TYR A CD1 1 
ATOM   2558 C  CD2 . TYR A 1 355 ? 23.037  108.609 10.212  1.00 17.26 ? 355  TYR A CD2 1 
ATOM   2559 C  CE1 . TYR A 1 355 ? 22.257  108.026 7.620   1.00 17.96 ? 355  TYR A CE1 1 
ATOM   2560 C  CE2 . TYR A 1 355 ? 23.963  108.096 9.308   1.00 18.04 ? 355  TYR A CE2 1 
ATOM   2561 C  CZ  . TYR A 1 355 ? 23.566  107.808 8.013   1.00 17.58 ? 355  TYR A CZ  1 
ATOM   2562 O  OH  . TYR A 1 355 ? 24.476  107.305 7.113   1.00 17.76 ? 355  TYR A OH  1 
ATOM   2563 N  N   . TRP A 1 356 ? 21.198  107.178 12.956  1.00 17.82 ? 356  TRP A N   1 
ATOM   2564 C  CA  . TRP A 1 356 ? 21.994  106.062 13.459  1.00 18.27 ? 356  TRP A CA  1 
ATOM   2565 C  C   . TRP A 1 356 ? 21.156  104.839 13.822  1.00 18.62 ? 356  TRP A C   1 
ATOM   2566 O  O   . TRP A 1 356 ? 21.614  103.708 13.664  1.00 19.14 ? 356  TRP A O   1 
ATOM   2567 C  CB  . TRP A 1 356 ? 22.865  106.518 14.635  1.00 17.82 ? 356  TRP A CB  1 
ATOM   2568 C  CG  . TRP A 1 356 ? 23.971  107.431 14.179  1.00 17.60 ? 356  TRP A CG  1 
ATOM   2569 C  CD1 . TRP A 1 356 ? 24.182  108.728 14.563  1.00 17.24 ? 356  TRP A CD1 1 
ATOM   2570 C  CD2 . TRP A 1 356 ? 24.959  107.144 13.179  1.00 17.50 ? 356  TRP A CD2 1 
ATOM   2571 N  NE1 . TRP A 1 356 ? 25.235  109.267 13.858  1.00 17.77 ? 356  TRP A NE1 1 
ATOM   2572 C  CE2 . TRP A 1 356 ? 25.729  108.317 13.002  1.00 17.73 ? 356  TRP A CE2 1 
ATOM   2573 C  CE3 . TRP A 1 356 ? 25.267  106.009 12.412  1.00 17.96 ? 356  TRP A CE3 1 
ATOM   2574 C  CZ2 . TRP A 1 356 ? 26.786  108.389 12.088  1.00 17.62 ? 356  TRP A CZ2 1 
ATOM   2575 C  CZ3 . TRP A 1 356 ? 26.320  106.079 11.503  1.00 17.73 ? 356  TRP A CZ3 1 
ATOM   2576 C  CH2 . TRP A 1 356 ? 27.066  107.263 11.349  1.00 17.79 ? 356  TRP A CH2 1 
ATOM   2577 N  N   . ARG A 1 357 ? 19.928  105.057 14.293  1.00 19.20 ? 357  ARG A N   1 
ATOM   2578 C  CA  . ARG A 1 357 ? 19.040  103.941 14.619  1.00 19.37 ? 357  ARG A CA  1 
ATOM   2579 C  C   . ARG A 1 357 ? 18.667  103.256 13.306  1.00 18.31 ? 357  ARG A C   1 
ATOM   2580 O  O   . ARG A 1 357 ? 18.583  102.030 13.225  1.00 18.07 ? 357  ARG A O   1 
ATOM   2581 C  CB  . ARG A 1 357 ? 17.759  104.429 15.305  1.00 21.41 ? 357  ARG A CB  1 
ATOM   2582 C  CG  . ARG A 1 357 ? 17.943  104.940 16.720  1.00 24.72 ? 357  ARG A CG  1 
ATOM   2583 C  CD  . ARG A 1 357 ? 18.618  103.907 17.589  1.00 27.58 ? 357  ARG A CD  1 
ATOM   2584 N  NE  . ARG A 1 357 ? 18.706  104.340 18.979  1.00 30.03 ? 357  ARG A NE  1 
ATOM   2585 C  CZ  . ARG A 1 357 ? 19.524  103.799 19.873  1.00 31.19 ? 357  ARG A CZ  1 
ATOM   2586 N  NH1 . ARG A 1 357 ? 20.327  102.802 19.513  1.00 32.09 ? 357  ARG A NH1 1 
ATOM   2587 N  NH2 . ARG A 1 357 ? 19.539  104.252 21.122  1.00 32.39 ? 357  ARG A NH2 1 
ATOM   2588 N  N   . TYR A 1 358 ? 18.435  104.063 12.278  1.00 16.98 ? 358  TYR A N   1 
ATOM   2589 C  CA  . TYR A 1 358 ? 18.087  103.542 10.962  1.00 16.08 ? 358  TYR A CA  1 
ATOM   2590 C  C   . TYR A 1 358 ? 19.240  102.697 10.421  1.00 15.64 ? 358  TYR A C   1 
ATOM   2591 O  O   . TYR A 1 358 ? 19.021  101.610 9.889   1.00 15.22 ? 358  TYR A O   1 
ATOM   2592 C  CB  . TYR A 1 358 ? 17.784  104.691 9.995   1.00 15.57 ? 358  TYR A CB  1 
ATOM   2593 C  CG  . TYR A 1 358 ? 17.808  104.280 8.538   1.00 15.62 ? 358  TYR A CG  1 
ATOM   2594 C  CD1 . TYR A 1 358 ? 16.776  103.516 7.982   1.00 15.80 ? 358  TYR A CD1 1 
ATOM   2595 C  CD2 . TYR A 1 358 ? 18.882  104.629 7.724   1.00 16.13 ? 358  TYR A CD2 1 
ATOM   2596 C  CE1 . TYR A 1 358 ? 16.823  103.114 6.638   1.00 16.78 ? 358  TYR A CE1 1 
ATOM   2597 C  CE2 . TYR A 1 358 ? 18.940  104.235 6.390   1.00 16.26 ? 358  TYR A CE2 1 
ATOM   2598 C  CZ  . TYR A 1 358 ? 17.913  103.481 5.853   1.00 17.15 ? 358  TYR A CZ  1 
ATOM   2599 O  OH  . TYR A 1 358 ? 17.984  103.115 4.525   1.00 18.06 ? 358  TYR A OH  1 
ATOM   2600 N  N   . ILE A 1 359 ? 20.466  103.199 10.553  1.00 15.30 ? 359  ILE A N   1 
ATOM   2601 C  CA  . ILE A 1 359 ? 21.630  102.460 10.079  1.00 15.89 ? 359  ILE A CA  1 
ATOM   2602 C  C   . ILE A 1 359 ? 21.730  101.127 10.822  1.00 16.04 ? 359  ILE A C   1 
ATOM   2603 O  O   . ILE A 1 359 ? 22.023  100.095 10.219  1.00 16.45 ? 359  ILE A O   1 
ATOM   2604 C  CB  . ILE A 1 359 ? 22.941  103.266 10.279  1.00 15.91 ? 359  ILE A CB  1 
ATOM   2605 C  CG1 . ILE A 1 359 ? 22.942  104.501 9.365   1.00 16.12 ? 359  ILE A CG1 1 
ATOM   2606 C  CG2 . ILE A 1 359 ? 24.150  102.390 9.957   1.00 15.51 ? 359  ILE A CG2 1 
ATOM   2607 C  CD1 . ILE A 1 359 ? 22.911  104.169 7.869   1.00 15.36 ? 359  ILE A CD1 1 
ATOM   2608 N  N   . GLY A 1 360 ? 21.477  101.156 12.130  1.00 16.18 ? 360  GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 360 ? 21.527  99.940  12.922  1.00 16.01 ? 360  GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 360 ? 20.537  98.912  12.399  1.00 16.72 ? 360  GLY A C   1 
ATOM   2611 O  O   . GLY A 1 360 ? 20.874  97.735  12.240  1.00 16.66 ? 360  GLY A O   1 
ATOM   2612 N  N   . ARG A 1 361 ? 19.312  99.352  12.126  1.00 16.22 ? 361  ARG A N   1 
ATOM   2613 C  CA  . ARG A 1 361 ? 18.292  98.457  11.604  1.00 16.61 ? 361  ARG A CA  1 
ATOM   2614 C  C   . ARG A 1 361 ? 18.634  97.993  10.181  1.00 17.14 ? 361  ARG A C   1 
ATOM   2615 O  O   . ARG A 1 361 ? 18.429  96.826  9.846   1.00 16.95 ? 361  ARG A O   1 
ATOM   2616 C  CB  . ARG A 1 361 ? 16.915  99.139  11.621  1.00 16.35 ? 361  ARG A CB  1 
ATOM   2617 C  CG  . ARG A 1 361 ? 16.423  99.521  13.017  1.00 16.31 ? 361  ARG A CG  1 
ATOM   2618 C  CD  . ARG A 1 361 ? 14.939  99.884  13.007  1.00 16.37 ? 361  ARG A CD  1 
ATOM   2619 N  NE  . ARG A 1 361 ? 14.646  101.031 12.146  1.00 16.27 ? 361  ARG A NE  1 
ATOM   2620 C  CZ  . ARG A 1 361 ? 14.776  102.302 12.516  1.00 15.93 ? 361  ARG A CZ  1 
ATOM   2621 N  NH1 . ARG A 1 361 ? 15.187  102.595 13.741  1.00 15.64 ? 361  ARG A NH1 1 
ATOM   2622 N  NH2 . ARG A 1 361 ? 14.487  103.280 11.663  1.00 15.34 ? 361  ARG A NH2 1 
ATOM   2623 N  N   . SER A 1 362 ? 19.162  98.894  9.352   1.00 17.30 ? 362  SER A N   1 
ATOM   2624 C  CA  . SER A 1 362 ? 19.523  98.538  7.976   1.00 18.56 ? 362  SER A CA  1 
ATOM   2625 C  C   . SER A 1 362 ? 20.567  97.429  7.984   1.00 18.38 ? 362  SER A C   1 
ATOM   2626 O  O   . SER A 1 362 ? 20.456  96.453  7.241   1.00 18.33 ? 362  SER A O   1 
ATOM   2627 C  CB  . SER A 1 362 ? 20.098  99.742  7.222   1.00 19.22 ? 362  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 362 ? 19.219  100.848 7.271   1.00 23.01 ? 362  SER A OG  1 
ATOM   2629 N  N   . LEU A 1 363 ? 21.584  97.594  8.823   1.00 18.63 ? 363  LEU A N   1 
ATOM   2630 C  CA  . LEU A 1 363 ? 22.651  96.607  8.945   1.00 19.30 ? 363  LEU A CA  1 
ATOM   2631 C  C   . LEU A 1 363 ? 22.101  95.229  9.310   1.00 19.49 ? 363  LEU A C   1 
ATOM   2632 O  O   . LEU A 1 363 ? 22.545  94.215  8.774   1.00 19.72 ? 363  LEU A O   1 
ATOM   2633 C  CB  . LEU A 1 363 ? 23.662  97.054  10.005  1.00 19.36 ? 363  LEU A CB  1 
ATOM   2634 C  CG  . LEU A 1 363 ? 24.523  98.268  9.650   1.00 20.04 ? 363  LEU A CG  1 
ATOM   2635 C  CD1 . LEU A 1 363 ? 25.314  98.715  10.872  1.00 20.53 ? 363  LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A 1 363 ? 25.461  97.911  8.500   1.00 20.94 ? 363  LEU A CD2 1 
ATOM   2637 N  N   . GLN A 1 364 ? 21.133  95.193  10.219  1.00 19.80 ? 364  GLN A N   1 
ATOM   2638 C  CA  . GLN A 1 364 ? 20.533  93.934  10.649  1.00 20.55 ? 364  GLN A CA  1 
ATOM   2639 C  C   . GLN A 1 364 ? 19.654  93.302  9.577   1.00 21.15 ? 364  GLN A C   1 
ATOM   2640 O  O   . GLN A 1 364 ? 19.556  92.078  9.487   1.00 20.96 ? 364  GLN A O   1 
ATOM   2641 C  CB  . GLN A 1 364 ? 19.706  94.152  11.917  1.00 20.87 ? 364  GLN A CB  1 
ATOM   2642 C  CG  . GLN A 1 364 ? 20.545  94.337  13.173  1.00 21.72 ? 364  GLN A CG  1 
ATOM   2643 C  CD  . GLN A 1 364 ? 19.716  94.784  14.352  1.00 23.17 ? 364  GLN A CD  1 
ATOM   2644 O  OE1 . GLN A 1 364 ? 19.522  95.982  14.570  1.00 24.65 ? 364  GLN A OE1 1 
ATOM   2645 N  NE2 . GLN A 1 364 ? 19.201  93.825  15.111  1.00 23.27 ? 364  GLN A NE2 1 
ATOM   2646 N  N   . SER A 1 365 ? 19.011  94.135  8.768   1.00 21.73 ? 365  SER A N   1 
ATOM   2647 C  CA  . SER A 1 365 ? 18.144  93.631  7.714   1.00 22.97 ? 365  SER A CA  1 
ATOM   2648 C  C   . SER A 1 365 ? 18.979  93.062  6.573   1.00 23.63 ? 365  SER A C   1 
ATOM   2649 O  O   . SER A 1 365 ? 18.527  92.185  5.842   1.00 24.01 ? 365  SER A O   1 
ATOM   2650 C  CB  . SER A 1 365 ? 17.248  94.751  7.182   1.00 22.88 ? 365  SER A CB  1 
ATOM   2651 O  OG  . SER A 1 365 ? 18.013  95.710  6.475   1.00 23.86 ? 365  SER A OG  1 
ATOM   2652 N  N   . LYS A 1 366 ? 20.205  93.557  6.431   1.00 24.20 ? 366  LYS A N   1 
ATOM   2653 C  CA  . LYS A 1 366 ? 21.092  93.106  5.365   1.00 25.30 ? 366  LYS A CA  1 
ATOM   2654 C  C   . LYS A 1 366 ? 22.092  92.018  5.750   1.00 25.40 ? 366  LYS A C   1 
ATOM   2655 O  O   . LYS A 1 366 ? 22.477  91.209  4.904   1.00 25.18 ? 366  LYS A O   1 
ATOM   2656 C  CB  . LYS A 1 366 ? 21.884  94.288  4.798   1.00 25.97 ? 366  LYS A CB  1 
ATOM   2657 C  CG  . LYS A 1 366 ? 21.067  95.378  4.143   1.00 26.64 ? 366  LYS A CG  1 
ATOM   2658 C  CD  . LYS A 1 366 ? 21.991  96.516  3.743   1.00 28.22 ? 366  LYS A CD  1 
ATOM   2659 C  CE  . LYS A 1 366 ? 21.229  97.697  3.181   1.00 28.77 ? 366  LYS A CE  1 
ATOM   2660 N  NZ  . LYS A 1 366 ? 22.160  98.836  2.937   1.00 30.59 ? 366  LYS A NZ  1 
ATOM   2661 N  N   . HIS A 1 367 ? 22.522  91.988  7.008   1.00 26.03 ? 367  HIS A N   1 
ATOM   2662 C  CA  . HIS A 1 367 ? 23.522  90.999  7.406   1.00 27.27 ? 367  HIS A CA  1 
ATOM   2663 C  C   . HIS A 1 367 ? 23.225  90.207  8.679   1.00 28.13 ? 367  HIS A C   1 
ATOM   2664 O  O   . HIS A 1 367 ? 24.183  89.605  9.213   1.00 27.98 ? 367  HIS A O   1 
ATOM   2665 C  CB  . HIS A 1 367 ? 24.881  91.692  7.553   1.00 27.24 ? 367  HIS A CB  1 
ATOM   2666 C  CG  . HIS A 1 367 ? 25.177  92.676  6.463   1.00 27.25 ? 367  HIS A CG  1 
ATOM   2667 N  ND1 . HIS A 1 367 ? 24.991  94.034  6.616   1.00 27.31 ? 367  HIS A ND1 1 
ATOM   2668 C  CD2 . HIS A 1 367 ? 25.611  92.497  5.193   1.00 26.82 ? 367  HIS A CD2 1 
ATOM   2669 C  CE1 . HIS A 1 367 ? 25.297  94.647  5.486   1.00 27.26 ? 367  HIS A CE1 1 
ATOM   2670 N  NE2 . HIS A 1 367 ? 25.676  93.737  4.607   1.00 27.04 ? 367  HIS A NE2 1 
ATOM   2671 N  N   . PRO B 2 17  ? 4.396   117.681 34.968  1.00 22.87 ? 517  PRO B N   1 
ATOM   2672 C  CA  . PRO B 2 17  ? 3.267   118.636 34.867  1.00 21.85 ? 517  PRO B CA  1 
ATOM   2673 C  C   . PRO B 2 17  ? 3.119   119.178 33.445  1.00 21.36 ? 517  PRO B C   1 
ATOM   2674 O  O   . PRO B 2 17  ? 4.108   119.336 32.726  1.00 20.16 ? 517  PRO B O   1 
ATOM   2675 C  CB  . PRO B 2 17  ? 3.542   119.757 35.860  1.00 22.64 ? 517  PRO B CB  1 
ATOM   2676 C  CG  . PRO B 2 17  ? 5.058   119.660 36.024  1.00 23.30 ? 517  PRO B CG  1 
ATOM   2677 C  CD  . PRO B 2 17  ? 5.364   118.162 35.970  1.00 23.07 ? 517  PRO B CD  1 
ATOM   2678 N  N   . VAL B 2 18  ? 1.880   119.464 33.048  1.00 20.77 ? 518  VAL B N   1 
ATOM   2679 C  CA  . VAL B 2 18  ? 1.602   119.960 31.701  1.00 20.49 ? 518  VAL B CA  1 
ATOM   2680 C  C   . VAL B 2 18  ? 2.159   121.348 31.426  1.00 20.61 ? 518  VAL B C   1 
ATOM   2681 O  O   . VAL B 2 18  ? 2.329   121.731 30.270  1.00 20.68 ? 518  VAL B O   1 
ATOM   2682 C  CB  . VAL B 2 18  ? 0.078   119.992 31.410  1.00 20.38 ? 518  VAL B CB  1 
ATOM   2683 C  CG1 . VAL B 2 18  ? -0.506  118.600 31.549  1.00 20.76 ? 518  VAL B CG1 1 
ATOM   2684 C  CG2 . VAL B 2 18  ? -0.622  120.969 32.357  1.00 20.29 ? 518  VAL B CG2 1 
ATOM   2685 N  N   . TRP B 2 19  ? 2.445   122.101 32.483  1.00 20.77 ? 519  TRP B N   1 
ATOM   2686 C  CA  . TRP B 2 19  ? 2.963   123.454 32.325  1.00 20.67 ? 519  TRP B CA  1 
ATOM   2687 C  C   . TRP B 2 19  ? 4.485   123.548 32.233  1.00 21.25 ? 519  TRP B C   1 
ATOM   2688 O  O   . TRP B 2 19  ? 5.050   124.642 32.217  1.00 21.73 ? 519  TRP B O   1 
ATOM   2689 C  CB  . TRP B 2 19  ? 2.446   124.355 33.451  1.00 20.82 ? 519  TRP B CB  1 
ATOM   2690 C  CG  . TRP B 2 19  ? 2.481   123.733 34.819  1.00 20.59 ? 519  TRP B CG  1 
ATOM   2691 C  CD1 . TRP B 2 19  ? 1.427   123.201 35.508  1.00 20.81 ? 519  TRP B CD1 1 
ATOM   2692 C  CD2 . TRP B 2 19  ? 3.627   123.595 35.669  1.00 20.60 ? 519  TRP B CD2 1 
ATOM   2693 N  NE1 . TRP B 2 19  ? 1.846   122.741 36.738  1.00 21.27 ? 519  TRP B NE1 1 
ATOM   2694 C  CE2 . TRP B 2 19  ? 3.191   122.970 36.862  1.00 20.87 ? 519  TRP B CE2 1 
ATOM   2695 C  CE3 . TRP B 2 19  ? 4.980   123.936 35.539  1.00 19.93 ? 519  TRP B CE3 1 
ATOM   2696 C  CZ2 . TRP B 2 19  ? 4.062   122.681 37.918  1.00 20.56 ? 519  TRP B CZ2 1 
ATOM   2697 C  CZ3 . TRP B 2 19  ? 5.846   123.648 36.591  1.00 20.07 ? 519  TRP B CZ3 1 
ATOM   2698 C  CH2 . TRP B 2 19  ? 5.381   123.027 37.766  1.00 20.51 ? 519  TRP B CH2 1 
ATOM   2699 N  N   . SER B 2 20  ? 5.155   122.405 32.180  1.00 21.50 ? 520  SER B N   1 
ATOM   2700 C  CA  . SER B 2 20  ? 6.605   122.404 32.047  1.00 21.65 ? 520  SER B CA  1 
ATOM   2701 C  C   . SER B 2 20  ? 6.971   121.307 31.063  1.00 21.56 ? 520  SER B C   1 
ATOM   2702 O  O   . SER B 2 20  ? 6.494   120.179 31.170  1.00 21.70 ? 520  SER B O   1 
ATOM   2703 C  CB  . SER B 2 20  ? 7.289   122.157 33.394  1.00 21.89 ? 520  SER B CB  1 
ATOM   2704 O  OG  . SER B 2 20  ? 8.695   122.334 33.280  1.00 22.33 ? 520  SER B OG  1 
ATOM   2705 N  N   . GLU B 2 21  ? 7.806   121.643 30.090  1.00 21.40 ? 521  GLU B N   1 
ATOM   2706 C  CA  . GLU B 2 21  ? 8.211   120.671 29.085  1.00 21.14 ? 521  GLU B CA  1 
ATOM   2707 C  C   . GLU B 2 21  ? 9.717   120.733 28.867  1.00 20.68 ? 521  GLU B C   1 
ATOM   2708 O  O   . GLU B 2 21  ? 10.236  121.702 28.313  1.00 20.40 ? 521  GLU B O   1 
ATOM   2709 C  CB  . GLU B 2 21  ? 7.460   120.936 27.778  1.00 21.85 ? 521  GLU B CB  1 
ATOM   2710 C  CG  . GLU B 2 21  ? 7.875   120.043 26.622  1.00 22.92 ? 521  GLU B CG  1 
ATOM   2711 C  CD  . GLU B 2 21  ? 6.899   120.112 25.460  1.00 24.19 ? 521  GLU B CD  1 
ATOM   2712 O  OE1 . GLU B 2 21  ? 6.581   121.231 24.997  1.00 23.40 ? 521  GLU B OE1 1 
ATOM   2713 O  OE2 . GLU B 2 21  ? 6.450   119.039 25.009  1.00 25.34 ? 521  GLU B OE2 1 
ATOM   2714 N  N   . PRO B 2 22  ? 10.441  119.703 29.328  1.00 20.57 ? 522  PRO B N   1 
ATOM   2715 C  CA  . PRO B 2 22  ? 11.899  119.637 29.184  1.00 20.34 ? 522  PRO B CA  1 
ATOM   2716 C  C   . PRO B 2 22  ? 12.330  119.769 27.726  1.00 20.06 ? 522  PRO B C   1 
ATOM   2717 O  O   . PRO B 2 22  ? 11.681  119.230 26.828  1.00 19.86 ? 522  PRO B O   1 
ATOM   2718 C  CB  . PRO B 2 22  ? 12.239  118.272 29.773  1.00 21.09 ? 522  PRO B CB  1 
ATOM   2719 C  CG  . PRO B 2 22  ? 11.189  118.118 30.858  1.00 21.18 ? 522  PRO B CG  1 
ATOM   2720 C  CD  . PRO B 2 22  ? 9.941   118.575 30.139  1.00 20.76 ? 522  PRO B CD  1 
ATOM   2721 N  N   . LEU B 2 23  ? 13.423  120.488 27.494  1.00 18.92 ? 523  LEU B N   1 
ATOM   2722 C  CA  . LEU B 2 23  ? 13.914  120.683 26.139  1.00 18.72 ? 523  LEU B CA  1 
ATOM   2723 C  C   . LEU B 2 23  ? 15.278  120.036 25.916  1.00 18.65 ? 523  LEU B C   1 
ATOM   2724 O  O   . LEU B 2 23  ? 16.138  120.022 26.801  1.00 18.18 ? 523  LEU B O   1 
ATOM   2725 C  CB  . LEU B 2 23  ? 13.981  122.181 25.810  1.00 18.15 ? 523  LEU B CB  1 
ATOM   2726 C  CG  . LEU B 2 23  ? 12.645  122.938 25.836  1.00 18.26 ? 523  LEU B CG  1 
ATOM   2727 C  CD1 . LEU B 2 23  ? 12.880  124.407 25.536  1.00 17.82 ? 523  LEU B CD1 1 
ATOM   2728 C  CD2 . LEU B 2 23  ? 11.682  122.329 24.815  1.00 17.94 ? 523  LEU B CD2 1 
ATOM   2729 N  N   . TYR B 2 24  ? 15.450  119.492 24.719  1.00 18.21 ? 524  TYR B N   1 
ATOM   2730 C  CA  . TYR B 2 24  ? 16.683  118.834 24.310  1.00 18.80 ? 524  TYR B CA  1 
ATOM   2731 C  C   . TYR B 2 24  ? 17.854  119.809 24.399  1.00 19.20 ? 524  TYR B C   1 
ATOM   2732 O  O   . TYR B 2 24  ? 18.928  119.472 24.902  1.00 19.08 ? 524  TYR B O   1 
ATOM   2733 C  CB  . TYR B 2 24  ? 16.521  118.345 22.867  1.00 18.55 ? 524  TYR B CB  1 
ATOM   2734 C  CG  . TYR B 2 24  ? 17.753  117.747 22.235  1.00 18.57 ? 524  TYR B CG  1 
ATOM   2735 C  CD1 . TYR B 2 24  ? 18.175  116.457 22.559  1.00 18.60 ? 524  TYR B CD1 1 
ATOM   2736 C  CD2 . TYR B 2 24  ? 18.474  118.457 21.270  1.00 18.80 ? 524  TYR B CD2 1 
ATOM   2737 C  CE1 . TYR B 2 24  ? 19.281  115.885 21.930  1.00 19.37 ? 524  TYR B CE1 1 
ATOM   2738 C  CE2 . TYR B 2 24  ? 19.581  117.897 20.638  1.00 18.84 ? 524  TYR B CE2 1 
ATOM   2739 C  CZ  . TYR B 2 24  ? 19.974  116.613 20.968  1.00 19.06 ? 524  TYR B CZ  1 
ATOM   2740 O  OH  . TYR B 2 24  ? 21.042  116.051 20.317  1.00 19.22 ? 524  TYR B OH  1 
ATOM   2741 N  N   . SER B 2 25  ? 17.631  121.025 23.914  1.00 19.20 ? 525  SER B N   1 
ATOM   2742 C  CA  . SER B 2 25  ? 18.664  122.051 23.905  1.00 20.04 ? 525  SER B CA  1 
ATOM   2743 C  C   . SER B 2 25  ? 19.047  122.553 25.293  1.00 20.74 ? 525  SER B C   1 
ATOM   2744 O  O   . SER B 2 25  ? 20.087  123.192 25.456  1.00 20.20 ? 525  SER B O   1 
ATOM   2745 C  CB  . SER B 2 25  ? 18.208  123.232 23.047  1.00 20.01 ? 525  SER B CB  1 
ATOM   2746 O  OG  . SER B 2 25  ? 17.891  122.799 21.735  1.00 19.46 ? 525  SER B OG  1 
ATOM   2747 N  N   . LEU B 2 26  ? 18.211  122.261 26.285  1.00 21.54 ? 526  LEU B N   1 
ATOM   2748 C  CA  . LEU B 2 26  ? 18.468  122.703 27.650  1.00 23.26 ? 526  LEU B CA  1 
ATOM   2749 C  C   . LEU B 2 26  ? 19.045  121.620 28.556  1.00 24.07 ? 526  LEU B C   1 
ATOM   2750 O  O   . LEU B 2 26  ? 19.318  121.878 29.727  1.00 24.59 ? 526  LEU B O   1 
ATOM   2751 C  CB  . LEU B 2 26  ? 17.183  123.262 28.271  1.00 23.63 ? 526  LEU B CB  1 
ATOM   2752 C  CG  . LEU B 2 26  ? 16.592  124.492 27.576  1.00 24.22 ? 526  LEU B CG  1 
ATOM   2753 C  CD1 . LEU B 2 26  ? 15.364  124.980 28.330  1.00 24.44 ? 526  LEU B CD1 1 
ATOM   2754 C  CD2 . LEU B 2 26  ? 17.643  125.583 27.517  1.00 24.97 ? 526  LEU B CD2 1 
ATOM   2755 N  N   . ARG B 2 27  ? 19.227  120.414 28.026  1.00 25.19 ? 527  ARG B N   1 
ATOM   2756 C  CA  . ARG B 2 27  ? 19.797  119.327 28.817  1.00 26.43 ? 527  ARG B CA  1 
ATOM   2757 C  C   . ARG B 2 27  ? 21.224  119.716 29.198  1.00 26.56 ? 527  ARG B C   1 
ATOM   2758 O  O   . ARG B 2 27  ? 21.907  120.414 28.447  1.00 25.97 ? 527  ARG B O   1 
ATOM   2759 C  CB  . ARG B 2 27  ? 19.829  118.022 28.012  1.00 28.01 ? 527  ARG B CB  1 
ATOM   2760 C  CG  . ARG B 2 27  ? 18.465  117.463 27.630  1.00 30.60 ? 527  ARG B CG  1 
ATOM   2761 C  CD  . ARG B 2 27  ? 18.619  116.189 26.804  1.00 33.28 ? 527  ARG B CD  1 
ATOM   2762 N  NE  . ARG B 2 27  ? 17.336  115.658 26.347  1.00 35.96 ? 527  ARG B NE  1 
ATOM   2763 C  CZ  . ARG B 2 27  ? 17.200  114.588 25.566  1.00 37.15 ? 527  ARG B CZ  1 
ATOM   2764 N  NH1 . ARG B 2 27  ? 18.274  113.924 25.149  1.00 37.27 ? 527  ARG B NH1 1 
ATOM   2765 N  NH2 . ARG B 2 27  ? 15.989  114.184 25.196  1.00 37.60 ? 527  ARG B NH2 1 
ATOM   2766 N  N   . PRO B 2 28  ? 21.695  119.275 30.373  1.00 26.79 ? 528  PRO B N   1 
ATOM   2767 C  CA  . PRO B 2 28  ? 23.060  119.624 30.776  1.00 26.74 ? 528  PRO B CA  1 
ATOM   2768 C  C   . PRO B 2 28  ? 24.123  119.095 29.814  1.00 26.00 ? 528  PRO B C   1 
ATOM   2769 O  O   . PRO B 2 28  ? 25.119  119.765 29.564  1.00 26.18 ? 528  PRO B O   1 
ATOM   2770 C  CB  . PRO B 2 28  ? 23.169  119.027 32.182  1.00 26.86 ? 528  PRO B CB  1 
ATOM   2771 C  CG  . PRO B 2 28  ? 22.229  117.864 32.130  1.00 27.26 ? 528  PRO B CG  1 
ATOM   2772 C  CD  . PRO B 2 28  ? 21.041  118.444 31.398  1.00 27.04 ? 528  PRO B CD  1 
ATOM   2773 N  N   . GLU B 2 29  ? 23.901  117.906 29.260  1.00 26.01 ? 529  GLU B N   1 
ATOM   2774 C  CA  . GLU B 2 29  ? 24.861  117.319 28.329  1.00 25.96 ? 529  GLU B CA  1 
ATOM   2775 C  C   . GLU B 2 29  ? 24.943  118.103 27.021  1.00 24.68 ? 529  GLU B C   1 
ATOM   2776 O  O   . GLU B 2 29  ? 25.890  117.940 26.255  1.00 23.78 ? 529  GLU B O   1 
ATOM   2777 C  CB  . GLU B 2 29  ? 24.488  115.875 27.969  1.00 28.10 ? 529  GLU B CB  1 
ATOM   2778 C  CG  . GLU B 2 29  ? 23.804  115.069 29.046  1.00 31.68 ? 529  GLU B CG  1 
ATOM   2779 C  CD  . GLU B 2 29  ? 22.306  115.288 29.063  1.00 32.75 ? 529  GLU B CD  1 
ATOM   2780 O  OE1 . GLU B 2 29  ? 21.857  116.293 29.649  1.00 33.59 ? 529  GLU B OE1 1 
ATOM   2781 O  OE2 . GLU B 2 29  ? 21.579  114.456 28.474  1.00 34.38 ? 529  GLU B OE2 1 
ATOM   2782 N  N   . HIS B 2 30  ? 23.947  118.939 26.752  1.00 22.97 ? 530  HIS B N   1 
ATOM   2783 C  CA  . HIS B 2 30  ? 23.943  119.689 25.504  1.00 21.88 ? 530  HIS B CA  1 
ATOM   2784 C  C   . HIS B 2 30  ? 25.147  120.623 25.385  1.00 21.97 ? 530  HIS B C   1 
ATOM   2785 O  O   . HIS B 2 30  ? 25.596  120.930 24.278  1.00 20.78 ? 530  HIS B O   1 
ATOM   2786 C  CB  . HIS B 2 30  ? 22.633  120.473 25.356  1.00 20.85 ? 530  HIS B CB  1 
ATOM   2787 C  CG  . HIS B 2 30  ? 22.381  120.952 23.961  1.00 19.85 ? 530  HIS B CG  1 
ATOM   2788 N  ND1 . HIS B 2 30  ? 22.556  122.265 23.581  1.00 19.63 ? 530  HIS B ND1 1 
ATOM   2789 C  CD2 . HIS B 2 30  ? 22.020  120.280 22.841  1.00 19.36 ? 530  HIS B CD2 1 
ATOM   2790 C  CE1 . HIS B 2 30  ? 22.315  122.382 22.287  1.00 19.10 ? 530  HIS B CE1 1 
ATOM   2791 N  NE2 . HIS B 2 30  ? 21.989  121.192 21.815  1.00 19.36 ? 530  HIS B NE2 1 
ATOM   2792 N  N   . ALA B 2 31  ? 25.679  121.058 26.526  1.00 21.95 ? 531  ALA B N   1 
ATOM   2793 C  CA  . ALA B 2 31  ? 26.839  121.945 26.534  1.00 22.26 ? 531  ALA B CA  1 
ATOM   2794 C  C   . ALA B 2 31  ? 28.046  121.276 25.879  1.00 22.68 ? 531  ALA B C   1 
ATOM   2795 O  O   . ALA B 2 31  ? 28.940  121.952 25.370  1.00 22.77 ? 531  ALA B O   1 
ATOM   2796 C  CB  . ALA B 2 31  ? 27.181  122.361 27.969  1.00 22.46 ? 531  ALA B CB  1 
ATOM   2797 N  N   . ARG B 2 32  ? 28.072  119.947 25.880  1.00 23.56 ? 532  ARG B N   1 
ATOM   2798 C  CA  . ARG B 2 32  ? 29.185  119.231 25.264  1.00 24.95 ? 532  ARG B CA  1 
ATOM   2799 C  C   . ARG B 2 32  ? 29.134  119.282 23.744  1.00 24.28 ? 532  ARG B C   1 
ATOM   2800 O  O   . ARG B 2 32  ? 30.081  118.877 23.071  1.00 24.00 ? 532  ARG B O   1 
ATOM   2801 C  CB  . ARG B 2 32  ? 29.213  117.771 25.716  1.00 27.54 ? 532  ARG B CB  1 
ATOM   2802 C  CG  . ARG B 2 32  ? 30.122  117.529 26.907  1.00 31.73 ? 532  ARG B CG  1 
ATOM   2803 C  CD  . ARG B 2 32  ? 29.334  117.174 28.146  1.00 34.53 ? 532  ARG B CD  1 
ATOM   2804 N  NE  . ARG B 2 32  ? 28.745  115.842 28.056  1.00 36.91 ? 532  ARG B NE  1 
ATOM   2805 C  CZ  . ARG B 2 32  ? 28.039  115.277 29.030  1.00 38.29 ? 532  ARG B CZ  1 
ATOM   2806 N  NH1 . ARG B 2 32  ? 27.835  115.935 30.166  1.00 38.85 ? 532  ARG B NH1 1 
ATOM   2807 N  NH2 . ARG B 2 32  ? 27.541  114.056 28.872  1.00 39.06 ? 532  ARG B NH2 1 
ATOM   2808 N  N   . GLU B 2 33  ? 28.029  119.784 23.206  1.00 23.33 ? 533  GLU B N   1 
ATOM   2809 C  CA  . GLU B 2 33  ? 27.871  119.872 21.762  1.00 23.08 ? 533  GLU B CA  1 
ATOM   2810 C  C   . GLU B 2 33  ? 28.466  121.159 21.200  1.00 22.17 ? 533  GLU B C   1 
ATOM   2811 O  O   . GLU B 2 33  ? 28.407  121.399 19.990  1.00 21.61 ? 533  GLU B O   1 
ATOM   2812 C  CB  . GLU B 2 33  ? 26.390  119.773 21.387  1.00 23.49 ? 533  GLU B CB  1 
ATOM   2813 C  CG  . GLU B 2 33  ? 25.715  118.491 21.853  1.00 25.39 ? 533  GLU B CG  1 
ATOM   2814 C  CD  . GLU B 2 33  ? 26.447  117.242 21.395  1.00 27.07 ? 533  GLU B CD  1 
ATOM   2815 O  OE1 . GLU B 2 33  ? 26.848  117.180 20.218  1.00 28.75 ? 533  GLU B OE1 1 
ATOM   2816 O  OE2 . GLU B 2 33  ? 26.617  116.314 22.210  1.00 28.83 ? 533  GLU B OE2 1 
ATOM   2817 N  N   . ARG B 2 34  ? 29.031  121.988 22.076  1.00 21.25 ? 534  ARG B N   1 
ATOM   2818 C  CA  . ARG B 2 34  ? 29.643  123.238 21.641  1.00 21.10 ? 534  ARG B CA  1 
ATOM   2819 C  C   . ARG B 2 34  ? 30.847  122.927 20.762  1.00 20.69 ? 534  ARG B C   1 
ATOM   2820 O  O   . ARG B 2 34  ? 31.499  121.890 20.914  1.00 19.61 ? 534  ARG B O   1 
ATOM   2821 C  CB  . ARG B 2 34  ? 30.079  124.090 22.843  1.00 22.27 ? 534  ARG B CB  1 
ATOM   2822 C  CG  . ARG B 2 34  ? 28.924  124.755 23.607  1.00 23.56 ? 534  ARG B CG  1 
ATOM   2823 C  CD  . ARG B 2 34  ? 28.219  125.826 22.774  1.00 24.77 ? 534  ARG B CD  1 
ATOM   2824 N  NE  . ARG B 2 34  ? 28.964  127.084 22.694  1.00 25.75 ? 534  ARG B NE  1 
ATOM   2825 C  CZ  . ARG B 2 34  ? 28.985  128.014 23.648  1.00 26.63 ? 534  ARG B CZ  1 
ATOM   2826 N  NH1 . ARG B 2 34  ? 28.304  127.841 24.773  1.00 27.18 ? 534  ARG B NH1 1 
ATOM   2827 N  NH2 . ARG B 2 34  ? 29.679  129.130 23.474  1.00 27.04 ? 534  ARG B NH2 1 
ATOM   2828 N  N   . LEU B 2 35  ? 31.138  123.835 19.842  1.00 20.28 ? 535  LEU B N   1 
ATOM   2829 C  CA  . LEU B 2 35  ? 32.248  123.661 18.918  1.00 21.13 ? 535  LEU B CA  1 
ATOM   2830 C  C   . LEU B 2 35  ? 33.596  123.390 19.587  1.00 21.23 ? 535  LEU B C   1 
ATOM   2831 O  O   . LEU B 2 35  ? 33.947  124.009 20.592  1.00 21.10 ? 535  LEU B O   1 
ATOM   2832 C  CB  . LEU B 2 35  ? 32.383  124.899 18.023  1.00 20.94 ? 535  LEU B CB  1 
ATOM   2833 C  CG  . LEU B 2 35  ? 33.564  124.890 17.048  1.00 21.55 ? 535  LEU B CG  1 
ATOM   2834 C  CD1 . LEU B 2 35  ? 33.344  123.807 16.000  1.00 21.51 ? 535  LEU B CD1 1 
ATOM   2835 C  CD2 . LEU B 2 35  ? 33.706  126.256 16.382  1.00 21.52 ? 535  LEU B CD2 1 
ATOM   2836 N  N   . GLN B 2 36  ? 34.335  122.444 19.023  1.00 21.13 ? 536  GLN B N   1 
ATOM   2837 C  CA  . GLN B 2 36  ? 35.674  122.116 19.497  1.00 21.28 ? 536  GLN B CA  1 
ATOM   2838 C  C   . GLN B 2 36  ? 36.565  122.545 18.337  1.00 21.11 ? 536  GLN B C   1 
ATOM   2839 O  O   . GLN B 2 36  ? 36.624  121.863 17.313  1.00 21.05 ? 536  GLN B O   1 
ATOM   2840 C  CB  . GLN B 2 36  ? 35.810  120.610 19.749  1.00 21.58 ? 536  GLN B CB  1 
ATOM   2841 C  CG  . GLN B 2 36  ? 35.204  120.152 21.071  1.00 22.25 ? 536  GLN B CG  1 
ATOM   2842 C  CD  . GLN B 2 36  ? 35.182  118.645 21.221  1.00 22.50 ? 536  GLN B CD  1 
ATOM   2843 O  OE1 . GLN B 2 36  ? 34.135  118.006 21.080  1.00 23.62 ? 536  GLN B OE1 1 
ATOM   2844 N  NE2 . GLN B 2 36  ? 36.339  118.065 21.501  1.00 22.41 ? 536  GLN B NE2 1 
ATOM   2845 N  N   . ASP B 2 37  ? 37.233  123.687 18.480  1.00 21.06 ? 537  ASP B N   1 
ATOM   2846 C  CA  . ASP B 2 37  ? 38.084  124.187 17.406  1.00 21.31 ? 537  ASP B CA  1 
ATOM   2847 C  C   . ASP B 2 37  ? 39.502  123.634 17.401  1.00 21.23 ? 537  ASP B C   1 
ATOM   2848 O  O   . ASP B 2 37  ? 40.340  124.088 16.623  1.00 20.82 ? 537  ASP B O   1 
ATOM   2849 C  CB  . ASP B 2 37  ? 38.139  125.720 17.420  1.00 21.68 ? 537  ASP B CB  1 
ATOM   2850 C  CG  . ASP B 2 37  ? 38.799  126.282 18.672  1.00 22.63 ? 537  ASP B CG  1 
ATOM   2851 O  OD1 . ASP B 2 37  ? 39.434  125.515 19.427  1.00 22.73 ? 537  ASP B OD1 1 
ATOM   2852 O  OD2 . ASP B 2 37  ? 38.688  127.505 18.891  1.00 22.99 ? 537  ASP B OD2 1 
ATOM   2853 N  N   . ASP B 2 38  ? 39.764  122.652 18.260  1.00 21.32 ? 538  ASP B N   1 
ATOM   2854 C  CA  . ASP B 2 38  ? 41.085  122.028 18.347  1.00 21.83 ? 538  ASP B CA  1 
ATOM   2855 C  C   . ASP B 2 38  ? 42.204  123.047 18.567  1.00 22.62 ? 538  ASP B C   1 
ATOM   2856 O  O   . ASP B 2 38  ? 43.365  122.776 18.260  1.00 22.57 ? 538  ASP B O   1 
ATOM   2857 C  CB  . ASP B 2 38  ? 41.378  121.232 17.071  1.00 21.32 ? 538  ASP B CB  1 
ATOM   2858 C  CG  . ASP B 2 38  ? 40.269  120.254 16.725  1.00 21.22 ? 538  ASP B CG  1 
ATOM   2859 O  OD1 . ASP B 2 38  ? 39.904  119.442 17.598  1.00 19.96 ? 538  ASP B OD1 1 
ATOM   2860 O  OD2 . ASP B 2 38  ? 39.766  120.297 15.580  1.00 21.42 ? 538  ASP B OD2 1 
ATOM   2861 N  N   . SER B 2 39  ? 41.848  124.213 19.095  1.00 23.41 ? 539  SER B N   1 
ATOM   2862 C  CA  . SER B 2 39  ? 42.813  125.278 19.346  1.00 24.59 ? 539  SER B CA  1 
ATOM   2863 C  C   . SER B 2 39  ? 43.422  125.813 18.053  1.00 25.00 ? 539  SER B C   1 
ATOM   2864 O  O   . SER B 2 39  ? 44.530  126.350 18.051  1.00 25.50 ? 539  SER B O   1 
ATOM   2865 C  CB  . SER B 2 39  ? 43.923  124.787 20.282  1.00 25.30 ? 539  SER B CB  1 
ATOM   2866 O  OG  . SER B 2 39  ? 43.396  124.457 21.556  1.00 26.34 ? 539  SER B OG  1 
ATOM   2867 N  N   . VAL B 2 40  ? 42.699  125.652 16.950  1.00 24.96 ? 540  VAL B N   1 
ATOM   2868 C  CA  . VAL B 2 40  ? 43.154  126.149 15.654  1.00 24.63 ? 540  VAL B CA  1 
ATOM   2869 C  C   . VAL B 2 40  ? 42.031  127.036 15.134  1.00 24.60 ? 540  VAL B C   1 
ATOM   2870 O  O   . VAL B 2 40  ? 41.008  126.542 14.656  1.00 23.94 ? 540  VAL B O   1 
ATOM   2871 C  CB  . VAL B 2 40  ? 43.406  125.002 14.649  1.00 24.59 ? 540  VAL B CB  1 
ATOM   2872 C  CG1 . VAL B 2 40  ? 43.837  125.576 13.299  1.00 24.94 ? 540  VAL B CG1 1 
ATOM   2873 C  CG2 . VAL B 2 40  ? 44.486  124.073 15.184  1.00 24.76 ? 540  VAL B CG2 1 
ATOM   2874 N  N   . GLU B 2 41  ? 42.219  128.346 15.240  1.00 24.39 ? 541  GLU B N   1 
ATOM   2875 C  CA  . GLU B 2 41  ? 41.200  129.287 14.802  1.00 24.89 ? 541  GLU B CA  1 
ATOM   2876 C  C   . GLU B 2 41  ? 41.339  129.722 13.354  1.00 24.03 ? 541  GLU B C   1 
ATOM   2877 O  O   . GLU B 2 41  ? 42.436  130.016 12.882  1.00 24.02 ? 541  GLU B O   1 
ATOM   2878 C  CB  . GLU B 2 41  ? 41.216  130.541 15.681  1.00 26.59 ? 541  GLU B CB  1 
ATOM   2879 C  CG  . GLU B 2 41  ? 41.204  130.284 17.174  1.00 29.71 ? 541  GLU B CG  1 
ATOM   2880 C  CD  . GLU B 2 41  ? 41.016  131.564 17.971  1.00 31.64 ? 541  GLU B CD  1 
ATOM   2881 O  OE1 . GLU B 2 41  ? 41.658  132.580 17.627  1.00 32.67 ? 541  GLU B OE1 1 
ATOM   2882 O  OE2 . GLU B 2 41  ? 40.231  131.553 18.942  1.00 33.14 ? 541  GLU B OE2 1 
ATOM   2883 N  N   . THR B 2 42  ? 40.210  129.749 12.654  1.00 22.67 ? 542  THR B N   1 
ATOM   2884 C  CA  . THR B 2 42  ? 40.161  130.210 11.272  1.00 21.60 ? 542  THR B CA  1 
ATOM   2885 C  C   . THR B 2 42  ? 38.865  130.998 11.210  1.00 21.08 ? 542  THR B C   1 
ATOM   2886 O  O   . THR B 2 42  ? 38.050  130.910 12.127  1.00 20.32 ? 542  THR B O   1 
ATOM   2887 C  CB  . THR B 2 42  ? 40.103  129.052 10.246  1.00 21.37 ? 542  THR B CB  1 
ATOM   2888 O  OG1 . THR B 2 42  ? 38.876  128.329 10.395  1.00 21.20 ? 542  THR B OG1 1 
ATOM   2889 C  CG2 . THR B 2 42  ? 41.286  128.113 10.429  1.00 20.84 ? 542  THR B CG2 1 
ATOM   2890 N  N   . VAL B 2 43  ? 38.677  131.777 10.152  1.00 20.45 ? 543  VAL B N   1 
ATOM   2891 C  CA  . VAL B 2 43  ? 37.462  132.569 10.016  1.00 20.78 ? 543  VAL B CA  1 
ATOM   2892 C  C   . VAL B 2 43  ? 36.225  131.707 10.261  1.00 19.93 ? 543  VAL B C   1 
ATOM   2893 O  O   . VAL B 2 43  ? 35.273  132.144 10.907  1.00 19.89 ? 543  VAL B O   1 
ATOM   2894 C  CB  . VAL B 2 43  ? 37.362  133.206 8.608   1.00 21.43 ? 543  VAL B CB  1 
ATOM   2895 C  CG1 . VAL B 2 43  ? 36.039  133.956 8.462   1.00 22.76 ? 543  VAL B CG1 1 
ATOM   2896 C  CG2 . VAL B 2 43  ? 38.528  134.169 8.398   1.00 22.47 ? 543  VAL B CG2 1 
ATOM   2897 N  N   . THR B 2 44  ? 36.246  130.481 9.751   1.00 18.98 ? 544  THR B N   1 
ATOM   2898 C  CA  . THR B 2 44  ? 35.116  129.571 9.918   1.00 18.36 ? 544  THR B CA  1 
ATOM   2899 C  C   . THR B 2 44  ? 34.766  129.265 11.377  1.00 18.34 ? 544  THR B C   1 
ATOM   2900 O  O   . THR B 2 44  ? 33.609  129.414 11.779  1.00 17.50 ? 544  THR B O   1 
ATOM   2901 C  CB  . THR B 2 44  ? 35.362  128.232 9.189   1.00 18.13 ? 544  THR B CB  1 
ATOM   2902 O  OG1 . THR B 2 44  ? 35.440  128.466 7.777   1.00 18.03 ? 544  THR B OG1 1 
ATOM   2903 C  CG2 . THR B 2 44  ? 34.214  127.248 9.468   1.00 17.90 ? 544  THR B CG2 1 
ATOM   2904 N  N   . SER B 2 45  ? 35.753  128.842 12.168  1.00 18.28 ? 545  SER B N   1 
ATOM   2905 C  CA  . SER B 2 45  ? 35.491  128.502 13.568  1.00 18.28 ? 545  SER B CA  1 
ATOM   2906 C  C   . SER B 2 45  ? 35.106  129.718 14.402  1.00 18.75 ? 545  SER B C   1 
ATOM   2907 O  O   . SER B 2 45  ? 34.269  129.622 15.304  1.00 18.60 ? 545  SER B O   1 
ATOM   2908 C  CB  . SER B 2 45  ? 36.700  127.789 14.199  1.00 17.93 ? 545  SER B CB  1 
ATOM   2909 O  OG  . SER B 2 45  ? 37.859  128.605 14.213  1.00 17.47 ? 545  SER B OG  1 
ATOM   2910 N  N   . ILE B 2 46  ? 35.715  130.859 14.098  1.00 19.15 ? 546  ILE B N   1 
ATOM   2911 C  CA  . ILE B 2 46  ? 35.421  132.090 14.816  1.00 19.59 ? 546  ILE B CA  1 
ATOM   2912 C  C   . ILE B 2 46  ? 33.958  132.498 14.624  1.00 19.73 ? 546  ILE B C   1 
ATOM   2913 O  O   . ILE B 2 46  ? 33.272  132.862 15.582  1.00 19.20 ? 546  ILE B O   1 
ATOM   2914 C  CB  . ILE B 2 46  ? 36.339  133.236 14.332  1.00 20.23 ? 546  ILE B CB  1 
ATOM   2915 C  CG1 . ILE B 2 46  ? 37.779  132.954 14.769  1.00 20.44 ? 546  ILE B CG1 1 
ATOM   2916 C  CG2 . ILE B 2 46  ? 35.862  134.572 14.903  1.00 20.21 ? 546  ILE B CG2 1 
ATOM   2917 C  CD1 . ILE B 2 46  ? 38.782  133.936 14.234  1.00 22.07 ? 546  ILE B CD1 1 
ATOM   2918 N  N   . GLU B 2 47  ? 33.479  132.432 13.387  1.00 19.42 ? 547  GLU B N   1 
ATOM   2919 C  CA  . GLU B 2 47  ? 32.098  132.806 13.108  1.00 20.27 ? 547  GLU B CA  1 
ATOM   2920 C  C   . GLU B 2 47  ? 31.120  131.815 13.729  1.00 19.65 ? 547  GLU B C   1 
ATOM   2921 O  O   . GLU B 2 47  ? 30.087  132.207 14.273  1.00 19.26 ? 547  GLU B O   1 
ATOM   2922 C  CB  . GLU B 2 47  ? 31.872  132.902 11.597  1.00 21.57 ? 547  GLU B CB  1 
ATOM   2923 C  CG  . GLU B 2 47  ? 32.632  134.052 10.956  1.00 23.97 ? 547  GLU B CG  1 
ATOM   2924 C  CD  . GLU B 2 47  ? 32.311  135.381 11.618  1.00 26.40 ? 547  GLU B CD  1 
ATOM   2925 O  OE1 . GLU B 2 47  ? 31.132  135.793 11.577  1.00 27.24 ? 547  GLU B OE1 1 
ATOM   2926 O  OE2 . GLU B 2 47  ? 33.234  136.007 12.189  1.00 27.56 ? 547  GLU B OE2 1 
ATOM   2927 N  N   . GLN B 2 48  ? 31.457  130.533 13.648  1.00 18.94 ? 548  GLN B N   1 
ATOM   2928 C  CA  . GLN B 2 48  ? 30.618  129.484 14.208  1.00 19.10 ? 548  GLN B CA  1 
ATOM   2929 C  C   . GLN B 2 48  ? 30.504  129.664 15.722  1.00 19.16 ? 548  GLN B C   1 
ATOM   2930 O  O   . GLN B 2 48  ? 29.418  129.562 16.286  1.00 19.46 ? 548  GLN B O   1 
ATOM   2931 C  CB  . GLN B 2 48  ? 31.215  128.110 13.883  1.00 17.95 ? 548  GLN B CB  1 
ATOM   2932 C  CG  . GLN B 2 48  ? 30.448  126.924 14.458  1.00 17.59 ? 548  GLN B CG  1 
ATOM   2933 C  CD  . GLN B 2 48  ? 28.986  126.916 14.050  1.00 17.54 ? 548  GLN B CD  1 
ATOM   2934 O  OE1 . GLN B 2 48  ? 28.637  127.350 12.952  1.00 17.26 ? 548  GLN B OE1 1 
ATOM   2935 N  NE2 . GLN B 2 48  ? 28.126  126.407 14.927  1.00 16.38 ? 548  GLN B NE2 1 
ATOM   2936 N  N   . ALA B 2 49  ? 31.629  129.938 16.374  1.00 19.72 ? 549  ALA B N   1 
ATOM   2937 C  CA  . ALA B 2 49  ? 31.644  130.131 17.823  1.00 20.26 ? 549  ALA B CA  1 
ATOM   2938 C  C   . ALA B 2 49  ? 30.807  131.340 18.238  1.00 20.31 ? 549  ALA B C   1 
ATOM   2939 O  O   . ALA B 2 49  ? 30.151  131.321 19.279  1.00 20.45 ? 549  ALA B O   1 
ATOM   2940 C  CB  . ALA B 2 49  ? 33.086  130.290 18.317  1.00 20.44 ? 549  ALA B CB  1 
ATOM   2941 N  N   . LYS B 2 50  ? 30.829  132.393 17.428  1.00 21.09 ? 550  LYS B N   1 
ATOM   2942 C  CA  . LYS B 2 50  ? 30.054  133.594 17.736  1.00 21.52 ? 550  LYS B CA  1 
ATOM   2943 C  C   . LYS B 2 50  ? 28.559  133.288 17.707  1.00 20.82 ? 550  LYS B C   1 
ATOM   2944 O  O   . LYS B 2 50  ? 27.807  133.744 18.567  1.00 20.56 ? 550  LYS B O   1 
ATOM   2945 C  CB  . LYS B 2 50  ? 30.367  134.710 16.739  1.00 23.22 ? 550  LYS B CB  1 
ATOM   2946 C  CG  . LYS B 2 50  ? 31.782  135.256 16.846  1.00 26.53 ? 550  LYS B CG  1 
ATOM   2947 C  CD  . LYS B 2 50  ? 32.061  136.276 15.752  1.00 29.15 ? 550  LYS B CD  1 
ATOM   2948 C  CE  . LYS B 2 50  ? 31.248  137.537 15.955  1.00 31.14 ? 550  LYS B CE  1 
ATOM   2949 N  NZ  . LYS B 2 50  ? 31.643  138.225 17.221  1.00 34.01 ? 550  LYS B NZ  1 
ATOM   2950 N  N   . VAL B 2 51  ? 28.132  132.520 16.710  1.00 19.90 ? 551  VAL B N   1 
ATOM   2951 C  CA  . VAL B 2 51  ? 26.729  132.156 16.599  1.00 19.20 ? 551  VAL B CA  1 
ATOM   2952 C  C   . VAL B 2 51  ? 26.330  131.303 17.801  1.00 19.38 ? 551  VAL B C   1 
ATOM   2953 O  O   . VAL B 2 51  ? 25.297  131.540 18.425  1.00 19.18 ? 551  VAL B O   1 
ATOM   2954 C  CB  . VAL B 2 51  ? 26.454  131.364 15.296  1.00 19.36 ? 551  VAL B CB  1 
ATOM   2955 C  CG1 . VAL B 2 51  ? 25.061  130.724 15.347  1.00 18.26 ? 551  VAL B CG1 1 
ATOM   2956 C  CG2 . VAL B 2 51  ? 26.548  132.303 14.095  1.00 19.20 ? 551  VAL B CG2 1 
ATOM   2957 N  N   . GLU B 2 52  ? 27.158  130.316 18.131  1.00 19.80 ? 552  GLU B N   1 
ATOM   2958 C  CA  . GLU B 2 52  ? 26.861  129.436 19.256  1.00 20.14 ? 552  GLU B CA  1 
ATOM   2959 C  C   . GLU B 2 52  ? 26.740  130.178 20.583  1.00 20.64 ? 552  GLU B C   1 
ATOM   2960 O  O   . GLU B 2 52  ? 25.868  129.864 21.392  1.00 19.70 ? 552  GLU B O   1 
ATOM   2961 C  CB  . GLU B 2 52  ? 27.918  128.330 19.367  1.00 20.44 ? 552  GLU B CB  1 
ATOM   2962 C  CG  . GLU B 2 52  ? 27.798  127.257 18.284  1.00 20.15 ? 552  GLU B CG  1 
ATOM   2963 C  CD  . GLU B 2 52  ? 28.800  126.126 18.449  1.00 20.80 ? 552  GLU B CD  1 
ATOM   2964 O  OE1 . GLU B 2 52  ? 29.346  125.959 19.562  1.00 20.67 ? 552  GLU B OE1 1 
ATOM   2965 O  OE2 . GLU B 2 52  ? 29.030  125.391 17.468  1.00 20.43 ? 552  GLU B OE2 1 
ATOM   2966 N  N   . GLU B 2 53  ? 27.605  131.163 20.809  1.00 21.49 ? 553  GLU B N   1 
ATOM   2967 C  CA  . GLU B 2 53  ? 27.551  131.917 22.056  1.00 22.81 ? 553  GLU B CA  1 
ATOM   2968 C  C   . GLU B 2 53  ? 26.212  132.646 22.175  1.00 22.31 ? 553  GLU B C   1 
ATOM   2969 O  O   . GLU B 2 53  ? 25.590  132.649 23.236  1.00 21.83 ? 553  GLU B O   1 
ATOM   2970 C  CB  . GLU B 2 53  ? 28.702  132.922 22.130  1.00 25.11 ? 553  GLU B CB  1 
ATOM   2971 C  CG  . GLU B 2 53  ? 28.685  133.758 23.399  1.00 29.34 ? 553  GLU B CG  1 
ATOM   2972 C  CD  . GLU B 2 53  ? 28.642  132.898 24.652  1.00 31.99 ? 553  GLU B CD  1 
ATOM   2973 O  OE1 . GLU B 2 53  ? 29.623  132.161 24.900  1.00 34.06 ? 553  GLU B OE1 1 
ATOM   2974 O  OE2 . GLU B 2 53  ? 27.624  132.950 25.383  1.00 33.92 ? 553  GLU B OE2 1 
ATOM   2975 N  N   . LYS B 2 54  ? 25.775  133.262 21.082  1.00 21.48 ? 554  LYS B N   1 
ATOM   2976 C  CA  . LYS B 2 54  ? 24.502  133.971 21.071  1.00 21.97 ? 554  LYS B CA  1 
ATOM   2977 C  C   . LYS B 2 54  ? 23.344  132.994 21.275  1.00 21.07 ? 554  LYS B C   1 
ATOM   2978 O  O   . LYS B 2 54  ? 22.423  133.265 22.045  1.00 21.18 ? 554  LYS B O   1 
ATOM   2979 C  CB  . LYS B 2 54  ? 24.320  134.713 19.744  1.00 23.02 ? 554  LYS B CB  1 
ATOM   2980 C  CG  . LYS B 2 54  ? 22.956  135.374 19.576  1.00 25.01 ? 554  LYS B CG  1 
ATOM   2981 C  CD  . LYS B 2 54  ? 22.688  136.404 20.667  1.00 26.70 ? 554  LYS B CD  1 
ATOM   2982 C  CE  . LYS B 2 54  ? 21.336  137.077 20.468  1.00 27.95 ? 554  LYS B CE  1 
ATOM   2983 N  NZ  . LYS B 2 54  ? 21.091  138.116 21.509  1.00 29.67 ? 554  LYS B NZ  1 
ATOM   2984 N  N   . ILE B 2 55  ? 23.397  131.854 20.592  1.00 20.16 ? 555  ILE B N   1 
ATOM   2985 C  CA  . ILE B 2 55  ? 22.338  130.856 20.708  1.00 19.47 ? 555  ILE B CA  1 
ATOM   2986 C  C   . ILE B 2 55  ? 22.224  130.299 22.128  1.00 19.11 ? 555  ILE B C   1 
ATOM   2987 O  O   . ILE B 2 55  ? 21.123  130.032 22.599  1.00 18.60 ? 555  ILE B O   1 
ATOM   2988 C  CB  . ILE B 2 55  ? 22.550  129.675 19.719  1.00 19.72 ? 555  ILE B CB  1 
ATOM   2989 C  CG1 . ILE B 2 55  ? 22.534  130.189 18.273  1.00 20.31 ? 555  ILE B CG1 1 
ATOM   2990 C  CG2 . ILE B 2 55  ? 21.446  128.629 19.903  1.00 19.14 ? 555  ILE B CG2 1 
ATOM   2991 C  CD1 . ILE B 2 55  ? 21.257  130.892 17.879  1.00 20.31 ? 555  ILE B CD1 1 
ATOM   2992 N  N   . GLN B 2 56  ? 23.355  130.118 22.806  1.00 19.01 ? 556  GLN B N   1 
ATOM   2993 C  CA  . GLN B 2 56  ? 23.328  129.600 24.173  1.00 19.88 ? 556  GLN B CA  1 
ATOM   2994 C  C   . GLN B 2 56  ? 22.604  130.591 25.084  1.00 20.08 ? 556  GLN B C   1 
ATOM   2995 O  O   . GLN B 2 56  ? 21.828  130.191 25.951  1.00 20.12 ? 556  GLN B O   1 
ATOM   2996 C  CB  . GLN B 2 56  ? 24.749  129.360 24.691  1.00 20.29 ? 556  GLN B CB  1 
ATOM   2997 C  CG  . GLN B 2 56  ? 24.818  128.791 26.110  1.00 21.45 ? 556  GLN B CG  1 
ATOM   2998 C  CD  . GLN B 2 56  ? 24.031  127.497 26.269  1.00 22.59 ? 556  GLN B CD  1 
ATOM   2999 O  OE1 . GLN B 2 56  ? 22.884  127.500 26.716  1.00 23.91 ? 556  GLN B OE1 1 
ATOM   3000 N  NE2 . GLN B 2 56  ? 24.645  126.384 25.895  1.00 23.05 ? 556  GLN B NE2 1 
ATOM   3001 N  N   . GLU B 2 57  ? 22.867  131.880 24.887  1.00 20.35 ? 557  GLU B N   1 
ATOM   3002 C  CA  . GLU B 2 57  ? 22.216  132.920 25.679  1.00 20.79 ? 557  GLU B CA  1 
ATOM   3003 C  C   . GLU B 2 57  ? 20.706  132.840 25.471  1.00 19.97 ? 557  GLU B C   1 
ATOM   3004 O  O   . GLU B 2 57  ? 19.932  132.933 26.419  1.00 19.09 ? 557  GLU B O   1 
ATOM   3005 C  CB  . GLU B 2 57  ? 22.708  134.306 25.257  1.00 22.67 ? 557  GLU B CB  1 
ATOM   3006 C  CG  . GLU B 2 57  ? 24.121  134.631 25.690  1.00 26.86 ? 557  GLU B CG  1 
ATOM   3007 C  CD  . GLU B 2 57  ? 24.561  136.001 25.206  1.00 29.47 ? 557  GLU B CD  1 
ATOM   3008 O  OE1 . GLU B 2 57  ? 23.700  136.909 25.139  1.00 31.32 ? 557  GLU B OE1 1 
ATOM   3009 O  OE2 . GLU B 2 57  ? 25.764  136.171 24.905  1.00 30.95 ? 557  GLU B OE2 1 
ATOM   3010 N  N   . VAL B 2 58  ? 20.292  132.677 24.219  1.00 19.02 ? 558  VAL B N   1 
ATOM   3011 C  CA  . VAL B 2 58  ? 18.874  132.573 23.909  1.00 18.79 ? 558  VAL B CA  1 
ATOM   3012 C  C   . VAL B 2 58  ? 18.276  131.337 24.578  1.00 18.68 ? 558  VAL B C   1 
ATOM   3013 O  O   . VAL B 2 58  ? 17.251  131.429 25.253  1.00 18.86 ? 558  VAL B O   1 
ATOM   3014 C  CB  . VAL B 2 58  ? 18.638  132.490 22.385  1.00 18.86 ? 558  VAL B CB  1 
ATOM   3015 C  CG1 . VAL B 2 58  ? 17.153  132.315 22.098  1.00 18.26 ? 558  VAL B CG1 1 
ATOM   3016 C  CG2 . VAL B 2 58  ? 19.168  133.752 21.712  1.00 18.70 ? 558  VAL B CG2 1 
ATOM   3017 N  N   . PHE B 2 59  ? 18.919  130.186 24.394  1.00 18.54 ? 559  PHE B N   1 
ATOM   3018 C  CA  . PHE B 2 59  ? 18.445  128.937 24.993  1.00 18.73 ? 559  PHE B CA  1 
ATOM   3019 C  C   . PHE B 2 59  ? 18.230  129.124 26.496  1.00 19.28 ? 559  PHE B C   1 
ATOM   3020 O  O   . PHE B 2 59  ? 17.179  128.771 27.041  1.00 19.42 ? 559  PHE B O   1 
ATOM   3021 C  CB  . PHE B 2 59  ? 19.471  127.814 24.780  1.00 18.29 ? 559  PHE B CB  1 
ATOM   3022 C  CG  . PHE B 2 59  ? 19.457  127.204 23.398  1.00 18.62 ? 559  PHE B CG  1 
ATOM   3023 C  CD1 . PHE B 2 59  ? 20.510  126.389 22.987  1.00 17.91 ? 559  PHE B CD1 1 
ATOM   3024 C  CD2 . PHE B 2 59  ? 18.388  127.406 22.525  1.00 17.93 ? 559  PHE B CD2 1 
ATOM   3025 C  CE1 . PHE B 2 59  ? 20.500  125.782 21.728  1.00 18.17 ? 559  PHE B CE1 1 
ATOM   3026 C  CE2 . PHE B 2 59  ? 18.370  126.801 21.262  1.00 18.49 ? 559  PHE B CE2 1 
ATOM   3027 C  CZ  . PHE B 2 59  ? 19.427  125.989 20.864  1.00 17.76 ? 559  PHE B CZ  1 
ATOM   3028 N  N   . SER B 2 60  ? 19.238  129.677 27.162  1.00 19.32 ? 560  SER B N   1 
ATOM   3029 C  CA  . SER B 2 60  ? 19.170  129.900 28.603  1.00 19.78 ? 560  SER B CA  1 
ATOM   3030 C  C   . SER B 2 60  ? 18.013  130.796 29.039  1.00 19.64 ? 560  SER B C   1 
ATOM   3031 O  O   . SER B 2 60  ? 17.506  130.659 30.154  1.00 19.69 ? 560  SER B O   1 
ATOM   3032 C  CB  . SER B 2 60  ? 20.489  130.490 29.101  1.00 20.01 ? 560  SER B CB  1 
ATOM   3033 O  OG  . SER B 2 60  ? 21.529  129.535 28.988  1.00 21.19 ? 560  SER B OG  1 
ATOM   3034 N  N   . SER B 2 61  ? 17.584  131.702 28.166  1.00 19.44 ? 561  SER B N   1 
ATOM   3035 C  CA  . SER B 2 61  ? 16.494  132.606 28.522  1.00 20.14 ? 561  SER B CA  1 
ATOM   3036 C  C   . SER B 2 61  ? 15.143  131.899 28.606  1.00 20.23 ? 561  SER B C   1 
ATOM   3037 O  O   . SER B 2 61  ? 14.168  132.485 29.077  1.00 20.43 ? 561  SER B O   1 
ATOM   3038 C  CB  . SER B 2 61  ? 16.408  133.773 27.528  1.00 20.06 ? 561  SER B CB  1 
ATOM   3039 O  OG  . SER B 2 61  ? 15.901  133.353 26.275  1.00 20.52 ? 561  SER B OG  1 
ATOM   3040 N  N   . TYR B 2 62  ? 15.079  130.650 28.146  1.00 19.89 ? 562  TYR B N   1 
ATOM   3041 C  CA  . TYR B 2 62  ? 13.832  129.887 28.197  1.00 20.01 ? 562  TYR B CA  1 
ATOM   3042 C  C   . TYR B 2 62  ? 13.817  128.870 29.332  1.00 20.07 ? 562  TYR B C   1 
ATOM   3043 O  O   . TYR B 2 62  ? 12.856  128.115 29.488  1.00 19.99 ? 562  TYR B O   1 
ATOM   3044 C  CB  . TYR B 2 62  ? 13.580  129.160 26.871  1.00 20.26 ? 562  TYR B CB  1 
ATOM   3045 C  CG  . TYR B 2 62  ? 13.215  130.091 25.744  1.00 19.61 ? 562  TYR B CG  1 
ATOM   3046 C  CD1 . TYR B 2 62  ? 14.200  130.755 25.013  1.00 19.78 ? 562  TYR B CD1 1 
ATOM   3047 C  CD2 . TYR B 2 62  ? 11.880  130.354 25.444  1.00 19.76 ? 562  TYR B CD2 1 
ATOM   3048 C  CE1 . TYR B 2 62  ? 13.862  131.664 24.009  1.00 20.19 ? 562  TYR B CE1 1 
ATOM   3049 C  CE2 . TYR B 2 62  ? 11.531  131.257 24.450  1.00 20.57 ? 562  TYR B CE2 1 
ATOM   3050 C  CZ  . TYR B 2 62  ? 12.527  131.909 23.738  1.00 20.38 ? 562  TYR B CZ  1 
ATOM   3051 O  OH  . TYR B 2 62  ? 12.175  132.812 22.766  1.00 21.86 ? 562  TYR B OH  1 
ATOM   3052 N  N   . LYS B 2 63  ? 14.883  128.863 30.125  1.00 20.34 ? 563  LYS B N   1 
ATOM   3053 C  CA  . LYS B 2 63  ? 15.011  127.936 31.247  1.00 21.12 ? 563  LYS B CA  1 
ATOM   3054 C  C   . LYS B 2 63  ? 15.066  128.692 32.570  1.00 20.93 ? 563  LYS B C   1 
ATOM   3055 O  O   . LYS B 2 63  ? 15.777  129.686 32.694  1.00 20.73 ? 563  LYS B O   1 
ATOM   3056 C  CB  . LYS B 2 63  ? 16.283  127.092 31.084  1.00 21.52 ? 563  LYS B CB  1 
ATOM   3057 C  CG  . LYS B 2 63  ? 16.544  126.095 32.207  1.00 23.12 ? 563  LYS B CG  1 
ATOM   3058 C  CD  . LYS B 2 63  ? 17.825  125.302 31.950  1.00 24.04 ? 563  LYS B CD  1 
ATOM   3059 C  CE  . LYS B 2 63  ? 18.234  124.471 33.166  1.00 24.98 ? 563  LYS B CE  1 
ATOM   3060 N  NZ  . LYS B 2 63  ? 17.176  123.506 33.595  1.00 25.21 ? 563  LYS B NZ  1 
ATOM   3061 N  N   . PHE B 2 64  ? 14.297  128.223 33.546  1.00 20.61 ? 564  PHE B N   1 
ATOM   3062 C  CA  . PHE B 2 64  ? 14.267  128.831 34.872  1.00 20.79 ? 564  PHE B CA  1 
ATOM   3063 C  C   . PHE B 2 64  ? 14.489  127.667 35.828  1.00 20.54 ? 564  PHE B C   1 
ATOM   3064 O  O   . PHE B 2 64  ? 13.572  127.212 36.516  1.00 20.38 ? 564  PHE B O   1 
ATOM   3065 C  CB  . PHE B 2 64  ? 12.913  129.507 35.108  1.00 22.16 ? 564  PHE B CB  1 
ATOM   3066 C  CG  . PHE B 2 64  ? 12.558  130.522 34.050  1.00 23.53 ? 564  PHE B CG  1 
ATOM   3067 C  CD1 . PHE B 2 64  ? 11.897  130.135 32.886  1.00 24.08 ? 564  PHE B CD1 1 
ATOM   3068 C  CD2 . PHE B 2 64  ? 12.946  131.853 34.187  1.00 24.30 ? 564  PHE B CD2 1 
ATOM   3069 C  CE1 . PHE B 2 64  ? 11.630  131.060 31.871  1.00 24.66 ? 564  PHE B CE1 1 
ATOM   3070 C  CE2 . PHE B 2 64  ? 12.685  132.788 33.180  1.00 24.53 ? 564  PHE B CE2 1 
ATOM   3071 C  CZ  . PHE B 2 64  ? 12.026  132.389 32.018  1.00 25.00 ? 564  PHE B CZ  1 
ATOM   3072 N  N   . ASN B 2 65  ? 15.728  127.187 35.846  1.00 20.26 ? 565  ASN B N   1 
ATOM   3073 C  CA  . ASN B 2 65  ? 16.105  126.036 36.647  1.00 20.50 ? 565  ASN B CA  1 
ATOM   3074 C  C   . ASN B 2 65  ? 15.235  124.863 36.207  1.00 20.42 ? 565  ASN B C   1 
ATOM   3075 O  O   . ASN B 2 65  ? 15.241  124.512 35.026  1.00 20.85 ? 565  ASN B O   1 
ATOM   3076 C  CB  . ASN B 2 65  ? 15.966  126.337 38.145  1.00 19.97 ? 565  ASN B CB  1 
ATOM   3077 C  CG  . ASN B 2 65  ? 17.076  127.242 38.645  1.00 20.52 ? 565  ASN B CG  1 
ATOM   3078 O  OD1 . ASN B 2 65  ? 18.250  126.979 38.392  1.00 20.92 ? 565  ASN B OD1 1 
ATOM   3079 N  ND2 . ASN B 2 65  ? 16.717  128.310 39.344  1.00 20.06 ? 565  ASN B ND2 1 
ATOM   3080 N  N   . HIS B 2 66  ? 14.473  124.265 37.117  1.00 20.16 ? 566  HIS B N   1 
ATOM   3081 C  CA  . HIS B 2 66  ? 13.648  123.123 36.734  1.00 20.30 ? 566  HIS B CA  1 
ATOM   3082 C  C   . HIS B 2 66  ? 12.331  123.511 36.053  1.00 19.89 ? 566  HIS B C   1 
ATOM   3083 O  O   . HIS B 2 66  ? 11.593  122.648 35.573  1.00 19.80 ? 566  HIS B O   1 
ATOM   3084 C  CB  . HIS B 2 66  ? 13.376  122.237 37.954  1.00 21.43 ? 566  HIS B CB  1 
ATOM   3085 C  CG  . HIS B 2 66  ? 12.878  120.869 37.605  1.00 22.83 ? 566  HIS B CG  1 
ATOM   3086 N  ND1 . HIS B 2 66  ? 13.539  120.040 36.725  1.00 23.53 ? 566  HIS B ND1 1 
ATOM   3087 C  CD2 . HIS B 2 66  ? 11.780  120.186 38.011  1.00 23.52 ? 566  HIS B CD2 1 
ATOM   3088 C  CE1 . HIS B 2 66  ? 12.870  118.907 36.600  1.00 23.73 ? 566  HIS B CE1 1 
ATOM   3089 N  NE2 . HIS B 2 66  ? 11.798  118.971 37.370  1.00 24.22 ? 566  HIS B NE2 1 
ATOM   3090 N  N   . LEU B 2 67  ? 12.031  124.804 36.011  1.00 19.06 ? 567  LEU B N   1 
ATOM   3091 C  CA  . LEU B 2 67  ? 10.813  125.268 35.355  1.00 18.49 ? 567  LEU B CA  1 
ATOM   3092 C  C   . LEU B 2 67  ? 11.148  125.592 33.900  1.00 18.18 ? 567  LEU B C   1 
ATOM   3093 O  O   . LEU B 2 67  ? 12.004  126.434 33.634  1.00 17.29 ? 567  LEU B O   1 
ATOM   3094 C  CB  . LEU B 2 67  ? 10.267  126.524 36.048  1.00 18.07 ? 567  LEU B CB  1 
ATOM   3095 C  CG  . LEU B 2 67  ? 9.087   127.224 35.365  1.00 17.83 ? 567  LEU B CG  1 
ATOM   3096 C  CD1 . LEU B 2 67  ? 7.919   126.251 35.216  1.00 17.91 ? 567  LEU B CD1 1 
ATOM   3097 C  CD2 . LEU B 2 67  ? 8.668   128.440 36.183  1.00 18.29 ? 567  LEU B CD2 1 
ATOM   3098 N  N   . VAL B 2 68  ? 10.487  124.913 32.966  1.00 17.88 ? 568  VAL B N   1 
ATOM   3099 C  CA  . VAL B 2 68  ? 10.717  125.154 31.540  1.00 17.83 ? 568  VAL B CA  1 
ATOM   3100 C  C   . VAL B 2 68  ? 9.362   125.317 30.849  1.00 17.66 ? 568  VAL B C   1 
ATOM   3101 O  O   . VAL B 2 68  ? 8.773   124.353 30.358  1.00 17.76 ? 568  VAL B O   1 
ATOM   3102 C  CB  . VAL B 2 68  ? 11.495  123.985 30.893  1.00 18.00 ? 568  VAL B CB  1 
ATOM   3103 C  CG1 . VAL B 2 68  ? 11.942  124.366 29.481  1.00 17.94 ? 568  VAL B CG1 1 
ATOM   3104 C  CG2 . VAL B 2 68  ? 12.705  123.628 31.756  1.00 18.39 ? 568  VAL B CG2 1 
ATOM   3105 N  N   . PRO B 2 69  ? 8.846   126.555 30.809  1.00 17.81 ? 569  PRO B N   1 
ATOM   3106 C  CA  . PRO B 2 69  ? 7.551   126.851 30.185  1.00 18.06 ? 569  PRO B CA  1 
ATOM   3107 C  C   . PRO B 2 69  ? 7.462   126.372 28.739  1.00 18.08 ? 569  PRO B C   1 
ATOM   3108 O  O   . PRO B 2 69  ? 8.446   126.411 27.997  1.00 17.99 ? 569  PRO B O   1 
ATOM   3109 C  CB  . PRO B 2 69  ? 7.457   128.374 30.293  1.00 18.02 ? 569  PRO B CB  1 
ATOM   3110 C  CG  . PRO B 2 69  ? 8.272   128.682 31.520  1.00 18.32 ? 569  PRO B CG  1 
ATOM   3111 C  CD  . PRO B 2 69  ? 9.470   127.783 31.326  1.00 18.02 ? 569  PRO B CD  1 
ATOM   3112 N  N   . ARG B 2 70  ? 6.278   125.916 28.343  1.00 18.00 ? 570  ARG B N   1 
ATOM   3113 C  CA  . ARG B 2 70  ? 6.076   125.441 26.980  1.00 18.24 ? 570  ARG B CA  1 
ATOM   3114 C  C   . ARG B 2 70  ? 6.366   126.553 25.974  1.00 17.87 ? 570  ARG B C   1 
ATOM   3115 O  O   . ARG B 2 70  ? 6.042   127.716 26.212  1.00 17.57 ? 570  ARG B O   1 
ATOM   3116 C  CB  . ARG B 2 70  ? 4.643   124.923 26.804  1.00 18.67 ? 570  ARG B CB  1 
ATOM   3117 C  CG  . ARG B 2 70  ? 4.424   123.544 27.405  1.00 19.63 ? 570  ARG B CG  1 
ATOM   3118 C  CD  . ARG B 2 70  ? 3.018   123.014 27.156  1.00 21.01 ? 570  ARG B CD  1 
ATOM   3119 N  NE  . ARG B 2 70  ? 2.856   121.673 27.711  1.00 21.73 ? 570  ARG B NE  1 
ATOM   3120 C  CZ  . ARG B 2 70  ? 2.857   120.548 27.000  1.00 22.55 ? 570  ARG B CZ  1 
ATOM   3121 N  NH1 . ARG B 2 70  ? 3.005   120.582 25.680  1.00 23.07 ? 570  ARG B NH1 1 
ATOM   3122 N  NH2 . ARG B 2 70  ? 2.725   119.379 27.617  1.00 22.38 ? 570  ARG B NH2 1 
ATOM   3123 N  N   . LEU B 2 71  ? 6.991   126.190 24.857  1.00 17.58 ? 571  LEU B N   1 
ATOM   3124 C  CA  . LEU B 2 71  ? 7.328   127.160 23.819  1.00 17.53 ? 571  LEU B CA  1 
ATOM   3125 C  C   . LEU B 2 71  ? 6.069   127.572 23.068  1.00 17.42 ? 571  LEU B C   1 
ATOM   3126 O  O   . LEU B 2 71  ? 5.166   126.762 22.868  1.00 17.20 ? 571  LEU B O   1 
ATOM   3127 C  CB  . LEU B 2 71  ? 8.349   126.562 22.843  1.00 17.12 ? 571  LEU B CB  1 
ATOM   3128 C  CG  . LEU B 2 71  ? 9.683   126.141 23.472  1.00 17.28 ? 571  LEU B CG  1 
ATOM   3129 C  CD1 . LEU B 2 71  ? 10.603  125.579 22.399  1.00 16.47 ? 571  LEU B CD1 1 
ATOM   3130 C  CD2 . LEU B 2 71  ? 10.333  127.339 24.164  1.00 16.91 ? 571  LEU B CD2 1 
ATOM   3131 N  N   . VAL B 2 72  ? 6.022   128.832 22.648  1.00 17.31 ? 572  VAL B N   1 
ATOM   3132 C  CA  . VAL B 2 72  ? 4.862   129.359 21.942  1.00 17.43 ? 572  VAL B CA  1 
ATOM   3133 C  C   . VAL B 2 72  ? 5.170   129.981 20.579  1.00 17.68 ? 572  VAL B C   1 
ATOM   3134 O  O   . VAL B 2 72  ? 6.062   130.823 20.455  1.00 17.46 ? 572  VAL B O   1 
ATOM   3135 C  CB  . VAL B 2 72  ? 4.146   130.437 22.801  1.00 17.72 ? 572  VAL B CB  1 
ATOM   3136 C  CG1 . VAL B 2 72  ? 2.966   131.033 22.033  1.00 17.26 ? 572  VAL B CG1 1 
ATOM   3137 C  CG2 . VAL B 2 72  ? 3.681   129.829 24.124  1.00 17.23 ? 572  VAL B CG2 1 
ATOM   3138 N  N   . LEU B 2 73  ? 4.432   129.551 19.559  1.00 17.85 ? 573  LEU B N   1 
ATOM   3139 C  CA  . LEU B 2 73  ? 4.576   130.117 18.221  1.00 17.84 ? 573  LEU B CA  1 
ATOM   3140 C  C   . LEU B 2 73  ? 3.669   131.349 18.286  1.00 18.07 ? 573  LEU B C   1 
ATOM   3141 O  O   . LEU B 2 73  ? 2.480   131.219 18.557  1.00 18.01 ? 573  LEU B O   1 
ATOM   3142 C  CB  . LEU B 2 73  ? 4.056   129.144 17.155  1.00 17.13 ? 573  LEU B CB  1 
ATOM   3143 C  CG  . LEU B 2 73  ? 3.986   129.710 15.729  1.00 17.56 ? 573  LEU B CG  1 
ATOM   3144 C  CD1 . LEU B 2 73  ? 5.388   129.958 15.212  1.00 16.74 ? 573  LEU B CD1 1 
ATOM   3145 C  CD2 . LEU B 2 73  ? 3.242   128.753 14.811  1.00 17.47 ? 573  LEU B CD2 1 
ATOM   3146 N  N   . GLN B 2 74  ? 4.226   132.533 18.052  1.00 18.75 ? 574  GLN B N   1 
ATOM   3147 C  CA  . GLN B 2 74  ? 3.442   133.763 18.125  1.00 20.01 ? 574  GLN B CA  1 
ATOM   3148 C  C   . GLN B 2 74  ? 2.576   133.990 16.883  1.00 20.02 ? 574  GLN B C   1 
ATOM   3149 O  O   . GLN B 2 74  ? 2.771   134.946 16.129  1.00 19.15 ? 574  GLN B O   1 
ATOM   3150 C  CB  . GLN B 2 74  ? 4.371   134.957 18.355  1.00 20.89 ? 574  GLN B CB  1 
ATOM   3151 C  CG  . GLN B 2 74  ? 5.228   134.854 19.622  1.00 22.65 ? 574  GLN B CG  1 
ATOM   3152 C  CD  . GLN B 2 74  ? 4.401   134.756 20.896  1.00 24.50 ? 574  GLN B CD  1 
ATOM   3153 O  OE1 . GLN B 2 74  ? 3.308   135.316 20.988  1.00 26.06 ? 574  GLN B OE1 1 
ATOM   3154 N  NE2 . GLN B 2 74  ? 4.931   134.055 21.895  1.00 25.23 ? 574  GLN B NE2 1 
ATOM   3155 N  N   . ARG B 2 75  ? 1.610   133.095 16.704  1.00 20.19 ? 575  ARG B N   1 
ATOM   3156 C  CA  . ARG B 2 75  ? 0.678   133.111 15.580  1.00 21.01 ? 575  ARG B CA  1 
ATOM   3157 C  C   . ARG B 2 75  ? 0.088   134.465 15.218  1.00 20.96 ? 575  ARG B C   1 
ATOM   3158 O  O   . ARG B 2 75  ? 0.203   134.917 14.080  1.00 19.58 ? 575  ARG B O   1 
ATOM   3159 C  CB  . ARG B 2 75  ? -0.480  132.159 15.862  1.00 21.27 ? 575  ARG B CB  1 
ATOM   3160 C  CG  . ARG B 2 75  ? -0.074  130.724 15.985  1.00 23.24 ? 575  ARG B CG  1 
ATOM   3161 C  CD  . ARG B 2 75  ? -1.230  129.883 16.494  1.00 23.78 ? 575  ARG B CD  1 
ATOM   3162 N  NE  . ARG B 2 75  ? -1.098  128.523 16.004  1.00 25.28 ? 575  ARG B NE  1 
ATOM   3163 C  CZ  . ARG B 2 75  ? -1.371  128.160 14.759  1.00 25.09 ? 575  ARG B CZ  1 
ATOM   3164 N  NH1 . ARG B 2 75  ? -1.802  129.062 13.886  1.00 24.92 ? 575  ARG B NH1 1 
ATOM   3165 N  NH2 . ARG B 2 75  ? -1.189  126.905 14.384  1.00 25.50 ? 575  ARG B NH2 1 
ATOM   3166 N  N   . GLU B 2 76  ? -0.566  135.101 16.183  1.00 21.44 ? 576  GLU B N   1 
ATOM   3167 C  CA  . GLU B 2 76  ? -1.193  136.388 15.923  1.00 23.14 ? 576  GLU B CA  1 
ATOM   3168 C  C   . GLU B 2 76  ? -0.238  137.466 15.437  1.00 22.08 ? 576  GLU B C   1 
ATOM   3169 O  O   . GLU B 2 76  ? -0.592  138.254 14.560  1.00 22.14 ? 576  GLU B O   1 
ATOM   3170 C  CB  . GLU B 2 76  ? -1.956  136.871 17.155  1.00 24.85 ? 576  GLU B CB  1 
ATOM   3171 C  CG  . GLU B 2 76  ? -3.275  136.148 17.350  1.00 29.72 ? 576  GLU B CG  1 
ATOM   3172 C  CD  . GLU B 2 76  ? -4.094  136.073 16.064  1.00 32.32 ? 576  GLU B CD  1 
ATOM   3173 O  OE1 . GLU B 2 76  ? -3.822  135.180 15.224  1.00 34.29 ? 576  GLU B OE1 1 
ATOM   3174 O  OE2 . GLU B 2 76  ? -5.003  136.915 15.886  1.00 34.00 ? 576  GLU B OE2 1 
ATOM   3175 N  N   . LYS B 2 77  ? 0.968   137.509 15.995  1.00 21.88 ? 577  LYS B N   1 
ATOM   3176 C  CA  . LYS B 2 77  ? 1.940   138.506 15.558  1.00 21.77 ? 577  LYS B CA  1 
ATOM   3177 C  C   . LYS B 2 77  ? 2.345   138.214 14.112  1.00 21.09 ? 577  LYS B C   1 
ATOM   3178 O  O   . LYS B 2 77  ? 2.416   139.122 13.279  1.00 20.22 ? 577  LYS B O   1 
ATOM   3179 C  CB  . LYS B 2 77  ? 3.182   138.479 16.446  1.00 23.58 ? 577  LYS B CB  1 
ATOM   3180 C  CG  . LYS B 2 77  ? 2.926   138.751 17.920  1.00 26.00 ? 577  LYS B CG  1 
ATOM   3181 C  CD  . LYS B 2 77  ? 4.215   138.539 18.699  1.00 28.76 ? 577  LYS B CD  1 
ATOM   3182 C  CE  . LYS B 2 77  ? 4.023   138.682 20.202  1.00 30.57 ? 577  LYS B CE  1 
ATOM   3183 N  NZ  . LYS B 2 77  ? 5.333   138.512 20.902  1.00 31.50 ? 577  LYS B NZ  1 
ATOM   3184 N  N   . HIS B 2 78  ? 2.607   136.944 13.814  1.00 20.04 ? 578  HIS B N   1 
ATOM   3185 C  CA  . HIS B 2 78  ? 3.003   136.564 12.461  1.00 19.64 ? 578  HIS B CA  1 
ATOM   3186 C  C   . HIS B 2 78  ? 1.884   136.876 11.477  1.00 19.99 ? 578  HIS B C   1 
ATOM   3187 O  O   . HIS B 2 78  ? 2.132   137.389 10.386  1.00 19.14 ? 578  HIS B O   1 
ATOM   3188 C  CB  . HIS B 2 78  ? 3.350   135.073 12.403  1.00 19.28 ? 578  HIS B CB  1 
ATOM   3189 C  CG  . HIS B 2 78  ? 4.448   134.678 13.341  1.00 18.52 ? 578  HIS B CG  1 
ATOM   3190 N  ND1 . HIS B 2 78  ? 5.579   135.443 13.523  1.00 18.67 ? 578  HIS B ND1 1 
ATOM   3191 C  CD2 . HIS B 2 78  ? 4.596   133.591 14.136  1.00 18.21 ? 578  HIS B CD2 1 
ATOM   3192 C  CE1 . HIS B 2 78  ? 6.378   134.845 14.389  1.00 18.25 ? 578  HIS B CE1 1 
ATOM   3193 N  NE2 . HIS B 2 78  ? 5.804   133.719 14.776  1.00 18.16 ? 578  HIS B NE2 1 
ATOM   3194 N  N   . PHE B 2 79  ? 0.649   136.577 11.878  1.00 20.10 ? 579  PHE B N   1 
ATOM   3195 C  CA  . PHE B 2 79  ? -0.514  136.831 11.037  1.00 20.66 ? 579  PHE B CA  1 
ATOM   3196 C  C   . PHE B 2 79  ? -0.638  138.304 10.637  1.00 20.75 ? 579  PHE B C   1 
ATOM   3197 O  O   . PHE B 2 79  ? -0.823  138.619 9.462   1.00 20.68 ? 579  PHE B O   1 
ATOM   3198 C  CB  . PHE B 2 79  ? -1.794  136.382 11.757  1.00 21.22 ? 579  PHE B CB  1 
ATOM   3199 C  CG  . PHE B 2 79  ? -3.061  136.860 11.101  1.00 21.94 ? 579  PHE B CG  1 
ATOM   3200 C  CD1 . PHE B 2 79  ? -3.357  136.511 9.787   1.00 22.00 ? 579  PHE B CD1 1 
ATOM   3201 C  CD2 . PHE B 2 79  ? -3.954  137.669 11.796  1.00 22.50 ? 579  PHE B CD2 1 
ATOM   3202 C  CE1 . PHE B 2 79  ? -4.523  136.962 9.171   1.00 22.20 ? 579  PHE B CE1 1 
ATOM   3203 C  CE2 . PHE B 2 79  ? -5.127  138.128 11.189  1.00 22.49 ? 579  PHE B CE2 1 
ATOM   3204 C  CZ  . PHE B 2 79  ? -5.410  137.772 9.873   1.00 22.70 ? 579  PHE B CZ  1 
ATOM   3205 N  N   . HIS B 2 80  ? -0.537  139.204 11.609  1.00 21.04 ? 580  HIS B N   1 
ATOM   3206 C  CA  . HIS B 2 80  ? -0.655  140.632 11.324  1.00 21.71 ? 580  HIS B CA  1 
ATOM   3207 C  C   . HIS B 2 80  ? 0.458   141.147 10.416  1.00 20.93 ? 580  HIS B C   1 
ATOM   3208 O  O   . HIS B 2 80  ? 0.227   142.003 9.563   1.00 19.58 ? 580  HIS B O   1 
ATOM   3209 C  CB  . HIS B 2 80  ? -0.700  141.421 12.633  1.00 23.96 ? 580  HIS B CB  1 
ATOM   3210 C  CG  . HIS B 2 80  ? -1.962  141.203 13.409  1.00 26.65 ? 580  HIS B CG  1 
ATOM   3211 N  ND1 . HIS B 2 80  ? -3.209  141.469 12.884  1.00 27.72 ? 580  HIS B ND1 1 
ATOM   3212 C  CD2 . HIS B 2 80  ? -2.175  140.701 14.649  1.00 27.91 ? 580  HIS B CD2 1 
ATOM   3213 C  CE1 . HIS B 2 80  ? -4.136  141.136 13.765  1.00 28.23 ? 580  HIS B CE1 1 
ATOM   3214 N  NE2 . HIS B 2 80  ? -3.535  140.667 14.844  1.00 28.42 ? 580  HIS B NE2 1 
ATOM   3215 N  N   . TYR B 2 81  ? 1.660   140.611 10.599  1.00 19.81 ? 581  TYR B N   1 
ATOM   3216 C  CA  . TYR B 2 81  ? 2.810   140.982 9.782   1.00 19.54 ? 581  TYR B CA  1 
ATOM   3217 C  C   . TYR B 2 81  ? 2.552   140.536 8.337   1.00 19.38 ? 581  TYR B C   1 
ATOM   3218 O  O   . TYR B 2 81  ? 2.758   141.297 7.390   1.00 19.10 ? 581  TYR B O   1 
ATOM   3219 C  CB  . TYR B 2 81  ? 4.062   140.303 10.352  1.00 19.17 ? 581  TYR B CB  1 
ATOM   3220 C  CG  . TYR B 2 81  ? 5.288   140.325 9.463   1.00 19.69 ? 581  TYR B CG  1 
ATOM   3221 C  CD1 . TYR B 2 81  ? 5.882   141.529 9.070   1.00 19.15 ? 581  TYR B CD1 1 
ATOM   3222 C  CD2 . TYR B 2 81  ? 5.879   139.130 9.044   1.00 19.32 ? 581  TYR B CD2 1 
ATOM   3223 C  CE1 . TYR B 2 81  ? 7.044   141.535 8.283   1.00 19.20 ? 581  TYR B CE1 1 
ATOM   3224 C  CE2 . TYR B 2 81  ? 7.030   139.125 8.265   1.00 19.24 ? 581  TYR B CE2 1 
ATOM   3225 C  CZ  . TYR B 2 81  ? 7.608   140.323 7.888   1.00 19.24 ? 581  TYR B CZ  1 
ATOM   3226 O  OH  . TYR B 2 81  ? 8.753   140.292 7.125   1.00 18.78 ? 581  TYR B OH  1 
ATOM   3227 N  N   . LEU B 2 82  ? 2.080   139.303 8.183   1.00 19.43 ? 582  LEU B N   1 
ATOM   3228 C  CA  . LEU B 2 82  ? 1.782   138.736 6.871   1.00 20.05 ? 582  LEU B CA  1 
ATOM   3229 C  C   . LEU B 2 82  ? 0.625   139.461 6.182   1.00 21.41 ? 582  LEU B C   1 
ATOM   3230 O  O   . LEU B 2 82  ? 0.703   139.804 4.998   1.00 21.14 ? 582  LEU B O   1 
ATOM   3231 C  CB  . LEU B 2 82  ? 1.432   137.253 7.020   1.00 19.86 ? 582  LEU B CB  1 
ATOM   3232 C  CG  . LEU B 2 82  ? 2.575   136.331 7.449   1.00 19.49 ? 582  LEU B CG  1 
ATOM   3233 C  CD1 . LEU B 2 82  ? 2.015   135.006 7.948   1.00 18.76 ? 582  LEU B CD1 1 
ATOM   3234 C  CD2 . LEU B 2 82  ? 3.520   136.125 6.258   1.00 19.18 ? 582  LEU B CD2 1 
ATOM   3235 N  N   . LYS B 2 83  ? -0.451  139.680 6.930   1.00 22.03 ? 583  LYS B N   1 
ATOM   3236 C  CA  . LYS B 2 83  ? -1.635  140.356 6.411   1.00 24.11 ? 583  LYS B CA  1 
ATOM   3237 C  C   . LYS B 2 83  ? -1.270  141.725 5.838   1.00 24.32 ? 583  LYS B C   1 
ATOM   3238 O  O   . LYS B 2 83  ? -1.740  142.112 4.772   1.00 24.11 ? 583  LYS B O   1 
ATOM   3239 C  CB  . LYS B 2 83  ? -2.672  140.505 7.531   1.00 24.62 ? 583  LYS B CB  1 
ATOM   3240 C  CG  . LYS B 2 83  ? -3.974  141.170 7.113   1.00 27.23 ? 583  LYS B CG  1 
ATOM   3241 C  CD  . LYS B 2 83  ? -4.965  141.195 8.275   1.00 28.70 ? 583  LYS B CD  1 
ATOM   3242 C  CE  . LYS B 2 83  ? -6.233  141.952 7.918   1.00 29.93 ? 583  LYS B CE  1 
ATOM   3243 N  NZ  . LYS B 2 83  ? -5.938  143.363 7.551   1.00 32.51 ? 583  LYS B NZ  1 
ATOM   3244 N  N   . ARG B 2 84  ? -0.415  142.447 6.550   1.00 25.31 ? 584  ARG B N   1 
ATOM   3245 C  CA  . ARG B 2 84  ? 0.018   143.765 6.115   1.00 26.56 ? 584  ARG B CA  1 
ATOM   3246 C  C   . ARG B 2 84  ? 0.868   143.696 4.843   1.00 26.16 ? 584  ARG B C   1 
ATOM   3247 O  O   . ARG B 2 84  ? 0.663   144.471 3.906   1.00 25.95 ? 584  ARG B O   1 
ATOM   3248 C  CB  . ARG B 2 84  ? 0.810   144.438 7.237   1.00 28.35 ? 584  ARG B CB  1 
ATOM   3249 C  CG  . ARG B 2 84  ? 1.462   145.748 6.846   1.00 32.03 ? 584  ARG B CG  1 
ATOM   3250 C  CD  . ARG B 2 84  ? 0.426   146.819 6.551   1.00 35.13 ? 584  ARG B CD  1 
ATOM   3251 N  NE  . ARG B 2 84  ? 1.041   148.061 6.089   1.00 37.73 ? 584  ARG B NE  1 
ATOM   3252 C  CZ  . ARG B 2 84  ? 0.378   149.199 5.906   1.00 39.55 ? 584  ARG B CZ  1 
ATOM   3253 N  NH1 . ARG B 2 84  ? -0.927  149.254 6.149   1.00 40.45 ? 584  ARG B NH1 1 
ATOM   3254 N  NH2 . ARG B 2 84  ? 1.016   150.283 5.480   1.00 39.84 ? 584  ARG B NH2 1 
ATOM   3255 N  N   . GLY B 2 85  ? 1.812   142.761 4.808   1.00 25.23 ? 585  GLY B N   1 
ATOM   3256 C  CA  . GLY B 2 85  ? 2.679   142.634 3.651   1.00 25.08 ? 585  GLY B CA  1 
ATOM   3257 C  C   . GLY B 2 85  ? 1.986   142.257 2.354   1.00 25.33 ? 585  GLY B C   1 
ATOM   3258 O  O   . GLY B 2 85  ? 2.460   142.596 1.268   1.00 24.76 ? 585  GLY B O   1 
ATOM   3259 N  N   . LEU B 2 86  ? 0.859   141.564 2.461   1.00 25.43 ? 586  LEU B N   1 
ATOM   3260 C  CA  . LEU B 2 86  ? 0.124   141.126 1.285   1.00 26.13 ? 586  LEU B CA  1 
ATOM   3261 C  C   . LEU B 2 86  ? -0.467  142.294 0.492   1.00 26.88 ? 586  LEU B C   1 
ATOM   3262 O  O   . LEU B 2 86  ? -0.757  142.158 -0.696  1.00 26.10 ? 586  LEU B O   1 
ATOM   3263 C  CB  . LEU B 2 86  ? -0.977  140.140 1.699   1.00 25.82 ? 586  LEU B CB  1 
ATOM   3264 C  CG  . LEU B 2 86  ? -1.662  139.336 0.590   1.00 26.01 ? 586  LEU B CG  1 
ATOM   3265 C  CD1 . LEU B 2 86  ? -0.626  138.569 -0.226  1.00 26.25 ? 586  LEU B CD1 1 
ATOM   3266 C  CD2 . LEU B 2 86  ? -2.663  138.382 1.207   1.00 25.99 ? 586  LEU B CD2 1 
ATOM   3267 N  N   . ARG B 2 87  ? -0.630  143.446 1.137   1.00 27.74 ? 587  ARG B N   1 
ATOM   3268 C  CA  . ARG B 2 87  ? -1.184  144.606 0.449   1.00 29.73 ? 587  ARG B CA  1 
ATOM   3269 C  C   . ARG B 2 87  ? -0.118  145.623 0.056   1.00 30.34 ? 587  ARG B C   1 
ATOM   3270 O  O   . ARG B 2 87  ? 0.008   145.967 -1.115  1.00 30.12 ? 587  ARG B O   1 
ATOM   3271 C  CB  . ARG B 2 87  ? -2.253  145.290 1.315   1.00 30.95 ? 587  ARG B CB  1 
ATOM   3272 C  CG  . ARG B 2 87  ? -3.353  144.346 1.784   1.00 32.74 ? 587  ARG B CG  1 
ATOM   3273 C  CD  . ARG B 2 87  ? -4.703  144.569 1.091   1.00 34.49 ? 587  ARG B CD  1 
ATOM   3274 N  NE  . ARG B 2 87  ? -4.641  144.558 -0.371  1.00 34.83 ? 587  ARG B NE  1 
ATOM   3275 C  CZ  . ARG B 2 87  ? -5.643  144.162 -1.156  1.00 35.36 ? 587  ARG B CZ  1 
ATOM   3276 N  NH1 . ARG B 2 87  ? -6.780  143.734 -0.621  1.00 35.40 ? 587  ARG B NH1 1 
ATOM   3277 N  NH2 . ARG B 2 87  ? -5.523  144.218 -2.477  1.00 34.76 ? 587  ARG B NH2 1 
ATOM   3278 N  N   . GLN B 2 88  ? 0.659   146.095 1.024   1.00 31.52 ? 588  GLN B N   1 
ATOM   3279 C  CA  . GLN B 2 88  ? 1.683   147.091 0.724   1.00 32.91 ? 588  GLN B CA  1 
ATOM   3280 C  C   . GLN B 2 88  ? 3.029   146.867 1.390   1.00 32.71 ? 588  GLN B C   1 
ATOM   3281 O  O   . GLN B 2 88  ? 3.135   146.156 2.388   1.00 33.02 ? 588  GLN B O   1 
ATOM   3282 C  CB  . GLN B 2 88  ? 1.169   148.486 1.076   1.00 33.67 ? 588  GLN B CB  1 
ATOM   3283 C  CG  . GLN B 2 88  ? 0.110   148.984 0.114   1.00 36.71 ? 588  GLN B CG  1 
ATOM   3284 C  CD  . GLN B 2 88  ? -0.506  150.299 0.546   1.00 37.87 ? 588  GLN B CD  1 
ATOM   3285 O  OE1 . GLN B 2 88  ? 0.200   151.279 0.797   1.00 38.52 ? 588  GLN B OE1 1 
ATOM   3286 N  NE2 . GLN B 2 88  ? -1.834  150.329 0.631   1.00 38.54 ? 588  GLN B NE2 1 
ATOM   3287 N  N   . LEU B 2 89  ? 4.054   147.498 0.824   1.00 32.15 ? 589  LEU B N   1 
ATOM   3288 C  CA  . LEU B 2 89  ? 5.417   147.377 1.326   1.00 31.64 ? 589  LEU B CA  1 
ATOM   3289 C  C   . LEU B 2 89  ? 6.161   148.698 1.150   1.00 31.52 ? 589  LEU B C   1 
ATOM   3290 O  O   . LEU B 2 89  ? 5.863   149.464 0.236   1.00 31.33 ? 589  LEU B O   1 
ATOM   3291 C  CB  . LEU B 2 89  ? 6.143   146.274 0.555   1.00 31.16 ? 589  LEU B CB  1 
ATOM   3292 C  CG  . LEU B 2 89  ? 5.439   144.916 0.552   1.00 31.30 ? 589  LEU B CG  1 
ATOM   3293 C  CD1 . LEU B 2 89  ? 6.016   144.028 -0.544  1.00 31.00 ? 589  LEU B CD1 1 
ATOM   3294 C  CD2 . LEU B 2 89  ? 5.586   144.270 1.924   1.00 31.13 ? 589  LEU B CD2 1 
ATOM   3295 N  N   . THR B 2 90  ? 7.125   148.962 2.027   1.00 31.76 ? 590  THR B N   1 
ATOM   3296 C  CA  . THR B 2 90  ? 7.910   150.191 1.942   1.00 32.18 ? 590  THR B CA  1 
ATOM   3297 C  C   . THR B 2 90  ? 8.919   150.048 0.808   1.00 32.23 ? 590  THR B C   1 
ATOM   3298 O  O   . THR B 2 90  ? 9.089   148.953 0.266   1.00 31.69 ? 590  THR B O   1 
ATOM   3299 C  CB  . THR B 2 90  ? 8.683   150.457 3.241   1.00 32.46 ? 590  THR B CB  1 
ATOM   3300 O  OG1 . THR B 2 90  ? 9.574   149.364 3.495   1.00 32.99 ? 590  THR B OG1 1 
ATOM   3301 C  CG2 . THR B 2 90  ? 7.720   150.607 4.416   1.00 32.90 ? 590  THR B CG2 1 
ATOM   3302 N  N   . ASP B 2 91  ? 9.589   151.144 0.453   1.00 31.95 ? 591  ASP B N   1 
ATOM   3303 C  CA  . ASP B 2 91  ? 10.575  151.099 -0.621  1.00 31.95 ? 591  ASP B CA  1 
ATOM   3304 C  C   . ASP B 2 91  ? 11.751  150.204 -0.261  1.00 31.51 ? 591  ASP B C   1 
ATOM   3305 O  O   . ASP B 2 91  ? 12.653  149.992 -1.069  1.00 31.85 ? 591  ASP B O   1 
ATOM   3306 C  CB  . ASP B 2 91  ? 11.077  152.505 -0.980  1.00 32.60 ? 591  ASP B CB  1 
ATOM   3307 C  CG  . ASP B 2 91  ? 11.575  153.286 0.224   1.00 32.94 ? 591  ASP B CG  1 
ATOM   3308 O  OD1 . ASP B 2 91  ? 12.172  152.682 1.138   1.00 32.80 ? 591  ASP B OD1 1 
ATOM   3309 O  OD2 . ASP B 2 91  ? 11.381  154.520 0.241   1.00 33.69 ? 591  ASP B OD2 1 
ATOM   3310 N  N   . ALA B 2 92  ? 11.740  149.681 0.959   1.00 31.11 ? 592  ALA B N   1 
ATOM   3311 C  CA  . ALA B 2 92  ? 12.797  148.783 1.394   1.00 30.46 ? 592  ALA B CA  1 
ATOM   3312 C  C   . ALA B 2 92  ? 12.703  147.512 0.555   1.00 30.07 ? 592  ALA B C   1 
ATOM   3313 O  O   . ALA B 2 92  ? 13.659  146.743 0.474   1.00 30.24 ? 592  ALA B O   1 
ATOM   3314 C  CB  . ALA B 2 92  ? 12.631  148.450 2.871   1.00 30.72 ? 592  ALA B CB  1 
ATOM   3315 N  N   . TYR B 2 93  ? 11.545  147.297 -0.067  1.00 29.13 ? 593  TYR B N   1 
ATOM   3316 C  CA  . TYR B 2 93  ? 11.336  146.117 -0.902  1.00 28.08 ? 593  TYR B CA  1 
ATOM   3317 C  C   . TYR B 2 93  ? 11.564  146.375 -2.385  1.00 26.66 ? 593  TYR B C   1 
ATOM   3318 O  O   . TYR B 2 93  ? 11.158  145.580 -3.230  1.00 25.89 ? 593  TYR B O   1 
ATOM   3319 C  CB  . TYR B 2 93  ? 9.930   145.542 -0.686  1.00 29.18 ? 593  TYR B CB  1 
ATOM   3320 C  CG  . TYR B 2 93  ? 9.862   144.620 0.507   1.00 30.60 ? 593  TYR B CG  1 
ATOM   3321 C  CD1 . TYR B 2 93  ? 9.818   145.124 1.810   1.00 31.41 ? 593  TYR B CD1 1 
ATOM   3322 C  CD2 . TYR B 2 93  ? 9.954   143.242 0.337   1.00 31.24 ? 593  TYR B CD2 1 
ATOM   3323 C  CE1 . TYR B 2 93  ? 9.879   144.268 2.918   1.00 31.66 ? 593  TYR B CE1 1 
ATOM   3324 C  CE2 . TYR B 2 93  ? 10.017  142.384 1.423   1.00 32.09 ? 593  TYR B CE2 1 
ATOM   3325 C  CZ  . TYR B 2 93  ? 9.985   142.897 2.710   1.00 32.32 ? 593  TYR B CZ  1 
ATOM   3326 O  OH  . TYR B 2 93  ? 10.097  142.015 3.764   1.00 32.70 ? 593  TYR B OH  1 
ATOM   3327 N  N   . GLU B 2 94  ? 12.209  147.489 -2.705  1.00 25.25 ? 594  GLU B N   1 
ATOM   3328 C  CA  . GLU B 2 94  ? 12.492  147.789 -4.097  1.00 24.42 ? 594  GLU B CA  1 
ATOM   3329 C  C   . GLU B 2 94  ? 13.427  146.711 -4.638  1.00 23.43 ? 594  GLU B C   1 
ATOM   3330 O  O   . GLU B 2 94  ? 13.422  146.418 -5.832  1.00 23.08 ? 594  GLU B O   1 
ATOM   3331 C  CB  . GLU B 2 94  ? 13.136  149.174 -4.227  1.00 24.70 ? 594  GLU B CB  1 
ATOM   3332 C  CG  . GLU B 2 94  ? 12.131  150.318 -4.150  1.00 24.81 ? 594  GLU B CG  1 
ATOM   3333 C  CD  . GLU B 2 94  ? 12.780  151.688 -4.223  1.00 24.98 ? 594  GLU B CD  1 
ATOM   3334 O  OE1 . GLU B 2 94  ? 12.040  152.684 -4.387  1.00 24.84 ? 594  GLU B OE1 1 
ATOM   3335 O  OE2 . GLU B 2 94  ? 14.022  151.772 -4.111  1.00 24.45 ? 594  GLU B OE2 1 
ATOM   3336 N  N   . CYS B 2 95  ? 14.215  146.109 -3.751  1.00 22.67 ? 595  CYS B N   1 
ATOM   3337 C  CA  . CYS B 2 95  ? 15.155  145.063 -4.153  1.00 22.70 ? 595  CYS B CA  1 
ATOM   3338 C  C   . CYS B 2 95  ? 14.448  143.777 -4.578  1.00 21.66 ? 595  CYS B C   1 
ATOM   3339 O  O   . CYS B 2 95  ? 15.077  142.868 -5.126  1.00 21.35 ? 595  CYS B O   1 
ATOM   3340 C  CB  . CYS B 2 95  ? 16.129  144.757 -3.014  1.00 23.17 ? 595  CYS B CB  1 
ATOM   3341 S  SG  . CYS B 2 95  ? 15.338  144.158 -1.508  1.00 26.46 ? 595  CYS B SG  1 
ATOM   3342 N  N   . LEU B 2 96  ? 13.144  143.709 -4.323  1.00 20.61 ? 596  LEU B N   1 
ATOM   3343 C  CA  . LEU B 2 96  ? 12.340  142.545 -4.687  1.00 20.45 ? 596  LEU B CA  1 
ATOM   3344 C  C   . LEU B 2 96  ? 11.305  142.900 -5.747  1.00 19.59 ? 596  LEU B C   1 
ATOM   3345 O  O   . LEU B 2 96  ? 10.343  142.161 -5.962  1.00 19.43 ? 596  LEU B O   1 
ATOM   3346 C  CB  . LEU B 2 96  ? 11.632  141.979 -3.451  1.00 21.43 ? 596  LEU B CB  1 
ATOM   3347 C  CG  . LEU B 2 96  ? 12.539  141.274 -2.437  1.00 22.44 ? 596  LEU B CG  1 
ATOM   3348 C  CD1 . LEU B 2 96  ? 11.741  140.882 -1.198  1.00 23.73 ? 596  LEU B CD1 1 
ATOM   3349 C  CD2 . LEU B 2 96  ? 13.148  140.046 -3.082  1.00 22.61 ? 596  LEU B CD2 1 
ATOM   3350 N  N   . ASP B 2 97  ? 11.514  144.028 -6.419  1.00 19.06 ? 597  ASP B N   1 
ATOM   3351 C  CA  . ASP B 2 97  ? 10.586  144.480 -7.450  1.00 18.87 ? 597  ASP B CA  1 
ATOM   3352 C  C   . ASP B 2 97  ? 10.514  143.509 -8.629  1.00 18.42 ? 597  ASP B C   1 
ATOM   3353 O  O   . ASP B 2 97  ? 9.593   143.579 -9.446  1.00 19.07 ? 597  ASP B O   1 
ATOM   3354 C  CB  . ASP B 2 97  ? 10.986  145.876 -7.941  1.00 18.71 ? 597  ASP B CB  1 
ATOM   3355 C  CG  . ASP B 2 97  ? 9.978   146.459 -8.905  1.00 19.05 ? 597  ASP B CG  1 
ATOM   3356 O  OD1 . ASP B 2 97  ? 8.774   146.459 -8.573  1.00 18.63 ? 597  ASP B OD1 1 
ATOM   3357 O  OD2 . ASP B 2 97  ? 10.387  146.917 -9.992  1.00 18.83 ? 597  ASP B OD2 1 
ATOM   3358 N  N   . ALA B 2 98  ? 11.484  142.603 -8.717  1.00 17.83 ? 598  ALA B N   1 
ATOM   3359 C  CA  . ALA B 2 98  ? 11.506  141.617 -9.793  1.00 17.19 ? 598  ALA B CA  1 
ATOM   3360 C  C   . ALA B 2 98  ? 11.181  140.224 -9.240  1.00 17.36 ? 598  ALA B C   1 
ATOM   3361 O  O   . ALA B 2 98  ? 11.478  139.207 -9.871  1.00 16.81 ? 598  ALA B O   1 
ATOM   3362 C  CB  . ALA B 2 98  ? 12.872  141.612 -10.472 1.00 16.97 ? 598  ALA B CB  1 
ATOM   3363 N  N   . SER B 2 99  ? 10.560  140.190 -8.063  1.00 16.99 ? 599  SER B N   1 
ATOM   3364 C  CA  . SER B 2 99  ? 10.185  138.929 -7.415  1.00 17.53 ? 599  SER B CA  1 
ATOM   3365 C  C   . SER B 2 99  ? 8.855   139.060 -6.675  1.00 17.47 ? 599  SER B C   1 
ATOM   3366 O  O   . SER B 2 99  ? 8.650   138.417 -5.648  1.00 17.38 ? 599  SER B O   1 
ATOM   3367 C  CB  . SER B 2 99  ? 11.259  138.504 -6.404  1.00 17.53 ? 599  SER B CB  1 
ATOM   3368 O  OG  . SER B 2 99  ? 12.465  138.133 -7.045  1.00 19.36 ? 599  SER B OG  1 
ATOM   3369 N  N   . ARG B 2 100 ? 7.948   139.883 -7.186  1.00 16.80 ? 600  ARG B N   1 
ATOM   3370 C  CA  . ARG B 2 100 ? 6.683   140.057 -6.490  1.00 17.05 ? 600  ARG B CA  1 
ATOM   3371 C  C   . ARG B 2 100 ? 5.835   138.790 -6.380  1.00 16.48 ? 600  ARG B C   1 
ATOM   3372 O  O   . ARG B 2 100 ? 5.140   138.602 -5.383  1.00 16.90 ? 600  ARG B O   1 
ATOM   3373 C  CB  . ARG B 2 100 ? 5.919   141.240 -7.090  1.00 16.48 ? 600  ARG B CB  1 
ATOM   3374 C  CG  . ARG B 2 100 ? 6.654   142.554 -6.770  1.00 17.39 ? 600  ARG B CG  1 
ATOM   3375 C  CD  . ARG B 2 100 ? 6.044   143.761 -7.428  1.00 17.79 ? 600  ARG B CD  1 
ATOM   3376 N  NE  . ARG B 2 100 ? 4.709   144.059 -6.924  1.00 17.64 ? 600  ARG B NE  1 
ATOM   3377 C  CZ  . ARG B 2 100 ? 3.829   144.792 -7.593  1.00 17.80 ? 600  ARG B CZ  1 
ATOM   3378 N  NH1 . ARG B 2 100 ? 4.163   145.285 -8.780  1.00 17.65 ? 600  ARG B NH1 1 
ATOM   3379 N  NH2 . ARG B 2 100 ? 2.630   145.037 -7.081  1.00 17.09 ? 600  ARG B NH2 1 
ATOM   3380 N  N   . PRO B 2 101 ? 5.878   137.900 -7.388  1.00 16.35 ? 601  PRO B N   1 
ATOM   3381 C  CA  . PRO B 2 101 ? 5.062   136.691 -7.222  1.00 16.05 ? 601  PRO B CA  1 
ATOM   3382 C  C   . PRO B 2 101 ? 5.595   135.877 -6.033  1.00 15.99 ? 601  PRO B C   1 
ATOM   3383 O  O   . PRO B 2 101 ? 4.854   135.119 -5.408  1.00 15.37 ? 601  PRO B O   1 
ATOM   3384 C  CB  . PRO B 2 101 ? 5.241   135.971 -8.554  1.00 16.34 ? 601  PRO B CB  1 
ATOM   3385 C  CG  . PRO B 2 101 ? 5.340   137.125 -9.526  1.00 16.34 ? 601  PRO B CG  1 
ATOM   3386 C  CD  . PRO B 2 101 ? 6.309   138.048 -8.790  1.00 16.72 ? 601  PRO B CD  1 
ATOM   3387 N  N   . TRP B 2 102 ? 6.884   136.036 -5.731  1.00 15.98 ? 602  TRP B N   1 
ATOM   3388 C  CA  . TRP B 2 102 ? 7.492   135.340 -4.596  1.00 16.08 ? 602  TRP B CA  1 
ATOM   3389 C  C   . TRP B 2 102 ? 6.885   135.870 -3.298  1.00 16.42 ? 602  TRP B C   1 
ATOM   3390 O  O   . TRP B 2 102 ? 6.607   135.105 -2.373  1.00 16.88 ? 602  TRP B O   1 
ATOM   3391 C  CB  . TRP B 2 102 ? 9.011   135.555 -4.563  1.00 15.52 ? 602  TRP B CB  1 
ATOM   3392 C  CG  . TRP B 2 102 ? 9.781   134.627 -5.454  1.00 15.50 ? 602  TRP B CG  1 
ATOM   3393 C  CD1 . TRP B 2 102 ? 10.398  134.935 -6.637  1.00 15.41 ? 602  TRP B CD1 1 
ATOM   3394 C  CD2 . TRP B 2 102 ? 10.020  133.233 -5.228  1.00 14.99 ? 602  TRP B CD2 1 
ATOM   3395 N  NE1 . TRP B 2 102 ? 11.008  133.815 -7.160  1.00 14.94 ? 602  TRP B NE1 1 
ATOM   3396 C  CE2 . TRP B 2 102 ? 10.790  132.758 -6.314  1.00 15.27 ? 602  TRP B CE2 1 
ATOM   3397 C  CE3 . TRP B 2 102 ? 9.656   132.338 -4.211  1.00 15.22 ? 602  TRP B CE3 1 
ATOM   3398 C  CZ2 . TRP B 2 102 ? 11.205  131.423 -6.413  1.00 15.25 ? 602  TRP B CZ2 1 
ATOM   3399 C  CZ3 . TRP B 2 102 ? 10.069  131.011 -4.306  1.00 15.14 ? 602  TRP B CZ3 1 
ATOM   3400 C  CH2 . TRP B 2 102 ? 10.838  130.568 -5.401  1.00 15.71 ? 602  TRP B CH2 1 
ATOM   3401 N  N   . LEU B 2 103 ? 6.697   137.183 -3.222  1.00 16.09 ? 603  LEU B N   1 
ATOM   3402 C  CA  . LEU B 2 103 ? 6.102   137.779 -2.030  1.00 16.67 ? 603  LEU B CA  1 
ATOM   3403 C  C   . LEU B 2 103 ? 4.691   137.216 -1.840  1.00 16.42 ? 603  LEU B C   1 
ATOM   3404 O  O   . LEU B 2 103 ? 4.287   136.891 -0.721  1.00 16.03 ? 603  LEU B O   1 
ATOM   3405 C  CB  . LEU B 2 103 ? 6.060   139.307 -2.159  1.00 16.64 ? 603  LEU B CB  1 
ATOM   3406 C  CG  . LEU B 2 103 ? 7.412   140.030 -2.077  1.00 17.27 ? 603  LEU B CG  1 
ATOM   3407 C  CD1 . LEU B 2 103 ? 7.255   141.476 -2.551  1.00 17.83 ? 603  LEU B CD1 1 
ATOM   3408 C  CD2 . LEU B 2 103 ? 7.936   139.990 -0.640  1.00 17.82 ? 603  LEU B CD2 1 
ATOM   3409 N  N   . CYS B 2 104 ? 3.952   137.084 -2.938  1.00 16.53 ? 604  CYS B N   1 
ATOM   3410 C  CA  . CYS B 2 104 ? 2.595   136.543 -2.882  1.00 17.01 ? 604  CYS B CA  1 
ATOM   3411 C  C   . CYS B 2 104 ? 2.626   135.116 -2.341  1.00 17.12 ? 604  CYS B C   1 
ATOM   3412 O  O   . CYS B 2 104 ? 1.850   134.757 -1.443  1.00 16.99 ? 604  CYS B O   1 
ATOM   3413 C  CB  . CYS B 2 104 ? 1.955   136.529 -4.277  1.00 17.54 ? 604  CYS B CB  1 
ATOM   3414 S  SG  . CYS B 2 104 ? 1.497   138.153 -4.951  1.00 18.62 ? 604  CYS B SG  1 
ATOM   3415 N  N   . TYR B 2 105 ? 3.523   134.307 -2.899  1.00 16.43 ? 605  TYR B N   1 
ATOM   3416 C  CA  . TYR B 2 105 ? 3.661   132.915 -2.487  1.00 16.53 ? 605  TYR B CA  1 
ATOM   3417 C  C   . TYR B 2 105 ? 4.102   132.767 -1.033  1.00 16.27 ? 605  TYR B C   1 
ATOM   3418 O  O   . TYR B 2 105 ? 3.464   132.055 -0.265  1.00 16.76 ? 605  TYR B O   1 
ATOM   3419 C  CB  . TYR B 2 105 ? 4.650   132.176 -3.397  1.00 16.21 ? 605  TYR B CB  1 
ATOM   3420 C  CG  . TYR B 2 105 ? 5.118   130.857 -2.812  1.00 16.14 ? 605  TYR B CG  1 
ATOM   3421 C  CD1 . TYR B 2 105 ? 4.212   129.827 -2.544  1.00 15.73 ? 605  TYR B CD1 1 
ATOM   3422 C  CD2 . TYR B 2 105 ? 6.456   130.666 -2.462  1.00 15.84 ? 605  TYR B CD2 1 
ATOM   3423 C  CE1 . TYR B 2 105 ? 4.625   128.640 -1.933  1.00 15.88 ? 605  TYR B CE1 1 
ATOM   3424 C  CE2 . TYR B 2 105 ? 6.883   129.483 -1.852  1.00 16.32 ? 605  TYR B CE2 1 
ATOM   3425 C  CZ  . TYR B 2 105 ? 5.962   128.478 -1.587  1.00 16.43 ? 605  TYR B CZ  1 
ATOM   3426 O  OH  . TYR B 2 105 ? 6.368   127.325 -0.962  1.00 17.13 ? 605  TYR B OH  1 
ATOM   3427 N  N   . TRP B 2 106 ? 5.191   133.432 -0.657  1.00 16.15 ? 606  TRP B N   1 
ATOM   3428 C  CA  . TRP B 2 106 ? 5.687   133.336 0.716   1.00 16.08 ? 606  TRP B CA  1 
ATOM   3429 C  C   . TRP B 2 106 ? 4.623   133.723 1.737   1.00 16.22 ? 606  TRP B C   1 
ATOM   3430 O  O   . TRP B 2 106 ? 4.466   133.064 2.769   1.00 16.48 ? 606  TRP B O   1 
ATOM   3431 C  CB  . TRP B 2 106 ? 6.912   134.234 0.928   1.00 15.68 ? 606  TRP B CB  1 
ATOM   3432 C  CG  . TRP B 2 106 ? 8.123   133.837 0.138   1.00 15.56 ? 606  TRP B CG  1 
ATOM   3433 C  CD1 . TRP B 2 106 ? 8.509   132.567 -0.197  1.00 15.61 ? 606  TRP B CD1 1 
ATOM   3434 C  CD2 . TRP B 2 106 ? 9.127   134.714 -0.389  1.00 15.49 ? 606  TRP B CD2 1 
ATOM   3435 N  NE1 . TRP B 2 106 ? 9.690   132.604 -0.902  1.00 15.42 ? 606  TRP B NE1 1 
ATOM   3436 C  CE2 . TRP B 2 106 ? 10.091  133.907 -1.036  1.00 14.96 ? 606  TRP B CE2 1 
ATOM   3437 C  CE3 . TRP B 2 106 ? 9.304   136.106 -0.380  1.00 14.99 ? 606  TRP B CE3 1 
ATOM   3438 C  CZ2 . TRP B 2 106 ? 11.215  134.446 -1.670  1.00 15.65 ? 606  TRP B CZ2 1 
ATOM   3439 C  CZ3 . TRP B 2 106 ? 10.429  136.643 -1.013  1.00 16.00 ? 606  TRP B CZ3 1 
ATOM   3440 C  CH2 . TRP B 2 106 ? 11.367  135.813 -1.647  1.00 15.31 ? 606  TRP B CH2 1 
ATOM   3441 N  N   . ILE B 2 107 ? 3.896   134.800 1.453   1.00 16.08 ? 607  ILE B N   1 
ATOM   3442 C  CA  . ILE B 2 107 ? 2.863   135.268 2.366   1.00 16.11 ? 607  ILE B CA  1 
ATOM   3443 C  C   . ILE B 2 107 ? 1.646   134.345 2.407   1.00 15.90 ? 607  ILE B C   1 
ATOM   3444 O  O   . ILE B 2 107 ? 1.173   133.985 3.488   1.00 16.42 ? 607  ILE B O   1 
ATOM   3445 C  CB  . ILE B 2 107 ? 2.437   136.713 2.010   1.00 16.21 ? 607  ILE B CB  1 
ATOM   3446 C  CG1 . ILE B 2 107 ? 3.626   137.653 2.232   1.00 15.51 ? 607  ILE B CG1 1 
ATOM   3447 C  CG2 . ILE B 2 107 ? 1.249   137.142 2.864   1.00 15.35 ? 607  ILE B CG2 1 
ATOM   3448 C  CD1 . ILE B 2 107 ? 3.400   139.077 1.762   1.00 16.48 ? 607  ILE B CD1 1 
ATOM   3449 N  N   . LEU B 2 108 ? 1.151   133.948 1.240   1.00 15.65 ? 608  LEU B N   1 
ATOM   3450 C  CA  . LEU B 2 108 ? -0.007  133.061 1.173   1.00 15.95 ? 608  LEU B CA  1 
ATOM   3451 C  C   . LEU B 2 108 ? 0.274   131.695 1.786   1.00 16.03 ? 608  LEU B C   1 
ATOM   3452 O  O   . LEU B 2 108 ? -0.589  131.111 2.448   1.00 16.31 ? 608  LEU B O   1 
ATOM   3453 C  CB  . LEU B 2 108 ? -0.465  132.885 -0.277  1.00 16.16 ? 608  LEU B CB  1 
ATOM   3454 C  CG  . LEU B 2 108 ? -1.086  134.126 -0.922  1.00 17.46 ? 608  LEU B CG  1 
ATOM   3455 C  CD1 . LEU B 2 108 ? -1.538  133.798 -2.348  1.00 17.87 ? 608  LEU B CD1 1 
ATOM   3456 C  CD2 . LEU B 2 108 ? -2.266  134.593 -0.088  1.00 18.20 ? 608  LEU B CD2 1 
ATOM   3457 N  N   . HIS B 2 109 ? 1.480   131.180 1.568   1.00 15.59 ? 609  HIS B N   1 
ATOM   3458 C  CA  . HIS B 2 109 ? 1.832   129.877 2.119   1.00 15.22 ? 609  HIS B CA  1 
ATOM   3459 C  C   . HIS B 2 109 ? 1.993   129.951 3.634   1.00 15.26 ? 609  HIS B C   1 
ATOM   3460 O  O   . HIS B 2 109 ? 1.661   129.001 4.348   1.00 14.83 ? 609  HIS B O   1 
ATOM   3461 C  CB  . HIS B 2 109 ? 3.120   129.349 1.489   1.00 14.76 ? 609  HIS B CB  1 
ATOM   3462 C  CG  . HIS B 2 109 ? 3.506   127.988 1.977   1.00 14.61 ? 609  HIS B CG  1 
ATOM   3463 N  ND1 . HIS B 2 109 ? 2.610   126.943 2.044   1.00 14.20 ? 609  HIS B ND1 1 
ATOM   3464 C  CD2 . HIS B 2 109 ? 4.690   127.496 2.408   1.00 14.62 ? 609  HIS B CD2 1 
ATOM   3465 C  CE1 . HIS B 2 109 ? 3.226   125.865 2.497   1.00 14.75 ? 609  HIS B CE1 1 
ATOM   3466 N  NE2 . HIS B 2 109 ? 4.489   126.173 2.726   1.00 15.25 ? 609  HIS B NE2 1 
ATOM   3467 N  N   . SER B 2 110 ? 2.509   131.073 4.123   1.00 15.23 ? 610  SER B N   1 
ATOM   3468 C  CA  . SER B 2 110 ? 2.677   131.246 5.564   1.00 15.80 ? 610  SER B CA  1 
ATOM   3469 C  C   . SER B 2 110 ? 1.293   131.292 6.214   1.00 16.21 ? 610  SER B C   1 
ATOM   3470 O  O   . SER B 2 110 ? 1.061   130.664 7.250   1.00 16.19 ? 610  SER B O   1 
ATOM   3471 C  CB  . SER B 2 110 ? 3.435   132.542 5.868   1.00 15.08 ? 610  SER B CB  1 
ATOM   3472 O  OG  . SER B 2 110 ? 4.767   132.488 5.380   1.00 15.86 ? 610  SER B OG  1 
ATOM   3473 N  N   . LEU B 2 111 ? 0.379   132.043 5.602   1.00 16.52 ? 611  LEU B N   1 
ATOM   3474 C  CA  . LEU B 2 111 ? -0.983  132.165 6.117   1.00 16.86 ? 611  LEU B CA  1 
ATOM   3475 C  C   . LEU B 2 111 ? -1.665  130.802 6.074   1.00 17.21 ? 611  LEU B C   1 
ATOM   3476 O  O   . LEU B 2 111 ? -2.391  130.418 6.994   1.00 17.36 ? 611  LEU B O   1 
ATOM   3477 C  CB  . LEU B 2 111 ? -1.771  133.178 5.281   1.00 17.01 ? 611  LEU B CB  1 
ATOM   3478 C  CG  . LEU B 2 111 ? -1.313  134.636 5.414   1.00 17.54 ? 611  LEU B CG  1 
ATOM   3479 C  CD1 . LEU B 2 111 ? -1.946  135.485 4.307   1.00 17.84 ? 611  LEU B CD1 1 
ATOM   3480 C  CD2 . LEU B 2 111 ? -1.693  135.167 6.791   1.00 17.43 ? 611  LEU B CD2 1 
ATOM   3481 N  N   . GLU B 2 112 ? -1.427  130.076 4.989   1.00 17.29 ? 612  GLU B N   1 
ATOM   3482 C  CA  . GLU B 2 112 ? -1.987  128.744 4.823   1.00 17.78 ? 612  GLU B CA  1 
ATOM   3483 C  C   . GLU B 2 112 ? -1.476  127.822 5.936   1.00 17.36 ? 612  GLU B C   1 
ATOM   3484 O  O   . GLU B 2 112 ? -2.248  127.068 6.534   1.00 16.88 ? 612  GLU B O   1 
ATOM   3485 C  CB  . GLU B 2 112 ? -1.597  128.198 3.448   1.00 18.78 ? 612  GLU B CB  1 
ATOM   3486 C  CG  . GLU B 2 112 ? -1.573  126.699 3.349   1.00 20.39 ? 612  GLU B CG  1 
ATOM   3487 C  CD  . GLU B 2 112 ? -1.073  126.215 2.004   1.00 19.92 ? 612  GLU B CD  1 
ATOM   3488 O  OE1 . GLU B 2 112 ? 0.006   126.664 1.554   1.00 19.18 ? 612  GLU B OE1 1 
ATOM   3489 O  OE2 . GLU B 2 112 ? -1.760  125.372 1.402   1.00 20.57 ? 612  GLU B OE2 1 
ATOM   3490 N  N   . LEU B 2 113 ? -0.179  127.886 6.220   1.00 17.00 ? 613  LEU B N   1 
ATOM   3491 C  CA  . LEU B 2 113 ? 0.398   127.047 7.270   1.00 17.09 ? 613  LEU B CA  1 
ATOM   3492 C  C   . LEU B 2 113 ? -0.197  127.388 8.637   1.00 17.56 ? 613  LEU B C   1 
ATOM   3493 O  O   . LEU B 2 113 ? -0.420  126.504 9.470   1.00 16.54 ? 613  LEU B O   1 
ATOM   3494 C  CB  . LEU B 2 113 ? 1.918   127.216 7.306   1.00 16.98 ? 613  LEU B CB  1 
ATOM   3495 C  CG  . LEU B 2 113 ? 2.693   126.596 6.135   1.00 17.50 ? 613  LEU B CG  1 
ATOM   3496 C  CD1 . LEU B 2 113 ? 4.147   127.044 6.174   1.00 16.80 ? 613  LEU B CD1 1 
ATOM   3497 C  CD2 . LEU B 2 113 ? 2.597   125.078 6.211   1.00 17.10 ? 613  LEU B CD2 1 
ATOM   3498 N  N   . LEU B 2 114 ? -0.449  128.678 8.853   1.00 17.88 ? 614  LEU B N   1 
ATOM   3499 C  CA  . LEU B 2 114 ? -1.015  129.175 10.100  1.00 19.39 ? 614  LEU B CA  1 
ATOM   3500 C  C   . LEU B 2 114 ? -2.527  128.988 10.142  1.00 20.84 ? 614  LEU B C   1 
ATOM   3501 O  O   . LEU B 2 114 ? -3.187  129.400 11.096  1.00 21.04 ? 614  LEU B O   1 
ATOM   3502 C  CB  . LEU B 2 114 ? -0.677  130.660 10.265  1.00 18.52 ? 614  LEU B CB  1 
ATOM   3503 C  CG  . LEU B 2 114 ? 0.812   130.960 10.442  1.00 18.30 ? 614  LEU B CG  1 
ATOM   3504 C  CD1 . LEU B 2 114 ? 1.066   132.456 10.322  1.00 18.06 ? 614  LEU B CD1 1 
ATOM   3505 C  CD2 . LEU B 2 114 ? 1.271   130.428 11.799  1.00 18.44 ? 614  LEU B CD2 1 
ATOM   3506 N  N   . ASP B 2 115 ? -3.071  128.367 9.102   1.00 22.17 ? 615  ASP B N   1 
ATOM   3507 C  CA  . ASP B 2 115 ? -4.504  128.127 9.016   1.00 24.43 ? 615  ASP B CA  1 
ATOM   3508 C  C   . ASP B 2 115 ? -5.291  129.437 9.140   1.00 25.58 ? 615  ASP B C   1 
ATOM   3509 O  O   . ASP B 2 115 ? -6.320  129.497 9.814   1.00 25.64 ? 615  ASP B O   1 
ATOM   3510 C  CB  . ASP B 2 115 ? -4.935  127.137 10.106  1.00 25.45 ? 615  ASP B CB  1 
ATOM   3511 C  CG  . ASP B 2 115 ? -6.285  126.509 9.820   1.00 26.72 ? 615  ASP B CG  1 
ATOM   3512 O  OD1 . ASP B 2 115 ? -6.587  126.263 8.633   1.00 27.17 ? 615  ASP B OD1 1 
ATOM   3513 O  OD2 . ASP B 2 115 ? -7.039  126.246 10.781  1.00 27.62 ? 615  ASP B OD2 1 
ATOM   3514 N  N   . GLU B 2 116 ? -4.789  130.487 8.498   1.00 26.71 ? 616  GLU B N   1 
ATOM   3515 C  CA  . GLU B 2 116 ? -5.452  131.788 8.512   1.00 28.14 ? 616  GLU B CA  1 
ATOM   3516 C  C   . GLU B 2 116 ? -6.186  131.907 7.183   1.00 29.45 ? 616  GLU B C   1 
ATOM   3517 O  O   . GLU B 2 116 ? -5.575  131.841 6.118   1.00 29.69 ? 616  GLU B O   1 
ATOM   3518 C  CB  . GLU B 2 116 ? -4.427  132.919 8.643   1.00 27.98 ? 616  GLU B CB  1 
ATOM   3519 C  CG  . GLU B 2 116 ? -3.633  132.903 9.943   1.00 27.64 ? 616  GLU B CG  1 
ATOM   3520 C  CD  . GLU B 2 116 ? -4.415  133.440 11.129  1.00 28.19 ? 616  GLU B CD  1 
ATOM   3521 O  OE1 . GLU B 2 116 ? -5.638  133.661 10.997  1.00 27.66 ? 616  GLU B OE1 1 
ATOM   3522 O  OE2 . GLU B 2 116 ? -3.801  133.635 12.200  1.00 28.72 ? 616  GLU B OE2 1 
ATOM   3523 N  N   . PRO B 2 117 ? -7.512  132.076 7.226   1.00 30.65 ? 617  PRO B N   1 
ATOM   3524 C  CA  . PRO B 2 117 ? -8.277  132.192 5.984   1.00 31.63 ? 617  PRO B CA  1 
ATOM   3525 C  C   . PRO B 2 117 ? -7.902  133.393 5.120   1.00 32.04 ? 617  PRO B C   1 
ATOM   3526 O  O   . PRO B 2 117 ? -7.511  134.447 5.623   1.00 32.71 ? 617  PRO B O   1 
ATOM   3527 C  CB  . PRO B 2 117 ? -9.725  132.250 6.474   1.00 31.67 ? 617  PRO B CB  1 
ATOM   3528 C  CG  . PRO B 2 117 ? -9.599  132.917 7.813   1.00 31.74 ? 617  PRO B CG  1 
ATOM   3529 C  CD  . PRO B 2 117 ? -8.387  132.222 8.403   1.00 31.47 ? 617  PRO B CD  1 
ATOM   3530 N  N   . ILE B 2 118 ? -8.009  133.209 3.811   1.00 32.32 ? 618  ILE B N   1 
ATOM   3531 C  CA  . ILE B 2 118 ? -7.713  134.264 2.856   1.00 32.92 ? 618  ILE B CA  1 
ATOM   3532 C  C   . ILE B 2 118 ? -9.047  134.810 2.356   1.00 32.61 ? 618  ILE B C   1 
ATOM   3533 O  O   . ILE B 2 118 ? -9.807  134.101 1.697   1.00 33.02 ? 618  ILE B O   1 
ATOM   3534 C  CB  . ILE B 2 118 ? -6.899  133.720 1.661   1.00 33.57 ? 618  ILE B CB  1 
ATOM   3535 C  CG1 . ILE B 2 118 ? -5.558  133.171 2.161   1.00 34.56 ? 618  ILE B CG1 1 
ATOM   3536 C  CG2 . ILE B 2 118 ? -6.672  134.823 0.632   1.00 33.55 ? 618  ILE B CG2 1 
ATOM   3537 C  CD1 . ILE B 2 118 ? -4.722  132.508 1.085   1.00 35.84 ? 618  ILE B CD1 1 
ATOM   3538 N  N   . PRO B 2 119 ? -9.358  136.072 2.684   1.00 32.28 ? 619  PRO B N   1 
ATOM   3539 C  CA  . PRO B 2 119 ? -10.612 136.698 2.254   1.00 32.15 ? 619  PRO B CA  1 
ATOM   3540 C  C   . PRO B 2 119 ? -10.790 136.562 0.746   1.00 32.03 ? 619  PRO B C   1 
ATOM   3541 O  O   . PRO B 2 119 ? -9.820  136.640 -0.004  1.00 31.48 ? 619  PRO B O   1 
ATOM   3542 C  CB  . PRO B 2 119 ? -10.435 138.149 2.686   1.00 32.30 ? 619  PRO B CB  1 
ATOM   3543 C  CG  . PRO B 2 119 ? -9.587  138.028 3.913   1.00 32.47 ? 619  PRO B CG  1 
ATOM   3544 C  CD  . PRO B 2 119 ? -8.556  137.005 3.495   1.00 32.19 ? 619  PRO B CD  1 
ATOM   3545 N  N   . GLN B 2 120 ? -12.029 136.360 0.308   1.00 32.26 ? 620  GLN B N   1 
ATOM   3546 C  CA  . GLN B 2 120 ? -12.326 136.205 -1.114  1.00 33.05 ? 620  GLN B CA  1 
ATOM   3547 C  C   . GLN B 2 120 ? -11.802 137.392 -1.927  1.00 32.19 ? 620  GLN B C   1 
ATOM   3548 O  O   . GLN B 2 120 ? -11.258 137.215 -3.015  1.00 31.99 ? 620  GLN B O   1 
ATOM   3549 C  CB  . GLN B 2 120 ? -13.836 136.073 -1.321  1.00 35.17 ? 620  GLN B CB  1 
ATOM   3550 C  CG  . GLN B 2 120 ? -14.257 135.283 -2.562  1.00 38.63 ? 620  GLN B CG  1 
ATOM   3551 C  CD  . GLN B 2 120 ? -13.548 135.723 -3.834  1.00 40.91 ? 620  GLN B CD  1 
ATOM   3552 O  OE1 . GLN B 2 120 ? -12.412 135.314 -4.105  1.00 42.46 ? 620  GLN B OE1 1 
ATOM   3553 N  NE2 . GLN B 2 120 ? -14.214 136.564 -4.622  1.00 42.17 ? 620  GLN B NE2 1 
ATOM   3554 N  N   . ILE B 2 121 ? -11.973 138.599 -1.397  1.00 31.37 ? 621  ILE B N   1 
ATOM   3555 C  CA  . ILE B 2 121 ? -11.519 139.806 -2.078  1.00 30.90 ? 621  ILE B CA  1 
ATOM   3556 C  C   . ILE B 2 121 ? -10.008 139.806 -2.273  1.00 30.12 ? 621  ILE B C   1 
ATOM   3557 O  O   . ILE B 2 121 ? -9.513  140.116 -3.359  1.00 30.08 ? 621  ILE B O   1 
ATOM   3558 C  CB  . ILE B 2 121 ? -11.925 141.074 -1.295  1.00 31.32 ? 621  ILE B CB  1 
ATOM   3559 C  CG1 . ILE B 2 121 ? -13.447 141.244 -1.347  1.00 32.30 ? 621  ILE B CG1 1 
ATOM   3560 C  CG2 . ILE B 2 121 ? -11.231 142.295 -1.876  1.00 31.49 ? 621  ILE B CG2 1 
ATOM   3561 C  CD1 . ILE B 2 121 ? -13.959 142.492 -0.646  1.00 32.99 ? 621  ILE B CD1 1 
ATOM   3562 N  N   . VAL B 2 122 ? -9.281  139.463 -1.215  1.00 28.87 ? 622  VAL B N   1 
ATOM   3563 C  CA  . VAL B 2 122 ? -7.827  139.409 -1.274  1.00 28.15 ? 622  VAL B CA  1 
ATOM   3564 C  C   . VAL B 2 122 ? -7.412  138.352 -2.296  1.00 27.13 ? 622  VAL B C   1 
ATOM   3565 O  O   . VAL B 2 122 ? -6.495  138.565 -3.090  1.00 26.43 ? 622  VAL B O   1 
ATOM   3566 C  CB  . VAL B 2 122 ? -7.231  139.044 0.105   1.00 28.64 ? 622  VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 2 122 ? -5.721  138.895 0.001   1.00 29.15 ? 622  VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 2 122 ? -7.580  140.122 1.120   1.00 30.03 ? 622  VAL B CG2 1 
ATOM   3569 N  N   . ALA B 2 123 ? -8.105  137.218 -2.272  1.00 26.02 ? 623  ALA B N   1 
ATOM   3570 C  CA  . ALA B 2 123 ? -7.819  136.118 -3.183  1.00 25.77 ? 623  ALA B CA  1 
ATOM   3571 C  C   . ALA B 2 123 ? -7.966  136.547 -4.640  1.00 25.81 ? 623  ALA B C   1 
ATOM   3572 O  O   . ALA B 2 123 ? -7.093  136.273 -5.468  1.00 24.94 ? 623  ALA B O   1 
ATOM   3573 C  CB  . ALA B 2 123 ? -8.744  134.949 -2.888  1.00 26.12 ? 623  ALA B CB  1 
ATOM   3574 N  N   . THR B 2 124 ? -9.071  137.218 -4.954  1.00 25.19 ? 624  THR B N   1 
ATOM   3575 C  CA  . THR B 2 124 ? -9.302  137.671 -6.318  1.00 25.37 ? 624  THR B CA  1 
ATOM   3576 C  C   . THR B 2 124 ? -8.289  138.736 -6.725  1.00 24.11 ? 624  THR B C   1 
ATOM   3577 O  O   . THR B 2 124 ? -7.846  138.770 -7.873  1.00 24.12 ? 624  THR B O   1 
ATOM   3578 C  CB  . THR B 2 124 ? -10.740 138.213 -6.498  1.00 26.35 ? 624  THR B CB  1 
ATOM   3579 O  OG1 . THR B 2 124 ? -11.010 139.215 -5.512  1.00 29.26 ? 624  THR B OG1 1 
ATOM   3580 C  CG2 . THR B 2 124 ? -11.744 137.085 -6.344  1.00 26.61 ? 624  THR B CG2 1 
ATOM   3581 N  N   . ASP B 2 125 ? -7.909  139.594 -5.785  1.00 23.32 ? 625  ASP B N   1 
ATOM   3582 C  CA  . ASP B 2 125 ? -6.927  140.632 -6.076  1.00 22.55 ? 625  ASP B CA  1 
ATOM   3583 C  C   . ASP B 2 125 ? -5.572  140.001 -6.412  1.00 22.24 ? 625  ASP B C   1 
ATOM   3584 O  O   . ASP B 2 125 ? -4.888  140.440 -7.338  1.00 21.51 ? 625  ASP B O   1 
ATOM   3585 C  CB  . ASP B 2 125 ? -6.791  141.582 -4.885  1.00 22.87 ? 625  ASP B CB  1 
ATOM   3586 C  CG  . ASP B 2 125 ? -7.982  142.526 -4.753  1.00 23.62 ? 625  ASP B CG  1 
ATOM   3587 O  OD1 . ASP B 2 125 ? -8.110  143.185 -3.703  1.00 24.23 ? 625  ASP B OD1 1 
ATOM   3588 O  OD2 . ASP B 2 125 ? -8.783  142.612 -5.706  1.00 22.97 ? 625  ASP B OD2 1 
ATOM   3589 N  N   . VAL B 2 126 ? -5.187  138.972 -5.661  1.00 21.31 ? 626  VAL B N   1 
ATOM   3590 C  CA  . VAL B 2 126 ? -3.921  138.296 -5.924  1.00 20.84 ? 626  VAL B CA  1 
ATOM   3591 C  C   . VAL B 2 126 ? -3.981  137.692 -7.321  1.00 20.93 ? 626  VAL B C   1 
ATOM   3592 O  O   . VAL B 2 126 ? -3.034  137.812 -8.099  1.00 20.46 ? 626  VAL B O   1 
ATOM   3593 C  CB  . VAL B 2 126 ? -3.647  137.171 -4.900  1.00 20.70 ? 626  VAL B CB  1 
ATOM   3594 C  CG1 . VAL B 2 126 ? -2.414  136.365 -5.322  1.00 19.71 ? 626  VAL B CG1 1 
ATOM   3595 C  CG2 . VAL B 2 126 ? -3.430  137.772 -3.520  1.00 19.78 ? 626  VAL B CG2 1 
ATOM   3596 N  N   . CYS B 2 127 ? -5.100  137.044 -7.634  1.00 20.92 ? 627  CYS B N   1 
ATOM   3597 C  CA  . CYS B 2 127 ? -5.286  136.441 -8.947  1.00 21.79 ? 627  CYS B CA  1 
ATOM   3598 C  C   . CYS B 2 127 ? -5.096  137.472 -10.063 1.00 22.28 ? 627  CYS B C   1 
ATOM   3599 O  O   . CYS B 2 127 ? -4.366  137.231 -11.027 1.00 22.44 ? 627  CYS B O   1 
ATOM   3600 C  CB  . CYS B 2 127 ? -6.688  135.835 -9.064  1.00 22.07 ? 627  CYS B CB  1 
ATOM   3601 S  SG  . CYS B 2 127 ? -6.909  134.265 -8.214  1.00 22.05 ? 627  CYS B SG  1 
ATOM   3602 N  N   . GLN B 2 128 ? -5.761  138.617 -9.928  1.00 22.16 ? 628  GLN B N   1 
ATOM   3603 C  CA  . GLN B 2 128 ? -5.670  139.673 -10.932 1.00 22.55 ? 628  GLN B CA  1 
ATOM   3604 C  C   . GLN B 2 128 ? -4.237  140.170 -11.086 1.00 21.71 ? 628  GLN B C   1 
ATOM   3605 O  O   . GLN B 2 128 ? -3.774  140.417 -12.201 1.00 21.17 ? 628  GLN B O   1 
ATOM   3606 C  CB  . GLN B 2 128 ? -6.597  140.841 -10.565 1.00 23.90 ? 628  GLN B CB  1 
ATOM   3607 C  CG  . GLN B 2 128 ? -8.076  140.474 -10.619 1.00 27.18 ? 628  GLN B CG  1 
ATOM   3608 C  CD  . GLN B 2 128 ? -9.000  141.621 -10.230 1.00 29.55 ? 628  GLN B CD  1 
ATOM   3609 O  OE1 . GLN B 2 128 ? -10.220 141.450 -10.173 1.00 31.72 ? 628  GLN B OE1 1 
ATOM   3610 N  NE2 . GLN B 2 128 ? -8.428  142.794 -9.965  1.00 30.22 ? 628  GLN B NE2 1 
ATOM   3611 N  N   . PHE B 2 129 ? -3.537  140.312 -9.966  1.00 20.36 ? 629  PHE B N   1 
ATOM   3612 C  CA  . PHE B 2 129 ? -2.157  140.772 -10.008 1.00 20.43 ? 629  PHE B CA  1 
ATOM   3613 C  C   . PHE B 2 129 ? -1.244  139.772 -10.710 1.00 20.09 ? 629  PHE B C   1 
ATOM   3614 O  O   . PHE B 2 129 ? -0.415  140.160 -11.529 1.00 20.07 ? 629  PHE B O   1 
ATOM   3615 C  CB  . PHE B 2 129 ? -1.614  141.031 -8.601  1.00 20.19 ? 629  PHE B CB  1 
ATOM   3616 C  CG  . PHE B 2 129 ? -0.143  141.337 -8.584  1.00 20.71 ? 629  PHE B CG  1 
ATOM   3617 C  CD1 . PHE B 2 129 ? 0.348   142.477 -9.214  1.00 20.18 ? 629  PHE B CD1 1 
ATOM   3618 C  CD2 . PHE B 2 129 ? 0.757   140.463 -7.983  1.00 20.23 ? 629  PHE B CD2 1 
ATOM   3619 C  CE1 . PHE B 2 129 ? 1.712   142.741 -9.247  1.00 20.78 ? 629  PHE B CE1 1 
ATOM   3620 C  CE2 . PHE B 2 129 ? 2.126   140.718 -8.010  1.00 20.63 ? 629  PHE B CE2 1 
ATOM   3621 C  CZ  . PHE B 2 129 ? 2.605   141.857 -8.643  1.00 20.21 ? 629  PHE B CZ  1 
ATOM   3622 N  N   . LEU B 2 130 ? -1.388  138.489 -10.389 1.00 20.07 ? 630  LEU B N   1 
ATOM   3623 C  CA  . LEU B 2 130 ? -0.547  137.476 -11.018 1.00 19.75 ? 630  LEU B CA  1 
ATOM   3624 C  C   . LEU B 2 130 ? -0.866  137.370 -12.505 1.00 20.20 ? 630  LEU B C   1 
ATOM   3625 O  O   . LEU B 2 130 ? -0.001  137.036 -13.312 1.00 19.70 ? 630  LEU B O   1 
ATOM   3626 C  CB  . LEU B 2 130 ? -0.718  136.123 -10.318 1.00 19.20 ? 630  LEU B CB  1 
ATOM   3627 C  CG  . LEU B 2 130 ? -0.196  136.128 -8.873  1.00 19.10 ? 630  LEU B CG  1 
ATOM   3628 C  CD1 . LEU B 2 130 ? -0.437  134.785 -8.213  1.00 18.25 ? 630  LEU B CD1 1 
ATOM   3629 C  CD2 . LEU B 2 130 ? 1.298   136.459 -8.873  1.00 18.55 ? 630  LEU B CD2 1 
ATOM   3630 N  N   . GLU B 2 131 ? -2.110  137.664 -12.873 1.00 20.91 ? 631  GLU B N   1 
ATOM   3631 C  CA  . GLU B 2 131 ? -2.492  137.630 -14.279 1.00 21.93 ? 631  GLU B CA  1 
ATOM   3632 C  C   . GLU B 2 131 ? -1.709  138.734 -14.993 1.00 21.39 ? 631  GLU B C   1 
ATOM   3633 O  O   . GLU B 2 131 ? -1.265  138.560 -16.132 1.00 21.13 ? 631  GLU B O   1 
ATOM   3634 C  CB  . GLU B 2 131 ? -3.998  137.865 -14.432 1.00 24.13 ? 631  GLU B CB  1 
ATOM   3635 C  CG  . GLU B 2 131 ? -4.487  137.870 -15.874 1.00 28.25 ? 631  GLU B CG  1 
ATOM   3636 C  CD  . GLU B 2 131 ? -6.005  137.837 -15.969 1.00 30.93 ? 631  GLU B CD  1 
ATOM   3637 O  OE1 . GLU B 2 131 ? -6.659  138.705 -15.350 1.00 33.29 ? 631  GLU B OE1 1 
ATOM   3638 O  OE2 . GLU B 2 131 ? -6.545  136.943 -16.661 1.00 32.60 ? 631  GLU B OE2 1 
ATOM   3639 N  N   . LEU B 2 132 ? -1.524  139.862 -14.310 1.00 20.36 ? 632  LEU B N   1 
ATOM   3640 C  CA  . LEU B 2 132 ? -0.780  140.982 -14.881 1.00 20.29 ? 632  LEU B CA  1 
ATOM   3641 C  C   . LEU B 2 132 ? 0.709   140.656 -15.008 1.00 19.97 ? 632  LEU B C   1 
ATOM   3642 O  O   . LEU B 2 132 ? 1.411   141.244 -15.831 1.00 19.13 ? 632  LEU B O   1 
ATOM   3643 C  CB  . LEU B 2 132 ? -0.960  142.240 -14.026 1.00 19.89 ? 632  LEU B CB  1 
ATOM   3644 C  CG  . LEU B 2 132 ? -2.380  142.818 -13.978 1.00 21.05 ? 632  LEU B CG  1 
ATOM   3645 C  CD1 . LEU B 2 132 ? -2.412  144.018 -13.036 1.00 20.66 ? 632  LEU B CD1 1 
ATOM   3646 C  CD2 . LEU B 2 132 ? -2.821  143.221 -15.382 1.00 20.87 ? 632  LEU B CD2 1 
ATOM   3647 N  N   . CYS B 2 133 ? 1.184   139.717 -14.192 1.00 19.54 ? 633  CYS B N   1 
ATOM   3648 C  CA  . CYS B 2 133 ? 2.591   139.313 -14.228 1.00 19.32 ? 633  CYS B CA  1 
ATOM   3649 C  C   . CYS B 2 133 ? 2.847   138.249 -15.289 1.00 19.56 ? 633  CYS B C   1 
ATOM   3650 O  O   . CYS B 2 133 ? 3.996   137.987 -15.648 1.00 19.20 ? 633  CYS B O   1 
ATOM   3651 C  CB  . CYS B 2 133 ? 3.029   138.751 -12.873 1.00 18.92 ? 633  CYS B CB  1 
ATOM   3652 S  SG  . CYS B 2 133 ? 3.093   139.934 -11.531 1.00 16.85 ? 633  CYS B SG  1 
ATOM   3653 N  N   . GLN B 2 134 ? 1.780   137.627 -15.781 1.00 19.86 ? 634  GLN B N   1 
ATOM   3654 C  CA  . GLN B 2 134 ? 1.921   136.578 -16.781 1.00 20.52 ? 634  GLN B CA  1 
ATOM   3655 C  C   . GLN B 2 134 ? 2.301   137.157 -18.136 1.00 21.30 ? 634  GLN B C   1 
ATOM   3656 O  O   . GLN B 2 134 ? 1.695   138.118 -18.608 1.00 21.52 ? 634  GLN B O   1 
ATOM   3657 C  CB  . GLN B 2 134 ? 0.626   135.766 -16.884 1.00 20.17 ? 634  GLN B CB  1 
ATOM   3658 C  CG  . GLN B 2 134 ? 0.710   134.570 -17.826 1.00 19.77 ? 634  GLN B CG  1 
ATOM   3659 C  CD  . GLN B 2 134 ? -0.447  133.604 -17.645 1.00 20.25 ? 634  GLN B CD  1 
ATOM   3660 O  OE1 . GLN B 2 134 ? -1.612  134.014 -17.569 1.00 21.25 ? 634  GLN B OE1 1 
ATOM   3661 N  NE2 . GLN B 2 134 ? -0.136  132.316 -17.580 1.00 18.02 ? 634  GLN B NE2 1 
ATOM   3662 N  N   . SER B 2 135 ? 3.323   136.569 -18.748 1.00 22.01 ? 635  SER B N   1 
ATOM   3663 C  CA  . SER B 2 135 ? 3.819   137.014 -20.044 1.00 22.95 ? 635  SER B CA  1 
ATOM   3664 C  C   . SER B 2 135 ? 3.067   136.394 -21.215 1.00 23.59 ? 635  SER B C   1 
ATOM   3665 O  O   . SER B 2 135 ? 2.641   135.238 -21.156 1.00 23.39 ? 635  SER B O   1 
ATOM   3666 C  CB  . SER B 2 135 ? 5.308   136.675 -20.170 1.00 23.27 ? 635  SER B CB  1 
ATOM   3667 O  OG  . SER B 2 135 ? 5.796   136.948 -21.473 1.00 24.09 ? 635  SER B OG  1 
ATOM   3668 N  N   . PRO B 2 136 ? 2.890   137.162 -22.303 1.00 24.25 ? 636  PRO B N   1 
ATOM   3669 C  CA  . PRO B 2 136 ? 2.184   136.620 -23.465 1.00 24.56 ? 636  PRO B CA  1 
ATOM   3670 C  C   . PRO B 2 136 ? 2.942   135.445 -24.084 1.00 24.10 ? 636  PRO B C   1 
ATOM   3671 O  O   . PRO B 2 136 ? 2.362   134.641 -24.801 1.00 24.87 ? 636  PRO B O   1 
ATOM   3672 C  CB  . PRO B 2 136 ? 2.081   137.827 -24.402 1.00 24.82 ? 636  PRO B CB  1 
ATOM   3673 C  CG  . PRO B 2 136 ? 3.272   138.641 -24.037 1.00 25.56 ? 636  PRO B CG  1 
ATOM   3674 C  CD  . PRO B 2 136 ? 3.269   138.566 -22.530 1.00 24.53 ? 636  PRO B CD  1 
ATOM   3675 N  N   . GLU B 2 137 ? 4.239   135.340 -23.797 1.00 24.73 ? 637  GLU B N   1 
ATOM   3676 C  CA  . GLU B 2 137 ? 5.034   134.236 -24.334 1.00 24.24 ? 637  GLU B CA  1 
ATOM   3677 C  C   . GLU B 2 137 ? 4.943   133.018 -23.411 1.00 22.90 ? 637  GLU B C   1 
ATOM   3678 O  O   . GLU B 2 137 ? 5.507   131.960 -23.699 1.00 22.72 ? 637  GLU B O   1 
ATOM   3679 C  CB  . GLU B 2 137 ? 6.503   134.652 -24.505 1.00 26.04 ? 637  GLU B CB  1 
ATOM   3680 C  CG  . GLU B 2 137 ? 7.282   134.826 -23.202 1.00 28.07 ? 637  GLU B CG  1 
ATOM   3681 C  CD  . GLU B 2 137 ? 8.759   135.122 -23.433 1.00 29.72 ? 637  GLU B CD  1 
ATOM   3682 O  OE1 . GLU B 2 137 ? 9.468   134.256 -23.990 1.00 30.75 ? 637  GLU B OE1 1 
ATOM   3683 O  OE2 . GLU B 2 137 ? 9.216   136.222 -23.058 1.00 30.27 ? 637  GLU B OE2 1 
ATOM   3684 N  N   . GLY B 2 138 ? 4.217   133.170 -22.308 1.00 21.71 ? 638  GLY B N   1 
ATOM   3685 C  CA  . GLY B 2 138 ? 4.072   132.081 -21.358 1.00 19.78 ? 638  GLY B CA  1 
ATOM   3686 C  C   . GLY B 2 138 ? 4.924   132.322 -20.127 1.00 18.95 ? 638  GLY B C   1 
ATOM   3687 O  O   . GLY B 2 138 ? 5.938   133.012 -20.199 1.00 18.23 ? 638  GLY B O   1 
ATOM   3688 N  N   . GLY B 2 139 ? 4.519   131.748 -18.998 1.00 18.15 ? 639  GLY B N   1 
ATOM   3689 C  CA  . GLY B 2 139 ? 5.269   131.931 -17.767 1.00 17.52 ? 639  GLY B CA  1 
ATOM   3690 C  C   . GLY B 2 139 ? 4.951   133.258 -17.107 1.00 17.14 ? 639  GLY B C   1 
ATOM   3691 O  O   . GLY B 2 139 ? 4.207   134.073 -17.659 1.00 17.32 ? 639  GLY B O   1 
ATOM   3692 N  N   . PHE B 2 140 ? 5.509   133.479 -15.921 1.00 16.97 ? 640  PHE B N   1 
ATOM   3693 C  CA  . PHE B 2 140 ? 5.281   134.721 -15.191 1.00 16.62 ? 640  PHE B CA  1 
ATOM   3694 C  C   . PHE B 2 140 ? 6.590   135.467 -14.956 1.00 16.76 ? 640  PHE B C   1 
ATOM   3695 O  O   . PHE B 2 140 ? 7.652   134.852 -14.833 1.00 16.38 ? 640  PHE B O   1 
ATOM   3696 C  CB  . PHE B 2 140 ? 4.622   134.444 -13.830 1.00 16.75 ? 640  PHE B CB  1 
ATOM   3697 C  CG  . PHE B 2 140 ? 3.269   133.791 -13.923 1.00 16.33 ? 640  PHE B CG  1 
ATOM   3698 C  CD1 . PHE B 2 140 ? 3.152   132.437 -14.223 1.00 16.37 ? 640  PHE B CD1 1 
ATOM   3699 C  CD2 . PHE B 2 140 ? 2.108   134.534 -13.711 1.00 16.61 ? 640  PHE B CD2 1 
ATOM   3700 C  CE1 . PHE B 2 140 ? 1.898   131.826 -14.310 1.00 16.78 ? 640  PHE B CE1 1 
ATOM   3701 C  CE2 . PHE B 2 140 ? 0.846   133.936 -13.796 1.00 16.74 ? 640  PHE B CE2 1 
ATOM   3702 C  CZ  . PHE B 2 140 ? 0.741   132.576 -14.096 1.00 16.72 ? 640  PHE B CZ  1 
ATOM   3703 N  N   . GLY B 2 141 ? 6.501   136.795 -14.902 1.00 16.29 ? 641  GLY B N   1 
ATOM   3704 C  CA  . GLY B 2 141 ? 7.666   137.621 -14.648 1.00 15.82 ? 641  GLY B CA  1 
ATOM   3705 C  C   . GLY B 2 141 ? 7.615   138.130 -13.216 1.00 16.28 ? 641  GLY B C   1 
ATOM   3706 O  O   . GLY B 2 141 ? 6.641   137.876 -12.502 1.00 16.11 ? 641  GLY B O   1 
ATOM   3707 N  N   . GLY B 2 142 ? 8.647   138.857 -12.799 1.00 16.05 ? 642  GLY B N   1 
ATOM   3708 C  CA  . GLY B 2 142 ? 8.703   139.371 -11.440 1.00 16.72 ? 642  GLY B CA  1 
ATOM   3709 C  C   . GLY B 2 142 ? 7.730   140.491 -11.132 1.00 17.00 ? 642  GLY B C   1 
ATOM   3710 O  O   . GLY B 2 142 ? 7.565   140.875 -9.976  1.00 16.78 ? 642  GLY B O   1 
ATOM   3711 N  N   . GLY B 2 143 ? 7.090   141.016 -12.173 1.00 17.75 ? 643  GLY B N   1 
ATOM   3712 C  CA  . GLY B 2 143 ? 6.131   142.094 -12.013 1.00 17.63 ? 643  GLY B CA  1 
ATOM   3713 C  C   . GLY B 2 143 ? 5.481   142.359 -13.361 1.00 18.41 ? 643  GLY B C   1 
ATOM   3714 O  O   . GLY B 2 143 ? 5.906   141.783 -14.363 1.00 17.65 ? 643  GLY B O   1 
ATOM   3715 N  N   . PRO B 2 144 ? 4.453   143.220 -13.427 1.00 18.62 ? 644  PRO B N   1 
ATOM   3716 C  CA  . PRO B 2 144 ? 3.790   143.509 -14.701 1.00 19.47 ? 644  PRO B CA  1 
ATOM   3717 C  C   . PRO B 2 144 ? 4.751   144.028 -15.770 1.00 19.64 ? 644  PRO B C   1 
ATOM   3718 O  O   . PRO B 2 144 ? 5.532   144.944 -15.522 1.00 19.73 ? 644  PRO B O   1 
ATOM   3719 C  CB  . PRO B 2 144 ? 2.743   144.554 -14.311 1.00 19.60 ? 644  PRO B CB  1 
ATOM   3720 C  CG  . PRO B 2 144 ? 2.398   144.165 -12.899 1.00 19.05 ? 644  PRO B CG  1 
ATOM   3721 C  CD  . PRO B 2 144 ? 3.778   143.918 -12.319 1.00 18.94 ? 644  PRO B CD  1 
ATOM   3722 N  N   . GLY B 2 145 ? 4.700   143.426 -16.954 1.00 20.15 ? 645  GLY B N   1 
ATOM   3723 C  CA  . GLY B 2 145 ? 5.558   143.869 -18.043 1.00 20.28 ? 645  GLY B CA  1 
ATOM   3724 C  C   . GLY B 2 145 ? 6.965   143.302 -18.065 1.00 20.37 ? 645  GLY B C   1 
ATOM   3725 O  O   . GLY B 2 145 ? 7.712   143.523 -19.020 1.00 20.01 ? 645  GLY B O   1 
ATOM   3726 N  N   . GLN B 2 146 ? 7.341   142.581 -17.015 1.00 19.72 ? 646  GLN B N   1 
ATOM   3727 C  CA  . GLN B 2 146 ? 8.670   141.990 -16.959 1.00 19.27 ? 646  GLN B CA  1 
ATOM   3728 C  C   . GLN B 2 146 ? 8.685   140.690 -17.761 1.00 19.39 ? 646  GLN B C   1 
ATOM   3729 O  O   . GLN B 2 146 ? 7.647   140.059 -17.955 1.00 18.81 ? 646  GLN B O   1 
ATOM   3730 C  CB  . GLN B 2 146 ? 9.069   141.721 -15.501 1.00 18.95 ? 646  GLN B CB  1 
ATOM   3731 C  CG  . GLN B 2 146 ? 9.350   142.992 -14.695 1.00 18.95 ? 646  GLN B CG  1 
ATOM   3732 C  CD  . GLN B 2 146 ? 9.660   142.713 -13.228 1.00 19.61 ? 646  GLN B CD  1 
ATOM   3733 O  OE1 . GLN B 2 146 ? 10.431  141.809 -12.903 1.00 18.69 ? 646  GLN B OE1 1 
ATOM   3734 N  NE2 . GLN B 2 146 ? 9.066   143.503 -12.337 1.00 18.36 ? 646  GLN B NE2 1 
ATOM   3735 N  N   . TYR B 2 147 ? 9.862   140.309 -18.247 1.00 19.39 ? 647  TYR B N   1 
ATOM   3736 C  CA  . TYR B 2 147 ? 10.009  139.070 -19.004 1.00 20.36 ? 647  TYR B CA  1 
ATOM   3737 C  C   . TYR B 2 147 ? 9.743   137.900 -18.064 1.00 19.57 ? 647  TYR B C   1 
ATOM   3738 O  O   . TYR B 2 147 ? 9.945   138.011 -16.850 1.00 19.06 ? 647  TYR B O   1 
ATOM   3739 C  CB  . TYR B 2 147 ? 11.433  138.940 -19.549 1.00 21.74 ? 647  TYR B CB  1 
ATOM   3740 C  CG  . TYR B 2 147 ? 11.817  139.967 -20.593 1.00 25.19 ? 647  TYR B CG  1 
ATOM   3741 C  CD1 . TYR B 2 147 ? 13.151  140.326 -20.775 1.00 26.03 ? 647  TYR B CD1 1 
ATOM   3742 C  CD2 . TYR B 2 147 ? 10.858  140.554 -21.421 1.00 26.79 ? 647  TYR B CD2 1 
ATOM   3743 C  CE1 . TYR B 2 147 ? 13.524  141.241 -21.753 1.00 28.26 ? 647  TYR B CE1 1 
ATOM   3744 C  CE2 . TYR B 2 147 ? 11.223  141.471 -22.409 1.00 28.44 ? 647  TYR B CE2 1 
ATOM   3745 C  CZ  . TYR B 2 147 ? 12.559  141.806 -22.566 1.00 28.92 ? 647  TYR B CZ  1 
ATOM   3746 O  OH  . TYR B 2 147 ? 12.938  142.699 -23.539 1.00 31.67 ? 647  TYR B OH  1 
ATOM   3747 N  N   . PRO B 2 148 ? 9.278   136.763 -18.609 1.00 18.67 ? 648  PRO B N   1 
ATOM   3748 C  CA  . PRO B 2 148 ? 9.014   135.606 -17.751 1.00 18.05 ? 648  PRO B CA  1 
ATOM   3749 C  C   . PRO B 2 148 ? 10.337  135.042 -17.217 1.00 17.91 ? 648  PRO B C   1 
ATOM   3750 O  O   . PRO B 2 148 ? 11.390  135.202 -17.839 1.00 18.04 ? 648  PRO B O   1 
ATOM   3751 C  CB  . PRO B 2 148 ? 8.285   134.642 -18.684 1.00 18.15 ? 648  PRO B CB  1 
ATOM   3752 C  CG  . PRO B 2 148 ? 8.886   134.957 -20.024 1.00 18.10 ? 648  PRO B CG  1 
ATOM   3753 C  CD  . PRO B 2 148 ? 8.968   136.466 -20.021 1.00 17.87 ? 648  PRO B CD  1 
ATOM   3754 N  N   . HIS B 2 149 ? 10.274  134.399 -16.057 1.00 17.14 ? 649  HIS B N   1 
ATOM   3755 C  CA  . HIS B 2 149 ? 11.452  133.824 -15.416 1.00 16.27 ? 649  HIS B CA  1 
ATOM   3756 C  C   . HIS B 2 149 ? 10.914  132.618 -14.643 1.00 15.79 ? 649  HIS B C   1 
ATOM   3757 O  O   . HIS B 2 149 ? 9.824   132.683 -14.065 1.00 14.84 ? 649  HIS B O   1 
ATOM   3758 C  CB  . HIS B 2 149 ? 12.065  134.877 -14.482 1.00 17.06 ? 649  HIS B CB  1 
ATOM   3759 C  CG  . HIS B 2 149 ? 13.385  134.493 -13.883 1.00 17.13 ? 649  HIS B CG  1 
ATOM   3760 N  ND1 . HIS B 2 149 ? 13.517  133.497 -12.939 1.00 17.02 ? 649  HIS B ND1 1 
ATOM   3761 C  CD2 . HIS B 2 149 ? 14.619  135.036 -14.029 1.00 17.53 ? 649  HIS B CD2 1 
ATOM   3762 C  CE1 . HIS B 2 149 ? 14.771  133.449 -12.523 1.00 16.54 ? 649  HIS B CE1 1 
ATOM   3763 N  NE2 . HIS B 2 149 ? 15.461  134.372 -13.168 1.00 16.65 ? 649  HIS B NE2 1 
ATOM   3764 N  N   . LEU B 2 150 ? 11.654  131.513 -14.649 1.00 14.53 ? 650  LEU B N   1 
ATOM   3765 C  CA  . LEU B 2 150 ? 11.189  130.313 -13.964 1.00 14.50 ? 650  LEU B CA  1 
ATOM   3766 C  C   . LEU B 2 150 ? 10.985  130.457 -12.461 1.00 14.07 ? 650  LEU B C   1 
ATOM   3767 O  O   . LEU B 2 150 ? 10.132  129.780 -11.898 1.00 14.61 ? 650  LEU B O   1 
ATOM   3768 C  CB  . LEU B 2 150 ? 12.127  129.131 -14.248 1.00 13.94 ? 650  LEU B CB  1 
ATOM   3769 C  CG  . LEU B 2 150 ? 11.861  128.407 -15.571 1.00 14.77 ? 650  LEU B CG  1 
ATOM   3770 C  CD1 . LEU B 2 150 ? 12.919  127.315 -15.796 1.00 14.41 ? 650  LEU B CD1 1 
ATOM   3771 C  CD2 . LEU B 2 150 ? 10.462  127.793 -15.541 1.00 14.92 ? 650  LEU B CD2 1 
ATOM   3772 N  N   . ALA B 2 151 ? 11.748  131.333 -11.811 1.00 13.93 ? 651  ALA B N   1 
ATOM   3773 C  CA  . ALA B 2 151 ? 11.602  131.498 -10.361 1.00 13.67 ? 651  ALA B CA  1 
ATOM   3774 C  C   . ALA B 2 151 ? 10.235  132.090 -10.021 1.00 14.06 ? 651  ALA B C   1 
ATOM   3775 O  O   . ALA B 2 151 ? 9.471   131.490 -9.266  1.00 14.52 ? 651  ALA B O   1 
ATOM   3776 C  CB  . ALA B 2 151 ? 12.733  132.367 -9.803  1.00 13.29 ? 651  ALA B CB  1 
ATOM   3777 N  N   . PRO B 2 152 ? 9.904   133.277 -10.564 1.00 14.22 ? 652  PRO B N   1 
ATOM   3778 C  CA  . PRO B 2 152 ? 8.586   133.837 -10.246 1.00 14.29 ? 652  PRO B CA  1 
ATOM   3779 C  C   . PRO B 2 152 ? 7.443   133.004 -10.849 1.00 14.64 ? 652  PRO B C   1 
ATOM   3780 O  O   . PRO B 2 152 ? 6.309   133.054 -10.369 1.00 14.90 ? 652  PRO B O   1 
ATOM   3781 C  CB  . PRO B 2 152 ? 8.659   135.264 -10.811 1.00 14.27 ? 652  PRO B CB  1 
ATOM   3782 C  CG  . PRO B 2 152 ? 9.680   135.160 -11.908 1.00 14.94 ? 652  PRO B CG  1 
ATOM   3783 C  CD  . PRO B 2 152 ? 10.732  134.262 -11.287 1.00 14.06 ? 652  PRO B CD  1 
ATOM   3784 N  N   . THR B 2 153 ? 7.742   132.244 -11.901 1.00 14.56 ? 653  THR B N   1 
ATOM   3785 C  CA  . THR B 2 153 ? 6.736   131.388 -12.528 1.00 14.07 ? 653  THR B CA  1 
ATOM   3786 C  C   . THR B 2 153 ? 6.359   130.299 -11.518 1.00 14.09 ? 653  THR B C   1 
ATOM   3787 O  O   . THR B 2 153 ? 5.183   130.001 -11.312 1.00 13.84 ? 653  THR B O   1 
ATOM   3788 C  CB  . THR B 2 153 ? 7.279   130.720 -13.813 1.00 13.72 ? 653  THR B CB  1 
ATOM   3789 O  OG1 . THR B 2 153 ? 7.485   131.717 -14.821 1.00 14.07 ? 653  THR B OG1 1 
ATOM   3790 C  CG2 . THR B 2 153 ? 6.295   129.683 -14.336 1.00 14.30 ? 653  THR B CG2 1 
ATOM   3791 N  N   . TYR B 2 154 ? 7.376   129.709 -10.901 1.00 13.70 ? 654  TYR B N   1 
ATOM   3792 C  CA  . TYR B 2 154 ? 7.178   128.680 -9.889  1.00 13.77 ? 654  TYR B CA  1 
ATOM   3793 C  C   . TYR B 2 154 ? 6.342   129.252 -8.742  1.00 13.67 ? 654  TYR B C   1 
ATOM   3794 O  O   . TYR B 2 154 ? 5.385   128.625 -8.282  1.00 13.56 ? 654  TYR B O   1 
ATOM   3795 C  CB  . TYR B 2 154 ? 8.536   128.224 -9.351  1.00 13.54 ? 654  TYR B CB  1 
ATOM   3796 C  CG  . TYR B 2 154 ? 8.477   127.524 -8.009  1.00 13.86 ? 654  TYR B CG  1 
ATOM   3797 C  CD1 . TYR B 2 154 ? 8.130   126.175 -7.914  1.00 13.54 ? 654  TYR B CD1 1 
ATOM   3798 C  CD2 . TYR B 2 154 ? 8.788   128.209 -6.833  1.00 13.76 ? 654  TYR B CD2 1 
ATOM   3799 C  CE1 . TYR B 2 154 ? 8.102   125.526 -6.679  1.00 13.34 ? 654  TYR B CE1 1 
ATOM   3800 C  CE2 . TYR B 2 154 ? 8.764   127.568 -5.593  1.00 13.65 ? 654  TYR B CE2 1 
ATOM   3801 C  CZ  . TYR B 2 154 ? 8.423   126.227 -5.524  1.00 14.00 ? 654  TYR B CZ  1 
ATOM   3802 O  OH  . TYR B 2 154 ? 8.427   125.585 -4.303  1.00 13.26 ? 654  TYR B OH  1 
ATOM   3803 N  N   . ALA B 2 155 ? 6.715   130.446 -8.288  1.00 13.57 ? 655  ALA B N   1 
ATOM   3804 C  CA  . ALA B 2 155 ? 6.026   131.110 -7.187  1.00 14.26 ? 655  ALA B CA  1 
ATOM   3805 C  C   . ALA B 2 155 ? 4.587   131.473 -7.530  1.00 14.52 ? 655  ALA B C   1 
ATOM   3806 O  O   . ALA B 2 155 ? 3.691   131.296 -6.711  1.00 15.17 ? 655  ALA B O   1 
ATOM   3807 C  CB  . ALA B 2 155 ? 6.797   132.378 -6.766  1.00 13.34 ? 655  ALA B CB  1 
ATOM   3808 N  N   . ALA B 2 156 ? 4.371   131.985 -8.738  1.00 14.65 ? 656  ALA B N   1 
ATOM   3809 C  CA  . ALA B 2 156 ? 3.032   132.376 -9.167  1.00 14.97 ? 656  ALA B CA  1 
ATOM   3810 C  C   . ALA B 2 156 ? 2.102   131.169 -9.221  1.00 15.00 ? 656  ALA B C   1 
ATOM   3811 O  O   . ALA B 2 156 ? 0.963   131.236 -8.757  1.00 15.61 ? 656  ALA B O   1 
ATOM   3812 C  CB  . ALA B 2 156 ? 3.093   133.057 -10.537 1.00 15.04 ? 656  ALA B CB  1 
ATOM   3813 N  N   . VAL B 2 157 ? 2.585   130.069 -9.787  1.00 14.69 ? 657  VAL B N   1 
ATOM   3814 C  CA  . VAL B 2 157 ? 1.781   128.859 -9.890  1.00 14.67 ? 657  VAL B CA  1 
ATOM   3815 C  C   . VAL B 2 157 ? 1.451   128.305 -8.499  1.00 15.03 ? 657  VAL B C   1 
ATOM   3816 O  O   . VAL B 2 157 ? 0.330   127.865 -8.252  1.00 14.98 ? 657  VAL B O   1 
ATOM   3817 C  CB  . VAL B 2 157 ? 2.507   127.784 -10.731 1.00 14.56 ? 657  VAL B CB  1 
ATOM   3818 C  CG1 . VAL B 2 157 ? 1.751   126.462 -10.669 1.00 13.55 ? 657  VAL B CG1 1 
ATOM   3819 C  CG2 . VAL B 2 157 ? 2.622   128.258 -12.179 1.00 13.89 ? 657  VAL B CG2 1 
ATOM   3820 N  N   . ASN B 2 158 ? 2.425   128.325 -7.594  1.00 15.06 ? 658  ASN B N   1 
ATOM   3821 C  CA  . ASN B 2 158 ? 2.190   127.841 -6.232  1.00 15.33 ? 658  ASN B CA  1 
ATOM   3822 C  C   . ASN B 2 158 ? 1.156   128.722 -5.523  1.00 15.30 ? 658  ASN B C   1 
ATOM   3823 O  O   . ASN B 2 158 ? 0.276   128.221 -4.826  1.00 15.24 ? 658  ASN B O   1 
ATOM   3824 C  CB  . ASN B 2 158 ? 3.497   127.835 -5.433  1.00 15.04 ? 658  ASN B CB  1 
ATOM   3825 C  CG  . ASN B 2 158 ? 4.156   126.463 -5.401  1.00 15.16 ? 658  ASN B CG  1 
ATOM   3826 O  OD1 . ASN B 2 158 ? 3.745   125.540 -6.110  1.00 14.30 ? 658  ASN B OD1 1 
ATOM   3827 N  ND2 . ASN B 2 158 ? 5.188   126.326 -4.575  1.00 14.66 ? 658  ASN B ND2 1 
ATOM   3828 N  N   . ALA B 2 159 ? 1.269   130.034 -5.707  1.00 15.39 ? 659  ALA B N   1 
ATOM   3829 C  CA  . ALA B 2 159 ? 0.343   130.979 -5.086  1.00 15.42 ? 659  ALA B CA  1 
ATOM   3830 C  C   . ALA B 2 159 ? -1.078  130.737 -5.580  1.00 15.83 ? 659  ALA B C   1 
ATOM   3831 O  O   . ALA B 2 159 ? -2.026  130.698 -4.790  1.00 15.61 ? 659  ALA B O   1 
ATOM   3832 C  CB  . ALA B 2 159 ? 0.769   132.410 -5.400  1.00 14.57 ? 659  ALA B CB  1 
ATOM   3833 N  N   . LEU B 2 160 ? -1.221  130.582 -6.895  1.00 15.59 ? 660  LEU B N   1 
ATOM   3834 C  CA  . LEU B 2 160 ? -2.526  130.336 -7.494  1.00 16.14 ? 660  LEU B CA  1 
ATOM   3835 C  C   . LEU B 2 160 ? -3.129  129.032 -6.982  1.00 16.43 ? 660  LEU B C   1 
ATOM   3836 O  O   . LEU B 2 160 ? -4.345  128.943 -6.782  1.00 16.87 ? 660  LEU B O   1 
ATOM   3837 C  CB  . LEU B 2 160 ? -2.411  130.297 -9.027  1.00 15.54 ? 660  LEU B CB  1 
ATOM   3838 C  CG  . LEU B 2 160 ? -2.106  131.651 -9.677  1.00 16.01 ? 660  LEU B CG  1 
ATOM   3839 C  CD1 . LEU B 2 160 ? -1.814  131.466 -11.165 1.00 16.15 ? 660  LEU B CD1 1 
ATOM   3840 C  CD2 . LEU B 2 160 ? -3.292  132.592 -9.474  1.00 15.23 ? 660  LEU B CD2 1 
ATOM   3841 N  N   . CYS B 2 161 ? -2.286  128.022 -6.772  1.00 16.08 ? 661  CYS B N   1 
ATOM   3842 C  CA  . CYS B 2 161 ? -2.770  126.738 -6.274  1.00 16.78 ? 661  CYS B CA  1 
ATOM   3843 C  C   . CYS B 2 161 ? -3.161  126.816 -4.797  1.00 16.94 ? 661  CYS B C   1 
ATOM   3844 O  O   . CYS B 2 161 ? -4.044  126.087 -4.345  1.00 17.08 ? 661  CYS B O   1 
ATOM   3845 C  CB  . CYS B 2 161 ? -1.725  125.640 -6.503  1.00 16.02 ? 661  CYS B CB  1 
ATOM   3846 S  SG  . CYS B 2 161 ? -1.533  125.202 -8.258  1.00 17.80 ? 661  CYS B SG  1 
ATOM   3847 N  N   . ILE B 2 162 ? -2.515  127.701 -4.047  1.00 16.98 ? 662  ILE B N   1 
ATOM   3848 C  CA  . ILE B 2 162 ? -2.857  127.865 -2.638  1.00 17.69 ? 662  ILE B CA  1 
ATOM   3849 C  C   . ILE B 2 162 ? -4.263  128.475 -2.561  1.00 18.48 ? 662  ILE B C   1 
ATOM   3850 O  O   . ILE B 2 162 ? -5.073  128.085 -1.721  1.00 18.50 ? 662  ILE B O   1 
ATOM   3851 C  CB  . ILE B 2 162 ? -1.833  128.771 -1.912  1.00 17.58 ? 662  ILE B CB  1 
ATOM   3852 C  CG1 . ILE B 2 162 ? -0.499  128.024 -1.771  1.00 17.17 ? 662  ILE B CG1 1 
ATOM   3853 C  CG2 . ILE B 2 162 ? -2.357  129.167 -0.529  1.00 17.29 ? 662  ILE B CG2 1 
ATOM   3854 C  CD1 . ILE B 2 162 ? 0.631   128.871 -1.201  1.00 15.87 ? 662  ILE B CD1 1 
ATOM   3855 N  N   . ILE B 2 163 ? -4.550  129.432 -3.442  1.00 18.74 ? 663  ILE B N   1 
ATOM   3856 C  CA  . ILE B 2 163 ? -5.874  130.050 -3.479  1.00 19.42 ? 663  ILE B CA  1 
ATOM   3857 C  C   . ILE B 2 163 ? -6.851  128.937 -3.863  1.00 19.98 ? 663  ILE B C   1 
ATOM   3858 O  O   . ILE B 2 163 ? -7.919  128.799 -3.272  1.00 19.59 ? 663  ILE B O   1 
ATOM   3859 C  CB  . ILE B 2 163 ? -5.908  131.211 -4.500  1.00 19.34 ? 663  ILE B CB  1 
ATOM   3860 C  CG1 . ILE B 2 163 ? -5.078  132.378 -3.952  1.00 19.17 ? 663  ILE B CG1 1 
ATOM   3861 C  CG2 . ILE B 2 163 ? -7.346  131.647 -4.770  1.00 19.10 ? 663  ILE B CG2 1 
ATOM   3862 C  CD1 . ILE B 2 163 ? -4.903  133.522 -4.916  1.00 20.71 ? 663  ILE B CD1 1 
ATOM   3863 N  N   . GLY B 2 164 ? -6.458  128.145 -4.858  1.00 20.87 ? 664  GLY B N   1 
ATOM   3864 C  CA  . GLY B 2 164 ? -7.239  126.996 -5.284  1.00 21.67 ? 664  GLY B CA  1 
ATOM   3865 C  C   . GLY B 2 164 ? -8.636  127.131 -5.855  1.00 22.39 ? 664  GLY B C   1 
ATOM   3866 O  O   . GLY B 2 164 ? -9.405  126.173 -5.823  1.00 22.46 ? 664  GLY B O   1 
ATOM   3867 N  N   . THR B 2 165 ? -8.979  128.297 -6.377  1.00 23.05 ? 665  THR B N   1 
ATOM   3868 C  CA  . THR B 2 165 ? -10.298 128.483 -6.959  1.00 23.84 ? 665  THR B CA  1 
ATOM   3869 C  C   . THR B 2 165 ? -10.172 128.292 -8.466  1.00 24.39 ? 665  THR B C   1 
ATOM   3870 O  O   . THR B 2 165 ? -9.075  128.394 -9.014  1.00 23.69 ? 665  THR B O   1 
ATOM   3871 C  CB  . THR B 2 165 ? -10.831 129.894 -6.682  1.00 23.83 ? 665  THR B CB  1 
ATOM   3872 O  OG1 . THR B 2 165 ? -9.918  130.859 -7.221  1.00 23.75 ? 665  THR B OG1 1 
ATOM   3873 C  CG2 . THR B 2 165 ? -10.984 130.122 -5.177  1.00 23.82 ? 665  THR B CG2 1 
ATOM   3874 N  N   . GLU B 2 166 ? -11.284 128.009 -9.137  1.00 25.25 ? 666  GLU B N   1 
ATOM   3875 C  CA  . GLU B 2 166 ? -11.236 127.830 -10.582 1.00 26.49 ? 666  GLU B CA  1 
ATOM   3876 C  C   . GLU B 2 166 ? -10.723 129.123 -11.199 1.00 26.18 ? 666  GLU B C   1 
ATOM   3877 O  O   . GLU B 2 166 ? -10.028 129.103 -12.213 1.00 26.30 ? 666  GLU B O   1 
ATOM   3878 C  CB  . GLU B 2 166 ? -12.620 127.496 -11.140 1.00 28.04 ? 666  GLU B CB  1 
ATOM   3879 C  CG  . GLU B 2 166 ? -13.281 126.314 -10.455 1.00 31.03 ? 666  GLU B CG  1 
ATOM   3880 C  CD  . GLU B 2 166 ? -14.252 125.576 -11.361 1.00 32.82 ? 666  GLU B CD  1 
ATOM   3881 O  OE1 . GLU B 2 166 ? -14.977 126.243 -12.133 1.00 33.94 ? 666  GLU B OE1 1 
ATOM   3882 O  OE2 . GLU B 2 166 ? -14.292 124.328 -11.290 1.00 33.50 ? 666  GLU B OE2 1 
ATOM   3883 N  N   . GLU B 2 167 ? -11.066 130.247 -10.576 1.00 25.74 ? 667  GLU B N   1 
ATOM   3884 C  CA  . GLU B 2 167 ? -10.614 131.544 -11.061 1.00 25.59 ? 667  GLU B CA  1 
ATOM   3885 C  C   . GLU B 2 167 ? -9.086  131.572 -11.064 1.00 24.38 ? 667  GLU B C   1 
ATOM   3886 O  O   . GLU B 2 167 ? -8.466  131.992 -12.038 1.00 24.49 ? 667  GLU B O   1 
ATOM   3887 C  CB  . GLU B 2 167 ? -11.141 132.671 -10.167 1.00 27.14 ? 667  GLU B CB  1 
ATOM   3888 C  CG  . GLU B 2 167 ? -10.461 134.012 -10.431 1.00 29.92 ? 667  GLU B CG  1 
ATOM   3889 C  CD  . GLU B 2 167 ? -10.991 135.139 -9.565  1.00 31.47 ? 667  GLU B CD  1 
ATOM   3890 O  OE1 . GLU B 2 167 ? -11.045 134.978 -8.328  1.00 32.53 ? 667  GLU B OE1 1 
ATOM   3891 O  OE2 . GLU B 2 167 ? -11.345 136.197 -10.126 1.00 34.09 ? 667  GLU B OE2 1 
ATOM   3892 N  N   . ALA B 2 168 ? -8.486  131.122 -9.966  1.00 23.01 ? 668  ALA B N   1 
ATOM   3893 C  CA  . ALA B 2 168 ? -7.031  131.095 -9.847  1.00 21.94 ? 668  ALA B CA  1 
ATOM   3894 C  C   . ALA B 2 168 ? -6.409  130.127 -10.855 1.00 21.23 ? 668  ALA B C   1 
ATOM   3895 O  O   . ALA B 2 168 ? -5.466  130.481 -11.563 1.00 21.00 ? 668  ALA B O   1 
ATOM   3896 C  CB  . ALA B 2 168 ? -6.629  130.708 -8.424  1.00 21.26 ? 668  ALA B CB  1 
ATOM   3897 N  N   . TYR B 2 169 ? -6.943  128.912 -10.925 1.00 20.60 ? 669  TYR B N   1 
ATOM   3898 C  CA  . TYR B 2 169 ? -6.434  127.899 -11.853 1.00 20.67 ? 669  TYR B CA  1 
ATOM   3899 C  C   . TYR B 2 169 ? -6.457  128.359 -13.307 1.00 21.22 ? 669  TYR B C   1 
ATOM   3900 O  O   . TYR B 2 169 ? -5.486  128.168 -14.041 1.00 21.25 ? 669  TYR B O   1 
ATOM   3901 C  CB  . TYR B 2 169 ? -7.264  126.617 -11.771 1.00 19.83 ? 669  TYR B CB  1 
ATOM   3902 C  CG  . TYR B 2 169 ? -7.253  125.893 -10.445 1.00 20.09 ? 669  TYR B CG  1 
ATOM   3903 C  CD1 . TYR B 2 169 ? -8.378  125.187 -10.020 1.00 19.04 ? 669  TYR B CD1 1 
ATOM   3904 C  CD2 . TYR B 2 169 ? -6.118  125.881 -9.628  1.00 19.55 ? 669  TYR B CD2 1 
ATOM   3905 C  CE1 . TYR B 2 169 ? -8.381  124.487 -8.823  1.00 19.76 ? 669  TYR B CE1 1 
ATOM   3906 C  CE2 . TYR B 2 169 ? -6.112  125.177 -8.419  1.00 19.45 ? 669  TYR B CE2 1 
ATOM   3907 C  CZ  . TYR B 2 169 ? -7.250  124.482 -8.025  1.00 19.61 ? 669  TYR B CZ  1 
ATOM   3908 O  OH  . TYR B 2 169 ? -7.269  123.770 -6.846  1.00 19.77 ? 669  TYR B OH  1 
ATOM   3909 N  N   . ASP B 2 170 ? -7.575  128.951 -13.723 1.00 21.41 ? 670  ASP B N   1 
ATOM   3910 C  CA  . ASP B 2 170 ? -7.744  129.391 -15.106 1.00 22.23 ? 670  ASP B CA  1 
ATOM   3911 C  C   . ASP B 2 170 ? -6.921  130.596 -15.552 1.00 21.74 ? 670  ASP B C   1 
ATOM   3912 O  O   . ASP B 2 170 ? -6.876  130.916 -16.741 1.00 21.19 ? 670  ASP B O   1 
ATOM   3913 C  CB  . ASP B 2 170 ? -9.226  129.643 -15.395 1.00 23.93 ? 670  ASP B CB  1 
ATOM   3914 C  CG  . ASP B 2 170 ? -10.071 128.399 -15.204 1.00 26.22 ? 670  ASP B CG  1 
ATOM   3915 O  OD1 . ASP B 2 170 ? -9.578  127.291 -15.518 1.00 26.68 ? 670  ASP B OD1 1 
ATOM   3916 O  OD2 . ASP B 2 170 ? -11.230 128.526 -14.749 1.00 28.61 ? 670  ASP B OD2 1 
ATOM   3917 N  N   . ILE B 2 171 ? -6.278  131.270 -14.609 1.00 21.00 ? 671  ILE B N   1 
ATOM   3918 C  CA  . ILE B 2 171 ? -5.437  132.405 -14.956 1.00 21.02 ? 671  ILE B CA  1 
ATOM   3919 C  C   . ILE B 2 171 ? -4.244  131.901 -15.766 1.00 20.10 ? 671  ILE B C   1 
ATOM   3920 O  O   . ILE B 2 171 ? -3.790  132.553 -16.701 1.00 19.95 ? 671  ILE B O   1 
ATOM   3921 C  CB  . ILE B 2 171 ? -4.922  133.109 -13.688 1.00 22.06 ? 671  ILE B CB  1 
ATOM   3922 C  CG1 . ILE B 2 171 ? -6.052  133.938 -13.079 1.00 23.63 ? 671  ILE B CG1 1 
ATOM   3923 C  CG2 . ILE B 2 171 ? -3.717  133.987 -14.014 1.00 22.57 ? 671  ILE B CG2 1 
ATOM   3924 C  CD1 . ILE B 2 171 ? -5.763  134.391 -11.688 1.00 24.65 ? 671  ILE B CD1 1 
ATOM   3925 N  N   . ILE B 2 172 ? -3.756  130.719 -15.408 1.00 19.20 ? 672  ILE B N   1 
ATOM   3926 C  CA  . ILE B 2 172 ? -2.601  130.135 -16.074 1.00 18.47 ? 672  ILE B CA  1 
ATOM   3927 C  C   . ILE B 2 172 ? -2.839  129.792 -17.541 1.00 18.27 ? 672  ILE B C   1 
ATOM   3928 O  O   . ILE B 2 172 ? -3.741  129.026 -17.875 1.00 18.50 ? 672  ILE B O   1 
ATOM   3929 C  CB  . ILE B 2 172 ? -2.140  128.852 -15.348 1.00 18.71 ? 672  ILE B CB  1 
ATOM   3930 C  CG1 . ILE B 2 172 ? -1.911  129.154 -13.862 1.00 18.52 ? 672  ILE B CG1 1 
ATOM   3931 C  CG2 . ILE B 2 172 ? -0.857  128.314 -15.994 1.00 17.94 ? 672  ILE B CG2 1 
ATOM   3932 C  CD1 . ILE B 2 172 ? -1.588  127.929 -13.025 1.00 18.15 ? 672  ILE B CD1 1 
ATOM   3933 N  N   . ASN B 2 173 ? -2.031  130.374 -18.415 1.00 17.68 ? 673  ASN B N   1 
ATOM   3934 C  CA  . ASN B 2 173 ? -2.135  130.083 -19.837 1.00 17.52 ? 673  ASN B CA  1 
ATOM   3935 C  C   . ASN B 2 173 ? -1.245  128.859 -20.029 1.00 17.09 ? 673  ASN B C   1 
ATOM   3936 O  O   . ASN B 2 173 ? -0.036  128.981 -20.218 1.00 17.28 ? 673  ASN B O   1 
ATOM   3937 C  CB  . ASN B 2 173 ? -1.607  131.248 -20.668 1.00 17.42 ? 673  ASN B CB  1 
ATOM   3938 C  CG  . ASN B 2 173 ? -1.753  131.007 -22.153 1.00 18.45 ? 673  ASN B CG  1 
ATOM   3939 O  OD1 . ASN B 2 173 ? -1.655  129.869 -22.621 1.00 18.26 ? 673  ASN B OD1 1 
ATOM   3940 N  ND2 . ASN B 2 173 ? -1.975  132.078 -22.910 1.00 18.89 ? 673  ASN B ND2 1 
ATOM   3941 N  N   . ARG B 2 174 ? -1.853  127.681 -19.969 1.00 17.16 ? 674  ARG B N   1 
ATOM   3942 C  CA  . ARG B 2 174 ? -1.122  126.426 -20.088 1.00 17.17 ? 674  ARG B CA  1 
ATOM   3943 C  C   . ARG B 2 174 ? -0.434  126.194 -21.428 1.00 17.34 ? 674  ARG B C   1 
ATOM   3944 O  O   . ARG B 2 174 ? 0.678   125.671 -21.471 1.00 16.87 ? 674  ARG B O   1 
ATOM   3945 C  CB  . ARG B 2 174 ? -2.064  125.261 -19.753 1.00 17.26 ? 674  ARG B CB  1 
ATOM   3946 C  CG  . ARG B 2 174 ? -2.565  125.312 -18.305 1.00 17.46 ? 674  ARG B CG  1 
ATOM   3947 C  CD  . ARG B 2 174 ? -3.674  124.308 -17.994 1.00 17.64 ? 674  ARG B CD  1 
ATOM   3948 N  NE  . ARG B 2 174 ? -3.230  122.919 -18.085 1.00 17.57 ? 674  ARG B NE  1 
ATOM   3949 C  CZ  . ARG B 2 174 ? -3.489  122.117 -19.111 1.00 17.64 ? 674  ARG B CZ  1 
ATOM   3950 N  NH1 . ARG B 2 174 ? -4.196  122.564 -20.145 1.00 17.53 ? 674  ARG B NH1 1 
ATOM   3951 N  NH2 . ARG B 2 174 ? -3.040  120.869 -19.105 1.00 15.96 ? 674  ARG B NH2 1 
ATOM   3952 N  N   . GLU B 2 175 ? -1.086  126.574 -22.522 1.00 18.16 ? 675  GLU B N   1 
ATOM   3953 C  CA  . GLU B 2 175 ? -0.490  126.395 -23.841 1.00 18.92 ? 675  GLU B CA  1 
ATOM   3954 C  C   . GLU B 2 175 ? 0.842   127.142 -23.920 1.00 18.54 ? 675  GLU B C   1 
ATOM   3955 O  O   . GLU B 2 175 ? 1.858   126.577 -24.313 1.00 18.64 ? 675  GLU B O   1 
ATOM   3956 C  CB  . GLU B 2 175 ? -1.424  126.925 -24.938 1.00 21.05 ? 675  GLU B CB  1 
ATOM   3957 C  CG  . GLU B 2 175 ? -2.716  126.140 -25.145 1.00 23.72 ? 675  GLU B CG  1 
ATOM   3958 C  CD  . GLU B 2 175 ? -3.673  126.225 -23.966 1.00 25.39 ? 675  GLU B CD  1 
ATOM   3959 O  OE1 . GLU B 2 175 ? -3.655  127.247 -23.242 1.00 26.00 ? 675  GLU B OE1 1 
ATOM   3960 O  OE2 . GLU B 2 175 ? -4.462  125.273 -23.778 1.00 27.04 ? 675  GLU B OE2 1 
ATOM   3961 N  N   . LYS B 2 176 ? 0.829   128.417 -23.544 1.00 18.05 ? 676  LYS B N   1 
ATOM   3962 C  CA  . LYS B 2 176 ? 2.034   129.233 -23.589 1.00 18.24 ? 676  LYS B CA  1 
ATOM   3963 C  C   . LYS B 2 176 ? 3.067   128.818 -22.551 1.00 17.91 ? 676  LYS B C   1 
ATOM   3964 O  O   . LYS B 2 176 ? 4.267   128.943 -22.793 1.00 17.96 ? 676  LYS B O   1 
ATOM   3965 C  CB  . LYS B 2 176 ? 1.681   130.713 -23.403 1.00 18.84 ? 676  LYS B CB  1 
ATOM   3966 C  CG  . LYS B 2 176 ? 0.755   131.265 -24.480 1.00 21.04 ? 676  LYS B CG  1 
ATOM   3967 C  CD  . LYS B 2 176 ? 1.300   131.024 -25.889 1.00 22.60 ? 676  LYS B CD  1 
ATOM   3968 C  CE  . LYS B 2 176 ? 2.609   131.771 -26.127 1.00 24.69 ? 676  LYS B CE  1 
ATOM   3969 N  NZ  . LYS B 2 176 ? 3.009   131.767 -27.576 1.00 26.13 ? 676  LYS B NZ  1 
ATOM   3970 N  N   . LEU B 2 177 ? 2.610   128.332 -21.399 1.00 17.16 ? 677  LEU B N   1 
ATOM   3971 C  CA  . LEU B 2 177 ? 3.536   127.901 -20.355 1.00 17.33 ? 677  LEU B CA  1 
ATOM   3972 C  C   . LEU B 2 177 ? 4.404   126.752 -20.860 1.00 17.10 ? 677  LEU B C   1 
ATOM   3973 O  O   . LEU B 2 177 ? 5.616   126.749 -20.657 1.00 17.64 ? 677  LEU B O   1 
ATOM   3974 C  CB  . LEU B 2 177 ? 2.779   127.455 -19.093 1.00 16.10 ? 677  LEU B CB  1 
ATOM   3975 C  CG  . LEU B 2 177 ? 3.650   126.961 -17.921 1.00 16.84 ? 677  LEU B CG  1 
ATOM   3976 C  CD1 . LEU B 2 177 ? 4.696   128.009 -17.559 1.00 15.28 ? 677  LEU B CD1 1 
ATOM   3977 C  CD2 . LEU B 2 177 ? 2.768   126.647 -16.711 1.00 15.77 ? 677  LEU B CD2 1 
ATOM   3978 N  N   . LEU B 2 178 ? 3.784   125.776 -21.518 1.00 17.49 ? 678  LEU B N   1 
ATOM   3979 C  CA  . LEU B 2 178 ? 4.530   124.633 -22.036 1.00 17.51 ? 678  LEU B CA  1 
ATOM   3980 C  C   . LEU B 2 178 ? 5.502   125.084 -23.123 1.00 17.41 ? 678  LEU B C   1 
ATOM   3981 O  O   . LEU B 2 178 ? 6.648   124.644 -23.162 1.00 17.62 ? 678  LEU B O   1 
ATOM   3982 C  CB  . LEU B 2 178 ? 3.572   123.567 -22.583 1.00 17.47 ? 678  LEU B CB  1 
ATOM   3983 C  CG  . LEU B 2 178 ? 4.222   122.284 -23.118 1.00 17.90 ? 678  LEU B CG  1 
ATOM   3984 C  CD1 . LEU B 2 178 ? 5.211   121.726 -22.094 1.00 17.51 ? 678  LEU B CD1 1 
ATOM   3985 C  CD2 . LEU B 2 178 ? 3.137   121.258 -23.430 1.00 18.22 ? 678  LEU B CD2 1 
ATOM   3986 N  N   . GLN B 2 179 ? 5.048   125.967 -24.004 1.00 17.83 ? 679  GLN B N   1 
ATOM   3987 C  CA  . GLN B 2 179 ? 5.914   126.473 -25.061 1.00 18.58 ? 679  GLN B CA  1 
ATOM   3988 C  C   . GLN B 2 179 ? 7.108   127.199 -24.439 1.00 18.29 ? 679  GLN B C   1 
ATOM   3989 O  O   . GLN B 2 179 ? 8.242   127.074 -24.905 1.00 17.93 ? 679  GLN B O   1 
ATOM   3990 C  CB  . GLN B 2 179 ? 5.135   127.427 -25.961 1.00 19.98 ? 679  GLN B CB  1 
ATOM   3991 C  CG  . GLN B 2 179 ? 4.136   126.726 -26.868 1.00 22.23 ? 679  GLN B CG  1 
ATOM   3992 C  CD  . GLN B 2 179 ? 3.341   127.705 -27.697 1.00 23.99 ? 679  GLN B CD  1 
ATOM   3993 O  OE1 . GLN B 2 179 ? 3.893   128.654 -28.248 1.00 25.38 ? 679  GLN B OE1 1 
ATOM   3994 N  NE2 . GLN B 2 179 ? 2.039   127.480 -27.794 1.00 25.34 ? 679  GLN B NE2 1 
ATOM   3995 N  N   . TYR B 2 180 ? 6.841   127.958 -23.381 1.00 17.75 ? 680  TYR B N   1 
ATOM   3996 C  CA  . TYR B 2 180 ? 7.887   128.692 -22.683 1.00 17.55 ? 680  TYR B CA  1 
ATOM   3997 C  C   . TYR B 2 180 ? 8.924   127.719 -22.109 1.00 17.13 ? 680  TYR B C   1 
ATOM   3998 O  O   . TYR B 2 180 ? 10.129  127.920 -22.265 1.00 17.05 ? 680  TYR B O   1 
ATOM   3999 C  CB  . TYR B 2 180 ? 7.274   129.533 -21.556 1.00 17.76 ? 680  TYR B CB  1 
ATOM   4000 C  CG  . TYR B 2 180 ? 8.296   130.306 -20.753 1.00 18.20 ? 680  TYR B CG  1 
ATOM   4001 C  CD1 . TYR B 2 180 ? 9.143   131.220 -21.374 1.00 18.00 ? 680  TYR B CD1 1 
ATOM   4002 C  CD2 . TYR B 2 180 ? 8.434   130.103 -19.379 1.00 17.90 ? 680  TYR B CD2 1 
ATOM   4003 C  CE1 . TYR B 2 180 ? 10.107  131.910 -20.654 1.00 18.85 ? 680  TYR B CE1 1 
ATOM   4004 C  CE2 . TYR B 2 180 ? 9.397   130.793 -18.644 1.00 18.85 ? 680  TYR B CE2 1 
ATOM   4005 C  CZ  . TYR B 2 180 ? 10.232  131.694 -19.291 1.00 19.17 ? 680  TYR B CZ  1 
ATOM   4006 O  OH  . TYR B 2 180 ? 11.209  132.365 -18.591 1.00 19.86 ? 680  TYR B OH  1 
ATOM   4007 N  N   . LEU B 2 181 ? 8.461   126.662 -21.447 1.00 16.97 ? 681  LEU B N   1 
ATOM   4008 C  CA  . LEU B 2 181 ? 9.394   125.691 -20.885 1.00 17.08 ? 681  LEU B CA  1 
ATOM   4009 C  C   . LEU B 2 181 ? 10.259  125.116 -22.010 1.00 17.30 ? 681  LEU B C   1 
ATOM   4010 O  O   . LEU B 2 181 ? 11.472  124.960 -21.853 1.00 16.70 ? 681  LEU B O   1 
ATOM   4011 C  CB  . LEU B 2 181 ? 8.639   124.572 -20.158 1.00 16.72 ? 681  LEU B CB  1 
ATOM   4012 C  CG  . LEU B 2 181 ? 7.826   124.998 -18.927 1.00 17.14 ? 681  LEU B CG  1 
ATOM   4013 C  CD1 . LEU B 2 181 ? 7.211   123.763 -18.276 1.00 16.98 ? 681  LEU B CD1 1 
ATOM   4014 C  CD2 . LEU B 2 181 ? 8.720   125.731 -17.930 1.00 17.17 ? 681  LEU B CD2 1 
ATOM   4015 N  N   . TYR B 2 182 ? 9.635   124.814 -23.148 1.00 17.06 ? 682  TYR B N   1 
ATOM   4016 C  CA  . TYR B 2 182 ? 10.374  124.284 -24.291 1.00 17.52 ? 682  TYR B CA  1 
ATOM   4017 C  C   . TYR B 2 182 ? 11.452  125.277 -24.711 1.00 17.12 ? 682  TYR B C   1 
ATOM   4018 O  O   . TYR B 2 182 ? 12.570  124.884 -25.055 1.00 17.84 ? 682  TYR B O   1 
ATOM   4019 C  CB  . TYR B 2 182 ? 9.432   124.028 -25.479 1.00 18.11 ? 682  TYR B CB  1 
ATOM   4020 C  CG  . TYR B 2 182 ? 8.873   122.621 -25.556 1.00 19.36 ? 682  TYR B CG  1 
ATOM   4021 C  CD1 . TYR B 2 182 ? 8.247   122.035 -24.456 1.00 19.55 ? 682  TYR B CD1 1 
ATOM   4022 C  CD2 . TYR B 2 182 ? 8.957   121.882 -26.737 1.00 19.90 ? 682  TYR B CD2 1 
ATOM   4023 C  CE1 . TYR B 2 182 ? 7.718   120.746 -24.528 1.00 20.14 ? 682  TYR B CE1 1 
ATOM   4024 C  CE2 . TYR B 2 182 ? 8.428   120.588 -26.822 1.00 19.85 ? 682  TYR B CE2 1 
ATOM   4025 C  CZ  . TYR B 2 182 ? 7.812   120.027 -25.715 1.00 20.12 ? 682  TYR B CZ  1 
ATOM   4026 O  OH  . TYR B 2 182 ? 7.297   118.752 -25.791 1.00 19.76 ? 682  TYR B OH  1 
ATOM   4027 N  N   . SER B 2 183 ? 11.118  126.564 -24.668 1.00 16.94 ? 683  SER B N   1 
ATOM   4028 C  CA  . SER B 2 183 ? 12.056  127.611 -25.067 1.00 16.46 ? 683  SER B CA  1 
ATOM   4029 C  C   . SER B 2 183 ? 13.253  127.755 -24.129 1.00 16.17 ? 683  SER B C   1 
ATOM   4030 O  O   . SER B 2 183 ? 14.204  128.467 -24.445 1.00 16.07 ? 683  SER B O   1 
ATOM   4031 C  CB  . SER B 2 183 ? 11.331  128.964 -25.193 1.00 16.59 ? 683  SER B CB  1 
ATOM   4032 O  OG  . SER B 2 183 ? 11.076  129.551 -23.926 1.00 15.99 ? 683  SER B OG  1 
ATOM   4033 N  N   . LEU B 2 184 ? 13.212  127.079 -22.984 1.00 16.22 ? 684  LEU B N   1 
ATOM   4034 C  CA  . LEU B 2 184 ? 14.308  127.146 -22.014 1.00 16.99 ? 684  LEU B CA  1 
ATOM   4035 C  C   . LEU B 2 184 ? 15.075  125.826 -21.896 1.00 17.26 ? 684  LEU B C   1 
ATOM   4036 O  O   . LEU B 2 184 ? 16.132  125.776 -21.269 1.00 17.73 ? 684  LEU B O   1 
ATOM   4037 C  CB  . LEU B 2 184 ? 13.769  127.519 -20.626 1.00 16.86 ? 684  LEU B CB  1 
ATOM   4038 C  CG  . LEU B 2 184 ? 12.974  128.819 -20.460 1.00 17.35 ? 684  LEU B CG  1 
ATOM   4039 C  CD1 . LEU B 2 184 ? 12.471  128.929 -19.018 1.00 17.53 ? 684  LEU B CD1 1 
ATOM   4040 C  CD2 . LEU B 2 184 ? 13.861  130.016 -20.816 1.00 17.16 ? 684  LEU B CD2 1 
ATOM   4041 N  N   . LYS B 2 185 ? 14.542  124.766 -22.498 1.00 17.31 ? 685  LYS B N   1 
ATOM   4042 C  CA  . LYS B 2 185 ? 15.151  123.438 -22.433 1.00 18.03 ? 685  LYS B CA  1 
ATOM   4043 C  C   . LYS B 2 185 ? 16.435  123.311 -23.247 1.00 18.87 ? 685  LYS B C   1 
ATOM   4044 O  O   . LYS B 2 185 ? 16.457  123.605 -24.443 1.00 18.79 ? 685  LYS B O   1 
ATOM   4045 C  CB  . LYS B 2 185 ? 14.144  122.376 -22.899 1.00 18.28 ? 685  LYS B CB  1 
ATOM   4046 C  CG  . LYS B 2 185 ? 14.683  120.941 -22.913 1.00 18.74 ? 685  LYS B CG  1 
ATOM   4047 C  CD  . LYS B 2 185 ? 14.946  120.432 -21.502 1.00 19.21 ? 685  LYS B CD  1 
ATOM   4048 C  CE  . LYS B 2 185 ? 15.605  119.054 -21.503 1.00 19.66 ? 685  LYS B CE  1 
ATOM   4049 N  NZ  . LYS B 2 185 ? 14.777  118.012 -22.159 1.00 19.20 ? 685  LYS B NZ  1 
ATOM   4050 N  N   . GLN B 2 186 ? 17.494  122.859 -22.582 1.00 19.05 ? 686  GLN B N   1 
ATOM   4051 C  CA  . GLN B 2 186 ? 18.799  122.670 -23.205 1.00 20.46 ? 686  GLN B CA  1 
ATOM   4052 C  C   . GLN B 2 186 ? 18.980  121.207 -23.607 1.00 21.08 ? 686  GLN B C   1 
ATOM   4053 O  O   . GLN B 2 186 ? 18.388  120.311 -23.008 1.00 20.67 ? 686  GLN B O   1 
ATOM   4054 C  CB  . GLN B 2 186 ? 19.905  123.075 -22.228 1.00 21.04 ? 686  GLN B CB  1 
ATOM   4055 C  CG  . GLN B 2 186 ? 19.786  124.509 -21.740 1.00 22.40 ? 686  GLN B CG  1 
ATOM   4056 C  CD  . GLN B 2 186 ? 20.021  125.508 -22.853 1.00 23.86 ? 686  GLN B CD  1 
ATOM   4057 O  OE1 . GLN B 2 186 ? 21.163  125.742 -23.262 1.00 24.87 ? 686  GLN B OE1 1 
ATOM   4058 N  NE2 . GLN B 2 186 ? 18.940  126.096 -23.361 1.00 24.06 ? 686  GLN B NE2 1 
ATOM   4059 N  N   . PRO B 2 187 ? 19.811  120.949 -24.629 1.00 22.04 ? 687  PRO B N   1 
ATOM   4060 C  CA  . PRO B 2 187 ? 20.046  119.577 -25.085 1.00 22.65 ? 687  PRO B CA  1 
ATOM   4061 C  C   . PRO B 2 187 ? 20.657  118.631 -24.046 1.00 22.53 ? 687  PRO B C   1 
ATOM   4062 O  O   . PRO B 2 187 ? 20.461  117.424 -24.126 1.00 23.01 ? 687  PRO B O   1 
ATOM   4063 C  CB  . PRO B 2 187 ? 20.938  119.771 -26.316 1.00 23.25 ? 687  PRO B CB  1 
ATOM   4064 C  CG  . PRO B 2 187 ? 21.673  121.039 -26.013 1.00 24.03 ? 687  PRO B CG  1 
ATOM   4065 C  CD  . PRO B 2 187 ? 20.585  121.913 -25.431 1.00 23.02 ? 687  PRO B CD  1 
ATOM   4066 N  N   . ASP B 2 188 ? 21.383  119.168 -23.068 1.00 22.15 ? 688  ASP B N   1 
ATOM   4067 C  CA  . ASP B 2 188 ? 21.994  118.318 -22.047 1.00 21.80 ? 688  ASP B CA  1 
ATOM   4068 C  C   . ASP B 2 188 ? 21.035  117.978 -20.903 1.00 21.18 ? 688  ASP B C   1 
ATOM   4069 O  O   . ASP B 2 188 ? 21.433  117.361 -19.915 1.00 21.25 ? 688  ASP B O   1 
ATOM   4070 C  CB  . ASP B 2 188 ? 23.265  118.976 -21.485 1.00 21.80 ? 688  ASP B CB  1 
ATOM   4071 C  CG  . ASP B 2 188 ? 22.980  120.239 -20.694 1.00 22.30 ? 688  ASP B CG  1 
ATOM   4072 O  OD1 . ASP B 2 188 ? 23.949  120.854 -20.196 1.00 22.17 ? 688  ASP B OD1 1 
ATOM   4073 O  OD2 . ASP B 2 188 ? 21.796  120.620 -20.566 1.00 21.94 ? 688  ASP B OD2 1 
ATOM   4074 N  N   . GLY B 2 189 ? 19.775  118.385 -21.042 1.00 20.24 ? 689  GLY B N   1 
ATOM   4075 C  CA  . GLY B 2 189 ? 18.780  118.100 -20.022 1.00 19.28 ? 689  GLY B CA  1 
ATOM   4076 C  C   . GLY B 2 189 ? 18.476  119.232 -19.052 1.00 18.59 ? 689  GLY B C   1 
ATOM   4077 O  O   . GLY B 2 189 ? 17.466  119.195 -18.346 1.00 18.00 ? 689  GLY B O   1 
ATOM   4078 N  N   . SER B 2 190 ? 19.337  120.243 -19.014 1.00 17.62 ? 690  SER B N   1 
ATOM   4079 C  CA  . SER B 2 190 ? 19.131  121.370 -18.107 1.00 17.43 ? 690  SER B CA  1 
ATOM   4080 C  C   . SER B 2 190 ? 18.171  122.409 -18.689 1.00 16.88 ? 690  SER B C   1 
ATOM   4081 O  O   . SER B 2 190 ? 17.767  122.318 -19.850 1.00 16.77 ? 690  SER B O   1 
ATOM   4082 C  CB  . SER B 2 190 ? 20.473  122.044 -17.793 1.00 17.49 ? 690  SER B CB  1 
ATOM   4083 O  OG  . SER B 2 190 ? 21.002  122.680 -18.948 1.00 18.27 ? 690  SER B OG  1 
ATOM   4084 N  N   . PHE B 2 191 ? 17.809  123.393 -17.870 1.00 16.38 ? 691  PHE B N   1 
ATOM   4085 C  CA  . PHE B 2 191 ? 16.922  124.474 -18.296 1.00 16.64 ? 691  PHE B CA  1 
ATOM   4086 C  C   . PHE B 2 191 ? 17.548  125.819 -17.951 1.00 16.72 ? 691  PHE B C   1 
ATOM   4087 O  O   . PHE B 2 191 ? 18.244  125.940 -16.943 1.00 16.69 ? 691  PHE B O   1 
ATOM   4088 C  CB  . PHE B 2 191 ? 15.568  124.426 -17.573 1.00 16.17 ? 691  PHE B CB  1 
ATOM   4089 C  CG  . PHE B 2 191 ? 14.647  123.335 -18.037 1.00 16.70 ? 691  PHE B CG  1 
ATOM   4090 C  CD1 . PHE B 2 191 ? 14.825  122.022 -17.615 1.00 17.16 ? 691  PHE B CD1 1 
ATOM   4091 C  CD2 . PHE B 2 191 ? 13.571  123.632 -18.870 1.00 16.88 ? 691  PHE B CD2 1 
ATOM   4092 C  CE1 . PHE B 2 191 ? 13.942  121.018 -18.011 1.00 17.26 ? 691  PHE B CE1 1 
ATOM   4093 C  CE2 . PHE B 2 191 ? 12.679  122.636 -19.274 1.00 17.26 ? 691  PHE B CE2 1 
ATOM   4094 C  CZ  . PHE B 2 191 ? 12.865  121.326 -18.842 1.00 17.59 ? 691  PHE B CZ  1 
ATOM   4095 N  N   . LEU B 2 192 ? 17.297  126.826 -18.786 1.00 16.59 ? 692  LEU B N   1 
ATOM   4096 C  CA  . LEU B 2 192 ? 17.773  128.178 -18.508 1.00 16.49 ? 692  LEU B CA  1 
ATOM   4097 C  C   . LEU B 2 192 ? 16.748  128.719 -17.502 1.00 16.48 ? 692  LEU B C   1 
ATOM   4098 O  O   . LEU B 2 192 ? 15.597  128.278 -17.511 1.00 15.63 ? 692  LEU B O   1 
ATOM   4099 C  CB  . LEU B 2 192 ? 17.721  129.052 -19.770 1.00 16.48 ? 692  LEU B CB  1 
ATOM   4100 C  CG  . LEU B 2 192 ? 18.477  128.611 -21.029 1.00 17.17 ? 692  LEU B CG  1 
ATOM   4101 C  CD1 . LEU B 2 192 ? 18.291  129.669 -22.125 1.00 17.56 ? 692  LEU B CD1 1 
ATOM   4102 C  CD2 . LEU B 2 192 ? 19.947  128.420 -20.711 1.00 16.64 ? 692  LEU B CD2 1 
ATOM   4103 N  N   . MET B 2 193 ? 17.149  129.650 -16.637 1.00 16.74 ? 693  MET B N   1 
ATOM   4104 C  CA  . MET B 2 193 ? 16.204  130.229 -15.675 1.00 17.06 ? 693  MET B CA  1 
ATOM   4105 C  C   . MET B 2 193 ? 15.242  131.155 -16.426 1.00 17.50 ? 693  MET B C   1 
ATOM   4106 O  O   . MET B 2 193 ? 14.103  131.364 -16.006 1.00 17.03 ? 693  MET B O   1 
ATOM   4107 C  CB  . MET B 2 193 ? 16.936  131.025 -14.585 1.00 17.69 ? 693  MET B CB  1 
ATOM   4108 C  CG  . MET B 2 193 ? 17.589  130.179 -13.488 1.00 17.62 ? 693  MET B CG  1 
ATOM   4109 S  SD  . MET B 2 193 ? 16.441  129.031 -12.689 1.00 19.18 ? 693  MET B SD  1 
ATOM   4110 C  CE  . MET B 2 193 ? 15.415  130.138 -11.742 1.00 18.79 ? 693  MET B CE  1 
ATOM   4111 N  N   . HIS B 2 194 ? 15.724  131.711 -17.536 1.00 17.18 ? 694  HIS B N   1 
ATOM   4112 C  CA  . HIS B 2 194 ? 14.934  132.593 -18.390 1.00 17.58 ? 694  HIS B CA  1 
ATOM   4113 C  C   . HIS B 2 194 ? 15.687  132.761 -19.704 1.00 17.66 ? 694  HIS B C   1 
ATOM   4114 O  O   . HIS B 2 194 ? 16.848  132.362 -19.811 1.00 17.02 ? 694  HIS B O   1 
ATOM   4115 C  CB  . HIS B 2 194 ? 14.689  133.954 -17.710 1.00 17.65 ? 694  HIS B CB  1 
ATOM   4116 C  CG  . HIS B 2 194 ? 15.925  134.777 -17.510 1.00 18.53 ? 694  HIS B CG  1 
ATOM   4117 N  ND1 . HIS B 2 194 ? 16.234  135.860 -18.305 1.00 19.05 ? 694  HIS B ND1 1 
ATOM   4118 C  CD2 . HIS B 2 194 ? 16.909  134.700 -16.582 1.00 18.73 ? 694  HIS B CD2 1 
ATOM   4119 C  CE1 . HIS B 2 194 ? 17.353  136.417 -17.874 1.00 19.16 ? 694  HIS B CE1 1 
ATOM   4120 N  NE2 . HIS B 2 194 ? 17.783  135.732 -16.828 1.00 19.23 ? 694  HIS B NE2 1 
ATOM   4121 N  N   . VAL B 2 195 ? 15.032  133.330 -20.710 1.00 18.71 ? 695  VAL B N   1 
ATOM   4122 C  CA  . VAL B 2 195 ? 15.673  133.514 -22.010 1.00 19.25 ? 695  VAL B CA  1 
ATOM   4123 C  C   . VAL B 2 195 ? 16.973  134.291 -21.851 1.00 19.48 ? 695  VAL B C   1 
ATOM   4124 O  O   . VAL B 2 195 ? 16.996  135.371 -21.263 1.00 19.82 ? 695  VAL B O   1 
ATOM   4125 C  CB  . VAL B 2 195 ? 14.738  134.253 -22.995 1.00 19.73 ? 695  VAL B CB  1 
ATOM   4126 C  CG1 . VAL B 2 195 ? 15.417  134.411 -24.354 1.00 19.74 ? 695  VAL B CG1 1 
ATOM   4127 C  CG2 . VAL B 2 195 ? 13.445  133.469 -23.147 1.00 20.00 ? 695  VAL B CG2 1 
ATOM   4128 N  N   . GLY B 2 196 ? 18.056  133.724 -22.371 1.00 19.92 ? 696  GLY B N   1 
ATOM   4129 C  CA  . GLY B 2 196 ? 19.355  134.361 -22.262 1.00 20.25 ? 696  GLY B CA  1 
ATOM   4130 C  C   . GLY B 2 196 ? 19.838  134.392 -20.823 1.00 20.83 ? 696  GLY B C   1 
ATOM   4131 O  O   . GLY B 2 196 ? 20.710  135.187 -20.478 1.00 21.51 ? 696  GLY B O   1 
ATOM   4132 N  N   . GLY B 2 197 ? 19.279  133.519 -19.985 1.00 20.48 ? 697  GLY B N   1 
ATOM   4133 C  CA  . GLY B 2 197 ? 19.649  133.483 -18.579 1.00 19.34 ? 697  GLY B CA  1 
ATOM   4134 C  C   . GLY B 2 197 ? 20.577  132.356 -18.154 1.00 19.34 ? 697  GLY B C   1 
ATOM   4135 O  O   . GLY B 2 197 ? 20.971  131.519 -18.961 1.00 18.65 ? 697  GLY B O   1 
ATOM   4136 N  N   . GLU B 2 198 ? 20.911  132.335 -16.867 1.00 18.91 ? 698  GLU B N   1 
ATOM   4137 C  CA  . GLU B 2 198 ? 21.814  131.337 -16.310 1.00 19.05 ? 698  GLU B CA  1 
ATOM   4138 C  C   . GLU B 2 198 ? 21.150  129.981 -16.095 1.00 18.58 ? 698  GLU B C   1 
ATOM   4139 O  O   . GLU B 2 198 ? 19.924  129.865 -16.043 1.00 17.90 ? 698  GLU B O   1 
ATOM   4140 C  CB  . GLU B 2 198 ? 22.388  131.827 -14.969 1.00 19.84 ? 698  GLU B CB  1 
ATOM   4141 C  CG  . GLU B 2 198 ? 21.391  131.813 -13.794 1.00 21.20 ? 698  GLU B CG  1 
ATOM   4142 C  CD  . GLU B 2 198 ? 20.456  133.022 -13.765 1.00 22.99 ? 698  GLU B CD  1 
ATOM   4143 O  OE1 . GLU B 2 198 ? 20.389  133.767 -14.767 1.00 24.19 ? 698  GLU B OE1 1 
ATOM   4144 O  OE2 . GLU B 2 198 ? 19.778  133.225 -12.733 1.00 23.59 ? 698  GLU B OE2 1 
ATOM   4145 N  N   . VAL B 2 199 ? 21.974  128.950 -15.973 1.00 18.57 ? 699  VAL B N   1 
ATOM   4146 C  CA  . VAL B 2 199 ? 21.461  127.615 -15.727 1.00 18.85 ? 699  VAL B CA  1 
ATOM   4147 C  C   . VAL B 2 199 ? 22.032  127.026 -14.439 1.00 18.17 ? 699  VAL B C   1 
ATOM   4148 O  O   . VAL B 2 199 ? 23.220  127.165 -14.153 1.00 18.06 ? 699  VAL B O   1 
ATOM   4149 C  CB  . VAL B 2 199 ? 21.775  126.660 -16.907 1.00 19.54 ? 699  VAL B CB  1 
ATOM   4150 C  CG1 . VAL B 2 199 ? 23.117  126.993 -17.499 1.00 22.41 ? 699  VAL B CG1 1 
ATOM   4151 C  CG2 . VAL B 2 199 ? 21.773  125.212 -16.428 1.00 19.33 ? 699  VAL B CG2 1 
ATOM   4152 N  N   . ASP B 2 200 ? 21.150  126.411 -13.655 1.00 17.52 ? 700  ASP B N   1 
ATOM   4153 C  CA  . ASP B 2 200 ? 21.497  125.716 -12.418 1.00 17.15 ? 700  ASP B CA  1 
ATOM   4154 C  C   . ASP B 2 200 ? 20.286  124.858 -12.041 1.00 16.89 ? 700  ASP B C   1 
ATOM   4155 O  O   . ASP B 2 200 ? 19.214  125.013 -12.624 1.00 16.73 ? 700  ASP B O   1 
ATOM   4156 C  CB  . ASP B 2 200 ? 21.919  126.679 -11.289 1.00 16.46 ? 700  ASP B CB  1 
ATOM   4157 C  CG  . ASP B 2 200 ? 20.847  127.678 -10.910 1.00 16.61 ? 700  ASP B CG  1 
ATOM   4158 O  OD1 . ASP B 2 200 ? 19.756  127.256 -10.475 1.00 16.35 ? 700  ASP B OD1 1 
ATOM   4159 O  OD2 . ASP B 2 200 ? 21.113  128.896 -11.031 1.00 16.46 ? 700  ASP B OD2 1 
ATOM   4160 N  N   . VAL B 2 201 ? 20.452  123.949 -11.085 1.00 17.10 ? 701  VAL B N   1 
ATOM   4161 C  CA  . VAL B 2 201 ? 19.370  123.031 -10.724 1.00 16.87 ? 701  VAL B CA  1 
ATOM   4162 C  C   . VAL B 2 201 ? 18.030  123.656 -10.348 1.00 15.96 ? 701  VAL B C   1 
ATOM   4163 O  O   . VAL B 2 201 ? 17.003  122.988 -10.409 1.00 15.30 ? 701  VAL B O   1 
ATOM   4164 C  CB  . VAL B 2 201 ? 19.804  122.073 -9.592  1.00 17.98 ? 701  VAL B CB  1 
ATOM   4165 C  CG1 . VAL B 2 201 ? 18.947  120.808 -9.631  1.00 18.10 ? 701  VAL B CG1 1 
ATOM   4166 C  CG2 . VAL B 2 201 ? 21.268  121.708 -9.753  1.00 20.77 ? 701  VAL B CG2 1 
ATOM   4167 N  N   . ARG B 2 202 ? 18.023  124.927 -9.958  1.00 15.63 ? 702  ARG B N   1 
ATOM   4168 C  CA  . ARG B 2 202 ? 16.760  125.569 -9.611  1.00 15.25 ? 702  ARG B CA  1 
ATOM   4169 C  C   . ARG B 2 202 ? 15.784  125.516 -10.788 1.00 15.35 ? 702  ARG B C   1 
ATOM   4170 O  O   . ARG B 2 202 ? 14.583  125.310 -10.596 1.00 15.10 ? 702  ARG B O   1 
ATOM   4171 C  CB  . ARG B 2 202 ? 16.972  127.033 -9.221  1.00 15.52 ? 702  ARG B CB  1 
ATOM   4172 C  CG  . ARG B 2 202 ? 17.716  127.275 -7.910  1.00 15.11 ? 702  ARG B CG  1 
ATOM   4173 C  CD  . ARG B 2 202 ? 17.982  128.773 -7.753  1.00 16.09 ? 702  ARG B CD  1 
ATOM   4174 N  NE  . ARG B 2 202 ? 18.630  129.288 -8.958  1.00 16.01 ? 702  ARG B NE  1 
ATOM   4175 C  CZ  . ARG B 2 202 ? 18.530  130.538 -9.400  1.00 16.30 ? 702  ARG B CZ  1 
ATOM   4176 N  NH1 . ARG B 2 202 ? 17.806  131.435 -8.736  1.00 15.35 ? 702  ARG B NH1 1 
ATOM   4177 N  NH2 . ARG B 2 202 ? 19.140  130.882 -10.526 1.00 15.56 ? 702  ARG B NH2 1 
ATOM   4178 N  N   . SER B 2 203 ? 16.297  125.695 -12.005 1.00 14.67 ? 703  SER B N   1 
ATOM   4179 C  CA  . SER B 2 203 ? 15.436  125.693 -13.185 1.00 14.47 ? 703  SER B CA  1 
ATOM   4180 C  C   . SER B 2 203 ? 14.701  124.370 -13.377 1.00 13.81 ? 703  SER B C   1 
ATOM   4181 O  O   . SER B 2 203 ? 13.503  124.358 -13.660 1.00 13.60 ? 703  SER B O   1 
ATOM   4182 C  CB  . SER B 2 203 ? 16.243  126.031 -14.450 1.00 14.46 ? 703  SER B CB  1 
ATOM   4183 O  OG  . SER B 2 203 ? 17.195  125.025 -14.749 1.00 15.11 ? 703  SER B OG  1 
ATOM   4184 N  N   . ALA B 2 204 ? 15.411  123.257 -13.212 1.00 13.59 ? 704  ALA B N   1 
ATOM   4185 C  CA  . ALA B 2 204 ? 14.796  121.946 -13.379 1.00 13.40 ? 704  ALA B CA  1 
ATOM   4186 C  C   . ALA B 2 204 ? 13.632  121.754 -12.413 1.00 13.43 ? 704  ALA B C   1 
ATOM   4187 O  O   . ALA B 2 204 ? 12.586  121.219 -12.783 1.00 13.38 ? 704  ALA B O   1 
ATOM   4188 C  CB  . ALA B 2 204 ? 15.834  120.848 -13.175 1.00 13.40 ? 704  ALA B CB  1 
ATOM   4189 N  N   . TYR B 2 205 ? 13.818  122.188 -11.172 1.00 13.08 ? 705  TYR B N   1 
ATOM   4190 C  CA  . TYR B 2 205 ? 12.770  122.061 -10.166 1.00 13.30 ? 705  TYR B CA  1 
ATOM   4191 C  C   . TYR B 2 205 ? 11.588  122.983 -10.463 1.00 13.27 ? 705  TYR B C   1 
ATOM   4192 O  O   . TYR B 2 205 ? 10.433  122.571 -10.377 1.00 13.33 ? 705  TYR B O   1 
ATOM   4193 C  CB  . TYR B 2 205 ? 13.331  122.378 -8.778  1.00 13.14 ? 705  TYR B CB  1 
ATOM   4194 C  CG  . TYR B 2 205 ? 12.259  122.487 -7.723  1.00 13.64 ? 705  TYR B CG  1 
ATOM   4195 C  CD1 . TYR B 2 205 ? 11.489  121.376 -7.361  1.00 13.53 ? 705  TYR B CD1 1 
ATOM   4196 C  CD2 . TYR B 2 205 ? 11.982  123.713 -7.117  1.00 13.57 ? 705  TYR B CD2 1 
ATOM   4197 C  CE1 . TYR B 2 205 ? 10.461  121.488 -6.419  1.00 14.20 ? 705  TYR B CE1 1 
ATOM   4198 C  CE2 . TYR B 2 205 ? 10.965  123.836 -6.178  1.00 13.82 ? 705  TYR B CE2 1 
ATOM   4199 C  CZ  . TYR B 2 205 ? 10.208  122.723 -5.834  1.00 13.87 ? 705  TYR B CZ  1 
ATOM   4200 O  OH  . TYR B 2 205 ? 9.204   122.851 -4.908  1.00 13.52 ? 705  TYR B OH  1 
ATOM   4201 N  N   . CYS B 2 206 ? 11.875  124.237 -10.802 1.00 13.31 ? 706  CYS B N   1 
ATOM   4202 C  CA  . CYS B 2 206 ? 10.811  125.184 -11.113 1.00 14.15 ? 706  CYS B CA  1 
ATOM   4203 C  C   . CYS B 2 206 ? 9.967   124.649 -12.269 1.00 13.97 ? 706  CYS B C   1 
ATOM   4204 O  O   . CYS B 2 206 ? 8.740   124.678 -12.210 1.00 14.61 ? 706  CYS B O   1 
ATOM   4205 C  CB  . CYS B 2 206 ? 11.390  126.559 -11.483 1.00 14.13 ? 706  CYS B CB  1 
ATOM   4206 S  SG  . CYS B 2 206 ? 12.063  127.500 -10.079 1.00 15.91 ? 706  CYS B SG  1 
ATOM   4207 N  N   . ALA B 2 207 ? 10.633  124.152 -13.309 1.00 14.23 ? 707  ALA B N   1 
ATOM   4208 C  CA  . ALA B 2 207 ? 9.946   123.603 -14.481 1.00 14.46 ? 707  ALA B CA  1 
ATOM   4209 C  C   . ALA B 2 207 ? 9.123   122.359 -14.137 1.00 14.69 ? 707  ALA B C   1 
ATOM   4210 O  O   . ALA B 2 207 ? 7.942   122.267 -14.492 1.00 14.53 ? 707  ALA B O   1 
ATOM   4211 C  CB  . ALA B 2 207 ? 10.965  123.264 -15.575 1.00 13.45 ? 707  ALA B CB  1 
ATOM   4212 N  N   . ALA B 2 208 ? 9.746   121.402 -13.450 1.00 14.89 ? 708  ALA B N   1 
ATOM   4213 C  CA  . ALA B 2 208 ? 9.060   120.167 -13.073 1.00 14.98 ? 708  ALA B CA  1 
ATOM   4214 C  C   . ALA B 2 208 ? 7.874   120.449 -12.160 1.00 15.06 ? 708  ALA B C   1 
ATOM   4215 O  O   . ALA B 2 208 ? 6.822   119.819 -12.278 1.00 15.77 ? 708  ALA B O   1 
ATOM   4216 C  CB  . ALA B 2 208 ? 10.035  119.205 -12.381 1.00 14.65 ? 708  ALA B CB  1 
ATOM   4217 N  N   . SER B 2 209 ? 8.041   121.394 -11.244 1.00 14.99 ? 709  SER B N   1 
ATOM   4218 C  CA  . SER B 2 209 ? 6.969   121.731 -10.320 1.00 15.36 ? 709  SER B CA  1 
ATOM   4219 C  C   . SER B 2 209 ? 5.739   122.279 -11.043 1.00 15.41 ? 709  SER B C   1 
ATOM   4220 O  O   . SER B 2 209 ? 4.640   121.739 -10.904 1.00 15.19 ? 709  SER B O   1 
ATOM   4221 C  CB  . SER B 2 209 ? 7.457   122.751 -9.286  1.00 15.58 ? 709  SER B CB  1 
ATOM   4222 O  OG  . SER B 2 209 ? 6.405   123.152 -8.423  1.00 15.76 ? 709  SER B OG  1 
ATOM   4223 N  N   . VAL B 2 210 ? 5.916   123.341 -11.823 1.00 15.29 ? 710  VAL B N   1 
ATOM   4224 C  CA  . VAL B 2 210 ? 4.775   123.926 -12.521 1.00 15.58 ? 710  VAL B CA  1 
ATOM   4225 C  C   . VAL B 2 210 ? 4.168   123.016 -13.586 1.00 15.65 ? 710  VAL B C   1 
ATOM   4226 O  O   . VAL B 2 210 ? 2.954   123.005 -13.769 1.00 15.85 ? 710  VAL B O   1 
ATOM   4227 C  CB  . VAL B 2 210 ? 5.135   125.283 -13.185 1.00 15.48 ? 710  VAL B CB  1 
ATOM   4228 C  CG1 . VAL B 2 210 ? 5.669   126.250 -12.136 1.00 14.76 ? 710  VAL B CG1 1 
ATOM   4229 C  CG2 . VAL B 2 210 ? 6.140   125.073 -14.309 1.00 15.12 ? 710  VAL B CG2 1 
ATOM   4230 N  N   . ALA B 2 211 ? 5.006   122.252 -14.281 1.00 16.07 ? 711  ALA B N   1 
ATOM   4231 C  CA  . ALA B 2 211 ? 4.526   121.358 -15.336 1.00 16.28 ? 711  ALA B CA  1 
ATOM   4232 C  C   . ALA B 2 211 ? 3.698   120.193 -14.790 1.00 16.62 ? 711  ALA B C   1 
ATOM   4233 O  O   . ALA B 2 211 ? 2.688   119.805 -15.388 1.00 16.07 ? 711  ALA B O   1 
ATOM   4234 C  CB  . ALA B 2 211 ? 5.708   120.833 -16.157 1.00 16.08 ? 711  ALA B CB  1 
ATOM   4235 N  N   . SER B 2 212 ? 4.120   119.636 -13.657 1.00 16.62 ? 712  SER B N   1 
ATOM   4236 C  CA  . SER B 2 212 ? 3.390   118.528 -13.055 1.00 17.15 ? 712  SER B CA  1 
ATOM   4237 C  C   . SER B 2 212 ? 2.075   119.019 -12.450 1.00 17.18 ? 712  SER B C   1 
ATOM   4238 O  O   . SER B 2 212 ? 1.038   118.377 -12.603 1.00 17.09 ? 712  SER B O   1 
ATOM   4239 C  CB  . SER B 2 212 ? 4.245   117.829 -11.988 1.00 17.82 ? 712  SER B CB  1 
ATOM   4240 O  OG  . SER B 2 212 ? 4.613   118.710 -10.942 1.00 19.31 ? 712  SER B OG  1 
ATOM   4241 N  N   . LEU B 2 213 ? 2.111   120.158 -11.766 1.00 16.98 ? 713  LEU B N   1 
ATOM   4242 C  CA  . LEU B 2 213 ? 0.892   120.702 -11.175 1.00 17.43 ? 713  LEU B CA  1 
ATOM   4243 C  C   . LEU B 2 213 ? -0.163  121.040 -12.233 1.00 17.46 ? 713  LEU B C   1 
ATOM   4244 O  O   . LEU B 2 213 ? -1.346  120.740 -12.061 1.00 17.17 ? 713  LEU B O   1 
ATOM   4245 C  CB  . LEU B 2 213 ? 1.199   121.965 -10.363 1.00 16.66 ? 713  LEU B CB  1 
ATOM   4246 C  CG  . LEU B 2 213 ? 1.901   121.787 -9.010  1.00 17.13 ? 713  LEU B CG  1 
ATOM   4247 C  CD1 . LEU B 2 213 ? 2.267   123.157 -8.445  1.00 16.26 ? 713  LEU B CD1 1 
ATOM   4248 C  CD2 . LEU B 2 213 ? 0.990   121.037 -8.047  1.00 16.58 ? 713  LEU B CD2 1 
ATOM   4249 N  N   . THR B 2 214 ? 0.270   121.656 -13.329 1.00 17.05 ? 714  THR B N   1 
ATOM   4250 C  CA  . THR B 2 214 ? -0.656  122.063 -14.382 1.00 16.86 ? 714  THR B CA  1 
ATOM   4251 C  C   . THR B 2 214 ? -0.898  121.020 -15.466 1.00 17.69 ? 714  THR B C   1 
ATOM   4252 O  O   . THR B 2 214 ? -1.588  121.290 -16.453 1.00 17.97 ? 714  THR B O   1 
ATOM   4253 C  CB  . THR B 2 214 ? -0.181  123.373 -15.042 1.00 16.15 ? 714  THR B CB  1 
ATOM   4254 O  OG1 . THR B 2 214 ? 1.075   123.161 -15.697 1.00 15.90 ? 714  THR B OG1 1 
ATOM   4255 C  CG2 . THR B 2 214 ? -0.014  124.455 -13.982 1.00 15.32 ? 714  THR B CG2 1 
ATOM   4256 N  N   . ASN B 2 215 ? -0.330  119.833 -15.280 1.00 18.08 ? 715  ASN B N   1 
ATOM   4257 C  CA  . ASN B 2 215 ? -0.490  118.737 -16.232 1.00 18.81 ? 715  ASN B CA  1 
ATOM   4258 C  C   . ASN B 2 215 ? -0.111  119.108 -17.671 1.00 19.23 ? 715  ASN B C   1 
ATOM   4259 O  O   . ASN B 2 215 ? -0.927  118.994 -18.590 1.00 19.63 ? 715  ASN B O   1 
ATOM   4260 C  CB  . ASN B 2 215 ? -1.934  118.216 -16.174 1.00 18.47 ? 715  ASN B CB  1 
ATOM   4261 C  CG  . ASN B 2 215 ? -2.181  117.048 -17.118 1.00 19.26 ? 715  ASN B CG  1 
ATOM   4262 O  OD1 . ASN B 2 215 ? -1.342  116.160 -17.270 1.00 19.14 ? 715  ASN B OD1 1 
ATOM   4263 N  ND2 . ASN B 2 215 ? -3.351  117.037 -17.741 1.00 19.48 ? 715  ASN B ND2 1 
ATOM   4264 N  N   . ILE B 2 216 ? 1.128   119.557 -17.865 1.00 19.16 ? 716  ILE B N   1 
ATOM   4265 C  CA  . ILE B 2 216 ? 1.598   119.913 -19.199 1.00 19.35 ? 716  ILE B CA  1 
ATOM   4266 C  C   . ILE B 2 216 ? 2.890   119.176 -19.540 1.00 19.99 ? 716  ILE B C   1 
ATOM   4267 O  O   . ILE B 2 216 ? 3.603   119.548 -20.467 1.00 19.63 ? 716  ILE B O   1 
ATOM   4268 C  CB  . ILE B 2 216 ? 1.837   121.436 -19.346 1.00 18.87 ? 716  ILE B CB  1 
ATOM   4269 C  CG1 . ILE B 2 216 ? 2.897   121.907 -18.348 1.00 18.55 ? 716  ILE B CG1 1 
ATOM   4270 C  CG2 . ILE B 2 216 ? 0.517   122.188 -19.161 1.00 18.71 ? 716  ILE B CG2 1 
ATOM   4271 C  CD1 . ILE B 2 216 ? 3.235   123.393 -18.462 1.00 16.15 ? 716  ILE B CD1 1 
ATOM   4272 N  N   . ILE B 2 217 ? 3.186   118.123 -18.789 1.00 20.76 ? 717  ILE B N   1 
ATOM   4273 C  CA  . ILE B 2 217 ? 4.392   117.349 -19.039 1.00 21.74 ? 717  ILE B CA  1 
ATOM   4274 C  C   . ILE B 2 217 ? 4.248   116.469 -20.271 1.00 22.66 ? 717  ILE B C   1 
ATOM   4275 O  O   . ILE B 2 217 ? 3.277   115.732 -20.404 1.00 22.83 ? 717  ILE B O   1 
ATOM   4276 C  CB  . ILE B 2 217 ? 4.743   116.433 -17.849 1.00 21.66 ? 717  ILE B CB  1 
ATOM   4277 C  CG1 . ILE B 2 217 ? 5.069   117.275 -16.616 1.00 21.30 ? 717  ILE B CG1 1 
ATOM   4278 C  CG2 . ILE B 2 217 ? 5.934   115.534 -18.214 1.00 21.60 ? 717  ILE B CG2 1 
ATOM   4279 C  CD1 . ILE B 2 217 ? 5.420   116.451 -15.401 1.00 21.84 ? 717  ILE B CD1 1 
ATOM   4280 N  N   . THR B 2 218 ? 5.216   116.563 -21.175 1.00 23.77 ? 718  THR B N   1 
ATOM   4281 C  CA  . THR B 2 218 ? 5.226   115.739 -22.374 1.00 24.55 ? 718  THR B CA  1 
ATOM   4282 C  C   . THR B 2 218 ? 6.389   114.775 -22.179 1.00 25.62 ? 718  THR B C   1 
ATOM   4283 O  O   . THR B 2 218 ? 7.274   115.019 -21.355 1.00 25.11 ? 718  THR B O   1 
ATOM   4284 C  CB  . THR B 2 218 ? 5.474   116.564 -23.651 1.00 24.56 ? 718  THR B CB  1 
ATOM   4285 O  OG1 . THR B 2 218 ? 6.719   117.261 -23.539 1.00 23.33 ? 718  THR B OG1 1 
ATOM   4286 C  CG2 . THR B 2 218 ? 4.344   117.559 -23.873 1.00 24.56 ? 718  THR B CG2 1 
ATOM   4287 N  N   . PRO B 2 219 ? 6.408   113.667 -22.932 1.00 26.88 ? 719  PRO B N   1 
ATOM   4288 C  CA  . PRO B 2 219 ? 7.496   112.695 -22.797 1.00 27.17 ? 719  PRO B CA  1 
ATOM   4289 C  C   . PRO B 2 219 ? 8.897   113.260 -23.048 1.00 27.06 ? 719  PRO B C   1 
ATOM   4290 O  O   . PRO B 2 219 ? 9.861   112.839 -22.413 1.00 27.84 ? 719  PRO B O   1 
ATOM   4291 C  CB  . PRO B 2 219 ? 7.112   111.612 -23.806 1.00 28.10 ? 719  PRO B CB  1 
ATOM   4292 C  CG  . PRO B 2 219 ? 6.356   112.384 -24.855 1.00 28.02 ? 719  PRO B CG  1 
ATOM   4293 C  CD  . PRO B 2 219 ? 5.479   113.267 -24.005 1.00 27.40 ? 719  PRO B CD  1 
ATOM   4294 N  N   . ASP B 2 220 ? 9.012   114.222 -23.957 1.00 26.57 ? 720  ASP B N   1 
ATOM   4295 C  CA  . ASP B 2 220 ? 10.318  114.793 -24.273 1.00 26.34 ? 720  ASP B CA  1 
ATOM   4296 C  C   . ASP B 2 220 ? 10.730  116.027 -23.467 1.00 24.77 ? 720  ASP B C   1 
ATOM   4297 O  O   . ASP B 2 220 ? 11.907  116.379 -23.446 1.00 23.95 ? 720  ASP B O   1 
ATOM   4298 C  CB  . ASP B 2 220 ? 10.399  115.120 -25.768 1.00 28.65 ? 720  ASP B CB  1 
ATOM   4299 C  CG  . ASP B 2 220 ? 9.364   116.137 -26.201 1.00 30.78 ? 720  ASP B CG  1 
ATOM   4300 O  OD1 . ASP B 2 220 ? 8.150   115.883 -26.018 1.00 32.28 ? 720  ASP B OD1 1 
ATOM   4301 O  OD2 . ASP B 2 220 ? 9.764   117.194 -26.733 1.00 32.68 ? 720  ASP B OD2 1 
ATOM   4302 N  N   . LEU B 2 221 ? 9.776   116.679 -22.806 1.00 23.07 ? 721  LEU B N   1 
ATOM   4303 C  CA  . LEU B 2 221 ? 10.077  117.877 -22.024 1.00 21.72 ? 721  LEU B CA  1 
ATOM   4304 C  C   . LEU B 2 221 ? 11.250  117.698 -21.061 1.00 20.84 ? 721  LEU B C   1 
ATOM   4305 O  O   . LEU B 2 221 ? 12.144  118.543 -20.999 1.00 19.56 ? 721  LEU B O   1 
ATOM   4306 C  CB  . LEU B 2 221 ? 8.843   118.330 -21.233 1.00 21.30 ? 721  LEU B CB  1 
ATOM   4307 C  CG  . LEU B 2 221 ? 9.047   119.520 -20.284 1.00 21.58 ? 721  LEU B CG  1 
ATOM   4308 C  CD1 . LEU B 2 221 ? 9.530   120.731 -21.062 1.00 21.25 ? 721  LEU B CD1 1 
ATOM   4309 C  CD2 . LEU B 2 221 ? 7.734   119.837 -19.564 1.00 21.83 ? 721  LEU B CD2 1 
ATOM   4310 N  N   . PHE B 2 222 ? 11.251  116.601 -20.312 1.00 20.29 ? 722  PHE B N   1 
ATOM   4311 C  CA  . PHE B 2 222 ? 12.324  116.363 -19.353 1.00 20.71 ? 722  PHE B CA  1 
ATOM   4312 C  C   . PHE B 2 222 ? 13.339  115.308 -19.770 1.00 21.05 ? 722  PHE B C   1 
ATOM   4313 O  O   . PHE B 2 222 ? 14.023  114.721 -18.934 1.00 20.04 ? 722  PHE B O   1 
ATOM   4314 C  CB  . PHE B 2 222 ? 11.726  116.023 -17.988 1.00 20.08 ? 722  PHE B CB  1 
ATOM   4315 C  CG  . PHE B 2 222 ? 10.954  117.157 -17.385 1.00 19.86 ? 722  PHE B CG  1 
ATOM   4316 C  CD1 . PHE B 2 222 ? 9.568   117.121 -17.325 1.00 19.56 ? 722  PHE B CD1 1 
ATOM   4317 C  CD2 . PHE B 2 222 ? 11.617  118.291 -16.925 1.00 19.53 ? 722  PHE B CD2 1 
ATOM   4318 C  CE1 . PHE B 2 222 ? 8.850   118.199 -16.817 1.00 19.29 ? 722  PHE B CE1 1 
ATOM   4319 C  CE2 . PHE B 2 222 ? 10.909  119.376 -16.416 1.00 19.55 ? 722  PHE B CE2 1 
ATOM   4320 C  CZ  . PHE B 2 222 ? 9.523   119.330 -16.362 1.00 18.89 ? 722  PHE B CZ  1 
ATOM   4321 N  N   . GLU B 2 223 ? 13.442  115.078 -21.073 1.00 22.21 ? 723  GLU B N   1 
ATOM   4322 C  CA  . GLU B 2 223 ? 14.396  114.111 -21.598 1.00 23.16 ? 723  GLU B CA  1 
ATOM   4323 C  C   . GLU B 2 223 ? 15.804  114.578 -21.224 1.00 22.13 ? 723  GLU B C   1 
ATOM   4324 O  O   . GLU B 2 223 ? 16.196  115.706 -21.527 1.00 21.75 ? 723  GLU B O   1 
ATOM   4325 C  CB  . GLU B 2 223 ? 14.230  114.003 -23.125 1.00 25.68 ? 723  GLU B CB  1 
ATOM   4326 C  CG  . GLU B 2 223 ? 15.514  114.088 -23.928 1.00 30.80 ? 723  GLU B CG  1 
ATOM   4327 C  CD  . GLU B 2 223 ? 16.436  112.913 -23.693 1.00 33.51 ? 723  GLU B CD  1 
ATOM   4328 O  OE1 . GLU B 2 223 ? 17.620  112.998 -24.099 1.00 36.30 ? 723  GLU B OE1 1 
ATOM   4329 O  OE2 . GLU B 2 223 ? 15.979  111.905 -23.110 1.00 35.69 ? 723  GLU B OE2 1 
ATOM   4330 N  N   . GLY B 2 224 ? 16.551  113.710 -20.544 1.00 21.21 ? 724  GLY B N   1 
ATOM   4331 C  CA  . GLY B 2 224 ? 17.906  114.044 -20.135 1.00 20.00 ? 724  GLY B CA  1 
ATOM   4332 C  C   . GLY B 2 224 ? 18.021  114.811 -18.824 1.00 19.25 ? 724  GLY B C   1 
ATOM   4333 O  O   . GLY B 2 224 ? 19.097  114.880 -18.240 1.00 18.69 ? 724  GLY B O   1 
ATOM   4334 N  N   . THR B 2 225 ? 16.916  115.377 -18.349 1.00 19.06 ? 725  THR B N   1 
ATOM   4335 C  CA  . THR B 2 225 ? 16.931  116.160 -17.115 1.00 18.53 ? 725  THR B CA  1 
ATOM   4336 C  C   . THR B 2 225 ? 17.377  115.379 -15.878 1.00 18.87 ? 725  THR B C   1 
ATOM   4337 O  O   . THR B 2 225 ? 18.218  115.853 -15.110 1.00 18.76 ? 725  THR B O   1 
ATOM   4338 C  CB  . THR B 2 225 ? 15.546  116.785 -16.856 1.00 18.47 ? 725  THR B CB  1 
ATOM   4339 O  OG1 . THR B 2 225 ? 15.169  117.569 -17.994 1.00 18.44 ? 725  THR B OG1 1 
ATOM   4340 C  CG2 . THR B 2 225 ? 15.579  117.685 -15.627 1.00 17.45 ? 725  THR B CG2 1 
ATOM   4341 N  N   . ALA B 2 226 ? 16.820  114.186 -15.684 1.00 18.57 ? 726  ALA B N   1 
ATOM   4342 C  CA  . ALA B 2 226 ? 17.189  113.364 -14.537 1.00 18.29 ? 726  ALA B CA  1 
ATOM   4343 C  C   . ALA B 2 226 ? 18.696  113.089 -14.511 1.00 18.48 ? 726  ALA B C   1 
ATOM   4344 O  O   . ALA B 2 226 ? 19.330  113.145 -13.452 1.00 18.02 ? 726  ALA B O   1 
ATOM   4345 C  CB  . ALA B 2 226 ? 16.414  112.047 -14.564 1.00 18.13 ? 726  ALA B CB  1 
ATOM   4346 N  N   . GLU B 2 227 ? 19.269  112.793 -15.675 1.00 18.38 ? 727  GLU B N   1 
ATOM   4347 C  CA  . GLU B 2 227 ? 20.701  112.514 -15.772 1.00 18.48 ? 727  GLU B CA  1 
ATOM   4348 C  C   . GLU B 2 227 ? 21.527  113.759 -15.450 1.00 18.27 ? 727  GLU B C   1 
ATOM   4349 O  O   . GLU B 2 227 ? 22.566  113.678 -14.790 1.00 18.56 ? 727  GLU B O   1 
ATOM   4350 C  CB  . GLU B 2 227 ? 21.060  112.019 -17.180 1.00 19.93 ? 727  GLU B CB  1 
ATOM   4351 C  CG  . GLU B 2 227 ? 20.498  110.642 -17.563 1.00 21.92 ? 727  GLU B CG  1 
ATOM   4352 C  CD  . GLU B 2 227 ? 18.984  110.622 -17.714 1.00 23.28 ? 727  GLU B CD  1 
ATOM   4353 O  OE1 . GLU B 2 227 ? 18.383  111.678 -18.003 1.00 23.92 ? 727  GLU B OE1 1 
ATOM   4354 O  OE2 . GLU B 2 227 ? 18.388  109.536 -17.559 1.00 25.59 ? 727  GLU B OE2 1 
ATOM   4355 N  N   . TRP B 2 228 ? 21.071  114.911 -15.923 1.00 17.59 ? 728  TRP B N   1 
ATOM   4356 C  CA  . TRP B 2 228 ? 21.785  116.152 -15.664 1.00 17.66 ? 728  TRP B CA  1 
ATOM   4357 C  C   . TRP B 2 228 ? 21.784  116.441 -14.164 1.00 17.42 ? 728  TRP B C   1 
ATOM   4358 O  O   . TRP B 2 228 ? 22.796  116.854 -13.603 1.00 17.17 ? 728  TRP B O   1 
ATOM   4359 C  CB  . TRP B 2 228 ? 21.134  117.323 -16.406 1.00 17.80 ? 728  TRP B CB  1 
ATOM   4360 C  CG  . TRP B 2 228 ? 21.916  118.603 -16.256 1.00 17.88 ? 728  TRP B CG  1 
ATOM   4361 C  CD1 . TRP B 2 228 ? 23.002  118.991 -16.985 1.00 17.99 ? 728  TRP B CD1 1 
ATOM   4362 C  CD2 . TRP B 2 228 ? 21.709  119.622 -15.271 1.00 17.96 ? 728  TRP B CD2 1 
ATOM   4363 N  NE1 . TRP B 2 228 ? 23.486  120.190 -16.515 1.00 18.84 ? 728  TRP B NE1 1 
ATOM   4364 C  CE2 . TRP B 2 228 ? 22.710  120.598 -15.463 1.00 18.33 ? 728  TRP B CE2 1 
ATOM   4365 C  CE3 . TRP B 2 228 ? 20.774  119.804 -14.243 1.00 17.90 ? 728  TRP B CE3 1 
ATOM   4366 C  CZ2 . TRP B 2 228 ? 22.804  121.742 -14.664 1.00 18.42 ? 728  TRP B CZ2 1 
ATOM   4367 C  CZ3 . TRP B 2 228 ? 20.867  120.938 -13.449 1.00 17.73 ? 728  TRP B CZ3 1 
ATOM   4368 C  CH2 . TRP B 2 228 ? 21.876  121.893 -13.664 1.00 18.46 ? 728  TRP B CH2 1 
ATOM   4369 N  N   . ILE B 2 229 ? 20.645  116.214 -13.514 1.00 17.28 ? 729  ILE B N   1 
ATOM   4370 C  CA  . ILE B 2 229 ? 20.544  116.463 -12.082 1.00 16.80 ? 729  ILE B CA  1 
ATOM   4371 C  C   . ILE B 2 229 ? 21.497  115.554 -11.315 1.00 17.27 ? 729  ILE B C   1 
ATOM   4372 O  O   . ILE B 2 229 ? 22.197  116.002 -10.404 1.00 17.30 ? 729  ILE B O   1 
ATOM   4373 C  CB  . ILE B 2 229 ? 19.094  116.252 -11.582 1.00 17.07 ? 729  ILE B CB  1 
ATOM   4374 C  CG1 . ILE B 2 229 ? 18.186  117.332 -12.177 1.00 16.22 ? 729  ILE B CG1 1 
ATOM   4375 C  CG2 . ILE B 2 229 ? 19.046  116.302 -10.050 1.00 16.52 ? 729  ILE B CG2 1 
ATOM   4376 C  CD1 . ILE B 2 229 ? 16.707  117.124 -11.898 1.00 17.18 ? 729  ILE B CD1 1 
ATOM   4377 N  N   . ALA B 2 230 ? 21.532  114.279 -11.690 1.00 17.23 ? 730  ALA B N   1 
ATOM   4378 C  CA  . ALA B 2 230 ? 22.413  113.325 -11.029 1.00 17.57 ? 730  ALA B CA  1 
ATOM   4379 C  C   . ALA B 2 230 ? 23.868  113.784 -11.138 1.00 17.60 ? 730  ALA B C   1 
ATOM   4380 O  O   . ALA B 2 230 ? 24.658  113.584 -10.214 1.00 18.22 ? 730  ALA B O   1 
ATOM   4381 C  CB  . ALA B 2 230 ? 22.243  111.936 -11.646 1.00 17.40 ? 730  ALA B CB  1 
ATOM   4382 N  N   . ARG B 2 231 ? 24.222  114.405 -12.261 1.00 17.56 ? 731  ARG B N   1 
ATOM   4383 C  CA  . ARG B 2 231 ? 25.584  114.899 -12.449 1.00 17.43 ? 731  ARG B CA  1 
ATOM   4384 C  C   . ARG B 2 231 ? 25.899  116.022 -11.462 1.00 16.91 ? 731  ARG B C   1 
ATOM   4385 O  O   . ARG B 2 231 ? 27.070  116.327 -11.219 1.00 15.93 ? 731  ARG B O   1 
ATOM   4386 C  CB  . ARG B 2 231 ? 25.788  115.412 -13.879 1.00 19.05 ? 731  ARG B CB  1 
ATOM   4387 C  CG  . ARG B 2 231 ? 25.954  114.319 -14.940 1.00 21.57 ? 731  ARG B CG  1 
ATOM   4388 C  CD  . ARG B 2 231 ? 26.107  114.946 -16.322 1.00 23.71 ? 731  ARG B CD  1 
ATOM   4389 N  NE  . ARG B 2 231 ? 27.239  115.869 -16.364 1.00 25.68 ? 731  ARG B NE  1 
ATOM   4390 C  CZ  . ARG B 2 231 ? 27.325  116.915 -17.180 1.00 26.96 ? 731  ARG B CZ  1 
ATOM   4391 N  NH1 . ARG B 2 231 ? 26.341  117.181 -18.033 1.00 27.62 ? 731  ARG B NH1 1 
ATOM   4392 N  NH2 . ARG B 2 231 ? 28.391  117.703 -17.140 1.00 26.83 ? 731  ARG B NH2 1 
ATOM   4393 N  N   . CYS B 2 232 ? 24.857  116.637 -10.902 1.00 15.90 ? 732  CYS B N   1 
ATOM   4394 C  CA  . CYS B 2 232 ? 25.035  117.722 -9.936  1.00 15.67 ? 732  CYS B CA  1 
ATOM   4395 C  C   . CYS B 2 232 ? 25.310  117.207 -8.523  1.00 15.43 ? 732  CYS B C   1 
ATOM   4396 O  O   . CYS B 2 232 ? 25.777  117.964 -7.672  1.00 15.34 ? 732  CYS B O   1 
ATOM   4397 C  CB  . CYS B 2 232 ? 23.811  118.652 -9.920  1.00 15.72 ? 732  CYS B CB  1 
ATOM   4398 S  SG  . CYS B 2 232 ? 23.555  119.590 -11.464 1.00 15.98 ? 732  CYS B SG  1 
ATOM   4399 N  N   . GLN B 2 233 ? 25.008  115.937 -8.261  1.00 15.33 ? 733  GLN B N   1 
ATOM   4400 C  CA  . GLN B 2 233 ? 25.301  115.371 -6.944  1.00 15.77 ? 733  GLN B CA  1 
ATOM   4401 C  C   . GLN B 2 233 ? 26.820  115.257 -6.947  1.00 16.04 ? 733  GLN B C   1 
ATOM   4402 O  O   . GLN B 2 233 ? 27.402  114.848 -7.951  1.00 16.42 ? 733  GLN B O   1 
ATOM   4403 C  CB  . GLN B 2 233 ? 24.657  113.982 -6.774  1.00 15.45 ? 733  GLN B CB  1 
ATOM   4404 C  CG  . GLN B 2 233 ? 25.103  113.242 -5.506  1.00 15.16 ? 733  GLN B CG  1 
ATOM   4405 C  CD  . GLN B 2 233 ? 24.285  111.988 -5.221  1.00 15.54 ? 733  GLN B CD  1 
ATOM   4406 O  OE1 . GLN B 2 233 ? 24.029  111.180 -6.114  1.00 14.79 ? 733  GLN B OE1 1 
ATOM   4407 N  NE2 . GLN B 2 233 ? 23.881  111.819 -3.965  1.00 15.29 ? 733  GLN B NE2 1 
ATOM   4408 N  N   . ASN B 2 234 ? 27.474  115.634 -5.855  1.00 15.97 ? 734  ASN B N   1 
ATOM   4409 C  CA  . ASN B 2 234 ? 28.932  115.569 -5.833  1.00 16.22 ? 734  ASN B CA  1 
ATOM   4410 C  C   . ASN B 2 234 ? 29.495  114.613 -4.791  1.00 16.03 ? 734  ASN B C   1 
ATOM   4411 O  O   . ASN B 2 234 ? 28.753  113.846 -4.171  1.00 15.94 ? 734  ASN B O   1 
ATOM   4412 C  CB  . ASN B 2 234 ? 29.522  116.981 -5.650  1.00 15.47 ? 734  ASN B CB  1 
ATOM   4413 C  CG  . ASN B 2 234 ? 29.437  117.483 -4.217  1.00 16.47 ? 734  ASN B CG  1 
ATOM   4414 O  OD1 . ASN B 2 234 ? 28.730  116.914 -3.383  1.00 16.94 ? 734  ASN B OD1 1 
ATOM   4415 N  ND2 . ASN B 2 234 ? 30.159  118.565 -3.928  1.00 14.40 ? 734  ASN B ND2 1 
ATOM   4416 N  N   . TRP B 2 235 ? 30.814  114.666 -4.613  1.00 16.00 ? 735  TRP B N   1 
ATOM   4417 C  CA  . TRP B 2 235 ? 31.523  113.809 -3.669  1.00 16.11 ? 735  TRP B CA  1 
ATOM   4418 C  C   . TRP B 2 235 ? 30.992  113.882 -2.242  1.00 16.24 ? 735  TRP B C   1 
ATOM   4419 O  O   . TRP B 2 235 ? 31.203  112.962 -1.456  1.00 16.58 ? 735  TRP B O   1 
ATOM   4420 C  CB  . TRP B 2 235 ? 33.022  114.158 -3.656  1.00 16.29 ? 735  TRP B CB  1 
ATOM   4421 C  CG  . TRP B 2 235 ? 33.292  115.600 -3.328  1.00 16.44 ? 735  TRP B CG  1 
ATOM   4422 C  CD1 . TRP B 2 235 ? 33.272  116.654 -4.196  1.00 16.19 ? 735  TRP B CD1 1 
ATOM   4423 C  CD2 . TRP B 2 235 ? 33.570  116.153 -2.032  1.00 16.33 ? 735  TRP B CD2 1 
ATOM   4424 N  NE1 . TRP B 2 235 ? 33.519  117.829 -3.523  1.00 16.38 ? 735  TRP B NE1 1 
ATOM   4425 C  CE2 . TRP B 2 235 ? 33.705  117.551 -2.195  1.00 15.85 ? 735  TRP B CE2 1 
ATOM   4426 C  CE3 . TRP B 2 235 ? 33.718  115.604 -0.750  1.00 16.16 ? 735  TRP B CE3 1 
ATOM   4427 C  CZ2 . TRP B 2 235 ? 33.979  118.410 -1.124  1.00 16.55 ? 735  TRP B CZ2 1 
ATOM   4428 C  CZ3 . TRP B 2 235 ? 33.991  116.457 0.315   1.00 16.02 ? 735  TRP B CZ3 1 
ATOM   4429 C  CH2 . TRP B 2 235 ? 34.117  117.847 0.121   1.00 16.57 ? 735  TRP B CH2 1 
ATOM   4430 N  N   . GLU B 2 236 ? 30.315  114.976 -1.907  1.00 16.11 ? 736  GLU B N   1 
ATOM   4431 C  CA  . GLU B 2 236 ? 29.769  115.160 -0.560  1.00 15.74 ? 736  GLU B CA  1 
ATOM   4432 C  C   . GLU B 2 236 ? 28.481  114.373 -0.323  1.00 15.29 ? 736  GLU B C   1 
ATOM   4433 O  O   . GLU B 2 236 ? 28.134  114.068 0.822   1.00 15.11 ? 736  GLU B O   1 
ATOM   4434 C  CB  . GLU B 2 236 ? 29.474  116.639 -0.306  1.00 15.37 ? 736  GLU B CB  1 
ATOM   4435 C  CG  . GLU B 2 236 ? 30.680  117.557 -0.343  1.00 15.21 ? 736  GLU B CG  1 
ATOM   4436 C  CD  . GLU B 2 236 ? 30.282  119.015 -0.201  1.00 14.71 ? 736  GLU B CD  1 
ATOM   4437 O  OE1 . GLU B 2 236 ? 30.184  119.715 -1.233  1.00 15.10 ? 736  GLU B OE1 1 
ATOM   4438 O  OE2 . GLU B 2 236 ? 30.053  119.454 0.946   1.00 14.83 ? 736  GLU B OE2 1 
ATOM   4439 N  N   . GLY B 2 237 ? 27.772  114.065 -1.405  1.00 14.76 ? 737  GLY B N   1 
ATOM   4440 C  CA  . GLY B 2 237 ? 26.516  113.343 -1.295  1.00 14.37 ? 737  GLY B CA  1 
ATOM   4441 C  C   . GLY B 2 237 ? 25.351  114.269 -1.598  1.00 14.81 ? 737  GLY B C   1 
ATOM   4442 O  O   . GLY B 2 237 ? 24.287  113.830 -2.048  1.00 14.32 ? 737  GLY B O   1 
ATOM   4443 N  N   . GLY B 2 238 ? 25.558  115.559 -1.337  1.00 14.63 ? 738  GLY B N   1 
ATOM   4444 C  CA  . GLY B 2 238 ? 24.542  116.558 -1.609  1.00 14.54 ? 738  GLY B CA  1 
ATOM   4445 C  C   . GLY B 2 238 ? 24.603  116.947 -3.078  1.00 14.81 ? 738  GLY B C   1 
ATOM   4446 O  O   . GLY B 2 238 ? 25.377  116.364 -3.839  1.00 14.81 ? 738  GLY B O   1 
ATOM   4447 N  N   . ILE B 2 239 ? 23.809  117.942 -3.469  1.00 14.89 ? 739  ILE B N   1 
ATOM   4448 C  CA  . ILE B 2 239 ? 23.737  118.399 -4.861  1.00 14.41 ? 739  ILE B CA  1 
ATOM   4449 C  C   . ILE B 2 239 ? 24.151  119.865 -5.008  1.00 14.76 ? 739  ILE B C   1 
ATOM   4450 O  O   . ILE B 2 239 ? 23.770  120.710 -4.196  1.00 14.19 ? 739  ILE B O   1 
ATOM   4451 C  CB  . ILE B 2 239 ? 22.291  118.226 -5.402  1.00 14.63 ? 739  ILE B CB  1 
ATOM   4452 C  CG1 . ILE B 2 239 ? 21.883  116.750 -5.303  1.00 14.87 ? 739  ILE B CG1 1 
ATOM   4453 C  CG2 . ILE B 2 239 ? 22.189  118.730 -6.842  1.00 14.29 ? 739  ILE B CG2 1 
ATOM   4454 C  CD1 . ILE B 2 239 ? 20.431  116.464 -5.673  1.00 14.54 ? 739  ILE B CD1 1 
ATOM   4455 N  N   . GLY B 2 240 ? 24.937  120.158 -6.044  1.00 14.76 ? 740  GLY B N   1 
ATOM   4456 C  CA  . GLY B 2 240 ? 25.382  121.521 -6.280  1.00 14.73 ? 740  GLY B CA  1 
ATOM   4457 C  C   . GLY B 2 240 ? 24.566  122.198 -7.368  1.00 14.90 ? 740  GLY B C   1 
ATOM   4458 O  O   . GLY B 2 240 ? 23.780  121.544 -8.050  1.00 15.13 ? 740  GLY B O   1 
ATOM   4459 N  N   . GLY B 2 241 ? 24.758  123.505 -7.535  1.00 15.07 ? 741  GLY B N   1 
ATOM   4460 C  CA  . GLY B 2 241 ? 24.016  124.252 -8.540  1.00 14.87 ? 741  GLY B CA  1 
ATOM   4461 C  C   . GLY B 2 241 ? 24.161  123.706 -9.948  1.00 14.82 ? 741  GLY B C   1 
ATOM   4462 O  O   . GLY B 2 241 ? 23.205  123.706 -10.724 1.00 15.01 ? 741  GLY B O   1 
ATOM   4463 N  N   . VAL B 2 242 ? 25.369  123.257 -10.272 1.00 14.77 ? 742  VAL B N   1 
ATOM   4464 C  CA  . VAL B 2 242 ? 25.686  122.671 -11.572 1.00 15.30 ? 742  VAL B CA  1 
ATOM   4465 C  C   . VAL B 2 242 ? 26.746  121.606 -11.303 1.00 15.42 ? 742  VAL B C   1 
ATOM   4466 O  O   . VAL B 2 242 ? 27.322  121.567 -10.217 1.00 15.18 ? 742  VAL B O   1 
ATOM   4467 C  CB  . VAL B 2 242 ? 26.270  123.724 -12.562 1.00 15.61 ? 742  VAL B CB  1 
ATOM   4468 C  CG1 . VAL B 2 242 ? 25.235  124.808 -12.858 1.00 15.13 ? 742  VAL B CG1 1 
ATOM   4469 C  CG2 . VAL B 2 242 ? 27.533  124.336 -11.985 1.00 15.36 ? 742  VAL B CG2 1 
ATOM   4470 N  N   . PRO B 2 243 ? 27.011  120.722 -12.280 1.00 15.74 ? 743  PRO B N   1 
ATOM   4471 C  CA  . PRO B 2 243 ? 28.021  119.679 -12.077 1.00 15.83 ? 743  PRO B CA  1 
ATOM   4472 C  C   . PRO B 2 243 ? 29.364  120.262 -11.652 1.00 16.18 ? 743  PRO B C   1 
ATOM   4473 O  O   . PRO B 2 243 ? 29.847  121.227 -12.251 1.00 15.90 ? 743  PRO B O   1 
ATOM   4474 C  CB  . PRO B 2 243 ? 28.093  118.999 -13.443 1.00 15.78 ? 743  PRO B CB  1 
ATOM   4475 C  CG  . PRO B 2 243 ? 26.685  119.124 -13.934 1.00 15.63 ? 743  PRO B CG  1 
ATOM   4476 C  CD  . PRO B 2 243 ? 26.357  120.565 -13.592 1.00 15.77 ? 743  PRO B CD  1 
ATOM   4477 N  N   . GLY B 2 244 ? 29.951  119.671 -10.612 1.00 16.24 ? 744  GLY B N   1 
ATOM   4478 C  CA  . GLY B 2 244 ? 31.235  120.122 -10.103 1.00 16.40 ? 744  GLY B CA  1 
ATOM   4479 C  C   . GLY B 2 244 ? 31.155  121.008 -8.870  1.00 16.58 ? 744  GLY B C   1 
ATOM   4480 O  O   . GLY B 2 244 ? 32.089  121.059 -8.068  1.00 16.39 ? 744  GLY B O   1 
ATOM   4481 N  N   . MET B 2 245 ? 30.034  121.696 -8.694  1.00 16.63 ? 745  MET B N   1 
ATOM   4482 C  CA  . MET B 2 245 ? 29.897  122.602 -7.563  1.00 16.23 ? 745  MET B CA  1 
ATOM   4483 C  C   . MET B 2 245 ? 29.539  121.999 -6.211  1.00 15.73 ? 745  MET B C   1 
ATOM   4484 O  O   . MET B 2 245 ? 28.992  120.898 -6.112  1.00 15.18 ? 745  MET B O   1 
ATOM   4485 C  CB  . MET B 2 245 ? 28.915  123.721 -7.909  1.00 17.01 ? 745  MET B CB  1 
ATOM   4486 C  CG  . MET B 2 245 ? 29.588  124.908 -8.597  1.00 18.27 ? 745  MET B CG  1 
ATOM   4487 S  SD  . MET B 2 245 ? 30.954  125.556 -7.598  1.00 20.50 ? 745  MET B SD  1 
ATOM   4488 C  CE  . MET B 2 245 ? 30.051  126.456 -6.329  1.00 19.75 ? 745  MET B CE  1 
ATOM   4489 N  N   . GLU B 2 246 ? 29.877  122.757 -5.174  1.00 15.30 ? 746  GLU B N   1 
ATOM   4490 C  CA  . GLU B 2 246 ? 29.658  122.391 -3.780  1.00 15.16 ? 746  GLU B CA  1 
ATOM   4491 C  C   . GLU B 2 246 ? 28.201  122.079 -3.464  1.00 15.12 ? 746  GLU B C   1 
ATOM   4492 O  O   . GLU B 2 246 ? 27.289  122.747 -3.948  1.00 14.94 ? 746  GLU B O   1 
ATOM   4493 C  CB  . GLU B 2 246 ? 30.160  123.533 -2.885  1.00 15.05 ? 746  GLU B CB  1 
ATOM   4494 C  CG  . GLU B 2 246 ? 29.885  123.384 -1.391  1.00 15.05 ? 746  GLU B CG  1 
ATOM   4495 C  CD  . GLU B 2 246 ? 30.450  124.544 -0.588  1.00 14.97 ? 746  GLU B CD  1 
ATOM   4496 O  OE1 . GLU B 2 246 ? 30.558  125.654 -1.148  1.00 14.94 ? 746  GLU B OE1 1 
ATOM   4497 O  OE2 . GLU B 2 246 ? 30.774  124.360 0.606   1.00 15.33 ? 746  GLU B OE2 1 
ATOM   4498 N  N   . ALA B 2 247 ? 27.996  121.054 -2.645  1.00 15.11 ? 747  ALA B N   1 
ATOM   4499 C  CA  . ALA B 2 247 ? 26.661  120.643 -2.243  1.00 15.01 ? 747  ALA B CA  1 
ATOM   4500 C  C   . ALA B 2 247 ? 26.013  121.715 -1.378  1.00 14.82 ? 747  ALA B C   1 
ATOM   4501 O  O   . ALA B 2 247 ? 26.620  122.205 -0.427  1.00 15.39 ? 747  ALA B O   1 
ATOM   4502 C  CB  . ALA B 2 247 ? 26.733  119.333 -1.469  1.00 14.34 ? 747  ALA B CB  1 
ATOM   4503 N  N   . HIS B 2 248 ? 24.776  122.073 -1.707  1.00 14.99 ? 748  HIS B N   1 
ATOM   4504 C  CA  . HIS B 2 248 ? 24.050  123.073 -0.935  1.00 14.59 ? 748  HIS B CA  1 
ATOM   4505 C  C   . HIS B 2 248 ? 22.605  122.625 -0.740  1.00 14.18 ? 748  HIS B C   1 
ATOM   4506 O  O   . HIS B 2 248 ? 21.983  122.098 -1.660  1.00 13.72 ? 748  HIS B O   1 
ATOM   4507 C  CB  . HIS B 2 248 ? 24.088  124.432 -1.642  1.00 14.59 ? 748  HIS B CB  1 
ATOM   4508 C  CG  . HIS B 2 248 ? 23.721  125.578 -0.751  1.00 14.92 ? 748  HIS B CG  1 
ATOM   4509 N  ND1 . HIS B 2 248 ? 22.435  125.792 -0.303  1.00 14.65 ? 748  HIS B ND1 1 
ATOM   4510 C  CD2 . HIS B 2 248 ? 24.484  126.540 -0.178  1.00 14.81 ? 748  HIS B CD2 1 
ATOM   4511 C  CE1 . HIS B 2 248 ? 22.422  126.834 0.510   1.00 14.84 ? 748  HIS B CE1 1 
ATOM   4512 N  NE2 . HIS B 2 248 ? 23.653  127.305 0.603   1.00 15.18 ? 748  HIS B NE2 1 
ATOM   4513 N  N   . GLY B 2 249 ? 22.080  122.831 0.466   1.00 13.97 ? 749  GLY B N   1 
ATOM   4514 C  CA  . GLY B 2 249 ? 20.713  122.431 0.764   1.00 14.19 ? 749  GLY B CA  1 
ATOM   4515 C  C   . GLY B 2 249 ? 19.694  122.954 -0.228  1.00 14.60 ? 749  GLY B C   1 
ATOM   4516 O  O   . GLY B 2 249 ? 18.740  122.258 -0.588  1.00 14.69 ? 749  GLY B O   1 
ATOM   4517 N  N   . GLY B 2 250 ? 19.890  124.189 -0.673  1.00 14.66 ? 750  GLY B N   1 
ATOM   4518 C  CA  . GLY B 2 250 ? 18.965  124.770 -1.625  1.00 14.54 ? 750  GLY B CA  1 
ATOM   4519 C  C   . GLY B 2 250 ? 18.908  124.016 -2.941  1.00 14.75 ? 750  GLY B C   1 
ATOM   4520 O  O   . GLY B 2 250 ? 17.830  123.675 -3.421  1.00 14.44 ? 750  GLY B O   1 
ATOM   4521 N  N   . TYR B 2 251 ? 20.072  123.754 -3.524  1.00 14.35 ? 751  TYR B N   1 
ATOM   4522 C  CA  . TYR B 2 251 ? 20.146  123.035 -4.789  1.00 14.58 ? 751  TYR B CA  1 
ATOM   4523 C  C   . TYR B 2 251 ? 19.832  121.553 -4.608  1.00 14.21 ? 751  TYR B C   1 
ATOM   4524 O  O   . TYR B 2 251 ? 19.344  120.902 -5.529  1.00 14.61 ? 751  TYR B O   1 
ATOM   4525 C  CB  . TYR B 2 251 ? 21.538  123.210 -5.402  1.00 14.97 ? 751  TYR B CB  1 
ATOM   4526 C  CG  . TYR B 2 251 ? 21.816  124.631 -5.837  1.00 14.60 ? 751  TYR B CG  1 
ATOM   4527 C  CD1 . TYR B 2 251 ? 23.007  125.268 -5.494  1.00 14.38 ? 751  TYR B CD1 1 
ATOM   4528 C  CD2 . TYR B 2 251 ? 20.896  125.332 -6.621  1.00 15.50 ? 751  TYR B CD2 1 
ATOM   4529 C  CE1 . TYR B 2 251 ? 23.277  126.569 -5.926  1.00 14.51 ? 751  TYR B CE1 1 
ATOM   4530 C  CE2 . TYR B 2 251 ? 21.155  126.630 -7.055  1.00 14.98 ? 751  TYR B CE2 1 
ATOM   4531 C  CZ  . TYR B 2 251 ? 22.347  127.239 -6.706  1.00 15.25 ? 751  TYR B CZ  1 
ATOM   4532 O  OH  . TYR B 2 251 ? 22.603  128.520 -7.144  1.00 15.78 ? 751  TYR B OH  1 
ATOM   4533 N  N   . THR B 2 252 ? 20.103  121.024 -3.417  1.00 13.45 ? 752  THR B N   1 
ATOM   4534 C  CA  . THR B 2 252 ? 19.823  119.619 -3.135  1.00 13.11 ? 752  THR B CA  1 
ATOM   4535 C  C   . THR B 2 252 ? 18.310  119.405 -3.054  1.00 13.19 ? 752  THR B C   1 
ATOM   4536 O  O   . THR B 2 252 ? 17.787  118.409 -3.559  1.00 12.79 ? 752  THR B O   1 
ATOM   4537 C  CB  . THR B 2 252 ? 20.500  119.168 -1.822  1.00 12.49 ? 752  THR B CB  1 
ATOM   4538 O  OG1 . THR B 2 252 ? 21.914  119.384 -1.932  1.00 12.82 ? 752  THR B OG1 1 
ATOM   4539 C  CG2 . THR B 2 252 ? 20.247  117.680 -1.562  1.00 12.14 ? 752  THR B CG2 1 
ATOM   4540 N  N   . PHE B 2 253 ? 17.605  120.338 -2.419  1.00 13.00 ? 753  PHE B N   1 
ATOM   4541 C  CA  . PHE B 2 253 ? 16.155  120.227 -2.352  1.00 13.24 ? 753  PHE B CA  1 
ATOM   4542 C  C   . PHE B 2 253 ? 15.619  120.282 -3.784  1.00 13.04 ? 753  PHE B C   1 
ATOM   4543 O  O   . PHE B 2 253 ? 14.816  119.446 -4.191  1.00 13.22 ? 753  PHE B O   1 
ATOM   4544 C  CB  . PHE B 2 253 ? 15.517  121.375 -1.564  1.00 12.82 ? 753  PHE B CB  1 
ATOM   4545 C  CG  . PHE B 2 253 ? 14.013  121.355 -1.620  1.00 13.46 ? 753  PHE B CG  1 
ATOM   4546 C  CD1 . PHE B 2 253 ? 13.289  120.486 -0.806  1.00 13.51 ? 753  PHE B CD1 1 
ATOM   4547 C  CD2 . PHE B 2 253 ? 13.330  122.093 -2.585  1.00 13.30 ? 753  PHE B CD2 1 
ATOM   4548 C  CE1 . PHE B 2 253 ? 11.910  120.341 -0.960  1.00 12.55 ? 753  PHE B CE1 1 
ATOM   4549 C  CE2 . PHE B 2 253 ? 11.947  121.956 -2.748  1.00 13.45 ? 753  PHE B CE2 1 
ATOM   4550 C  CZ  . PHE B 2 253 ? 11.239  121.076 -1.936  1.00 13.08 ? 753  PHE B CZ  1 
ATOM   4551 N  N   . CYS B 2 254 ? 16.057  121.279 -4.545  1.00 12.86 ? 754  CYS B N   1 
ATOM   4552 C  CA  . CYS B 2 254 ? 15.601  121.414 -5.928  1.00 13.66 ? 754  CYS B CA  1 
ATOM   4553 C  C   . CYS B 2 254 ? 15.846  120.146 -6.738  1.00 13.87 ? 754  CYS B C   1 
ATOM   4554 O  O   . CYS B 2 254 ? 14.958  119.677 -7.455  1.00 14.31 ? 754  CYS B O   1 
ATOM   4555 C  CB  . CYS B 2 254 ? 16.299  122.589 -6.621  1.00 13.60 ? 754  CYS B CB  1 
ATOM   4556 S  SG  . CYS B 2 254 ? 15.696  124.224 -6.129  1.00 15.30 ? 754  CYS B SG  1 
ATOM   4557 N  N   . GLY B 2 255 ? 17.053  119.600 -6.627  1.00 13.57 ? 755  GLY B N   1 
ATOM   4558 C  CA  . GLY B 2 255 ? 17.392  118.401 -7.373  1.00 13.14 ? 755  GLY B CA  1 
ATOM   4559 C  C   . GLY B 2 255 ? 16.568  117.177 -7.016  1.00 13.14 ? 755  GLY B C   1 
ATOM   4560 O  O   . GLY B 2 255 ? 16.015  116.522 -7.896  1.00 12.96 ? 755  GLY B O   1 
ATOM   4561 N  N   . LEU B 2 256 ? 16.471  116.861 -5.729  1.00 12.62 ? 756  LEU B N   1 
ATOM   4562 C  CA  . LEU B 2 256 ? 15.712  115.683 -5.324  1.00 12.87 ? 756  LEU B CA  1 
ATOM   4563 C  C   . LEU B 2 256 ? 14.213  115.851 -5.549  1.00 12.63 ? 756  LEU B C   1 
ATOM   4564 O  O   . LEU B 2 256 ? 13.546  114.921 -5.989  1.00 13.21 ? 756  LEU B O   1 
ATOM   4565 C  CB  . LEU B 2 256 ? 15.989  115.334 -3.855  1.00 12.25 ? 756  LEU B CB  1 
ATOM   4566 C  CG  . LEU B 2 256 ? 15.246  114.099 -3.321  1.00 13.49 ? 756  LEU B CG  1 
ATOM   4567 C  CD1 . LEU B 2 256 ? 15.573  112.879 -4.184  1.00 13.57 ? 756  LEU B CD1 1 
ATOM   4568 C  CD2 . LEU B 2 256 ? 15.646  113.842 -1.871  1.00 12.97 ? 756  LEU B CD2 1 
ATOM   4569 N  N   . ALA B 2 257 ? 13.680  117.032 -5.257  1.00 12.83 ? 757  ALA B N   1 
ATOM   4570 C  CA  . ALA B 2 257 ? 12.254  117.264 -5.448  1.00 13.56 ? 757  ALA B CA  1 
ATOM   4571 C  C   . ALA B 2 257 ? 11.906  117.120 -6.933  1.00 13.98 ? 757  ALA B C   1 
ATOM   4572 O  O   . ALA B 2 257 ? 10.868  116.568 -7.284  1.00 13.95 ? 757  ALA B O   1 
ATOM   4573 C  CB  . ALA B 2 257 ? 11.867  118.659 -4.936  1.00 13.54 ? 757  ALA B CB  1 
ATOM   4574 N  N   . ALA B 2 258 ? 12.781  117.612 -7.804  1.00 14.57 ? 758  ALA B N   1 
ATOM   4575 C  CA  . ALA B 2 258 ? 12.543  117.505 -9.239  1.00 14.75 ? 758  ALA B CA  1 
ATOM   4576 C  C   . ALA B 2 258 ? 12.555  116.030 -9.656  1.00 15.42 ? 758  ALA B C   1 
ATOM   4577 O  O   . ALA B 2 258 ? 11.696  115.583 -10.416 1.00 15.44 ? 758  ALA B O   1 
ATOM   4578 C  CB  . ALA B 2 258 ? 13.606  118.287 -10.008 1.00 13.71 ? 758  ALA B CB  1 
ATOM   4579 N  N   . LEU B 2 259 ? 13.524  115.274 -9.148  1.00 15.86 ? 759  LEU B N   1 
ATOM   4580 C  CA  . LEU B 2 259 ? 13.620  113.856 -9.487  1.00 16.72 ? 759  LEU B CA  1 
ATOM   4581 C  C   . LEU B 2 259 ? 12.421  113.072 -8.978  1.00 17.02 ? 759  LEU B C   1 
ATOM   4582 O  O   . LEU B 2 259 ? 11.973  112.127 -9.629  1.00 17.42 ? 759  LEU B O   1 
ATOM   4583 C  CB  . LEU B 2 259 ? 14.918  113.252 -8.937  1.00 16.49 ? 759  LEU B CB  1 
ATOM   4584 C  CG  . LEU B 2 259 ? 16.179  113.691 -9.688  1.00 17.28 ? 759  LEU B CG  1 
ATOM   4585 C  CD1 . LEU B 2 259 ? 17.419  113.133 -8.998  1.00 17.42 ? 759  LEU B CD1 1 
ATOM   4586 C  CD2 . LEU B 2 259 ? 16.106  113.207 -11.131 1.00 16.91 ? 759  LEU B CD2 1 
ATOM   4587 N  N   . VAL B 2 260 ? 11.900  113.456 -7.816  1.00 17.15 ? 760  VAL B N   1 
ATOM   4588 C  CA  . VAL B 2 260 ? 10.732  112.775 -7.264  1.00 17.44 ? 760  VAL B CA  1 
ATOM   4589 C  C   . VAL B 2 260 ? 9.556   112.984 -8.210  1.00 17.63 ? 760  VAL B C   1 
ATOM   4590 O  O   . VAL B 2 260 ? 8.795   112.057 -8.481  1.00 17.90 ? 760  VAL B O   1 
ATOM   4591 C  CB  . VAL B 2 260 ? 10.367  113.312 -5.862  1.00 17.53 ? 760  VAL B CB  1 
ATOM   4592 C  CG1 . VAL B 2 260 ? 8.997   112.771 -5.426  1.00 17.15 ? 760  VAL B CG1 1 
ATOM   4593 C  CG2 . VAL B 2 260 ? 11.441  112.894 -4.857  1.00 17.19 ? 760  VAL B CG2 1 
ATOM   4594 N  N   . ILE B 2 261 ? 9.416   114.206 -8.716  1.00 17.74 ? 761  ILE B N   1 
ATOM   4595 C  CA  . ILE B 2 261 ? 8.337   114.522 -9.649  1.00 17.99 ? 761  ILE B CA  1 
ATOM   4596 C  C   . ILE B 2 261 ? 8.489   113.677 -10.913 1.00 18.46 ? 761  ILE B C   1 
ATOM   4597 O  O   . ILE B 2 261 ? 7.509   113.164 -11.447 1.00 17.80 ? 761  ILE B O   1 
ATOM   4598 C  CB  . ILE B 2 261 ? 8.356   116.024 -10.050 1.00 17.94 ? 761  ILE B CB  1 
ATOM   4599 C  CG1 . ILE B 2 261 ? 7.982   116.889 -8.844  1.00 17.13 ? 761  ILE B CG1 1 
ATOM   4600 C  CG2 . ILE B 2 261 ? 7.397   116.273 -11.210 1.00 17.45 ? 761  ILE B CG2 1 
ATOM   4601 C  CD1 . ILE B 2 261 ? 8.148   118.377 -9.072  1.00 16.82 ? 761  ILE B CD1 1 
ATOM   4602 N  N   . LEU B 2 262 ? 9.727   113.531 -11.378 1.00 18.74 ? 762  LEU B N   1 
ATOM   4603 C  CA  . LEU B 2 262 ? 10.015  112.755 -12.582 1.00 19.69 ? 762  LEU B CA  1 
ATOM   4604 C  C   . LEU B 2 262 ? 10.087  111.249 -12.309 1.00 20.30 ? 762  LEU B C   1 
ATOM   4605 O  O   . LEU B 2 262 ? 10.256  110.453 -13.235 1.00 19.95 ? 762  LEU B O   1 
ATOM   4606 C  CB  . LEU B 2 262 ? 11.339  113.220 -13.195 1.00 19.62 ? 762  LEU B CB  1 
ATOM   4607 C  CG  . LEU B 2 262 ? 11.446  114.701 -13.571 1.00 20.04 ? 762  LEU B CG  1 
ATOM   4608 C  CD1 . LEU B 2 262 ? 12.840  114.992 -14.123 1.00 20.33 ? 762  LEU B CD1 1 
ATOM   4609 C  CD2 . LEU B 2 262 ? 10.389  115.048 -14.601 1.00 20.05 ? 762  LEU B CD2 1 
ATOM   4610 N  N   . LYS B 2 263 ? 9.956   110.865 -11.042 1.00 20.54 ? 763  LYS B N   1 
ATOM   4611 C  CA  . LYS B 2 263 ? 10.021  109.462 -10.651 1.00 22.08 ? 763  LYS B CA  1 
ATOM   4612 C  C   . LYS B 2 263 ? 11.372  108.856 -11.030 1.00 22.06 ? 763  LYS B C   1 
ATOM   4613 O  O   . LYS B 2 263 ? 11.449  107.709 -11.474 1.00 21.91 ? 763  LYS B O   1 
ATOM   4614 C  CB  . LYS B 2 263 ? 8.890   108.667 -11.314 1.00 24.03 ? 763  LYS B CB  1 
ATOM   4615 C  CG  . LYS B 2 263 ? 7.490   109.115 -10.898 1.00 26.34 ? 763  LYS B CG  1 
ATOM   4616 C  CD  . LYS B 2 263 ? 6.414   108.179 -11.443 1.00 29.11 ? 763  LYS B CD  1 
ATOM   4617 C  CE  . LYS B 2 263 ? 6.302   108.258 -12.964 1.00 31.00 ? 763  LYS B CE  1 
ATOM   4618 N  NZ  . LYS B 2 263 ? 5.731   109.563 -13.430 1.00 33.00 ? 763  LYS B NZ  1 
ATOM   4619 N  N   . ARG B 2 264 ? 12.434  109.634 -10.849 1.00 21.74 ? 764  ARG B N   1 
ATOM   4620 C  CA  . ARG B 2 264 ? 13.780  109.177 -11.175 1.00 22.26 ? 764  ARG B CA  1 
ATOM   4621 C  C   . ARG B 2 264 ? 14.752  109.344 -9.995  1.00 22.35 ? 764  ARG B C   1 
ATOM   4622 O  O   . ARG B 2 264 ? 15.954  109.498 -10.202 1.00 21.39 ? 764  ARG B O   1 
ATOM   4623 C  CB  . ARG B 2 264 ? 14.314  109.947 -12.392 1.00 22.79 ? 764  ARG B CB  1 
ATOM   4624 C  CG  . ARG B 2 264 ? 13.567  109.699 -13.711 1.00 23.90 ? 764  ARG B CG  1 
ATOM   4625 C  CD  . ARG B 2 264 ? 13.794  108.277 -14.219 1.00 25.35 ? 764  ARG B CD  1 
ATOM   4626 N  NE  . ARG B 2 264 ? 15.219  107.979 -14.359 1.00 27.21 ? 764  ARG B NE  1 
ATOM   4627 C  CZ  . ARG B 2 264 ? 15.969  108.315 -15.407 1.00 27.98 ? 764  ARG B CZ  1 
ATOM   4628 N  NH1 . ARG B 2 264 ? 15.440  108.962 -16.439 1.00 27.71 ? 764  ARG B NH1 1 
ATOM   4629 N  NH2 . ARG B 2 264 ? 17.262  108.014 -15.414 1.00 29.04 ? 764  ARG B NH2 1 
ATOM   4630 N  N   . GLU B 2 265 ? 14.236  109.305 -8.767  1.00 23.01 ? 765  GLU B N   1 
ATOM   4631 C  CA  . GLU B 2 265 ? 15.081  109.459 -7.578  1.00 24.69 ? 765  GLU B CA  1 
ATOM   4632 C  C   . GLU B 2 265 ? 16.258  108.493 -7.562  1.00 24.91 ? 765  GLU B C   1 
ATOM   4633 O  O   . GLU B 2 265 ? 17.347  108.833 -7.089  1.00 24.75 ? 765  GLU B O   1 
ATOM   4634 C  CB  . GLU B 2 265 ? 14.287  109.229 -6.286  1.00 25.66 ? 765  GLU B CB  1 
ATOM   4635 C  CG  . GLU B 2 265 ? 12.984  109.972 -6.179  1.00 28.04 ? 765  GLU B CG  1 
ATOM   4636 C  CD  . GLU B 2 265 ? 11.824  109.169 -6.721  1.00 28.72 ? 765  GLU B CD  1 
ATOM   4637 O  OE1 . GLU B 2 265 ? 11.755  108.966 -7.950  1.00 29.26 ? 765  GLU B OE1 1 
ATOM   4638 O  OE2 . GLU B 2 265 ? 10.982  108.734 -5.907  1.00 31.07 ? 765  GLU B OE2 1 
ATOM   4639 N  N   . ARG B 2 266 ? 16.029  107.282 -8.057  1.00 25.35 ? 766  ARG B N   1 
ATOM   4640 C  CA  . ARG B 2 266 ? 17.069  106.261 -8.087  1.00 26.43 ? 766  ARG B CA  1 
ATOM   4641 C  C   . ARG B 2 266 ? 18.291  106.636 -8.909  1.00 25.68 ? 766  ARG B C   1 
ATOM   4642 O  O   . ARG B 2 266 ? 19.302  105.934 -8.876  1.00 25.88 ? 766  ARG B O   1 
ATOM   4643 C  CB  . ARG B 2 266 ? 16.512  104.938 -8.612  1.00 28.77 ? 766  ARG B CB  1 
ATOM   4644 C  CG  . ARG B 2 266 ? 15.724  104.138 -7.599  1.00 32.21 ? 766  ARG B CG  1 
ATOM   4645 C  CD  . ARG B 2 266 ? 15.713  102.674 -8.022  1.00 35.59 ? 766  ARG B CD  1 
ATOM   4646 N  NE  . ARG B 2 266 ? 14.974  101.816 -7.104  1.00 38.31 ? 766  ARG B NE  1 
ATOM   4647 C  CZ  . ARG B 2 266 ? 14.965  100.487 -7.174  1.00 39.68 ? 766  ARG B CZ  1 
ATOM   4648 N  NH1 . ARG B 2 266 ? 15.663  99.867  -8.120  1.00 40.70 ? 766  ARG B NH1 1 
ATOM   4649 N  NH2 . ARG B 2 266 ? 14.254  99.779  -6.305  1.00 40.18 ? 766  ARG B NH2 1 
ATOM   4650 N  N   . SER B 2 267 ? 18.206  107.725 -9.658  1.00 24.69 ? 767  SER B N   1 
ATOM   4651 C  CA  . SER B 2 267 ? 19.348  108.154 -10.457 1.00 24.40 ? 767  SER B CA  1 
ATOM   4652 C  C   . SER B 2 267 ? 20.447  108.681 -9.543  1.00 23.24 ? 767  SER B C   1 
ATOM   4653 O  O   . SER B 2 267 ? 21.594  108.823 -9.957  1.00 23.48 ? 767  SER B O   1 
ATOM   4654 C  CB  . SER B 2 267 ? 18.935  109.248 -11.441 1.00 24.63 ? 767  SER B CB  1 
ATOM   4655 O  OG  . SER B 2 267 ? 18.034  108.732 -12.400 1.00 26.36 ? 767  SER B OG  1 
ATOM   4656 N  N   . LEU B 2 268 ? 20.087  108.970 -8.299  1.00 22.07 ? 768  LEU B N   1 
ATOM   4657 C  CA  . LEU B 2 268 ? 21.042  109.487 -7.322  1.00 21.43 ? 768  LEU B CA  1 
ATOM   4658 C  C   . LEU B 2 268 ? 21.526  108.395 -6.380  1.00 21.18 ? 768  LEU B C   1 
ATOM   4659 O  O   . LEU B 2 268 ? 20.925  107.322 -6.292  1.00 20.97 ? 768  LEU B O   1 
ATOM   4660 C  CB  . LEU B 2 268 ? 20.393  110.571 -6.456  1.00 21.40 ? 768  LEU B CB  1 
ATOM   4661 C  CG  . LEU B 2 268 ? 19.844  111.854 -7.073  1.00 21.44 ? 768  LEU B CG  1 
ATOM   4662 C  CD1 . LEU B 2 268 ? 19.104  112.645 -6.007  1.00 21.76 ? 768  LEU B CD1 1 
ATOM   4663 C  CD2 . LEU B 2 268 ? 20.976  112.674 -7.650  1.00 21.79 ? 768  LEU B CD2 1 
ATOM   4664 N  N   . ASN B 2 269 ? 22.617  108.683 -5.677  1.00 20.15 ? 769  ASN B N   1 
ATOM   4665 C  CA  . ASN B 2 269 ? 23.140  107.773 -4.672  1.00 19.58 ? 769  ASN B CA  1 
ATOM   4666 C  C   . ASN B 2 269 ? 22.396  108.282 -3.436  1.00 19.43 ? 769  ASN B C   1 
ATOM   4667 O  O   . ASN B 2 269 ? 22.812  109.259 -2.809  1.00 18.47 ? 769  ASN B O   1 
ATOM   4668 C  CB  . ASN B 2 269 ? 24.649  107.965 -4.495  1.00 19.57 ? 769  ASN B CB  1 
ATOM   4669 C  CG  . ASN B 2 269 ? 25.218  107.116 -3.367  1.00 20.33 ? 769  ASN B CG  1 
ATOM   4670 O  OD1 . ASN B 2 269 ? 24.500  106.737 -2.438  1.00 18.89 ? 769  ASN B OD1 1 
ATOM   4671 N  ND2 . ASN B 2 269 ? 26.519  106.833 -3.432  1.00 20.20 ? 769  ASN B ND2 1 
ATOM   4672 N  N   . LEU B 2 270 ? 21.277  107.644 -3.111  1.00 19.16 ? 770  LEU B N   1 
ATOM   4673 C  CA  . LEU B 2 270 ? 20.469  108.072 -1.972  1.00 20.34 ? 770  LEU B CA  1 
ATOM   4674 C  C   . LEU B 2 270 ? 21.159  107.902 -0.627  1.00 20.43 ? 770  LEU B C   1 
ATOM   4675 O  O   . LEU B 2 270 ? 20.837  108.606 0.329   1.00 20.66 ? 770  LEU B O   1 
ATOM   4676 C  CB  . LEU B 2 270 ? 19.130  107.328 -1.968  1.00 20.29 ? 770  LEU B CB  1 
ATOM   4677 C  CG  . LEU B 2 270 ? 18.251  107.567 -3.202  1.00 20.70 ? 770  LEU B CG  1 
ATOM   4678 C  CD1 . LEU B 2 270 ? 16.971  106.744 -3.085  1.00 21.15 ? 770  LEU B CD1 1 
ATOM   4679 C  CD2 . LEU B 2 270 ? 17.929  109.049 -3.334  1.00 19.59 ? 770  LEU B CD2 1 
ATOM   4680 N  N   . LYS B 2 271 ? 22.105  106.970 -0.556  1.00 20.58 ? 771  LYS B N   1 
ATOM   4681 C  CA  . LYS B 2 271 ? 22.834  106.721 0.678   1.00 20.84 ? 771  LYS B CA  1 
ATOM   4682 C  C   . LYS B 2 271 ? 23.737  107.898 1.034   1.00 19.74 ? 771  LYS B C   1 
ATOM   4683 O  O   . LYS B 2 271 ? 23.721  108.383 2.167   1.00 19.07 ? 771  LYS B O   1 
ATOM   4684 C  CB  . LYS B 2 271 ? 23.691  105.456 0.548   1.00 23.08 ? 771  LYS B CB  1 
ATOM   4685 C  CG  . LYS B 2 271 ? 24.519  105.151 1.794   1.00 25.99 ? 771  LYS B CG  1 
ATOM   4686 C  CD  . LYS B 2 271 ? 25.543  104.051 1.542   1.00 28.43 ? 771  LYS B CD  1 
ATOM   4687 C  CE  . LYS B 2 271 ? 26.578  104.483 0.506   1.00 30.13 ? 771  LYS B CE  1 
ATOM   4688 N  NZ  . LYS B 2 271 ? 27.569  103.404 0.194   1.00 30.43 ? 771  LYS B NZ  1 
ATOM   4689 N  N   . SER B 2 272 ? 24.532  108.353 0.071   1.00 18.18 ? 772  SER B N   1 
ATOM   4690 C  CA  . SER B 2 272 ? 25.434  109.467 0.326   1.00 17.49 ? 772  SER B CA  1 
ATOM   4691 C  C   . SER B 2 272 ? 24.652  110.759 0.526   1.00 17.13 ? 772  SER B C   1 
ATOM   4692 O  O   . SER B 2 272 ? 25.086  111.641 1.269   1.00 17.06 ? 772  SER B O   1 
ATOM   4693 C  CB  . SER B 2 272 ? 26.441  109.628 -0.818  1.00 17.16 ? 772  SER B CB  1 
ATOM   4694 O  OG  . SER B 2 272 ? 25.799  109.887 -2.051  1.00 17.69 ? 772  SER B OG  1 
ATOM   4695 N  N   . LEU B 2 273 ? 23.494  110.865 -0.122  1.00 16.39 ? 773  LEU B N   1 
ATOM   4696 C  CA  . LEU B 2 273 ? 22.667  112.062 0.016   1.00 16.57 ? 773  LEU B CA  1 
ATOM   4697 C  C   . LEU B 2 273 ? 22.080  112.103 1.425   1.00 16.08 ? 773  LEU B C   1 
ATOM   4698 O  O   . LEU B 2 273 ? 22.075  113.148 2.072   1.00 16.44 ? 773  LEU B O   1 
ATOM   4699 C  CB  . LEU B 2 273 ? 21.534  112.063 -1.018  1.00 16.74 ? 773  LEU B CB  1 
ATOM   4700 C  CG  . LEU B 2 273 ? 20.921  113.438 -1.339  1.00 18.66 ? 773  LEU B CG  1 
ATOM   4701 C  CD1 . LEU B 2 273 ? 20.012  113.328 -2.563  1.00 19.20 ? 773  LEU B CD1 1 
ATOM   4702 C  CD2 . LEU B 2 273 ? 20.146  113.967 -0.156  1.00 19.30 ? 773  LEU B CD2 1 
ATOM   4703 N  N   . LEU B 2 274 ? 21.584  110.961 1.892   1.00 15.80 ? 774  LEU B N   1 
ATOM   4704 C  CA  . LEU B 2 274 ? 20.994  110.869 3.227   1.00 16.02 ? 774  LEU B CA  1 
ATOM   4705 C  C   . LEU B 2 274 ? 22.020  111.210 4.306   1.00 16.23 ? 774  LEU B C   1 
ATOM   4706 O  O   . LEU B 2 274 ? 21.743  111.987 5.221   1.00 16.39 ? 774  LEU B O   1 
ATOM   4707 C  CB  . LEU B 2 274 ? 20.443  109.460 3.474   1.00 15.10 ? 774  LEU B CB  1 
ATOM   4708 C  CG  . LEU B 2 274 ? 19.868  109.165 4.868   1.00 16.07 ? 774  LEU B CG  1 
ATOM   4709 C  CD1 . LEU B 2 274 ? 18.635  110.041 5.138   1.00 14.22 ? 774  LEU B CD1 1 
ATOM   4710 C  CD2 . LEU B 2 274 ? 19.497  107.691 4.955   1.00 15.23 ? 774  LEU B CD2 1 
ATOM   4711 N  N   . GLN B 2 275 ? 23.211  110.632 4.199   1.00 16.55 ? 775  GLN B N   1 
ATOM   4712 C  CA  . GLN B 2 275 ? 24.238  110.898 5.191   1.00 16.96 ? 775  GLN B CA  1 
ATOM   4713 C  C   . GLN B 2 275 ? 24.650  112.373 5.156   1.00 16.33 ? 775  GLN B C   1 
ATOM   4714 O  O   . GLN B 2 275 ? 24.904  112.972 6.196   1.00 15.70 ? 775  GLN B O   1 
ATOM   4715 C  CB  . GLN B 2 275 ? 25.450  109.986 4.971   1.00 18.20 ? 775  GLN B CB  1 
ATOM   4716 C  CG  . GLN B 2 275 ? 26.475  110.070 6.101   1.00 20.77 ? 775  GLN B CG  1 
ATOM   4717 C  CD  . GLN B 2 275 ? 27.301  108.805 6.249   1.00 22.40 ? 775  GLN B CD  1 
ATOM   4718 O  OE1 . GLN B 2 275 ? 27.670  108.169 5.260   1.00 23.89 ? 775  GLN B OE1 1 
ATOM   4719 N  NE2 . GLN B 2 275 ? 27.609  108.442 7.494   1.00 23.72 ? 775  GLN B NE2 1 
ATOM   4720 N  N   . TRP B 2 276 ? 24.691  112.959 3.963   1.00 15.53 ? 776  TRP B N   1 
ATOM   4721 C  CA  . TRP B 2 276 ? 25.060  114.363 3.822   1.00 15.38 ? 776  TRP B CA  1 
ATOM   4722 C  C   . TRP B 2 276 ? 24.042  115.304 4.467   1.00 14.97 ? 776  TRP B C   1 
ATOM   4723 O  O   . TRP B 2 276 ? 24.411  116.148 5.281   1.00 14.97 ? 776  TRP B O   1 
ATOM   4724 C  CB  . TRP B 2 276 ? 25.216  114.741 2.344   1.00 15.17 ? 776  TRP B CB  1 
ATOM   4725 C  CG  . TRP B 2 276 ? 25.504  116.206 2.140   1.00 15.01 ? 776  TRP B CG  1 
ATOM   4726 C  CD1 . TRP B 2 276 ? 26.716  116.834 2.248   1.00 15.43 ? 776  TRP B CD1 1 
ATOM   4727 C  CD2 . TRP B 2 276 ? 24.550  117.230 1.829   1.00 15.13 ? 776  TRP B CD2 1 
ATOM   4728 N  NE1 . TRP B 2 276 ? 26.573  118.184 2.024   1.00 15.23 ? 776  TRP B NE1 1 
ATOM   4729 C  CE2 . TRP B 2 276 ? 25.255  118.454 1.765   1.00 15.07 ? 776  TRP B CE2 1 
ATOM   4730 C  CE3 . TRP B 2 276 ? 23.166  117.233 1.600   1.00 14.35 ? 776  TRP B CE3 1 
ATOM   4731 C  CZ2 . TRP B 2 276 ? 24.621  119.674 1.481   1.00 14.83 ? 776  TRP B CZ2 1 
ATOM   4732 C  CZ3 . TRP B 2 276 ? 22.537  118.446 1.318   1.00 14.92 ? 776  TRP B CZ3 1 
ATOM   4733 C  CH2 . TRP B 2 276 ? 23.268  119.648 1.261   1.00 14.25 ? 776  TRP B CH2 1 
ATOM   4734 N  N   . VAL B 2 277 ? 22.762  115.169 4.115   1.00 14.72 ? 777  VAL B N   1 
ATOM   4735 C  CA  . VAL B 2 277 ? 21.757  116.065 4.686   1.00 14.69 ? 777  VAL B CA  1 
ATOM   4736 C  C   . VAL B 2 277 ? 21.614  115.937 6.209   1.00 14.64 ? 777  VAL B C   1 
ATOM   4737 O  O   . VAL B 2 277 ? 21.503  116.947 6.910   1.00 13.59 ? 777  VAL B O   1 
ATOM   4738 C  CB  . VAL B 2 277 ? 20.362  115.888 4.014   1.00 14.54 ? 777  VAL B CB  1 
ATOM   4739 C  CG1 . VAL B 2 277 ? 19.807  114.501 4.276   1.00 14.97 ? 777  VAL B CG1 1 
ATOM   4740 C  CG2 . VAL B 2 277 ? 19.398  116.956 4.543   1.00 14.96 ? 777  VAL B CG2 1 
ATOM   4741 N  N   . THR B 2 278 ? 21.629  114.712 6.727   1.00 14.44 ? 778  THR B N   1 
ATOM   4742 C  CA  . THR B 2 278 ? 21.509  114.534 8.173   1.00 14.53 ? 778  THR B CA  1 
ATOM   4743 C  C   . THR B 2 278 ? 22.686  115.204 8.892   1.00 14.81 ? 778  THR B C   1 
ATOM   4744 O  O   . THR B 2 278 ? 22.543  115.694 10.015  1.00 14.26 ? 778  THR B O   1 
ATOM   4745 C  CB  . THR B 2 278 ? 21.441  113.040 8.556   1.00 14.79 ? 778  THR B CB  1 
ATOM   4746 O  OG1 . THR B 2 278 ? 22.597  112.356 8.058   1.00 15.23 ? 778  THR B OG1 1 
ATOM   4747 C  CG2 . THR B 2 278 ? 20.183  112.401 7.968   1.00 14.34 ? 778  THR B CG2 1 
ATOM   4748 N  N   . SER B 2 279 ? 23.841  115.241 8.230   1.00 14.83 ? 779  SER B N   1 
ATOM   4749 C  CA  . SER B 2 279 ? 25.033  115.863 8.796   1.00 15.04 ? 779  SER B CA  1 
ATOM   4750 C  C   . SER B 2 279 ? 24.925  117.385 8.819   1.00 15.11 ? 779  SER B C   1 
ATOM   4751 O  O   . SER B 2 279 ? 25.688  118.059 9.521   1.00 14.59 ? 779  SER B O   1 
ATOM   4752 C  CB  . SER B 2 279 ? 26.281  115.457 7.999   1.00 15.65 ? 779  SER B CB  1 
ATOM   4753 O  OG  . SER B 2 279 ? 26.565  114.074 8.154   1.00 17.79 ? 779  SER B OG  1 
ATOM   4754 N  N   . ARG B 2 280 ? 23.975  117.921 8.055   1.00 14.48 ? 780  ARG B N   1 
ATOM   4755 C  CA  . ARG B 2 280 ? 23.772  119.364 7.976   1.00 14.64 ? 780  ARG B CA  1 
ATOM   4756 C  C   . ARG B 2 280 ? 23.004  119.947 9.164   1.00 15.35 ? 780  ARG B C   1 
ATOM   4757 O  O   . ARG B 2 280 ? 22.902  121.171 9.298   1.00 14.74 ? 780  ARG B O   1 
ATOM   4758 C  CB  . ARG B 2 280 ? 23.065  119.720 6.663   1.00 14.50 ? 780  ARG B CB  1 
ATOM   4759 C  CG  . ARG B 2 280 ? 23.815  119.281 5.400   1.00 14.14 ? 780  ARG B CG  1 
ATOM   4760 C  CD  . ARG B 2 280 ? 25.032  120.161 5.085   1.00 14.52 ? 780  ARG B CD  1 
ATOM   4761 N  NE  . ARG B 2 280 ? 26.111  120.040 6.063   1.00 13.99 ? 780  ARG B NE  1 
ATOM   4762 C  CZ  . ARG B 2 280 ? 26.918  118.986 6.172   1.00 15.13 ? 780  ARG B CZ  1 
ATOM   4763 N  NH1 . ARG B 2 280 ? 26.777  117.945 5.357   1.00 14.66 ? 780  ARG B NH1 1 
ATOM   4764 N  NH2 . ARG B 2 280 ? 27.869  118.970 7.101   1.00 13.70 ? 780  ARG B NH2 1 
ATOM   4765 N  N   . GLN B 2 281 ? 22.445  119.090 10.017  1.00 15.21 ? 781  GLN B N   1 
ATOM   4766 C  CA  . GLN B 2 281 ? 21.744  119.594 11.198  1.00 15.51 ? 781  GLN B CA  1 
ATOM   4767 C  C   . GLN B 2 281 ? 22.827  119.882 12.237  1.00 15.85 ? 781  GLN B C   1 
ATOM   4768 O  O   . GLN B 2 281 ? 23.687  119.043 12.494  1.00 15.82 ? 781  GLN B O   1 
ATOM   4769 C  CB  . GLN B 2 281 ? 20.730  118.576 11.742  1.00 15.23 ? 781  GLN B CB  1 
ATOM   4770 C  CG  . GLN B 2 281 ? 19.917  119.114 12.925  1.00 15.29 ? 781  GLN B CG  1 
ATOM   4771 C  CD  . GLN B 2 281 ? 18.647  118.321 13.215  1.00 15.68 ? 781  GLN B CD  1 
ATOM   4772 O  OE1 . GLN B 2 281 ? 18.585  117.111 12.996  1.00 15.50 ? 781  GLN B OE1 1 
ATOM   4773 N  NE2 . GLN B 2 281 ? 17.633  119.006 13.737  1.00 16.19 ? 781  GLN B NE2 1 
ATOM   4774 N  N   . MET B 2 282 ? 22.786  121.074 12.821  1.00 16.24 ? 782  MET B N   1 
ATOM   4775 C  CA  . MET B 2 282 ? 23.789  121.490 13.794  1.00 16.33 ? 782  MET B CA  1 
ATOM   4776 C  C   . MET B 2 282 ? 23.584  120.869 15.171  1.00 16.55 ? 782  MET B C   1 
ATOM   4777 O  O   . MET B 2 282 ? 22.547  121.059 15.807  1.00 15.84 ? 782  MET B O   1 
ATOM   4778 C  CB  . MET B 2 282 ? 23.795  123.017 13.892  1.00 16.64 ? 782  MET B CB  1 
ATOM   4779 C  CG  . MET B 2 282 ? 23.811  123.721 12.527  1.00 17.27 ? 782  MET B CG  1 
ATOM   4780 S  SD  . MET B 2 282 ? 25.253  123.309 11.497  1.00 18.11 ? 782  MET B SD  1 
ATOM   4781 C  CE  . MET B 2 282 ? 26.466  124.480 12.135  1.00 19.20 ? 782  MET B CE  1 
ATOM   4782 N  N   . ARG B 2 283 ? 24.592  120.134 15.634  1.00 16.61 ? 783  ARG B N   1 
ATOM   4783 C  CA  . ARG B 2 283 ? 24.513  119.466 16.929  1.00 17.30 ? 783  ARG B CA  1 
ATOM   4784 C  C   . ARG B 2 283 ? 24.189  120.419 18.071  1.00 17.15 ? 783  ARG B C   1 
ATOM   4785 O  O   . ARG B 2 283 ? 23.500  120.042 19.014  1.00 17.45 ? 783  ARG B O   1 
ATOM   4786 C  CB  . ARG B 2 283 ? 25.820  118.725 17.234  1.00 18.22 ? 783  ARG B CB  1 
ATOM   4787 C  CG  . ARG B 2 283 ? 27.036  119.630 17.379  1.00 20.37 ? 783  ARG B CG  1 
ATOM   4788 C  CD  . ARG B 2 283 ? 28.296  118.825 17.691  1.00 22.54 ? 783  ARG B CD  1 
ATOM   4789 N  NE  . ARG B 2 283 ? 28.661  117.923 16.602  1.00 24.84 ? 783  ARG B NE  1 
ATOM   4790 C  CZ  . ARG B 2 283 ? 28.457  116.610 16.609  1.00 27.54 ? 783  ARG B CZ  1 
ATOM   4791 N  NH1 . ARG B 2 283 ? 27.884  116.022 17.657  1.00 29.11 ? 783  ARG B NH1 1 
ATOM   4792 N  NH2 . ARG B 2 283 ? 28.827  115.879 15.565  1.00 29.09 ? 783  ARG B NH2 1 
ATOM   4793 N  N   . PHE B 2 284 ? 24.683  121.651 18.004  1.00 17.44 ? 784  PHE B N   1 
ATOM   4794 C  CA  . PHE B 2 284 ? 24.391  122.588 19.080  1.00 17.34 ? 784  PHE B CA  1 
ATOM   4795 C  C   . PHE B 2 284 ? 23.127  123.415 18.858  1.00 17.16 ? 784  PHE B C   1 
ATOM   4796 O  O   . PHE B 2 284 ? 22.228  123.406 19.693  1.00 17.16 ? 784  PHE B O   1 
ATOM   4797 C  CB  . PHE B 2 284 ? 25.553  123.554 19.329  1.00 18.40 ? 784  PHE B CB  1 
ATOM   4798 C  CG  . PHE B 2 284 ? 25.319  124.457 20.513  1.00 18.89 ? 784  PHE B CG  1 
ATOM   4799 C  CD1 . PHE B 2 284 ? 25.372  123.947 21.808  1.00 19.58 ? 784  PHE B CD1 1 
ATOM   4800 C  CD2 . PHE B 2 284 ? 24.945  125.785 20.332  1.00 19.28 ? 784  PHE B CD2 1 
ATOM   4801 C  CE1 . PHE B 2 284 ? 25.046  124.743 22.911  1.00 19.59 ? 784  PHE B CE1 1 
ATOM   4802 C  CE2 . PHE B 2 284 ? 24.617  126.590 21.426  1.00 19.63 ? 784  PHE B CE2 1 
ATOM   4803 C  CZ  . PHE B 2 284 ? 24.666  126.065 22.719  1.00 19.30 ? 784  PHE B CZ  1 
ATOM   4804 N  N   . GLU B 2 285 ? 23.058  124.125 17.735  1.00 16.37 ? 785  GLU B N   1 
ATOM   4805 C  CA  . GLU B 2 285 ? 21.907  124.980 17.452  1.00 16.39 ? 785  GLU B CA  1 
ATOM   4806 C  C   . GLU B 2 285 ? 20.592  124.241 17.221  1.00 15.99 ? 785  GLU B C   1 
ATOM   4807 O  O   . GLU B 2 285 ? 19.531  124.751 17.565  1.00 15.75 ? 785  GLU B O   1 
ATOM   4808 C  CB  . GLU B 2 285 ? 22.191  125.883 16.242  1.00 16.43 ? 785  GLU B CB  1 
ATOM   4809 C  CG  . GLU B 2 285 ? 23.460  126.719 16.360  1.00 16.81 ? 785  GLU B CG  1 
ATOM   4810 C  CD  . GLU B 2 285 ? 24.675  126.024 15.763  1.00 17.74 ? 785  GLU B CD  1 
ATOM   4811 O  OE1 . GLU B 2 285 ? 25.099  124.980 16.298  1.00 17.34 ? 785  GLU B OE1 1 
ATOM   4812 O  OE2 . GLU B 2 285 ? 25.202  126.524 14.747  1.00 18.41 ? 785  GLU B OE2 1 
ATOM   4813 N  N   . GLY B 2 286 ? 20.657  123.051 16.632  1.00 15.63 ? 786  GLY B N   1 
ATOM   4814 C  CA  . GLY B 2 286 ? 19.442  122.298 16.373  1.00 14.83 ? 786  GLY B CA  1 
ATOM   4815 C  C   . GLY B 2 286 ? 18.870  122.566 14.990  1.00 14.66 ? 786  GLY B C   1 
ATOM   4816 O  O   . GLY B 2 286 ? 18.115  121.754 14.457  1.00 14.23 ? 786  GLY B O   1 
ATOM   4817 N  N   . GLY B 2 287 ? 19.217  123.716 14.415  1.00 14.77 ? 787  GLY B N   1 
ATOM   4818 C  CA  . GLY B 2 287 ? 18.744  124.054 13.084  1.00 14.44 ? 787  GLY B CA  1 
ATOM   4819 C  C   . GLY B 2 287 ? 19.680  123.455 12.048  1.00 14.45 ? 787  GLY B C   1 
ATOM   4820 O  O   . GLY B 2 287 ? 20.573  122.681 12.398  1.00 13.87 ? 787  GLY B O   1 
ATOM   4821 N  N   . PHE B 2 288 ? 19.482  123.809 10.779  1.00 14.06 ? 788  PHE B N   1 
ATOM   4822 C  CA  . PHE B 2 288 ? 20.321  123.300 9.693   1.00 14.36 ? 788  PHE B CA  1 
ATOM   4823 C  C   . PHE B 2 288 ? 21.167  124.391 9.034   1.00 14.48 ? 788  PHE B C   1 
ATOM   4824 O  O   . PHE B 2 288 ? 20.761  125.552 8.977   1.00 14.03 ? 788  PHE B O   1 
ATOM   4825 C  CB  . PHE B 2 288 ? 19.468  122.656 8.586   1.00 13.57 ? 788  PHE B CB  1 
ATOM   4826 C  CG  . PHE B 2 288 ? 18.913  121.303 8.935   1.00 14.84 ? 788  PHE B CG  1 
ATOM   4827 C  CD1 . PHE B 2 288 ? 17.804  121.178 9.769   1.00 13.96 ? 788  PHE B CD1 1 
ATOM   4828 C  CD2 . PHE B 2 288 ? 19.487  120.149 8.400   1.00 14.19 ? 788  PHE B CD2 1 
ATOM   4829 C  CE1 . PHE B 2 288 ? 17.271  119.917 10.062  1.00 14.37 ? 788  PHE B CE1 1 
ATOM   4830 C  CE2 . PHE B 2 288 ? 18.965  118.887 8.684   1.00 14.92 ? 788  PHE B CE2 1 
ATOM   4831 C  CZ  . PHE B 2 288 ? 17.852  118.770 9.518   1.00 14.04 ? 788  PHE B CZ  1 
ATOM   4832 N  N   . GLN B 2 289 ? 22.340  123.997 8.534   1.00 14.49 ? 789  GLN B N   1 
ATOM   4833 C  CA  . GLN B 2 289 ? 23.238  124.897 7.813   1.00 14.87 ? 789  GLN B CA  1 
ATOM   4834 C  C   . GLN B 2 289 ? 22.974  124.585 6.331   1.00 14.85 ? 789  GLN B C   1 
ATOM   4835 O  O   . GLN B 2 289 ? 22.386  123.547 6.016   1.00 15.40 ? 789  GLN B O   1 
ATOM   4836 C  CB  . GLN B 2 289 ? 24.711  124.610 8.174   1.00 14.36 ? 789  GLN B CB  1 
ATOM   4837 C  CG  . GLN B 2 289 ? 25.180  123.193 7.837   1.00 15.26 ? 789  GLN B CG  1 
ATOM   4838 C  CD  . GLN B 2 289 ? 26.585  122.881 8.341   1.00 15.78 ? 789  GLN B CD  1 
ATOM   4839 O  OE1 . GLN B 2 289 ? 27.282  123.751 8.875   1.00 16.78 ? 789  GLN B OE1 1 
ATOM   4840 N  NE2 . GLN B 2 289 ? 27.006  121.635 8.172   1.00 15.12 ? 789  GLN B NE2 1 
ATOM   4841 N  N   . GLY B 2 290 ? 23.391  125.474 5.431   1.00 15.05 ? 790  GLY B N   1 
ATOM   4842 C  CA  . GLY B 2 290 ? 23.165  125.258 4.008   1.00 14.63 ? 790  GLY B CA  1 
ATOM   4843 C  C   . GLY B 2 290 ? 24.216  124.400 3.332   1.00 14.85 ? 790  GLY B C   1 
ATOM   4844 O  O   . GLY B 2 290 ? 23.964  123.765 2.309   1.00 15.37 ? 790  GLY B O   1 
ATOM   4845 N  N   . ARG B 2 291 ? 25.414  124.400 3.897   1.00 15.14 ? 791  ARG B N   1 
ATOM   4846 C  CA  . ARG B 2 291 ? 26.512  123.607 3.373   1.00 15.30 ? 791  ARG B CA  1 
ATOM   4847 C  C   . ARG B 2 291 ? 27.500  123.392 4.505   1.00 15.10 ? 791  ARG B C   1 
ATOM   4848 O  O   . ARG B 2 291 ? 27.505  124.136 5.484   1.00 14.82 ? 791  ARG B O   1 
ATOM   4849 C  CB  . ARG B 2 291 ? 27.181  124.308 2.176   1.00 15.06 ? 791  ARG B CB  1 
ATOM   4850 C  CG  . ARG B 2 291 ? 27.183  125.830 2.239   1.00 15.45 ? 791  ARG B CG  1 
ATOM   4851 C  CD  . ARG B 2 291 ? 27.916  126.438 1.040   1.00 15.00 ? 791  ARG B CD  1 
ATOM   4852 N  NE  . ARG B 2 291 ? 27.707  127.882 0.948   1.00 16.00 ? 791  ARG B NE  1 
ATOM   4853 C  CZ  . ARG B 2 291 ? 28.481  128.713 0.254   1.00 16.11 ? 791  ARG B CZ  1 
ATOM   4854 N  NH1 . ARG B 2 291 ? 29.530  128.247 -0.419  1.00 15.91 ? 791  ARG B NH1 1 
ATOM   4855 N  NH2 . ARG B 2 291 ? 28.211  130.013 0.236   1.00 16.30 ? 791  ARG B NH2 1 
ATOM   4856 N  N   . CYS B 2 292 ? 28.321  122.359 4.380   1.00 15.12 ? 792  CYS B N   1 
ATOM   4857 C  CA  . CYS B 2 292 ? 29.288  122.042 5.414   1.00 15.21 ? 792  CYS B CA  1 
ATOM   4858 C  C   . CYS B 2 292 ? 30.169  123.233 5.791   1.00 15.37 ? 792  CYS B C   1 
ATOM   4859 O  O   . CYS B 2 292 ? 30.664  123.966 4.931   1.00 14.47 ? 792  CYS B O   1 
ATOM   4860 C  CB  . CYS B 2 292 ? 30.161  120.866 4.969   1.00 16.02 ? 792  CYS B CB  1 
ATOM   4861 S  SG  . CYS B 2 292 ? 31.339  120.322 6.228   1.00 16.91 ? 792  CYS B SG  1 
ATOM   4862 N  N   . ASN B 2 293 ? 30.343  123.414 7.096   1.00 15.04 ? 793  ASN B N   1 
ATOM   4863 C  CA  . ASN B 2 293 ? 31.158  124.484 7.652   1.00 15.32 ? 793  ASN B CA  1 
ATOM   4864 C  C   . ASN B 2 293 ? 30.681  125.917 7.449   1.00 15.42 ? 793  ASN B C   1 
ATOM   4865 O  O   . ASN B 2 293 ? 31.478  126.853 7.486   1.00 14.92 ? 793  ASN B O   1 
ATOM   4866 C  CB  . ASN B 2 293 ? 32.618  124.342 7.202   1.00 15.44 ? 793  ASN B CB  1 
ATOM   4867 C  CG  . ASN B 2 293 ? 33.437  123.508 8.171   1.00 16.41 ? 793  ASN B CG  1 
ATOM   4868 O  OD1 . ASN B 2 293 ? 33.293  123.641 9.391   1.00 17.88 ? 793  ASN B OD1 1 
ATOM   4869 N  ND2 . ASN B 2 293 ? 34.307  122.653 7.640   1.00 16.60 ? 793  ASN B ND2 1 
ATOM   4870 N  N   . LYS B 2 294 ? 29.383  126.085 7.215   1.00 15.47 ? 794  LYS B N   1 
ATOM   4871 C  CA  . LYS B 2 294 ? 28.820  127.421 7.117   1.00 15.88 ? 794  LYS B CA  1 
ATOM   4872 C  C   . LYS B 2 294 ? 27.822  127.514 8.267   1.00 15.83 ? 794  LYS B C   1 
ATOM   4873 O  O   . LYS B 2 294 ? 27.715  126.578 9.063   1.00 15.50 ? 794  LYS B O   1 
ATOM   4874 C  CB  . LYS B 2 294 ? 28.193  127.693 5.741   1.00 16.44 ? 794  LYS B CB  1 
ATOM   4875 C  CG  . LYS B 2 294 ? 29.275  127.873 4.651   1.00 16.91 ? 794  LYS B CG  1 
ATOM   4876 C  CD  . LYS B 2 294 ? 28.958  128.980 3.642   1.00 16.74 ? 794  LYS B CD  1 
ATOM   4877 C  CE  . LYS B 2 294 ? 29.163  130.373 4.244   1.00 17.09 ? 794  LYS B CE  1 
ATOM   4878 N  NZ  . LYS B 2 294 ? 28.681  131.452 3.326   1.00 16.89 ? 794  LYS B NZ  1 
ATOM   4879 N  N   . LEU B 2 295 ? 27.095  128.619 8.361   1.00 15.72 ? 795  LEU B N   1 
ATOM   4880 C  CA  . LEU B 2 295 ? 26.200  128.839 9.490   1.00 15.65 ? 795  LEU B CA  1 
ATOM   4881 C  C   . LEU B 2 295 ? 24.760  128.339 9.444   1.00 15.53 ? 795  LEU B C   1 
ATOM   4882 O  O   . LEU B 2 295 ? 24.174  128.152 8.379   1.00 15.84 ? 795  LEU B O   1 
ATOM   4883 C  CB  . LEU B 2 295 ? 26.195  130.334 9.818   1.00 15.42 ? 795  LEU B CB  1 
ATOM   4884 C  CG  . LEU B 2 295 ? 27.581  130.986 9.901   1.00 15.59 ? 795  LEU B CG  1 
ATOM   4885 C  CD1 . LEU B 2 295 ? 27.432  132.502 10.070  1.00 15.58 ? 795  LEU B CD1 1 
ATOM   4886 C  CD2 . LEU B 2 295 ? 28.364  130.383 11.064  1.00 15.15 ? 795  LEU B CD2 1 
ATOM   4887 N  N   . VAL B 2 296 ? 24.206  128.128 10.635  1.00 15.16 ? 796  VAL B N   1 
ATOM   4888 C  CA  . VAL B 2 296 ? 22.827  127.689 10.800  1.00 14.97 ? 796  VAL B CA  1 
ATOM   4889 C  C   . VAL B 2 296 ? 21.963  128.820 10.247  1.00 15.15 ? 796  VAL B C   1 
ATOM   4890 O  O   . VAL B 2 296 ? 22.372  129.982 10.269  1.00 15.30 ? 796  VAL B O   1 
ATOM   4891 C  CB  . VAL B 2 296 ? 22.489  127.461 12.310  1.00 15.06 ? 796  VAL B CB  1 
ATOM   4892 C  CG1 . VAL B 2 296 ? 22.447  128.794 13.051  1.00 14.32 ? 796  VAL B CG1 1 
ATOM   4893 C  CG2 . VAL B 2 296 ? 21.162  126.720 12.455  1.00 14.25 ? 796  VAL B CG2 1 
ATOM   4894 N  N   . ASP B 2 297 ? 20.782  128.482 9.739   1.00 14.61 ? 797  ASP B N   1 
ATOM   4895 C  CA  . ASP B 2 297 ? 19.873  129.481 9.177   1.00 14.61 ? 797  ASP B CA  1 
ATOM   4896 C  C   . ASP B 2 297 ? 18.462  128.888 9.155   1.00 14.36 ? 797  ASP B C   1 
ATOM   4897 O  O   . ASP B 2 297 ? 18.244  127.801 8.619   1.00 15.12 ? 797  ASP B O   1 
ATOM   4898 C  CB  . ASP B 2 297 ? 20.323  129.851 7.752   1.00 14.34 ? 797  ASP B CB  1 
ATOM   4899 C  CG  . ASP B 2 297 ? 19.405  130.868 7.076   1.00 14.79 ? 797  ASP B CG  1 
ATOM   4900 O  OD1 . ASP B 2 297 ? 18.253  131.049 7.522   1.00 14.10 ? 797  ASP B OD1 1 
ATOM   4901 O  OD2 . ASP B 2 297 ? 19.837  131.474 6.069   1.00 15.23 ? 797  ASP B OD2 1 
ATOM   4902 N  N   . GLY B 2 298 ? 17.512  129.604 9.746   1.00 13.91 ? 798  GLY B N   1 
ATOM   4903 C  CA  . GLY B 2 298 ? 16.139  129.133 9.791   1.00 13.86 ? 798  GLY B CA  1 
ATOM   4904 C  C   . GLY B 2 298 ? 15.495  128.685 8.484   1.00 13.95 ? 798  GLY B C   1 
ATOM   4905 O  O   . GLY B 2 298 ? 14.675  127.764 8.493   1.00 14.07 ? 798  GLY B O   1 
ATOM   4906 N  N   . CYS B 2 299 ? 15.840  129.305 7.358   1.00 13.73 ? 799  CYS B N   1 
ATOM   4907 C  CA  . CYS B 2 299 ? 15.205  128.897 6.103   1.00 13.26 ? 799  CYS B CA  1 
ATOM   4908 C  C   . CYS B 2 299 ? 15.573  127.468 5.699   1.00 13.36 ? 799  CYS B C   1 
ATOM   4909 O  O   . CYS B 2 299 ? 14.803  126.802 5.009   1.00 13.20 ? 799  CYS B O   1 
ATOM   4910 C  CB  . CYS B 2 299 ? 15.540  129.879 4.964   1.00 13.61 ? 799  CYS B CB  1 
ATOM   4911 S  SG  . CYS B 2 299 ? 17.269  129.892 4.433   1.00 14.40 ? 799  CYS B SG  1 
ATOM   4912 N  N   . TYR B 2 300 ? 16.739  126.987 6.129   1.00 13.04 ? 800  TYR B N   1 
ATOM   4913 C  CA  . TYR B 2 300 ? 17.140  125.624 5.794   1.00 13.10 ? 800  TYR B CA  1 
ATOM   4914 C  C   . TYR B 2 300 ? 16.305  124.618 6.579   1.00 13.13 ? 800  TYR B C   1 
ATOM   4915 O  O   . TYR B 2 300 ? 16.426  123.411 6.383   1.00 13.47 ? 800  TYR B O   1 
ATOM   4916 C  CB  . TYR B 2 300 ? 18.642  125.428 6.042   1.00 12.77 ? 800  TYR B CB  1 
ATOM   4917 C  CG  . TYR B 2 300 ? 19.474  126.314 5.138   1.00 13.33 ? 800  TYR B CG  1 
ATOM   4918 C  CD1 . TYR B 2 300 ? 20.515  127.087 5.649   1.00 12.55 ? 800  TYR B CD1 1 
ATOM   4919 C  CD2 . TYR B 2 300 ? 19.165  126.437 3.781   1.00 12.89 ? 800  TYR B CD2 1 
ATOM   4920 C  CE1 . TYR B 2 300 ? 21.218  127.967 4.835   1.00 14.20 ? 800  TYR B CE1 1 
ATOM   4921 C  CE2 . TYR B 2 300 ? 19.861  127.311 2.958   1.00 13.71 ? 800  TYR B CE2 1 
ATOM   4922 C  CZ  . TYR B 2 300 ? 20.884  128.077 3.489   1.00 13.95 ? 800  TYR B CZ  1 
ATOM   4923 O  OH  . TYR B 2 300 ? 21.550  128.970 2.680   1.00 13.61 ? 800  TYR B OH  1 
ATOM   4924 N  N   . SER B 2 301 ? 15.454  125.121 7.469   1.00 13.73 ? 801  SER B N   1 
ATOM   4925 C  CA  . SER B 2 301 ? 14.563  124.247 8.221   1.00 14.19 ? 801  SER B CA  1 
ATOM   4926 C  C   . SER B 2 301 ? 13.704  123.545 7.171   1.00 14.44 ? 801  SER B C   1 
ATOM   4927 O  O   . SER B 2 301 ? 13.216  122.436 7.389   1.00 14.38 ? 801  SER B O   1 
ATOM   4928 C  CB  . SER B 2 301 ? 13.672  125.058 9.166   1.00 14.06 ? 801  SER B CB  1 
ATOM   4929 O  OG  . SER B 2 301 ? 14.446  125.729 10.146  1.00 15.62 ? 801  SER B OG  1 
ATOM   4930 N  N   . PHE B 2 302 ? 13.518  124.203 6.028   1.00 14.00 ? 802  PHE B N   1 
ATOM   4931 C  CA  . PHE B 2 302 ? 12.746  123.603 4.950   1.00 14.32 ? 802  PHE B CA  1 
ATOM   4932 C  C   . PHE B 2 302 ? 13.637  122.984 3.874   1.00 14.08 ? 802  PHE B C   1 
ATOM   4933 O  O   . PHE B 2 302 ? 13.520  121.800 3.578   1.00 14.73 ? 802  PHE B O   1 
ATOM   4934 C  CB  . PHE B 2 302 ? 11.820  124.609 4.254   1.00 13.46 ? 802  PHE B CB  1 
ATOM   4935 C  CG  . PHE B 2 302 ? 11.113  124.015 3.060   1.00 13.82 ? 802  PHE B CG  1 
ATOM   4936 C  CD1 . PHE B 2 302 ? 10.065  123.112 3.237   1.00 13.76 ? 802  PHE B CD1 1 
ATOM   4937 C  CD2 . PHE B 2 302 ? 11.589  124.237 1.770   1.00 13.78 ? 802  PHE B CD2 1 
ATOM   4938 C  CE1 . PHE B 2 302 ? 9.514   122.427 2.151   1.00 13.83 ? 802  PHE B CE1 1 
ATOM   4939 C  CE2 . PHE B 2 302 ? 11.045  123.557 0.676   1.00 13.62 ? 802  PHE B CE2 1 
ATOM   4940 C  CZ  . PHE B 2 302 ? 10.008  122.648 0.870   1.00 13.80 ? 802  PHE B CZ  1 
ATOM   4941 N  N   . TRP B 2 303 ? 14.520  123.789 3.288   1.00 13.59 ? 803  TRP B N   1 
ATOM   4942 C  CA  . TRP B 2 303 ? 15.380  123.299 2.213   1.00 13.62 ? 803  TRP B CA  1 
ATOM   4943 C  C   . TRP B 2 303 ? 16.119  122.014 2.573   1.00 13.31 ? 803  TRP B C   1 
ATOM   4944 O  O   . TRP B 2 303 ? 16.193  121.093 1.759   1.00 12.94 ? 803  TRP B O   1 
ATOM   4945 C  CB  . TRP B 2 303 ? 16.389  124.378 1.791   1.00 13.60 ? 803  TRP B CB  1 
ATOM   4946 C  CG  . TRP B 2 303 ? 15.768  125.678 1.316   1.00 13.13 ? 803  TRP B CG  1 
ATOM   4947 C  CD1 . TRP B 2 303 ? 15.959  126.923 1.857   1.00 13.15 ? 803  TRP B CD1 1 
ATOM   4948 C  CD2 . TRP B 2 303 ? 14.877  125.859 0.205   1.00 13.52 ? 803  TRP B CD2 1 
ATOM   4949 N  NE1 . TRP B 2 303 ? 15.245  127.864 1.153   1.00 13.10 ? 803  TRP B NE1 1 
ATOM   4950 C  CE2 . TRP B 2 303 ? 14.573  127.241 0.133   1.00 13.05 ? 803  TRP B CE2 1 
ATOM   4951 C  CE3 . TRP B 2 303 ? 14.306  124.990 -0.739  1.00 13.46 ? 803  TRP B CE3 1 
ATOM   4952 C  CZ2 . TRP B 2 303 ? 13.722  127.775 -0.847  1.00 13.56 ? 803  TRP B CZ2 1 
ATOM   4953 C  CZ3 . TRP B 2 303 ? 13.455  125.524 -1.716  1.00 14.24 ? 803  TRP B CZ3 1 
ATOM   4954 C  CH2 . TRP B 2 303 ? 13.174  126.904 -1.759  1.00 13.70 ? 803  TRP B CH2 1 
ATOM   4955 N  N   . GLN B 2 304 ? 16.655  121.944 3.790   1.00 12.94 ? 804  GLN B N   1 
ATOM   4956 C  CA  . GLN B 2 304 ? 17.389  120.752 4.225   1.00 12.77 ? 804  GLN B CA  1 
ATOM   4957 C  C   . GLN B 2 304 ? 16.483  119.694 4.854   1.00 13.10 ? 804  GLN B C   1 
ATOM   4958 O  O   . GLN B 2 304 ? 16.444  118.548 4.396   1.00 12.96 ? 804  GLN B O   1 
ATOM   4959 C  CB  . GLN B 2 304 ? 18.496  121.133 5.226   1.00 12.81 ? 804  GLN B CB  1 
ATOM   4960 C  CG  . GLN B 2 304 ? 19.615  122.017 4.651   1.00 12.21 ? 804  GLN B CG  1 
ATOM   4961 C  CD  . GLN B 2 304 ? 20.631  121.233 3.822   1.00 13.08 ? 804  GLN B CD  1 
ATOM   4962 O  OE1 . GLN B 2 304 ? 20.298  120.225 3.197   1.00 11.63 ? 804  GLN B OE1 1 
ATOM   4963 N  NE2 . GLN B 2 304 ? 21.875  121.712 3.799   1.00 12.68 ? 804  GLN B NE2 1 
ATOM   4964 N  N   . ALA B 2 305 ? 15.761  120.069 5.908   1.00 12.97 ? 805  ALA B N   1 
ATOM   4965 C  CA  . ALA B 2 305 ? 14.888  119.114 6.588   1.00 13.78 ? 805  ALA B CA  1 
ATOM   4966 C  C   . ALA B 2 305 ? 13.829  118.544 5.650   1.00 13.81 ? 805  ALA B C   1 
ATOM   4967 O  O   . ALA B 2 305 ? 13.388  117.405 5.817   1.00 14.04 ? 805  ALA B O   1 
ATOM   4968 C  CB  . ALA B 2 305 ? 14.228  119.766 7.803   1.00 13.00 ? 805  ALA B CB  1 
ATOM   4969 N  N   . GLY B 2 306 ? 13.426  119.339 4.663   1.00 14.49 ? 806  GLY B N   1 
ATOM   4970 C  CA  . GLY B 2 306 ? 12.435  118.886 3.701   1.00 14.61 ? 806  GLY B CA  1 
ATOM   4971 C  C   . GLY B 2 306 ? 12.929  117.716 2.865   1.00 15.04 ? 806  GLY B C   1 
ATOM   4972 O  O   . GLY B 2 306 ? 12.134  117.001 2.252   1.00 15.30 ? 806  GLY B O   1 
ATOM   4973 N  N   . LEU B 2 307 ? 14.243  117.515 2.827   1.00 14.56 ? 807  LEU B N   1 
ATOM   4974 C  CA  . LEU B 2 307 ? 14.806  116.402 2.067   1.00 14.55 ? 807  LEU B CA  1 
ATOM   4975 C  C   . LEU B 2 307 ? 14.520  115.055 2.731   1.00 14.45 ? 807  LEU B C   1 
ATOM   4976 O  O   . LEU B 2 307 ? 14.498  114.022 2.064   1.00 14.38 ? 807  LEU B O   1 
ATOM   4977 C  CB  . LEU B 2 307 ? 16.323  116.573 1.909   1.00 13.88 ? 807  LEU B CB  1 
ATOM   4978 C  CG  . LEU B 2 307 ? 16.805  117.703 0.991   1.00 14.29 ? 807  LEU B CG  1 
ATOM   4979 C  CD1 . LEU B 2 307 ? 18.290  117.976 1.230   1.00 13.40 ? 807  LEU B CD1 1 
ATOM   4980 C  CD2 . LEU B 2 307 ? 16.547  117.316 -0.467  1.00 13.56 ? 807  LEU B CD2 1 
ATOM   4981 N  N   . LEU B 2 308 ? 14.295  115.052 4.042   1.00 14.44 ? 808  LEU B N   1 
ATOM   4982 C  CA  . LEU B 2 308 ? 14.046  113.790 4.727   1.00 14.82 ? 808  LEU B CA  1 
ATOM   4983 C  C   . LEU B 2 308 ? 12.713  113.131 4.376   1.00 14.56 ? 808  LEU B C   1 
ATOM   4984 O  O   . LEU B 2 308 ? 12.642  111.912 4.250   1.00 15.18 ? 808  LEU B O   1 
ATOM   4985 C  CB  . LEU B 2 308 ? 14.249  113.980 6.233   1.00 15.70 ? 808  LEU B CB  1 
ATOM   4986 C  CG  . LEU B 2 308 ? 15.782  114.117 6.291   1.00 17.50 ? 808  LEU B CG  1 
ATOM   4987 C  CD1 . LEU B 2 308 ? 16.204  115.255 7.173   1.00 18.02 ? 808  LEU B CD1 1 
ATOM   4988 C  CD2 . LEU B 2 308 ? 16.405  112.794 6.680   1.00 17.20 ? 808  LEU B CD2 1 
ATOM   4989 N  N   . PRO B 2 309 ? 11.636  113.916 4.228   1.00 14.22 ? 809  PRO B N   1 
ATOM   4990 C  CA  . PRO B 2 309 ? 10.381  113.248 3.865   1.00 14.42 ? 809  PRO B CA  1 
ATOM   4991 C  C   . PRO B 2 309 ? 10.519  112.724 2.425   1.00 14.64 ? 809  PRO B C   1 
ATOM   4992 O  O   . PRO B 2 309 ? 9.969   111.676 2.070   1.00 14.48 ? 809  PRO B O   1 
ATOM   4993 C  CB  . PRO B 2 309 ? 9.348   114.367 3.965   1.00 14.65 ? 809  PRO B CB  1 
ATOM   4994 C  CG  . PRO B 2 309 ? 9.906   115.246 5.033   1.00 14.73 ? 809  PRO B CG  1 
ATOM   4995 C  CD  . PRO B 2 309 ? 11.385  115.284 4.711   1.00 14.37 ? 809  PRO B CD  1 
ATOM   4996 N  N   . LEU B 2 310 ? 11.263  113.458 1.598   1.00 14.47 ? 810  LEU B N   1 
ATOM   4997 C  CA  . LEU B 2 310 ? 11.473  113.046 0.205   1.00 15.48 ? 810  LEU B CA  1 
ATOM   4998 C  C   . LEU B 2 310 ? 12.290  111.750 0.152   1.00 15.64 ? 810  LEU B C   1 
ATOM   4999 O  O   . LEU B 2 310 ? 11.992  110.845 -0.629  1.00 16.13 ? 810  LEU B O   1 
ATOM   5000 C  CB  . LEU B 2 310 ? 12.191  114.147 -0.586  1.00 14.61 ? 810  LEU B CB  1 
ATOM   5001 C  CG  . LEU B 2 310 ? 11.432  115.471 -0.769  1.00 15.45 ? 810  LEU B CG  1 
ATOM   5002 C  CD1 . LEU B 2 310 ? 12.280  116.430 -1.592  1.00 14.81 ? 810  LEU B CD1 1 
ATOM   5003 C  CD2 . LEU B 2 310 ? 10.096  115.223 -1.467  1.00 14.67 ? 810  LEU B CD2 1 
ATOM   5004 N  N   . LEU B 2 311 ? 13.321  111.671 0.984   1.00 15.88 ? 811  LEU B N   1 
ATOM   5005 C  CA  . LEU B 2 311 ? 14.159  110.478 1.048   1.00 16.70 ? 811  LEU B CA  1 
ATOM   5006 C  C   . LEU B 2 311 ? 13.351  109.312 1.610   1.00 17.23 ? 811  LEU B C   1 
ATOM   5007 O  O   . LEU B 2 311 ? 13.468  108.180 1.137   1.00 16.85 ? 811  LEU B O   1 
ATOM   5008 C  CB  . LEU B 2 311 ? 15.391  110.739 1.920   1.00 15.93 ? 811  LEU B CB  1 
ATOM   5009 C  CG  . LEU B 2 311 ? 16.457  111.636 1.276   1.00 16.68 ? 811  LEU B CG  1 
ATOM   5010 C  CD1 . LEU B 2 311 ? 17.509  112.034 2.307   1.00 14.79 ? 811  LEU B CD1 1 
ATOM   5011 C  CD2 . LEU B 2 311 ? 17.103  110.893 0.106   1.00 17.22 ? 811  LEU B CD2 1 
ATOM   5012 N  N   . HIS B 2 312 ? 12.534  109.592 2.620   1.00 18.10 ? 812  HIS B N   1 
ATOM   5013 C  CA  . HIS B 2 312 ? 11.701  108.560 3.229   1.00 20.25 ? 812  HIS B CA  1 
ATOM   5014 C  C   . HIS B 2 312 ? 10.825  107.911 2.155   1.00 21.28 ? 812  HIS B C   1 
ATOM   5015 O  O   . HIS B 2 312 ? 10.765  106.687 2.033   1.00 20.64 ? 812  HIS B O   1 
ATOM   5016 C  CB  . HIS B 2 312 ? 10.796  109.164 4.300   1.00 20.87 ? 812  HIS B CB  1 
ATOM   5017 C  CG  . HIS B 2 312 ? 10.086  108.138 5.122   1.00 22.88 ? 812  HIS B CG  1 
ATOM   5018 N  ND1 . HIS B 2 312 ? 10.625  107.609 6.275   1.00 22.74 ? 812  HIS B ND1 1 
ATOM   5019 C  CD2 . HIS B 2 312 ? 8.912   107.493 4.925   1.00 23.54 ? 812  HIS B CD2 1 
ATOM   5020 C  CE1 . HIS B 2 312 ? 9.814   106.682 6.752   1.00 23.17 ? 812  HIS B CE1 1 
ATOM   5021 N  NE2 . HIS B 2 312 ? 8.768   106.591 5.950   1.00 23.83 ? 812  HIS B NE2 1 
ATOM   5022 N  N   . ARG B 2 313 ? 10.145  108.753 1.386   1.00 22.32 ? 813  ARG B N   1 
ATOM   5023 C  CA  . ARG B 2 313 ? 9.271   108.304 0.310   1.00 24.56 ? 813  ARG B CA  1 
ATOM   5024 C  C   . ARG B 2 313 ? 10.050  107.489 -0.721  1.00 23.99 ? 813  ARG B C   1 
ATOM   5025 O  O   . ARG B 2 313 ? 9.598   106.432 -1.155  1.00 24.24 ? 813  ARG B O   1 
ATOM   5026 C  CB  . ARG B 2 313 ? 8.629   109.517 -0.373  1.00 26.97 ? 813  ARG B CB  1 
ATOM   5027 C  CG  . ARG B 2 313 ? 7.697   109.180 -1.525  1.00 31.21 ? 813  ARG B CG  1 
ATOM   5028 C  CD  . ARG B 2 313 ? 6.344   108.674 -1.044  1.00 35.07 ? 813  ARG B CD  1 
ATOM   5029 N  NE  . ARG B 2 313 ? 5.621   109.686 -0.276  1.00 38.44 ? 813  ARG B NE  1 
ATOM   5030 C  CZ  . ARG B 2 313 ? 4.321   109.625 0.003   1.00 39.58 ? 813  ARG B CZ  1 
ATOM   5031 N  NH1 . ARG B 2 313 ? 3.594   108.598 -0.426  1.00 40.34 ? 813  ARG B NH1 1 
ATOM   5032 N  NH2 . ARG B 2 313 ? 3.745   110.593 0.706   1.00 40.48 ? 813  ARG B NH2 1 
ATOM   5033 N  N   . ALA B 2 314 ? 11.222  107.984 -1.106  1.00 23.91 ? 814  ALA B N   1 
ATOM   5034 C  CA  . ALA B 2 314 ? 12.057  107.308 -2.092  1.00 23.83 ? 814  ALA B CA  1 
ATOM   5035 C  C   . ALA B 2 314 ? 12.502  105.924 -1.623  1.00 24.69 ? 814  ALA B C   1 
ATOM   5036 O  O   . ALA B 2 314 ? 12.430  104.948 -2.377  1.00 24.60 ? 814  ALA B O   1 
ATOM   5037 C  CB  . ALA B 2 314 ? 13.277  108.164 -2.414  1.00 23.81 ? 814  ALA B CB  1 
ATOM   5038 N  N   . LEU B 2 315 ? 12.971  105.840 -0.382  1.00 24.40 ? 815  LEU B N   1 
ATOM   5039 C  CA  . LEU B 2 315 ? 13.420  104.569 0.167   1.00 25.25 ? 815  LEU B CA  1 
ATOM   5040 C  C   . LEU B 2 315 ? 12.239  103.630 0.385   1.00 26.25 ? 815  LEU B C   1 
ATOM   5041 O  O   . LEU B 2 315 ? 12.349  102.426 0.163   1.00 26.23 ? 815  LEU B O   1 
ATOM   5042 C  CB  . LEU B 2 315 ? 14.172  104.797 1.484   1.00 24.34 ? 815  LEU B CB  1 
ATOM   5043 C  CG  . LEU B 2 315 ? 15.464  105.611 1.352   1.00 24.50 ? 815  LEU B CG  1 
ATOM   5044 C  CD1 . LEU B 2 315 ? 16.066  105.845 2.728   1.00 24.27 ? 815  LEU B CD1 1 
ATOM   5045 C  CD2 . LEU B 2 315 ? 16.455  104.877 0.446   1.00 23.94 ? 815  LEU B CD2 1 
ATOM   5046 N  N   . HIS B 2 316 ? 11.107  104.186 0.810   1.00 27.76 ? 816  HIS B N   1 
ATOM   5047 C  CA  . HIS B 2 316 ? 9.906   103.394 1.051   1.00 29.97 ? 816  HIS B CA  1 
ATOM   5048 C  C   . HIS B 2 316 ? 9.440   102.747 -0.252  1.00 30.98 ? 816  HIS B C   1 
ATOM   5049 O  O   . HIS B 2 316 ? 8.941   101.617 -0.259  1.00 30.92 ? 816  HIS B O   1 
ATOM   5050 C  CB  . HIS B 2 316 ? 8.790   104.279 1.610   1.00 30.99 ? 816  HIS B CB  1 
ATOM   5051 C  CG  . HIS B 2 316 ? 7.509   103.548 1.870   1.00 32.96 ? 816  HIS B CG  1 
ATOM   5052 N  ND1 . HIS B 2 316 ? 7.373   102.614 2.875   1.00 33.67 ? 816  HIS B ND1 1 
ATOM   5053 C  CD2 . HIS B 2 316 ? 6.306   103.612 1.252   1.00 33.53 ? 816  HIS B CD2 1 
ATOM   5054 C  CE1 . HIS B 2 316 ? 6.142   102.135 2.865   1.00 33.53 ? 816  HIS B CE1 1 
ATOM   5055 N  NE2 . HIS B 2 316 ? 5.474   102.724 1.890   1.00 33.98 ? 816  HIS B NE2 1 
ATOM   5056 N  N   . ALA B 2 317 ? 9.608   103.473 -1.351  1.00 31.56 ? 817  ALA B N   1 
ATOM   5057 C  CA  . ALA B 2 317 ? 9.212   102.980 -2.661  1.00 32.49 ? 817  ALA B CA  1 
ATOM   5058 C  C   . ALA B 2 317 ? 10.070  101.790 -3.074  1.00 32.99 ? 817  ALA B C   1 
ATOM   5059 O  O   . ALA B 2 317 ? 9.635   100.958 -3.866  1.00 33.66 ? 817  ALA B O   1 
ATOM   5060 C  CB  . ALA B 2 317 ? 9.327   104.092 -3.697  1.00 31.98 ? 817  ALA B CB  1 
ATOM   5061 N  N   . GLN B 2 318 ? 11.285  101.710 -2.538  1.00 33.64 ? 818  GLN B N   1 
ATOM   5062 C  CA  . GLN B 2 318 ? 12.191  100.611 -2.866  1.00 34.01 ? 818  GLN B CA  1 
ATOM   5063 C  C   . GLN B 2 318 ? 12.041  99.447  -1.890  1.00 33.55 ? 818  GLN B C   1 
ATOM   5064 O  O   . GLN B 2 318 ? 12.763  98.457  -1.988  1.00 33.97 ? 818  GLN B O   1 
ATOM   5065 C  CB  . GLN B 2 318 ? 13.643  101.084 -2.843  1.00 34.82 ? 818  GLN B CB  1 
ATOM   5066 C  CG  . GLN B 2 318 ? 13.881  102.426 -3.494  1.00 36.64 ? 818  GLN B CG  1 
ATOM   5067 C  CD  . GLN B 2 318 ? 15.344  102.812 -3.492  1.00 37.10 ? 818  GLN B CD  1 
ATOM   5068 O  OE1 . GLN B 2 318 ? 16.068  102.539 -2.535  1.00 38.08 ? 818  GLN B OE1 1 
ATOM   5069 N  NE2 . GLN B 2 318 ? 15.787  103.464 -4.561  1.00 38.18 ? 818  GLN B NE2 1 
ATOM   5070 N  N   . GLY B 2 319 ? 11.121  99.579  -0.940  1.00 32.87 ? 819  GLY B N   1 
ATOM   5071 C  CA  . GLY B 2 319 ? 10.897  98.519  0.026   1.00 32.11 ? 819  GLY B CA  1 
ATOM   5072 C  C   . GLY B 2 319 ? 11.902  98.431  1.163   1.00 31.38 ? 819  GLY B C   1 
ATOM   5073 O  O   . GLY B 2 319 ? 12.140  97.345  1.696   1.00 32.14 ? 819  GLY B O   1 
ATOM   5074 N  N   . ASP B 2 320 ? 12.488  99.563  1.542   1.00 29.60 ? 820  ASP B N   1 
ATOM   5075 C  CA  . ASP B 2 320 ? 13.465  99.597  2.630   1.00 27.60 ? 820  ASP B CA  1 
ATOM   5076 C  C   . ASP B 2 320 ? 12.798  99.132  3.926   1.00 26.78 ? 820  ASP B C   1 
ATOM   5077 O  O   . ASP B 2 320 ? 11.963  99.835  4.493   1.00 26.89 ? 820  ASP B O   1 
ATOM   5078 C  CB  . ASP B 2 320 ? 13.998  101.018 2.810   1.00 26.58 ? 820  ASP B CB  1 
ATOM   5079 C  CG  . ASP B 2 320 ? 15.209  101.074 3.717   1.00 25.73 ? 820  ASP B CG  1 
ATOM   5080 O  OD1 . ASP B 2 320 ? 15.232  100.339 4.729   1.00 24.64 ? 820  ASP B OD1 1 
ATOM   5081 O  OD2 . ASP B 2 320 ? 16.132  101.861 3.421   1.00 24.96 ? 820  ASP B OD2 1 
ATOM   5082 N  N   . PRO B 2 321 ? 13.178  97.945  4.427   1.00 26.01 ? 821  PRO B N   1 
ATOM   5083 C  CA  . PRO B 2 321 ? 12.587  97.418  5.660   1.00 25.42 ? 821  PRO B CA  1 
ATOM   5084 C  C   . PRO B 2 321 ? 13.043  98.067  6.970   1.00 24.35 ? 821  PRO B C   1 
ATOM   5085 O  O   . PRO B 2 321 ? 12.476  97.794  8.026   1.00 24.36 ? 821  PRO B O   1 
ATOM   5086 C  CB  . PRO B 2 321 ? 12.946  95.938  5.592   1.00 25.60 ? 821  PRO B CB  1 
ATOM   5087 C  CG  . PRO B 2 321 ? 14.302  95.972  4.985   1.00 26.11 ? 821  PRO B CG  1 
ATOM   5088 C  CD  . PRO B 2 321 ? 14.158  96.997  3.868   1.00 26.20 ? 821  PRO B CD  1 
ATOM   5089 N  N   . ALA B 2 322 ? 14.051  98.930  6.905   1.00 23.17 ? 822  ALA B N   1 
ATOM   5090 C  CA  . ALA B 2 322 ? 14.564  99.575  8.110   1.00 22.24 ? 822  ALA B CA  1 
ATOM   5091 C  C   . ALA B 2 322 ? 13.994  100.967 8.381   1.00 21.62 ? 822  ALA B C   1 
ATOM   5092 O  O   . ALA B 2 322 ? 14.253  101.551 9.434   1.00 21.06 ? 822  ALA B O   1 
ATOM   5093 C  CB  . ALA B 2 322 ? 16.082  99.643  8.045   1.00 22.16 ? 822  ALA B CB  1 
ATOM   5094 N  N   . LEU B 2 323 ? 13.219  101.497 7.440   1.00 20.93 ? 823  LEU B N   1 
ATOM   5095 C  CA  . LEU B 2 323 ? 12.633  102.828 7.605   1.00 20.88 ? 823  LEU B CA  1 
ATOM   5096 C  C   . LEU B 2 323 ? 11.745  102.946 8.835   1.00 20.57 ? 823  LEU B C   1 
ATOM   5097 O  O   . LEU B 2 323 ? 11.016  102.021 9.178   1.00 20.07 ? 823  LEU B O   1 
ATOM   5098 C  CB  . LEU B 2 323 ? 11.803  103.217 6.377   1.00 21.11 ? 823  LEU B CB  1 
ATOM   5099 C  CG  . LEU B 2 323 ? 12.531  103.689 5.121   1.00 21.55 ? 823  LEU B CG  1 
ATOM   5100 C  CD1 . LEU B 2 323 ? 11.498  104.053 4.050   1.00 21.54 ? 823  LEU B CD1 1 
ATOM   5101 C  CD2 . LEU B 2 323 ? 13.399  104.899 5.456   1.00 21.39 ? 823  LEU B CD2 1 
ATOM   5102 N  N   . SER B 2 324 ? 11.807  104.098 9.491   1.00 20.30 ? 824  SER B N   1 
ATOM   5103 C  CA  . SER B 2 324 ? 10.982  104.347 10.663  1.00 21.07 ? 824  SER B CA  1 
ATOM   5104 C  C   . SER B 2 324 ? 9.535   104.511 10.215  1.00 21.94 ? 824  SER B C   1 
ATOM   5105 O  O   . SER B 2 324 ? 9.269   104.914 9.082   1.00 21.11 ? 824  SER B O   1 
ATOM   5106 C  CB  . SER B 2 324 ? 11.424  105.629 11.367  1.00 20.91 ? 824  SER B CB  1 
ATOM   5107 O  OG  . SER B 2 324 ? 10.481  106.008 12.355  1.00 20.36 ? 824  SER B OG  1 
ATOM   5108 N  N   . MET B 2 325 ? 8.601   104.190 11.104  1.00 22.85 ? 825  MET B N   1 
ATOM   5109 C  CA  . MET B 2 325 ? 7.186   104.343 10.796  1.00 24.06 ? 825  MET B CA  1 
ATOM   5110 C  C   . MET B 2 325 ? 6.590   105.437 11.677  1.00 22.74 ? 825  MET B C   1 
ATOM   5111 O  O   . MET B 2 325 ? 5.372   105.544 11.800  1.00 22.12 ? 825  MET B O   1 
ATOM   5112 C  CB  . MET B 2 325 ? 6.431   103.032 11.034  1.00 27.46 ? 825  MET B CB  1 
ATOM   5113 C  CG  . MET B 2 325 ? 6.833   101.900 10.106  1.00 32.09 ? 825  MET B CG  1 
ATOM   5114 S  SD  . MET B 2 325 ? 5.769   100.449 10.309  1.00 38.50 ? 825  MET B SD  1 
ATOM   5115 C  CE  . MET B 2 325 ? 6.310   99.863  11.927  1.00 36.19 ? 825  MET B CE  1 
ATOM   5116 N  N   . SER B 2 326 ? 7.449   106.258 12.278  1.00 21.13 ? 826  SER B N   1 
ATOM   5117 C  CA  . SER B 2 326 ? 6.971   107.320 13.157  1.00 20.40 ? 826  SER B CA  1 
ATOM   5118 C  C   . SER B 2 326 ? 7.773   108.627 13.139  1.00 19.30 ? 826  SER B C   1 
ATOM   5119 O  O   . SER B 2 326 ? 7.268   109.658 13.581  1.00 19.18 ? 826  SER B O   1 
ATOM   5120 C  CB  . SER B 2 326 ? 6.910   106.800 14.593  1.00 20.29 ? 826  SER B CB  1 
ATOM   5121 O  OG  . SER B 2 326 ? 8.201   106.416 15.033  1.00 20.44 ? 826  SER B OG  1 
ATOM   5122 N  N   . HIS B 2 327 ? 9.010   108.590 12.646  1.00 18.58 ? 827  HIS B N   1 
ATOM   5123 C  CA  . HIS B 2 327 ? 9.839   109.799 12.606  1.00 18.36 ? 827  HIS B CA  1 
ATOM   5124 C  C   . HIS B 2 327 ? 10.644  109.972 11.322  1.00 17.57 ? 827  HIS B C   1 
ATOM   5125 O  O   . HIS B 2 327 ? 10.983  108.996 10.649  1.00 17.06 ? 827  HIS B O   1 
ATOM   5126 C  CB  . HIS B 2 327 ? 10.846  109.817 13.764  1.00 19.62 ? 827  HIS B CB  1 
ATOM   5127 C  CG  . HIS B 2 327 ? 10.225  109.835 15.126  1.00 21.54 ? 827  HIS B CG  1 
ATOM   5128 N  ND1 . HIS B 2 327 ? 9.819   108.688 15.774  1.00 22.88 ? 827  HIS B ND1 1 
ATOM   5129 C  CD2 . HIS B 2 327 ? 9.963   110.858 15.972  1.00 22.29 ? 827  HIS B CD2 1 
ATOM   5130 C  CE1 . HIS B 2 327 ? 9.334   109.005 16.963  1.00 22.69 ? 827  HIS B CE1 1 
ATOM   5131 N  NE2 . HIS B 2 327 ? 9.410   110.315 17.107  1.00 23.54 ? 827  HIS B NE2 1 
ATOM   5132 N  N   . TRP B 2 328 ? 10.951  111.229 11.001  1.00 16.72 ? 828  TRP B N   1 
ATOM   5133 C  CA  . TRP B 2 328 ? 11.779  111.556 9.844   1.00 16.40 ? 828  TRP B CA  1 
ATOM   5134 C  C   . TRP B 2 328 ? 13.189  111.305 10.370  1.00 16.55 ? 828  TRP B C   1 
ATOM   5135 O  O   . TRP B 2 328 ? 13.394  111.257 11.589  1.00 16.15 ? 828  TRP B O   1 
ATOM   5136 C  CB  . TRP B 2 328 ? 11.651  113.037 9.469   1.00 15.88 ? 828  TRP B CB  1 
ATOM   5137 C  CG  . TRP B 2 328 ? 10.279  113.462 9.045   1.00 15.39 ? 828  TRP B CG  1 
ATOM   5138 C  CD1 . TRP B 2 328 ? 9.564   114.519 9.535   1.00 15.91 ? 828  TRP B CD1 1 
ATOM   5139 C  CD2 . TRP B 2 328 ? 9.469   112.867 8.024   1.00 15.87 ? 828  TRP B CD2 1 
ATOM   5140 N  NE1 . TRP B 2 328 ? 8.357   114.620 8.882   1.00 15.77 ? 828  TRP B NE1 1 
ATOM   5141 C  CE2 . TRP B 2 328 ? 8.271   113.617 7.951   1.00 15.89 ? 828  TRP B CE2 1 
ATOM   5142 C  CE3 . TRP B 2 328 ? 9.636   111.770 7.163   1.00 15.62 ? 828  TRP B CE3 1 
ATOM   5143 C  CZ2 . TRP B 2 328 ? 7.244   113.307 7.051   1.00 15.68 ? 828  TRP B CZ2 1 
ATOM   5144 C  CZ3 . TRP B 2 328 ? 8.611   111.461 6.267   1.00 15.85 ? 828  TRP B CZ3 1 
ATOM   5145 C  CH2 . TRP B 2 328 ? 7.430   112.229 6.221   1.00 16.09 ? 828  TRP B CH2 1 
ATOM   5146 N  N   . MET B 2 329 ? 14.160  111.162 9.476   1.00 16.11 ? 829  MET B N   1 
ATOM   5147 C  CA  . MET B 2 329 ? 15.520  110.905 9.920   1.00 16.71 ? 829  MET B CA  1 
ATOM   5148 C  C   . MET B 2 329 ? 16.366  112.133 10.252  1.00 15.98 ? 829  MET B C   1 
ATOM   5149 O  O   . MET B 2 329 ? 17.465  112.313 9.727   1.00 16.22 ? 829  MET B O   1 
ATOM   5150 C  CB  . MET B 2 329 ? 16.248  109.998 8.914   1.00 16.65 ? 829  MET B CB  1 
ATOM   5151 C  CG  . MET B 2 329 ? 15.724  108.557 8.944   1.00 18.05 ? 829  MET B CG  1 
ATOM   5152 S  SD  . MET B 2 329 ? 16.581  107.403 7.839   1.00 18.89 ? 829  MET B SD  1 
ATOM   5153 C  CE  . MET B 2 329 ? 15.824  107.847 6.275   1.00 17.95 ? 829  MET B CE  1 
ATOM   5154 N  N   . PHE B 2 330 ? 15.829  112.982 11.121  1.00 15.44 ? 830  PHE B N   1 
ATOM   5155 C  CA  . PHE B 2 330 ? 16.536  114.160 11.613  1.00 15.04 ? 830  PHE B CA  1 
ATOM   5156 C  C   . PHE B 2 330 ? 15.928  114.424 12.988  1.00 14.86 ? 830  PHE B C   1 
ATOM   5157 O  O   . PHE B 2 330 ? 14.902  113.828 13.337  1.00 14.92 ? 830  PHE B O   1 
ATOM   5158 C  CB  . PHE B 2 330 ? 16.424  115.368 10.645  1.00 14.83 ? 830  PHE B CB  1 
ATOM   5159 C  CG  . PHE B 2 330 ? 15.078  116.057 10.625  1.00 15.69 ? 830  PHE B CG  1 
ATOM   5160 C  CD1 . PHE B 2 330 ? 14.786  117.074 11.529  1.00 15.32 ? 830  PHE B CD1 1 
ATOM   5161 C  CD2 . PHE B 2 330 ? 14.120  115.720 9.664   1.00 15.40 ? 830  PHE B CD2 1 
ATOM   5162 C  CE1 . PHE B 2 330 ? 13.563  117.750 11.480  1.00 15.41 ? 830  PHE B CE1 1 
ATOM   5163 C  CE2 . PHE B 2 330 ? 12.893  116.392 9.607   1.00 14.73 ? 830  PHE B CE2 1 
ATOM   5164 C  CZ  . PHE B 2 330 ? 12.617  117.407 10.517  1.00 14.82 ? 830  PHE B CZ  1 
ATOM   5165 N  N   . HIS B 2 331 ? 16.562  115.271 13.788  1.00 14.56 ? 831  HIS B N   1 
ATOM   5166 C  CA  . HIS B 2 331 ? 16.047  115.531 15.128  1.00 14.51 ? 831  HIS B CA  1 
ATOM   5167 C  C   . HIS B 2 331 ? 14.893  116.519 15.048  1.00 14.87 ? 831  HIS B C   1 
ATOM   5168 O  O   . HIS B 2 331 ? 15.090  117.734 15.055  1.00 14.76 ? 831  HIS B O   1 
ATOM   5169 C  CB  . HIS B 2 331 ? 17.159  116.071 16.030  1.00 14.54 ? 831  HIS B CB  1 
ATOM   5170 C  CG  . HIS B 2 331 ? 16.946  115.779 17.484  1.00 14.72 ? 831  HIS B CG  1 
ATOM   5171 N  ND1 . HIS B 2 331 ? 15.910  116.326 18.209  1.00 14.82 ? 831  HIS B ND1 1 
ATOM   5172 C  CD2 . HIS B 2 331 ? 17.628  114.984 18.343  1.00 14.86 ? 831  HIS B CD2 1 
ATOM   5173 C  CE1 . HIS B 2 331 ? 15.964  115.883 19.454  1.00 15.08 ? 831  HIS B CE1 1 
ATOM   5174 N  NE2 . HIS B 2 331 ? 16.997  115.066 19.561  1.00 15.13 ? 831  HIS B NE2 1 
ATOM   5175 N  N   . GLN B 2 332 ? 13.683  115.979 14.965  1.00 15.21 ? 832  GLN B N   1 
ATOM   5176 C  CA  . GLN B 2 332 ? 12.488  116.801 14.858  1.00 15.66 ? 832  GLN B CA  1 
ATOM   5177 C  C   . GLN B 2 332 ? 12.321  117.780 16.015  1.00 16.36 ? 832  GLN B C   1 
ATOM   5178 O  O   . GLN B 2 332 ? 11.971  118.945 15.802  1.00 16.07 ? 832  GLN B O   1 
ATOM   5179 C  CB  . GLN B 2 332 ? 11.256  115.901 14.730  1.00 15.43 ? 832  GLN B CB  1 
ATOM   5180 C  CG  . GLN B 2 332 ? 11.065  115.332 13.326  1.00 13.91 ? 832  GLN B CG  1 
ATOM   5181 C  CD  . GLN B 2 332 ? 10.046  114.206 13.283  1.00 14.73 ? 832  GLN B CD  1 
ATOM   5182 O  OE1 . GLN B 2 332 ? 10.407  113.027 13.255  1.00 13.91 ? 832  GLN B OE1 1 
ATOM   5183 N  NE2 . GLN B 2 332 ? 8.767   114.566 13.288  1.00 13.54 ? 832  GLN B NE2 1 
ATOM   5184 N  N   . GLN B 2 333 ? 12.585  117.322 17.236  1.00 16.55 ? 833  GLN B N   1 
ATOM   5185 C  CA  . GLN B 2 333 ? 12.440  118.198 18.389  1.00 16.99 ? 833  GLN B CA  1 
ATOM   5186 C  C   . GLN B 2 333 ? 13.457  119.335 18.369  1.00 16.06 ? 833  GLN B C   1 
ATOM   5187 O  O   . GLN B 2 333 ? 13.103  120.497 18.552  1.00 15.94 ? 833  GLN B O   1 
ATOM   5188 C  CB  . GLN B 2 333 ? 12.573  117.412 19.701  1.00 18.42 ? 833  GLN B CB  1 
ATOM   5189 C  CG  . GLN B 2 333 ? 12.132  118.235 20.906  1.00 22.85 ? 833  GLN B CG  1 
ATOM   5190 C  CD  . GLN B 2 333 ? 12.270  117.506 22.230  1.00 25.28 ? 833  GLN B CD  1 
ATOM   5191 O  OE1 . GLN B 2 333 ? 12.086  116.289 22.307  1.00 27.92 ? 833  GLN B OE1 1 
ATOM   5192 N  NE2 . GLN B 2 333 ? 12.574  118.253 23.286  1.00 25.01 ? 833  GLN B NE2 1 
ATOM   5193 N  N   . ALA B 2 334 ? 14.722  119.002 18.139  1.00 15.34 ? 834  ALA B N   1 
ATOM   5194 C  CA  . ALA B 2 334 ? 15.768  120.016 18.113  1.00 15.39 ? 834  ALA B CA  1 
ATOM   5195 C  C   . ALA B 2 334 ? 15.491  121.118 17.084  1.00 15.30 ? 834  ALA B C   1 
ATOM   5196 O  O   . ALA B 2 334 ? 15.745  122.295 17.348  1.00 14.82 ? 834  ALA B O   1 
ATOM   5197 C  CB  . ALA B 2 334 ? 17.125  119.360 17.837  1.00 15.52 ? 834  ALA B CB  1 
ATOM   5198 N  N   . LEU B 2 335 ? 14.977  120.747 15.913  1.00 14.38 ? 835  LEU B N   1 
ATOM   5199 C  CA  . LEU B 2 335 ? 14.689  121.751 14.895  1.00 14.61 ? 835  LEU B CA  1 
ATOM   5200 C  C   . LEU B 2 335 ? 13.571  122.675 15.373  1.00 14.77 ? 835  LEU B C   1 
ATOM   5201 O  O   . LEU B 2 335 ? 13.631  123.893 15.187  1.00 14.79 ? 835  LEU B O   1 
ATOM   5202 C  CB  . LEU B 2 335 ? 14.283  121.090 13.570  1.00 14.33 ? 835  LEU B CB  1 
ATOM   5203 C  CG  . LEU B 2 335 ? 13.980  122.098 12.452  1.00 14.59 ? 835  LEU B CG  1 
ATOM   5204 C  CD1 . LEU B 2 335 ? 15.188  123.015 12.249  1.00 13.84 ? 835  LEU B CD1 1 
ATOM   5205 C  CD2 . LEU B 2 335 ? 13.644  121.364 11.162  1.00 13.91 ? 835  LEU B CD2 1 
ATOM   5206 N  N   . GLN B 2 336 ? 12.548  122.097 15.995  1.00 14.90 ? 836  GLN B N   1 
ATOM   5207 C  CA  . GLN B 2 336 ? 11.440  122.900 16.497  1.00 15.10 ? 836  GLN B CA  1 
ATOM   5208 C  C   . GLN B 2 336 ? 11.938  123.869 17.574  1.00 15.07 ? 836  GLN B C   1 
ATOM   5209 O  O   . GLN B 2 336 ? 11.479  125.004 17.658  1.00 14.97 ? 836  GLN B O   1 
ATOM   5210 C  CB  . GLN B 2 336 ? 10.330  121.993 17.048  1.00 15.86 ? 836  GLN B CB  1 
ATOM   5211 C  CG  . GLN B 2 336 ? 9.620   121.177 15.960  1.00 16.30 ? 836  GLN B CG  1 
ATOM   5212 C  CD  . GLN B 2 336 ? 8.462   120.352 16.492  1.00 17.15 ? 836  GLN B CD  1 
ATOM   5213 O  OE1 . GLN B 2 336 ? 7.554   120.877 17.139  1.00 17.70 ? 836  GLN B OE1 1 
ATOM   5214 N  NE2 . GLN B 2 336 ? 8.482   119.055 16.209  1.00 17.61 ? 836  GLN B NE2 1 
ATOM   5215 N  N   . GLU B 2 337 ? 12.894  123.420 18.382  1.00 15.11 ? 837  GLU B N   1 
ATOM   5216 C  CA  . GLU B 2 337 ? 13.451  124.259 19.437  1.00 15.21 ? 837  GLU B CA  1 
ATOM   5217 C  C   . GLU B 2 337 ? 14.221  125.436 18.848  1.00 15.27 ? 837  GLU B C   1 
ATOM   5218 O  O   . GLU B 2 337 ? 14.101  126.568 19.326  1.00 14.64 ? 837  GLU B O   1 
ATOM   5219 C  CB  . GLU B 2 337 ? 14.344  123.413 20.360  1.00 14.95 ? 837  GLU B CB  1 
ATOM   5220 C  CG  . GLU B 2 337 ? 13.532  122.514 21.305  1.00 16.07 ? 837  GLU B CG  1 
ATOM   5221 C  CD  . GLU B 2 337 ? 14.384  121.570 22.140  1.00 16.77 ? 837  GLU B CD  1 
ATOM   5222 O  OE1 . GLU B 2 337 ? 15.591  121.838 22.308  1.00 16.86 ? 837  GLU B OE1 1 
ATOM   5223 O  OE2 . GLU B 2 337 ? 13.836  120.561 22.642  1.00 16.77 ? 837  GLU B OE2 1 
ATOM   5224 N  N   . TYR B 2 338 ? 14.998  125.179 17.798  1.00 15.02 ? 838  TYR B N   1 
ATOM   5225 C  CA  . TYR B 2 338 ? 15.755  126.250 17.164  1.00 15.13 ? 838  TYR B CA  1 
ATOM   5226 C  C   . TYR B 2 338 ? 14.818  127.296 16.568  1.00 15.30 ? 838  TYR B C   1 
ATOM   5227 O  O   . TYR B 2 338 ? 14.995  128.498 16.773  1.00 15.16 ? 838  TYR B O   1 
ATOM   5228 C  CB  . TYR B 2 338 ? 16.662  125.713 16.049  1.00 15.12 ? 838  TYR B CB  1 
ATOM   5229 C  CG  . TYR B 2 338 ? 17.389  126.832 15.331  1.00 14.52 ? 838  TYR B CG  1 
ATOM   5230 C  CD1 . TYR B 2 338 ? 18.359  127.584 15.991  1.00 14.59 ? 838  TYR B CD1 1 
ATOM   5231 C  CD2 . TYR B 2 338 ? 17.054  127.187 14.025  1.00 14.93 ? 838  TYR B CD2 1 
ATOM   5232 C  CE1 . TYR B 2 338 ? 18.976  128.668 15.378  1.00 14.57 ? 838  TYR B CE1 1 
ATOM   5233 C  CE2 . TYR B 2 338 ? 17.668  128.278 13.394  1.00 14.13 ? 838  TYR B CE2 1 
ATOM   5234 C  CZ  . TYR B 2 338 ? 18.624  129.012 14.081  1.00 14.76 ? 838  TYR B CZ  1 
ATOM   5235 O  OH  . TYR B 2 338 ? 19.214  130.101 13.485  1.00 14.77 ? 838  TYR B OH  1 
ATOM   5236 N  N   . ILE B 2 339 ? 13.822  126.834 15.822  1.00 15.44 ? 839  ILE B N   1 
ATOM   5237 C  CA  . ILE B 2 339 ? 12.870  127.737 15.193  1.00 15.34 ? 839  ILE B CA  1 
ATOM   5238 C  C   . ILE B 2 339 ? 12.078  128.554 16.218  1.00 15.88 ? 839  ILE B C   1 
ATOM   5239 O  O   . ILE B 2 339 ? 12.054  129.784 16.163  1.00 16.18 ? 839  ILE B O   1 
ATOM   5240 C  CB  . ILE B 2 339 ? 11.871  126.958 14.307  1.00 14.97 ? 839  ILE B CB  1 
ATOM   5241 C  CG1 . ILE B 2 339 ? 12.621  126.244 13.174  1.00 15.01 ? 839  ILE B CG1 1 
ATOM   5242 C  CG2 . ILE B 2 339 ? 10.822  127.913 13.735  1.00 14.70 ? 839  ILE B CG2 1 
ATOM   5243 C  CD1 . ILE B 2 339 ? 11.741  125.327 12.331  1.00 14.13 ? 839  ILE B CD1 1 
ATOM   5244 N  N   . LEU B 2 340 ? 11.439  127.865 17.157  1.00 15.78 ? 840  LEU B N   1 
ATOM   5245 C  CA  . LEU B 2 340 ? 10.620  128.537 18.164  1.00 16.10 ? 840  LEU B CA  1 
ATOM   5246 C  C   . LEU B 2 340 ? 11.372  129.469 19.107  1.00 16.19 ? 840  LEU B C   1 
ATOM   5247 O  O   . LEU B 2 340 ? 10.873  130.545 19.435  1.00 15.87 ? 840  LEU B O   1 
ATOM   5248 C  CB  . LEU B 2 340 ? 9.835   127.503 18.981  1.00 15.68 ? 840  LEU B CB  1 
ATOM   5249 C  CG  . LEU B 2 340 ? 8.769   126.719 18.204  1.00 16.14 ? 840  LEU B CG  1 
ATOM   5250 C  CD1 . LEU B 2 340 ? 8.181   125.626 19.085  1.00 15.88 ? 840  LEU B CD1 1 
ATOM   5251 C  CD2 . LEU B 2 340 ? 7.672   127.676 17.730  1.00 16.42 ? 840  LEU B CD2 1 
ATOM   5252 N  N   . MET B 2 341 ? 12.563  129.069 19.545  1.00 16.03 ? 841  MET B N   1 
ATOM   5253 C  CA  . MET B 2 341 ? 13.337  129.902 20.466  1.00 16.34 ? 841  MET B CA  1 
ATOM   5254 C  C   . MET B 2 341 ? 14.248  130.929 19.807  1.00 16.46 ? 841  MET B C   1 
ATOM   5255 O  O   . MET B 2 341 ? 14.458  132.008 20.357  1.00 16.33 ? 841  MET B O   1 
ATOM   5256 C  CB  . MET B 2 341 ? 14.198  129.033 21.394  1.00 16.52 ? 841  MET B CB  1 
ATOM   5257 C  CG  . MET B 2 341 ? 13.429  128.294 22.485  1.00 17.08 ? 841  MET B CG  1 
ATOM   5258 S  SD  . MET B 2 341 ? 14.552  127.504 23.670  1.00 18.20 ? 841  MET B SD  1 
ATOM   5259 C  CE  . MET B 2 341 ? 14.908  125.947 22.807  1.00 16.60 ? 841  MET B CE  1 
ATOM   5260 N  N   . CYS B 2 342 ? 14.775  130.611 18.629  1.00 16.15 ? 842  CYS B N   1 
ATOM   5261 C  CA  . CYS B 2 342 ? 15.716  131.513 17.972  1.00 16.32 ? 842  CYS B CA  1 
ATOM   5262 C  C   . CYS B 2 342 ? 15.280  132.223 16.696  1.00 16.49 ? 842  CYS B C   1 
ATOM   5263 O  O   . CYS B 2 342 ? 15.909  133.204 16.304  1.00 16.48 ? 842  CYS B O   1 
ATOM   5264 C  CB  . CYS B 2 342 ? 17.014  130.756 17.659  1.00 16.60 ? 842  CYS B CB  1 
ATOM   5265 S  SG  . CYS B 2 342 ? 17.709  129.814 19.033  1.00 18.08 ? 842  CYS B SG  1 
ATOM   5266 N  N   . CYS B 2 343 ? 14.219  131.757 16.047  1.00 16.08 ? 843  CYS B N   1 
ATOM   5267 C  CA  . CYS B 2 343 ? 13.825  132.366 14.779  1.00 17.02 ? 843  CYS B CA  1 
ATOM   5268 C  C   . CYS B 2 343 ? 12.554  133.203 14.733  1.00 17.44 ? 843  CYS B C   1 
ATOM   5269 O  O   . CYS B 2 343 ? 12.081  133.535 13.652  1.00 17.19 ? 843  CYS B O   1 
ATOM   5270 C  CB  . CYS B 2 343 ? 13.745  131.282 13.700  1.00 16.02 ? 843  CYS B CB  1 
ATOM   5271 S  SG  . CYS B 2 343 ? 15.298  130.382 13.448  1.00 16.45 ? 843  CYS B SG  1 
ATOM   5272 N  N   . GLN B 2 344 ? 11.999  133.548 15.888  1.00 17.94 ? 844  GLN B N   1 
ATOM   5273 C  CA  . GLN B 2 344 ? 10.788  134.356 15.901  1.00 19.10 ? 844  GLN B CA  1 
ATOM   5274 C  C   . GLN B 2 344 ? 11.071  135.812 16.244  1.00 20.15 ? 844  GLN B C   1 
ATOM   5275 O  O   . GLN B 2 344 ? 11.735  136.103 17.235  1.00 19.94 ? 844  GLN B O   1 
ATOM   5276 C  CB  . GLN B 2 344 ? 9.780   133.809 16.914  1.00 19.07 ? 844  GLN B CB  1 
ATOM   5277 C  CG  . GLN B 2 344 ? 9.181   132.451 16.571  1.00 18.33 ? 844  GLN B CG  1 
ATOM   5278 C  CD  . GLN B 2 344 ? 8.064   132.081 17.523  1.00 18.54 ? 844  GLN B CD  1 
ATOM   5279 O  OE1 . GLN B 2 344 ? 8.298   131.505 18.593  1.00 19.70 ? 844  GLN B OE1 1 
ATOM   5280 N  NE2 . GLN B 2 344 ? 6.841   132.431 17.153  1.00 17.55 ? 844  GLN B NE2 1 
ATOM   5281 N  N   . CYS B 2 345 ? 10.568  136.722 15.419  1.00 21.22 ? 845  CYS B N   1 
ATOM   5282 C  CA  . CYS B 2 345 ? 10.731  138.141 15.693  1.00 23.14 ? 845  CYS B CA  1 
ATOM   5283 C  C   . CYS B 2 345 ? 9.593   138.507 16.636  1.00 24.10 ? 845  CYS B C   1 
ATOM   5284 O  O   . CYS B 2 345 ? 8.430   138.214 16.355  1.00 24.24 ? 845  CYS B O   1 
ATOM   5285 C  CB  . CYS B 2 345 ? 10.616  138.968 14.412  1.00 23.44 ? 845  CYS B CB  1 
ATOM   5286 S  SG  . CYS B 2 345 ? 10.627  140.760 14.702  1.00 24.66 ? 845  CYS B SG  1 
ATOM   5287 N  N   . PRO B 2 346 ? 9.912   139.136 17.778  1.00 25.31 ? 846  PRO B N   1 
ATOM   5288 C  CA  . PRO B 2 346 ? 8.889   139.531 18.752  1.00 25.90 ? 846  PRO B CA  1 
ATOM   5289 C  C   . PRO B 2 346 ? 7.743   140.323 18.124  1.00 25.95 ? 846  PRO B C   1 
ATOM   5290 O  O   . PRO B 2 346 ? 6.591   140.195 18.535  1.00 27.04 ? 846  PRO B O   1 
ATOM   5291 C  CB  . PRO B 2 346 ? 9.681   140.364 19.759  1.00 26.40 ? 846  PRO B CB  1 
ATOM   5292 C  CG  . PRO B 2 346 ? 11.021  139.697 19.744  1.00 26.71 ? 846  PRO B CG  1 
ATOM   5293 C  CD  . PRO B 2 346 ? 11.259  139.487 18.261  1.00 25.88 ? 846  PRO B CD  1 
ATOM   5294 N  N   . ALA B 2 347 ? 8.066   141.134 17.123  1.00 25.56 ? 847  ALA B N   1 
ATOM   5295 C  CA  . ALA B 2 347 ? 7.072   141.958 16.443  1.00 25.47 ? 847  ALA B CA  1 
ATOM   5296 C  C   . ALA B 2 347 ? 6.306   141.212 15.351  1.00 24.81 ? 847  ALA B C   1 
ATOM   5297 O  O   . ALA B 2 347 ? 5.458   141.796 14.675  1.00 25.68 ? 847  ALA B O   1 
ATOM   5298 C  CB  . ALA B 2 347 ? 7.749   143.186 15.847  1.00 25.34 ? 847  ALA B CB  1 
ATOM   5299 N  N   . GLY B 2 348 ? 6.596   139.926 15.179  1.00 23.69 ? 848  GLY B N   1 
ATOM   5300 C  CA  . GLY B 2 348 ? 5.925   139.156 14.148  1.00 21.80 ? 848  GLY B CA  1 
ATOM   5301 C  C   . GLY B 2 348 ? 6.881   138.866 13.003  1.00 21.00 ? 848  GLY B C   1 
ATOM   5302 O  O   . GLY B 2 348 ? 7.720   139.700 12.662  1.00 20.42 ? 848  GLY B O   1 
ATOM   5303 N  N   . GLY B 2 349 ? 6.755   137.686 12.405  1.00 20.06 ? 849  GLY B N   1 
ATOM   5304 C  CA  . GLY B 2 349 ? 7.640   137.314 11.317  1.00 18.79 ? 849  GLY B CA  1 
ATOM   5305 C  C   . GLY B 2 349 ? 8.749   136.435 11.860  1.00 18.50 ? 849  GLY B C   1 
ATOM   5306 O  O   . GLY B 2 349 ? 8.997   136.428 13.067  1.00 17.96 ? 849  GLY B O   1 
ATOM   5307 N  N   . LEU B 2 350 ? 9.404   135.677 10.987  1.00 17.72 ? 850  LEU B N   1 
ATOM   5308 C  CA  . LEU B 2 350 ? 10.486  134.813 11.422  1.00 17.50 ? 850  LEU B CA  1 
ATOM   5309 C  C   . LEU B 2 350 ? 11.768  135.148 10.684  1.00 18.28 ? 850  LEU B C   1 
ATOM   5310 O  O   . LEU B 2 350 ? 11.769  135.951 9.746   1.00 18.14 ? 850  LEU B O   1 
ATOM   5311 C  CB  . LEU B 2 350 ? 10.112  133.336 11.254  1.00 16.32 ? 850  LEU B CB  1 
ATOM   5312 C  CG  . LEU B 2 350 ? 9.017   132.886 12.234  1.00 16.30 ? 850  LEU B CG  1 
ATOM   5313 C  CD1 . LEU B 2 350 ? 7.652   133.093 11.598  1.00 15.49 ? 850  LEU B CD1 1 
ATOM   5314 C  CD2 . LEU B 2 350 ? 9.202   131.427 12.608  1.00 16.17 ? 850  LEU B CD2 1 
ATOM   5315 N  N   . LEU B 2 351 ? 12.866  134.530 11.096  1.00 18.56 ? 851  LEU B N   1 
ATOM   5316 C  CA  . LEU B 2 351 ? 14.131  134.866 10.477  1.00 19.16 ? 851  LEU B CA  1 
ATOM   5317 C  C   . LEU B 2 351 ? 15.223  133.811 10.449  1.00 18.48 ? 851  LEU B C   1 
ATOM   5318 O  O   . LEU B 2 351 ? 15.049  132.680 10.902  1.00 17.72 ? 851  LEU B O   1 
ATOM   5319 C  CB  . LEU B 2 351 ? 14.656  136.138 11.140  1.00 21.84 ? 851  LEU B CB  1 
ATOM   5320 C  CG  . LEU B 2 351 ? 14.392  136.178 12.646  1.00 22.41 ? 851  LEU B CG  1 
ATOM   5321 C  CD1 . LEU B 2 351 ? 15.479  135.401 13.354  1.00 24.25 ? 851  LEU B CD1 1 
ATOM   5322 C  CD2 . LEU B 2 351 ? 14.354  137.617 13.138  1.00 24.20 ? 851  LEU B CD2 1 
ATOM   5323 N  N   . ASP B 2 352 ? 16.348  134.228 9.883   1.00 17.82 ? 852  ASP B N   1 
ATOM   5324 C  CA  . ASP B 2 352 ? 17.554  133.427 9.716   1.00 17.69 ? 852  ASP B CA  1 
ATOM   5325 C  C   . ASP B 2 352 ? 18.108  132.967 11.065  1.00 18.02 ? 852  ASP B C   1 
ATOM   5326 O  O   . ASP B 2 352 ? 18.147  131.767 11.365  1.00 17.19 ? 852  ASP B O   1 
ATOM   5327 C  CB  . ASP B 2 352 ? 18.570  134.291 8.958   1.00 16.96 ? 852  ASP B CB  1 
ATOM   5328 C  CG  . ASP B 2 352 ? 19.970  133.714 8.946   1.00 16.90 ? 852  ASP B CG  1 
ATOM   5329 O  OD1 . ASP B 2 352 ? 20.262  132.735 9.661   1.00 16.15 ? 852  ASP B OD1 1 
ATOM   5330 O  OD2 . ASP B 2 352 ? 20.796  134.280 8.209   1.00 16.53 ? 852  ASP B OD2 1 
ATOM   5331 N  N   . LYS B 2 353 ? 18.547  133.923 11.873  1.00 18.31 ? 853  LYS B N   1 
ATOM   5332 C  CA  . LYS B 2 353 ? 19.094  133.612 13.192  1.00 19.12 ? 853  LYS B CA  1 
ATOM   5333 C  C   . LYS B 2 353 ? 18.995  134.857 14.065  1.00 19.69 ? 853  LYS B C   1 
ATOM   5334 O  O   . LYS B 2 353 ? 18.729  135.952 13.566  1.00 19.66 ? 853  LYS B O   1 
ATOM   5335 C  CB  . LYS B 2 353 ? 20.560  133.158 13.078  1.00 18.83 ? 853  LYS B CB  1 
ATOM   5336 C  CG  . LYS B 2 353 ? 21.505  134.201 12.484  1.00 19.33 ? 853  LYS B CG  1 
ATOM   5337 C  CD  . LYS B 2 353 ? 22.971  133.766 12.567  1.00 19.38 ? 853  LYS B CD  1 
ATOM   5338 C  CE  . LYS B 2 353 ? 23.260  132.509 11.744  1.00 18.92 ? 853  LYS B CE  1 
ATOM   5339 N  NZ  . LYS B 2 353 ? 23.087  132.721 10.266  1.00 18.28 ? 853  LYS B NZ  1 
ATOM   5340 N  N   . PRO B 2 354 ? 19.197  134.706 15.383  1.00 20.21 ? 854  PRO B N   1 
ATOM   5341 C  CA  . PRO B 2 354 ? 19.117  135.861 16.282  1.00 21.06 ? 854  PRO B CA  1 
ATOM   5342 C  C   . PRO B 2 354 ? 20.022  136.995 15.809  1.00 21.62 ? 854  PRO B C   1 
ATOM   5343 O  O   . PRO B 2 354 ? 21.194  136.779 15.499  1.00 21.97 ? 854  PRO B O   1 
ATOM   5344 C  CB  . PRO B 2 354 ? 19.571  135.282 17.623  1.00 21.14 ? 854  PRO B CB  1 
ATOM   5345 C  CG  . PRO B 2 354 ? 19.117  133.852 17.542  1.00 20.31 ? 854  PRO B CG  1 
ATOM   5346 C  CD  . PRO B 2 354 ? 19.506  133.474 16.130  1.00 20.24 ? 854  PRO B CD  1 
ATOM   5347 N  N   . GLY B 2 355 ? 19.476  138.203 15.746  1.00 22.86 ? 855  GLY B N   1 
ATOM   5348 C  CA  . GLY B 2 355 ? 20.275  139.334 15.310  1.00 23.75 ? 855  GLY B CA  1 
ATOM   5349 C  C   . GLY B 2 355 ? 19.950  139.773 13.897  1.00 24.41 ? 855  GLY B C   1 
ATOM   5350 O  O   . GLY B 2 355 ? 20.292  140.885 13.491  1.00 24.51 ? 855  GLY B O   1 
ATOM   5351 N  N   . LYS B 2 356 ? 19.297  138.895 13.142  1.00 24.01 ? 856  LYS B N   1 
ATOM   5352 C  CA  . LYS B 2 356 ? 18.916  139.205 11.771  1.00 24.54 ? 856  LYS B CA  1 
ATOM   5353 C  C   . LYS B 2 356 ? 17.525  139.819 11.779  1.00 24.72 ? 856  LYS B C   1 
ATOM   5354 O  O   . LYS B 2 356 ? 16.774  139.668 12.743  1.00 24.62 ? 856  LYS B O   1 
ATOM   5355 C  CB  . LYS B 2 356 ? 18.891  137.935 10.917  1.00 25.24 ? 856  LYS B CB  1 
ATOM   5356 C  CG  . LYS B 2 356 ? 20.220  137.198 10.833  1.00 25.80 ? 856  LYS B CG  1 
ATOM   5357 C  CD  . LYS B 2 356 ? 21.278  138.026 10.127  1.00 27.11 ? 856  LYS B CD  1 
ATOM   5358 C  CE  . LYS B 2 356 ? 22.526  137.199 9.880   1.00 28.21 ? 856  LYS B CE  1 
ATOM   5359 N  NZ  . LYS B 2 356 ? 23.580  137.971 9.173   1.00 30.18 ? 856  LYS B NZ  1 
ATOM   5360 N  N   . SER B 2 357 ? 17.172  140.503 10.701  1.00 24.47 ? 857  SER B N   1 
ATOM   5361 C  CA  . SER B 2 357 ? 15.857  141.113 10.626  1.00 24.51 ? 857  SER B CA  1 
ATOM   5362 C  C   . SER B 2 357 ? 14.883  140.167 9.936   1.00 23.47 ? 857  SER B C   1 
ATOM   5363 O  O   . SER B 2 357 ? 15.273  139.327 9.127   1.00 23.40 ? 857  SER B O   1 
ATOM   5364 C  CB  . SER B 2 357 ? 15.931  142.436 9.866   1.00 25.69 ? 857  SER B CB  1 
ATOM   5365 O  OG  . SER B 2 357 ? 16.337  142.227 8.526   1.00 28.39 ? 857  SER B OG  1 
ATOM   5366 N  N   . ARG B 2 358 ? 13.610  140.307 10.267  1.00 22.43 ? 858  ARG B N   1 
ATOM   5367 C  CA  . ARG B 2 358 ? 12.574  139.472 9.683   1.00 21.61 ? 858  ARG B CA  1 
ATOM   5368 C  C   . ARG B 2 358 ? 12.376  139.795 8.202   1.00 20.71 ? 858  ARG B C   1 
ATOM   5369 O  O   . ARG B 2 358 ? 12.690  140.890 7.740   1.00 20.12 ? 858  ARG B O   1 
ATOM   5370 C  CB  . ARG B 2 358 ? 11.256  139.718 10.412  1.00 21.96 ? 858  ARG B CB  1 
ATOM   5371 C  CG  . ARG B 2 358 ? 10.739  141.145 10.211  1.00 22.27 ? 858  ARG B CG  1 
ATOM   5372 C  CD  . ARG B 2 358 ? 9.471   141.407 10.990  1.00 23.10 ? 858  ARG B CD  1 
ATOM   5373 N  NE  . ARG B 2 358 ? 8.966   142.759 10.762  1.00 23.32 ? 858  ARG B NE  1 
ATOM   5374 C  CZ  . ARG B 2 358 ? 7.907   143.273 11.381  1.00 24.18 ? 858  ARG B CZ  1 
ATOM   5375 N  NH1 . ARG B 2 358 ? 7.242   142.543 12.269  1.00 23.73 ? 858  ARG B NH1 1 
ATOM   5376 N  NH2 . ARG B 2 358 ? 7.506   144.510 11.107  1.00 24.06 ? 858  ARG B NH2 1 
ATOM   5377 N  N   . ASP B 2 359 ? 11.862  138.822 7.463   1.00 19.61 ? 859  ASP B N   1 
ATOM   5378 C  CA  . ASP B 2 359 ? 11.539  139.007 6.055   1.00 19.22 ? 859  ASP B CA  1 
ATOM   5379 C  C   . ASP B 2 359 ? 10.559  137.897 5.707   1.00 18.47 ? 859  ASP B C   1 
ATOM   5380 O  O   . ASP B 2 359 ? 10.483  136.887 6.409   1.00 17.52 ? 859  ASP B O   1 
ATOM   5381 C  CB  . ASP B 2 359 ? 12.789  138.980 5.156   1.00 19.73 ? 859  ASP B CB  1 
ATOM   5382 C  CG  . ASP B 2 359 ? 13.535  137.666 5.209   1.00 20.77 ? 859  ASP B CG  1 
ATOM   5383 O  OD1 . ASP B 2 359 ? 12.932  136.618 4.915   1.00 20.53 ? 859  ASP B OD1 1 
ATOM   5384 O  OD2 . ASP B 2 359 ? 14.740  137.690 5.537   1.00 22.58 ? 859  ASP B OD2 1 
ATOM   5385 N  N   . PHE B 2 360 ? 9.791   138.086 4.643   1.00 17.80 ? 860  PHE B N   1 
ATOM   5386 C  CA  . PHE B 2 360 ? 8.794   137.097 4.268   1.00 17.49 ? 860  PHE B CA  1 
ATOM   5387 C  C   . PHE B 2 360 ? 9.362   135.760 3.821   1.00 16.87 ? 860  PHE B C   1 
ATOM   5388 O  O   . PHE B 2 360 ? 8.734   134.720 4.015   1.00 17.51 ? 860  PHE B O   1 
ATOM   5389 C  CB  . PHE B 2 360 ? 7.865   137.694 3.215   1.00 17.74 ? 860  PHE B CB  1 
ATOM   5390 C  CG  . PHE B 2 360 ? 7.102   138.887 3.717   1.00 18.64 ? 860  PHE B CG  1 
ATOM   5391 C  CD1 . PHE B 2 360 ? 7.445   140.175 3.314   1.00 19.01 ? 860  PHE B CD1 1 
ATOM   5392 C  CD2 . PHE B 2 360 ? 6.078   138.726 4.649   1.00 18.83 ? 860  PHE B CD2 1 
ATOM   5393 C  CE1 . PHE B 2 360 ? 6.777   141.289 3.836   1.00 19.85 ? 860  PHE B CE1 1 
ATOM   5394 C  CE2 . PHE B 2 360 ? 5.406   139.832 5.177   1.00 19.01 ? 860  PHE B CE2 1 
ATOM   5395 C  CZ  . PHE B 2 360 ? 5.756   141.112 4.770   1.00 19.27 ? 860  PHE B CZ  1 
ATOM   5396 N  N   . TYR B 2 361 ? 10.552  135.787 3.232   1.00 16.58 ? 861  TYR B N   1 
ATOM   5397 C  CA  . TYR B 2 361 ? 11.214  134.568 2.783   1.00 16.19 ? 861  TYR B CA  1 
ATOM   5398 C  C   . TYR B 2 361 ? 11.472  133.660 3.991   1.00 15.98 ? 861  TYR B C   1 
ATOM   5399 O  O   . TYR B 2 361 ? 11.091  132.489 3.988   1.00 16.31 ? 861  TYR B O   1 
ATOM   5400 C  CB  . TYR B 2 361 ? 12.537  134.924 2.100   1.00 15.65 ? 861  TYR B CB  1 
ATOM   5401 C  CG  . TYR B 2 361 ? 13.499  133.763 1.919   1.00 15.44 ? 861  TYR B CG  1 
ATOM   5402 C  CD1 . TYR B 2 361 ? 13.438  132.940 0.793   1.00 15.00 ? 861  TYR B CD1 1 
ATOM   5403 C  CD2 . TYR B 2 361 ? 14.486  133.504 2.872   1.00 14.96 ? 861  TYR B CD2 1 
ATOM   5404 C  CE1 . TYR B 2 361 ? 14.347  131.886 0.620   1.00 15.32 ? 861  TYR B CE1 1 
ATOM   5405 C  CE2 . TYR B 2 361 ? 15.392  132.459 2.712   1.00 14.45 ? 861  TYR B CE2 1 
ATOM   5406 C  CZ  . TYR B 2 361 ? 15.321  131.655 1.588   1.00 14.99 ? 861  TYR B CZ  1 
ATOM   5407 O  OH  . TYR B 2 361 ? 16.227  130.626 1.439   1.00 15.51 ? 861  TYR B OH  1 
ATOM   5408 N  N   . HIS B 2 362 ? 12.117  134.195 5.025   1.00 15.02 ? 862  HIS B N   1 
ATOM   5409 C  CA  . HIS B 2 362 ? 12.399  133.385 6.207   1.00 15.40 ? 862  HIS B CA  1 
ATOM   5410 C  C   . HIS B 2 362 ? 11.134  133.016 6.963   1.00 14.94 ? 862  HIS B C   1 
ATOM   5411 O  O   . HIS B 2 362 ? 11.059  131.950 7.571   1.00 15.08 ? 862  HIS B O   1 
ATOM   5412 C  CB  . HIS B 2 362 ? 13.406  134.081 7.135   1.00 15.03 ? 862  HIS B CB  1 
ATOM   5413 C  CG  . HIS B 2 362 ? 14.814  134.027 6.625   1.00 15.74 ? 862  HIS B CG  1 
ATOM   5414 N  ND1 . HIS B 2 362 ? 15.407  135.076 5.954   1.00 15.11 ? 862  HIS B ND1 1 
ATOM   5415 C  CD2 . HIS B 2 362 ? 15.712  133.013 6.604   1.00 15.70 ? 862  HIS B CD2 1 
ATOM   5416 C  CE1 . HIS B 2 362 ? 16.607  134.708 5.539   1.00 15.27 ? 862  HIS B CE1 1 
ATOM   5417 N  NE2 . HIS B 2 362 ? 16.815  133.461 5.919   1.00 15.60 ? 862  HIS B NE2 1 
ATOM   5418 N  N   . THR B 2 363 ? 10.128  133.881 6.912   1.00 14.52 ? 863  THR B N   1 
ATOM   5419 C  CA  . THR B 2 363 ? 8.878   133.577 7.590   1.00 15.15 ? 863  THR B CA  1 
ATOM   5420 C  C   . THR B 2 363 ? 8.266   132.344 6.934   1.00 14.95 ? 863  THR B C   1 
ATOM   5421 O  O   . THR B 2 363 ? 7.799   131.434 7.617   1.00 15.14 ? 863  THR B O   1 
ATOM   5422 C  CB  . THR B 2 363 ? 7.896   134.763 7.502   1.00 15.30 ? 863  THR B CB  1 
ATOM   5423 O  OG1 . THR B 2 363 ? 8.421   135.861 8.258   1.00 15.51 ? 863  THR B OG1 1 
ATOM   5424 C  CG2 . THR B 2 363 ? 6.528   134.378 8.054   1.00 15.35 ? 863  THR B CG2 1 
ATOM   5425 N  N   . CYS B 2 364 ? 8.285   132.313 5.604   1.00 14.62 ? 864  CYS B N   1 
ATOM   5426 C  CA  . CYS B 2 364 ? 7.735   131.189 4.856   1.00 13.97 ? 864  CYS B CA  1 
ATOM   5427 C  C   . CYS B 2 364 ? 8.478   129.877 5.113   1.00 13.66 ? 864  CYS B C   1 
ATOM   5428 O  O   . CYS B 2 364 ? 7.869   128.860 5.447   1.00 13.99 ? 864  CYS B O   1 
ATOM   5429 C  CB  . CYS B 2 364 ? 7.762   131.495 3.350   1.00 14.66 ? 864  CYS B CB  1 
ATOM   5430 S  SG  . CYS B 2 364 ? 7.397   130.063 2.292   1.00 15.47 ? 864  CYS B SG  1 
ATOM   5431 N  N   . TYR B 2 365 ? 9.797   129.898 4.975   1.00 12.86 ? 865  TYR B N   1 
ATOM   5432 C  CA  . TYR B 2 365 ? 10.564  128.676 5.149   1.00 13.13 ? 865  TYR B CA  1 
ATOM   5433 C  C   . TYR B 2 365 ? 10.755  128.205 6.590   1.00 13.11 ? 865  TYR B C   1 
ATOM   5434 O  O   . TYR B 2 365 ? 10.866  127.002 6.830   1.00 12.51 ? 865  TYR B O   1 
ATOM   5435 C  CB  . TYR B 2 365 ? 11.882  128.797 4.378   1.00 12.75 ? 865  TYR B CB  1 
ATOM   5436 C  CG  . TYR B 2 365 ? 11.595  128.834 2.888   1.00 13.53 ? 865  TYR B CG  1 
ATOM   5437 C  CD1 . TYR B 2 365 ? 11.727  130.015 2.155   1.00 13.41 ? 865  TYR B CD1 1 
ATOM   5438 C  CD2 . TYR B 2 365 ? 11.070  127.710 2.237   1.00 12.68 ? 865  TYR B CD2 1 
ATOM   5439 C  CE1 . TYR B 2 365 ? 11.335  130.079 0.809   1.00 13.46 ? 865  TYR B CE1 1 
ATOM   5440 C  CE2 . TYR B 2 365 ? 10.677  127.766 0.896   1.00 12.95 ? 865  TYR B CE2 1 
ATOM   5441 C  CZ  . TYR B 2 365 ? 10.810  128.953 0.193   1.00 12.99 ? 865  TYR B CZ  1 
ATOM   5442 O  OH  . TYR B 2 365 ? 10.411  129.022 -1.123  1.00 13.47 ? 865  TYR B OH  1 
ATOM   5443 N  N   . CYS B 2 366 ? 10.775  129.130 7.549   1.00 12.95 ? 866  CYS B N   1 
ATOM   5444 C  CA  . CYS B 2 366 ? 10.885  128.721 8.948   1.00 13.57 ? 866  CYS B CA  1 
ATOM   5445 C  C   . CYS B 2 366 ? 9.593   127.993 9.305   1.00 13.71 ? 866  CYS B C   1 
ATOM   5446 O  O   . CYS B 2 366 ? 9.619   126.945 9.940   1.00 13.78 ? 866  CYS B O   1 
ATOM   5447 C  CB  . CYS B 2 366 ? 11.050  129.924 9.882   1.00 13.83 ? 866  CYS B CB  1 
ATOM   5448 S  SG  . CYS B 2 366 ? 12.736  130.532 10.049  1.00 15.02 ? 866  CYS B SG  1 
ATOM   5449 N  N   . LEU B 2 367 ? 8.460   128.549 8.882   1.00 14.22 ? 867  LEU B N   1 
ATOM   5450 C  CA  . LEU B 2 367 ? 7.169   127.930 9.179   1.00 14.27 ? 867  LEU B CA  1 
ATOM   5451 C  C   . LEU B 2 367 ? 7.018   126.616 8.422   1.00 14.16 ? 867  LEU B C   1 
ATOM   5452 O  O   . LEU B 2 367 ? 6.508   125.633 8.964   1.00 13.55 ? 867  LEU B O   1 
ATOM   5453 C  CB  . LEU B 2 367 ? 6.023   128.886 8.824   1.00 14.28 ? 867  LEU B CB  1 
ATOM   5454 C  CG  . LEU B 2 367 ? 5.918   130.158 9.681   1.00 14.84 ? 867  LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 2 367 ? 4.890   131.102 9.076   1.00 14.40 ? 867  LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 2 367 ? 5.535   129.791 11.118  1.00 14.49 ? 867  LEU B CD2 1 
ATOM   5457 N  N   . SER B 2 368 ? 7.464   126.599 7.168   1.00 14.22 ? 868  SER B N   1 
ATOM   5458 C  CA  . SER B 2 368 ? 7.380   125.389 6.361   1.00 14.61 ? 868  SER B CA  1 
ATOM   5459 C  C   . SER B 2 368 ? 8.171   124.277 7.039   1.00 14.62 ? 868  SER B C   1 
ATOM   5460 O  O   . SER B 2 368 ? 7.715   123.133 7.122   1.00 15.30 ? 868  SER B O   1 
ATOM   5461 C  CB  . SER B 2 368 ? 7.941   125.641 4.958   1.00 14.74 ? 868  SER B CB  1 
ATOM   5462 O  OG  . SER B 2 368 ? 7.132   126.565 4.254   1.00 15.34 ? 868  SER B OG  1 
ATOM   5463 N  N   . GLY B 2 369 ? 9.362   124.620 7.516   1.00 14.04 ? 869  GLY B N   1 
ATOM   5464 C  CA  . GLY B 2 369 ? 10.201  123.644 8.186   1.00 14.34 ? 869  GLY B CA  1 
ATOM   5465 C  C   . GLY B 2 369 ? 9.612   123.187 9.512   1.00 13.84 ? 869  GLY B C   1 
ATOM   5466 O  O   . GLY B 2 369 ? 9.719   122.018 9.875   1.00 13.59 ? 869  GLY B O   1 
ATOM   5467 N  N   . LEU B 2 370 ? 8.999   124.108 10.246  1.00 14.00 ? 870  LEU B N   1 
ATOM   5468 C  CA  . LEU B 2 370 ? 8.384   123.763 11.527  1.00 14.44 ? 870  LEU B CA  1 
ATOM   5469 C  C   . LEU B 2 370 ? 7.287   122.717 11.301  1.00 15.09 ? 870  LEU B C   1 
ATOM   5470 O  O   . LEU B 2 370 ? 7.164   121.753 12.061  1.00 14.88 ? 870  LEU B O   1 
ATOM   5471 C  CB  . LEU B 2 370 ? 7.784   125.015 12.180  1.00 15.12 ? 870  LEU B CB  1 
ATOM   5472 C  CG  . LEU B 2 370 ? 7.084   124.831 13.532  1.00 15.53 ? 870  LEU B CG  1 
ATOM   5473 C  CD1 . LEU B 2 370 ? 8.047   124.232 14.532  1.00 16.63 ? 870  LEU B CD1 1 
ATOM   5474 C  CD2 . LEU B 2 370 ? 6.568   126.173 14.035  1.00 15.84 ? 870  LEU B CD2 1 
ATOM   5475 N  N   . SER B 2 371 ? 6.499   122.911 10.244  1.00 15.12 ? 871  SER B N   1 
ATOM   5476 C  CA  . SER B 2 371 ? 5.414   121.992 9.908   1.00 15.40 ? 871  SER B CA  1 
ATOM   5477 C  C   . SER B 2 371 ? 5.948   120.594 9.586   1.00 15.55 ? 871  SER B C   1 
ATOM   5478 O  O   . SER B 2 371 ? 5.388   119.586 10.016  1.00 15.02 ? 871  SER B O   1 
ATOM   5479 C  CB  . SER B 2 371 ? 4.623   122.536 8.713   1.00 16.00 ? 871  SER B CB  1 
ATOM   5480 O  OG  . SER B 2 371 ? 3.594   121.643 8.335   1.00 16.91 ? 871  SER B OG  1 
ATOM   5481 N  N   . ILE B 2 372 ? 7.028   120.534 8.816   1.00 15.94 ? 872  ILE B N   1 
ATOM   5482 C  CA  . ILE B 2 372 ? 7.625   119.252 8.472   1.00 16.39 ? 872  ILE B CA  1 
ATOM   5483 C  C   . ILE B 2 372 ? 8.116   118.547 9.737   1.00 16.23 ? 872  ILE B C   1 
ATOM   5484 O  O   . ILE B 2 372 ? 7.938   117.338 9.894   1.00 16.45 ? 872  ILE B O   1 
ATOM   5485 C  CB  . ILE B 2 372 ? 8.798   119.445 7.492   1.00 16.59 ? 872  ILE B CB  1 
ATOM   5486 C  CG1 . ILE B 2 372 ? 8.241   119.787 6.107   1.00 17.23 ? 872  ILE B CG1 1 
ATOM   5487 C  CG2 . ILE B 2 372 ? 9.665   118.187 7.437   1.00 16.72 ? 872  ILE B CG2 1 
ATOM   5488 C  CD1 . ILE B 2 372 ? 9.286   120.209 5.121   1.00 18.58 ? 872  ILE B CD1 1 
ATOM   5489 N  N   . ALA B 2 373 ? 8.724   119.311 10.640  1.00 16.21 ? 873  ALA B N   1 
ATOM   5490 C  CA  . ALA B 2 373 ? 9.244   118.759 11.890  1.00 16.49 ? 873  ALA B CA  1 
ATOM   5491 C  C   . ALA B 2 373 ? 8.137   118.264 12.817  1.00 16.42 ? 873  ALA B C   1 
ATOM   5492 O  O   . ALA B 2 373 ? 8.358   117.362 13.627  1.00 16.24 ? 873  ALA B O   1 
ATOM   5493 C  CB  . ALA B 2 373 ? 10.086  119.804 12.607  1.00 16.30 ? 873  ALA B CB  1 
ATOM   5494 N  N   . GLN B 2 374 ? 6.949   118.852 12.701  1.00 16.57 ? 874  GLN B N   1 
ATOM   5495 C  CA  . GLN B 2 374 ? 5.825   118.457 13.547  1.00 17.29 ? 874  GLN B CA  1 
ATOM   5496 C  C   . GLN B 2 374 ? 5.058   117.252 13.017  1.00 17.58 ? 874  GLN B C   1 
ATOM   5497 O  O   . GLN B 2 374 ? 4.477   116.494 13.790  1.00 17.48 ? 874  GLN B O   1 
ATOM   5498 C  CB  . GLN B 2 374 ? 4.813   119.601 13.688  1.00 17.29 ? 874  GLN B CB  1 
ATOM   5499 C  CG  . GLN B 2 374 ? 5.339   120.909 14.248  1.00 16.97 ? 874  GLN B CG  1 
ATOM   5500 C  CD  . GLN B 2 374 ? 4.269   121.994 14.224  1.00 17.70 ? 874  GLN B CD  1 
ATOM   5501 O  OE1 . GLN B 2 374 ? 3.424   122.020 13.326  1.00 17.37 ? 874  GLN B OE1 1 
ATOM   5502 N  NE2 . GLN B 2 374 ? 4.309   122.900 15.198  1.00 16.45 ? 874  GLN B NE2 1 
ATOM   5503 N  N   . HIS B 2 375 ? 5.055   117.071 11.700  1.00 17.89 ? 875  HIS B N   1 
ATOM   5504 C  CA  . HIS B 2 375 ? 4.271   115.993 11.116  1.00 18.89 ? 875  HIS B CA  1 
ATOM   5505 C  C   . HIS B 2 375 ? 4.971   114.923 10.303  1.00 19.17 ? 875  HIS B C   1 
ATOM   5506 O  O   . HIS B 2 375 ? 5.619   115.213 9.300   1.00 18.34 ? 875  HIS B O   1 
ATOM   5507 C  CB  . HIS B 2 375 ? 3.166   116.582 10.237  1.00 18.92 ? 875  HIS B CB  1 
ATOM   5508 C  CG  . HIS B 2 375 ? 2.348   117.637 10.910  1.00 20.09 ? 875  HIS B CG  1 
ATOM   5509 N  ND1 . HIS B 2 375 ? 2.492   118.979 10.632  1.00 20.86 ? 875  HIS B ND1 1 
ATOM   5510 C  CD2 . HIS B 2 375 ? 1.360   117.546 11.831  1.00 19.65 ? 875  HIS B CD2 1 
ATOM   5511 C  CE1 . HIS B 2 375 ? 1.625   119.670 11.350  1.00 20.23 ? 875  HIS B CE1 1 
ATOM   5512 N  NE2 . HIS B 2 375 ? 0.926   118.826 12.085  1.00 21.01 ? 875  HIS B NE2 1 
ATOM   5513 N  N   . PHE B 2 376 ? 4.802   113.678 10.736  1.00 20.08 ? 876  PHE B N   1 
ATOM   5514 C  CA  . PHE B 2 376 ? 5.353   112.536 10.027  1.00 21.28 ? 876  PHE B CA  1 
ATOM   5515 C  C   . PHE B 2 376 ? 4.175   111.805 9.398   1.00 22.85 ? 876  PHE B C   1 
ATOM   5516 O  O   . PHE B 2 376 ? 3.122   111.653 10.022  1.00 21.65 ? 876  PHE B O   1 
ATOM   5517 C  CB  . PHE B 2 376 ? 6.066   111.564 10.967  1.00 21.02 ? 876  PHE B CB  1 
ATOM   5518 C  CG  . PHE B 2 376 ? 6.422   110.253 10.309  1.00 21.09 ? 876  PHE B CG  1 
ATOM   5519 C  CD1 . PHE B 2 376 ? 7.587   110.129 9.553   1.00 20.79 ? 876  PHE B CD1 1 
ATOM   5520 C  CD2 . PHE B 2 376 ? 5.558   109.162 10.393  1.00 20.66 ? 876  PHE B CD2 1 
ATOM   5521 C  CE1 . PHE B 2 376 ? 7.884   108.939 8.887   1.00 20.82 ? 876  PHE B CE1 1 
ATOM   5522 C  CE2 . PHE B 2 376 ? 5.846   107.965 9.728   1.00 21.13 ? 876  PHE B CE2 1 
ATOM   5523 C  CZ  . PHE B 2 376 ? 7.009   107.853 8.974   1.00 20.60 ? 876  PHE B CZ  1 
ATOM   5524 N  N   . GLY B 2 377 ? 4.362   111.342 8.169   1.00 24.59 ? 877  GLY B N   1 
ATOM   5525 C  CA  . GLY B 2 377 ? 3.308   110.618 7.488   1.00 27.61 ? 877  GLY B CA  1 
ATOM   5526 C  C   . GLY B 2 377 ? 3.881   109.705 6.422   1.00 29.63 ? 877  GLY B C   1 
ATOM   5527 O  O   . GLY B 2 377 ? 4.607   110.157 5.537   1.00 30.57 ? 877  GLY B O   1 
ATOM   5528 N  N   . SER B 2 378 ? 3.563   108.418 6.512   1.00 30.94 ? 878  SER B N   1 
ATOM   5529 C  CA  . SER B 2 378 ? 4.036   107.429 5.550   1.00 32.69 ? 878  SER B CA  1 
ATOM   5530 C  C   . SER B 2 378 ? 3.005   106.310 5.482   1.00 33.66 ? 878  SER B C   1 
ATOM   5531 O  O   . SER B 2 378 ? 2.758   105.621 6.475   1.00 33.68 ? 878  SER B O   1 
ATOM   5532 C  CB  . SER B 2 378 ? 5.389   106.857 5.981   1.00 33.02 ? 878  SER B CB  1 
ATOM   5533 O  OG  . SER B 2 378 ? 5.835   105.868 5.066   1.00 33.89 ? 878  SER B OG  1 
ATOM   5534 N  N   . GLY B 2 379 ? 2.407   106.130 4.310   1.00 34.49 ? 879  GLY B N   1 
ATOM   5535 C  CA  . GLY B 2 379 ? 1.395   105.103 4.163   1.00 35.57 ? 879  GLY B CA  1 
ATOM   5536 C  C   . GLY B 2 379 ? 0.184   105.512 4.976   1.00 36.31 ? 879  GLY B C   1 
ATOM   5537 O  O   . GLY B 2 379 ? -0.343  106.610 4.802   1.00 36.82 ? 879  GLY B O   1 
ATOM   5538 N  N   . ALA B 2 380 ? -0.257  104.638 5.873   1.00 36.61 ? 880  ALA B N   1 
ATOM   5539 C  CA  . ALA B 2 380 ? -1.409  104.937 6.716   1.00 36.95 ? 880  ALA B CA  1 
ATOM   5540 C  C   . ALA B 2 380 ? -0.927  105.425 8.078   1.00 36.93 ? 880  ALA B C   1 
ATOM   5541 O  O   . ALA B 2 380 ? -1.727  105.789 8.942   1.00 37.36 ? 880  ALA B O   1 
ATOM   5542 C  CB  . ALA B 2 380 ? -2.274  103.691 6.882   1.00 37.40 ? 880  ALA B CB  1 
ATOM   5543 N  N   . MET B 2 381 ? 0.389   105.436 8.260   1.00 36.38 ? 881  MET B N   1 
ATOM   5544 C  CA  . MET B 2 381 ? 0.986   105.868 9.516   1.00 35.95 ? 881  MET B CA  1 
ATOM   5545 C  C   . MET B 2 381 ? 1.137   107.385 9.613   1.00 34.83 ? 881  MET B C   1 
ATOM   5546 O  O   . MET B 2 381 ? 1.674   108.029 8.712   1.00 34.74 ? 881  MET B O   1 
ATOM   5547 C  CB  . MET B 2 381 ? 2.356   105.212 9.695   1.00 37.34 ? 881  MET B CB  1 
ATOM   5548 C  CG  . MET B 2 381 ? 2.326   103.696 9.624   1.00 39.34 ? 881  MET B CG  1 
ATOM   5549 S  SD  . MET B 2 381 ? 1.129   103.011 10.785  1.00 41.71 ? 881  MET B SD  1 
ATOM   5550 C  CE  . MET B 2 381 ? 2.065   103.124 12.327  1.00 41.30 ? 881  MET B CE  1 
ATOM   5551 N  N   . LEU B 2 382 ? 0.654   107.942 10.718  1.00 32.94 ? 882  LEU B N   1 
ATOM   5552 C  CA  . LEU B 2 382 ? 0.741   109.372 10.981  1.00 31.27 ? 882  LEU B CA  1 
ATOM   5553 C  C   . LEU B 2 382 ? 1.188   109.544 12.430  1.00 30.02 ? 882  LEU B C   1 
ATOM   5554 O  O   . LEU B 2 382 ? 0.587   108.975 13.344  1.00 29.18 ? 882  LEU B O   1 
ATOM   5555 C  CB  . LEU B 2 382 ? -0.620  110.044 10.786  1.00 31.67 ? 882  LEU B CB  1 
ATOM   5556 C  CG  . LEU B 2 382 ? -1.210  110.109 9.375   1.00 32.46 ? 882  LEU B CG  1 
ATOM   5557 C  CD1 . LEU B 2 382 ? -2.629  110.637 9.462   1.00 32.56 ? 882  LEU B CD1 1 
ATOM   5558 C  CD2 . LEU B 2 382 ? -0.358  111.005 8.481   1.00 32.64 ? 882  LEU B CD2 1 
ATOM   5559 N  N   . HIS B 2 383 ? 2.250   110.315 12.637  1.00 28.16 ? 883  HIS B N   1 
ATOM   5560 C  CA  . HIS B 2 383 ? 2.754   110.546 13.983  1.00 26.82 ? 883  HIS B CA  1 
ATOM   5561 C  C   . HIS B 2 383 ? 3.187   112.001 14.139  1.00 26.23 ? 883  HIS B C   1 
ATOM   5562 O  O   . HIS B 2 383 ? 4.141   112.457 13.496  1.00 25.32 ? 883  HIS B O   1 
ATOM   5563 C  CB  . HIS B 2 383 ? 3.931   109.613 14.286  1.00 26.84 ? 883  HIS B CB  1 
ATOM   5564 C  CG  . HIS B 2 383 ? 4.441   109.731 15.690  1.00 28.00 ? 883  HIS B CG  1 
ATOM   5565 N  ND1 . HIS B 2 383 ? 3.718   109.301 16.782  1.00 28.28 ? 883  HIS B ND1 1 
ATOM   5566 C  CD2 . HIS B 2 383 ? 5.574   110.285 16.184  1.00 27.72 ? 883  HIS B CD2 1 
ATOM   5567 C  CE1 . HIS B 2 383 ? 4.382   109.589 17.888  1.00 28.61 ? 883  HIS B CE1 1 
ATOM   5568 N  NE2 . HIS B 2 383 ? 5.511   110.187 17.553  1.00 28.05 ? 883  HIS B NE2 1 
ATOM   5569 N  N   . ASP B 2 384 ? 2.476   112.727 14.994  1.00 24.94 ? 884  ASP B N   1 
ATOM   5570 C  CA  . ASP B 2 384 ? 2.775   114.132 15.230  1.00 24.87 ? 884  ASP B CA  1 
ATOM   5571 C  C   . ASP B 2 384 ? 3.595   114.371 16.488  1.00 24.48 ? 884  ASP B C   1 
ATOM   5572 O  O   . ASP B 2 384 ? 3.434   113.680 17.494  1.00 24.02 ? 884  ASP B O   1 
ATOM   5573 C  CB  . ASP B 2 384 ? 1.479   114.938 15.329  1.00 25.18 ? 884  ASP B CB  1 
ATOM   5574 C  CG  . ASP B 2 384 ? 0.811   115.138 13.987  1.00 26.25 ? 884  ASP B CG  1 
ATOM   5575 O  OD1 . ASP B 2 384 ? -0.338  115.625 13.970  1.00 28.39 ? 884  ASP B OD1 1 
ATOM   5576 O  OD2 . ASP B 2 384 ? 1.430   114.822 12.948  1.00 25.37 ? 884  ASP B OD2 1 
ATOM   5577 N  N   . VAL B 2 385 ? 4.474   115.363 16.413  1.00 23.94 ? 885  VAL B N   1 
ATOM   5578 C  CA  . VAL B 2 385 ? 5.315   115.755 17.535  1.00 23.79 ? 885  VAL B CA  1 
ATOM   5579 C  C   . VAL B 2 385 ? 5.267   117.274 17.584  1.00 22.80 ? 885  VAL B C   1 
ATOM   5580 O  O   . VAL B 2 385 ? 6.133   117.944 17.029  1.00 24.07 ? 885  VAL B O   1 
ATOM   5581 C  CB  . VAL B 2 385 ? 6.785   115.312 17.340  1.00 24.62 ? 885  VAL B CB  1 
ATOM   5582 C  CG1 . VAL B 2 385 ? 7.639   115.842 18.490  1.00 25.10 ? 885  VAL B CG1 1 
ATOM   5583 C  CG2 . VAL B 2 385 ? 6.873   113.787 17.285  1.00 25.20 ? 885  VAL B CG2 1 
ATOM   5584 N  N   . VAL B 2 386 ? 4.239   117.815 18.228  1.00 21.46 ? 886  VAL B N   1 
ATOM   5585 C  CA  . VAL B 2 386 ? 4.081   119.260 18.336  1.00 19.78 ? 886  VAL B CA  1 
ATOM   5586 C  C   . VAL B 2 386 ? 4.663   119.756 19.656  1.00 19.47 ? 886  VAL B C   1 
ATOM   5587 O  O   . VAL B 2 386 ? 4.065   119.591 20.717  1.00 18.47 ? 886  VAL B O   1 
ATOM   5588 C  CB  . VAL B 2 386 ? 2.591   119.662 18.256  1.00 19.74 ? 886  VAL B CB  1 
ATOM   5589 C  CG1 . VAL B 2 386 ? 2.450   121.184 18.313  1.00 19.20 ? 886  VAL B CG1 1 
ATOM   5590 C  CG2 . VAL B 2 386 ? 1.980   119.121 16.980  1.00 19.60 ? 886  VAL B CG2 1 
ATOM   5591 N  N   . LEU B 2 387 ? 5.843   120.361 19.584  1.00 18.99 ? 887  LEU B N   1 
ATOM   5592 C  CA  . LEU B 2 387 ? 6.502   120.876 20.775  1.00 18.93 ? 887  LEU B CA  1 
ATOM   5593 C  C   . LEU B 2 387 ? 5.827   122.155 21.261  1.00 18.13 ? 887  LEU B C   1 
ATOM   5594 O  O   . LEU B 2 387 ? 5.384   122.972 20.455  1.00 17.98 ? 887  LEU B O   1 
ATOM   5595 C  CB  . LEU B 2 387 ? 7.975   121.150 20.465  1.00 20.09 ? 887  LEU B CB  1 
ATOM   5596 C  CG  . LEU B 2 387 ? 8.848   121.663 21.607  1.00 21.29 ? 887  LEU B CG  1 
ATOM   5597 C  CD1 . LEU B 2 387 ? 8.932   120.612 22.711  1.00 20.78 ? 887  LEU B CD1 1 
ATOM   5598 C  CD2 . LEU B 2 387 ? 10.235  121.984 21.067  1.00 21.46 ? 887  LEU B CD2 1 
ATOM   5599 N  N   . GLY B 2 388 ? 5.750   122.319 22.580  1.00 17.83 ? 888  GLY B N   1 
ATOM   5600 C  CA  . GLY B 2 388 ? 5.144   123.508 23.158  1.00 16.93 ? 888  GLY B CA  1 
ATOM   5601 C  C   . GLY B 2 388 ? 3.642   123.400 23.333  1.00 17.42 ? 888  GLY B C   1 
ATOM   5602 O  O   . GLY B 2 388 ? 3.100   122.299 23.462  1.00 16.70 ? 888  GLY B O   1 
ATOM   5603 N  N   . VAL B 2 389 ? 2.961   124.542 23.343  1.00 17.35 ? 889  VAL B N   1 
ATOM   5604 C  CA  . VAL B 2 389 ? 1.512   124.539 23.490  1.00 17.93 ? 889  VAL B CA  1 
ATOM   5605 C  C   . VAL B 2 389 ? 0.914   123.913 22.235  1.00 18.97 ? 889  VAL B C   1 
ATOM   5606 O  O   . VAL B 2 389 ? 1.420   124.115 21.127  1.00 18.31 ? 889  VAL B O   1 
ATOM   5607 C  CB  . VAL B 2 389 ? 0.953   125.971 23.696  1.00 17.35 ? 889  VAL B CB  1 
ATOM   5608 C  CG1 . VAL B 2 389 ? 1.484   126.542 25.003  1.00 17.22 ? 889  VAL B CG1 1 
ATOM   5609 C  CG2 . VAL B 2 389 ? 1.343   126.875 22.532  1.00 17.07 ? 889  VAL B CG2 1 
ATOM   5610 N  N   . PRO B 2 390 ? -0.167  123.129 22.393  1.00 19.52 ? 890  PRO B N   1 
ATOM   5611 C  CA  . PRO B 2 390 ? -0.817  122.472 21.253  1.00 20.19 ? 890  PRO B CA  1 
ATOM   5612 C  C   . PRO B 2 390 ? -1.192  123.380 20.086  1.00 20.08 ? 890  PRO B C   1 
ATOM   5613 O  O   . PRO B 2 390 ? -1.230  122.930 18.942  1.00 19.98 ? 890  PRO B O   1 
ATOM   5614 C  CB  . PRO B 2 390 ? -2.025  121.768 21.890  1.00 20.60 ? 890  PRO B CB  1 
ATOM   5615 C  CG  . PRO B 2 390 ? -2.266  122.541 23.154  1.00 21.44 ? 890  PRO B CG  1 
ATOM   5616 C  CD  . PRO B 2 390 ? -0.878  122.837 23.648  1.00 20.04 ? 890  PRO B CD  1 
ATOM   5617 N  N   . GLU B 2 391 ? -1.447  124.655 20.367  1.00 20.55 ? 891  GLU B N   1 
ATOM   5618 C  CA  . GLU B 2 391 ? -1.804  125.610 19.321  1.00 20.79 ? 891  GLU B CA  1 
ATOM   5619 C  C   . GLU B 2 391 ? -0.660  125.821 18.327  1.00 20.08 ? 891  GLU B C   1 
ATOM   5620 O  O   . GLU B 2 391 ? -0.861  126.409 17.263  1.00 19.61 ? 891  GLU B O   1 
ATOM   5621 C  CB  . GLU B 2 391 ? -2.182  126.967 19.929  1.00 22.77 ? 891  GLU B CB  1 
ATOM   5622 C  CG  . GLU B 2 391 ? -3.443  126.960 20.783  1.00 26.03 ? 891  GLU B CG  1 
ATOM   5623 C  CD  . GLU B 2 391 ? -3.339  126.005 21.963  1.00 28.44 ? 891  GLU B CD  1 
ATOM   5624 O  OE1 . GLU B 2 391 ? -2.360  126.109 22.735  1.00 27.12 ? 891  GLU B OE1 1 
ATOM   5625 O  OE2 . GLU B 2 391 ? -4.241  125.147 22.110  1.00 31.65 ? 891  GLU B OE2 1 
ATOM   5626 N  N   . ASN B 2 392 ? 0.538   125.356 18.676  1.00 18.35 ? 892  ASN B N   1 
ATOM   5627 C  CA  . ASN B 2 392 ? 1.690   125.505 17.790  1.00 17.97 ? 892  ASN B CA  1 
ATOM   5628 C  C   . ASN B 2 392 ? 1.539   124.669 16.519  1.00 17.31 ? 892  ASN B C   1 
ATOM   5629 O  O   . ASN B 2 392 ? 2.203   124.931 15.519  1.00 17.74 ? 892  ASN B O   1 
ATOM   5630 C  CB  . ASN B 2 392 ? 2.986   125.093 18.504  1.00 16.37 ? 892  ASN B CB  1 
ATOM   5631 C  CG  . ASN B 2 392 ? 3.431   126.103 19.551  1.00 16.37 ? 892  ASN B CG  1 
ATOM   5632 O  OD1 . ASN B 2 392 ? 2.880   127.202 19.652  1.00 15.61 ? 892  ASN B OD1 1 
ATOM   5633 N  ND2 . ASN B 2 392 ? 4.447   125.736 20.328  1.00 14.92 ? 892  ASN B ND2 1 
ATOM   5634 N  N   . ALA B 2 393 ? 0.668   123.666 16.566  1.00 16.98 ? 893  ALA B N   1 
ATOM   5635 C  CA  . ALA B 2 393 ? 0.447   122.783 15.422  1.00 16.65 ? 893  ALA B CA  1 
ATOM   5636 C  C   . ALA B 2 393 ? 0.083   123.552 14.159  1.00 16.62 ? 893  ALA B C   1 
ATOM   5637 O  O   . ALA B 2 393 ? -0.898  124.291 14.124  1.00 16.06 ? 893  ALA B O   1 
ATOM   5638 C  CB  . ALA B 2 393 ? -0.647  121.765 15.744  1.00 16.73 ? 893  ALA B CB  1 
ATOM   5639 N  N   . LEU B 2 394 ? 0.886   123.364 13.119  1.00 16.13 ? 894  LEU B N   1 
ATOM   5640 C  CA  . LEU B 2 394 ? 0.659   124.033 11.850  1.00 16.44 ? 894  LEU B CA  1 
ATOM   5641 C  C   . LEU B 2 394 ? -0.011  123.079 10.877  1.00 17.02 ? 894  LEU B C   1 
ATOM   5642 O  O   . LEU B 2 394 ? -0.061  121.871 11.108  1.00 16.73 ? 894  LEU B O   1 
ATOM   5643 C  CB  . LEU B 2 394 ? 1.990   124.491 11.248  1.00 16.15 ? 894  LEU B CB  1 
ATOM   5644 C  CG  . LEU B 2 394 ? 2.779   125.583 11.973  1.00 16.72 ? 894  LEU B CG  1 
ATOM   5645 C  CD1 . LEU B 2 394 ? 4.111   125.802 11.257  1.00 16.82 ? 894  LEU B CD1 1 
ATOM   5646 C  CD2 . LEU B 2 394 ? 1.965   126.878 11.995  1.00 16.28 ? 894  LEU B CD2 1 
ATOM   5647 N  N   . GLN B 2 395 ? -0.529  123.626 9.786   1.00 17.54 ? 895  GLN B N   1 
ATOM   5648 C  CA  . GLN B 2 395 ? -1.144  122.794 8.767   1.00 18.29 ? 895  GLN B CA  1 
ATOM   5649 C  C   . GLN B 2 395 ? 0.003   122.088 8.055   1.00 18.13 ? 895  GLN B C   1 
ATOM   5650 O  O   . GLN B 2 395 ? 1.101   122.633 7.939   1.00 17.37 ? 895  GLN B O   1 
ATOM   5651 C  CB  . GLN B 2 395 ? -1.929  123.661 7.783   1.00 19.30 ? 895  GLN B CB  1 
ATOM   5652 C  CG  . GLN B 2 395 ? -3.161  124.289 8.406   1.00 21.43 ? 895  GLN B CG  1 
ATOM   5653 C  CD  . GLN B 2 395 ? -4.164  123.244 8.867   1.00 22.97 ? 895  GLN B CD  1 
ATOM   5654 O  OE1 . GLN B 2 395 ? -4.787  122.573 8.052   1.00 24.68 ? 895  GLN B OE1 1 
ATOM   5655 N  NE2 . GLN B 2 395 ? -4.310  123.093 10.179  1.00 23.77 ? 895  GLN B NE2 1 
ATOM   5656 N  N   . PRO B 2 396 ? -0.225  120.857 7.586   1.00 18.33 ? 896  PRO B N   1 
ATOM   5657 C  CA  . PRO B 2 396 ? 0.860   120.153 6.895   1.00 18.22 ? 896  PRO B CA  1 
ATOM   5658 C  C   . PRO B 2 396 ? 1.248   120.808 5.567   1.00 17.88 ? 896  PRO B C   1 
ATOM   5659 O  O   . PRO B 2 396 ? 0.500   121.618 5.017   1.00 17.27 ? 896  PRO B O   1 
ATOM   5660 C  CB  . PRO B 2 396 ? 0.288   118.748 6.704   1.00 18.81 ? 896  PRO B CB  1 
ATOM   5661 C  CG  . PRO B 2 396 ? -1.197  119.006 6.571   1.00 19.92 ? 896  PRO B CG  1 
ATOM   5662 C  CD  . PRO B 2 396 ? -1.442  120.029 7.661   1.00 18.93 ? 896  PRO B CD  1 
ATOM   5663 N  N   . THR B 2 397 ? 2.430   120.472 5.066   1.00 17.05 ? 897  THR B N   1 
ATOM   5664 C  CA  . THR B 2 397 ? 2.880   121.011 3.791   1.00 17.22 ? 897  THR B CA  1 
ATOM   5665 C  C   . THR B 2 397 ? 3.420   119.854 2.954   1.00 16.98 ? 897  THR B C   1 
ATOM   5666 O  O   . THR B 2 397 ? 3.969   118.891 3.497   1.00 17.26 ? 897  THR B O   1 
ATOM   5667 C  CB  . THR B 2 397 ? 3.977   122.085 3.985   1.00 17.04 ? 897  THR B CB  1 
ATOM   5668 O  OG1 . THR B 2 397 ? 4.172   122.789 2.755   1.00 17.24 ? 897  THR B OG1 1 
ATOM   5669 C  CG2 . THR B 2 397 ? 5.302   121.447 4.414   1.00 16.34 ? 897  THR B CG2 1 
ATOM   5670 N  N   . HIS B 2 398 ? 3.238   119.933 1.638   1.00 16.96 ? 898  HIS B N   1 
ATOM   5671 C  CA  . HIS B 2 398 ? 3.709   118.888 0.735   1.00 15.78 ? 898  HIS B CA  1 
ATOM   5672 C  C   . HIS B 2 398 ? 5.214   119.086 0.581   1.00 15.80 ? 898  HIS B C   1 
ATOM   5673 O  O   . HIS B 2 398 ? 5.667   120.179 0.259   1.00 15.36 ? 898  HIS B O   1 
ATOM   5674 C  CB  . HIS B 2 398 ? 3.004   119.012 -0.618  1.00 16.64 ? 898  HIS B CB  1 
ATOM   5675 C  CG  . HIS B 2 398 ? 3.162   117.808 -1.492  1.00 16.87 ? 898  HIS B CG  1 
ATOM   5676 N  ND1 . HIS B 2 398 ? 4.358   117.466 -2.083  1.00 16.66 ? 898  HIS B ND1 1 
ATOM   5677 C  CD2 . HIS B 2 398 ? 2.278   116.845 -1.848  1.00 17.77 ? 898  HIS B CD2 1 
ATOM   5678 C  CE1 . HIS B 2 398 ? 4.207   116.343 -2.763  1.00 17.41 ? 898  HIS B CE1 1 
ATOM   5679 N  NE2 . HIS B 2 398 ? 2.953   115.946 -2.637  1.00 17.51 ? 898  HIS B NE2 1 
ATOM   5680 N  N   . PRO B 2 399 ? 6.009   118.025 0.805   1.00 15.60 ? 899  PRO B N   1 
ATOM   5681 C  CA  . PRO B 2 399 ? 7.470   118.114 0.699   1.00 15.77 ? 899  PRO B CA  1 
ATOM   5682 C  C   . PRO B 2 399 ? 8.042   118.450 -0.680  1.00 15.92 ? 899  PRO B C   1 
ATOM   5683 O  O   . PRO B 2 399 ? 9.136   118.997 -0.781  1.00 15.99 ? 899  PRO B O   1 
ATOM   5684 C  CB  . PRO B 2 399 ? 7.931   116.752 1.221   1.00 15.85 ? 899  PRO B CB  1 
ATOM   5685 C  CG  . PRO B 2 399 ? 6.834   115.842 0.783   1.00 16.00 ? 899  PRO B CG  1 
ATOM   5686 C  CD  . PRO B 2 399 ? 5.586   116.645 1.103   1.00 15.75 ? 899  PRO B CD  1 
ATOM   5687 N  N   . VAL B 2 400 ? 7.305   118.134 -1.738  1.00 15.84 ? 900  VAL B N   1 
ATOM   5688 C  CA  . VAL B 2 400 ? 7.776   118.425 -3.088  1.00 15.60 ? 900  VAL B CA  1 
ATOM   5689 C  C   . VAL B 2 400 ? 7.496   119.869 -3.509  1.00 15.76 ? 900  VAL B C   1 
ATOM   5690 O  O   . VAL B 2 400 ? 8.405   120.600 -3.907  1.00 15.23 ? 900  VAL B O   1 
ATOM   5691 C  CB  . VAL B 2 400 ? 7.110   117.491 -4.130  1.00 15.57 ? 900  VAL B CB  1 
ATOM   5692 C  CG1 . VAL B 2 400 ? 7.467   117.952 -5.548  1.00 14.82 ? 900  VAL B CG1 1 
ATOM   5693 C  CG2 . VAL B 2 400 ? 7.557   116.044 -3.906  1.00 15.13 ? 900  VAL B CG2 1 
ATOM   5694 N  N   . TYR B 2 401 ? 6.232   120.272 -3.407  1.00 15.44 ? 901  TYR B N   1 
ATOM   5695 C  CA  . TYR B 2 401 ? 5.800   121.606 -3.828  1.00 15.40 ? 901  TYR B CA  1 
ATOM   5696 C  C   . TYR B 2 401 ? 5.824   122.714 -2.776  1.00 15.12 ? 901  TYR B C   1 
ATOM   5697 O  O   . TYR B 2 401 ? 5.905   123.897 -3.107  1.00 14.38 ? 901  TYR B O   1 
ATOM   5698 C  CB  . TYR B 2 401 ? 4.383   121.506 -4.403  1.00 15.65 ? 901  TYR B CB  1 
ATOM   5699 C  CG  . TYR B 2 401 ? 4.244   120.456 -5.484  1.00 16.32 ? 901  TYR B CG  1 
ATOM   5700 C  CD1 . TYR B 2 401 ? 3.781   119.173 -5.188  1.00 16.00 ? 901  TYR B CD1 1 
ATOM   5701 C  CD2 . TYR B 2 401 ? 4.614   120.736 -6.798  1.00 16.55 ? 901  TYR B CD2 1 
ATOM   5702 C  CE1 . TYR B 2 401 ? 3.690   118.195 -6.174  1.00 17.10 ? 901  TYR B CE1 1 
ATOM   5703 C  CE2 . TYR B 2 401 ? 4.531   119.767 -7.792  1.00 17.22 ? 901  TYR B CE2 1 
ATOM   5704 C  CZ  . TYR B 2 401 ? 4.070   118.498 -7.474  1.00 17.62 ? 901  TYR B CZ  1 
ATOM   5705 O  OH  . TYR B 2 401 ? 4.016   117.533 -8.453  1.00 17.85 ? 901  TYR B OH  1 
ATOM   5706 N  N   . ASN B 2 402 ? 5.759   122.316 -1.513  1.00 14.72 ? 902  ASN B N   1 
ATOM   5707 C  CA  . ASN B 2 402 ? 5.718   123.233 -0.381  1.00 14.72 ? 902  ASN B CA  1 
ATOM   5708 C  C   . ASN B 2 402 ? 4.489   124.142 -0.372  1.00 15.17 ? 902  ASN B C   1 
ATOM   5709 O  O   . ASN B 2 402 ? 4.585   125.366 -0.235  1.00 14.72 ? 902  ASN B O   1 
ATOM   5710 C  CB  . ASN B 2 402 ? 6.996   124.077 -0.250  1.00 14.26 ? 902  ASN B CB  1 
ATOM   5711 C  CG  . ASN B 2 402 ? 7.122   124.710 1.141   1.00 15.16 ? 902  ASN B CG  1 
ATOM   5712 O  OD1 . ASN B 2 402 ? 6.558   124.195 2.113   1.00 14.46 ? 902  ASN B OD1 1 
ATOM   5713 N  ND2 . ASN B 2 402 ? 7.864   125.815 1.245   1.00 14.81 ? 902  ASN B ND2 1 
ATOM   5714 N  N   . ILE B 2 403 ? 3.335   123.510 -0.559  1.00 15.92 ? 903  ILE B N   1 
ATOM   5715 C  CA  . ILE B 2 403 ? 2.030   124.155 -0.471  1.00 16.22 ? 903  ILE B CA  1 
ATOM   5716 C  C   . ILE B 2 403 ? 1.221   123.029 0.181   1.00 16.67 ? 903  ILE B C   1 
ATOM   5717 O  O   . ILE B 2 403 ? 1.660   121.876 0.169   1.00 16.42 ? 903  ILE B O   1 
ATOM   5718 C  CB  . ILE B 2 403 ? 1.404   124.542 -1.853  1.00 16.13 ? 903  ILE B CB  1 
ATOM   5719 C  CG1 . ILE B 2 403 ? 1.134   123.296 -2.691  1.00 16.54 ? 903  ILE B CG1 1 
ATOM   5720 C  CG2 . ILE B 2 403 ? 2.314   125.530 -2.593  1.00 15.60 ? 903  ILE B CG2 1 
ATOM   5721 C  CD1 . ILE B 2 403 ? 0.356   123.595 -3.972  1.00 17.27 ? 903  ILE B CD1 1 
ATOM   5722 N  N   . GLY B 2 404 ? 0.067   123.342 0.758   1.00 17.42 ? 904  GLY B N   1 
ATOM   5723 C  CA  . GLY B 2 404 ? -0.722  122.304 1.406   1.00 18.36 ? 904  GLY B CA  1 
ATOM   5724 C  C   . GLY B 2 404 ? -0.962  121.067 0.549   1.00 18.71 ? 904  GLY B C   1 
ATOM   5725 O  O   . GLY B 2 404 ? -1.170  121.190 -0.655  1.00 19.27 ? 904  GLY B O   1 
ATOM   5726 N  N   . PRO B 2 405 ? -0.928  119.857 1.137   1.00 19.49 ? 905  PRO B N   1 
ATOM   5727 C  CA  . PRO B 2 405 ? -1.153  118.614 0.390   1.00 19.75 ? 905  PRO B CA  1 
ATOM   5728 C  C   . PRO B 2 405 ? -2.539  118.637 -0.245  1.00 20.33 ? 905  PRO B C   1 
ATOM   5729 O  O   . PRO B 2 405 ? -2.746  118.108 -1.337  1.00 20.02 ? 905  PRO B O   1 
ATOM   5730 C  CB  . PRO B 2 405 ? -1.035  117.535 1.464   1.00 20.05 ? 905  PRO B CB  1 
ATOM   5731 C  CG  . PRO B 2 405 ? -0.121  118.150 2.469   1.00 20.52 ? 905  PRO B CG  1 
ATOM   5732 C  CD  . PRO B 2 405 ? -0.614  119.568 2.546   1.00 19.44 ? 905  PRO B CD  1 
ATOM   5733 N  N   . ASP B 2 406 ? -3.485  119.252 0.458   1.00 20.23 ? 906  ASP B N   1 
ATOM   5734 C  CA  . ASP B 2 406 ? -4.850  119.378 -0.037  1.00 20.99 ? 906  ASP B CA  1 
ATOM   5735 C  C   . ASP B 2 406 ? -4.843  120.233 -1.301  1.00 20.51 ? 906  ASP B C   1 
ATOM   5736 O  O   . ASP B 2 406 ? -5.593  119.969 -2.243  1.00 19.66 ? 906  ASP B O   1 
ATOM   5737 C  CB  . ASP B 2 406 ? -5.744  120.026 1.032   1.00 22.55 ? 906  ASP B CB  1 
ATOM   5738 C  CG  . ASP B 2 406 ? -5.246  121.404 1.459   1.00 24.92 ? 906  ASP B CG  1 
ATOM   5739 O  OD1 . ASP B 2 406 ? -4.023  121.564 1.667   1.00 26.09 ? 906  ASP B OD1 1 
ATOM   5740 O  OD2 . ASP B 2 406 ? -6.079  122.326 1.600   1.00 26.41 ? 906  ASP B OD2 1 
ATOM   5741 N  N   . LYS B 2 407 ? -3.990  121.257 -1.316  1.00 20.08 ? 907  LYS B N   1 
ATOM   5742 C  CA  . LYS B 2 407 ? -3.884  122.150 -2.471  1.00 20.27 ? 907  LYS B CA  1 
ATOM   5743 C  C   . LYS B 2 407 ? -3.279  121.425 -3.672  1.00 19.79 ? 907  LYS B C   1 
ATOM   5744 O  O   . LYS B 2 407 ? -3.674  121.659 -4.812  1.00 19.85 ? 907  LYS B O   1 
ATOM   5745 C  CB  . LYS B 2 407 ? -3.026  123.372 -2.126  1.00 20.62 ? 907  LYS B CB  1 
ATOM   5746 C  CG  . LYS B 2 407 ? -3.496  124.152 -0.899  1.00 22.03 ? 907  LYS B CG  1 
ATOM   5747 C  CD  . LYS B 2 407 ? -4.897  124.703 -1.091  1.00 23.29 ? 907  LYS B CD  1 
ATOM   5748 C  CE  . LYS B 2 407 ? -5.337  125.517 0.115   1.00 24.75 ? 907  LYS B CE  1 
ATOM   5749 N  NZ  . LYS B 2 407 ? -6.715  126.051 -0.088  1.00 26.37 ? 907  LYS B NZ  1 
ATOM   5750 N  N   . VAL B 2 408 ? -2.312  120.550 -3.411  1.00 19.59 ? 908  VAL B N   1 
ATOM   5751 C  CA  . VAL B 2 408 ? -1.673  119.789 -4.479  1.00 19.80 ? 908  VAL B CA  1 
ATOM   5752 C  C   . VAL B 2 408 ? -2.688  118.856 -5.144  1.00 20.33 ? 908  VAL B C   1 
ATOM   5753 O  O   . VAL B 2 408 ? -2.810  118.819 -6.367  1.00 20.02 ? 908  VAL B O   1 
ATOM   5754 C  CB  . VAL B 2 408 ? -0.506  118.928 -3.939  1.00 19.21 ? 908  VAL B CB  1 
ATOM   5755 C  CG1 . VAL B 2 408 ? 0.047   118.045 -5.049  1.00 18.61 ? 908  VAL B CG1 1 
ATOM   5756 C  CG2 . VAL B 2 408 ? 0.587   119.821 -3.383  1.00 19.42 ? 908  VAL B CG2 1 
ATOM   5757 N  N   . ILE B 2 409 ? -3.417  118.108 -4.326  1.00 20.88 ? 909  ILE B N   1 
ATOM   5758 C  CA  . ILE B 2 409 ? -4.408  117.170 -4.835  1.00 21.74 ? 909  ILE B CA  1 
ATOM   5759 C  C   . ILE B 2 409 ? -5.497  117.874 -5.637  1.00 21.64 ? 909  ILE B C   1 
ATOM   5760 O  O   . ILE B 2 409 ? -5.846  117.444 -6.739  1.00 20.98 ? 909  ILE B O   1 
ATOM   5761 C  CB  . ILE B 2 409 ? -5.061  116.377 -3.679  1.00 22.66 ? 909  ILE B CB  1 
ATOM   5762 C  CG1 . ILE B 2 409 ? -3.992  115.557 -2.953  1.00 23.44 ? 909  ILE B CG1 1 
ATOM   5763 C  CG2 . ILE B 2 409 ? -6.152  115.449 -4.228  1.00 23.05 ? 909  ILE B CG2 1 
ATOM   5764 C  CD1 . ILE B 2 409 ? -4.492  114.865 -1.692  1.00 24.35 ? 909  ILE B CD1 1 
ATOM   5765 N  N   . GLN B 2 410 ? -6.022  118.962 -5.086  1.00 21.52 ? 910  GLN B N   1 
ATOM   5766 C  CA  . GLN B 2 410 ? -7.075  119.715 -5.750  1.00 22.22 ? 910  GLN B CA  1 
ATOM   5767 C  C   . GLN B 2 410 ? -6.605  120.289 -7.090  1.00 21.98 ? 910  GLN B C   1 
ATOM   5768 O  O   . GLN B 2 410 ? -7.324  120.221 -8.088  1.00 20.73 ? 910  GLN B O   1 
ATOM   5769 C  CB  . GLN B 2 410 ? -7.565  120.841 -4.837  1.00 23.94 ? 910  GLN B CB  1 
ATOM   5770 C  CG  . GLN B 2 410 ? -8.823  121.537 -5.329  1.00 27.43 ? 910  GLN B CG  1 
ATOM   5771 C  CD  . GLN B 2 410 ? -9.338  122.562 -4.338  1.00 29.72 ? 910  GLN B CD  1 
ATOM   5772 O  OE1 . GLN B 2 410 ? -9.593  122.242 -3.173  1.00 31.68 ? 910  GLN B OE1 1 
ATOM   5773 N  NE2 . GLN B 2 410 ? -9.497  123.801 -4.793  1.00 30.03 ? 910  GLN B NE2 1 
ATOM   5774 N  N   . ALA B 2 411 ? -5.395  120.842 -7.115  1.00 21.09 ? 911  ALA B N   1 
ATOM   5775 C  CA  . ALA B 2 411 ? -4.865  121.418 -8.346  1.00 21.61 ? 911  ALA B CA  1 
ATOM   5776 C  C   . ALA B 2 411 ? -4.587  120.338 -9.391  1.00 21.98 ? 911  ALA B C   1 
ATOM   5777 O  O   . ALA B 2 411 ? -5.039  120.437 -10.532 1.00 21.51 ? 911  ALA B O   1 
ATOM   5778 C  CB  . ALA B 2 411 ? -3.592  122.210 -8.057  1.00 20.67 ? 911  ALA B CB  1 
ATOM   5779 N  N   . THR B 2 412 ? -3.850  119.303 -9.002  1.00 22.65 ? 912  THR B N   1 
ATOM   5780 C  CA  . THR B 2 412 ? -3.533  118.230 -9.936  1.00 24.15 ? 912  THR B CA  1 
ATOM   5781 C  C   . THR B 2 412 ? -4.800  117.580 -10.480 1.00 24.23 ? 912  THR B C   1 
ATOM   5782 O  O   . THR B 2 412 ? -4.866  117.239 -11.660 1.00 24.73 ? 912  THR B O   1 
ATOM   5783 C  CB  . THR B 2 412 ? -2.652  117.144 -9.286  1.00 24.86 ? 912  THR B CB  1 
ATOM   5784 O  OG1 . THR B 2 412 ? -3.363  116.535 -8.204  1.00 27.15 ? 912  THR B OG1 1 
ATOM   5785 C  CG2 . THR B 2 412 ? -1.356  117.755 -8.758  1.00 24.83 ? 912  THR B CG2 1 
ATOM   5786 N  N   . THR B 2 413 ? -5.806  117.411 -9.625  1.00 24.12 ? 913  THR B N   1 
ATOM   5787 C  CA  . THR B 2 413 ? -7.065  116.806 -10.057 1.00 24.31 ? 913  THR B CA  1 
ATOM   5788 C  C   . THR B 2 413 ? -7.743  117.703 -11.088 1.00 23.96 ? 913  THR B C   1 
ATOM   5789 O  O   . THR B 2 413 ? -8.236  117.233 -12.114 1.00 23.99 ? 913  THR B O   1 
ATOM   5790 C  CB  . THR B 2 413 ? -8.032  116.588 -8.867  1.00 24.88 ? 913  THR B CB  1 
ATOM   5791 O  OG1 . THR B 2 413 ? -7.487  115.598 -7.984  1.00 25.96 ? 913  THR B OG1 1 
ATOM   5792 C  CG2 . THR B 2 413 ? -9.393  116.110 -9.364  1.00 25.32 ? 913  THR B CG2 1 
ATOM   5793 N  N   . TYR B 2 414 ? -7.756  119.001 -10.813 1.00 23.03 ? 914  TYR B N   1 
ATOM   5794 C  CA  . TYR B 2 414 ? -8.365  119.955 -11.719 1.00 22.70 ? 914  TYR B CA  1 
ATOM   5795 C  C   . TYR B 2 414 ? -7.689  119.948 -13.094 1.00 22.11 ? 914  TYR B C   1 
ATOM   5796 O  O   . TYR B 2 414 ? -8.349  119.779 -14.120 1.00 21.65 ? 914  TYR B O   1 
ATOM   5797 C  CB  . TYR B 2 414 ? -8.282  121.361 -11.128 1.00 23.51 ? 914  TYR B CB  1 
ATOM   5798 C  CG  . TYR B 2 414 ? -8.990  122.394 -11.963 1.00 24.26 ? 914  TYR B CG  1 
ATOM   5799 C  CD1 . TYR B 2 414 ? -10.382 122.475 -11.966 1.00 24.76 ? 914  TYR B CD1 1 
ATOM   5800 C  CD2 . TYR B 2 414 ? -8.274  123.278 -12.770 1.00 23.79 ? 914  TYR B CD2 1 
ATOM   5801 C  CE1 . TYR B 2 414 ? -11.045 123.412 -12.750 1.00 25.24 ? 914  TYR B CE1 1 
ATOM   5802 C  CE2 . TYR B 2 414 ? -8.924  124.216 -13.557 1.00 25.09 ? 914  TYR B CE2 1 
ATOM   5803 C  CZ  . TYR B 2 414 ? -10.311 124.279 -13.542 1.00 25.49 ? 914  TYR B CZ  1 
ATOM   5804 O  OH  . TYR B 2 414 ? -10.962 125.214 -14.311 1.00 26.63 ? 914  TYR B OH  1 
ATOM   5805 N  N   . PHE B 2 415 ? -6.372  120.127 -13.113 1.00 21.13 ? 915  PHE B N   1 
ATOM   5806 C  CA  . PHE B 2 415 ? -5.640  120.166 -14.372 1.00 21.08 ? 915  PHE B CA  1 
ATOM   5807 C  C   . PHE B 2 415 ? -5.568  118.840 -15.121 1.00 21.59 ? 915  PHE B C   1 
ATOM   5808 O  O   . PHE B 2 415 ? -5.414  118.831 -16.343 1.00 21.47 ? 915  PHE B O   1 
ATOM   5809 C  CB  . PHE B 2 415 ? -4.232  120.729 -14.148 1.00 20.02 ? 915  PHE B CB  1 
ATOM   5810 C  CG  . PHE B 2 415 ? -4.223  122.184 -13.782 1.00 19.68 ? 915  PHE B CG  1 
ATOM   5811 C  CD1 . PHE B 2 415 ? -3.812  122.596 -12.521 1.00 19.28 ? 915  PHE B CD1 1 
ATOM   5812 C  CD2 . PHE B 2 415 ? -4.662  123.145 -14.692 1.00 19.34 ? 915  PHE B CD2 1 
ATOM   5813 C  CE1 . PHE B 2 415 ? -3.837  123.950 -12.164 1.00 19.37 ? 915  PHE B CE1 1 
ATOM   5814 C  CE2 . PHE B 2 415 ? -4.692  124.500 -14.346 1.00 18.98 ? 915  PHE B CE2 1 
ATOM   5815 C  CZ  . PHE B 2 415 ? -4.279  124.901 -13.080 1.00 18.70 ? 915  PHE B CZ  1 
ATOM   5816 N  N   . LEU B 2 416 ? -5.673  117.725 -14.404 1.00 22.49 ? 916  LEU B N   1 
ATOM   5817 C  CA  . LEU B 2 416 ? -5.642  116.418 -15.056 1.00 24.15 ? 916  LEU B CA  1 
ATOM   5818 C  C   . LEU B 2 416 ? -6.868  116.242 -15.946 1.00 25.32 ? 916  LEU B C   1 
ATOM   5819 O  O   . LEU B 2 416 ? -6.900  115.355 -16.797 1.00 25.86 ? 916  LEU B O   1 
ATOM   5820 C  CB  . LEU B 2 416 ? -5.597  115.289 -14.022 1.00 24.17 ? 916  LEU B CB  1 
ATOM   5821 C  CG  . LEU B 2 416 ? -4.216  114.911 -13.477 1.00 24.79 ? 916  LEU B CG  1 
ATOM   5822 C  CD1 . LEU B 2 416 ? -4.368  113.883 -12.359 1.00 24.75 ? 916  LEU B CD1 1 
ATOM   5823 C  CD2 . LEU B 2 416 ? -3.359  114.352 -14.602 1.00 24.13 ? 916  LEU B CD2 1 
ATOM   5824 N  N   . GLN B 2 417 ? -7.874  117.087 -15.744 1.00 26.17 ? 917  GLN B N   1 
ATOM   5825 C  CA  . GLN B 2 417 ? -9.095  117.028 -16.543 1.00 27.81 ? 917  GLN B CA  1 
ATOM   5826 C  C   . GLN B 2 417 ? -8.933  117.807 -17.844 1.00 27.60 ? 917  GLN B C   1 
ATOM   5827 O  O   . GLN B 2 417 ? -9.836  117.843 -18.679 1.00 27.83 ? 917  GLN B O   1 
ATOM   5828 C  CB  . GLN B 2 417 ? -10.274 117.592 -15.755 1.00 29.20 ? 917  GLN B CB  1 
ATOM   5829 C  CG  . GLN B 2 417 ? -10.694 116.723 -14.589 1.00 32.49 ? 917  GLN B CG  1 
ATOM   5830 C  CD  . GLN B 2 417 ? -11.914 117.270 -13.883 1.00 34.72 ? 917  GLN B CD  1 
ATOM   5831 O  OE1 . GLN B 2 417 ? -11.858 118.327 -13.249 1.00 36.66 ? 917  GLN B OE1 1 
ATOM   5832 N  NE2 . GLN B 2 417 ? -13.032 116.558 -13.996 1.00 36.18 ? 917  GLN B NE2 1 
ATOM   5833 N  N   . LYS B 2 418 ? -7.780  118.444 -18.000 1.00 27.36 ? 918  LYS B N   1 
ATOM   5834 C  CA  . LYS B 2 418 ? -7.476  119.208 -19.200 1.00 27.07 ? 918  LYS B CA  1 
ATOM   5835 C  C   . LYS B 2 418 ? -6.431  118.419 -19.978 1.00 26.50 ? 918  LYS B C   1 
ATOM   5836 O  O   . LYS B 2 418 ? -5.666  117.649 -19.397 1.00 26.43 ? 918  LYS B O   1 
ATOM   5837 C  CB  . LYS B 2 418 ? -6.926  120.585 -18.825 1.00 27.82 ? 918  LYS B CB  1 
ATOM   5838 C  CG  . LYS B 2 418 ? -7.970  121.539 -18.271 1.00 28.79 ? 918  LYS B CG  1 
ATOM   5839 C  CD  . LYS B 2 418 ? -7.329  122.822 -17.774 1.00 30.38 ? 918  LYS B CD  1 
ATOM   5840 C  CE  . LYS B 2 418 ? -8.349  123.948 -17.677 1.00 30.99 ? 918  LYS B CE  1 
ATOM   5841 N  NZ  . LYS B 2 418 ? -9.587  123.516 -16.983 1.00 32.18 ? 918  LYS B NZ  1 
ATOM   5842 N  N   . PRO B 2 419 ? -6.387  118.587 -21.305 1.00 26.19 ? 919  PRO B N   1 
ATOM   5843 C  CA  . PRO B 2 419 ? -5.389  117.838 -22.068 1.00 25.21 ? 919  PRO B CA  1 
ATOM   5844 C  C   . PRO B 2 419 ? -4.040  118.544 -22.010 1.00 24.36 ? 919  PRO B C   1 
ATOM   5845 O  O   . PRO B 2 419 ? -3.966  119.725 -21.677 1.00 23.24 ? 919  PRO B O   1 
ATOM   5846 C  CB  . PRO B 2 419 ? -5.967  117.851 -23.475 1.00 25.68 ? 919  PRO B CB  1 
ATOM   5847 C  CG  . PRO B 2 419 ? -6.521  119.249 -23.557 1.00 26.19 ? 919  PRO B CG  1 
ATOM   5848 C  CD  . PRO B 2 419 ? -7.226  119.407 -22.201 1.00 26.09 ? 919  PRO B CD  1 
ATOM   5849 N  N   . VAL B 2 420 ? -2.976  117.811 -22.316 1.00 24.13 ? 920  VAL B N   1 
ATOM   5850 C  CA  . VAL B 2 420 ? -1.649  118.404 -22.356 1.00 24.11 ? 920  VAL B CA  1 
ATOM   5851 C  C   . VAL B 2 420 ? -1.716  119.245 -23.634 1.00 24.33 ? 920  VAL B C   1 
ATOM   5852 O  O   . VAL B 2 420 ? -2.066  118.730 -24.692 1.00 23.66 ? 920  VAL B O   1 
ATOM   5853 C  CB  . VAL B 2 420 ? -0.562  117.323 -22.494 1.00 23.96 ? 920  VAL B CB  1 
ATOM   5854 C  CG1 . VAL B 2 420 ? 0.813   117.969 -22.530 1.00 24.04 ? 920  VAL B CG1 1 
ATOM   5855 C  CG2 . VAL B 2 420 ? -0.660  116.336 -21.329 1.00 24.43 ? 920  VAL B CG2 1 
ATOM   5856 N  N   . PRO B 2 421 ? -1.394  120.547 -23.548 1.00 24.55 ? 921  PRO B N   1 
ATOM   5857 C  CA  . PRO B 2 421 ? -1.427  121.469 -24.692 1.00 25.26 ? 921  PRO B CA  1 
ATOM   5858 C  C   . PRO B 2 421 ? -0.829  120.949 -26.000 1.00 26.24 ? 921  PRO B C   1 
ATOM   5859 O  O   . PRO B 2 421 ? 0.373   120.709 -26.095 1.00 25.67 ? 921  PRO B O   1 
ATOM   5860 C  CB  . PRO B 2 421 ? -0.685  122.696 -24.167 1.00 25.13 ? 921  PRO B CB  1 
ATOM   5861 C  CG  . PRO B 2 421 ? -1.030  122.683 -22.707 1.00 24.95 ? 921  PRO B CG  1 
ATOM   5862 C  CD  . PRO B 2 421 ? -0.847  121.221 -22.356 1.00 24.24 ? 921  PRO B CD  1 
ATOM   5863 N  N   . GLY B 2 422 ? -1.681  120.788 -27.008 1.00 27.58 ? 922  GLY B N   1 
ATOM   5864 C  CA  . GLY B 2 422 ? -1.218  120.310 -28.298 1.00 30.06 ? 922  GLY B CA  1 
ATOM   5865 C  C   . GLY B 2 422 ? -0.775  118.867 -28.211 1.00 32.18 ? 922  GLY B C   1 
ATOM   5866 O  O   . GLY B 2 422 ? -0.131  118.346 -29.122 1.00 31.51 ? 922  GLY B O   1 
ATOM   5867 N  N   . PHE B 2 423 ? -1.135  118.237 -27.096 1.00 34.52 ? 923  PHE B N   1 
ATOM   5868 C  CA  . PHE B 2 423 ? -0.814  116.846 -26.808 1.00 37.36 ? 923  PHE B CA  1 
ATOM   5869 C  C   . PHE B 2 423 ? 0.691   116.602 -26.776 1.00 38.10 ? 923  PHE B C   1 
ATOM   5870 O  O   . PHE B 2 423 ? 1.197   116.186 -25.712 1.00 38.35 ? 923  PHE B O   1 
ATOM   5871 C  CB  . PHE B 2 423 ? -1.478  115.935 -27.840 1.00 39.11 ? 923  PHE B CB  1 
ATOM   5872 C  CG  . PHE B 2 423 ? -1.753  114.549 -27.338 1.00 40.72 ? 923  PHE B CG  1 
ATOM   5873 C  CD1 . PHE B 2 423 ? -0.713  113.657 -27.106 1.00 41.64 ? 923  PHE B CD1 1 
ATOM   5874 C  CD2 . PHE B 2 423 ? -3.060  114.139 -27.082 1.00 41.97 ? 923  PHE B CD2 1 
ATOM   5875 C  CE1 . PHE B 2 423 ? -0.966  112.371 -26.625 1.00 41.50 ? 923  PHE B CE1 1 
ATOM   5876 C  CE2 . PHE B 2 423 ? -3.325  112.859 -26.600 1.00 42.28 ? 923  PHE B CE2 1 
ATOM   5877 C  CZ  . PHE B 2 423 ? -2.274  111.974 -26.371 1.00 42.19 ? 923  PHE B CZ  1 
HETATM 5878 C  C1  . GLC C 3 .   ? 29.321  112.356 -7.852  1.00 31.32 ? 1    GLC C C1  1 
HETATM 5879 C  C2  . GLC C 3 .   ? 29.828  113.287 -8.992  1.00 31.87 ? 1    GLC C C2  1 
HETATM 5880 C  C3  . GLC C 3 .   ? 31.059  112.461 -9.740  1.00 32.23 ? 1    GLC C C3  1 
HETATM 5881 C  C4  . GLC C 3 .   ? 32.197  112.190 -8.702  1.00 32.18 ? 1    GLC C C4  1 
HETATM 5882 C  C5  . GLC C 3 .   ? 31.630  111.427 -7.442  1.00 32.43 ? 1    GLC C C5  1 
HETATM 5883 C  C6  . GLC C 3 .   ? 32.620  111.326 -6.270  1.00 32.91 ? 1    GLC C C6  1 
HETATM 5884 O  O2  . GLC C 3 .   ? 28.796  113.530 -9.949  1.00 32.27 ? 1    GLC C O2  1 
HETATM 5885 O  O3  . GLC C 3 .   ? 31.541  113.320 -10.767 1.00 32.18 ? 1    GLC C O3  1 
HETATM 5886 O  O4  . GLC C 3 .   ? 33.221  111.441 -9.368  1.00 32.43 ? 1    GLC C O4  1 
HETATM 5887 O  O5  . GLC C 3 .   ? 30.431  112.116 -6.918  1.00 31.81 ? 1    GLC C O5  1 
HETATM 5888 O  O6  . GLC C 3 .   ? 32.167  110.365 -5.315  1.00 33.60 ? 1    GLC C O6  1 
HETATM 5889 C  C1  . FRU C 3 .   ? 26.379  110.976 -8.736  1.00 28.76 ? 2    FRU C C1  1 
HETATM 5890 C  C2  . FRU C 3 .   ? 27.589  110.451 -7.903  1.00 29.29 ? 2    FRU C C2  1 
HETATM 5891 C  C3  . FRU C 3 .   ? 27.685  108.910 -7.764  1.00 29.29 ? 2    FRU C C3  1 
HETATM 5892 C  C4  . FRU C 3 .   ? 28.345  108.748 -6.395  1.00 29.24 ? 2    FRU C C4  1 
HETATM 5893 C  C5  . FRU C 3 .   ? 27.704  109.890 -5.574  1.00 28.61 ? 2    FRU C C5  1 
HETATM 5894 C  C6  . FRU C 3 .   ? 28.581  110.515 -4.466  1.00 28.27 ? 2    FRU C C6  1 
HETATM 5895 O  O1  . FRU C 3 .   ? 25.121  110.416 -8.347  1.00 27.29 ? 2    FRU C O1  1 
HETATM 5896 O  O2  . FRU C 3 .   ? 28.835  111.072 -8.379  1.00 30.45 ? 2    FRU C O2  1 
HETATM 5897 O  O3  . FRU C 3 .   ? 28.450  108.266 -8.789  1.00 29.95 ? 2    FRU C O3  1 
HETATM 5898 O  O4  . FRU C 3 .   ? 28.136  107.442 -5.867  1.00 29.26 ? 2    FRU C O4  1 
HETATM 5899 O  O5  . FRU C 3 .   ? 27.376  110.921 -6.543  1.00 28.80 ? 2    FRU C O5  1 
HETATM 5900 O  O6  . FRU C 3 .   ? 27.761  111.242 -3.559  1.00 27.26 ? 2    FRU C O6  1 
HETATM 5901 C  C   . ACY D 4 .   ? 22.085  135.353 -3.922  1.00 44.15 ? 904  ACY A C   1 
HETATM 5902 O  O   . ACY D 4 .   ? 23.139  134.605 -4.014  1.00 44.10 ? 904  ACY A O   1 
HETATM 5903 O  OXT . ACY D 4 .   ? 21.243  135.673 -4.850  1.00 44.74 ? 904  ACY A OXT 1 
HETATM 5904 C  CH3 . ACY D 4 .   ? 21.869  135.877 -2.530  1.00 44.32 ? 904  ACY A CH3 1 
HETATM 5905 C  C   . ACY E 4 .   ? 17.245  135.755 -7.618  1.00 44.03 ? 905  ACY A C   1 
HETATM 5906 O  O   . ACY E 4 .   ? 17.576  135.949 -8.878  1.00 43.98 ? 905  ACY A O   1 
HETATM 5907 O  OXT . ACY E 4 .   ? 17.674  136.397 -6.592  1.00 44.66 ? 905  ACY A OXT 1 
HETATM 5908 C  CH3 . ACY E 4 .   ? 16.230  134.635 -7.408  1.00 43.89 ? 905  ACY A CH3 1 
HETATM 5909 ZN ZN  . ZN  F 5 .   ? 18.094  131.998 5.178   1.00 18.64 ? 1001 ZN  B ZN  1 
HETATM 5910 C  C1  . FPP G 6 .   ? 24.542  130.430 -1.223  1.00 17.78 ? 1002 FPP B C1  1 
HETATM 5911 O  O1  . FPP G 6 .   ? 24.065  131.593 -0.557  1.00 16.86 ? 1002 FPP B O1  1 
HETATM 5912 C  C2  . FPP G 6 .   ? 23.394  129.562 -1.699  1.00 17.10 ? 1002 FPP B C2  1 
HETATM 5913 C  C3  . FPP G 6 .   ? 23.007  129.435 -3.003  1.00 17.74 ? 1002 FPP B C3  1 
HETATM 5914 C  C4  . FPP G 6 .   ? 23.691  130.155 -4.140  1.00 17.71 ? 1002 FPP B C4  1 
HETATM 5915 C  C5  . FPP G 6 .   ? 21.858  128.562 -3.468  1.00 17.83 ? 1002 FPP B C5  1 
HETATM 5916 C  C6  . FPP G 6 .   ? 20.672  128.422 -2.504  1.00 18.31 ? 1002 FPP B C6  1 
HETATM 5917 C  C7  . FPP G 6 .   ? 19.454  127.856 -3.194  1.00 17.74 ? 1002 FPP B C7  1 
HETATM 5918 C  C8  . FPP G 6 .   ? 18.245  127.661 -2.611  1.00 18.04 ? 1002 FPP B C8  1 
HETATM 5919 C  C10 . FPP G 6 .   ? 17.943  127.985 -1.167  1.00 17.35 ? 1002 FPP B C10 1 
HETATM 5920 C  C9  . FPP G 6 .   ? 17.067  127.087 -3.361  1.00 18.23 ? 1002 FPP B C9  1 
HETATM 5921 C  C11 . FPP G 6 .   ? 16.295  128.076 -4.229  1.00 18.05 ? 1002 FPP B C11 1 
HETATM 5922 C  C12 . FPP G 6 .   ? 15.029  127.450 -4.774  1.00 17.55 ? 1002 FPP B C12 1 
HETATM 5923 C  C13 . FPP G 6 .   ? 14.263  127.961 -5.763  1.00 17.75 ? 1002 FPP B C13 1 
HETATM 5924 C  C14 . FPP G 6 .   ? 14.558  129.252 -6.479  1.00 17.34 ? 1002 FPP B C14 1 
HETATM 5925 C  C15 . FPP G 6 .   ? 13.018  127.274 -6.246  1.00 17.96 ? 1002 FPP B C15 1 
HETATM 5926 P  PA  . FPP G 6 .   ? 24.774  131.997 0.814   1.00 17.01 ? 1002 FPP B PA  1 
HETATM 5927 O  O1A . FPP G 6 .   ? 26.270  131.933 0.756   1.00 16.93 ? 1002 FPP B O1A 1 
HETATM 5928 O  O2A . FPP G 6 .   ? 24.259  133.406 1.142   1.00 16.49 ? 1002 FPP B O2A 1 
HETATM 5929 O  O3A . FPP G 6 .   ? 24.181  131.068 1.956   1.00 16.47 ? 1002 FPP B O3A 1 
HETATM 5930 P  PB  . FPP G 6 .   ? 24.912  130.101 2.973   1.00 16.37 ? 1002 FPP B PB  1 
HETATM 5931 O  O1B . FPP G 6 .   ? 26.000  130.782 3.751   1.00 16.04 ? 1002 FPP B O1B 1 
HETATM 5932 O  O2B . FPP G 6 .   ? 25.425  128.942 2.087   1.00 15.71 ? 1002 FPP B O2B 1 
HETATM 5933 O  O3B . FPP G 6 .   ? 23.773  129.575 3.883   1.00 16.71 ? 1002 FPP B O3B 1 
HETATM 5934 C  C1  . U49 H 7 .   ? 15.293  134.420 -3.062  1.00 19.51 ? 1003 U49 B C1  1 
HETATM 5935 C  C2  . U49 H 7 .   ? 15.577  135.803 -2.882  1.00 22.51 ? 1003 U49 B C2  1 
HETATM 5936 C  C3  . U49 H 7 .   ? 14.187  134.006 -3.899  1.00 19.80 ? 1003 U49 B C3  1 
HETATM 5937 C  C4  . U49 H 7 .   ? 16.062  133.417 -2.456  1.00 18.41 ? 1003 U49 B C4  1 
HETATM 5938 N  N5  . U49 H 7 .   ? 16.691  136.106 -2.035  1.00 23.92 ? 1003 U49 B N5  1 
HETATM 5939 C  C6  . U49 H 7 .   ? 14.757  136.786 -3.542  1.00 20.64 ? 1003 U49 B C6  1 
HETATM 5940 C  C7  . U49 H 7 .   ? 13.913  132.617 -4.066  1.00 18.67 ? 1003 U49 B C7  1 
HETATM 5941 C  C8  . U49 H 7 .   ? 13.388  134.998 -4.546  1.00 19.43 ? 1003 U49 B C8  1 
HETATM 5942 C  C9  . U49 H 7 .   ? 15.818  132.045 -2.625  1.00 17.77 ? 1003 U49 B C9  1 
HETATM 5943 C  C10 . U49 H 7 .   ? 17.977  136.596 -2.570  1.00 25.96 ? 1003 U49 B C10 1 
HETATM 5944 C  C11 . U49 H 7 .   ? 16.673  136.111 -0.631  1.00 24.57 ? 1003 U49 B C11 1 
HETATM 5945 C  C12 . U49 H 7 .   ? 13.675  136.379 -4.368  1.00 19.71 ? 1003 U49 B C12 1 
HETATM 5946 C  C13 . U49 H 7 .   ? 14.723  131.634 -3.428  1.00 17.52 ? 1003 U49 B C13 1 
HETATM 5947 O  O14 . U49 H 7 .   ? 16.714  131.054 -2.132  1.00 16.56 ? 1003 U49 B O14 1 
HETATM 5948 C  C15 . U49 H 7 .   ? 18.669  137.266 -1.374  1.00 26.06 ? 1003 U49 B C15 1 
HETATM 5949 C  C17 . U49 H 7 .   ? 18.090  136.370 -0.280  1.00 25.72 ? 1003 U49 B C17 1 
HETATM 5950 C  C18 . U49 H 7 .   ? 18.093  131.440 -2.174  1.00 15.90 ? 1003 U49 B C18 1 
HETATM 5951 C  C20 . U49 H 7 .   ? 18.831  131.682 -3.383  1.00 15.94 ? 1003 U49 B C20 1 
HETATM 5952 C  C21 . U49 H 7 .   ? 18.733  131.586 -0.924  1.00 15.38 ? 1003 U49 B C21 1 
HETATM 5953 C  C22 . U49 H 7 .   ? 19.638  135.025 0.728   1.00 20.86 ? 1003 U49 B C22 1 
HETATM 5954 C  C23 . U49 H 7 .   ? 20.192  132.075 -3.300  1.00 15.33 ? 1003 U49 B C23 1 
HETATM 5955 C  C24 . U49 H 7 .   ? 18.174  131.516 -4.658  1.00 16.20 ? 1003 U49 B C24 1 
HETATM 5956 C  C25 . U49 H 7 .   ? 20.107  131.973 -0.830  1.00 15.66 ? 1003 U49 B C25 1 
HETATM 5957 C  C26 . U49 H 7 .   ? 19.446  133.921 1.707   1.00 19.45 ? 1003 U49 B C26 1 
HETATM 5958 C  C27 . U49 H 7 .   ? 20.831  132.223 -2.032  1.00 14.92 ? 1003 U49 B C27 1 
HETATM 5959 N  N28 . U49 H 7 .   ? 17.581  131.373 -5.627  1.00 17.31 ? 1003 U49 B N28 1 
HETATM 5960 C  C29 . U49 H 7 .   ? 20.829  132.128 0.505   1.00 16.39 ? 1003 U49 B C29 1 
HETATM 5961 N  N30 . U49 H 7 .   ? 19.982  132.655 1.582   1.00 17.06 ? 1003 U49 B N30 1 
HETATM 5962 C  C31 . U49 H 7 .   ? 18.752  133.881 2.898   1.00 17.47 ? 1003 U49 B C31 1 
HETATM 5963 C  C32 . U49 H 7 .   ? 19.597  131.941 2.674   1.00 16.90 ? 1003 U49 B C32 1 
HETATM 5964 N  N33 . U49 H 7 .   ? 18.849  132.664 3.489   1.00 17.31 ? 1003 U49 B N33 1 
HETATM 5965 O  O39 . U49 H 7 .   ? 15.757  135.966 0.124   1.00 26.19 ? 1003 U49 B O39 1 
HETATM 5966 N  N54 . U49 H 7 .   ? 18.678  136.077 0.967   1.00 24.24 ? 1003 U49 B N54 1 
HETATM 5967 O  O   . HOH I 8 .   ? 12.616  141.546 -14.455 1.00 18.10 ? 1004 HOH A O   1 
HETATM 5968 O  O   . HOH I 8 .   ? 34.314  124.974 -5.242  1.00 22.57 ? 1007 HOH A O   1 
HETATM 5969 O  O   . HOH I 8 .   ? 38.542  138.049 -18.710 1.00 21.71 ? 1008 HOH A O   1 
HETATM 5970 O  O   . HOH I 8 .   ? 15.060  158.891 -11.380 1.00 24.61 ? 1011 HOH A O   1 
HETATM 5971 O  O   . HOH I 8 .   ? 44.584  128.861 -10.986 1.00 20.45 ? 1016 HOH A O   1 
HETATM 5972 O  O   . HOH I 8 .   ? 16.941  169.612 -16.482 1.00 48.49 ? 1020 HOH A O   1 
HETATM 5973 O  O   . HOH I 8 .   ? 30.697  149.735 -23.601 1.00 24.97 ? 1021 HOH A O   1 
HETATM 5974 O  O   . HOH I 8 .   ? 31.485  151.670 -26.888 1.00 33.49 ? 1022 HOH A O   1 
HETATM 5975 O  O   . HOH I 8 .   ? 46.407  115.724 -9.084  1.00 26.55 ? 1025 HOH A O   1 
HETATM 5976 O  O   . HOH I 8 .   ? 21.855  159.217 -15.066 1.00 21.12 ? 1027 HOH A O   1 
HETATM 5977 O  O   . HOH I 8 .   ? 22.168  138.633 -16.166 1.00 15.75 ? 1028 HOH A O   1 
HETATM 5978 O  O   . HOH I 8 .   ? 29.386  144.663 -28.766 1.00 35.99 ? 1031 HOH A O   1 
HETATM 5979 O  O   . HOH I 8 .   ? 31.175  123.689 -12.393 1.00 18.51 ? 1033 HOH A O   1 
HETATM 5980 O  O   . HOH I 8 .   ? 31.683  130.172 7.438   1.00 18.72 ? 1034 HOH A O   1 
HETATM 5981 O  O   . HOH I 8 .   ? 8.333   151.411 -10.763 1.00 23.25 ? 1035 HOH A O   1 
HETATM 5982 O  O   . HOH I 8 .   ? 4.599   147.733 -6.596  1.00 23.84 ? 1036 HOH A O   1 
HETATM 5983 O  O   . HOH I 8 .   ? -0.647  144.821 -7.501  1.00 32.34 ? 1037 HOH A O   1 
HETATM 5984 O  O   . HOH I 8 .   ? 20.397  158.049 -27.910 1.00 26.88 ? 1039 HOH A O   1 
HETATM 5985 O  O   . HOH I 8 .   ? 40.737  132.402 2.602   1.00 18.85 ? 1040 HOH A O   1 
HETATM 5986 O  O   . HOH I 8 .   ? 46.573  122.814 -10.799 1.00 24.23 ? 1041 HOH A O   1 
HETATM 5987 O  O   . HOH I 8 .   ? 18.230  112.293 14.250  1.00 35.72 ? 1044 HOH A O   1 
HETATM 5988 O  O   . HOH I 8 .   ? 30.271  126.221 -13.388 1.00 16.54 ? 1046 HOH A O   1 
HETATM 5989 O  O   . HOH I 8 .   ? 23.412  106.881 4.598   1.00 20.76 ? 1047 HOH A O   1 
HETATM 5990 O  O   . HOH I 8 .   ? 19.832  161.270 -20.257 1.00 25.22 ? 1048 HOH A O   1 
HETATM 5991 O  O   . HOH I 8 .   ? 8.361   158.904 -9.947  1.00 39.18 ? 1054 HOH A O   1 
HETATM 5992 O  O   . HOH I 8 .   ? 32.654  98.762  18.102  1.00 36.07 ? 1057 HOH A O   1 
HETATM 5993 O  O   . HOH I 8 .   ? 43.819  126.804 8.126   1.00 17.62 ? 1063 HOH A O   1 
HETATM 5994 O  O   . HOH I 8 .   ? 45.069  127.873 -13.471 1.00 23.66 ? 1065 HOH A O   1 
HETATM 5995 O  O   . HOH I 8 .   ? 21.236  158.431 -18.573 1.00 31.71 ? 1066 HOH A O   1 
HETATM 5996 O  O   . HOH I 8 .   ? 44.036  132.969 -8.818  1.00 25.41 ? 1069 HOH A O   1 
HETATM 5997 O  O   . HOH I 8 .   ? 41.857  134.984 -3.207  1.00 25.82 ? 1070 HOH A O   1 
HETATM 5998 O  O   . HOH I 8 .   ? 35.287  114.601 20.117  1.00 30.33 ? 1077 HOH A O   1 
HETATM 5999 O  O   . HOH I 8 .   ? 32.123  102.773 0.738   1.00 20.83 ? 1084 HOH A O   1 
HETATM 6000 O  O   . HOH I 8 .   ? 44.918  134.299 -0.531  1.00 44.65 ? 1085 HOH A O   1 
HETATM 6001 O  O   . HOH I 8 .   ? 41.608  95.930  -0.631  1.00 21.82 ? 1087 HOH A O   1 
HETATM 6002 O  O   . HOH I 8 .   ? 24.850  115.529 18.525  1.00 20.45 ? 1090 HOH A O   1 
HETATM 6003 O  O   . HOH I 8 .   ? 31.696  118.488 2.919   1.00 16.29 ? 1092 HOH A O   1 
HETATM 6004 O  O   . HOH I 8 .   ? 44.546  100.538 2.831   1.00 24.30 ? 1096 HOH A O   1 
HETATM 6005 O  O   . HOH I 8 .   ? 19.339  138.745 -17.406 1.00 35.97 ? 1099 HOH A O   1 
HETATM 6006 O  O   . HOH I 8 .   ? 11.891  164.238 -20.183 1.00 23.54 ? 1101 HOH A O   1 
HETATM 6007 O  O   . HOH I 8 .   ? 17.847  136.133 -26.215 1.00 46.31 ? 1102 HOH A O   1 
HETATM 6008 O  O   . HOH I 8 .   ? 39.819  129.669 2.493   1.00 17.09 ? 1105 HOH A O   1 
HETATM 6009 O  O   . HOH I 8 .   ? 25.604  152.314 -19.485 1.00 30.64 ? 1107 HOH A O   1 
HETATM 6010 O  O   . HOH I 8 .   ? 8.902   160.476 -13.417 1.00 25.51 ? 1110 HOH A O   1 
HETATM 6011 O  O   . HOH I 8 .   ? 47.709  129.859 -7.999  1.00 36.69 ? 1112 HOH A O   1 
HETATM 6012 O  O   . HOH I 8 .   ? 41.046  131.796 8.553   1.00 24.17 ? 1113 HOH A O   1 
HETATM 6013 O  O   . HOH I 8 .   ? 45.808  118.070 -10.171 1.00 34.49 ? 1117 HOH A O   1 
HETATM 6014 O  O   . HOH I 8 .   ? 31.656  112.764 2.548   1.00 18.69 ? 1123 HOH A O   1 
HETATM 6015 O  O   . HOH I 8 .   ? 29.945  114.232 7.729   1.00 28.59 ? 1124 HOH A O   1 
HETATM 6016 O  O   . HOH I 8 .   ? 41.288  119.308 8.877   1.00 23.69 ? 1131 HOH A O   1 
HETATM 6017 O  O   . HOH I 8 .   ? 28.272  131.860 -11.073 1.00 19.81 ? 1138 HOH A O   1 
HETATM 6018 O  O   . HOH I 8 .   ? 40.325  142.021 -1.899  1.00 41.70 ? 1142 HOH A O   1 
HETATM 6019 O  O   . HOH I 8 .   ? 32.540  117.660 16.990  1.00 32.38 ? 1149 HOH A O   1 
HETATM 6020 O  O   . HOH I 8 .   ? 32.877  142.016 -2.858  1.00 29.64 ? 1150 HOH A O   1 
HETATM 6021 O  O   . HOH I 8 .   ? 17.998  97.900  16.375  1.00 31.93 ? 1153 HOH A O   1 
HETATM 6022 O  O   . HOH I 8 .   ? 40.190  105.677 -6.910  1.00 45.47 ? 1160 HOH A O   1 
HETATM 6023 O  O   . HOH I 8 .   ? 28.887  132.556 -13.732 1.00 18.84 ? 1171 HOH A O   1 
HETATM 6024 O  O   . HOH I 8 .   ? 48.567  124.126 -9.436  1.00 25.11 ? 1180 HOH A O   1 
HETATM 6025 O  O   . HOH I 8 .   ? 30.154  137.495 -1.172  1.00 26.55 ? 1182 HOH A O   1 
HETATM 6026 O  O   . HOH I 8 .   ? 35.571  122.717 12.909  1.00 20.19 ? 1188 HOH A O   1 
HETATM 6027 O  O   . HOH I 8 .   ? 38.532  135.323 4.534   1.00 31.40 ? 1193 HOH A O   1 
HETATM 6028 O  O   . HOH I 8 .   ? 40.013  134.438 0.976   1.00 32.59 ? 1194 HOH A O   1 
HETATM 6029 O  O   . HOH I 8 .   ? 38.576  113.404 15.002  1.00 35.69 ? 1196 HOH A O   1 
HETATM 6030 O  O   . HOH I 8 .   ? 15.231  105.900 12.616  1.00 26.57 ? 1204 HOH A O   1 
HETATM 6031 O  O   . HOH I 8 .   ? 39.601  117.219 10.001  1.00 23.71 ? 1205 HOH A O   1 
HETATM 6032 O  O   . HOH I 8 .   ? 37.640  144.741 -16.410 1.00 31.17 ? 1208 HOH A O   1 
HETATM 6033 O  O   . HOH I 8 .   ? 32.511  151.469 -14.949 1.00 43.58 ? 1211 HOH A O   1 
HETATM 6034 O  O   . HOH I 8 .   ? 28.289  112.196 4.731   1.00 33.26 ? 1213 HOH A O   1 
HETATM 6035 O  O   . HOH I 8 .   ? 16.013  101.184 16.122  1.00 20.63 ? 1228 HOH A O   1 
HETATM 6036 O  O   . HOH I 8 .   ? 39.790  149.118 -20.299 1.00 48.44 ? 1238 HOH A O   1 
HETATM 6037 O  O   . HOH I 8 .   ? 42.332  134.503 -15.911 1.00 18.59 ? 1242 HOH A O   1 
HETATM 6038 O  O   . HOH I 8 .   ? 25.565  131.541 -15.988 1.00 21.09 ? 1243 HOH A O   1 
HETATM 6039 O  O   . HOH I 8 .   ? 24.713  150.539 -12.573 1.00 27.01 ? 1244 HOH A O   1 
HETATM 6040 O  O   . HOH I 8 .   ? 8.399   80.909  8.574   1.00 28.18 ? 1248 HOH A O   1 
HETATM 6041 O  O   . HOH I 8 .   ? 37.267  131.173 5.054   1.00 20.17 ? 1250 HOH A O   1 
HETATM 6042 O  O   . HOH I 8 .   ? 35.890  134.889 3.911   1.00 22.90 ? 1251 HOH A O   1 
HETATM 6043 O  O   . HOH I 8 .   ? 46.503  104.635 -3.852  1.00 23.07 ? 1254 HOH A O   1 
HETATM 6044 O  O   . HOH I 8 .   ? 8.924   147.052 -15.353 1.00 24.79 ? 1258 HOH A O   1 
HETATM 6045 O  O   . HOH I 8 .   ? 27.857  116.916 10.890  1.00 17.91 ? 1260 HOH A O   1 
HETATM 6046 O  O   . HOH I 8 .   ? 45.021  135.135 -10.255 1.00 32.46 ? 1265 HOH A O   1 
HETATM 6047 O  O   . HOH I 8 .   ? 36.345  148.045 -12.853 1.00 34.01 ? 1267 HOH A O   1 
HETATM 6048 O  O   . HOH I 8 .   ? 41.576  102.435 -5.445  1.00 39.86 ? 1272 HOH A O   1 
HETATM 6049 O  O   . HOH I 8 .   ? 47.250  120.141 -10.905 1.00 29.55 ? 1276 HOH A O   1 
HETATM 6050 O  O   . HOH I 8 .   ? 46.406  132.780 -2.787  1.00 54.61 ? 1286 HOH A O   1 
HETATM 6051 O  O   . HOH I 8 .   ? 44.429  135.505 -4.039  1.00 36.35 ? 1292 HOH A O   1 
HETATM 6052 O  O   . HOH I 8 .   ? 23.603  155.299 -11.640 1.00 45.17 ? 1293 HOH A O   1 
HETATM 6053 O  O   . HOH I 8 .   ? 38.302  146.379 -14.035 1.00 34.92 ? 1296 HOH A O   1 
HETATM 6054 O  O   . HOH I 8 .   ? 42.507  129.571 -22.974 1.00 45.31 ? 1297 HOH A O   1 
HETATM 6055 O  O   . HOH I 8 .   ? 6.836   160.898 -15.294 1.00 39.72 ? 1303 HOH A O   1 
HETATM 6056 O  O   . HOH I 8 .   ? 18.826  100.675 15.634  1.00 20.40 ? 1318 HOH A O   1 
HETATM 6057 O  O   . HOH I 8 .   ? 20.973  90.779  11.711  1.00 27.40 ? 1324 HOH A O   1 
HETATM 6058 O  O   . HOH I 8 .   ? 26.107  97.313  4.708   1.00 29.26 ? 1325 HOH A O   1 
HETATM 6059 O  O   . HOH I 8 .   ? 29.574  107.305 0.933   1.00 24.50 ? 1329 HOH A O   1 
HETATM 6060 O  O   . HOH I 8 .   ? 17.894  97.498  4.136   1.00 41.92 ? 1330 HOH A O   1 
HETATM 6061 O  O   . HOH I 8 .   ? 26.816  89.848  15.090  1.00 30.21 ? 1331 HOH A O   1 
HETATM 6062 O  O   . HOH I 8 .   ? 34.962  132.546 4.893   1.00 19.72 ? 1335 HOH A O   1 
HETATM 6063 O  O   . HOH I 8 .   ? 22.168  166.010 -14.861 1.00 39.13 ? 1337 HOH A O   1 
HETATM 6064 O  O   . HOH I 8 .   ? 33.175  111.558 6.573   1.00 31.78 ? 1338 HOH A O   1 
HETATM 6065 O  O   . HOH I 8 .   ? 27.309  100.691 22.196  1.00 34.92 ? 1341 HOH A O   1 
HETATM 6066 O  O   . HOH I 8 .   ? 26.027  82.386  15.475  1.00 47.50 ? 1342 HOH A O   1 
HETATM 6067 O  O   . HOH I 8 .   ? 25.630  131.992 -21.283 1.00 33.48 ? 1347 HOH A O   1 
HETATM 6068 O  O   . HOH I 8 .   ? 13.384  159.607 -4.756  1.00 26.75 ? 1352 HOH A O   1 
HETATM 6069 O  O   . HOH I 8 .   ? 39.371  132.837 4.906   1.00 23.82 ? 1354 HOH A O   1 
HETATM 6070 O  O   . HOH I 8 .   ? 37.913  142.187 -14.341 1.00 21.37 ? 1357 HOH A O   1 
HETATM 6071 O  O   . HOH I 8 .   ? 11.351  145.864 -15.256 1.00 25.71 ? 1359 HOH A O   1 
HETATM 6072 O  O   . HOH I 8 .   ? 19.742  110.161 21.822  1.00 39.65 ? 1365 HOH A O   1 
HETATM 6073 O  O   . HOH I 8 .   ? 31.815  120.924 12.547  1.00 21.48 ? 1367 HOH A O   1 
HETATM 6074 O  O   . HOH I 8 .   ? 20.645  147.120 -6.771  1.00 29.48 ? 1369 HOH A O   1 
HETATM 6075 O  O   . HOH I 8 .   ? 30.069  102.728 3.603   1.00 25.42 ? 1370 HOH A O   1 
HETATM 6076 O  O   . HOH I 8 .   ? 4.627   153.505 -12.368 1.00 23.21 ? 1371 HOH A O   1 
HETATM 6077 O  O   . HOH I 8 .   ? 31.069  116.826 18.959  1.00 25.99 ? 1372 HOH A O   1 
HETATM 6078 O  O   . HOH I 8 .   ? 20.941  137.738 -23.016 1.00 30.54 ? 1379 HOH A O   1 
HETATM 6079 O  O   . HOH I 8 .   ? 6.988   162.599 -17.890 1.00 41.40 ? 1381 HOH A O   1 
HETATM 6080 O  O   . HOH I 8 .   ? 50.530  114.236 0.566   1.00 35.95 ? 1382 HOH A O   1 
HETATM 6081 O  O   . HOH I 8 .   ? 45.737  131.191 -9.784  1.00 32.40 ? 1383 HOH A O   1 
HETATM 6082 O  O   . HOH I 8 .   ? 39.129  105.706 -4.363  1.00 32.43 ? 1386 HOH A O   1 
HETATM 6083 O  O   . HOH I 8 .   ? 29.194  130.078 -14.723 1.00 22.30 ? 1393 HOH A O   1 
HETATM 6084 O  O   . HOH I 8 .   ? 48.644  119.786 -2.892  1.00 34.15 ? 1398 HOH A O   1 
HETATM 6085 O  O   . HOH I 8 .   ? 38.906  100.204 5.370   1.00 24.91 ? 1404 HOH A O   1 
HETATM 6086 O  O   . HOH I 8 .   ? 43.246  136.490 -14.231 1.00 25.57 ? 1405 HOH A O   1 
HETATM 6087 O  O   . HOH I 8 .   ? 32.967  110.806 9.268   1.00 22.16 ? 1412 HOH A O   1 
HETATM 6088 O  O   . HOH I 8 .   ? 35.026  108.132 -4.683  1.00 24.67 ? 1414 HOH A O   1 
HETATM 6089 O  O   . HOH I 8 .   ? 29.932  149.680 -21.038 1.00 24.84 ? 1417 HOH A O   1 
HETATM 6090 O  O   . HOH I 8 .   ? 24.726  91.276  15.781  1.00 30.25 ? 1423 HOH A O   1 
HETATM 6091 O  O   . HOH I 8 .   ? 6.966   153.451 -25.262 1.00 43.09 ? 1428 HOH A O   1 
HETATM 6092 O  O   . HOH I 8 .   ? 33.326  120.118 14.593  1.00 30.36 ? 1439 HOH A O   1 
HETATM 6093 O  O   . HOH I 8 .   ? 19.533  89.855  7.596   1.00 31.91 ? 1443 HOH A O   1 
HETATM 6094 O  O   . HOH I 8 .   ? 9.450   162.545 -21.457 1.00 31.86 ? 1445 HOH A O   1 
HETATM 6095 O  O   . HOH I 8 .   ? 8.296   82.577  11.183  1.00 38.20 ? 1447 HOH A O   1 
HETATM 6096 O  O   . HOH I 8 .   ? 20.032  158.249 -21.031 1.00 31.15 ? 1450 HOH A O   1 
HETATM 6097 O  O   . HOH I 8 .   ? 35.129  99.190  16.309  1.00 35.25 ? 1453 HOH A O   1 
HETATM 6098 O  O   . HOH I 8 .   ? 23.601  99.871  5.861   1.00 46.93 ? 1454 HOH A O   1 
HETATM 6099 O  O   . HOH I 8 .   ? 12.313  163.503 -6.427  1.00 28.41 ? 1455 HOH A O   1 
HETATM 6100 O  O   . HOH I 8 .   ? 23.238  91.322  2.317   1.00 43.12 ? 1459 HOH A O   1 
HETATM 6101 O  O   . HOH I 8 .   ? 45.286  134.229 -6.669  1.00 34.19 ? 1461 HOH A O   1 
HETATM 6102 O  O   . HOH I 8 .   ? 27.941  111.949 12.045  1.00 41.45 ? 1462 HOH A O   1 
HETATM 6103 O  O   . HOH I 8 .   ? 21.163  101.768 16.854  1.00 34.60 ? 1463 HOH A O   1 
HETATM 6104 O  O   . HOH I 8 .   ? 43.345  108.821 -12.680 1.00 34.95 ? 1474 HOH A O   1 
HETATM 6105 O  O   . HOH I 8 .   ? 50.875  115.223 3.244   1.00 49.97 ? 1475 HOH A O   1 
HETATM 6106 O  O   . HOH I 8 .   ? 22.272  104.440 4.348   1.00 34.98 ? 1476 HOH A O   1 
HETATM 6107 O  O   . HOH I 8 .   ? 14.143  104.923 15.557  1.00 40.91 ? 1477 HOH A O   1 
HETATM 6108 O  O   . HOH I 8 .   ? 20.661  142.809 -30.331 1.00 37.97 ? 1481 HOH A O   1 
HETATM 6109 O  O   . HOH I 8 .   ? 31.897  133.343 3.952   1.00 31.00 ? 1482 HOH A O   1 
HETATM 6110 O  O   . HOH I 8 .   ? 37.665  96.080  13.823  1.00 45.55 ? 1485 HOH A O   1 
HETATM 6111 O  O   . HOH I 8 .   ? 33.421  132.399 7.179   1.00 42.29 ? 1493 HOH A O   1 
HETATM 6112 O  O   . HOH I 8 .   ? 7.391   147.958 -20.896 1.00 40.45 ? 1497 HOH A O   1 
HETATM 6113 O  O   . HOH I 8 .   ? 46.831  121.338 15.625  1.00 43.17 ? 1500 HOH A O   1 
HETATM 6114 O  O   . HOH I 8 .   ? 4.002   156.666 -12.679 1.00 41.61 ? 1507 HOH A O   1 
HETATM 6115 O  O   . HOH I 8 .   ? 29.536  105.071 -3.364  1.00 35.20 ? 1517 HOH A O   1 
HETATM 6116 O  O   . HOH I 8 .   ? 17.638  98.435  1.670   1.00 38.38 ? 1519 HOH A O   1 
HETATM 6117 O  O   . HOH I 8 .   ? 38.755  145.332 -19.542 1.00 33.69 ? 1527 HOH A O   1 
HETATM 6118 O  O   . HOH I 8 .   ? 21.608  87.534  9.477   1.00 40.54 ? 1529 HOH A O   1 
HETATM 6119 O  O   . HOH I 8 .   ? 29.131  139.652 0.145   1.00 33.20 ? 1530 HOH A O   1 
HETATM 6120 O  O   . HOH I 8 .   ? 44.863  130.787 9.225   1.00 44.71 ? 1533 HOH A O   1 
HETATM 6121 O  O   . HOH I 8 .   ? 40.493  99.453  -8.700  1.00 35.99 ? 1553 HOH A O   1 
HETATM 6122 O  O   . HOH I 8 .   ? 41.575  140.738 -13.198 1.00 48.29 ? 1559 HOH A O   1 
HETATM 6123 O  O   . HOH I 8 .   ? 22.390  90.609  14.620  1.00 48.59 ? 1565 HOH A O   1 
HETATM 6124 O  O   . HOH I 8 .   ? 39.020  110.059 -10.928 1.00 40.14 ? 1572 HOH A O   1 
HETATM 6125 O  O   . HOH I 8 .   ? 26.960  105.329 4.300   1.00 47.63 ? 1574 HOH A O   1 
HETATM 6126 O  O   . HOH I 8 .   ? 37.871  111.767 -13.167 1.00 40.73 ? 1577 HOH A O   1 
HETATM 6127 O  O   . HOH I 8 .   ? 22.736  99.563  17.289  1.00 35.55 ? 1578 HOH A O   1 
HETATM 6128 O  O   . HOH I 8 .   ? 5.592   158.423 -15.604 1.00 40.92 ? 1585 HOH A O   1 
HETATM 6129 O  O   . HOH I 8 .   ? 38.591  97.600  5.938   1.00 28.75 ? 1588 HOH A O   1 
HETATM 6130 O  O   . HOH I 8 .   ? 14.578  99.002  16.337  1.00 28.78 ? 1590 HOH A O   1 
HETATM 6131 O  O   . HOH I 8 .   ? 24.855  97.045  19.922  1.00 36.64 ? 1593 HOH A O   1 
HETATM 6132 O  O   . HOH I 8 .   ? 26.497  105.458 7.590   1.00 30.62 ? 1594 HOH A O   1 
HETATM 6133 O  O   . HOH I 8 .   ? 7.507   158.391 -12.379 1.00 28.02 ? 1598 HOH A O   1 
HETATM 6134 O  O   . HOH I 8 .   ? 30.871  109.546 8.077   1.00 31.82 ? 1599 HOH A O   1 
HETATM 6135 O  O   . HOH I 8 .   ? 12.591  99.562  19.379  1.00 35.03 ? 1600 HOH A O   1 
HETATM 6136 O  O   . HOH I 8 .   ? 36.469  105.821 -4.841  1.00 36.85 ? 1601 HOH A O   1 
HETATM 6137 O  O   . HOH I 8 .   ? 38.882  140.509 -20.269 1.00 36.09 ? 1603 HOH A O   1 
HETATM 6138 O  O   . HOH I 8 .   ? 26.084  154.048 -28.867 1.00 38.98 ? 1607 HOH A O   1 
HETATM 6139 O  O   . HOH I 8 .   ? 5.339   147.541 -19.120 1.00 38.37 ? 1613 HOH A O   1 
HETATM 6140 O  O   . HOH I 8 .   ? 46.697  124.309 7.027   1.00 38.00 ? 1617 HOH A O   1 
HETATM 6141 O  O   . HOH I 8 .   ? 50.388  127.717 0.149   1.00 44.87 ? 1618 HOH A O   1 
HETATM 6142 O  O   . HOH I 8 .   ? 45.512  135.170 -13.158 1.00 41.49 ? 1620 HOH A O   1 
HETATM 6143 O  O   . HOH I 8 .   ? 20.022  104.568 2.688   1.00 37.76 ? 1621 HOH A O   1 
HETATM 6144 O  O   . HOH I 8 .   ? 36.595  91.017  9.919   1.00 55.87 ? 1624 HOH A O   1 
HETATM 6145 O  O   . HOH I 8 .   ? 47.775  103.585 -10.947 1.00 44.83 ? 1640 HOH A O   1 
HETATM 6146 O  O   . HOH I 8 .   ? 11.702  106.310 14.950  1.00 39.93 ? 1645 HOH A O   1 
HETATM 6147 O  O   . HOH I 8 .   ? 36.079  109.598 -6.954  1.00 46.43 ? 1646 HOH A O   1 
HETATM 6148 O  O   . HOH I 8 .   ? 25.967  113.087 25.079  1.00 42.23 ? 1648 HOH A O   1 
HETATM 6149 O  O   . HOH I 8 .   ? 32.805  86.803  13.323  1.00 33.38 ? 1650 HOH A O   1 
HETATM 6150 O  O   . HOH I 8 .   ? 25.710  89.611  4.850   1.00 33.76 ? 1665 HOH A O   1 
HETATM 6151 O  O   . HOH I 8 .   ? 44.604  133.189 -16.593 1.00 35.11 ? 1670 HOH A O   1 
HETATM 6152 O  O   . HOH I 8 .   ? 23.915  156.167 -17.202 1.00 33.43 ? 1671 HOH A O   1 
HETATM 6153 O  O   . HOH I 8 .   ? 18.954  137.430 -20.884 1.00 46.75 ? 1689 HOH A O   1 
HETATM 6154 O  O   . HOH I 8 .   ? 38.083  143.052 -20.709 1.00 29.34 ? 1692 HOH A O   1 
HETATM 6155 O  O   . HOH I 8 .   ? 26.214  132.921 -14.243 1.00 23.27 ? 1693 HOH A O   1 
HETATM 6156 O  O   . HOH I 8 .   ? 23.016  115.253 23.487  1.00 40.36 ? 1698 HOH A O   1 
HETATM 6157 O  O   . HOH I 8 .   ? 32.995  123.429 -14.679 1.00 42.82 ? 1705 HOH A O   1 
HETATM 6158 O  O   . HOH I 8 .   ? 38.316  108.971 -5.917  1.00 39.42 ? 1707 HOH A O   1 
HETATM 6159 O  O   . HOH I 8 .   ? -4.599  143.165 -7.861  1.00 30.73 ? 1708 HOH A O   1 
HETATM 6160 O  O   . HOH I 8 .   ? 41.225  147.541 -17.176 1.00 56.85 ? 1717 HOH A O   1 
HETATM 6161 O  O   . HOH I 8 .   ? 10.975  159.676 -3.073  1.00 33.37 ? 1718 HOH A O   1 
HETATM 6162 O  O   . HOH I 8 .   ? 41.043  112.830 -16.008 1.00 52.55 ? 1729 HOH A O   1 
HETATM 6163 O  O   . HOH I 8 .   ? 15.242  158.134 -3.468  1.00 42.16 ? 1733 HOH A O   1 
HETATM 6164 O  O   . HOH I 8 .   ? 35.698  151.554 -18.549 1.00 41.43 ? 1741 HOH A O   1 
HETATM 6165 O  O   . HOH I 8 .   ? 32.915  148.597 -7.155  1.00 39.98 ? 1746 HOH A O   1 
HETATM 6166 O  O   . HOH I 8 .   ? 1.799   150.395 -7.674  1.00 53.53 ? 1747 HOH A O   1 
HETATM 6167 O  O   . HOH I 8 .   ? 26.464  95.001  19.302  1.00 40.65 ? 1748 HOH A O   1 
HETATM 6168 O  O   . HOH I 8 .   ? 52.430  112.368 0.052   1.00 51.36 ? 1756 HOH A O   1 
HETATM 6169 O  O   . HOH I 8 .   ? 46.915  132.004 -12.021 1.00 46.68 ? 1759 HOH A O   1 
HETATM 6170 O  O   . HOH I 8 .   ? 40.464  132.236 -25.781 1.00 41.59 ? 1763 HOH A O   1 
HETATM 6171 O  O   . HOH I 8 .   ? 39.906  145.472 -12.169 1.00 47.62 ? 1787 HOH A O   1 
HETATM 6172 O  O   . HOH I 8 .   ? 46.596  124.363 9.631   1.00 48.60 ? 1791 HOH A O   1 
HETATM 6173 O  O   . HOH I 8 .   ? 25.924  130.386 -13.777 1.00 31.48 ? 1794 HOH A O   1 
HETATM 6174 O  O   . HOH I 8 .   ? 3.552   151.431 -6.034  1.00 30.54 ? 1798 HOH A O   1 
HETATM 6175 O  O   . HOH I 8 .   ? 30.161  124.873 -15.738 1.00 38.30 ? 1800 HOH A O   1 
HETATM 6176 O  O   . HOH I 8 .   ? 27.902  127.641 -14.155 1.00 20.55 ? 1801 HOH A O   1 
HETATM 6177 O  O   . HOH I 8 .   ? 40.214  136.397 2.761   1.00 40.70 ? 1805 HOH A O   1 
HETATM 6178 O  O   . HOH I 8 .   ? 13.148  111.149 17.069  1.00 42.37 ? 1808 HOH A O   1 
HETATM 6179 O  O   . HOH I 8 .   ? 10.662  170.362 -10.679 1.00 46.29 ? 1809 HOH A O   1 
HETATM 6180 O  O   . HOH I 8 .   ? 14.343  162.035 -5.390  1.00 36.49 ? 1817 HOH A O   1 
HETATM 6181 O  O   . HOH I 8 .   ? 5.871   80.774  7.736   1.00 34.70 ? 1818 HOH A O   1 
HETATM 6182 O  O   . HOH I 8 .   ? 15.533  151.167 -32.111 1.00 35.83 ? 1822 HOH A O   1 
HETATM 6183 O  O   . HOH I 8 .   ? 37.638  106.690 -8.023  1.00 55.41 ? 1830 HOH A O   1 
HETATM 6184 O  O   . HOH I 8 .   ? 34.611  110.971 20.400  1.00 57.08 ? 1836 HOH A O   1 
HETATM 6185 O  O   . HOH I 8 .   ? 40.399  93.462  3.695   1.00 45.83 ? 1840 HOH A O   1 
HETATM 6186 O  O   . HOH I 8 .   ? 19.530  140.544 -29.244 1.00 50.38 ? 1843 HOH A O   1 
HETATM 6187 O  O   . HOH I 8 .   ? 21.420  101.800 4.708   1.00 50.32 ? 1850 HOH A O   1 
HETATM 6188 O  O   . HOH I 8 .   ? 45.310  127.674 10.424  1.00 39.27 ? 1857 HOH A O   1 
HETATM 6189 O  O   . HOH I 8 .   ? 48.886  119.363 16.262  1.00 54.09 ? 1861 HOH A O   1 
HETATM 6190 O  O   . HOH I 8 .   ? 38.376  139.069 -27.670 1.00 38.83 ? 1862 HOH A O   1 
HETATM 6191 O  O   . HOH I 8 .   ? 21.349  160.182 -22.613 1.00 37.36 ? 1865 HOH A O   1 
HETATM 6192 O  O   . HOH I 8 .   ? 13.365  113.800 20.441  1.00 39.25 ? 1866 HOH A O   1 
HETATM 6193 O  O   . HOH I 8 .   ? 6.796   162.606 -25.413 1.00 49.87 ? 1868 HOH A O   1 
HETATM 6194 O  O   . HOH I 8 .   ? 43.063  115.583 -18.191 1.00 57.15 ? 1869 HOH A O   1 
HETATM 6195 O  O   . HOH I 8 .   ? 5.973   155.778 -24.495 1.00 32.39 ? 1871 HOH A O   1 
HETATM 6196 O  O   . HOH I 8 .   ? -2.904  147.976 -2.319  1.00 46.95 ? 1881 HOH A O   1 
HETATM 6197 O  O   . HOH I 8 .   ? 39.096  146.017 -9.470  1.00 50.54 ? 1883 HOH A O   1 
HETATM 6198 O  O   . HOH I 8 .   ? 32.456  124.115 -20.154 1.00 43.05 ? 1886 HOH A O   1 
HETATM 6199 O  O   . HOH I 8 .   ? 23.362  88.226  13.246  1.00 39.18 ? 1896 HOH A O   1 
HETATM 6200 O  O   . HOH I 8 .   ? 25.630  131.972 -10.324 1.00 22.51 ? 1906 HOH A O   1 
HETATM 6201 O  O   . HOH I 8 .   ? 24.387  133.379 -12.285 1.00 17.35 ? 1907 HOH A O   1 
HETATM 6202 O  O   . HOH I 8 .   ? 20.021  137.690 -8.073  1.00 19.95 ? 1908 HOH A O   1 
HETATM 6203 O  O   . HOH I 8 .   ? 25.547  141.089 -2.818  1.00 24.49 ? 1910 HOH A O   1 
HETATM 6204 O  O   . HOH I 8 .   ? 29.400  133.031 1.006   1.00 22.91 ? 1912 HOH A O   1 
HETATM 6205 O  O   . HOH I 8 .   ? 15.814  138.410 -9.799  1.00 21.75 ? 1913 HOH A O   1 
HETATM 6206 O  O   . HOH I 8 .   ? 18.130  135.673 -13.569 1.00 24.01 ? 1918 HOH A O   1 
HETATM 6207 O  O   . HOH I 8 .   ? 18.273  143.965 -5.836  1.00 26.56 ? 1919 HOH A O   1 
HETATM 6208 O  O   . HOH I 8 .   ? 42.295  135.151 -0.504  1.00 32.25 ? 1921 HOH A O   1 
HETATM 6209 O  O   . HOH I 8 .   ? 28.727  120.138 9.910   1.00 40.87 ? 1927 HOH A O   1 
HETATM 6210 O  O   . HOH I 8 .   ? 23.422  133.451 -21.932 1.00 35.17 ? 1929 HOH A O   1 
HETATM 6211 O  O   . HOH I 8 .   ? 24.218  156.724 -14.654 1.00 36.10 ? 1930 HOH A O   1 
HETATM 6212 O  O   . HOH I 8 .   ? 28.253  125.817 -17.588 1.00 34.50 ? 1932 HOH A O   1 
HETATM 6213 O  O   . HOH I 8 .   ? 20.650  142.201 -5.877  1.00 40.58 ? 1933 HOH A O   1 
HETATM 6214 O  O   . HOH I 8 .   ? 3.144   163.697 -24.496 1.00 30.88 ? 1941 HOH A O   1 
HETATM 6215 O  O   . HOH I 8 .   ? -6.579  144.628 -8.862  1.00 39.91 ? 1942 HOH A O   1 
HETATM 6216 O  O   . HOH I 8 .   ? 34.318  145.112 -27.936 1.00 35.45 ? 1943 HOH A O   1 
HETATM 6217 O  O   . HOH I 8 .   ? 8.755   167.247 -12.929 1.00 38.24 ? 1946 HOH A O   1 
HETATM 6218 O  O   . HOH I 8 .   ? 44.514  139.164 -14.456 1.00 36.39 ? 1947 HOH A O   1 
HETATM 6219 O  O   . HOH I 8 .   ? 40.540  95.200  1.759   1.00 37.92 ? 1950 HOH A O   1 
HETATM 6220 O  O   . HOH I 8 .   ? 42.205  96.285  8.308   1.00 41.03 ? 1951 HOH A O   1 
HETATM 6221 O  O   . HOH I 8 .   ? 21.434  156.185 -30.066 1.00 37.16 ? 1955 HOH A O   1 
HETATM 6222 O  O   . HOH I 8 .   ? 24.124  87.681  4.851   1.00 43.50 ? 1956 HOH A O   1 
HETATM 6223 O  O   . HOH I 8 .   ? 51.958  109.222 -3.704  1.00 37.42 ? 1957 HOH A O   1 
HETATM 6224 O  O   . HOH I 8 .   ? 40.258  135.301 -28.096 1.00 50.14 ? 1958 HOH A O   1 
HETATM 6225 O  O   . HOH I 8 .   ? 52.200  110.105 -1.219  1.00 44.31 ? 1959 HOH A O   1 
HETATM 6226 O  O   . HOH I 8 .   ? 46.296  126.757 -17.159 1.00 42.89 ? 1964 HOH A O   1 
HETATM 6227 O  O   . HOH I 8 .   ? 30.495  128.651 -22.394 1.00 39.64 ? 1967 HOH A O   1 
HETATM 6228 O  O   . HOH I 8 .   ? 21.845  138.890 -2.054  1.00 38.36 ? 1970 HOH A O   1 
HETATM 6229 O  O   . HOH I 8 .   ? 39.730  142.639 -12.235 1.00 39.09 ? 1972 HOH A O   1 
HETATM 6230 O  O   . HOH I 8 .   ? 33.542  118.119 -12.471 1.00 42.47 ? 1973 HOH A O   1 
HETATM 6231 O  O   . HOH I 8 .   ? 27.049  93.784  21.723  1.00 48.08 ? 1974 HOH A O   1 
HETATM 6232 O  O   . HOH I 8 .   ? 14.002  164.875 -26.969 1.00 46.77 ? 1975 HOH A O   1 
HETATM 6233 O  O   . HOH I 8 .   ? 43.366  138.953 -7.236  1.00 35.07 ? 1976 HOH A O   1 
HETATM 6234 O  O   . HOH I 8 .   ? 16.661  113.234 22.141  1.00 44.77 ? 1982 HOH A O   1 
HETATM 6235 O  O   . HOH I 8 .   ? 40.332  143.534 -9.102  1.00 48.85 ? 1984 HOH A O   1 
HETATM 6236 O  O   . HOH I 8 .   ? 18.789  112.802 20.723  1.00 45.75 ? 1985 HOH A O   1 
HETATM 6237 O  O   . HOH I 8 .   ? 4.238   153.442 -7.789  1.00 46.20 ? 1986 HOH A O   1 
HETATM 6238 O  O   . HOH I 8 .   ? 17.178  147.596 -4.581  1.00 41.61 ? 1987 HOH A O   1 
HETATM 6239 O  O   . HOH I 8 .   ? 31.142  99.194  -2.278  1.00 46.05 ? 1989 HOH A O   1 
HETATM 6240 O  O   . HOH I 8 .   ? 44.774  127.058 -21.697 1.00 49.55 ? 1991 HOH A O   1 
HETATM 6241 O  O   . HOH I 8 .   ? 36.307  98.696  -6.064  1.00 37.43 ? 1992 HOH A O   1 
HETATM 6242 O  O   . HOH I 8 .   ? 19.878  102.983 0.570   1.00 47.14 ? 1994 HOH A O   1 
HETATM 6243 O  O   . HOH I 8 .   ? 31.211  142.317 -0.717  1.00 45.13 ? 1996 HOH A O   1 
HETATM 6244 O  O   . HOH I 8 .   ? 29.404  124.721 -19.925 1.00 46.70 ? 2002 HOH A O   1 
HETATM 6245 O  O   . HOH I 8 .   ? 38.782  145.170 -4.666  1.00 44.59 ? 2008 HOH A O   1 
HETATM 6246 O  O   . HOH I 8 .   ? 9.740   169.917 -7.685  1.00 41.21 ? 2009 HOH A O   1 
HETATM 6247 O  O   . HOH I 8 .   ? 42.881  103.031 -9.248  1.00 44.42 ? 2011 HOH A O   1 
HETATM 6248 O  O   . HOH I 8 .   ? 30.142  105.455 3.111   1.00 41.72 ? 2012 HOH A O   1 
HETATM 6249 O  O   . HOH I 8 .   ? 3.349   155.442 -24.437 1.00 47.41 ? 2015 HOH A O   1 
HETATM 6250 O  O   . HOH I 8 .   ? 12.926  102.118 18.745  1.00 52.12 ? 2017 HOH A O   1 
HETATM 6251 O  O   . HOH I 8 .   ? 45.571  136.103 -17.154 1.00 46.54 ? 2020 HOH A O   1 
HETATM 6252 O  O   . HOH I 8 .   ? 50.041  127.264 -2.989  1.00 42.70 ? 2021 HOH A O   1 
HETATM 6253 O  O   . HOH I 8 .   ? 45.425  123.663 -18.341 1.00 43.01 ? 2024 HOH A O   1 
HETATM 6254 O  O   . HOH I 8 .   ? 5.213   151.984 -10.206 1.00 43.95 ? 2025 HOH A O   1 
HETATM 6255 O  O   . HOH I 8 .   ? 38.702  121.605 -19.867 1.00 38.24 ? 2028 HOH A O   1 
HETATM 6256 O  O   . HOH I 8 .   ? 28.808  134.970 3.323   1.00 48.63 ? 2029 HOH A O   1 
HETATM 6257 O  O   . HOH I 8 .   ? 40.038  95.499  6.844   1.00 46.64 ? 2030 HOH A O   1 
HETATM 6258 O  O   . HOH I 8 .   ? 27.201  133.883 -24.883 1.00 42.29 ? 2042 HOH A O   1 
HETATM 6259 O  O   . HOH I 8 .   ? 49.401  115.903 -9.633  1.00 44.33 ? 2044 HOH A O   1 
HETATM 6260 O  O   . HOH I 8 .   ? 44.672  107.150 -14.416 1.00 47.94 ? 2046 HOH A O   1 
HETATM 6261 O  O   . HOH I 8 .   ? 21.674  154.431 -5.599  1.00 51.18 ? 2052 HOH A O   1 
HETATM 6262 O  O   . HOH I 8 .   ? 8.006   165.124 -18.183 1.00 43.92 ? 2054 HOH A O   1 
HETATM 6263 O  O   . HOH I 8 .   ? 47.590  120.213 -13.758 1.00 51.94 ? 2055 HOH A O   1 
HETATM 6264 O  O   . HOH I 8 .   ? 32.806  139.094 -1.955  1.00 43.12 ? 2057 HOH A O   1 
HETATM 6265 O  O   . HOH I 8 .   ? 16.756  138.941 -5.639  1.00 28.87 ? 2059 HOH A O   1 
HETATM 6266 O  O   . HOH I 8 .   ? 25.284  133.705 -2.538  1.00 38.73 ? 2061 HOH A O   1 
HETATM 6267 O  O   . HOH I 8 .   ? 19.639  138.787 -5.658  1.00 32.33 ? 2062 HOH A O   1 
HETATM 6268 O  O   . HOH I 8 .   ? 35.960  101.193 17.797  1.00 51.12 ? 2072 HOH A O   1 
HETATM 6269 O  O   . HOH I 8 .   ? 25.804  98.204  22.273  1.00 44.96 ? 2073 HOH A O   1 
HETATM 6270 O  O   . HOH I 8 .   ? 47.482  123.653 2.123   1.00 43.14 ? 2077 HOH A O   1 
HETATM 6271 O  O   . HOH I 8 .   ? 51.240  124.691 -3.336  1.00 45.42 ? 2081 HOH A O   1 
HETATM 6272 O  O   . HOH I 8 .   ? 24.966  149.893 -9.659  1.00 44.65 ? 2082 HOH A O   1 
HETATM 6273 O  O   . HOH I 8 .   ? 41.180  133.628 6.675   1.00 47.41 ? 2083 HOH A O   1 
HETATM 6274 O  O   . HOH I 8 .   ? 19.786  168.173 -22.316 1.00 52.15 ? 2084 HOH A O   1 
HETATM 6275 O  O   . HOH I 8 .   ? 38.755  96.353  16.400  1.00 48.77 ? 2086 HOH A O   1 
HETATM 6276 O  O   . HOH I 8 .   ? 32.814  141.498 1.772   1.00 46.88 ? 2087 HOH A O   1 
HETATM 6277 O  O   . HOH I 8 .   ? 35.315  147.978 -8.429  1.00 47.16 ? 2088 HOH A O   1 
HETATM 6278 O  O   . HOH I 8 .   ? 5.262   162.057 -12.957 1.00 46.23 ? 2089 HOH A O   1 
HETATM 6279 O  O   . HOH I 8 .   ? 17.531  162.120 -27.346 1.00 48.51 ? 2093 HOH A O   1 
HETATM 6280 O  O   . HOH I 8 .   ? 7.191   146.027 -22.882 1.00 49.16 ? 2095 HOH A O   1 
HETATM 6281 O  O   . HOH I 8 .   ? 26.695  140.721 -0.220  1.00 49.37 ? 2100 HOH A O   1 
HETATM 6282 O  O   . HOH J 8 .   ? 25.959  128.411 12.964  1.00 15.57 ? 1004 HOH B O   1 
HETATM 6283 O  O   . HOH J 8 .   ? 13.005  146.677 -10.649 1.00 21.69 ? 1005 HOH B O   1 
HETATM 6284 O  O   . HOH J 8 .   ? 5.867   122.997 17.531  1.00 16.65 ? 1006 HOH B O   1 
HETATM 6285 O  O   . HOH J 8 .   ? -5.137  123.890 -5.354  1.00 20.47 ? 1007 HOH B O   1 
HETATM 6286 O  O   . HOH J 8 .   ? 28.916  122.659 17.657  1.00 17.50 ? 1008 HOH B O   1 
HETATM 6287 O  O   . HOH J 8 .   ? 8.733   148.709 -11.315 1.00 21.54 ? 1009 HOH B O   1 
HETATM 6288 O  O   . HOH J 8 .   ? 9.623   142.670 6.267   1.00 31.43 ? 1010 HOH B O   1 
HETATM 6289 O  O   . HOH J 8 .   ? 37.808  122.015 14.763  1.00 16.00 ? 1011 HOH B O   1 
HETATM 6290 O  O   . HOH J 8 .   ? 12.401  134.714 -20.233 1.00 18.57 ? 1012 HOH B O   1 
HETATM 6291 O  O   . HOH J 8 .   ? 20.032  115.218 11.313  1.00 17.59 ? 1013 HOH B O   1 
HETATM 6292 O  O   . HOH J 8 .   ? 4.923   125.590 -8.567  1.00 15.30 ? 1014 HOH B O   1 
HETATM 6293 O  O   . HOH J 8 .   ? 4.106   119.171 6.922   1.00 16.73 ? 1015 HOH B O   1 
HETATM 6294 O  O   . HOH J 8 .   ? 7.172   145.563 -13.551 1.00 20.03 ? 1016 HOH B O   1 
HETATM 6295 O  O   . HOH J 8 .   ? 28.362  115.424 5.274   1.00 14.67 ? 1017 HOH B O   1 
HETATM 6296 O  O   . HOH J 8 .   ? 1.814   130.941 -18.919 1.00 15.94 ? 1018 HOH B O   1 
HETATM 6297 O  O   . HOH J 8 .   ? 12.829  112.738 14.744  1.00 15.62 ? 1019 HOH B O   1 
HETATM 6298 O  O   . HOH J 8 .   ? 23.885  111.323 -14.736 1.00 23.32 ? 1020 HOH B O   1 
HETATM 6299 O  O   . HOH J 8 .   ? 23.813  123.783 25.954  1.00 34.24 ? 1021 HOH B O   1 
HETATM 6300 O  O   . HOH J 8 .   ? -5.208  127.192 -16.599 1.00 22.97 ? 1022 HOH B O   1 
HETATM 6301 O  O   . HOH J 8 .   ? 26.336  118.932 13.657  1.00 19.83 ? 1023 HOH B O   1 
HETATM 6302 O  O   . HOH J 8 .   ? 27.127  125.877 26.051  1.00 28.43 ? 1024 HOH B O   1 
HETATM 6303 O  O   . HOH J 8 .   ? 14.622  112.983 -17.161 1.00 19.39 ? 1025 HOH B O   1 
HETATM 6304 O  O   . HOH J 8 .   ? 0.750   128.924 19.316  1.00 17.58 ? 1026 HOH B O   1 
HETATM 6305 O  O   . HOH J 8 .   ? 29.116  134.706 13.099  1.00 28.02 ? 1027 HOH B O   1 
HETATM 6306 O  O   . HOH J 8 .   ? 13.092  105.319 -4.943  1.00 37.95 ? 1028 HOH B O   1 
HETATM 6307 O  O   . HOH J 8 .   ? 18.579  122.748 -15.013 1.00 15.09 ? 1029 HOH B O   1 
HETATM 6308 O  O   . HOH J 8 .   ? 26.763  122.861 16.006  1.00 16.51 ? 1030 HOH B O   1 
HETATM 6309 O  O   . HOH J 8 .   ? 28.184  119.087 -8.067  1.00 16.20 ? 1031 HOH B O   1 
HETATM 6310 O  O   . HOH J 8 .   ? 19.663  112.561 11.489  1.00 19.89 ? 1032 HOH B O   1 
HETATM 6311 O  O   . HOH J 8 .   ? 18.004  99.930  4.867   1.00 35.81 ? 1033 HOH B O   1 
HETATM 6312 O  O   . HOH J 8 .   ? 6.851   145.121 -10.120 1.00 19.51 ? 1034 HOH B O   1 
HETATM 6313 O  O   . HOH J 8 .   ? 5.157   139.317 -17.778 1.00 23.83 ? 1035 HOH B O   1 
HETATM 6314 O  O   . HOH J 8 .   ? 14.036  105.852 9.239   1.00 20.95 ? 1036 HOH B O   1 
HETATM 6315 O  O   . HOH J 8 .   ? 32.596  126.029 4.437   1.00 15.09 ? 1037 HOH B O   1 
HETATM 6316 O  O   . HOH J 8 .   ? 31.714  126.564 1.917   1.00 13.52 ? 1038 HOH B O   1 
HETATM 6317 O  O   . HOH J 8 .   ? 33.978  121.409 11.024  1.00 17.03 ? 1039 HOH B O   1 
HETATM 6318 O  O   . HOH J 8 .   ? 32.214  115.353 -6.984  1.00 22.56 ? 1040 HOH B O   1 
HETATM 6319 O  O   . HOH J 8 .   ? -4.259  141.112 3.365   1.00 36.72 ? 1041 HOH B O   1 
HETATM 6320 O  O   . HOH J 8 .   ? 29.922  126.820 10.607  1.00 18.60 ? 1042 HOH B O   1 
HETATM 6321 O  O   . HOH J 8 .   ? 6.933   112.324 14.095  1.00 17.58 ? 1043 HOH B O   1 
HETATM 6322 O  O   . HOH J 8 .   ? 1.463   116.114 -17.303 1.00 23.78 ? 1044 HOH B O   1 
HETATM 6323 O  O   . HOH J 8 .   ? 31.395  129.294 9.973   1.00 14.26 ? 1045 HOH B O   1 
HETATM 6324 O  O   . HOH J 8 .   ? 36.773  124.928 21.051  1.00 30.71 ? 1046 HOH B O   1 
HETATM 6325 O  O   . HOH J 8 .   ? 18.771  122.779 19.361  1.00 36.44 ? 1047 HOH B O   1 
HETATM 6326 O  O   . HOH J 8 .   ? 20.378  120.924 19.326  1.00 23.25 ? 1048 HOH B O   1 
HETATM 6327 O  O   . HOH J 8 .   ? 29.824  122.464 9.710   1.00 17.42 ? 1049 HOH B O   1 
HETATM 6328 O  O   . HOH J 8 .   ? 14.804  137.180 -20.428 1.00 29.80 ? 1050 HOH B O   1 
HETATM 6329 O  O   . HOH J 8 .   ? 31.879  124.982 11.439  1.00 21.74 ? 1051 HOH B O   1 
HETATM 6330 O  O   . HOH J 8 .   ? 29.760  114.626 2.923   1.00 16.68 ? 1052 HOH B O   1 
HETATM 6331 O  O   . HOH J 8 .   ? 21.355  114.347 -19.762 1.00 25.90 ? 1053 HOH B O   1 
HETATM 6332 O  O   . HOH J 8 .   ? 12.421  133.302 18.691  1.00 27.81 ? 1054 HOH B O   1 
HETATM 6333 O  O   . HOH J 8 .   ? 26.452  120.288 11.075  1.00 26.46 ? 1055 HOH B O   1 
HETATM 6334 O  O   . HOH J 8 .   ? 32.939  120.325 17.256  1.00 23.55 ? 1056 HOH B O   1 
HETATM 6335 O  O   . HOH J 8 .   ? 24.813  111.457 9.120   1.00 26.05 ? 1057 HOH B O   1 
HETATM 6336 O  O   . HOH J 8 .   ? 15.496  154.202 -4.315  1.00 41.81 ? 1058 HOH B O   1 
HETATM 6337 O  O   . HOH J 8 .   ? 6.797   139.552 -20.938 1.00 30.45 ? 1059 HOH B O   1 
HETATM 6338 O  O   . HOH J 8 .   ? 40.450  128.809 20.433  1.00 44.96 ? 1060 HOH B O   1 
HETATM 6339 O  O   . HOH J 8 .   ? 38.962  121.698 20.796  1.00 24.03 ? 1061 HOH B O   1 
HETATM 6340 O  O   . HOH J 8 .   ? 7.886   131.712 34.089  1.00 44.82 ? 1062 HOH B O   1 
HETATM 6341 O  O   . HOH J 8 .   ? 5.306   116.697 7.140   1.00 19.02 ? 1063 HOH B O   1 
HETATM 6342 O  O   . HOH J 8 .   ? 27.703  111.322 2.169   1.00 19.09 ? 1064 HOH B O   1 
HETATM 6343 O  O   . HOH J 8 .   ? 13.009  114.493 17.875  1.00 21.85 ? 1065 HOH B O   1 
HETATM 6344 O  O   . HOH J 8 .   ? 21.166  117.523 24.361  1.00 28.96 ? 1066 HOH B O   1 
HETATM 6345 O  O   . HOH J 8 .   ? 23.200  122.714 28.490  1.00 29.12 ? 1067 HOH B O   1 
HETATM 6346 O  O   . HOH J 8 .   ? -4.676  127.500 -20.596 1.00 24.72 ? 1068 HOH B O   1 
HETATM 6347 O  O   . HOH J 8 .   ? 22.087  109.148 -14.441 1.00 32.24 ? 1069 HOH B O   1 
HETATM 6348 O  O   . HOH J 8 .   ? 34.429  133.391 17.968  1.00 31.57 ? 1070 HOH B O   1 
HETATM 6349 O  O   . HOH J 8 .   ? -9.972  120.119 -8.218  1.00 31.69 ? 1071 HOH B O   1 
HETATM 6350 O  O   . HOH J 8 .   ? 20.358  136.421 -15.770 1.00 22.09 ? 1072 HOH B O   1 
HETATM 6351 O  O   . HOH J 8 .   ? 30.145  111.526 0.678   1.00 19.83 ? 1073 HOH B O   1 
HETATM 6352 O  O   . HOH J 8 .   ? 13.271  142.336 12.292  1.00 36.34 ? 1074 HOH B O   1 
HETATM 6353 O  O   . HOH J 8 .   ? 27.296  110.942 9.624   1.00 36.54 ? 1075 HOH B O   1 
HETATM 6354 O  O   . HOH J 8 .   ? 26.131  113.973 20.921  1.00 19.34 ? 1076 HOH B O   1 
HETATM 6355 O  O   . HOH J 8 .   ? 25.582  127.066 -15.513 1.00 18.55 ? 1077 HOH B O   1 
HETATM 6356 O  O   . HOH J 8 .   ? 9.317   114.411 -19.709 1.00 29.20 ? 1078 HOH B O   1 
HETATM 6357 O  O   . HOH J 8 .   ? 37.731  129.307 16.886  1.00 25.44 ? 1079 HOH B O   1 
HETATM 6358 O  O   . HOH J 8 .   ? 6.398   107.170 2.601   1.00 40.56 ? 1080 HOH B O   1 
HETATM 6359 O  O   . HOH J 8 .   ? 32.771  133.670 20.138  1.00 30.55 ? 1081 HOH B O   1 
HETATM 6360 O  O   . HOH J 8 .   ? 33.792  119.065 -7.113  1.00 24.56 ? 1082 HOH B O   1 
HETATM 6361 O  O   . HOH J 8 .   ? 28.029  114.274 10.628  1.00 27.37 ? 1083 HOH B O   1 
HETATM 6362 O  O   . HOH J 8 .   ? 7.960   130.607 23.412  1.00 28.29 ? 1084 HOH B O   1 
HETATM 6363 O  O   . HOH J 8 .   ? 7.854   123.490 24.779  1.00 11.86 ? 1085 HOH B O   1 
HETATM 6364 O  O   . HOH J 8 .   ? 24.674  129.345 -17.022 1.00 19.49 ? 1086 HOH B O   1 
HETATM 6365 O  O   . HOH J 8 .   ? 16.955  121.649 31.642  1.00 40.27 ? 1087 HOH B O   1 
HETATM 6366 O  O   . HOH J 8 .   ? 23.009  117.669 19.805  1.00 17.67 ? 1088 HOH B O   1 
HETATM 6367 O  O   . HOH J 8 .   ? -2.290  117.916 -12.922 1.00 28.47 ? 1089 HOH B O   1 
HETATM 6368 O  O   . HOH J 8 .   ? 10.461  128.199 28.063  1.00 19.90 ? 1090 HOH B O   1 
HETATM 6369 O  O   . HOH J 8 .   ? 7.556   110.955 19.334  1.00 39.89 ? 1091 HOH B O   1 
HETATM 6370 O  O   . HOH J 8 .   ? 1.242   113.634 10.628  1.00 27.20 ? 1092 HOH B O   1 
HETATM 6371 O  O   . HOH J 8 .   ? 25.415  115.811 24.409  1.00 38.28 ? 1093 HOH B O   1 
HETATM 6372 O  O   . HOH J 8 .   ? 14.050  115.668 38.136  1.00 41.36 ? 1094 HOH B O   1 
HETATM 6373 O  O   . HOH J 8 .   ? 25.893  122.274 -16.520 1.00 39.25 ? 1095 HOH B O   1 
HETATM 6374 O  O   . HOH J 8 .   ? 18.909  129.506 32.318  1.00 22.00 ? 1096 HOH B O   1 
HETATM 6375 O  O   . HOH J 8 .   ? 1.804   120.275 22.036  1.00 24.48 ? 1097 HOH B O   1 
HETATM 6376 O  O   . HOH J 8 .   ? -2.359  121.801 4.753   1.00 28.07 ? 1098 HOH B O   1 
HETATM 6377 O  O   . HOH J 8 .   ? 4.226   143.778 7.043   1.00 24.26 ? 1099 HOH B O   1 
HETATM 6378 O  O   . HOH J 8 .   ? 4.105   126.219 30.163  1.00 22.05 ? 1100 HOH B O   1 
HETATM 6379 O  O   . HOH J 8 .   ? 0.691   143.434 -17.515 1.00 26.21 ? 1101 HOH B O   1 
HETATM 6380 O  O   . HOH J 8 .   ? -3.784  129.503 -24.736 1.00 29.93 ? 1102 HOH B O   1 
HETATM 6381 O  O   . HOH J 8 .   ? -0.909  134.163 19.072  1.00 32.21 ? 1103 HOH B O   1 
HETATM 6382 O  O   . HOH J 8 .   ? 23.620  123.331 -19.168 1.00 37.16 ? 1104 HOH B O   1 
HETATM 6383 O  O   . HOH J 8 .   ? 15.944  111.381 -18.969 1.00 39.22 ? 1105 HOH B O   1 
HETATM 6384 O  O   . HOH J 8 .   ? -13.544 130.732 -8.867  1.00 33.42 ? 1106 HOH B O   1 
HETATM 6385 O  O   . HOH J 8 .   ? 6.209   116.748 4.682   1.00 30.90 ? 1107 HOH B O   1 
HETATM 6386 O  O   . HOH J 8 .   ? 14.457  130.449 -26.388 1.00 33.21 ? 1108 HOH B O   1 
HETATM 6387 O  O   . HOH J 8 .   ? 2.816   141.702 13.868  1.00 26.03 ? 1109 HOH B O   1 
HETATM 6388 O  O   . HOH J 8 .   ? 30.553  121.182 16.141  1.00 25.01 ? 1110 HOH B O   1 
HETATM 6389 O  O   . HOH J 8 .   ? -5.678  141.079 -14.122 1.00 26.77 ? 1111 HOH B O   1 
HETATM 6390 O  O   . HOH J 8 .   ? 4.623   118.592 29.959  1.00 34.00 ? 1112 HOH B O   1 
HETATM 6391 O  O   . HOH J 8 .   ? -1.698  106.426 12.583  1.00 42.18 ? 1113 HOH B O   1 
HETATM 6392 O  O   . HOH J 8 .   ? 3.979   147.496 -16.540 1.00 41.31 ? 1114 HOH B O   1 
HETATM 6393 O  O   . HOH J 8 .   ? 7.514   144.605 5.978   1.00 42.18 ? 1115 HOH B O   1 
HETATM 6394 O  O   . HOH J 8 .   ? 2.182   116.238 19.719  1.00 38.81 ? 1116 HOH B O   1 
HETATM 6395 O  O   . HOH J 8 .   ? 29.583  115.290 -11.991 1.00 31.26 ? 1117 HOH B O   1 
HETATM 6396 O  O   . HOH J 8 .   ? 10.715  120.661 33.880  1.00 25.07 ? 1118 HOH B O   1 
HETATM 6397 O  O   . HOH J 8 .   ? 2.317   115.097 1.816   1.00 43.19 ? 1119 HOH B O   1 
HETATM 6398 O  O   . HOH J 8 .   ? 8.615   109.650 -7.345  1.00 29.09 ? 1120 HOH B O   1 
HETATM 6399 O  O   . HOH J 8 .   ? 9.414   123.953 26.991  1.00 18.34 ? 1121 HOH B O   1 
HETATM 6400 O  O   . HOH J 8 .   ? -2.020  126.427 11.886  1.00 22.95 ? 1122 HOH B O   1 
HETATM 6401 O  O   . HOH J 8 .   ? 27.922  108.523 2.716   1.00 21.88 ? 1123 HOH B O   1 
HETATM 6402 O  O   . HOH J 8 .   ? 33.916  117.812 -9.610  1.00 30.05 ? 1124 HOH B O   1 
HETATM 6403 O  O   . HOH J 8 .   ? 18.051  128.312 34.718  1.00 26.14 ? 1125 HOH B O   1 
HETATM 6404 O  O   . HOH J 8 .   ? 29.151  122.429 -14.885 1.00 25.46 ? 1126 HOH B O   1 
HETATM 6405 O  O   . HOH J 8 .   ? -3.187  123.881 3.154   1.00 32.70 ? 1127 HOH B O   1 
HETATM 6406 O  O   . HOH J 8 .   ? 29.472  117.218 -9.300  1.00 31.76 ? 1128 HOH B O   1 
HETATM 6407 O  O   . HOH J 8 .   ? 13.482  106.338 -9.287  1.00 29.67 ? 1129 HOH B O   1 
HETATM 6408 O  O   . HOH J 8 .   ? 31.060  127.557 20.891  1.00 28.98 ? 1130 HOH B O   1 
HETATM 6409 O  O   . HOH J 8 .   ? 34.225  125.545 12.896  1.00 30.73 ? 1131 HOH B O   1 
HETATM 6410 O  O   . HOH J 8 .   ? 4.696   118.709 23.192  1.00 27.26 ? 1132 HOH B O   1 
HETATM 6411 O  O   . HOH J 8 .   ? -6.071  139.404 4.811   1.00 32.28 ? 1133 HOH B O   1 
HETATM 6412 O  O   . HOH J 8 .   ? 1.075   136.016 18.925  1.00 26.90 ? 1134 HOH B O   1 
HETATM 6413 O  O   . HOH J 8 .   ? 31.438  119.211 20.635  1.00 26.15 ? 1135 HOH B O   1 
HETATM 6414 O  O   . HOH J 8 .   ? 28.150  111.842 -12.079 1.00 31.54 ? 1136 HOH B O   1 
HETATM 6415 O  O   . HOH J 8 .   ? 3.068   108.813 -3.099  1.00 56.51 ? 1137 HOH B O   1 
HETATM 6416 O  O   . HOH J 8 .   ? 28.250  122.003 13.931  1.00 31.21 ? 1138 HOH B O   1 
HETATM 6417 O  O   . HOH J 8 .   ? 23.050  134.549 16.060  1.00 34.04 ? 1139 HOH B O   1 
HETATM 6418 O  O   . HOH J 8 .   ? 17.251  122.465 -26.688 1.00 35.89 ? 1140 HOH B O   1 
HETATM 6419 O  O   . HOH J 8 .   ? 23.155  121.631 -23.432 1.00 30.28 ? 1141 HOH B O   1 
HETATM 6420 O  O   . HOH J 8 .   ? -5.676  124.803 -20.628 1.00 28.88 ? 1142 HOH B O   1 
HETATM 6421 O  O   . HOH J 8 .   ? -0.956  115.917 -1.598  1.00 34.73 ? 1143 HOH B O   1 
HETATM 6422 O  O   . HOH J 8 .   ? 15.260  135.532 17.537  1.00 38.70 ? 1144 HOH B O   1 
HETATM 6423 O  O   . HOH J 8 .   ? 4.461   129.222 28.070  1.00 35.17 ? 1145 HOH B O   1 
HETATM 6424 O  O   . HOH J 8 .   ? 15.439  147.719 -1.521  1.00 35.38 ? 1146 HOH B O   1 
HETATM 6425 O  O   . HOH J 8 .   ? -10.831 121.121 -15.216 1.00 38.13 ? 1147 HOH B O   1 
HETATM 6426 O  O   . HOH J 8 .   ? 21.317  124.988 27.145  1.00 32.76 ? 1148 HOH B O   1 
HETATM 6427 O  O   . HOH J 8 .   ? 21.157  114.073 25.259  1.00 46.85 ? 1149 HOH B O   1 
HETATM 6428 O  O   . HOH J 8 .   ? 23.915  116.332 -18.855 1.00 33.79 ? 1150 HOH B O   1 
HETATM 6429 O  O   . HOH J 8 .   ? 1.015   111.206 4.930   1.00 52.69 ? 1151 HOH B O   1 
HETATM 6430 O  O   . HOH J 8 .   ? -2.620  136.787 -18.080 1.00 37.85 ? 1152 HOH B O   1 
HETATM 6431 O  O   . HOH J 8 .   ? 16.370  132.284 32.573  1.00 28.20 ? 1153 HOH B O   1 
HETATM 6432 O  O   . HOH J 8 .   ? 12.489  98.808  10.642  1.00 36.19 ? 1154 HOH B O   1 
HETATM 6433 O  O   . HOH J 8 .   ? 8.715   112.880 -17.599 1.00 50.72 ? 1155 HOH B O   1 
HETATM 6434 O  O   . HOH J 8 .   ? 14.288  117.785 -24.807 1.00 40.37 ? 1156 HOH B O   1 
HETATM 6435 O  O   . HOH J 8 .   ? 1.327   107.762 16.713  1.00 34.42 ? 1157 HOH B O   1 
HETATM 6436 O  O   . HOH J 8 .   ? -8.734  143.653 1.584   1.00 42.07 ? 1158 HOH B O   1 
HETATM 6437 O  O   . HOH J 8 .   ? 5.434   100.499 5.681   1.00 52.43 ? 1159 HOH B O   1 
HETATM 6438 O  O   . HOH J 8 .   ? 36.489  131.382 18.374  1.00 32.96 ? 1160 HOH B O   1 
HETATM 6439 O  O   . HOH J 8 .   ? 12.204  137.027 -22.641 1.00 39.89 ? 1161 HOH B O   1 
HETATM 6440 O  O   . HOH J 8 .   ? 8.023   146.349 -17.872 1.00 47.63 ? 1162 HOH B O   1 
HETATM 6441 O  O   . HOH J 8 .   ? 21.586  131.518 -21.673 1.00 32.32 ? 1163 HOH B O   1 
HETATM 6442 O  O   . HOH J 8 .   ? -4.741  126.438 5.876   1.00 36.08 ? 1164 HOH B O   1 
HETATM 6443 O  O   . HOH J 8 .   ? 0.537   111.189 16.254  1.00 37.14 ? 1165 HOH B O   1 
HETATM 6444 O  O   . HOH J 8 .   ? 7.962   129.966 26.385  1.00 37.11 ? 1166 HOH B O   1 
HETATM 6445 O  O   . HOH J 8 .   ? 44.816  129.273 16.010  1.00 42.94 ? 1167 HOH B O   1 
HETATM 6446 O  O   . HOH J 8 .   ? -0.774  130.186 21.113  1.00 33.06 ? 1168 HOH B O   1 
HETATM 6447 O  O   . HOH J 8 .   ? -8.107  117.923 -1.581  1.00 48.99 ? 1169 HOH B O   1 
HETATM 6448 O  O   . HOH J 8 .   ? -1.478  119.893 18.600  1.00 34.24 ? 1170 HOH B O   1 
HETATM 6449 O  O   . HOH J 8 .   ? -9.606  145.250 -2.909  1.00 38.82 ? 1171 HOH B O   1 
HETATM 6450 O  O   . HOH J 8 .   ? -5.523  129.958 12.974  1.00 42.55 ? 1172 HOH B O   1 
HETATM 6451 O  O   . HOH J 8 .   ? 24.185  108.178 -9.503  1.00 39.19 ? 1173 HOH B O   1 
HETATM 6452 O  O   . HOH J 8 .   ? 3.937   145.015 9.599   1.00 42.00 ? 1174 HOH B O   1 
HETATM 6453 O  O   . HOH J 8 .   ? -6.848  129.592 -19.077 1.00 43.49 ? 1175 HOH B O   1 
HETATM 6454 O  O   . HOH J 8 .   ? 12.996  143.455 8.352   1.00 36.07 ? 1176 HOH B O   1 
HETATM 6455 O  O   . HOH J 8 .   ? 5.357   129.077 -30.875 1.00 44.83 ? 1177 HOH B O   1 
HETATM 6456 O  O   . HOH J 8 .   ? 26.349  135.714 12.213  1.00 42.53 ? 1178 HOH B O   1 
HETATM 6457 O  O   . HOH J 8 .   ? 5.170   133.764 28.770  1.00 39.57 ? 1179 HOH B O   1 
HETATM 6458 O  O   . HOH J 8 .   ? 33.335  126.392 21.588  1.00 33.36 ? 1180 HOH B O   1 
HETATM 6459 O  O   . HOH J 8 .   ? 7.216   130.773 -25.451 1.00 24.26 ? 1181 HOH B O   1 
HETATM 6460 O  O   . HOH J 8 .   ? 28.492  135.980 19.939  1.00 29.20 ? 1182 HOH B O   1 
HETATM 6461 O  O   . HOH J 8 .   ? 25.842  111.019 -12.917 1.00 34.78 ? 1183 HOH B O   1 
HETATM 6462 O  O   . HOH J 8 .   ? 7.412   104.021 6.962   1.00 46.49 ? 1184 HOH B O   1 
HETATM 6463 O  O   . HOH J 8 .   ? 2.726   117.035 25.411  1.00 42.81 ? 1185 HOH B O   1 
HETATM 6464 O  O   . HOH J 8 .   ? 12.855  132.559 -26.791 1.00 38.60 ? 1186 HOH B O   1 
HETATM 6465 O  O   . HOH J 8 .   ? 2.852   116.694 30.700  1.00 40.91 ? 1187 HOH B O   1 
HETATM 6466 O  O   . HOH J 8 .   ? 28.104  130.454 26.734  1.00 44.71 ? 1188 HOH B O   1 
HETATM 6467 O  O   . HOH J 8 .   ? -0.365  114.524 -3.899  1.00 36.95 ? 1189 HOH B O   1 
HETATM 6468 O  O   . HOH J 8 .   ? 11.443  132.996 27.912  1.00 39.58 ? 1190 HOH B O   1 
HETATM 6469 O  O   . HOH J 8 .   ? 20.228  121.454 34.359  1.00 47.56 ? 1191 HOH B O   1 
HETATM 6470 O  O   . HOH J 8 .   ? 28.137  120.971 1.694   1.00 12.72 ? 1192 HOH B O   1 
HETATM 6471 O  O   . HOH J 8 .   ? 13.366  110.633 6.754   1.00 12.55 ? 1193 HOH B O   1 
HETATM 6472 O  O   . HOH J 8 .   ? 9.919   131.845 39.553  1.00 29.58 ? 1194 HOH B O   1 
HETATM 6473 O  O   . HOH J 8 .   ? 3.153   131.349 -34.846 1.00 34.43 ? 1195 HOH B O   1 
HETATM 6474 O  O   . HOH J 8 .   ? 14.000  134.541 21.963  1.00 37.58 ? 1196 HOH B O   1 
HETATM 6475 O  O   . HOH J 8 .   ? -3.784  108.623 13.425  1.00 54.89 ? 1197 HOH B O   1 
HETATM 6476 O  O   . HOH J 8 .   ? -12.222 116.314 -18.824 1.00 50.47 ? 1198 HOH B O   1 
HETATM 6477 O  O   . HOH J 8 .   ? 31.680  116.209 23.354  1.00 43.68 ? 1199 HOH B O   1 
HETATM 6478 O  O   . HOH J 8 .   ? 12.300  111.338 -16.845 1.00 45.33 ? 1200 HOH B O   1 
HETATM 6479 O  O   . HOH J 8 .   ? 10.824  100.728 11.394  1.00 37.68 ? 1201 HOH B O   1 
HETATM 6480 O  O   . HOH J 8 .   ? 12.206  108.386 8.041   1.00 24.06 ? 1202 HOH B O   1 
HETATM 6481 O  O   . HOH J 8 .   ? -10.021 133.407 -6.529  1.00 27.58 ? 1203 HOH B O   1 
HETATM 6482 O  O   . HOH J 8 .   ? 29.384  119.498 14.414  1.00 35.16 ? 1204 HOH B O   1 
HETATM 6483 O  O   . HOH J 8 .   ? 2.155   113.751 -25.231 1.00 41.86 ? 1205 HOH B O   1 
HETATM 6484 O  O   . HOH J 8 .   ? -0.882  109.068 16.933  1.00 49.32 ? 1206 HOH B O   1 
HETATM 6485 O  O   . HOH J 8 .   ? 20.982  104.936 -3.902  1.00 31.09 ? 1207 HOH B O   1 
HETATM 6486 O  O   . HOH J 8 .   ? 5.414   114.245 3.836   1.00 33.87 ? 1208 HOH B O   1 
HETATM 6487 O  O   . HOH J 8 .   ? 0.491   110.568 18.759  1.00 54.31 ? 1209 HOH B O   1 
HETATM 6488 O  O   . HOH J 8 .   ? 3.310   141.028 -18.021 1.00 27.55 ? 1210 HOH B O   1 
HETATM 6489 O  O   . HOH J 8 .   ? -1.014  104.404 15.113  1.00 45.64 ? 1211 HOH B O   1 
HETATM 6490 O  O   . HOH J 8 .   ? -9.588  133.303 -14.288 1.00 31.62 ? 1212 HOH B O   1 
HETATM 6491 O  O   . HOH J 8 .   ? 0.081   113.192 18.668  1.00 46.41 ? 1213 HOH B O   1 
HETATM 6492 O  O   . HOH J 8 .   ? 32.752  121.338 23.687  1.00 43.74 ? 1214 HOH B O   1 
HETATM 6493 O  O   . HOH J 8 .   ? 9.945   131.901 21.539  1.00 36.18 ? 1215 HOH B O   1 
HETATM 6494 O  O   . HOH J 8 .   ? -8.488  141.598 4.609   1.00 57.59 ? 1216 HOH B O   1 
HETATM 6495 O  O   . HOH J 8 .   ? 23.390  104.144 -2.574  1.00 50.45 ? 1217 HOH B O   1 
HETATM 6496 O  O   . HOH J 8 .   ? 11.329  135.664 19.898  1.00 36.83 ? 1218 HOH B O   1 
HETATM 6497 O  O   . HOH J 8 .   ? 11.484  111.182 19.657  1.00 47.42 ? 1219 HOH B O   1 
HETATM 6498 O  O   . HOH J 8 .   ? 31.216  130.099 21.364  1.00 34.07 ? 1220 HOH B O   1 
HETATM 6499 O  O   . HOH J 8 .   ? 7.161   117.377 32.961  1.00 41.44 ? 1221 HOH B O   1 
HETATM 6500 O  O   . HOH J 8 .   ? 28.867  117.129 13.300  1.00 42.06 ? 1222 HOH B O   1 
HETATM 6501 O  O   . HOH J 8 .   ? -2.920  107.931 15.936  1.00 42.88 ? 1223 HOH B O   1 
HETATM 6502 O  O   . HOH J 8 .   ? 13.634  108.001 11.306  1.00 35.44 ? 1224 HOH B O   1 
HETATM 6503 O  O   . HOH J 8 .   ? 2.706   115.080 6.485   1.00 41.99 ? 1225 HOH B O   1 
HETATM 6504 O  O   . HOH J 8 .   ? 9.448   118.472 34.650  1.00 33.63 ? 1226 HOH B O   1 
HETATM 6505 O  O   . HOH J 8 .   ? -0.161  134.479 -21.293 1.00 39.39 ? 1227 HOH B O   1 
HETATM 6506 O  O   . HOH J 8 .   ? -3.194  124.631 15.676  1.00 38.90 ? 1228 HOH B O   1 
HETATM 6507 O  O   . HOH J 8 .   ? 14.831  115.053 22.736  1.00 52.91 ? 1229 HOH B O   1 
HETATM 6508 O  O   . HOH J 8 .   ? 17.876  131.835 -24.466 1.00 40.64 ? 1230 HOH B O   1 
HETATM 6509 O  O   . HOH J 8 .   ? 2.574   108.660 2.204   1.00 47.25 ? 1231 HOH B O   1 
HETATM 6510 O  O   . HOH J 8 .   ? 20.445  134.091 28.726  1.00 37.22 ? 1232 HOH B O   1 
HETATM 6511 O  O   . HOH J 8 .   ? 30.421  123.184 12.710  1.00 40.10 ? 1233 HOH B O   1 
HETATM 6512 O  O   . HOH J 8 .   ? 7.005   143.590 -21.558 1.00 42.67 ? 1234 HOH B O   1 
HETATM 6513 O  O   . HOH J 8 .   ? 28.992  115.015 22.411  1.00 40.15 ? 1235 HOH B O   1 
HETATM 6514 O  O   . HOH J 8 .   ? 38.699  119.248 21.759  1.00 36.81 ? 1236 HOH B O   1 
HETATM 6515 O  O   . HOH J 8 .   ? 7.609   133.304 21.949  1.00 43.12 ? 1237 HOH B O   1 
HETATM 6516 O  O   . HOH J 8 .   ? 17.285  101.325 1.025   1.00 32.64 ? 1238 HOH B O   1 
HETATM 6517 O  O   . HOH J 8 .   ? -5.212  133.873 -18.849 1.00 51.69 ? 1239 HOH B O   1 
HETATM 6518 O  O   . HOH J 8 .   ? 0.699   142.616 16.064  1.00 42.45 ? 1240 HOH B O   1 
HETATM 6519 O  O   . HOH J 8 .   ? -6.170  143.991 4.799   1.00 55.04 ? 1241 HOH B O   1 
HETATM 6520 O  O   . HOH J 8 .   ? -3.574  144.434 5.028   1.00 36.98 ? 1242 HOH B O   1 
HETATM 6521 O  O   . HOH J 8 .   ? 11.994  102.123 -7.167  1.00 47.87 ? 1243 HOH B O   1 
HETATM 6522 O  O   . HOH J 8 .   ? 31.191  135.704 20.759  1.00 57.95 ? 1244 HOH B O   1 
HETATM 6523 O  O   . HOH J 8 .   ? 4.446   145.525 5.034   1.00 39.94 ? 1245 HOH B O   1 
HETATM 6524 O  O   . HOH J 8 .   ? 16.124  106.698 -12.194 1.00 44.40 ? 1246 HOH B O   1 
HETATM 6525 O  O   . HOH J 8 .   ? 28.449  101.532 2.046   1.00 45.76 ? 1247 HOH B O   1 
HETATM 6526 O  O   . HOH J 8 .   ? 5.239   144.633 12.906  1.00 49.56 ? 1248 HOH B O   1 
HETATM 6527 O  O   . HOH J 8 .   ? -1.214  118.205 14.351  1.00 41.99 ? 1249 HOH B O   1 
HETATM 6528 O  O   . HOH J 8 .   ? 26.068  136.094 14.930  1.00 54.01 ? 1250 HOH B O   1 
HETATM 6529 O  O   . HOH J 8 .   ? -2.194  119.822 12.193  1.00 52.99 ? 1251 HOH B O   1 
HETATM 6530 O  O   . HOH J 8 .   ? 26.772  127.652 40.013  1.00 55.40 ? 1252 HOH B O   1 
HETATM 6531 O  O   . HOH J 8 .   ? -2.178  116.246 12.264  1.00 45.38 ? 1253 HOH B O   1 
HETATM 6532 O  O   . HOH J 8 .   ? 8.639   115.058 30.780  1.00 43.15 ? 1254 HOH B O   1 
HETATM 6533 O  O   . HOH J 8 .   ? 4.913   114.678 -7.819  1.00 43.32 ? 1255 HOH B O   1 
HETATM 6534 O  O   . HOH J 8 .   ? 7.983   138.960 -23.639 1.00 59.40 ? 1256 HOH B O   1 
HETATM 6535 O  O   . HOH J 8 .   ? 9.898   117.111 26.667  1.00 38.03 ? 1257 HOH B O   1 
HETATM 6536 O  O   . HOH J 8 .   ? 20.554  114.944 -22.555 1.00 35.53 ? 1258 HOH B O   1 
HETATM 6537 O  O   . HOH J 8 .   ? 15.342  143.703 26.280  1.00 60.21 ? 1259 HOH B O   1 
HETATM 6538 O  O   . HOH J 8 .   ? 17.377  125.659 10.260  1.00 12.28 ? 1260 HOH B O   1 
HETATM 6539 O  O   . HOH J 8 .   ? 24.724  127.750 5.836   1.00 13.07 ? 1261 HOH B O   1 
HETATM 6540 O  O   . HOH J 8 .   ? 26.361  130.825 6.509   1.00 15.28 ? 1262 HOH B O   1 
HETATM 6541 O  O   . HOH J 8 .   ? 22.462  131.673 5.163   1.00 14.36 ? 1263 HOH B O   1 
HETATM 6542 O  O   . HOH J 8 .   ? 8.974   126.771 -1.789  1.00 17.04 ? 1264 HOH B O   1 
HETATM 6543 O  O   . HOH J 8 .   ? 27.547  132.721 -1.505  1.00 16.04 ? 1265 HOH B O   1 
HETATM 6544 O  O   . HOH J 8 .   ? 23.842  129.658 -10.879 1.00 18.25 ? 1266 HOH B O   1 
HETATM 6545 O  O   . HOH J 8 .   ? 16.331  136.808 8.708   1.00 19.56 ? 1267 HOH B O   1 
HETATM 6546 O  O   . HOH J 8 .   ? 14.124  142.121 -7.431  1.00 21.81 ? 1268 HOH B O   1 
HETATM 6547 O  O   . HOH J 8 .   ? 24.789  129.193 -8.285  1.00 22.33 ? 1269 HOH B O   1 
HETATM 6548 O  O   . HOH J 8 .   ? 25.777  133.543 4.260   1.00 21.31 ? 1270 HOH B O   1 
HETATM 6549 O  O   . HOH J 8 .   ? 17.773  133.830 -10.972 1.00 25.82 ? 1271 HOH B O   1 
HETATM 6550 O  O   . HOH J 8 .   ? 22.714  133.830 3.392   1.00 24.80 ? 1272 HOH B O   1 
HETATM 6551 O  O   . HOH J 8 .   ? 24.801  134.919 9.770   1.00 25.91 ? 1273 HOH B O   1 
HETATM 6552 O  O   . HOH J 8 .   ? 14.741  139.405 -7.393  1.00 25.41 ? 1274 HOH B O   1 
HETATM 6553 O  O   . HOH J 8 .   ? 11.671  138.199 1.598   1.00 27.66 ? 1275 HOH B O   1 
HETATM 6554 O  O   . HOH J 8 .   ? 23.810  131.277 7.532   1.00 29.10 ? 1276 HOH B O   1 
HETATM 6555 O  O   . HOH J 8 .   ? 28.520  105.812 -1.091  1.00 40.49 ? 1277 HOH B O   1 
HETATM 6556 O  O   . HOH J 8 .   ? 2.506   116.693 4.310   1.00 33.39 ? 1278 HOH B O   1 
HETATM 6557 O  O   . HOH J 8 .   ? 23.113  133.951 6.987   1.00 37.03 ? 1279 HOH B O   1 
HETATM 6558 O  O   . HOH J 8 .   ? 16.052  139.763 6.516   1.00 29.31 ? 1280 HOH B O   1 
HETATM 6559 O  O   . HOH J 8 .   ? -3.435  124.298 12.291  1.00 41.98 ? 1281 HOH B O   1 
HETATM 6560 O  O   . HOH J 8 .   ? 2.789   114.629 -27.622 1.00 45.22 ? 1282 HOH B O   1 
HETATM 6561 O  O   . HOH J 8 .   ? -0.415  115.976 -12.972 1.00 41.69 ? 1283 HOH B O   1 
HETATM 6562 O  O   . HOH J 8 .   ? -13.739 127.652 -7.483  1.00 40.30 ? 1284 HOH B O   1 
HETATM 6563 O  O   . HOH J 8 .   ? 31.830  116.233 -9.459  1.00 40.08 ? 1285 HOH B O   1 
HETATM 6564 O  O   . HOH J 8 .   ? 7.022   112.065 2.317   1.00 34.98 ? 1286 HOH B O   1 
HETATM 6565 O  O   . HOH J 8 .   ? 11.222  112.535 -19.856 1.00 36.34 ? 1287 HOH B O   1 
HETATM 6566 O  O   . HOH J 8 .   ? 3.582   112.863 5.350   1.00 41.60 ? 1288 HOH B O   1 
HETATM 6567 O  O   . HOH J 8 .   ? 9.906   102.863 13.457  1.00 44.71 ? 1289 HOH B O   1 
HETATM 6568 O  O   . HOH J 8 .   ? 14.629  134.504 30.775  1.00 35.26 ? 1290 HOH B O   1 
HETATM 6569 O  O   . HOH J 8 .   ? 16.253  136.527 2.823   1.00 38.06 ? 1291 HOH B O   1 
HETATM 6570 O  O   . HOH J 8 .   ? 2.289   112.404 19.948  1.00 49.48 ? 1292 HOH B O   1 
HETATM 6571 O  O   . HOH J 8 .   ? 6.908   146.642 4.439   1.00 40.93 ? 1293 HOH B O   1 
HETATM 6572 O  O   . HOH J 8 .   ? -11.488 119.076 -10.127 1.00 41.42 ? 1294 HOH B O   1 
HETATM 6573 O  O   . HOH J 8 .   ? 39.688  125.939 22.099  1.00 42.09 ? 1295 HOH B O   1 
HETATM 6574 O  O   . HOH J 8 .   ? 22.572  107.910 -12.223 1.00 40.13 ? 1296 HOH B O   1 
HETATM 6575 O  O   . HOH J 8 .   ? -2.185  143.287 9.991   1.00 31.75 ? 1297 HOH B O   1 
HETATM 6576 O  O   . HOH J 8 .   ? -2.686  118.781 16.543  1.00 46.59 ? 1298 HOH B O   1 
HETATM 6577 O  O   . HOH J 8 .   ? 19.103  141.136 8.744   1.00 45.63 ? 1299 HOH B O   1 
HETATM 6578 O  O   . HOH J 8 .   ? 13.018  135.500 -8.350  1.00 32.42 ? 1300 HOH B O   1 
HETATM 6579 O  O   . HOH J 8 .   ? 19.641  135.560 5.826   1.00 36.71 ? 1301 HOH B O   1 
HETATM 6580 O  O   . HOH J 8 .   ? 19.439  129.843 -25.292 1.00 45.58 ? 1302 HOH B O   1 
HETATM 6581 O  O   . HOH J 8 .   ? 23.727  129.826 -19.569 1.00 41.97 ? 1303 HOH B O   1 
HETATM 6582 O  O   . HOH J 8 .   ? 1.638   115.458 -14.572 1.00 45.37 ? 1304 HOH B O   1 
HETATM 6583 O  O   . HOH J 8 .   ? 16.795  131.133 -27.433 1.00 44.18 ? 1305 HOH B O   1 
HETATM 6584 O  O   . HOH J 8 .   ? -3.554  119.692 3.499   1.00 45.88 ? 1306 HOH B O   1 
HETATM 6585 O  O   . HOH J 8 .   ? -2.894  146.989 4.776   1.00 42.35 ? 1307 HOH B O   1 
HETATM 6586 O  O   . HOH J 8 .   ? 29.084  111.684 7.767   1.00 49.34 ? 1308 HOH B O   1 
HETATM 6587 O  O   . HOH J 8 .   ? 25.097  111.317 -17.242 1.00 43.68 ? 1309 HOH B O   1 
HETATM 6588 O  O   . HOH J 8 .   ? 9.844   110.869 -15.854 1.00 48.89 ? 1310 HOH B O   1 
HETATM 6589 O  O   . HOH J 8 .   ? 32.115  112.341 -13.319 1.00 48.03 ? 1311 HOH B O   1 
HETATM 6590 O  O   . HOH J 8 .   ? -13.547 139.301 1.148   1.00 44.69 ? 1312 HOH B O   1 
HETATM 6591 O  O   . HOH J 8 .   ? 4.785   114.301 -5.221  1.00 42.22 ? 1313 HOH B O   1 
HETATM 6592 O  O   . HOH J 8 .   ? 41.634  122.311 22.020  1.00 44.09 ? 1314 HOH B O   1 
HETATM 6593 O  O   . HOH J 8 .   ? 35.876  128.061 19.711  1.00 49.68 ? 1315 HOH B O   1 
HETATM 6594 O  O   . HOH J 8 .   ? -14.050 136.768 2.327   1.00 43.54 ? 1316 HOH B O   1 
HETATM 6595 O  O   . HOH J 8 .   ? 10.391  144.703 8.828   1.00 42.71 ? 1317 HOH B O   1 
HETATM 6596 O  O   . HOH J 8 .   ? 22.945  134.978 -0.028  1.00 45.37 ? 1318 HOH B O   1 
HETATM 6597 O  O   . HOH J 8 .   ? 15.871  135.594 24.243  1.00 41.40 ? 1319 HOH B O   1 
HETATM 6598 O  O   . HOH J 8 .   ? 22.390  129.618 -23.542 1.00 49.18 ? 1320 HOH B O   1 
HETATM 6599 O  O   . HOH J 8 .   ? 8.684   135.259 20.187  1.00 45.97 ? 1321 HOH B O   1 
HETATM 6600 O  O   . HOH J 8 .   ? 15.764  134.950 20.046  1.00 47.39 ? 1322 HOH B O   1 
HETATM 6601 O  O   . HOH J 8 .   ? -9.128  114.788 -12.666 1.00 44.80 ? 1323 HOH B O   1 
HETATM 6602 O  O   . HOH J 8 .   ? 20.784  127.656 31.168  1.00 46.98 ? 1324 HOH B O   1 
HETATM 6603 O  O   . HOH J 8 .   ? 24.799  125.654 -19.904 1.00 44.80 ? 1325 HOH B O   1 
HETATM 6604 O  O   . HOH J 8 .   ? -0.950  139.663 -18.772 1.00 46.95 ? 1326 HOH B O   1 
HETATM 6605 O  O   . HOH J 8 .   ? 19.546  124.567 -27.563 1.00 43.95 ? 1327 HOH B O   1 
HETATM 6606 O  O   . HOH J 8 .   ? 0.566   124.133 3.911   1.00 39.56 ? 1328 HOH B O   1 
HETATM 6607 O  O   . HOH J 8 .   ? 41.332  118.293 19.739  1.00 43.71 ? 1329 HOH B O   1 
HETATM 6608 O  O   . HOH J 8 .   ? 19.168  133.340 31.002  1.00 44.20 ? 1330 HOH B O   1 
HETATM 6609 O  O   . HOH J 8 .   ? 29.695  115.184 -14.758 1.00 44.59 ? 1331 HOH B O   1 
HETATM 6610 O  O   . HOH J 8 .   ? -5.513  129.536 4.792   1.00 49.06 ? 1332 HOH B O   1 
HETATM 6611 O  O   . HOH J 8 .   ? 30.755  112.431 9.785   1.00 46.57 ? 1333 HOH B O   1 
HETATM 6612 O  O   . HOH J 8 .   ? 6.808   117.122 28.995  1.00 42.88 ? 1334 HOH B O   1 
HETATM 6613 O  O   . HOH J 8 .   ? -11.575 132.778 -2.623  1.00 49.21 ? 1335 HOH B O   1 
HETATM 6614 O  O   . HOH J 8 .   ? 30.708  123.648 26.681  1.00 46.40 ? 1336 HOH B O   1 
HETATM 6615 O  O   . HOH J 8 .   ? 3.660   106.145 14.058  1.00 41.16 ? 1337 HOH B O   1 
HETATM 6616 O  O   . HOH J 8 .   ? 8.119   101.516 5.451   1.00 49.99 ? 1338 HOH B O   1 
HETATM 6617 O  O   . HOH J 8 .   ? 7.218   136.481 17.929  1.00 40.63 ? 1339 HOH B O   1 
HETATM 6618 O  O   . HOH J 8 .   ? 0.682   114.685 8.288   1.00 45.28 ? 1340 HOH B O   1 
HETATM 6619 O  O   . HOH J 8 .   ? 9.975   130.812 28.763  1.00 48.49 ? 1341 HOH B O   1 
HETATM 6620 O  O   . HOH J 8 .   ? 7.128   109.668 3.468   1.00 51.92 ? 1342 HOH B O   1 
HETATM 6621 O  O   . HOH J 8 .   ? 16.842  138.895 16.069  1.00 48.99 ? 1343 HOH B O   1 
HETATM 6622 O  O   . HOH J 8 .   ? 22.106  142.684 15.064  1.00 47.03 ? 1344 HOH B O   1 
HETATM 6623 O  O   . HOH J 8 .   ? -8.741  130.770 -1.140  1.00 44.66 ? 1345 HOH B O   1 
HETATM 6624 O  O   . HOH J 8 .   ? 26.761  129.084 42.348  1.00 45.52 ? 1346 HOH B O   1 
HETATM 6625 O  O   . HOH J 8 .   ? 5.542   111.929 -8.568  1.00 50.72 ? 1347 HOH B O   1 
HETATM 6626 O  O   . HOH J 8 .   ? 10.740  139.839 3.028   1.00 48.14 ? 1348 HOH B O   1 
HETATM 6627 O  O   . HOH J 8 .   ? 23.091  134.053 29.424  1.00 48.20 ? 1349 HOH B O   1 
HETATM 6628 O  O   . HOH J 8 .   ? 1.867   113.847 -18.780 1.00 46.62 ? 1350 HOH B O   1 
HETATM 6629 O  O   . HOH J 8 .   ? 25.688  122.305 31.189  1.00 48.25 ? 1351 HOH B O   1 
HETATM 6630 O  O   . HOH J 8 .   ? 25.641  124.913 -17.164 1.00 41.49 ? 1352 HOH B O   1 
HETATM 6631 O  O   . HOH J 8 .   ? -11.733 122.437 -7.911  1.00 47.21 ? 1353 HOH B O   1 
HETATM 6632 O  O   . HOH J 8 .   ? 21.538  136.074 4.098   1.00 27.84 ? 1354 HOH B O   1 
HETATM 6633 O  O   . HOH J 8 .   ? 13.515  136.886 -10.487 1.00 31.92 ? 1355 HOH B O   1 
HETATM 6634 O  O   . HOH J 8 .   ? 18.276  137.671 6.857   1.00 33.16 ? 1356 HOH B O   1 
HETATM 6635 O  O   . HOH J 8 .   ? 28.083  132.953 6.472   1.00 39.60 ? 1357 HOH B O   1 
HETATM 6636 O  O   . HOH J 8 .   ? 6.364   115.112 34.172  1.00 49.41 ? 1358 HOH B O   1 
HETATM 6637 O  O   . HOH J 8 .   ? 22.450  137.561 0.357   1.00 39.51 ? 1359 HOH B O   1 
HETATM 6638 O  O   . HOH J 8 .   ? 14.024  140.106 16.038  1.00 41.11 ? 1360 HOH B O   1 
HETATM 6639 O  O   . HOH J 8 .   ? 5.436   112.531 -3.201  1.00 46.60 ? 1361 HOH B O   1 
HETATM 6640 O  O   . HOH J 8 .   ? 24.398  131.674 28.367  1.00 45.59 ? 1362 HOH B O   1 
HETATM 6641 O  O   . HOH J 8 .   ? -0.945  137.811 -21.307 1.00 47.92 ? 1363 HOH B O   1 
HETATM 6642 O  O   . HOH J 8 .   ? 0.925   106.479 14.347  1.00 51.91 ? 1364 HOH B O   1 
HETATM 6643 O  O   . HOH J 8 .   ? -0.272  118.560 21.505  1.00 53.17 ? 1365 HOH B O   1 
HETATM 6644 O  O   . HOH J 8 .   ? 25.820  134.243 6.999   1.00 49.79 ? 1366 HOH B O   1 
HETATM 6645 O  O   . HOH J 8 .   ? 7.889   103.762 14.833  1.00 49.31 ? 1367 HOH B O   1 
HETATM 6646 O  O   . HOH J 8 .   ? -11.549 125.854 -17.366 1.00 53.60 ? 1368 HOH B O   1 
HETATM 6647 O  O   . HOH J 8 .   ? 23.988  127.854 -21.514 1.00 51.32 ? 1369 HOH B O   1 
HETATM 6648 O  O   . HOH J 8 .   ? 36.721  115.888 23.110  1.00 50.83 ? 1370 HOH B O   1 
HETATM 6649 O  O   . HOH J 8 .   ? 3.957   133.473 24.662  1.00 52.93 ? 1371 HOH B O   1 
HETATM 6650 O  O   . HOH J 8 .   ? 15.884  139.705 -0.735  1.00 51.56 ? 1372 HOH B O   1 
HETATM 6651 O  O   . HOH J 8 .   ? 19.627  139.767 19.275  1.00 54.17 ? 1373 HOH B O   1 
HETATM 6652 O  O   . HOH J 8 .   ? -4.351  132.761 16.731  1.00 50.55 ? 1374 HOH B O   1 
HETATM 6653 O  O   . HOH J 8 .   ? 35.649  135.688 11.095  1.00 51.12 ? 1375 HOH B O   1 
HETATM 6654 O  O   . HOH J 8 .   ? 10.123  96.235  8.533   1.00 47.86 ? 1376 HOH B O   1 
HETATM 6655 O  O   . HOH J 8 .   ? -0.328  112.897 -20.641 1.00 50.95 ? 1377 HOH B O   1 
HETATM 6656 O  O   . HOH J 8 .   ? -1.478  113.413 -18.232 1.00 50.08 ? 1378 HOH B O   1 
HETATM 6657 O  O   . HOH J 8 .   ? 21.260  111.773 -20.647 1.00 46.93 ? 1379 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'U49 B 1003 HAS WRONG CHIRALITY AT ATOM C17' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   VAL 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  GLN 21  21  ?   ?   ?   A . n 
A 1 22  PRO 22  22  ?   ?   ?   A . n 
A 1 23  PRO 23  23  ?   ?   ?   A . n 
A 1 24  PRO 24  24  ?   ?   ?   A . n 
A 1 25  GLN 25  25  ?   ?   ?   A . n 
A 1 26  PRO 26  26  ?   ?   ?   A . n 
A 1 27  HIS 27  27  ?   ?   ?   A . n 
A 1 28  PRO 28  28  ?   ?   ?   A . n 
A 1 29  PRO 29  29  ?   ?   ?   A . n 
A 1 30  PRO 30  30  ?   ?   ?   A . n 
A 1 31  PRO 31  31  ?   ?   ?   A . n 
A 1 32  GLN 32  32  ?   ?   ?   A . n 
A 1 33  GLN 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  HIS 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  GLU 38  38  ?   ?   ?   A . n 
A 1 39  MET 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLY 44  44  ?   ?   ?   A . n 
A 1 45  GLU 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  VAL 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  SER 49  49  ?   ?   ?   A . n 
A 1 50  PRO 50  50  ?   ?   ?   A . n 
A 1 51  MET 51  51  ?   ?   ?   A . n 
A 1 52  ASP 52  52  ?   ?   ?   A . n 
A 1 53  ASP 53  53  ?   ?   ?   A . n 
A 1 54  GLY 54  54  ?   ?   ?   A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 HIS 272 272 272 HIS HIS A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 TRP 277 277 277 TRP TRP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 ASN 325 325 325 ASN ASN A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 CYS 327 327 327 CYS CYS A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 ARG 361 361 361 ARG ARG A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 HIS 367 367 367 HIS HIS A . n 
A 1 368 SER 368 368 ?   ?   ?   A . n 
A 1 369 THR 369 369 ?   ?   ?   A . n 
A 1 370 GLU 370 370 ?   ?   ?   A . n 
A 1 371 ASN 371 371 ?   ?   ?   A . n 
A 1 372 ASP 372 372 ?   ?   ?   A . n 
A 1 373 SER 373 373 ?   ?   ?   A . n 
A 1 374 PRO 374 374 ?   ?   ?   A . n 
A 1 375 THR 375 375 ?   ?   ?   A . n 
A 1 376 ASN 376 376 ?   ?   ?   A . n 
A 1 377 VAL 377 377 ?   ?   ?   A . n 
A 1 378 GLN 378 378 ?   ?   ?   A . n 
A 1 379 GLN 379 379 ?   ?   ?   A . n 
A 1 380 GLU 380 380 ?   ?   ?   A . n 
A 1 381 GLU 381 381 ?   ?   ?   A . n 
A 1 382 PHE 382 382 ?   ?   ?   A . n 
B 2 1   MET 1   501 ?   ?   ?   B . n 
B 2 2   ALA 2   502 ?   ?   ?   B . n 
B 2 3   SER 3   503 ?   ?   ?   B . n 
B 2 4   PRO 4   504 ?   ?   ?   B . n 
B 2 5   SER 5   505 ?   ?   ?   B . n 
B 2 6   SER 6   506 ?   ?   ?   B . n 
B 2 7   PHE 7   507 ?   ?   ?   B . n 
B 2 8   THR 8   508 ?   ?   ?   B . n 
B 2 9   TYR 9   509 ?   ?   ?   B . n 
B 2 10  TYR 10  510 ?   ?   ?   B . n 
B 2 11  CYS 11  511 ?   ?   ?   B . n 
B 2 12  PRO 12  512 ?   ?   ?   B . n 
B 2 13  PRO 13  513 ?   ?   ?   B . n 
B 2 14  SER 14  514 ?   ?   ?   B . n 
B 2 15  SER 15  515 ?   ?   ?   B . n 
B 2 16  SER 16  516 ?   ?   ?   B . n 
B 2 17  PRO 17  517 517 PRO PRO B . n 
B 2 18  VAL 18  518 518 VAL VAL B . n 
B 2 19  TRP 19  519 519 TRP TRP B . n 
B 2 20  SER 20  520 520 SER SER B . n 
B 2 21  GLU 21  521 521 GLU GLU B . n 
B 2 22  PRO 22  522 522 PRO PRO B . n 
B 2 23  LEU 23  523 523 LEU LEU B . n 
B 2 24  TYR 24  524 524 TYR TYR B . n 
B 2 25  SER 25  525 525 SER SER B . n 
B 2 26  LEU 26  526 526 LEU LEU B . n 
B 2 27  ARG 27  527 527 ARG ARG B . n 
B 2 28  PRO 28  528 528 PRO PRO B . n 
B 2 29  GLU 29  529 529 GLU GLU B . n 
B 2 30  HIS 30  530 530 HIS HIS B . n 
B 2 31  ALA 31  531 531 ALA ALA B . n 
B 2 32  ARG 32  532 532 ARG ARG B . n 
B 2 33  GLU 33  533 533 GLU GLU B . n 
B 2 34  ARG 34  534 534 ARG ARG B . n 
B 2 35  LEU 35  535 535 LEU LEU B . n 
B 2 36  GLN 36  536 536 GLN GLN B . n 
B 2 37  ASP 37  537 537 ASP ASP B . n 
B 2 38  ASP 38  538 538 ASP ASP B . n 
B 2 39  SER 39  539 539 SER SER B . n 
B 2 40  VAL 40  540 540 VAL VAL B . n 
B 2 41  GLU 41  541 541 GLU GLU B . n 
B 2 42  THR 42  542 542 THR THR B . n 
B 2 43  VAL 43  543 543 VAL VAL B . n 
B 2 44  THR 44  544 544 THR THR B . n 
B 2 45  SER 45  545 545 SER SER B . n 
B 2 46  ILE 46  546 546 ILE ILE B . n 
B 2 47  GLU 47  547 547 GLU GLU B . n 
B 2 48  GLN 48  548 548 GLN GLN B . n 
B 2 49  ALA 49  549 549 ALA ALA B . n 
B 2 50  LYS 50  550 550 LYS LYS B . n 
B 2 51  VAL 51  551 551 VAL VAL B . n 
B 2 52  GLU 52  552 552 GLU GLU B . n 
B 2 53  GLU 53  553 553 GLU GLU B . n 
B 2 54  LYS 54  554 554 LYS LYS B . n 
B 2 55  ILE 55  555 555 ILE ILE B . n 
B 2 56  GLN 56  556 556 GLN GLN B . n 
B 2 57  GLU 57  557 557 GLU GLU B . n 
B 2 58  VAL 58  558 558 VAL VAL B . n 
B 2 59  PHE 59  559 559 PHE PHE B . n 
B 2 60  SER 60  560 560 SER SER B . n 
B 2 61  SER 61  561 561 SER SER B . n 
B 2 62  TYR 62  562 562 TYR TYR B . n 
B 2 63  LYS 63  563 563 LYS LYS B . n 
B 2 64  PHE 64  564 564 PHE PHE B . n 
B 2 65  ASN 65  565 565 ASN ASN B . n 
B 2 66  HIS 66  566 566 HIS HIS B . n 
B 2 67  LEU 67  567 567 LEU LEU B . n 
B 2 68  VAL 68  568 568 VAL VAL B . n 
B 2 69  PRO 69  569 569 PRO PRO B . n 
B 2 70  ARG 70  570 570 ARG ARG B . n 
B 2 71  LEU 71  571 571 LEU LEU B . n 
B 2 72  VAL 72  572 572 VAL VAL B . n 
B 2 73  LEU 73  573 573 LEU LEU B . n 
B 2 74  GLN 74  574 574 GLN GLN B . n 
B 2 75  ARG 75  575 575 ARG ARG B . n 
B 2 76  GLU 76  576 576 GLU GLU B . n 
B 2 77  LYS 77  577 577 LYS LYS B . n 
B 2 78  HIS 78  578 578 HIS HIS B . n 
B 2 79  PHE 79  579 579 PHE PHE B . n 
B 2 80  HIS 80  580 580 HIS HIS B . n 
B 2 81  TYR 81  581 581 TYR TYR B . n 
B 2 82  LEU 82  582 582 LEU LEU B . n 
B 2 83  LYS 83  583 583 LYS LYS B . n 
B 2 84  ARG 84  584 584 ARG ARG B . n 
B 2 85  GLY 85  585 585 GLY GLY B . n 
B 2 86  LEU 86  586 586 LEU LEU B . n 
B 2 87  ARG 87  587 587 ARG ARG B . n 
B 2 88  GLN 88  588 588 GLN GLN B . n 
B 2 89  LEU 89  589 589 LEU LEU B . n 
B 2 90  THR 90  590 590 THR THR B . n 
B 2 91  ASP 91  591 591 ASP ASP B . n 
B 2 92  ALA 92  592 592 ALA ALA B . n 
B 2 93  TYR 93  593 593 TYR TYR B . n 
B 2 94  GLU 94  594 594 GLU GLU B . n 
B 2 95  CYS 95  595 595 CYS CYS B . n 
B 2 96  LEU 96  596 596 LEU LEU B . n 
B 2 97  ASP 97  597 597 ASP ASP B . n 
B 2 98  ALA 98  598 598 ALA ALA B . n 
B 2 99  SER 99  599 599 SER SER B . n 
B 2 100 ARG 100 600 600 ARG ARG B . n 
B 2 101 PRO 101 601 601 PRO PRO B . n 
B 2 102 TRP 102 602 602 TRP TRP B . n 
B 2 103 LEU 103 603 603 LEU LEU B . n 
B 2 104 CYS 104 604 604 CYS CYS B . n 
B 2 105 TYR 105 605 605 TYR TYR B . n 
B 2 106 TRP 106 606 606 TRP TRP B . n 
B 2 107 ILE 107 607 607 ILE ILE B . n 
B 2 108 LEU 108 608 608 LEU LEU B . n 
B 2 109 HIS 109 609 609 HIS HIS B . n 
B 2 110 SER 110 610 610 SER SER B . n 
B 2 111 LEU 111 611 611 LEU LEU B . n 
B 2 112 GLU 112 612 612 GLU GLU B . n 
B 2 113 LEU 113 613 613 LEU LEU B . n 
B 2 114 LEU 114 614 614 LEU LEU B . n 
B 2 115 ASP 115 615 615 ASP ASP B . n 
B 2 116 GLU 116 616 616 GLU GLU B . n 
B 2 117 PRO 117 617 617 PRO PRO B . n 
B 2 118 ILE 118 618 618 ILE ILE B . n 
B 2 119 PRO 119 619 619 PRO PRO B . n 
B 2 120 GLN 120 620 620 GLN GLN B . n 
B 2 121 ILE 121 621 621 ILE ILE B . n 
B 2 122 VAL 122 622 622 VAL VAL B . n 
B 2 123 ALA 123 623 623 ALA ALA B . n 
B 2 124 THR 124 624 624 THR THR B . n 
B 2 125 ASP 125 625 625 ASP ASP B . n 
B 2 126 VAL 126 626 626 VAL VAL B . n 
B 2 127 CYS 127 627 627 CYS CYS B . n 
B 2 128 GLN 128 628 628 GLN GLN B . n 
B 2 129 PHE 129 629 629 PHE PHE B . n 
B 2 130 LEU 130 630 630 LEU LEU B . n 
B 2 131 GLU 131 631 631 GLU GLU B . n 
B 2 132 LEU 132 632 632 LEU LEU B . n 
B 2 133 CYS 133 633 633 CYS CYS B . n 
B 2 134 GLN 134 634 634 GLN GLN B . n 
B 2 135 SER 135 635 635 SER SER B . n 
B 2 136 PRO 136 636 636 PRO PRO B . n 
B 2 137 GLU 137 637 637 GLU GLU B . n 
B 2 138 GLY 138 638 638 GLY GLY B . n 
B 2 139 GLY 139 639 639 GLY GLY B . n 
B 2 140 PHE 140 640 640 PHE PHE B . n 
B 2 141 GLY 141 641 641 GLY GLY B . n 
B 2 142 GLY 142 642 642 GLY GLY B . n 
B 2 143 GLY 143 643 643 GLY GLY B . n 
B 2 144 PRO 144 644 644 PRO PRO B . n 
B 2 145 GLY 145 645 645 GLY GLY B . n 
B 2 146 GLN 146 646 646 GLN GLN B . n 
B 2 147 TYR 147 647 647 TYR TYR B . n 
B 2 148 PRO 148 648 648 PRO PRO B . n 
B 2 149 HIS 149 649 649 HIS HIS B . n 
B 2 150 LEU 150 650 650 LEU LEU B . n 
B 2 151 ALA 151 651 651 ALA ALA B . n 
B 2 152 PRO 152 652 652 PRO PRO B . n 
B 2 153 THR 153 653 653 THR THR B . n 
B 2 154 TYR 154 654 654 TYR TYR B . n 
B 2 155 ALA 155 655 655 ALA ALA B . n 
B 2 156 ALA 156 656 656 ALA ALA B . n 
B 2 157 VAL 157 657 657 VAL VAL B . n 
B 2 158 ASN 158 658 658 ASN ASN B . n 
B 2 159 ALA 159 659 659 ALA ALA B . n 
B 2 160 LEU 160 660 660 LEU LEU B . n 
B 2 161 CYS 161 661 661 CYS CYS B . n 
B 2 162 ILE 162 662 662 ILE ILE B . n 
B 2 163 ILE 163 663 663 ILE ILE B . n 
B 2 164 GLY 164 664 664 GLY GLY B . n 
B 2 165 THR 165 665 665 THR THR B . n 
B 2 166 GLU 166 666 666 GLU GLU B . n 
B 2 167 GLU 167 667 667 GLU GLU B . n 
B 2 168 ALA 168 668 668 ALA ALA B . n 
B 2 169 TYR 169 669 669 TYR TYR B . n 
B 2 170 ASP 170 670 670 ASP ASP B . n 
B 2 171 ILE 171 671 671 ILE ILE B . n 
B 2 172 ILE 172 672 672 ILE ILE B . n 
B 2 173 ASN 173 673 673 ASN ASN B . n 
B 2 174 ARG 174 674 674 ARG ARG B . n 
B 2 175 GLU 175 675 675 GLU GLU B . n 
B 2 176 LYS 176 676 676 LYS LYS B . n 
B 2 177 LEU 177 677 677 LEU LEU B . n 
B 2 178 LEU 178 678 678 LEU LEU B . n 
B 2 179 GLN 179 679 679 GLN GLN B . n 
B 2 180 TYR 180 680 680 TYR TYR B . n 
B 2 181 LEU 181 681 681 LEU LEU B . n 
B 2 182 TYR 182 682 682 TYR TYR B . n 
B 2 183 SER 183 683 683 SER SER B . n 
B 2 184 LEU 184 684 684 LEU LEU B . n 
B 2 185 LYS 185 685 685 LYS LYS B . n 
B 2 186 GLN 186 686 686 GLN GLN B . n 
B 2 187 PRO 187 687 687 PRO PRO B . n 
B 2 188 ASP 188 688 688 ASP ASP B . n 
B 2 189 GLY 189 689 689 GLY GLY B . n 
B 2 190 SER 190 690 690 SER SER B . n 
B 2 191 PHE 191 691 691 PHE PHE B . n 
B 2 192 LEU 192 692 692 LEU LEU B . n 
B 2 193 MET 193 693 693 MET MET B . n 
B 2 194 HIS 194 694 694 HIS HIS B . n 
B 2 195 VAL 195 695 695 VAL VAL B . n 
B 2 196 GLY 196 696 696 GLY GLY B . n 
B 2 197 GLY 197 697 697 GLY GLY B . n 
B 2 198 GLU 198 698 698 GLU GLU B . n 
B 2 199 VAL 199 699 699 VAL VAL B . n 
B 2 200 ASP 200 700 700 ASP ASP B . n 
B 2 201 VAL 201 701 701 VAL VAL B . n 
B 2 202 ARG 202 702 702 ARG ARG B . n 
B 2 203 SER 203 703 703 SER SER B . n 
B 2 204 ALA 204 704 704 ALA ALA B . n 
B 2 205 TYR 205 705 705 TYR TYR B . n 
B 2 206 CYS 206 706 706 CYS CYS B . n 
B 2 207 ALA 207 707 707 ALA ALA B . n 
B 2 208 ALA 208 708 708 ALA ALA B . n 
B 2 209 SER 209 709 709 SER SER B . n 
B 2 210 VAL 210 710 710 VAL VAL B . n 
B 2 211 ALA 211 711 711 ALA ALA B . n 
B 2 212 SER 212 712 712 SER SER B . n 
B 2 213 LEU 213 713 713 LEU LEU B . n 
B 2 214 THR 214 714 714 THR THR B . n 
B 2 215 ASN 215 715 715 ASN ASN B . n 
B 2 216 ILE 216 716 716 ILE ILE B . n 
B 2 217 ILE 217 717 717 ILE ILE B . n 
B 2 218 THR 218 718 718 THR THR B . n 
B 2 219 PRO 219 719 719 PRO PRO B . n 
B 2 220 ASP 220 720 720 ASP ASP B . n 
B 2 221 LEU 221 721 721 LEU LEU B . n 
B 2 222 PHE 222 722 722 PHE PHE B . n 
B 2 223 GLU 223 723 723 GLU GLU B . n 
B 2 224 GLY 224 724 724 GLY GLY B . n 
B 2 225 THR 225 725 725 THR THR B . n 
B 2 226 ALA 226 726 726 ALA ALA B . n 
B 2 227 GLU 227 727 727 GLU GLU B . n 
B 2 228 TRP 228 728 728 TRP TRP B . n 
B 2 229 ILE 229 729 729 ILE ILE B . n 
B 2 230 ALA 230 730 730 ALA ALA B . n 
B 2 231 ARG 231 731 731 ARG ARG B . n 
B 2 232 CYS 232 732 732 CYS CYS B . n 
B 2 233 GLN 233 733 733 GLN GLN B . n 
B 2 234 ASN 234 734 734 ASN ASN B . n 
B 2 235 TRP 235 735 735 TRP TRP B . n 
B 2 236 GLU 236 736 736 GLU GLU B . n 
B 2 237 GLY 237 737 737 GLY GLY B . n 
B 2 238 GLY 238 738 738 GLY GLY B . n 
B 2 239 ILE 239 739 739 ILE ILE B . n 
B 2 240 GLY 240 740 740 GLY GLY B . n 
B 2 241 GLY 241 741 741 GLY GLY B . n 
B 2 242 VAL 242 742 742 VAL VAL B . n 
B 2 243 PRO 243 743 743 PRO PRO B . n 
B 2 244 GLY 244 744 744 GLY GLY B . n 
B 2 245 MET 245 745 745 MET MET B . n 
B 2 246 GLU 246 746 746 GLU GLU B . n 
B 2 247 ALA 247 747 747 ALA ALA B . n 
B 2 248 HIS 248 748 748 HIS HIS B . n 
B 2 249 GLY 249 749 749 GLY GLY B . n 
B 2 250 GLY 250 750 750 GLY GLY B . n 
B 2 251 TYR 251 751 751 TYR TYR B . n 
B 2 252 THR 252 752 752 THR THR B . n 
B 2 253 PHE 253 753 753 PHE PHE B . n 
B 2 254 CYS 254 754 754 CYS CYS B . n 
B 2 255 GLY 255 755 755 GLY GLY B . n 
B 2 256 LEU 256 756 756 LEU LEU B . n 
B 2 257 ALA 257 757 757 ALA ALA B . n 
B 2 258 ALA 258 758 758 ALA ALA B . n 
B 2 259 LEU 259 759 759 LEU LEU B . n 
B 2 260 VAL 260 760 760 VAL VAL B . n 
B 2 261 ILE 261 761 761 ILE ILE B . n 
B 2 262 LEU 262 762 762 LEU LEU B . n 
B 2 263 LYS 263 763 763 LYS LYS B . n 
B 2 264 ARG 264 764 764 ARG ARG B . n 
B 2 265 GLU 265 765 765 GLU GLU B . n 
B 2 266 ARG 266 766 766 ARG ARG B . n 
B 2 267 SER 267 767 767 SER SER B . n 
B 2 268 LEU 268 768 768 LEU LEU B . n 
B 2 269 ASN 269 769 769 ASN ASN B . n 
B 2 270 LEU 270 770 770 LEU LEU B . n 
B 2 271 LYS 271 771 771 LYS LYS B . n 
B 2 272 SER 272 772 772 SER SER B . n 
B 2 273 LEU 273 773 773 LEU LEU B . n 
B 2 274 LEU 274 774 774 LEU LEU B . n 
B 2 275 GLN 275 775 775 GLN GLN B . n 
B 2 276 TRP 276 776 776 TRP TRP B . n 
B 2 277 VAL 277 777 777 VAL VAL B . n 
B 2 278 THR 278 778 778 THR THR B . n 
B 2 279 SER 279 779 779 SER SER B . n 
B 2 280 ARG 280 780 780 ARG ARG B . n 
B 2 281 GLN 281 781 781 GLN GLN B . n 
B 2 282 MET 282 782 782 MET MET B . n 
B 2 283 ARG 283 783 783 ARG ARG B . n 
B 2 284 PHE 284 784 784 PHE PHE B . n 
B 2 285 GLU 285 785 785 GLU GLU B . n 
B 2 286 GLY 286 786 786 GLY GLY B . n 
B 2 287 GLY 287 787 787 GLY GLY B . n 
B 2 288 PHE 288 788 788 PHE PHE B . n 
B 2 289 GLN 289 789 789 GLN GLN B . n 
B 2 290 GLY 290 790 790 GLY GLY B . n 
B 2 291 ARG 291 791 791 ARG ARG B . n 
B 2 292 CYS 292 792 792 CYS CYS B . n 
B 2 293 ASN 293 793 793 ASN ASN B . n 
B 2 294 LYS 294 794 794 LYS LYS B . n 
B 2 295 LEU 295 795 795 LEU LEU B . n 
B 2 296 VAL 296 796 796 VAL VAL B . n 
B 2 297 ASP 297 797 797 ASP ASP B . n 
B 2 298 GLY 298 798 798 GLY GLY B . n 
B 2 299 CYS 299 799 799 CYS CYS B . n 
B 2 300 TYR 300 800 800 TYR TYR B . n 
B 2 301 SER 301 801 801 SER SER B . n 
B 2 302 PHE 302 802 802 PHE PHE B . n 
B 2 303 TRP 303 803 803 TRP TRP B . n 
B 2 304 GLN 304 804 804 GLN GLN B . n 
B 2 305 ALA 305 805 805 ALA ALA B . n 
B 2 306 GLY 306 806 806 GLY GLY B . n 
B 2 307 LEU 307 807 807 LEU LEU B . n 
B 2 308 LEU 308 808 808 LEU LEU B . n 
B 2 309 PRO 309 809 809 PRO PRO B . n 
B 2 310 LEU 310 810 810 LEU LEU B . n 
B 2 311 LEU 311 811 811 LEU LEU B . n 
B 2 312 HIS 312 812 812 HIS HIS B . n 
B 2 313 ARG 313 813 813 ARG ARG B . n 
B 2 314 ALA 314 814 814 ALA ALA B . n 
B 2 315 LEU 315 815 815 LEU LEU B . n 
B 2 316 HIS 316 816 816 HIS HIS B . n 
B 2 317 ALA 317 817 817 ALA ALA B . n 
B 2 318 GLN 318 818 818 GLN GLN B . n 
B 2 319 GLY 319 819 819 GLY GLY B . n 
B 2 320 ASP 320 820 820 ASP ASP B . n 
B 2 321 PRO 321 821 821 PRO PRO B . n 
B 2 322 ALA 322 822 822 ALA ALA B . n 
B 2 323 LEU 323 823 823 LEU LEU B . n 
B 2 324 SER 324 824 824 SER SER B . n 
B 2 325 MET 325 825 825 MET MET B . n 
B 2 326 SER 326 826 826 SER SER B . n 
B 2 327 HIS 327 827 827 HIS HIS B . n 
B 2 328 TRP 328 828 828 TRP TRP B . n 
B 2 329 MET 329 829 829 MET MET B . n 
B 2 330 PHE 330 830 830 PHE PHE B . n 
B 2 331 HIS 331 831 831 HIS HIS B . n 
B 2 332 GLN 332 832 832 GLN GLN B . n 
B 2 333 GLN 333 833 833 GLN GLN B . n 
B 2 334 ALA 334 834 834 ALA ALA B . n 
B 2 335 LEU 335 835 835 LEU LEU B . n 
B 2 336 GLN 336 836 836 GLN GLN B . n 
B 2 337 GLU 337 837 837 GLU GLU B . n 
B 2 338 TYR 338 838 838 TYR TYR B . n 
B 2 339 ILE 339 839 839 ILE ILE B . n 
B 2 340 LEU 340 840 840 LEU LEU B . n 
B 2 341 MET 341 841 841 MET MET B . n 
B 2 342 CYS 342 842 842 CYS CYS B . n 
B 2 343 CYS 343 843 843 CYS CYS B . n 
B 2 344 GLN 344 844 844 GLN GLN B . n 
B 2 345 CYS 345 845 845 CYS CYS B . n 
B 2 346 PRO 346 846 846 PRO PRO B . n 
B 2 347 ALA 347 847 847 ALA ALA B . n 
B 2 348 GLY 348 848 848 GLY GLY B . n 
B 2 349 GLY 349 849 849 GLY GLY B . n 
B 2 350 LEU 350 850 850 LEU LEU B . n 
B 2 351 LEU 351 851 851 LEU LEU B . n 
B 2 352 ASP 352 852 852 ASP ASP B . n 
B 2 353 LYS 353 853 853 LYS LYS B . n 
B 2 354 PRO 354 854 854 PRO PRO B . n 
B 2 355 GLY 355 855 855 GLY GLY B . n 
B 2 356 LYS 356 856 856 LYS LYS B . n 
B 2 357 SER 357 857 857 SER SER B . n 
B 2 358 ARG 358 858 858 ARG ARG B . n 
B 2 359 ASP 359 859 859 ASP ASP B . n 
B 2 360 PHE 360 860 860 PHE PHE B . n 
B 2 361 TYR 361 861 861 TYR TYR B . n 
B 2 362 HIS 362 862 862 HIS HIS B . n 
B 2 363 THR 363 863 863 THR THR B . n 
B 2 364 CYS 364 864 864 CYS CYS B . n 
B 2 365 TYR 365 865 865 TYR TYR B . n 
B 2 366 CYS 366 866 866 CYS CYS B . n 
B 2 367 LEU 367 867 867 LEU LEU B . n 
B 2 368 SER 368 868 868 SER SER B . n 
B 2 369 GLY 369 869 869 GLY GLY B . n 
B 2 370 LEU 370 870 870 LEU LEU B . n 
B 2 371 SER 371 871 871 SER SER B . n 
B 2 372 ILE 372 872 872 ILE ILE B . n 
B 2 373 ALA 373 873 873 ALA ALA B . n 
B 2 374 GLN 374 874 874 GLN GLN B . n 
B 2 375 HIS 375 875 875 HIS HIS B . n 
B 2 376 PHE 376 876 876 PHE PHE B . n 
B 2 377 GLY 377 877 877 GLY GLY B . n 
B 2 378 SER 378 878 878 SER SER B . n 
B 2 379 GLY 379 879 879 GLY GLY B . n 
B 2 380 ALA 380 880 880 ALA ALA B . n 
B 2 381 MET 381 881 881 MET MET B . n 
B 2 382 LEU 382 882 882 LEU LEU B . n 
B 2 383 HIS 383 883 883 HIS HIS B . n 
B 2 384 ASP 384 884 884 ASP ASP B . n 
B 2 385 VAL 385 885 885 VAL VAL B . n 
B 2 386 VAL 386 886 886 VAL VAL B . n 
B 2 387 LEU 387 887 887 LEU LEU B . n 
B 2 388 GLY 388 888 888 GLY GLY B . n 
B 2 389 VAL 389 889 889 VAL VAL B . n 
B 2 390 PRO 390 890 890 PRO PRO B . n 
B 2 391 GLU 391 891 891 GLU GLU B . n 
B 2 392 ASN 392 892 892 ASN ASN B . n 
B 2 393 ALA 393 893 893 ALA ALA B . n 
B 2 394 LEU 394 894 894 LEU LEU B . n 
B 2 395 GLN 395 895 895 GLN GLN B . n 
B 2 396 PRO 396 896 896 PRO PRO B . n 
B 2 397 THR 397 897 897 THR THR B . n 
B 2 398 HIS 398 898 898 HIS HIS B . n 
B 2 399 PRO 399 899 899 PRO PRO B . n 
B 2 400 VAL 400 900 900 VAL VAL B . n 
B 2 401 TYR 401 901 901 TYR TYR B . n 
B 2 402 ASN 402 902 902 ASN ASN B . n 
B 2 403 ILE 403 903 903 ILE ILE B . n 
B 2 404 GLY 404 904 904 GLY GLY B . n 
B 2 405 PRO 405 905 905 PRO PRO B . n 
B 2 406 ASP 406 906 906 ASP ASP B . n 
B 2 407 LYS 407 907 907 LYS LYS B . n 
B 2 408 VAL 408 908 908 VAL VAL B . n 
B 2 409 ILE 409 909 909 ILE ILE B . n 
B 2 410 GLN 410 910 910 GLN GLN B . n 
B 2 411 ALA 411 911 911 ALA ALA B . n 
B 2 412 THR 412 912 912 THR THR B . n 
B 2 413 THR 413 913 913 THR THR B . n 
B 2 414 TYR 414 914 914 TYR TYR B . n 
B 2 415 PHE 415 915 915 PHE PHE B . n 
B 2 416 LEU 416 916 916 LEU LEU B . n 
B 2 417 GLN 417 917 917 GLN GLN B . n 
B 2 418 LYS 418 918 918 LYS LYS B . n 
B 2 419 PRO 419 919 919 PRO PRO B . n 
B 2 420 VAL 420 920 920 VAL VAL B . n 
B 2 421 PRO 421 921 921 PRO PRO B . n 
B 2 422 GLY 422 922 922 GLY GLY B . n 
B 2 423 PHE 423 923 923 PHE PHE B . n 
B 2 424 GLU 424 924 ?   ?   ?   B . n 
B 2 425 GLU 425 925 ?   ?   ?   B . n 
B 2 426 LEU 426 926 ?   ?   ?   B . n 
B 2 427 LYS 427 927 ?   ?   ?   B . n 
B 2 428 ASP 428 928 ?   ?   ?   B . n 
B 2 429 GLU 429 929 ?   ?   ?   B . n 
B 2 430 THR 430 930 ?   ?   ?   B . n 
B 2 431 SER 431 931 ?   ?   ?   B . n 
B 2 432 ALA 432 932 ?   ?   ?   B . n 
B 2 433 GLU 433 933 ?   ?   ?   B . n 
B 2 434 PRO 434 934 ?   ?   ?   B . n 
B 2 435 ALA 435 935 ?   ?   ?   B . n 
B 2 436 THR 436 936 ?   ?   ?   B . n 
B 2 437 ASP 437 937 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ACY 1   904  904  ACY ACY A . 
E 4 ACY 1   905  905  ACY ACY A . 
F 5 ZN  1   1001 1001 ZN  ZN  B . 
G 6 FPP 1   1002 902  FPP FPP B . 
H 7 U49 1   1003 903  U49 U49 B . 
I 8 HOH 1   1004 1004 HOH HOH A . 
I 8 HOH 2   1007 1007 HOH HOH A . 
I 8 HOH 3   1008 1008 HOH HOH A . 
I 8 HOH 4   1011 1011 HOH HOH A . 
I 8 HOH 5   1016 1016 HOH HOH A . 
I 8 HOH 6   1020 1020 HOH HOH A . 
I 8 HOH 7   1021 1021 HOH HOH A . 
I 8 HOH 8   1022 1022 HOH HOH A . 
I 8 HOH 9   1025 1025 HOH HOH A . 
I 8 HOH 10  1027 1027 HOH HOH A . 
I 8 HOH 11  1028 1028 HOH HOH A . 
I 8 HOH 12  1031 1031 HOH HOH A . 
I 8 HOH 13  1033 1033 HOH HOH A . 
I 8 HOH 14  1034 1034 HOH HOH A . 
I 8 HOH 15  1035 1035 HOH HOH A . 
I 8 HOH 16  1036 1036 HOH HOH A . 
I 8 HOH 17  1037 1037 HOH HOH A . 
I 8 HOH 18  1039 1039 HOH HOH A . 
I 8 HOH 19  1040 1040 HOH HOH A . 
I 8 HOH 20  1041 1041 HOH HOH A . 
I 8 HOH 21  1044 1044 HOH HOH A . 
I 8 HOH 22  1046 1046 HOH HOH A . 
I 8 HOH 23  1047 1047 HOH HOH A . 
I 8 HOH 24  1048 1048 HOH HOH A . 
I 8 HOH 25  1054 1054 HOH HOH A . 
I 8 HOH 26  1057 1057 HOH HOH A . 
I 8 HOH 27  1063 1063 HOH HOH A . 
I 8 HOH 28  1065 1065 HOH HOH A . 
I 8 HOH 29  1066 1066 HOH HOH A . 
I 8 HOH 30  1069 1069 HOH HOH A . 
I 8 HOH 31  1070 1070 HOH HOH A . 
I 8 HOH 32  1077 1077 HOH HOH A . 
I 8 HOH 33  1084 1084 HOH HOH A . 
I 8 HOH 34  1085 1085 HOH HOH A . 
I 8 HOH 35  1087 1087 HOH HOH A . 
I 8 HOH 36  1090 1090 HOH HOH A . 
I 8 HOH 37  1092 1092 HOH HOH A . 
I 8 HOH 38  1096 1096 HOH HOH A . 
I 8 HOH 39  1099 1099 HOH HOH A . 
I 8 HOH 40  1101 1101 HOH HOH A . 
I 8 HOH 41  1102 1102 HOH HOH A . 
I 8 HOH 42  1105 1105 HOH HOH A . 
I 8 HOH 43  1107 1107 HOH HOH A . 
I 8 HOH 44  1110 1110 HOH HOH A . 
I 8 HOH 45  1112 1112 HOH HOH A . 
I 8 HOH 46  1113 1113 HOH HOH A . 
I 8 HOH 47  1117 1117 HOH HOH A . 
I 8 HOH 48  1123 1123 HOH HOH A . 
I 8 HOH 49  1124 1124 HOH HOH A . 
I 8 HOH 50  1131 1131 HOH HOH A . 
I 8 HOH 51  1138 1138 HOH HOH A . 
I 8 HOH 52  1142 1142 HOH HOH A . 
I 8 HOH 53  1149 1149 HOH HOH A . 
I 8 HOH 54  1150 1150 HOH HOH A . 
I 8 HOH 55  1153 1153 HOH HOH A . 
I 8 HOH 56  1160 1160 HOH HOH A . 
I 8 HOH 57  1171 1171 HOH HOH A . 
I 8 HOH 58  1180 1180 HOH HOH A . 
I 8 HOH 59  1182 1182 HOH HOH A . 
I 8 HOH 60  1188 1188 HOH HOH A . 
I 8 HOH 61  1193 1193 HOH HOH A . 
I 8 HOH 62  1194 1194 HOH HOH A . 
I 8 HOH 63  1196 1196 HOH HOH A . 
I 8 HOH 64  1204 1204 HOH HOH A . 
I 8 HOH 65  1205 1205 HOH HOH A . 
I 8 HOH 66  1208 1208 HOH HOH A . 
I 8 HOH 67  1211 1211 HOH HOH A . 
I 8 HOH 68  1213 1213 HOH HOH A . 
I 8 HOH 69  1228 1228 HOH HOH A . 
I 8 HOH 70  1238 1238 HOH HOH A . 
I 8 HOH 71  1242 1242 HOH HOH A . 
I 8 HOH 72  1243 1243 HOH HOH A . 
I 8 HOH 73  1244 1244 HOH HOH A . 
I 8 HOH 74  1248 1248 HOH HOH A . 
I 8 HOH 75  1250 1250 HOH HOH A . 
I 8 HOH 76  1251 1251 HOH HOH A . 
I 8 HOH 77  1254 1254 HOH HOH A . 
I 8 HOH 78  1258 1258 HOH HOH A . 
I 8 HOH 79  1260 1260 HOH HOH A . 
I 8 HOH 80  1265 1265 HOH HOH A . 
I 8 HOH 81  1267 1267 HOH HOH A . 
I 8 HOH 82  1272 1272 HOH HOH A . 
I 8 HOH 83  1276 1276 HOH HOH A . 
I 8 HOH 84  1286 1286 HOH HOH A . 
I 8 HOH 85  1292 1292 HOH HOH A . 
I 8 HOH 86  1293 1293 HOH HOH A . 
I 8 HOH 87  1296 1296 HOH HOH A . 
I 8 HOH 88  1297 1297 HOH HOH A . 
I 8 HOH 89  1303 1303 HOH HOH A . 
I 8 HOH 90  1318 1318 HOH HOH A . 
I 8 HOH 91  1324 1324 HOH HOH A . 
I 8 HOH 92  1325 1325 HOH HOH A . 
I 8 HOH 93  1329 1329 HOH HOH A . 
I 8 HOH 94  1330 1330 HOH HOH A . 
I 8 HOH 95  1331 1331 HOH HOH A . 
I 8 HOH 96  1335 1335 HOH HOH A . 
I 8 HOH 97  1337 1337 HOH HOH A . 
I 8 HOH 98  1338 1338 HOH HOH A . 
I 8 HOH 99  1341 1341 HOH HOH A . 
I 8 HOH 100 1342 1342 HOH HOH A . 
I 8 HOH 101 1347 1347 HOH HOH A . 
I 8 HOH 102 1352 1352 HOH HOH A . 
I 8 HOH 103 1354 1354 HOH HOH A . 
I 8 HOH 104 1357 1357 HOH HOH A . 
I 8 HOH 105 1359 1359 HOH HOH A . 
I 8 HOH 106 1365 1365 HOH HOH A . 
I 8 HOH 107 1367 1367 HOH HOH A . 
I 8 HOH 108 1369 1369 HOH HOH A . 
I 8 HOH 109 1370 1370 HOH HOH A . 
I 8 HOH 110 1371 1371 HOH HOH A . 
I 8 HOH 111 1372 1372 HOH HOH A . 
I 8 HOH 112 1379 1379 HOH HOH A . 
I 8 HOH 113 1381 1381 HOH HOH A . 
I 8 HOH 114 1382 1382 HOH HOH A . 
I 8 HOH 115 1383 1383 HOH HOH A . 
I 8 HOH 116 1386 1386 HOH HOH A . 
I 8 HOH 117 1393 1393 HOH HOH A . 
I 8 HOH 118 1398 1398 HOH HOH A . 
I 8 HOH 119 1404 1404 HOH HOH A . 
I 8 HOH 120 1405 1405 HOH HOH A . 
I 8 HOH 121 1412 1412 HOH HOH A . 
I 8 HOH 122 1414 1414 HOH HOH A . 
I 8 HOH 123 1417 1417 HOH HOH A . 
I 8 HOH 124 1423 1423 HOH HOH A . 
I 8 HOH 125 1428 1428 HOH HOH A . 
I 8 HOH 126 1439 1439 HOH HOH A . 
I 8 HOH 127 1443 1443 HOH HOH A . 
I 8 HOH 128 1445 1445 HOH HOH A . 
I 8 HOH 129 1447 1447 HOH HOH A . 
I 8 HOH 130 1450 1450 HOH HOH A . 
I 8 HOH 131 1453 1453 HOH HOH A . 
I 8 HOH 132 1454 1454 HOH HOH A . 
I 8 HOH 133 1455 1455 HOH HOH A . 
I 8 HOH 134 1459 1459 HOH HOH A . 
I 8 HOH 135 1461 1461 HOH HOH A . 
I 8 HOH 136 1462 1462 HOH HOH A . 
I 8 HOH 137 1463 1463 HOH HOH A . 
I 8 HOH 138 1474 1474 HOH HOH A . 
I 8 HOH 139 1475 1475 HOH HOH A . 
I 8 HOH 140 1476 1476 HOH HOH A . 
I 8 HOH 141 1477 1477 HOH HOH A . 
I 8 HOH 142 1481 1481 HOH HOH A . 
I 8 HOH 143 1482 1482 HOH HOH A . 
I 8 HOH 144 1485 1485 HOH HOH A . 
I 8 HOH 145 1493 1493 HOH HOH A . 
I 8 HOH 146 1497 1497 HOH HOH A . 
I 8 HOH 147 1500 1500 HOH HOH A . 
I 8 HOH 148 1507 1507 HOH HOH A . 
I 8 HOH 149 1517 1517 HOH HOH A . 
I 8 HOH 150 1519 1519 HOH HOH A . 
I 8 HOH 151 1527 1527 HOH HOH A . 
I 8 HOH 152 1529 1529 HOH HOH A . 
I 8 HOH 153 1530 1530 HOH HOH A . 
I 8 HOH 154 1533 1533 HOH HOH A . 
I 8 HOH 155 1553 1553 HOH HOH A . 
I 8 HOH 156 1559 1559 HOH HOH A . 
I 8 HOH 157 1565 1565 HOH HOH A . 
I 8 HOH 158 1572 1572 HOH HOH A . 
I 8 HOH 159 1574 1574 HOH HOH A . 
I 8 HOH 160 1577 1577 HOH HOH A . 
I 8 HOH 161 1578 1578 HOH HOH A . 
I 8 HOH 162 1585 1585 HOH HOH A . 
I 8 HOH 163 1588 1588 HOH HOH A . 
I 8 HOH 164 1590 1590 HOH HOH A . 
I 8 HOH 165 1593 1593 HOH HOH A . 
I 8 HOH 166 1594 1594 HOH HOH A . 
I 8 HOH 167 1598 1598 HOH HOH A . 
I 8 HOH 168 1599 1599 HOH HOH A . 
I 8 HOH 169 1600 1600 HOH HOH A . 
I 8 HOH 170 1601 1601 HOH HOH A . 
I 8 HOH 171 1603 1603 HOH HOH A . 
I 8 HOH 172 1607 1607 HOH HOH A . 
I 8 HOH 173 1613 1613 HOH HOH A . 
I 8 HOH 174 1617 1617 HOH HOH A . 
I 8 HOH 175 1618 1618 HOH HOH A . 
I 8 HOH 176 1620 1620 HOH HOH A . 
I 8 HOH 177 1621 1621 HOH HOH A . 
I 8 HOH 178 1624 1624 HOH HOH A . 
I 8 HOH 179 1640 1640 HOH HOH A . 
I 8 HOH 180 1645 1645 HOH HOH A . 
I 8 HOH 181 1646 1646 HOH HOH A . 
I 8 HOH 182 1648 1648 HOH HOH A . 
I 8 HOH 183 1650 1650 HOH HOH A . 
I 8 HOH 184 1665 1665 HOH HOH A . 
I 8 HOH 185 1670 1670 HOH HOH A . 
I 8 HOH 186 1671 1671 HOH HOH A . 
I 8 HOH 187 1689 1689 HOH HOH A . 
I 8 HOH 188 1692 1692 HOH HOH A . 
I 8 HOH 189 1693 1693 HOH HOH A . 
I 8 HOH 190 1698 1698 HOH HOH A . 
I 8 HOH 191 1705 1705 HOH HOH A . 
I 8 HOH 192 1707 1707 HOH HOH A . 
I 8 HOH 193 1708 1708 HOH HOH A . 
I 8 HOH 194 1717 1717 HOH HOH A . 
I 8 HOH 195 1718 1718 HOH HOH A . 
I 8 HOH 196 1729 1729 HOH HOH A . 
I 8 HOH 197 1733 1733 HOH HOH A . 
I 8 HOH 198 1741 1741 HOH HOH A . 
I 8 HOH 199 1746 1746 HOH HOH A . 
I 8 HOH 200 1747 1747 HOH HOH A . 
I 8 HOH 201 1748 1748 HOH HOH A . 
I 8 HOH 202 1756 1756 HOH HOH A . 
I 8 HOH 203 1759 1759 HOH HOH A . 
I 8 HOH 204 1763 1763 HOH HOH A . 
I 8 HOH 205 1787 1787 HOH HOH A . 
I 8 HOH 206 1791 1791 HOH HOH A . 
I 8 HOH 207 1794 1794 HOH HOH A . 
I 8 HOH 208 1798 1798 HOH HOH A . 
I 8 HOH 209 1800 1800 HOH HOH A . 
I 8 HOH 210 1801 1801 HOH HOH A . 
I 8 HOH 211 1805 1805 HOH HOH A . 
I 8 HOH 212 1808 1808 HOH HOH A . 
I 8 HOH 213 1809 1809 HOH HOH A . 
I 8 HOH 214 1817 1817 HOH HOH A . 
I 8 HOH 215 1818 1818 HOH HOH A . 
I 8 HOH 216 1822 1822 HOH HOH A . 
I 8 HOH 217 1830 1830 HOH HOH A . 
I 8 HOH 218 1836 1836 HOH HOH A . 
I 8 HOH 219 1840 1840 HOH HOH A . 
I 8 HOH 220 1843 1843 HOH HOH A . 
I 8 HOH 221 1850 1850 HOH HOH A . 
I 8 HOH 222 1857 1857 HOH HOH A . 
I 8 HOH 223 1861 1861 HOH HOH A . 
I 8 HOH 224 1862 1862 HOH HOH A . 
I 8 HOH 225 1865 1865 HOH HOH A . 
I 8 HOH 226 1866 1866 HOH HOH A . 
I 8 HOH 227 1868 1868 HOH HOH A . 
I 8 HOH 228 1869 1869 HOH HOH A . 
I 8 HOH 229 1871 1871 HOH HOH A . 
I 8 HOH 230 1881 1881 HOH HOH A . 
I 8 HOH 231 1883 1883 HOH HOH A . 
I 8 HOH 232 1886 1886 HOH HOH A . 
I 8 HOH 233 1896 1896 HOH HOH A . 
I 8 HOH 234 1906 1906 HOH HOH A . 
I 8 HOH 235 1907 1907 HOH HOH A . 
I 8 HOH 236 1908 1908 HOH HOH A . 
I 8 HOH 237 1910 1910 HOH HOH A . 
I 8 HOH 238 1912 1912 HOH HOH A . 
I 8 HOH 239 1913 1913 HOH HOH A . 
I 8 HOH 240 1918 1918 HOH HOH A . 
I 8 HOH 241 1919 1919 HOH HOH A . 
I 8 HOH 242 1921 1921 HOH HOH A . 
I 8 HOH 243 1927 1927 HOH HOH A . 
I 8 HOH 244 1929 1929 HOH HOH A . 
I 8 HOH 245 1930 1930 HOH HOH A . 
I 8 HOH 246 1932 1932 HOH HOH A . 
I 8 HOH 247 1933 1933 HOH HOH A . 
I 8 HOH 248 1941 1941 HOH HOH A . 
I 8 HOH 249 1942 1942 HOH HOH A . 
I 8 HOH 250 1943 1943 HOH HOH A . 
I 8 HOH 251 1946 1946 HOH HOH A . 
I 8 HOH 252 1947 1947 HOH HOH A . 
I 8 HOH 253 1950 1950 HOH HOH A . 
I 8 HOH 254 1951 1951 HOH HOH A . 
I 8 HOH 255 1955 1955 HOH HOH A . 
I 8 HOH 256 1956 1956 HOH HOH A . 
I 8 HOH 257 1957 1957 HOH HOH A . 
I 8 HOH 258 1958 1958 HOH HOH A . 
I 8 HOH 259 1959 1959 HOH HOH A . 
I 8 HOH 260 1964 1964 HOH HOH A . 
I 8 HOH 261 1967 1967 HOH HOH A . 
I 8 HOH 262 1970 1970 HOH HOH A . 
I 8 HOH 263 1972 1972 HOH HOH A . 
I 8 HOH 264 1973 1973 HOH HOH A . 
I 8 HOH 265 1974 1974 HOH HOH A . 
I 8 HOH 266 1975 1975 HOH HOH A . 
I 8 HOH 267 1976 1976 HOH HOH A . 
I 8 HOH 268 1982 1982 HOH HOH A . 
I 8 HOH 269 1984 1984 HOH HOH A . 
I 8 HOH 270 1985 1985 HOH HOH A . 
I 8 HOH 271 1986 1986 HOH HOH A . 
I 8 HOH 272 1987 1987 HOH HOH A . 
I 8 HOH 273 1989 1989 HOH HOH A . 
I 8 HOH 274 1991 1991 HOH HOH A . 
I 8 HOH 275 1992 1992 HOH HOH A . 
I 8 HOH 276 1994 1994 HOH HOH A . 
I 8 HOH 277 1996 1996 HOH HOH A . 
I 8 HOH 278 2002 2002 HOH HOH A . 
I 8 HOH 279 2008 2008 HOH HOH A . 
I 8 HOH 280 2009 2009 HOH HOH A . 
I 8 HOH 281 2011 2011 HOH HOH A . 
I 8 HOH 282 2012 2012 HOH HOH A . 
I 8 HOH 283 2015 2015 HOH HOH A . 
I 8 HOH 284 2017 2017 HOH HOH A . 
I 8 HOH 285 2020 2020 HOH HOH A . 
I 8 HOH 286 2021 2021 HOH HOH A . 
I 8 HOH 287 2024 2024 HOH HOH A . 
I 8 HOH 288 2025 2025 HOH HOH A . 
I 8 HOH 289 2028 2028 HOH HOH A . 
I 8 HOH 290 2029 2029 HOH HOH A . 
I 8 HOH 291 2030 2030 HOH HOH A . 
I 8 HOH 292 2042 2042 HOH HOH A . 
I 8 HOH 293 2044 2044 HOH HOH A . 
I 8 HOH 294 2046 2046 HOH HOH A . 
I 8 HOH 295 2052 2052 HOH HOH A . 
I 8 HOH 296 2054 2054 HOH HOH A . 
I 8 HOH 297 2055 2055 HOH HOH A . 
I 8 HOH 298 2057 2057 HOH HOH A . 
I 8 HOH 299 2059 2059 HOH HOH A . 
I 8 HOH 300 2061 2061 HOH HOH A . 
I 8 HOH 301 2062 2062 HOH HOH A . 
I 8 HOH 302 2072 2072 HOH HOH A . 
I 8 HOH 303 2073 2073 HOH HOH A . 
I 8 HOH 304 2077 2077 HOH HOH A . 
I 8 HOH 305 2081 2081 HOH HOH A . 
I 8 HOH 306 2082 2082 HOH HOH A . 
I 8 HOH 307 2083 2083 HOH HOH A . 
I 8 HOH 308 2084 2084 HOH HOH A . 
I 8 HOH 309 2086 2086 HOH HOH A . 
I 8 HOH 310 2087 2087 HOH HOH A . 
I 8 HOH 311 2088 2088 HOH HOH A . 
I 8 HOH 312 2089 2089 HOH HOH A . 
I 8 HOH 313 2093 2093 HOH HOH A . 
I 8 HOH 314 2095 2095 HOH HOH A . 
I 8 HOH 315 2100 2100 HOH HOH A . 
J 8 HOH 1   1004 1003 HOH HOH B . 
J 8 HOH 2   1005 1005 HOH HOH B . 
J 8 HOH 3   1006 1009 HOH HOH B . 
J 8 HOH 4   1007 1012 HOH HOH B . 
J 8 HOH 5   1008 1014 HOH HOH B . 
J 8 HOH 6   1009 1015 HOH HOH B . 
J 8 HOH 7   1010 1017 HOH HOH B . 
J 8 HOH 8   1011 1018 HOH HOH B . 
J 8 HOH 9   1012 1019 HOH HOH B . 
J 8 HOH 10  1013 1023 HOH HOH B . 
J 8 HOH 11  1014 1024 HOH HOH B . 
J 8 HOH 12  1015 1026 HOH HOH B . 
J 8 HOH 13  1016 1029 HOH HOH B . 
J 8 HOH 14  1017 1030 HOH HOH B . 
J 8 HOH 15  1018 1042 HOH HOH B . 
J 8 HOH 16  1019 1043 HOH HOH B . 
J 8 HOH 17  1020 1049 HOH HOH B . 
J 8 HOH 18  1021 1053 HOH HOH B . 
J 8 HOH 19  1022 1055 HOH HOH B . 
J 8 HOH 20  1023 1056 HOH HOH B . 
J 8 HOH 21  1024 1058 HOH HOH B . 
J 8 HOH 22  1025 1059 HOH HOH B . 
J 8 HOH 23  1026 1061 HOH HOH B . 
J 8 HOH 24  1027 1064 HOH HOH B . 
J 8 HOH 25  1028 1068 HOH HOH B . 
J 8 HOH 26  1029 1071 HOH HOH B . 
J 8 HOH 27  1030 1072 HOH HOH B . 
J 8 HOH 28  1031 1076 HOH HOH B . 
J 8 HOH 29  1032 1080 HOH HOH B . 
J 8 HOH 30  1033 1082 HOH HOH B . 
J 8 HOH 31  1034 1083 HOH HOH B . 
J 8 HOH 32  1035 1086 HOH HOH B . 
J 8 HOH 33  1036 1088 HOH HOH B . 
J 8 HOH 34  1037 1093 HOH HOH B . 
J 8 HOH 35  1038 1094 HOH HOH B . 
J 8 HOH 36  1039 1097 HOH HOH B . 
J 8 HOH 37  1040 1098 HOH HOH B . 
J 8 HOH 38  1041 1100 HOH HOH B . 
J 8 HOH 39  1042 1104 HOH HOH B . 
J 8 HOH 40  1043 1108 HOH HOH B . 
J 8 HOH 41  1044 1109 HOH HOH B . 
J 8 HOH 42  1045 1114 HOH HOH B . 
J 8 HOH 43  1046 1116 HOH HOH B . 
J 8 HOH 44  1047 1118 HOH HOH B . 
J 8 HOH 45  1048 1121 HOH HOH B . 
J 8 HOH 46  1049 1122 HOH HOH B . 
J 8 HOH 47  1050 1128 HOH HOH B . 
J 8 HOH 48  1051 1129 HOH HOH B . 
J 8 HOH 49  1052 1130 HOH HOH B . 
J 8 HOH 50  1053 1132 HOH HOH B . 
J 8 HOH 51  1054 1133 HOH HOH B . 
J 8 HOH 52  1055 1135 HOH HOH B . 
J 8 HOH 53  1056 1136 HOH HOH B . 
J 8 HOH 54  1057 1140 HOH HOH B . 
J 8 HOH 55  1058 1144 HOH HOH B . 
J 8 HOH 56  1059 1151 HOH HOH B . 
J 8 HOH 57  1060 1152 HOH HOH B . 
J 8 HOH 58  1061 1155 HOH HOH B . 
J 8 HOH 59  1062 1178 HOH HOH B . 
J 8 HOH 60  1063 1185 HOH HOH B . 
J 8 HOH 61  1064 1186 HOH HOH B . 
J 8 HOH 62  1065 1192 HOH HOH B . 
J 8 HOH 63  1066 1209 HOH HOH B . 
J 8 HOH 64  1067 1212 HOH HOH B . 
J 8 HOH 65  1068 1214 HOH HOH B . 
J 8 HOH 66  1069 1216 HOH HOH B . 
J 8 HOH 67  1070 1218 HOH HOH B . 
J 8 HOH 68  1071 1219 HOH HOH B . 
J 8 HOH 69  1072 1222 HOH HOH B . 
J 8 HOH 70  1073 1224 HOH HOH B . 
J 8 HOH 71  1074 1235 HOH HOH B . 
J 8 HOH 72  1075 1240 HOH HOH B . 
J 8 HOH 73  1076 1257 HOH HOH B . 
J 8 HOH 74  1077 1259 HOH HOH B . 
J 8 HOH 75  1078 1268 HOH HOH B . 
J 8 HOH 76  1079 1269 HOH HOH B . 
J 8 HOH 77  1080 1273 HOH HOH B . 
J 8 HOH 78  1081 1282 HOH HOH B . 
J 8 HOH 79  1082 1291 HOH HOH B . 
J 8 HOH 80  1083 1305 HOH HOH B . 
J 8 HOH 81  1084 1309 HOH HOH B . 
J 8 HOH 82  1085 1314 HOH HOH B . 
J 8 HOH 83  1086 1315 HOH HOH B . 
J 8 HOH 84  1087 1317 HOH HOH B . 
J 8 HOH 85  1088 1320 HOH HOH B . 
J 8 HOH 86  1089 1322 HOH HOH B . 
J 8 HOH 87  1090 1323 HOH HOH B . 
J 8 HOH 88  1091 1326 HOH HOH B . 
J 8 HOH 89  1092 1328 HOH HOH B . 
J 8 HOH 90  1093 1339 HOH HOH B . 
J 8 HOH 91  1094 1343 HOH HOH B . 
J 8 HOH 92  1095 1348 HOH HOH B . 
J 8 HOH 93  1096 1350 HOH HOH B . 
J 8 HOH 94  1097 1351 HOH HOH B . 
J 8 HOH 95  1098 1353 HOH HOH B . 
J 8 HOH 96  1099 1355 HOH HOH B . 
J 8 HOH 97  1100 1356 HOH HOH B . 
J 8 HOH 98  1101 1361 HOH HOH B . 
J 8 HOH 99  1102 1362 HOH HOH B . 
J 8 HOH 100 1103 1366 HOH HOH B . 
J 8 HOH 101 1104 1368 HOH HOH B . 
J 8 HOH 102 1105 1373 HOH HOH B . 
J 8 HOH 103 1106 1375 HOH HOH B . 
J 8 HOH 104 1107 1376 HOH HOH B . 
J 8 HOH 105 1108 1378 HOH HOH B . 
J 8 HOH 106 1109 1380 HOH HOH B . 
J 8 HOH 107 1110 1384 HOH HOH B . 
J 8 HOH 108 1111 1385 HOH HOH B . 
J 8 HOH 109 1112 1387 HOH HOH B . 
J 8 HOH 110 1113 1388 HOH HOH B . 
J 8 HOH 111 1114 1389 HOH HOH B . 
J 8 HOH 112 1115 1390 HOH HOH B . 
J 8 HOH 113 1116 1391 HOH HOH B . 
J 8 HOH 114 1117 1395 HOH HOH B . 
J 8 HOH 115 1118 1396 HOH HOH B . 
J 8 HOH 116 1119 1397 HOH HOH B . 
J 8 HOH 117 1120 1399 HOH HOH B . 
J 8 HOH 118 1121 1401 HOH HOH B . 
J 8 HOH 119 1122 1402 HOH HOH B . 
J 8 HOH 120 1123 1403 HOH HOH B . 
J 8 HOH 121 1124 1406 HOH HOH B . 
J 8 HOH 122 1125 1407 HOH HOH B . 
J 8 HOH 123 1126 1408 HOH HOH B . 
J 8 HOH 124 1127 1409 HOH HOH B . 
J 8 HOH 125 1128 1411 HOH HOH B . 
J 8 HOH 126 1129 1413 HOH HOH B . 
J 8 HOH 127 1130 1415 HOH HOH B . 
J 8 HOH 128 1131 1416 HOH HOH B . 
J 8 HOH 129 1132 1418 HOH HOH B . 
J 8 HOH 130 1133 1419 HOH HOH B . 
J 8 HOH 131 1134 1420 HOH HOH B . 
J 8 HOH 132 1135 1422 HOH HOH B . 
J 8 HOH 133 1136 1424 HOH HOH B . 
J 8 HOH 134 1137 1426 HOH HOH B . 
J 8 HOH 135 1138 1430 HOH HOH B . 
J 8 HOH 136 1139 1431 HOH HOH B . 
J 8 HOH 137 1140 1432 HOH HOH B . 
J 8 HOH 138 1141 1434 HOH HOH B . 
J 8 HOH 139 1142 1435 HOH HOH B . 
J 8 HOH 140 1143 1436 HOH HOH B . 
J 8 HOH 141 1144 1437 HOH HOH B . 
J 8 HOH 142 1145 1441 HOH HOH B . 
J 8 HOH 143 1146 1442 HOH HOH B . 
J 8 HOH 144 1147 1446 HOH HOH B . 
J 8 HOH 145 1148 1457 HOH HOH B . 
J 8 HOH 146 1149 1458 HOH HOH B . 
J 8 HOH 147 1150 1467 HOH HOH B . 
J 8 HOH 148 1151 1468 HOH HOH B . 
J 8 HOH 149 1152 1471 HOH HOH B . 
J 8 HOH 150 1153 1473 HOH HOH B . 
J 8 HOH 151 1154 1483 HOH HOH B . 
J 8 HOH 152 1155 1487 HOH HOH B . 
J 8 HOH 153 1156 1488 HOH HOH B . 
J 8 HOH 154 1157 1492 HOH HOH B . 
J 8 HOH 155 1158 1494 HOH HOH B . 
J 8 HOH 156 1159 1495 HOH HOH B . 
J 8 HOH 157 1160 1499 HOH HOH B . 
J 8 HOH 158 1161 1502 HOH HOH B . 
J 8 HOH 159 1162 1503 HOH HOH B . 
J 8 HOH 160 1163 1504 HOH HOH B . 
J 8 HOH 161 1164 1508 HOH HOH B . 
J 8 HOH 162 1165 1509 HOH HOH B . 
J 8 HOH 163 1166 1512 HOH HOH B . 
J 8 HOH 164 1167 1513 HOH HOH B . 
J 8 HOH 165 1168 1515 HOH HOH B . 
J 8 HOH 166 1169 1518 HOH HOH B . 
J 8 HOH 167 1170 1526 HOH HOH B . 
J 8 HOH 168 1171 1538 HOH HOH B . 
J 8 HOH 169 1172 1540 HOH HOH B . 
J 8 HOH 170 1173 1542 HOH HOH B . 
J 8 HOH 171 1174 1543 HOH HOH B . 
J 8 HOH 172 1175 1550 HOH HOH B . 
J 8 HOH 173 1176 1551 HOH HOH B . 
J 8 HOH 174 1177 1554 HOH HOH B . 
J 8 HOH 175 1178 1566 HOH HOH B . 
J 8 HOH 176 1179 1571 HOH HOH B . 
J 8 HOH 177 1180 1584 HOH HOH B . 
J 8 HOH 178 1181 1587 HOH HOH B . 
J 8 HOH 179 1182 1589 HOH HOH B . 
J 8 HOH 180 1183 1591 HOH HOH B . 
J 8 HOH 181 1184 1596 HOH HOH B . 
J 8 HOH 182 1185 1608 HOH HOH B . 
J 8 HOH 183 1186 1611 HOH HOH B . 
J 8 HOH 184 1187 1612 HOH HOH B . 
J 8 HOH 185 1188 1614 HOH HOH B . 
J 8 HOH 186 1189 1616 HOH HOH B . 
J 8 HOH 187 1190 1622 HOH HOH B . 
J 8 HOH 188 1191 1627 HOH HOH B . 
J 8 HOH 189 1192 1635 HOH HOH B . 
J 8 HOH 190 1193 1636 HOH HOH B . 
J 8 HOH 191 1194 1637 HOH HOH B . 
J 8 HOH 192 1195 1638 HOH HOH B . 
J 8 HOH 193 1196 1643 HOH HOH B . 
J 8 HOH 194 1197 1651 HOH HOH B . 
J 8 HOH 195 1198 1652 HOH HOH B . 
J 8 HOH 196 1199 1663 HOH HOH B . 
J 8 HOH 197 1200 1666 HOH HOH B . 
J 8 HOH 198 1201 1667 HOH HOH B . 
J 8 HOH 199 1202 1669 HOH HOH B . 
J 8 HOH 200 1203 1677 HOH HOH B . 
J 8 HOH 201 1204 1680 HOH HOH B . 
J 8 HOH 202 1205 1682 HOH HOH B . 
J 8 HOH 203 1206 1683 HOH HOH B . 
J 8 HOH 204 1207 1686 HOH HOH B . 
J 8 HOH 205 1208 1688 HOH HOH B . 
J 8 HOH 206 1209 1690 HOH HOH B . 
J 8 HOH 207 1210 1694 HOH HOH B . 
J 8 HOH 208 1211 1697 HOH HOH B . 
J 8 HOH 209 1212 1699 HOH HOH B . 
J 8 HOH 210 1213 1711 HOH HOH B . 
J 8 HOH 211 1214 1713 HOH HOH B . 
J 8 HOH 212 1215 1727 HOH HOH B . 
J 8 HOH 213 1216 1738 HOH HOH B . 
J 8 HOH 214 1217 1740 HOH HOH B . 
J 8 HOH 215 1218 1753 HOH HOH B . 
J 8 HOH 216 1219 1769 HOH HOH B . 
J 8 HOH 217 1220 1776 HOH HOH B . 
J 8 HOH 218 1221 1792 HOH HOH B . 
J 8 HOH 219 1222 1795 HOH HOH B . 
J 8 HOH 220 1223 1796 HOH HOH B . 
J 8 HOH 221 1224 1799 HOH HOH B . 
J 8 HOH 222 1225 1804 HOH HOH B . 
J 8 HOH 223 1226 1806 HOH HOH B . 
J 8 HOH 224 1227 1811 HOH HOH B . 
J 8 HOH 225 1228 1813 HOH HOH B . 
J 8 HOH 226 1229 1814 HOH HOH B . 
J 8 HOH 227 1230 1819 HOH HOH B . 
J 8 HOH 228 1231 1820 HOH HOH B . 
J 8 HOH 229 1232 1831 HOH HOH B . 
J 8 HOH 230 1233 1832 HOH HOH B . 
J 8 HOH 231 1234 1833 HOH HOH B . 
J 8 HOH 232 1235 1834 HOH HOH B . 
J 8 HOH 233 1236 1835 HOH HOH B . 
J 8 HOH 234 1237 1837 HOH HOH B . 
J 8 HOH 235 1238 1838 HOH HOH B . 
J 8 HOH 236 1239 1842 HOH HOH B . 
J 8 HOH 237 1240 1844 HOH HOH B . 
J 8 HOH 238 1241 1845 HOH HOH B . 
J 8 HOH 239 1242 1846 HOH HOH B . 
J 8 HOH 240 1243 1848 HOH HOH B . 
J 8 HOH 241 1244 1853 HOH HOH B . 
J 8 HOH 242 1245 1854 HOH HOH B . 
J 8 HOH 243 1246 1856 HOH HOH B . 
J 8 HOH 244 1247 1860 HOH HOH B . 
J 8 HOH 245 1248 1867 HOH HOH B . 
J 8 HOH 246 1249 1872 HOH HOH B . 
J 8 HOH 247 1250 1874 HOH HOH B . 
J 8 HOH 248 1251 1875 HOH HOH B . 
J 8 HOH 249 1252 1876 HOH HOH B . 
J 8 HOH 250 1253 1877 HOH HOH B . 
J 8 HOH 251 1254 1879 HOH HOH B . 
J 8 HOH 252 1255 1882 HOH HOH B . 
J 8 HOH 253 1256 1885 HOH HOH B . 
J 8 HOH 254 1257 1887 HOH HOH B . 
J 8 HOH 255 1258 1892 HOH HOH B . 
J 8 HOH 256 1259 1894 HOH HOH B . 
J 8 HOH 257 1260 1897 HOH HOH B . 
J 8 HOH 258 1261 1898 HOH HOH B . 
J 8 HOH 259 1262 1899 HOH HOH B . 
J 8 HOH 260 1263 1900 HOH HOH B . 
J 8 HOH 261 1264 1901 HOH HOH B . 
J 8 HOH 262 1265 1902 HOH HOH B . 
J 8 HOH 263 1266 1903 HOH HOH B . 
J 8 HOH 264 1267 1904 HOH HOH B . 
J 8 HOH 265 1268 1905 HOH HOH B . 
J 8 HOH 266 1269 1909 HOH HOH B . 
J 8 HOH 267 1270 1914 HOH HOH B . 
J 8 HOH 268 1271 1915 HOH HOH B . 
J 8 HOH 269 1272 1916 HOH HOH B . 
J 8 HOH 270 1273 1920 HOH HOH B . 
J 8 HOH 271 1274 1922 HOH HOH B . 
J 8 HOH 272 1275 1923 HOH HOH B . 
J 8 HOH 273 1276 1924 HOH HOH B . 
J 8 HOH 274 1277 1925 HOH HOH B . 
J 8 HOH 275 1278 1926 HOH HOH B . 
J 8 HOH 276 1279 1928 HOH HOH B . 
J 8 HOH 277 1280 1931 HOH HOH B . 
J 8 HOH 278 1281 1934 HOH HOH B . 
J 8 HOH 279 1282 1935 HOH HOH B . 
J 8 HOH 280 1283 1936 HOH HOH B . 
J 8 HOH 281 1284 1937 HOH HOH B . 
J 8 HOH 282 1285 1938 HOH HOH B . 
J 8 HOH 283 1286 1939 HOH HOH B . 
J 8 HOH 284 1287 1940 HOH HOH B . 
J 8 HOH 285 1288 1944 HOH HOH B . 
J 8 HOH 286 1289 1945 HOH HOH B . 
J 8 HOH 287 1290 1948 HOH HOH B . 
J 8 HOH 288 1291 1949 HOH HOH B . 
J 8 HOH 289 1292 1952 HOH HOH B . 
J 8 HOH 290 1293 1953 HOH HOH B . 
J 8 HOH 291 1294 1954 HOH HOH B . 
J 8 HOH 292 1295 1960 HOH HOH B . 
J 8 HOH 293 1296 1961 HOH HOH B . 
J 8 HOH 294 1297 1962 HOH HOH B . 
J 8 HOH 295 1298 1963 HOH HOH B . 
J 8 HOH 296 1299 1965 HOH HOH B . 
J 8 HOH 297 1300 1966 HOH HOH B . 
J 8 HOH 298 1301 1968 HOH HOH B . 
J 8 HOH 299 1302 1969 HOH HOH B . 
J 8 HOH 300 1303 1971 HOH HOH B . 
J 8 HOH 301 1304 1977 HOH HOH B . 
J 8 HOH 302 1305 1978 HOH HOH B . 
J 8 HOH 303 1306 1979 HOH HOH B . 
J 8 HOH 304 1307 1980 HOH HOH B . 
J 8 HOH 305 1308 1981 HOH HOH B . 
J 8 HOH 306 1309 1983 HOH HOH B . 
J 8 HOH 307 1310 1988 HOH HOH B . 
J 8 HOH 308 1311 1990 HOH HOH B . 
J 8 HOH 309 1312 1993 HOH HOH B . 
J 8 HOH 310 1313 1995 HOH HOH B . 
J 8 HOH 311 1314 1997 HOH HOH B . 
J 8 HOH 312 1315 1998 HOH HOH B . 
J 8 HOH 313 1316 1999 HOH HOH B . 
J 8 HOH 314 1317 2000 HOH HOH B . 
J 8 HOH 315 1318 2001 HOH HOH B . 
J 8 HOH 316 1319 2003 HOH HOH B . 
J 8 HOH 317 1320 2004 HOH HOH B . 
J 8 HOH 318 1321 2005 HOH HOH B . 
J 8 HOH 319 1322 2006 HOH HOH B . 
J 8 HOH 320 1323 2007 HOH HOH B . 
J 8 HOH 321 1324 2010 HOH HOH B . 
J 8 HOH 322 1325 2013 HOH HOH B . 
J 8 HOH 323 1326 2014 HOH HOH B . 
J 8 HOH 324 1327 2016 HOH HOH B . 
J 8 HOH 325 1328 2018 HOH HOH B . 
J 8 HOH 326 1329 2019 HOH HOH B . 
J 8 HOH 327 1330 2022 HOH HOH B . 
J 8 HOH 328 1331 2023 HOH HOH B . 
J 8 HOH 329 1332 2026 HOH HOH B . 
J 8 HOH 330 1333 2027 HOH HOH B . 
J 8 HOH 331 1334 2031 HOH HOH B . 
J 8 HOH 332 1335 2032 HOH HOH B . 
J 8 HOH 333 1336 2033 HOH HOH B . 
J 8 HOH 334 1337 2034 HOH HOH B . 
J 8 HOH 335 1338 2035 HOH HOH B . 
J 8 HOH 336 1339 2036 HOH HOH B . 
J 8 HOH 337 1340 2037 HOH HOH B . 
J 8 HOH 338 1341 2038 HOH HOH B . 
J 8 HOH 339 1342 2039 HOH HOH B . 
J 8 HOH 340 1343 2040 HOH HOH B . 
J 8 HOH 341 1344 2041 HOH HOH B . 
J 8 HOH 342 1345 2043 HOH HOH B . 
J 8 HOH 343 1346 2045 HOH HOH B . 
J 8 HOH 344 1347 2047 HOH HOH B . 
J 8 HOH 345 1348 2048 HOH HOH B . 
J 8 HOH 346 1349 2049 HOH HOH B . 
J 8 HOH 347 1350 2050 HOH HOH B . 
J 8 HOH 348 1351 2051 HOH HOH B . 
J 8 HOH 349 1352 2053 HOH HOH B . 
J 8 HOH 350 1353 2056 HOH HOH B . 
J 8 HOH 351 1354 2058 HOH HOH B . 
J 8 HOH 352 1355 2060 HOH HOH B . 
J 8 HOH 353 1356 2063 HOH HOH B . 
J 8 HOH 354 1357 2064 HOH HOH B . 
J 8 HOH 355 1358 2065 HOH HOH B . 
J 8 HOH 356 1359 2066 HOH HOH B . 
J 8 HOH 357 1360 2067 HOH HOH B . 
J 8 HOH 358 1361 2068 HOH HOH B . 
J 8 HOH 359 1362 2069 HOH HOH B . 
J 8 HOH 360 1363 2070 HOH HOH B . 
J 8 HOH 361 1364 2071 HOH HOH B . 
J 8 HOH 362 1365 2074 HOH HOH B . 
J 8 HOH 363 1366 2075 HOH HOH B . 
J 8 HOH 364 1367 2076 HOH HOH B . 
J 8 HOH 365 1368 2078 HOH HOH B . 
J 8 HOH 366 1369 2079 HOH HOH B . 
J 8 HOH 367 1370 2080 HOH HOH B . 
J 8 HOH 368 1371 2085 HOH HOH B . 
J 8 HOH 369 1372 2090 HOH HOH B . 
J 8 HOH 370 1373 2091 HOH HOH B . 
J 8 HOH 371 1374 2092 HOH HOH B . 
J 8 HOH 372 1375 2094 HOH HOH B . 
J 8 HOH 373 1376 2096 HOH HOH B . 
J 8 HOH 374 1377 2097 HOH HOH B . 
J 8 HOH 375 1378 2098 HOH HOH B . 
J 8 HOH 376 1379 2099 HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9190  ? 
1 MORE         -57   ? 
1 'SSA (A^2)'  28020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 OD2 ? B ASP 297 ? B ASP 797  ? 1_555 56.1  ? 
2  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 88.8  ? 
3  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 101.9 ? 
4  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 88.4  ? 
5  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 123.7 ? 
6  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 121.4 ? 
7  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 N33 ? H U49 .   ? B U49 1003 ? 1_555 153.8 ? 
8  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 N33 ? H U49 .   ? B U49 1003 ? 1_555 97.8  ? 
9  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 N33 ? H U49 .   ? B U49 1003 ? 1_555 99.4  ? 
10 NE2 ? B HIS 362 ? B HIS 862 ? 1_555 ZN ? F ZN . ? B ZN 1001 ? 1_555 N33 ? H U49 .   ? B U49 1003 ? 1_555 107.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-19 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Database references'       
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Non-polymer description'   
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' entity_name_com               
6  4 'Structure model' pdbx_branch_scheme            
7  4 'Structure model' pdbx_chem_comp_identifier     
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_molecule_features        
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_conn_angle        
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_conn_type              
19 4 'Structure model' struct_ref_seq_dif            
20 4 'Structure model' struct_site                   
21 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_asym_id'                    
10 4 'Structure model' '_atom_site.label_atom_id'                    
11 4 'Structure model' '_atom_site.label_comp_id'                    
12 4 'Structure model' '_atom_site.label_entity_id'                  
13 4 'Structure model' '_atom_site.type_symbol'                      
14 4 'Structure model' '_chem_comp.formula'                          
15 4 'Structure model' '_chem_comp.formula_weight'                   
16 4 'Structure model' '_chem_comp.id'                               
17 4 'Structure model' '_chem_comp.mon_nstd_flag'                    
18 4 'Structure model' '_chem_comp.name'                             
19 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
20 4 'Structure model' '_chem_comp.type'                             
21 4 'Structure model' '_entity.formula_weight'                      
22 4 'Structure model' '_entity.pdbx_description'                    
23 4 'Structure model' '_entity.pdbx_number_of_molecules'            
24 4 'Structure model' '_entity.src_method'                          
25 4 'Structure model' '_entity.type'                                
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
34 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
35 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
36 4 'Structure model' '_pdbx_struct_conn_angle.value'               
37 4 'Structure model' '_struct_asym.entity_id'                      
38 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.37 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -14.93 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 88  ? ? 39.00   43.12   
2  1 LYS A 164 ? ? -100.89 76.65   
3  1 LEU A 215 ? ? -107.22 59.46   
4  1 THR A 247 ? ? -108.74 -85.09  
5  1 SER A 305 ? ? -98.90  -82.93  
6  1 HIS A 306 ? ? -69.85  32.58   
7  1 SER A 307 ? ? -56.75  178.64  
8  1 SER A 308 ? ? 159.40  164.51  
9  1 GLU A 347 ? ? -131.53 -52.03  
10 1 ASP A 349 ? ? -152.05 51.45   
11 1 ASN B 565 ? ? 58.54   -121.79 
12 1 SER B 599 ? ? -144.10 32.62   
13 1 SER B 826 ? ? -145.01 -18.30  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C17 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    U49 
_pdbx_validate_chiral.auth_seq_id     1003 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A VAL 7   ? A VAL 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A ALA 11  ? A ALA 11  
12 1 Y 1 A GLN 12  ? A GLN 12  
13 1 Y 1 A GLY 13  ? A GLY 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A PRO 19  ? A PRO 19  
20 1 Y 1 A ALA 20  ? A ALA 20  
21 1 Y 1 A GLN 21  ? A GLN 21  
22 1 Y 1 A PRO 22  ? A PRO 22  
23 1 Y 1 A PRO 23  ? A PRO 23  
24 1 Y 1 A PRO 24  ? A PRO 24  
25 1 Y 1 A GLN 25  ? A GLN 25  
26 1 Y 1 A PRO 26  ? A PRO 26  
27 1 Y 1 A HIS 27  ? A HIS 27  
28 1 Y 1 A PRO 28  ? A PRO 28  
29 1 Y 1 A PRO 29  ? A PRO 29  
30 1 Y 1 A PRO 30  ? A PRO 30  
31 1 Y 1 A PRO 31  ? A PRO 31  
32 1 Y 1 A GLN 32  ? A GLN 32  
33 1 Y 1 A GLN 33  ? A GLN 33  
34 1 Y 1 A GLN 34  ? A GLN 34  
35 1 Y 1 A HIS 35  ? A HIS 35  
36 1 Y 1 A LYS 36  ? A LYS 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A GLU 38  ? A GLU 38  
39 1 Y 1 A MET 39  ? A MET 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A GLU 42  ? A GLU 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLY 44  ? A GLY 44  
45 1 Y 1 A GLU 45  ? A GLU 45  
46 1 Y 1 A ALA 46  ? A ALA 46  
47 1 Y 1 A VAL 47  ? A VAL 47  
48 1 Y 1 A ALA 48  ? A ALA 48  
49 1 Y 1 A SER 49  ? A SER 49  
50 1 Y 1 A PRO 50  ? A PRO 50  
51 1 Y 1 A MET 51  ? A MET 51  
52 1 Y 1 A ASP 52  ? A ASP 52  
53 1 Y 1 A ASP 53  ? A ASP 53  
54 1 Y 1 A GLY 54  ? A GLY 54  
55 1 Y 1 A SER 368 ? A SER 368 
56 1 Y 1 A THR 369 ? A THR 369 
57 1 Y 1 A GLU 370 ? A GLU 370 
58 1 Y 1 A ASN 371 ? A ASN 371 
59 1 Y 1 A ASP 372 ? A ASP 372 
60 1 Y 1 A SER 373 ? A SER 373 
61 1 Y 1 A PRO 374 ? A PRO 374 
62 1 Y 1 A THR 375 ? A THR 375 
63 1 Y 1 A ASN 376 ? A ASN 376 
64 1 Y 1 A VAL 377 ? A VAL 377 
65 1 Y 1 A GLN 378 ? A GLN 378 
66 1 Y 1 A GLN 379 ? A GLN 379 
67 1 Y 1 A GLU 380 ? A GLU 380 
68 1 Y 1 A GLU 381 ? A GLU 381 
69 1 Y 1 A PHE 382 ? A PHE 382 
70 1 Y 1 B MET 501 ? B MET 1   
71 1 Y 1 B ALA 502 ? B ALA 2   
72 1 Y 1 B SER 503 ? B SER 3   
73 1 Y 1 B PRO 504 ? B PRO 4   
74 1 Y 1 B SER 505 ? B SER 5   
75 1 Y 1 B SER 506 ? B SER 6   
76 1 Y 1 B PHE 507 ? B PHE 7   
77 1 Y 1 B THR 508 ? B THR 8   
78 1 Y 1 B TYR 509 ? B TYR 9   
79 1 Y 1 B TYR 510 ? B TYR 10  
80 1 Y 1 B CYS 511 ? B CYS 11  
81 1 Y 1 B PRO 512 ? B PRO 12  
82 1 Y 1 B PRO 513 ? B PRO 13  
83 1 Y 1 B SER 514 ? B SER 14  
84 1 Y 1 B SER 515 ? B SER 15  
85 1 Y 1 B SER 516 ? B SER 16  
86 1 Y 1 B GLU 924 ? B GLU 424 
87 1 Y 1 B GLU 925 ? B GLU 425 
88 1 Y 1 B LEU 926 ? B LEU 426 
89 1 Y 1 B LYS 927 ? B LYS 427 
90 1 Y 1 B ASP 928 ? B ASP 428 
91 1 Y 1 B GLU 929 ? B GLU 429 
92 1 Y 1 B THR 930 ? B THR 430 
93 1 Y 1 B SER 931 ? B SER 431 
94 1 Y 1 B ALA 932 ? B ALA 432 
95 1 Y 1 B GLU 933 ? B GLU 433 
96 1 Y 1 B PRO 934 ? B PRO 434 
97 1 Y 1 B ALA 935 ? B ALA 435 
98 1 Y 1 B THR 936 ? B THR 436 
99 1 Y 1 B ASP 937 ? B ASP 437 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 GLC 1 C GLC 1 ? SUC 901 n 
C 3 FRU 2 C FRU 2 ? SUC 901 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 GLC 1 n 
3 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ACETIC ACID' ACY 
5 'ZINC ION' ZN  
6 'FARNESYL DIPHOSPHATE' FPP 
7 
;(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRI AZA-CYCLOOCTADECOSINE-9-CARBONITRILE
;
U49 
8 water HOH 
#