data_1LE9
# 
_entry.id   1LE9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LE9         
NDB   PD0309       
RCSB  RCSB015874   
WWPDB D_1000015874 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VKX 
;1VKX contains the same protein and   
Ig-kB DNA
;
unspecified 
PDB 1LE5 'CRYSTAL STRUCTURE OF A NF-KB HETERODIMER BOUND TO AN IFNB-KB'                                   unspecified 
PDB 1LEI 'The kB DNA sequence from the HIV-LTR functions as an allosteric regulator of HIV transcription' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LE9 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Benjamin, B.'    1 
'Huang, D.B.'     2 
'Chen-Park, F.E.' 3 
'Sigler, P.B.'    4 
'Ghosh, G.'       5 
# 
_citation.id                        primary 
_citation.title                     
'The x-ray crystal structure of the NF-kappa B p50.p65 heterodimer bound to the interferon beta -kappa B site.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                24694 
_citation.page_last                 24700 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11970948 
_citation.pdbx_database_id_DOI      10.1074/jbc.M200006200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Berkowitz, B.'   1 
primary 'Huang, D.B.'     2 
primary 'Chen-Park, F.E.' 3 
primary 'Sigler, P.B.'    4 
primary 'Ghosh, G.'       5 
# 
_cell.entry_id           1LE9 
_cell.length_a           137.835 
_cell.length_b           138.002 
_cell.length_c           90.044 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.28 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LE9 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*TP*GP*GP*GP*AP*CP*TP*TP*TP*CP*CP*T)-3'" 3644.376  2 ? ? ?         'Ig/HIV2-kB DNA' 
2 polymer syn "5'-D(*AP*AP*GP*GP*AP*AP*AP*GP*TP*CP*CP*C)-3'" 3680.432  2 ? ? ?         'Ig/HIV2-kB DNA' 
3 polymer man 'NUCLEAR FACTOR NF-KAPPA-B P65 SUBUNIT'        31115.236 2 ? ? 'p65 RHR' ?                
4 polymer man 'NUCLEAR FACTOR NF-KAPPA-B P50 SUBUNIT'        35056.066 2 ? ? 'p50 RHR' ?                
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'NF-KB P65' 
4 'NF-KB P50' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DG)(DG)(DA)(DC)(DT)(DT)(DT)(DC)(DC)(DT)' TGGGACTTTCCT C,G ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DG)(DG)(DA)(DA)(DA)(DG)(DT)(DC)(DC)(DC)' AAGGAAAGTCCC D,H ? 
3 'polypeptide(L)'        no no 
;MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRD
GYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTP
VLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPY
ADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
;
;MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRD
GYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTP
VLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPY
ADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
;
A,E ? 
4 'polypeptide(L)'        no no 
;MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQA
AVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD
IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
;
;MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQA
AVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD
IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
;
B,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DT  n 
1 9   DT  n 
1 10  DC  n 
1 11  DC  n 
1 12  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DT  n 
2 10  DC  n 
2 11  DC  n 
2 12  DC  n 
3 1   MET n 
3 2   ALA n 
3 3   TYR n 
3 4   VAL n 
3 5   GLU n 
3 6   ILE n 
3 7   ILE n 
3 8   GLU n 
3 9   GLN n 
3 10  PRO n 
3 11  LYS n 
3 12  GLN n 
3 13  ARG n 
3 14  GLY n 
3 15  MET n 
3 16  ARG n 
3 17  PHE n 
3 18  ARG n 
3 19  TYR n 
3 20  LYS n 
3 21  CYS n 
3 22  GLU n 
3 23  GLY n 
3 24  ARG n 
3 25  SER n 
3 26  ALA n 
3 27  GLY n 
3 28  SER n 
3 29  ILE n 
3 30  PRO n 
3 31  GLY n 
3 32  GLU n 
3 33  ARG n 
3 34  SER n 
3 35  THR n 
3 36  ASP n 
3 37  THR n 
3 38  THR n 
3 39  LYS n 
3 40  THR n 
3 41  HIS n 
3 42  PRO n 
3 43  THR n 
3 44  ILE n 
3 45  LYS n 
3 46  ILE n 
3 47  ASN n 
3 48  GLY n 
3 49  TYR n 
3 50  THR n 
3 51  GLY n 
3 52  PRO n 
3 53  GLY n 
3 54  THR n 
3 55  VAL n 
3 56  ARG n 
3 57  ILE n 
3 58  SER n 
3 59  LEU n 
3 60  VAL n 
3 61  THR n 
3 62  LYS n 
3 63  ASP n 
3 64  PRO n 
3 65  PRO n 
3 66  HIS n 
3 67  ARG n 
3 68  PRO n 
3 69  HIS n 
3 70  PRO n 
3 71  HIS n 
3 72  GLU n 
3 73  LEU n 
3 74  VAL n 
3 75  GLY n 
3 76  LYS n 
3 77  ASP n 
3 78  CYS n 
3 79  ARG n 
3 80  ASP n 
3 81  GLY n 
3 82  TYR n 
3 83  TYR n 
3 84  GLU n 
3 85  ALA n 
3 86  ASP n 
3 87  LEU n 
3 88  CYS n 
3 89  PRO n 
3 90  ASP n 
3 91  ARG n 
3 92  SER n 
3 93  ILE n 
3 94  HIS n 
3 95  SER n 
3 96  PHE n 
3 97  GLN n 
3 98  ASN n 
3 99  LEU n 
3 100 GLY n 
3 101 ILE n 
3 102 GLN n 
3 103 CYS n 
3 104 VAL n 
3 105 LYS n 
3 106 LYS n 
3 107 ARG n 
3 108 ASP n 
3 109 LEU n 
3 110 GLU n 
3 111 GLN n 
3 112 ALA n 
3 113 ILE n 
3 114 SER n 
3 115 GLN n 
3 116 ARG n 
3 117 ILE n 
3 118 GLN n 
3 119 THR n 
3 120 ASN n 
3 121 ASN n 
3 122 ASN n 
3 123 PRO n 
3 124 PHE n 
3 125 HIS n 
3 126 VAL n 
3 127 PRO n 
3 128 ILE n 
3 129 GLU n 
3 130 GLU n 
3 131 GLN n 
3 132 ARG n 
3 133 GLY n 
3 134 ASP n 
3 135 TYR n 
3 136 ASP n 
3 137 LEU n 
3 138 ASN n 
3 139 ALA n 
3 140 VAL n 
3 141 ARG n 
3 142 LEU n 
3 143 CYS n 
3 144 PHE n 
3 145 GLN n 
3 146 VAL n 
3 147 THR n 
3 148 VAL n 
3 149 ARG n 
3 150 ASP n 
3 151 PRO n 
3 152 ALA n 
3 153 GLY n 
3 154 ARG n 
3 155 PRO n 
3 156 LEU n 
3 157 LEU n 
3 158 LEU n 
3 159 THR n 
3 160 PRO n 
3 161 VAL n 
3 162 LEU n 
3 163 SER n 
3 164 HIS n 
3 165 PRO n 
3 166 ILE n 
3 167 PHE n 
3 168 ASP n 
3 169 ASN n 
3 170 ARG n 
3 171 ALA n 
3 172 PRO n 
3 173 ASN n 
3 174 THR n 
3 175 ALA n 
3 176 GLU n 
3 177 LEU n 
3 178 LYS n 
3 179 ILE n 
3 180 CYS n 
3 181 ARG n 
3 182 VAL n 
3 183 ASN n 
3 184 ARG n 
3 185 ASN n 
3 186 SER n 
3 187 GLY n 
3 188 SER n 
3 189 CYS n 
3 190 LEU n 
3 191 GLY n 
3 192 GLY n 
3 193 ASP n 
3 194 GLU n 
3 195 ILE n 
3 196 PHE n 
3 197 LEU n 
3 198 LEU n 
3 199 CYS n 
3 200 ASP n 
3 201 LYS n 
3 202 VAL n 
3 203 GLN n 
3 204 LYS n 
3 205 GLU n 
3 206 ASP n 
3 207 ILE n 
3 208 GLU n 
3 209 VAL n 
3 210 TYR n 
3 211 PHE n 
3 212 THR n 
3 213 GLY n 
3 214 PRO n 
3 215 GLY n 
3 216 TRP n 
3 217 GLU n 
3 218 ALA n 
3 219 ARG n 
3 220 GLY n 
3 221 SER n 
3 222 PHE n 
3 223 SER n 
3 224 GLN n 
3 225 ALA n 
3 226 ASP n 
3 227 VAL n 
3 228 HIS n 
3 229 ARG n 
3 230 GLN n 
3 231 VAL n 
3 232 ALA n 
3 233 ILE n 
3 234 VAL n 
3 235 PHE n 
3 236 ARG n 
3 237 THR n 
3 238 PRO n 
3 239 PRO n 
3 240 TYR n 
3 241 ALA n 
3 242 ASP n 
3 243 PRO n 
3 244 SER n 
3 245 LEU n 
3 246 GLN n 
3 247 ALA n 
3 248 PRO n 
3 249 VAL n 
3 250 ARG n 
3 251 VAL n 
3 252 SER n 
3 253 MET n 
3 254 GLN n 
3 255 LEU n 
3 256 ARG n 
3 257 ARG n 
3 258 PRO n 
3 259 SER n 
3 260 ASP n 
3 261 ARG n 
3 262 GLU n 
3 263 LEU n 
3 264 SER n 
3 265 GLU n 
3 266 PRO n 
3 267 MET n 
3 268 GLU n 
3 269 PHE n 
3 270 GLN n 
3 271 TYR n 
3 272 LEU n 
3 273 PRO n 
3 274 ASP n 
4 1   MET n 
4 2   GLY n 
4 3   PRO n 
4 4   TYR n 
4 5   LEU n 
4 6   GLN n 
4 7   ILE n 
4 8   LEU n 
4 9   GLU n 
4 10  GLN n 
4 11  PRO n 
4 12  LYS n 
4 13  GLN n 
4 14  ARG n 
4 15  GLY n 
4 16  PHE n 
4 17  ARG n 
4 18  PHE n 
4 19  ARG n 
4 20  TYR n 
4 21  VAL n 
4 22  CYS n 
4 23  GLU n 
4 24  GLY n 
4 25  PRO n 
4 26  SER n 
4 27  HIS n 
4 28  GLY n 
4 29  GLY n 
4 30  LEU n 
4 31  PRO n 
4 32  GLY n 
4 33  ALA n 
4 34  SER n 
4 35  SER n 
4 36  GLU n 
4 37  LYS n 
4 38  ASN n 
4 39  LYS n 
4 40  LYS n 
4 41  SER n 
4 42  TYR n 
4 43  PRO n 
4 44  GLN n 
4 45  VAL n 
4 46  LYS n 
4 47  ILE n 
4 48  CYS n 
4 49  ASN n 
4 50  TYR n 
4 51  VAL n 
4 52  GLY n 
4 53  PRO n 
4 54  ALA n 
4 55  LYS n 
4 56  VAL n 
4 57  ILE n 
4 58  VAL n 
4 59  GLN n 
4 60  LEU n 
4 61  VAL n 
4 62  THR n 
4 63  ASN n 
4 64  GLY n 
4 65  LYS n 
4 66  ASN n 
4 67  ILE n 
4 68  HIS n 
4 69  LEU n 
4 70  HIS n 
4 71  ALA n 
4 72  HIS n 
4 73  SER n 
4 74  LEU n 
4 75  VAL n 
4 76  GLY n 
4 77  LYS n 
4 78  HIS n 
4 79  CYS n 
4 80  GLU n 
4 81  ASP n 
4 82  GLY n 
4 83  VAL n 
4 84  CYS n 
4 85  THR n 
4 86  VAL n 
4 87  THR n 
4 88  ALA n 
4 89  GLY n 
4 90  PRO n 
4 91  LYS n 
4 92  ASP n 
4 93  MET n 
4 94  VAL n 
4 95  VAL n 
4 96  GLY n 
4 97  PHE n 
4 98  ALA n 
4 99  ASN n 
4 100 LEU n 
4 101 GLY n 
4 102 ILE n 
4 103 LEU n 
4 104 HIS n 
4 105 VAL n 
4 106 THR n 
4 107 LYS n 
4 108 LYS n 
4 109 LYS n 
4 110 VAL n 
4 111 PHE n 
4 112 GLU n 
4 113 THR n 
4 114 LEU n 
4 115 GLU n 
4 116 ALA n 
4 117 ARG n 
4 118 MET n 
4 119 THR n 
4 120 GLU n 
4 121 ALA n 
4 122 CYS n 
4 123 ILE n 
4 124 ARG n 
4 125 GLY n 
4 126 TYR n 
4 127 ASN n 
4 128 PRO n 
4 129 GLY n 
4 130 LEU n 
4 131 LEU n 
4 132 VAL n 
4 133 HIS n 
4 134 SER n 
4 135 ASP n 
4 136 LEU n 
4 137 ALA n 
4 138 TYR n 
4 139 LEU n 
4 140 GLN n 
4 141 ALA n 
4 142 GLU n 
4 143 GLY n 
4 144 GLY n 
4 145 GLY n 
4 146 ASP n 
4 147 ARG n 
4 148 GLN n 
4 149 LEU n 
4 150 THR n 
4 151 ASP n 
4 152 ARG n 
4 153 GLU n 
4 154 LYS n 
4 155 GLU n 
4 156 ILE n 
4 157 ILE n 
4 158 ARG n 
4 159 GLN n 
4 160 ALA n 
4 161 ALA n 
4 162 VAL n 
4 163 GLN n 
4 164 GLN n 
4 165 THR n 
4 166 LYS n 
4 167 GLU n 
4 168 MET n 
4 169 ASP n 
4 170 LEU n 
4 171 SER n 
4 172 VAL n 
4 173 VAL n 
4 174 ARG n 
4 175 LEU n 
4 176 MET n 
4 177 PHE n 
4 178 THR n 
4 179 ALA n 
4 180 PHE n 
4 181 LEU n 
4 182 PRO n 
4 183 ASP n 
4 184 SER n 
4 185 THR n 
4 186 GLY n 
4 187 SER n 
4 188 PHE n 
4 189 THR n 
4 190 ARG n 
4 191 ARG n 
4 192 LEU n 
4 193 GLU n 
4 194 PRO n 
4 195 VAL n 
4 196 VAL n 
4 197 SER n 
4 198 ASP n 
4 199 ALA n 
4 200 ILE n 
4 201 TYR n 
4 202 ASP n 
4 203 SER n 
4 204 LYS n 
4 205 ALA n 
4 206 PRO n 
4 207 ASN n 
4 208 ALA n 
4 209 SER n 
4 210 ASN n 
4 211 LEU n 
4 212 LYS n 
4 213 ILE n 
4 214 VAL n 
4 215 ARG n 
4 216 MET n 
4 217 ASP n 
4 218 ARG n 
4 219 THR n 
4 220 ALA n 
4 221 GLY n 
4 222 CYS n 
4 223 VAL n 
4 224 THR n 
4 225 GLY n 
4 226 GLY n 
4 227 GLU n 
4 228 GLU n 
4 229 ILE n 
4 230 TYR n 
4 231 LEU n 
4 232 LEU n 
4 233 CYS n 
4 234 ASP n 
4 235 LYS n 
4 236 VAL n 
4 237 GLN n 
4 238 LYS n 
4 239 ASP n 
4 240 ASP n 
4 241 ILE n 
4 242 GLN n 
4 243 ILE n 
4 244 ARG n 
4 245 PHE n 
4 246 TYR n 
4 247 GLU n 
4 248 GLU n 
4 249 GLU n 
4 250 GLU n 
4 251 ASN n 
4 252 GLY n 
4 253 GLY n 
4 254 VAL n 
4 255 TRP n 
4 256 GLU n 
4 257 GLY n 
4 258 PHE n 
4 259 GLY n 
4 260 ASP n 
4 261 PHE n 
4 262 SER n 
4 263 PRO n 
4 264 THR n 
4 265 ASP n 
4 266 VAL n 
4 267 HIS n 
4 268 ARG n 
4 269 GLN n 
4 270 PHE n 
4 271 ALA n 
4 272 ILE n 
4 273 VAL n 
4 274 PHE n 
4 275 LYS n 
4 276 THR n 
4 277 PRO n 
4 278 LYS n 
4 279 TYR n 
4 280 LYS n 
4 281 ASP n 
4 282 VAL n 
4 283 ASN n 
4 284 ILE n 
4 285 THR n 
4 286 LYS n 
4 287 PRO n 
4 288 ALA n 
4 289 SER n 
4 290 VAL n 
4 291 PHE n 
4 292 VAL n 
4 293 GLN n 
4 294 LEU n 
4 295 ARG n 
4 296 ARG n 
4 297 LYS n 
4 298 SER n 
4 299 ASP n 
4 300 LEU n 
4 301 GLU n 
4 302 THR n 
4 303 SER n 
4 304 GLU n 
4 305 PRO n 
4 306 LYS n 
4 307 PRO n 
4 308 PHE n 
4 309 LEU n 
4 310 TYR n 
4 311 TYR n 
4 312 PRO n 
4 313 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? 'house mouse' Mus rela  ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? 't7 promoter' ? ? ? pET29b ? ? 
4 1 sample ? ? ? 'house mouse' Mus nfkb1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? 't7 promoter' ? ? ? pET29b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP TF65_MOUSE  Q04207 3 20 ? ? 
2 UNP NFKB1_MOUSE P25799 4 39 ? ? 
3 PDB 1LE9        1LE9   1 ?  ? ? 
4 PDB 1LE9        1LE9   2 ?  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LE9 A 3 ? 274 ? Q04207 20  ? 291 ? 20  291 
2 2 1LE9 B 2 ? 313 ? P25799 39  ? 350 ? 39  350 
3 1 1LE9 E 3 ? 274 ? Q04207 20  ? 291 ? 20  291 
4 2 1LE9 F 2 ? 313 ? P25799 39  ? 350 ? 39  350 
5 3 1LE9 C 1 ? 12  ? 1LE9   701 ? 712 ? 701 712 
6 4 1LE9 D 1 ? 12  ? 1LE9   713 ? 724 ? 713 724 
7 3 1LE9 G 1 ? 12  ? 1LE9   801 ? 812 ? 801 812 
8 4 1LE9 H 1 ? 12  ? 1LE9   813 ? 824 ? 813 824 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LE9 MET A 1 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 18 1 
1 1LE9 ALA A 2 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 19 2 
3 1LE9 MET E 1 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 18 3 
3 1LE9 ALA E 2 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 19 4 
2 1LE9 MET B 1 ? UNP P25799 ? ? 'INITIATING MET'   38 5 
4 1LE9 MET F 1 ? UNP P25799 ? ? 'INITIATING MET'   38 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1LE9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.density_percent_sol   57.24 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, CaCl2, Na acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 110K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 3350'   ? ? ? 
1 2 1 CaCl2        ? ? ? 
1 3 1 'Na(C2H3O2)' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-09-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1LE9 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   33446 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.1 
_reflns_shell.percent_possible_all   98 
_reflns_shell.Rmerge_I_obs           0.43 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LE9 
_refine.ls_number_reflns_obs                     28493 
_refine.ls_number_reflns_all                     31118 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    85.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.249 
_refine.ls_R_factor_R_free                       0.305 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1704 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VKX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9260 
_refine_hist.pdbx_number_atoms_nucleic_acid   972 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10232 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.39  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LE9 
_struct.title                     'Crystal structure of a NF-kB heterodimer bound to the Ig/HIV-kB siti' 
_struct.pdbx_descriptor           'NUCLEAR FACTOR NF-KAPPA-B P65 SUBUNIT/NUCLEAR FACTOR NF-KAPPA-B P50 SUBUNIT/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LE9 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'transcription factor, NF-kB-DNA complex, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU E 109 ? THR E 119 ? LEU A 126 THR A 136 1 ? 11 
HELX_P HELX_P2  2  PRO E 127 ? GLN E 131 ? PRO A 144 GLN A 148 5 ? 5  
HELX_P HELX_P3  3  GLN E 203 ? ILE E 207 ? GLN A 220 ILE A 224 5 ? 5  
HELX_P HELX_P4  4  SER E 223 ? ALA E 225 ? SER A 240 ALA A 242 5 ? 3  
HELX_P HELX_P5  5  TYR F 20  ? GLY F 24  ? TYR B 57  GLY B 61  5 ? 5  
HELX_P HELX_P6  6  LYS F 109 ? GLU F 120 ? LYS B 146 GLU B 157 1 ? 12 
HELX_P HELX_P7  7  LEU F 149 ? GLN F 164 ? LEU B 186 GLN B 201 1 ? 16 
HELX_P HELX_P8  8  SER F 262 ? THR F 264 ? SER B 299 THR B 301 5 ? 3  
HELX_P HELX_P9  9  LEU G 109 ? GLN G 118 ? LEU E 126 GLN E 135 1 ? 10 
HELX_P HELX_P10 10 PRO G 127 ? GLN G 131 ? PRO E 144 GLN E 148 5 ? 5  
HELX_P HELX_P11 11 GLN G 203 ? ILE G 207 ? GLN E 220 ILE E 224 5 ? 5  
HELX_P HELX_P12 12 SER G 223 ? VAL G 227 ? SER E 240 VAL E 244 5 ? 5  
HELX_P HELX_P13 13 TYR H 20  ? GLY H 24  ? TYR F 57  GLY F 61  5 ? 5  
HELX_P HELX_P14 14 LYS H 108 ? GLU H 120 ? LYS F 145 GLU F 157 1 ? 13 
HELX_P HELX_P15 15 LEU H 149 ? GLN H 164 ? LEU F 186 GLN F 201 1 ? 16 
HELX_P HELX_P16 16 ALA H 205 ? SER H 209 ? ALA F 242 SER F 246 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? F CYS 79 SG ? ? ? 1_555 F CYS 84 SG ? ? B CYS 116 B CYS 121 1_555 ? ? ? ? ? ? ?               2.034 ? 
disulf2  disulf ? ? H CYS 79 SG ? ? ? 1_555 H CYS 84 SG ? ? F CYS 116 F CYS 121 1_555 ? ? ? ? ? ? ?               2.028 ? 
hydrog1  hydrog ? ? A DT  1  O4 ? ? ? 1_555 B DC  12 N4 ? ? C DT  701 D DC  724 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog2  hydrog ? ? A DG  2  N1 ? ? ? 1_555 B DC  12 N3 ? ? C DG  702 D DC  724 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? A DG  2  N2 ? ? ? 1_555 B DC  12 O2 ? ? C DG  702 D DC  724 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? A DG  2  O6 ? ? ? 1_555 B DC  12 N4 ? ? C DG  702 D DC  724 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? A DG  3  N1 ? ? ? 1_555 B DC  11 N3 ? ? C DG  703 D DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? A DG  3  N2 ? ? ? 1_555 B DC  11 O2 ? ? C DG  703 D DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? A DG  3  O6 ? ? ? 1_555 B DC  11 N4 ? ? C DG  703 D DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? A DG  4  N1 ? ? ? 1_555 B DC  10 N3 ? ? C DG  704 D DC  722 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? A DG  4  N2 ? ? ? 1_555 B DC  10 O2 ? ? C DG  704 D DC  722 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? A DG  4  O6 ? ? ? 1_555 B DC  10 N4 ? ? C DG  704 D DC  722 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? A DA  5  N1 ? ? ? 1_555 B DT  9  N3 ? ? C DA  705 D DT  721 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? A DA  5  N6 ? ? ? 1_555 B DT  9  O4 ? ? C DA  705 D DT  721 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? A DC  6  N3 ? ? ? 1_555 B DG  8  N1 ? ? C DC  706 D DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? A DC  6  N4 ? ? ? 1_555 B DG  8  O6 ? ? C DC  706 D DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? A DC  6  O2 ? ? ? 1_555 B DG  8  N2 ? ? C DC  706 D DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? A DT  7  N3 ? ? ? 1_555 B DA  7  N1 ? ? C DT  707 D DA  719 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? A DT  7  O4 ? ? ? 1_555 B DA  7  N6 ? ? C DT  707 D DA  719 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? A DT  8  N3 ? ? ? 1_555 B DA  6  N1 ? ? C DT  708 D DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? A DT  8  O4 ? ? ? 1_555 B DA  6  N6 ? ? C DT  708 D DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? A DT  9  N3 ? ? ? 1_555 B DA  5  N1 ? ? C DT  709 D DA  717 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? A DT  9  O4 ? ? ? 1_555 B DA  5  N6 ? ? C DT  709 D DA  717 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? A DC  10 N3 ? ? ? 1_555 B DG  4  N1 ? ? C DC  710 D DG  716 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? A DC  10 N4 ? ? ? 1_555 B DG  4  O6 ? ? C DC  710 D DG  716 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? A DC  10 O2 ? ? ? 1_555 B DG  4  N2 ? ? C DC  710 D DG  716 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? A DC  11 N3 ? ? ? 1_555 B DG  3  N1 ? ? C DC  711 D DG  715 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? A DC  11 N4 ? ? ? 1_555 B DG  3  O6 ? ? C DC  711 D DG  715 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? A DC  11 O2 ? ? ? 1_555 B DG  3  N2 ? ? C DC  711 D DG  715 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? A DT  12 N3 ? ? ? 1_555 B DA  2  N1 ? ? C DT  712 D DA  714 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? A DT  12 O4 ? ? ? 1_555 B DA  2  N6 ? ? C DT  712 D DA  714 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? C DG  4  N2 ? ? ? 1_555 D DC  11 N3 ? ? G DG  804 H DC  823 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog31 hydrog ? ? C DT  7  N3 ? ? ? 1_555 D DA  7  N1 ? ? G DT  807 H DA  819 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? C DT  7  O4 ? ? ? 1_555 D DA  7  N6 ? ? G DT  807 H DA  819 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 5 ? 
F ? 4 ? 
G ? 2 ? 
H ? 4 ? 
I ? 3 ? 
J ? 4 ? 
K ? 5 ? 
L ? 2 ? 
M ? 2 ? 
N ? 2 ? 
O ? 3 ? 
P ? 3 ? 
Q ? 5 ? 
R ? 4 ? 
S ? 4 ? 
T ? 3 ? 
U ? 4 ? 
V ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? parallel      
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
V 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU E 5   ? ILE E 6   ? GLU A 22  ILE A 23  
A 2 THR E 43  ? LYS E 45  ? THR A 60  LYS A 62  
A 3 HIS E 94  ? SER E 95  ? HIS A 111 SER A 112 
B 1 ALA E 85  ? LEU E 87  ? ALA A 102 LEU A 104 
B 2 GLY E 53  ? VAL E 60  ? GLY A 70  VAL A 77  
B 3 ALA E 139 ? VAL E 148 ? ALA A 156 VAL A 165 
B 4 LEU E 156 ? LEU E 157 ? LEU A 173 LEU A 174 
C 1 ALA E 85  ? LEU E 87  ? ALA A 102 LEU A 104 
C 2 GLY E 53  ? VAL E 60  ? GLY A 70  VAL A 77  
C 3 ALA E 139 ? VAL E 148 ? ALA A 156 VAL A 165 
C 4 LEU E 162 ? PHE E 167 ? LEU A 179 PHE A 184 
D 1 ILE E 179 ? VAL E 182 ? ILE A 196 VAL A 199 
D 2 GLU E 194 ? CYS E 199 ? GLU A 211 CYS A 216 
D 3 ALA E 232 ? ARG E 236 ? ALA A 249 ARG A 253 
D 4 VAL E 227 ? HIS E 228 ? VAL A 244 HIS A 245 
E 1 SER E 186 ? SER E 188 ? SER A 203 SER A 205 
E 2 MET E 267 ? LEU E 272 ? MET A 284 LEU A 289 
E 3 VAL E 249 ? ARG E 257 ? VAL A 266 ARG A 274 
E 4 GLU E 208 ? PHE E 211 ? GLU A 225 PHE A 228 
E 5 ALA E 218 ? ARG E 219 ? ALA A 235 ARG A 236 
F 1 SER E 186 ? SER E 188 ? SER A 203 SER A 205 
F 2 MET E 267 ? LEU E 272 ? MET A 284 LEU A 289 
F 3 VAL E 249 ? ARG E 257 ? VAL A 266 ARG A 274 
F 4 GLU E 262 ? LEU E 263 ? GLU A 279 LEU A 280 
G 1 LEU F 5   ? GLU F 9   ? LEU B 42  GLU B 46  
G 2 GLN F 44  ? ILE F 47  ? GLN B 81  ILE B 84  
H 1 PHE F 188 ? VAL F 196 ? PHE B 225 VAL B 233 
H 2 VAL F 172 ? PRO F 182 ? VAL B 209 PRO B 219 
H 3 ALA F 54  ? VAL F 61  ? ALA B 91  VAL B 98  
H 4 THR F 85  ? ALA F 88  ? THR B 122 ALA B 125 
I 1 PHE F 188 ? VAL F 196 ? PHE B 225 VAL B 233 
I 2 VAL F 172 ? PRO F 182 ? VAL B 209 PRO B 219 
I 3 ILE F 200 ? TYR F 201 ? ILE B 237 TYR B 238 
J 1 ILE F 213 ? MET F 216 ? ILE B 250 MET B 253 
J 2 GLU F 228 ? CYS F 233 ? GLU B 265 CYS B 270 
J 3 ALA F 271 ? LYS F 275 ? ALA B 308 LYS B 312 
J 4 VAL F 266 ? HIS F 267 ? VAL B 303 HIS B 304 
K 1 ALA F 220 ? CYS F 222 ? ALA B 257 CYS B 259 
K 2 LYS F 306 ? TYR F 311 ? LYS B 343 TYR B 348 
K 3 ALA F 288 ? ARG F 296 ? ALA B 325 ARG B 333 
K 4 ILE F 241 ? TYR F 246 ? ILE B 278 TYR B 283 
K 5 GLU F 256 ? PHE F 258 ? GLU B 293 PHE B 295 
L 1 ARG G 13  ? MET G 15  ? ARG E 30  MET E 32  
L 2 PHE G 167 ? ASP G 168 ? PHE E 184 ASP E 185 
M 1 THR G 43  ? ILE G 44  ? THR E 60  ILE E 61  
M 2 HIS G 94  ? SER G 95  ? HIS E 111 SER E 112 
N 1 THR G 54  ? VAL G 55  ? THR E 71  VAL E 72  
N 2 VAL G 146 ? THR G 147 ? VAL E 163 THR E 164 
O 1 SER G 58  ? LEU G 59  ? SER E 75  LEU E 76  
O 2 LEU G 142 ? PHE G 144 ? LEU E 159 PHE E 161 
O 3 VAL G 161 ? LEU G 162 ? VAL E 178 LEU E 179 
P 1 ILE G 179 ? VAL G 182 ? ILE E 196 VAL E 199 
P 2 GLU G 194 ? CYS G 199 ? GLU E 211 CYS E 216 
P 3 ALA G 232 ? ARG G 236 ? ALA E 249 ARG E 253 
Q 1 SER G 186 ? SER G 188 ? SER E 203 SER E 205 
Q 2 MET G 267 ? LEU G 272 ? MET E 284 LEU E 289 
Q 3 VAL G 249 ? ARG G 257 ? VAL E 266 ARG E 274 
Q 4 GLU G 208 ? PHE G 211 ? GLU E 225 PHE E 228 
Q 5 ALA G 218 ? ARG G 219 ? ALA E 235 ARG E 236 
R 1 SER G 186 ? SER G 188 ? SER E 203 SER E 205 
R 2 MET G 267 ? LEU G 272 ? MET E 284 LEU E 289 
R 3 VAL G 249 ? ARG G 257 ? VAL E 266 ARG E 274 
R 4 GLU G 262 ? LEU G 263 ? GLU E 279 LEU E 280 
S 1 PHE H 188 ? VAL H 196 ? PHE F 225 VAL F 233 
S 2 VAL H 172 ? PRO H 182 ? VAL F 209 PRO F 219 
S 3 ALA H 54  ? VAL H 61  ? ALA F 91  VAL F 98  
S 4 THR H 85  ? ALA H 88  ? THR F 122 ALA F 125 
T 1 PHE H 188 ? VAL H 196 ? PHE F 225 VAL F 233 
T 2 VAL H 172 ? PRO H 182 ? VAL F 209 PRO F 219 
T 3 ILE H 200 ? TYR H 201 ? ILE F 237 TYR F 238 
U 1 ILE H 213 ? MET H 216 ? ILE F 250 MET F 253 
U 2 GLU H 228 ? CYS H 233 ? GLU F 265 CYS F 270 
U 3 ALA H 271 ? LYS H 275 ? ALA F 308 LYS F 312 
U 4 VAL H 266 ? HIS H 267 ? VAL F 303 HIS F 304 
V 1 ALA H 220 ? CYS H 222 ? ALA F 257 CYS F 259 
V 2 LYS H 306 ? TYR H 311 ? LYS F 343 TYR F 348 
V 3 ALA H 288 ? ARG H 296 ? ALA F 325 ARG F 333 
V 4 ILE H 241 ? TYR H 246 ? ILE F 278 TYR F 283 
V 5 GLU H 256 ? PHE H 258 ? GLU F 293 PHE F 295 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU E 5   ? N GLU A 22  O LYS E 45  ? O LYS A 62  
A 2 3 N ILE E 44  ? N ILE A 61  O HIS E 94  ? O HIS A 111 
B 1 2 O LEU E 87  ? O LEU A 104 N GLY E 53  ? N GLY A 70  
B 2 3 N VAL E 60  ? N VAL A 77  O ARG E 141 ? O ARG A 158 
B 3 4 N VAL E 148 ? N VAL A 165 O LEU E 156 ? O LEU A 173 
C 1 2 O LEU E 87  ? O LEU A 104 N GLY E 53  ? N GLY A 70  
C 2 3 N VAL E 60  ? N VAL A 77  O ARG E 141 ? O ARG A 158 
C 3 4 N LEU E 142 ? N LEU A 159 O SER E 163 ? O SER A 180 
D 1 2 N ARG E 181 ? N ARG A 198 O LEU E 198 ? O LEU A 215 
D 2 3 N LEU E 197 ? N LEU A 214 O ILE E 233 ? O ILE A 250 
D 3 4 O ALA E 232 ? O ALA A 249 N HIS E 228 ? N HIS A 245 
E 1 2 N GLY E 187 ? N GLY A 204 O LEU E 272 ? O LEU A 289 
E 2 3 O MET E 267 ? O MET A 284 N MET E 253 ? N MET A 270 
E 3 4 O ARG E 256 ? O ARG A 273 N GLU E 208 ? N GLU A 225 
E 4 5 N PHE E 211 ? N PHE A 228 O ALA E 218 ? O ALA A 235 
F 1 2 N GLY E 187 ? N GLY A 204 O LEU E 272 ? O LEU A 289 
F 2 3 O MET E 267 ? O MET A 284 N MET E 253 ? N MET A 270 
F 3 4 N ARG E 257 ? N ARG A 274 O GLU E 262 ? O GLU A 279 
G 1 2 N GLU F 9   ? N GLU B 46  O GLN F 44  ? O GLN B 81  
H 1 2 O LEU F 192 ? O LEU B 229 N ALA F 179 ? N ALA B 216 
H 2 3 O ARG F 174 ? O ARG B 211 N VAL F 61  ? N VAL B 98  
H 3 4 N VAL F 56  ? N VAL B 93  O VAL F 86  ? O VAL B 123 
I 1 2 O LEU F 192 ? O LEU B 229 N ALA F 179 ? N ALA B 216 
I 2 3 N VAL F 173 ? N VAL B 210 O ILE F 200 ? O ILE B 237 
J 1 2 N ARG F 215 ? N ARG B 252 O LEU F 232 ? O LEU B 269 
J 2 3 N LEU F 231 ? N LEU B 268 O ILE F 272 ? O ILE B 309 
J 3 4 N ALA F 271 ? N ALA B 308 O HIS F 267 ? O HIS B 304 
K 1 2 N GLY F 221 ? N GLY B 258 O TYR F 311 ? O TYR B 348 
K 2 3 O PHE F 308 ? O PHE B 345 N VAL F 290 ? N VAL B 327 
K 3 4 O GLN F 293 ? O GLN B 330 N ARG F 244 ? N ARG B 281 
K 4 5 N PHE F 245 ? N PHE B 282 O GLY F 257 ? O GLY B 294 
L 1 2 N MET G 15  ? N MET E 32  O PHE G 167 ? O PHE E 184 
M 1 2 N ILE G 44  ? N ILE E 61  O HIS G 94  ? O HIS E 111 
N 1 2 N THR G 54  ? N THR E 71  O THR G 147 ? O THR E 164 
O 1 2 N SER G 58  ? N SER E 75  O CYS G 143 ? O CYS E 160 
O 2 3 N PHE G 144 ? N PHE E 161 O VAL G 161 ? O VAL E 178 
P 1 2 N ARG G 181 ? N ARG E 198 O LEU G 198 ? O LEU E 215 
P 2 3 N LEU G 197 ? N LEU E 214 O ILE G 233 ? O ILE E 250 
Q 1 2 N GLY G 187 ? N GLY E 204 O LEU G 272 ? O LEU E 289 
Q 2 3 O MET G 267 ? O MET E 284 N MET G 253 ? N MET E 270 
Q 3 4 O GLN G 254 ? O GLN E 271 N TYR G 210 ? N TYR E 227 
Q 4 5 N PHE G 211 ? N PHE E 228 O ALA G 218 ? O ALA E 235 
R 1 2 N GLY G 187 ? N GLY E 204 O LEU G 272 ? O LEU E 289 
R 2 3 O MET G 267 ? O MET E 284 N MET G 253 ? N MET E 270 
R 3 4 N ARG G 257 ? N ARG E 274 O GLU G 262 ? O GLU E 279 
S 1 2 O LEU H 192 ? O LEU F 229 N ALA H 179 ? N ALA F 216 
S 2 3 O ARG H 174 ? O ARG F 211 N VAL H 61  ? N VAL F 98  
S 3 4 N VAL H 56  ? N VAL F 93  O VAL H 86  ? O VAL F 123 
T 1 2 O LEU H 192 ? O LEU F 229 N ALA H 179 ? N ALA F 216 
T 2 3 N VAL H 173 ? N VAL F 210 O ILE H 200 ? O ILE F 237 
U 1 2 N ARG H 215 ? N ARG F 252 O LEU H 232 ? O LEU F 269 
U 2 3 N LEU H 231 ? N LEU F 268 O ILE H 272 ? O ILE F 309 
U 3 4 N ALA H 271 ? N ALA F 308 O HIS H 267 ? O HIS F 304 
V 1 2 N GLY H 221 ? N GLY F 258 O TYR H 311 ? O TYR F 348 
V 2 3 O PHE H 308 ? O PHE F 345 N VAL H 290 ? N VAL F 327 
V 3 4 O GLN H 293 ? O GLN F 330 N ARG H 244 ? N ARG F 281 
V 4 5 N PHE H 245 ? N PHE F 282 O GLY H 257 ? O GLY F 294 
# 
_database_PDB_matrix.entry_id          1LE9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LE9 
_atom_sites.fract_transf_matrix[1][1]   0.007255 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000927 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007246 
_atom_sites.fract_transf_matrix[2][3]   -0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011196 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'" . DT  A 1 1   ? 64.266  34.611  -0.865  1.00 38.17  ? 701 DT  C "O5'" 1 
ATOM 2     C "C5'" . DT  A 1 1   ? 65.598  34.410  -0.391  1.00 40.96  ? 701 DT  C "C5'" 1 
ATOM 3     C "C4'" . DT  A 1 1   ? 65.792  32.984  0.059   1.00 39.96  ? 701 DT  C "C4'" 1 
ATOM 4     O "O4'" . DT  A 1 1   ? 67.139  32.821  0.553   1.00 39.25  ? 701 DT  C "O4'" 1 
ATOM 5     C "C3'" . DT  A 1 1   ? 64.880  32.532  1.198   1.00 38.05  ? 701 DT  C "C3'" 1 
ATOM 6     O "O3'" . DT  A 1 1   ? 64.562  31.156  1.020   1.00 37.26  ? 701 DT  C "O3'" 1 
ATOM 7     C "C2'" . DT  A 1 1   ? 65.750  32.696  2.427   1.00 39.81  ? 701 DT  C "C2'" 1 
ATOM 8     C "C1'" . DT  A 1 1   ? 67.102  32.317  1.878   1.00 39.76  ? 701 DT  C "C1'" 1 
ATOM 9     N N1    . DT  A 1 1   ? 68.266  32.856  2.611   1.00 58.36  ? 701 DT  C N1    1 
ATOM 10    C C2    . DT  A 1 1   ? 68.871  32.023  3.514   1.00 59.49  ? 701 DT  C C2    1 
ATOM 11    O O2    . DT  A 1 1   ? 68.449  30.907  3.772   1.00 61.16  ? 701 DT  C O2    1 
ATOM 12    N N3    . DT  A 1 1   ? 69.991  32.548  4.112   1.00 56.90  ? 701 DT  C N3    1 
ATOM 13    C C4    . DT  A 1 1   ? 70.537  33.792  3.905   1.00 55.03  ? 701 DT  C C4    1 
ATOM 14    O O4    . DT  A 1 1   ? 71.551  34.120  4.500   1.00 57.93  ? 701 DT  C O4    1 
ATOM 15    C C5    . DT  A 1 1   ? 69.840  34.619  2.970   1.00 55.49  ? 701 DT  C C5    1 
ATOM 16    C C7    . DT  A 1 1   ? 70.364  35.992  2.702   1.00 55.92  ? 701 DT  C C7    1 
ATOM 17    C C6    . DT  A 1 1   ? 68.746  34.123  2.376   1.00 55.58  ? 701 DT  C C6    1 
ATOM 18    P P     . DG  A 1 2   ? 63.815  30.350  2.192   1.00 62.45  ? 702 DG  C P     1 
ATOM 19    O OP1   . DG  A 1 2   ? 63.402  29.033  1.638   1.00 35.36  ? 702 DG  C OP1   1 
ATOM 20    O OP2   . DG  A 1 2   ? 62.797  31.239  2.808   1.00 33.75  ? 702 DG  C OP2   1 
ATOM 21    O "O5'" . DG  A 1 2   ? 64.968  30.072  3.252   1.00 61.30  ? 702 DG  C "O5'" 1 
ATOM 22    C "C5'" . DG  A 1 2   ? 65.649  28.828  3.249   1.00 58.86  ? 702 DG  C "C5'" 1 
ATOM 23    C "C4'" . DG  A 1 2   ? 66.006  28.427  4.658   1.00 57.08  ? 702 DG  C "C4'" 1 
ATOM 24    O "O4'" . DG  A 1 2   ? 67.024  29.336  5.146   1.00 59.61  ? 702 DG  C "O4'" 1 
ATOM 25    C "C3'" . DG  A 1 2   ? 64.856  28.489  5.669   1.00 54.99  ? 702 DG  C "C3'" 1 
ATOM 26    O "O3'" . DG  A 1 2   ? 64.884  27.332  6.520   1.00 51.58  ? 702 DG  C "O3'" 1 
ATOM 27    C "C2'" . DG  A 1 2   ? 65.134  29.769  6.442   1.00 56.16  ? 702 DG  C "C2'" 1 
ATOM 28    C "C1'" . DG  A 1 2   ? 66.646  29.831  6.415   1.00 57.74  ? 702 DG  C "C1'" 1 
ATOM 29    N N9    . DG  A 1 2   ? 67.213  31.169  6.569   1.00 28.47  ? 702 DG  C N9    1 
ATOM 30    C C8    . DG  A 1 2   ? 66.555  32.365  6.425   1.00 27.81  ? 702 DG  C C8    1 
ATOM 31    N N7    . DG  A 1 2   ? 67.317  33.395  6.670   1.00 28.03  ? 702 DG  C N7    1 
ATOM 32    C C5    . DG  A 1 2   ? 68.550  32.846  6.986   1.00 29.24  ? 702 DG  C C5    1 
ATOM 33    C C6    . DG  A 1 2   ? 69.770  33.471  7.347   1.00 29.27  ? 702 DG  C C6    1 
ATOM 34    O O6    . DG  A 1 2   ? 70.009  34.672  7.480   1.00 29.71  ? 702 DG  C O6    1 
ATOM 35    N N1    . DG  A 1 2   ? 70.772  32.543  7.571   1.00 29.31  ? 702 DG  C N1    1 
ATOM 36    C C2    . DG  A 1 2   ? 70.629  31.190  7.467   1.00 30.72  ? 702 DG  C C2    1 
ATOM 37    N N2    . DG  A 1 2   ? 71.729  30.463  7.719   1.00 29.02  ? 702 DG  C N2    1 
ATOM 38    N N3    . DG  A 1 2   ? 69.495  30.589  7.140   1.00 31.54  ? 702 DG  C N3    1 
ATOM 39    C C4    . DG  A 1 2   ? 68.505  31.474  6.915   1.00 30.24  ? 702 DG  C C4    1 
ATOM 40    P P     . DG  A 1 3   ? 64.655  27.486  8.107   1.00 35.56  ? 703 DG  C P     1 
ATOM 41    O OP1   . DG  A 1 3   ? 64.522  26.131  8.712   1.00 34.05  ? 703 DG  C OP1   1 
ATOM 42    O OP2   . DG  A 1 3   ? 63.586  28.489  8.332   1.00 38.05  ? 703 DG  C OP2   1 
ATOM 43    O "O5'" . DG  A 1 3   ? 66.046  28.074  8.601   1.00 32.67  ? 703 DG  C "O5'" 1 
ATOM 44    C "C5'" . DG  A 1 3   ? 67.253  27.375  8.316   1.00 30.84  ? 703 DG  C "C5'" 1 
ATOM 45    C "C4'" . DG  A 1 3   ? 68.192  27.462  9.491   1.00 27.44  ? 703 DG  C "C4'" 1 
ATOM 46    O "O4'" . DG  A 1 3   ? 68.879  28.735  9.504   1.00 28.60  ? 703 DG  C "O4'" 1 
ATOM 47    C "C3'" . DG  A 1 3   ? 67.477  27.348  10.834  1.00 23.54  ? 703 DG  C "C3'" 1 
ATOM 48    O "O3'" . DG  A 1 3   ? 68.352  26.729  11.757  1.00 25.71  ? 703 DG  C "O3'" 1 
ATOM 49    C "C2'" . DG  A 1 3   ? 67.323  28.788  11.254  1.00 21.54  ? 703 DG  C "C2'" 1 
ATOM 50    C "C1'" . DG  A 1 3   ? 68.629  29.377  10.746  1.00 22.06  ? 703 DG  C "C1'" 1 
ATOM 51    N N9    . DG  A 1 3   ? 68.538  30.817  10.521  1.00 18.49  ? 703 DG  C N9    1 
ATOM 52    C C8    . DG  A 1 3   ? 67.409  31.526  10.188  1.00 20.15  ? 703 DG  C C8    1 
ATOM 53    N N7    . DG  A 1 3   ? 67.607  32.812  10.146  1.00 19.90  ? 703 DG  C N7    1 
ATOM 54    C C5    . DG  A 1 3   ? 68.947  32.957  10.449  1.00 13.40  ? 703 DG  C C5    1 
ATOM 55    C C6    . DG  A 1 3   ? 69.725  34.122  10.560  1.00 14.96  ? 703 DG  C C6    1 
ATOM 56    O O6    . DG  A 1 3   ? 69.362  35.313  10.410  1.00 11.96  ? 703 DG  C O6    1 
ATOM 57    N N1    . DG  A 1 3   ? 71.051  33.810  10.877  1.00 13.24  ? 703 DG  C N1    1 
ATOM 58    C C2    . DG  A 1 3   ? 71.544  32.531  11.058  1.00 10.75  ? 703 DG  C C2    1 
ATOM 59    N N2    . DG  A 1 3   ? 72.832  32.418  11.329  1.00 10.33  ? 703 DG  C N2    1 
ATOM 60    N N3    . DG  A 1 3   ? 70.816  31.446  10.968  1.00 8.36   ? 703 DG  C N3    1 
ATOM 61    C C4    . DG  A 1 3   ? 69.541  31.727  10.661  1.00 12.78  ? 703 DG  C C4    1 
ATOM 62    P P     . DG  A 1 4   ? 67.767  26.024  13.068  1.00 30.92  ? 704 DG  C P     1 
ATOM 63    O OP1   . DG  A 1 4   ? 66.966  24.825  12.718  1.00 26.35  ? 704 DG  C OP1   1 
ATOM 64    O OP2   . DG  A 1 4   ? 67.178  27.064  13.948  1.00 22.11  ? 704 DG  C OP2   1 
ATOM 65    O "O5'" . DG  A 1 4   ? 69.107  25.481  13.716  1.00 29.81  ? 704 DG  C "O5'" 1 
ATOM 66    C "C5'" . DG  A 1 4   ? 69.495  25.898  15.000  1.00 25.91  ? 704 DG  C "C5'" 1 
ATOM 67    C "C4'" . DG  A 1 4   ? 70.865  26.512  14.945  1.00 19.37  ? 704 DG  C "C4'" 1 
ATOM 68    O "O4'" . DG  A 1 4   ? 70.774  27.724  14.152  1.00 19.07  ? 704 DG  C "O4'" 1 
ATOM 69    C "C3'" . DG  A 1 4   ? 71.301  26.936  16.346  1.00 18.25  ? 704 DG  C "C3'" 1 
ATOM 70    O "O3'" . DG  A 1 4   ? 72.588  26.450  16.691  1.00 14.69  ? 704 DG  C "O3'" 1 
ATOM 71    C "C2'" . DG  A 1 4   ? 71.236  28.451  16.340  1.00 17.99  ? 704 DG  C "C2'" 1 
ATOM 72    C "C1'" . DG  A 1 4   ? 71.303  28.834  14.873  1.00 18.03  ? 704 DG  C "C1'" 1 
ATOM 73    N N9    . DG  A 1 4   ? 70.493  30.019  14.575  1.00 10.20  ? 704 DG  C N9    1 
ATOM 74    C C8    . DG  A 1 4   ? 69.159  30.052  14.265  1.00 12.11  ? 704 DG  C C8    1 
ATOM 75    N N7    . DG  A 1 4   ? 68.702  31.266  14.101  1.00 9.93   ? 704 DG  C N7    1 
ATOM 76    C C5    . DG  A 1 4   ? 69.804  32.085  14.293  1.00 5.36   ? 704 DG  C C5    1 
ATOM 77    C C6    . DG  A 1 4   ? 69.930  33.503  14.233  1.00 3.51   ? 704 DG  C C6    1 
ATOM 78    O O6    . DG  A 1 4   ? 69.061  34.348  13.991  1.00 2.05   ? 704 DG  C O6    1 
ATOM 79    N N1    . DG  A 1 4   ? 71.230  33.912  14.495  1.00 2.91   ? 704 DG  C N1    1 
ATOM 80    C C2    . DG  A 1 4   ? 72.274  33.078  14.780  1.00 2.74   ? 704 DG  C C2    1 
ATOM 81    N N2    . DG  A 1 4   ? 73.453  33.667  15.005  1.00 2.05   ? 704 DG  C N2    1 
ATOM 82    N N3    . DG  A 1 4   ? 72.173  31.762  14.838  1.00 4.56   ? 704 DG  C N3    1 
ATOM 83    C C4    . DG  A 1 4   ? 70.922  31.334  14.585  1.00 5.41   ? 704 DG  C C4    1 
ATOM 84    P P     . DA  A 1 5   ? 72.935  26.219  18.237  1.00 8.34   ? 705 DA  C P     1 
ATOM 85    O OP1   . DA  A 1 5   ? 74.035  25.243  18.365  1.00 8.58   ? 705 DA  C OP1   1 
ATOM 86    O OP2   . DA  A 1 5   ? 71.643  25.988  18.940  1.00 17.76  ? 705 DA  C OP2   1 
ATOM 87    O "O5'" . DA  A 1 5   ? 73.521  27.614  18.705  1.00 10.44  ? 705 DA  C "O5'" 1 
ATOM 88    C "C5'" . DA  A 1 5   ? 74.757  28.056  18.191  1.00 14.81  ? 705 DA  C "C5'" 1 
ATOM 89    C "C4'" . DA  A 1 5   ? 74.941  29.522  18.483  1.00 13.57  ? 705 DA  C "C4'" 1 
ATOM 90    O "O4'" . DA  A 1 5   ? 73.867  30.289  17.883  1.00 13.11  ? 705 DA  C "O4'" 1 
ATOM 91    C "C3'" . DA  A 1 5   ? 74.943  29.893  19.967  1.00 14.99  ? 705 DA  C "C3'" 1 
ATOM 92    O "O3'" . DA  A 1 5   ? 75.958  30.882  20.133  1.00 18.44  ? 705 DA  C "O3'" 1 
ATOM 93    C "C2'" . DA  A 1 5   ? 73.566  30.506  20.177  1.00 11.49  ? 705 DA  C "C2'" 1 
ATOM 94    C "C1'" . DA  A 1 5   ? 73.391  31.210  18.848  1.00 10.28  ? 705 DA  C "C1'" 1 
ATOM 95    N N9    . DA  A 1 5   ? 72.053  31.642  18.455  1.00 13.14  ? 705 DA  C N9    1 
ATOM 96    C C8    . DA  A 1 5   ? 70.942  30.883  18.200  1.00 11.87  ? 705 DA  C C8    1 
ATOM 97    N N7    . DA  A 1 5   ? 69.890  31.578  17.854  1.00 10.72  ? 705 DA  C N7    1 
ATOM 98    C C5    . DA  A 1 5   ? 70.340  32.887  17.889  1.00 13.09  ? 705 DA  C C5    1 
ATOM 99    C C6    . DA  A 1 5   ? 69.703  34.098  17.620  1.00 14.74  ? 705 DA  C C6    1 
ATOM 100   N N6    . DA  A 1 5   ? 68.411  34.191  17.255  1.00 13.25  ? 705 DA  C N6    1 
ATOM 101   N N1    . DA  A 1 5   ? 70.445  35.234  17.735  1.00 14.91  ? 705 DA  C N1    1 
ATOM 102   C C2    . DA  A 1 5   ? 71.731  35.128  18.097  1.00 8.44   ? 705 DA  C C2    1 
ATOM 103   N N3    . DA  A 1 5   ? 72.430  34.041  18.381  1.00 11.47  ? 705 DA  C N3    1 
ATOM 104   C C4    . DA  A 1 5   ? 71.667  32.940  18.253  1.00 12.32  ? 705 DA  C C4    1 
ATOM 105   P P     . DC  A 1 6   ? 76.824  30.930  21.478  1.00 31.13  ? 706 DC  C P     1 
ATOM 106   O OP1   . DC  A 1 6   ? 78.169  30.379  21.185  1.00 23.27  ? 706 DC  C OP1   1 
ATOM 107   O OP2   . DC  A 1 6   ? 76.003  30.359  22.581  1.00 30.76  ? 706 DC  C OP2   1 
ATOM 108   O "O5'" . DC  A 1 6   ? 76.986  32.491  21.717  1.00 28.48  ? 706 DC  C "O5'" 1 
ATOM 109   C "C5'" . DC  A 1 6   ? 77.299  33.346  20.630  1.00 20.34  ? 706 DC  C "C5'" 1 
ATOM 110   C "C4'" . DC  A 1 6   ? 76.686  34.711  20.835  1.00 17.00  ? 706 DC  C "C4'" 1 
ATOM 111   O "O4'" . DC  A 1 6   ? 75.293  34.722  20.433  1.00 14.85  ? 706 DC  C "O4'" 1 
ATOM 112   C "C3'" . DC  A 1 6   ? 76.746  35.284  22.257  1.00 13.37  ? 706 DC  C "C3'" 1 
ATOM 113   O "O3'" . DC  A 1 6   ? 77.211  36.631  22.178  1.00 16.29  ? 706 DC  C "O3'" 1 
ATOM 114   C "C2'" . DC  A 1 6   ? 75.286  35.267  22.695  1.00 15.91  ? 706 DC  C "C2'" 1 
ATOM 115   C "C1'" . DC  A 1 6   ? 74.564  35.494  21.377  1.00 15.72  ? 706 DC  C "C1'" 1 
ATOM 116   N N1    . DC  A 1 6   ? 73.131  35.105  21.311  1.00 14.99  ? 706 DC  C N1    1 
ATOM 117   C C2    . DC  A 1 6   ? 72.157  36.089  20.982  1.00 14.49  ? 706 DC  C C2    1 
ATOM 118   O O2    . DC  A 1 6   ? 72.517  37.259  20.732  1.00 12.21  ? 706 DC  C O2    1 
ATOM 119   N N3    . DC  A 1 6   ? 70.855  35.731  20.942  1.00 16.25  ? 706 DC  C N3    1 
ATOM 120   C C4    . DC  A 1 6   ? 70.494  34.476  21.188  1.00 18.88  ? 706 DC  C C4    1 
ATOM 121   N N4    . DC  A 1 6   ? 69.204  34.182  21.120  1.00 21.15  ? 706 DC  C N4    1 
ATOM 122   C C5    . DC  A 1 6   ? 71.442  33.468  21.513  1.00 15.58  ? 706 DC  C C5    1 
ATOM 123   C C6    . DC  A 1 6   ? 72.738  33.821  21.563  1.00 16.50  ? 706 DC  C C6    1 
ATOM 124   P P     . DT  A 1 7   ? 77.892  37.343  23.454  1.00 19.19  ? 707 DT  C P     1 
ATOM 125   O OP1   . DT  A 1 7   ? 79.203  37.909  22.997  1.00 6.93   ? 707 DT  C OP1   1 
ATOM 126   O OP2   . DT  A 1 7   ? 77.833  36.444  24.643  1.00 11.83  ? 707 DT  C OP2   1 
ATOM 127   O "O5'" . DT  A 1 7   ? 76.921  38.573  23.698  1.00 21.02  ? 707 DT  C "O5'" 1 
ATOM 128   C "C5'" . DT  A 1 7   ? 76.566  39.401  22.597  1.00 20.11  ? 707 DT  C "C5'" 1 
ATOM 129   C "C4'" . DT  A 1 7   ? 75.351  40.228  22.930  1.00 20.16  ? 707 DT  C "C4'" 1 
ATOM 130   O "O4'" . DT  A 1 7   ? 74.124  39.460  22.815  1.00 21.86  ? 707 DT  C "O4'" 1 
ATOM 131   C "C3'" . DT  A 1 7   ? 75.375  40.794  24.343  1.00 18.59  ? 707 DT  C "C3'" 1 
ATOM 132   O "O3'" . DT  A 1 7   ? 75.057  42.175  24.271  1.00 19.52  ? 707 DT  C "O3'" 1 
ATOM 133   C "C2'" . DT  A 1 7   ? 74.312  39.982  25.076  1.00 19.88  ? 707 DT  C "C2'" 1 
ATOM 134   C "C1'" . DT  A 1 7   ? 73.322  39.683  23.961  1.00 15.81  ? 707 DT  C "C1'" 1 
ATOM 135   N N1    . DT  A 1 7   ? 72.421  38.511  24.121  1.00 8.05   ? 707 DT  C N1    1 
ATOM 136   C C2    . DT  A 1 7   ? 71.065  38.725  24.012  1.00 10.88  ? 707 DT  C C2    1 
ATOM 137   O O2    . DT  A 1 7   ? 70.565  39.822  23.831  1.00 12.12  ? 707 DT  C O2    1 
ATOM 138   N N3    . DT  A 1 7   ? 70.297  37.596  24.129  1.00 11.91  ? 707 DT  C N3    1 
ATOM 139   C C4    . DT  A 1 7   ? 70.727  36.304  24.351  1.00 12.96  ? 707 DT  C C4    1 
ATOM 140   O O4    . DT  A 1 7   ? 69.897  35.388  24.424  1.00 11.01  ? 707 DT  C O4    1 
ATOM 141   C C5    . DT  A 1 7   ? 72.162  36.150  24.471  1.00 11.45  ? 707 DT  C C5    1 
ATOM 142   C C7    . DT  A 1 7   ? 72.734  34.789  24.710  1.00 14.08  ? 707 DT  C C7    1 
ATOM 143   C C6    . DT  A 1 7   ? 72.925  37.246  24.356  1.00 12.02  ? 707 DT  C C6    1 
ATOM 144   P P     . DT  A 1 8   ? 75.175  43.072  25.578  1.00 4.84   ? 708 DT  C P     1 
ATOM 145   O OP1   . DT  A 1 8   ? 75.847  44.343  25.261  1.00 9.27   ? 708 DT  C OP1   1 
ATOM 146   O OP2   . DT  A 1 8   ? 75.690  42.232  26.675  1.00 12.90  ? 708 DT  C OP2   1 
ATOM 147   O "O5'" . DT  A 1 8   ? 73.660  43.391  25.908  1.00 2.00   ? 708 DT  C "O5'" 1 
ATOM 148   C "C5'" . DT  A 1 8   ? 72.827  43.968  24.926  1.00 2.00   ? 708 DT  C "C5'" 1 
ATOM 149   C "C4'" . DT  A 1 8   ? 71.412  44.046  25.435  1.00 2.00   ? 708 DT  C "C4'" 1 
ATOM 150   O "O4'" . DT  A 1 8   ? 70.809  42.732  25.444  1.00 2.00   ? 708 DT  C "O4'" 1 
ATOM 151   C "C3'" . DT  A 1 8   ? 71.263  44.585  26.853  1.00 2.00   ? 708 DT  C "C3'" 1 
ATOM 152   O "O3'" . DT  A 1 8   ? 70.158  45.488  26.850  1.00 2.00   ? 708 DT  C "O3'" 1 
ATOM 153   C "C2'" . DT  A 1 8   ? 70.997  43.333  27.684  1.00 2.31   ? 708 DT  C "C2'" 1 
ATOM 154   C "C1'" . DT  A 1 8   ? 70.200  42.494  26.707  1.00 2.00   ? 708 DT  C "C1'" 1 
ATOM 155   N N1    . DT  A 1 8   ? 70.120  41.018  26.916  1.00 7.93   ? 708 DT  C N1    1 
ATOM 156   C C2    . DT  A 1 8   ? 68.857  40.445  26.917  1.00 7.95   ? 708 DT  C C2    1 
ATOM 157   O O2    . DT  A 1 8   ? 67.830  41.096  26.789  1.00 10.27  ? 708 DT  C O2    1 
ATOM 158   N N3    . DT  A 1 8   ? 68.836  39.083  27.080  1.00 5.47   ? 708 DT  C N3    1 
ATOM 159   C C4    . DT  A 1 8   ? 69.911  38.254  27.252  1.00 5.14   ? 708 DT  C C4    1 
ATOM 160   O O4    . DT  A 1 8   ? 69.723  37.061  27.400  1.00 2.00   ? 708 DT  C O4    1 
ATOM 161   C C5    . DT  A 1 8   ? 71.207  38.914  27.246  1.00 4.54   ? 708 DT  C C5    1 
ATOM 162   C C7    . DT  A 1 8   ? 72.441  38.092  27.422  1.00 2.90   ? 708 DT  C C7    1 
ATOM 163   C C6    . DT  A 1 8   ? 71.248  40.244  27.085  1.00 5.89   ? 708 DT  C C6    1 
ATOM 164   P P     . DT  A 1 9   ? 69.519  45.976  28.231  1.00 9.59   ? 709 DT  C P     1 
ATOM 165   O OP1   . DT  A 1 9   ? 69.058  47.358  27.984  1.00 25.30  ? 709 DT  C OP1   1 
ATOM 166   O OP2   . DT  A 1 9   ? 70.460  45.702  29.351  1.00 17.64  ? 709 DT  C OP2   1 
ATOM 167   O "O5'" . DT  A 1 9   ? 68.223  45.062  28.360  1.00 5.37   ? 709 DT  C "O5'" 1 
ATOM 168   C "C5'" . DT  A 1 9   ? 67.260  45.121  27.321  1.00 2.74   ? 709 DT  C "C5'" 1 
ATOM 169   C "C4'" . DT  A 1 9   ? 65.974  44.448  27.725  1.00 2.00   ? 709 DT  C "C4'" 1 
ATOM 170   O "O4'" . DT  A 1 9   ? 66.220  43.030  27.811  1.00 2.00   ? 709 DT  C "O4'" 1 
ATOM 171   C "C3'" . DT  A 1 9   ? 65.353  44.875  29.054  1.00 2.00   ? 709 DT  C "C3'" 1 
ATOM 172   O "O3'" . DT  A 1 9   ? 63.939  44.983  28.872  1.00 4.69   ? 709 DT  C "O3'" 1 
ATOM 173   C "C2'" . DT  A 1 9   ? 65.656  43.697  29.962  1.00 3.30   ? 709 DT  C "C2'" 1 
ATOM 174   C "C1'" . DT  A 1 9   ? 65.647  42.528  28.995  1.00 2.00   ? 709 DT  C "C1'" 1 
ATOM 175   N N1    . DT  A 1 9   ? 66.461  41.381  29.420  1.00 18.75  ? 709 DT  C N1    1 
ATOM 176   C C2    . DT  A 1 9   ? 65.866  40.160  29.524  1.00 20.63  ? 709 DT  C C2    1 
ATOM 177   O O2    . DT  A 1 9   ? 64.690  39.971  29.250  1.00 22.13  ? 709 DT  C O2    1 
ATOM 178   N N3    . DT  A 1 9   ? 66.703  39.160  29.948  1.00 21.85  ? 709 DT  C N3    1 
ATOM 179   C C4    . DT  A 1 9   ? 68.048  39.271  30.248  1.00 22.32  ? 709 DT  C C4    1 
ATOM 180   O O4    . DT  A 1 9   ? 68.687  38.292  30.603  1.00 21.13  ? 709 DT  C O4    1 
ATOM 181   C C5    . DT  A 1 9   ? 68.594  40.569  30.106  1.00 20.15  ? 709 DT  C C5    1 
ATOM 182   C C7    . DT  A 1 9   ? 70.037  40.773  30.408  1.00 18.14  ? 709 DT  C C7    1 
ATOM 183   C C6    . DT  A 1 9   ? 67.792  41.548  29.706  1.00 20.74  ? 709 DT  C C6    1 
ATOM 184   P P     . DC  A 1 10  ? 63.014  45.687  29.989  1.00 31.17  ? 710 DC  C P     1 
ATOM 185   O OP1   . DC  A 1 10  ? 62.596  46.995  29.422  1.00 13.69  ? 710 DC  C OP1   1 
ATOM 186   O OP2   . DC  A 1 10  ? 63.648  45.622  31.347  1.00 15.51  ? 710 DC  C OP2   1 
ATOM 187   O "O5'" . DC  A 1 10  ? 61.732  44.745  30.058  1.00 25.99  ? 710 DC  C "O5'" 1 
ATOM 188   C "C5'" . DC  A 1 10  ? 61.623  43.585  29.233  1.00 21.79  ? 710 DC  C "C5'" 1 
ATOM 189   C "C4'" . DC  A 1 10  ? 60.958  42.472  30.005  1.00 24.07  ? 710 DC  C "C4'" 1 
ATOM 190   O "O4'" . DC  A 1 10  ? 61.882  41.396  30.327  1.00 23.55  ? 710 DC  C "O4'" 1 
ATOM 191   C "C3'" . DC  A 1 10  ? 60.360  42.916  31.336  1.00 26.27  ? 710 DC  C "C3'" 1 
ATOM 192   O "O3'" . DC  A 1 10  ? 59.168  42.176  31.551  1.00 32.63  ? 710 DC  C "O3'" 1 
ATOM 193   C "C2'" . DC  A 1 10  ? 61.405  42.455  32.337  1.00 23.16  ? 710 DC  C "C2'" 1 
ATOM 194   C "C1'" . DC  A 1 10  ? 61.809  41.134  31.723  1.00 20.55  ? 710 DC  C "C1'" 1 
ATOM 195   N N1    . DC  A 1 10  ? 63.099  40.574  32.168  1.00 6.69   ? 710 DC  C N1    1 
ATOM 196   C C2    . DC  A 1 10  ? 63.155  39.223  32.501  1.00 11.53  ? 710 DC  C C2    1 
ATOM 197   O O2    . DC  A 1 10  ? 62.130  38.541  32.400  1.00 13.55  ? 710 DC  C O2    1 
ATOM 198   N N3    . DC  A 1 10  ? 64.326  38.688  32.924  1.00 12.16  ? 710 DC  C N3    1 
ATOM 199   C C4    . DC  A 1 10  ? 65.413  39.449  33.016  1.00 10.38  ? 710 DC  C C4    1 
ATOM 200   N N4    . DC  A 1 10  ? 66.538  38.869  33.449  1.00 7.29   ? 710 DC  C N4    1 
ATOM 201   C C5    . DC  A 1 10  ? 65.394  40.832  32.673  1.00 6.69   ? 710 DC  C C5    1 
ATOM 202   C C6    . DC  A 1 10  ? 64.225  41.351  32.260  1.00 6.69   ? 710 DC  C C6    1 
ATOM 203   P P     . DC  A 1 11  ? 58.340  42.354  32.916  1.00 35.28  ? 711 DC  C P     1 
ATOM 204   O OP1   . DC  A 1 11  ? 57.619  43.645  32.810  1.00 28.08  ? 711 DC  C OP1   1 
ATOM 205   O OP2   . DC  A 1 11  ? 59.171  42.092  34.125  1.00 27.98  ? 711 DC  C OP2   1 
ATOM 206   O "O5'" . DC  A 1 11  ? 57.318  41.147  32.824  1.00 32.37  ? 711 DC  C "O5'" 1 
ATOM 207   C "C5'" . DC  A 1 11  ? 57.640  40.011  32.037  1.00 36.73  ? 711 DC  C "C5'" 1 
ATOM 208   C "C4'" . DC  A 1 11  ? 57.784  38.804  32.923  1.00 42.18  ? 711 DC  C "C4'" 1 
ATOM 209   O "O4'" . DC  A 1 11  ? 59.176  38.521  33.223  1.00 42.68  ? 711 DC  C "O4'" 1 
ATOM 210   C "C3'" . DC  A 1 11  ? 57.078  38.963  34.271  1.00 45.47  ? 711 DC  C "C3'" 1 
ATOM 211   O "O3'" . DC  A 1 11  ? 56.354  37.776  34.586  1.00 50.73  ? 711 DC  C "O3'" 1 
ATOM 212   C "C2'" . DC  A 1 11  ? 58.231  39.145  35.244  1.00 45.22  ? 711 DC  C "C2'" 1 
ATOM 213   C "C1'" . DC  A 1 11  ? 59.293  38.267  34.610  1.00 41.39  ? 711 DC  C "C1'" 1 
ATOM 214   N N1    . DC  A 1 11  ? 60.675  38.558  35.021  1.00 32.55  ? 711 DC  C N1    1 
ATOM 215   C C2    . DC  A 1 11  ? 61.536  37.493  35.325  1.00 28.91  ? 711 DC  C C2    1 
ATOM 216   O O2    . DC  A 1 11  ? 61.123  36.332  35.215  1.00 24.56  ? 711 DC  C O2    1 
ATOM 217   N N3    . DC  A 1 11  ? 62.797  37.763  35.732  1.00 27.69  ? 711 DC  C N3    1 
ATOM 218   C C4    . DC  A 1 11  ? 63.212  39.027  35.830  1.00 25.77  ? 711 DC  C C4    1 
ATOM 219   N N4    . DC  A 1 11  ? 64.458  39.250  36.232  1.00 26.92  ? 711 DC  C N4    1 
ATOM 220   C C5    . DC  A 1 11  ? 62.362  40.125  35.517  1.00 27.37  ? 711 DC  C C5    1 
ATOM 221   C C6    . DC  A 1 11  ? 61.113  39.846  35.120  1.00 31.99  ? 711 DC  C C6    1 
ATOM 222   P P     . DT  A 1 12  ? 55.265  37.808  35.759  1.00 62.54  ? 712 DT  C P     1 
ATOM 223   O OP1   . DT  A 1 12  ? 54.827  36.398  35.937  1.00 71.26  ? 712 DT  C OP1   1 
ATOM 224   O OP2   . DT  A 1 12  ? 54.254  38.864  35.452  1.00 73.19  ? 712 DT  C OP2   1 
ATOM 225   O "O5'" . DT  A 1 12  ? 56.094  38.294  37.035  1.00 52.43  ? 712 DT  C "O5'" 1 
ATOM 226   C "C5'" . DT  A 1 12  ? 56.206  37.465  38.192  1.00 49.07  ? 712 DT  C "C5'" 1 
ATOM 227   C "C4'" . DT  A 1 12  ? 57.012  36.229  37.863  1.00 43.48  ? 712 DT  C "C4'" 1 
ATOM 228   O "O4'" . DT  A 1 12  ? 58.368  36.629  37.541  1.00 41.57  ? 712 DT  C "O4'" 1 
ATOM 229   C "C3'" . DT  A 1 12  ? 57.136  35.207  38.996  1.00 40.33  ? 712 DT  C "C3'" 1 
ATOM 230   O "O3'" . DT  A 1 12  ? 57.290  33.904  38.419  1.00 38.89  ? 712 DT  C "O3'" 1 
ATOM 231   C "C2'" . DT  A 1 12  ? 58.464  35.572  39.636  1.00 37.30  ? 712 DT  C "C2'" 1 
ATOM 232   C "C1'" . DT  A 1 12  ? 59.282  36.006  38.430  1.00 35.17  ? 712 DT  C "C1'" 1 
ATOM 233   N N1    . DT  A 1 12  ? 60.374  36.951  38.704  1.00 39.81  ? 712 DT  C N1    1 
ATOM 234   C C2    . DT  A 1 12  ? 61.599  36.410  38.972  1.00 38.53  ? 712 DT  C C2    1 
ATOM 235   O O2    . DT  A 1 12  ? 61.784  35.210  39.014  1.00 33.91  ? 712 DT  C O2    1 
ATOM 236   N N3    . DT  A 1 12  ? 62.601  37.316  39.190  1.00 38.01  ? 712 DT  C N3    1 
ATOM 237   C C4    . DT  A 1 12  ? 62.494  38.693  39.181  1.00 40.05  ? 712 DT  C C4    1 
ATOM 238   O O4    . DT  A 1 12  ? 63.486  39.392  39.409  1.00 39.29  ? 712 DT  C O4    1 
ATOM 239   C C5    . DT  A 1 12  ? 61.164  39.202  38.898  1.00 39.73  ? 712 DT  C C5    1 
ATOM 240   C C7    . DT  A 1 12  ? 60.950  40.685  38.861  1.00 40.20  ? 712 DT  C C7    1 
ATOM 241   C C6    . DT  A 1 12  ? 60.184  38.315  38.680  1.00 37.92  ? 712 DT  C C6    1 
ATOM 242   O "O5'" . DA  B 2 1   ? 66.749  38.797  46.907  1.00 36.81  ? 713 DA  D "O5'" 1 
ATOM 243   C "C5'" . DA  B 2 1   ? 67.286  37.490  47.099  1.00 40.43  ? 713 DA  D "C5'" 1 
ATOM 244   C "C4'" . DA  B 2 1   ? 67.595  36.794  45.798  1.00 40.70  ? 713 DA  D "C4'" 1 
ATOM 245   O "O4'" . DA  B 2 1   ? 66.494  37.009  44.883  1.00 43.25  ? 713 DA  D "O4'" 1 
ATOM 246   C "C3'" . DA  B 2 1   ? 68.846  37.294  45.068  1.00 41.02  ? 713 DA  D "C3'" 1 
ATOM 247   O "O3'" . DA  B 2 1   ? 69.459  36.216  44.361  1.00 40.25  ? 713 DA  D "O3'" 1 
ATOM 248   C "C2'" . DA  B 2 1   ? 68.288  38.301  44.086  1.00 41.98  ? 713 DA  D "C2'" 1 
ATOM 249   C "C1'" . DA  B 2 1   ? 66.936  37.705  43.732  1.00 41.09  ? 713 DA  D "C1'" 1 
ATOM 250   N N9    . DA  B 2 1   ? 65.924  38.700  43.402  1.00 60.21  ? 713 DA  D N9    1 
ATOM 251   C C8    . DA  B 2 1   ? 66.109  40.048  43.243  1.00 59.54  ? 713 DA  D C8    1 
ATOM 252   N N7    . DA  B 2 1   ? 65.017  40.701  42.929  1.00 61.66  ? 713 DA  D N7    1 
ATOM 253   C C5    . DA  B 2 1   ? 64.040  39.715  42.886  1.00 60.14  ? 713 DA  D C5    1 
ATOM 254   C C6    . DA  B 2 1   ? 62.667  39.763  42.611  1.00 58.36  ? 713 DA  D C6    1 
ATOM 255   N N6    . DA  B 2 1   ? 62.017  40.894  42.315  1.00 65.16  ? 713 DA  D N6    1 
ATOM 256   N N1    . DA  B 2 1   ? 61.977  38.602  42.646  1.00 52.99  ? 713 DA  D N1    1 
ATOM 257   C C2    . DA  B 2 1   ? 62.636  37.472  42.932  1.00 56.08  ? 713 DA  D C2    1 
ATOM 258   N N3    . DA  B 2 1   ? 63.931  37.299  43.210  1.00 56.75  ? 713 DA  D N3    1 
ATOM 259   C C4    . DA  B 2 1   ? 64.585  38.476  43.174  1.00 60.26  ? 713 DA  D C4    1 
ATOM 260   P P     . DA  B 2 2   ? 70.860  35.611  44.874  1.00 59.04  ? 714 DA  D P     1 
ATOM 261   O OP1   . DA  B 2 2   ? 70.739  35.413  46.340  1.00 43.64  ? 714 DA  D OP1   1 
ATOM 262   O OP2   . DA  B 2 2   ? 71.977  36.445  44.329  1.00 40.90  ? 714 DA  D OP2   1 
ATOM 263   O "O5'" . DA  B 2 2   ? 70.917  34.166  44.205  1.00 57.24  ? 714 DA  D "O5'" 1 
ATOM 264   C "C5'" . DA  B 2 2   ? 70.115  33.096  44.717  1.00 57.92  ? 714 DA  D "C5'" 1 
ATOM 265   C "C4'" . DA  B 2 2   ? 69.524  32.282  43.588  1.00 61.50  ? 714 DA  D "C4'" 1 
ATOM 266   O "O4'" . DA  B 2 2   ? 68.477  33.008  42.900  1.00 57.85  ? 714 DA  D "O4'" 1 
ATOM 267   C "C3'" . DA  B 2 2   ? 70.519  31.869  42.514  1.00 64.00  ? 714 DA  D "C3'" 1 
ATOM 268   O "O3'" . DA  B 2 2   ? 70.223  30.541  42.095  1.00 65.86  ? 714 DA  D "O3'" 1 
ATOM 269   C "C2'" . DA  B 2 2   ? 70.267  32.861  41.395  1.00 60.46  ? 714 DA  D "C2'" 1 
ATOM 270   C "C1'" . DA  B 2 2   ? 68.781  33.130  41.520  1.00 57.11  ? 714 DA  D "C1'" 1 
ATOM 271   N N9    . DA  B 2 2   ? 68.399  34.479  41.121  1.00 37.14  ? 714 DA  D N9    1 
ATOM 272   C C8    . DA  B 2 2   ? 69.162  35.614  41.195  1.00 37.02  ? 714 DA  D C8    1 
ATOM 273   N N7    . DA  B 2 2   ? 68.529  36.698  40.834  1.00 36.17  ? 714 DA  D N7    1 
ATOM 274   C C5    . DA  B 2 2   ? 67.270  36.242  40.485  1.00 31.31  ? 714 DA  D C5    1 
ATOM 275   C C6    . DA  B 2 2   ? 66.141  36.902  40.034  1.00 27.15  ? 714 DA  D C6    1 
ATOM 276   N N6    . DA  B 2 2   ? 66.091  38.222  39.868  1.00 26.52  ? 714 DA  D N6    1 
ATOM 277   N N1    . DA  B 2 2   ? 65.048  36.167  39.760  1.00 26.26  ? 714 DA  D N1    1 
ATOM 278   C C2    . DA  B 2 2   ? 65.106  34.844  39.947  1.00 27.11  ? 714 DA  D C2    1 
ATOM 279   N N3    . DA  B 2 2   ? 66.115  34.106  40.383  1.00 29.40  ? 714 DA  D N3    1 
ATOM 280   C C4    . DA  B 2 2   ? 67.181  34.875  40.637  1.00 32.26  ? 714 DA  D C4    1 
ATOM 281   P P     . DG  B 2 3   ? 70.803  30.010  40.703  1.00 50.83  ? 715 DG  D P     1 
ATOM 282   O OP1   . DG  B 2 3   ? 71.137  28.556  40.806  1.00 50.31  ? 715 DG  D OP1   1 
ATOM 283   O OP2   . DG  B 2 3   ? 71.865  30.993  40.325  1.00 49.08  ? 715 DG  D OP2   1 
ATOM 284   O "O5'" . DG  B 2 3   ? 69.552  30.159  39.734  1.00 46.10  ? 715 DG  D "O5'" 1 
ATOM 285   C "C5'" . DG  B 2 3   ? 68.348  29.475  40.035  1.00 39.73  ? 715 DG  D "C5'" 1 
ATOM 286   C "C4'" . DG  B 2 3   ? 67.350  29.672  38.922  1.00 36.85  ? 715 DG  D "C4'" 1 
ATOM 287   O "O4'" . DG  B 2 3   ? 66.994  31.068  38.808  1.00 36.28  ? 715 DG  D "O4'" 1 
ATOM 288   C "C3'" . DG  B 2 3   ? 67.834  29.258  37.537  1.00 33.89  ? 715 DG  D "C3'" 1 
ATOM 289   O "O3'" . DG  B 2 3   ? 66.736  28.645  36.881  1.00 32.98  ? 715 DG  D "O3'" 1 
ATOM 290   C "C2'" . DG  B 2 3   ? 68.137  30.583  36.865  1.00 32.94  ? 715 DG  D "C2'" 1 
ATOM 291   C "C1'" . DG  B 2 3   ? 67.040  31.428  37.450  1.00 33.16  ? 715 DG  D "C1'" 1 
ATOM 292   N N9    . DG  B 2 3   ? 67.199  32.873  37.362  1.00 34.97  ? 715 DG  D N9    1 
ATOM 293   C C8    . DG  B 2 3   ? 68.325  33.622  37.606  1.00 34.85  ? 715 DG  D C8    1 
ATOM 294   N N7    . DG  B 2 3   ? 68.130  34.899  37.432  1.00 32.51  ? 715 DG  D N7    1 
ATOM 295   C C5    . DG  B 2 3   ? 66.796  34.994  37.052  1.00 27.33  ? 715 DG  D C5    1 
ATOM 296   C C6    . DG  B 2 3   ? 66.013  36.118  36.733  1.00 24.09  ? 715 DG  D C6    1 
ATOM 297   O O6    . DG  B 2 3   ? 66.348  37.303  36.694  1.00 21.47  ? 715 DG  D O6    1 
ATOM 298   N N1    . DG  B 2 3   ? 64.708  35.762  36.427  1.00 28.16  ? 715 DG  D N1    1 
ATOM 299   C C2    . DG  B 2 3   ? 64.224  34.486  36.415  1.00 33.88  ? 715 DG  D C2    1 
ATOM 300   N N2    . DG  B 2 3   ? 62.937  34.334  36.098  1.00 36.73  ? 715 DG  D N2    1 
ATOM 301   N N3    . DG  B 2 3   ? 64.947  33.432  36.696  1.00 37.06  ? 715 DG  D N3    1 
ATOM 302   C C4    . DG  B 2 3   ? 66.216  33.757  37.008  1.00 33.11  ? 715 DG  D C4    1 
ATOM 303   P P     . DG  B 2 4   ? 66.981  27.773  35.567  1.00 36.94  ? 716 DG  D P     1 
ATOM 304   O OP1   . DG  B 2 4   ? 66.731  26.345  35.900  1.00 33.13  ? 716 DG  D OP1   1 
ATOM 305   O OP2   . DG  B 2 4   ? 68.274  28.181  34.961  1.00 28.91  ? 716 DG  D OP2   1 
ATOM 306   O "O5'" . DG  B 2 4   ? 65.779  28.235  34.652  1.00 33.84  ? 716 DG  D "O5'" 1 
ATOM 307   C "C5'" . DG  B 2 4   ? 64.458  28.027  35.099  1.00 24.69  ? 716 DG  D "C5'" 1 
ATOM 308   C "C4'" . DG  B 2 4   ? 63.499  28.752  34.195  1.00 23.28  ? 716 DG  D "C4'" 1 
ATOM 309   O "O4'" . DG  B 2 4   ? 63.694  30.184  34.354  1.00 23.66  ? 716 DG  D "O4'" 1 
ATOM 310   C "C3'" . DG  B 2 4   ? 63.742  28.441  32.722  1.00 23.47  ? 716 DG  D "C3'" 1 
ATOM 311   O "O3'" . DG  B 2 4   ? 62.496  28.236  32.066  1.00 25.40  ? 716 DG  D "O3'" 1 
ATOM 312   C "C2'" . DG  B 2 4   ? 64.495  29.662  32.212  1.00 19.09  ? 716 DG  D "C2'" 1 
ATOM 313   C "C1'" . DG  B 2 4   ? 63.987  30.789  33.101  1.00 21.00  ? 716 DG  D "C1'" 1 
ATOM 314   N N9    . DG  B 2 4   ? 64.941  31.883  33.316  1.00 19.00  ? 716 DG  D N9    1 
ATOM 315   C C8    . DG  B 2 4   ? 66.268  31.775  33.649  1.00 17.37  ? 716 DG  D C8    1 
ATOM 316   N N7    . DG  B 2 4   ? 66.882  32.929  33.701  1.00 17.10  ? 716 DG  D N7    1 
ATOM 317   C C5    . DG  B 2 4   ? 65.900  33.860  33.402  1.00 18.05  ? 716 DG  D C5    1 
ATOM 318   C C6    . DG  B 2 4   ? 65.966  35.282  33.308  1.00 19.10  ? 716 DG  D C6    1 
ATOM 319   O O6    . DG  B 2 4   ? 66.928  36.028  33.484  1.00 24.65  ? 716 DG  D O6    1 
ATOM 320   N N1    . DG  B 2 4   ? 64.740  35.829  32.977  1.00 17.10  ? 716 DG  D N1    1 
ATOM 321   C C2    . DG  B 2 4   ? 63.587  35.114  32.775  1.00 19.34  ? 716 DG  D C2    1 
ATOM 322   N N2    . DG  B 2 4   ? 62.507  35.831  32.472  1.00 22.27  ? 716 DG  D N2    1 
ATOM 323   N N3    . DG  B 2 4   ? 63.502  33.795  32.865  1.00 17.10  ? 716 DG  D N3    1 
ATOM 324   C C4    . DG  B 2 4   ? 64.691  33.236  33.175  1.00 18.85  ? 716 DG  D C4    1 
ATOM 325   P P     . DA  B 2 5   ? 62.461  27.868  30.509  1.00 9.88   ? 717 DA  D P     1 
ATOM 326   O OP1   . DA  B 2 5   ? 61.307  26.958  30.257  1.00 7.09   ? 717 DA  D OP1   1 
ATOM 327   O OP2   . DA  B 2 5   ? 63.813  27.466  30.040  1.00 7.09   ? 717 DA  D OP2   1 
ATOM 328   O "O5'" . DA  B 2 5   ? 62.069  29.268  29.892  1.00 5.40   ? 717 DA  D "O5'" 1 
ATOM 329   C "C5'" . DA  B 2 5   ? 60.898  29.889  30.365  1.00 5.40   ? 717 DA  D "C5'" 1 
ATOM 330   C "C4'" . DA  B 2 5   ? 60.769  31.261  29.773  1.00 5.40   ? 717 DA  D "C4'" 1 
ATOM 331   O "O4'" . DA  B 2 5   ? 61.888  32.055  30.219  1.00 6.93   ? 717 DA  D "O4'" 1 
ATOM 332   C "C3'" . DA  B 2 5   ? 60.836  31.271  28.253  1.00 7.55   ? 717 DA  D "C3'" 1 
ATOM 333   O "O3'" . DA  B 2 5   ? 59.850  32.189  27.786  1.00 12.34  ? 717 DA  D "O3'" 1 
ATOM 334   C "C2'" . DA  B 2 5   ? 62.237  31.785  27.956  1.00 5.41   ? 717 DA  D "C2'" 1 
ATOM 335   C "C1'" . DA  B 2 5   ? 62.424  32.739  29.110  1.00 5.40   ? 717 DA  D "C1'" 1 
ATOM 336   N N9    . DA  B 2 5   ? 63.783  33.153  29.437  1.00 7.09   ? 717 DA  D N9    1 
ATOM 337   C C8    . DA  B 2 5   ? 64.861  32.380  29.743  1.00 7.09   ? 717 DA  D C8    1 
ATOM 338   N N7    . DA  B 2 5   ? 65.957  33.062  29.960  1.00 7.09   ? 717 DA  D N7    1 
ATOM 339   C C5    . DA  B 2 5   ? 65.563  34.383  29.788  1.00 7.09   ? 717 DA  D C5    1 
ATOM 340   C C6    . DA  B 2 5   ? 66.271  35.619  29.866  1.00 7.09   ? 717 DA  D C6    1 
ATOM 341   N N6    . DA  B 2 5   ? 67.582  35.715  30.128  1.00 7.09   ? 717 DA  D N6    1 
ATOM 342   N N1    . DA  B 2 5   ? 65.570  36.756  29.652  1.00 7.09   ? 717 DA  D N1    1 
ATOM 343   C C2    . DA  B 2 5   ? 64.271  36.650  29.373  1.00 7.09   ? 717 DA  D C2    1 
ATOM 344   N N3    . DA  B 2 5   ? 63.501  35.555  29.261  1.00 7.09   ? 717 DA  D N3    1 
ATOM 345   C C4    . DA  B 2 5   ? 64.222  34.448  29.480  1.00 7.09   ? 717 DA  D C4    1 
ATOM 346   P P     . DA  B 2 6   ? 59.140  31.933  26.377  1.00 10.39  ? 718 DA  D P     1 
ATOM 347   O OP1   . DA  B 2 6   ? 57.792  31.369  26.605  1.00 3.06   ? 718 DA  D OP1   1 
ATOM 348   O OP2   . DA  B 2 6   ? 60.142  31.176  25.597  1.00 6.30   ? 718 DA  D OP2   1 
ATOM 349   O "O5'" . DA  B 2 6   ? 58.998  33.408  25.822  1.00 6.90   ? 718 DA  D "O5'" 1 
ATOM 350   C "C5'" . DA  B 2 6   ? 58.507  34.429  26.671  1.00 3.51   ? 718 DA  D "C5'" 1 
ATOM 351   C "C4'" . DA  B 2 6   ? 59.109  35.769  26.324  1.00 2.00   ? 718 DA  D "C4'" 1 
ATOM 352   O "O4'" . DA  B 2 6   ? 60.494  35.886  26.749  1.00 2.00   ? 718 DA  D "O4'" 1 
ATOM 353   C "C3'" . DA  B 2 6   ? 59.062  36.182  24.855  1.00 2.00   ? 718 DA  D "C3'" 1 
ATOM 354   O "O3'" . DA  B 2 6   ? 58.530  37.506  24.827  1.00 2.00   ? 718 DA  D "O3'" 1 
ATOM 355   C "C2'" . DA  B 2 6   ? 60.517  36.115  24.413  1.00 2.00   ? 718 DA  D "C2'" 1 
ATOM 356   C "C1'" . DA  B 2 6   ? 61.269  36.444  25.699  1.00 2.00   ? 718 DA  D "C1'" 1 
ATOM 357   N N9    . DA  B 2 6   ? 62.629  35.914  25.826  1.00 2.00   ? 718 DA  D N9    1 
ATOM 358   C C8    . DA  B 2 6   ? 63.081  34.621  25.682  1.00 2.00   ? 718 DA  D C8    1 
ATOM 359   N N7    . DA  B 2 6   ? 64.373  34.492  25.860  1.00 2.00   ? 718 DA  D N7    1 
ATOM 360   C C5    . DA  B 2 6   ? 64.799  35.779  26.141  1.00 2.00   ? 718 DA  D C5    1 
ATOM 361   C C6    . DA  B 2 6   ? 66.057  36.318  26.427  1.00 2.00   ? 718 DA  D C6    1 
ATOM 362   N N6    . DA  B 2 6   ? 67.180  35.603  26.473  1.00 2.00   ? 718 DA  D N6    1 
ATOM 363   N N1    . DA  B 2 6   ? 66.137  37.641  26.664  1.00 2.00   ? 718 DA  D N1    1 
ATOM 364   C C2    . DA  B 2 6   ? 65.024  38.361  26.607  1.00 2.00   ? 718 DA  D C2    1 
ATOM 365   N N3    . DA  B 2 6   ? 63.785  37.972  26.344  1.00 2.00   ? 718 DA  D N3    1 
ATOM 366   C C4    . DA  B 2 6   ? 63.737  36.662  26.123  1.00 2.00   ? 718 DA  D C4    1 
ATOM 367   P P     . DA  B 2 7   ? 58.303  38.260  23.428  1.00 9.97   ? 719 DA  D P     1 
ATOM 368   O OP1   . DA  B 2 7   ? 57.111  39.137  23.624  1.00 27.01  ? 719 DA  D OP1   1 
ATOM 369   O OP2   . DA  B 2 7   ? 58.333  37.286  22.281  1.00 22.45  ? 719 DA  D OP2   1 
ATOM 370   O "O5'" . DA  B 2 7   ? 59.597  39.191  23.348  1.00 8.50   ? 719 DA  D "O5'" 1 
ATOM 371   C "C5'" . DA  B 2 7   ? 59.772  40.258  24.249  1.00 6.33   ? 719 DA  D "C5'" 1 
ATOM 372   C "C4'" . DA  B 2 7   ? 61.011  41.033  23.889  1.00 6.98   ? 719 DA  D "C4'" 1 
ATOM 373   O "O4'" . DA  B 2 7   ? 62.136  40.150  24.078  1.00 9.11   ? 719 DA  D "O4'" 1 
ATOM 374   C "C3'" . DA  B 2 7   ? 61.102  41.545  22.441  1.00 6.43   ? 719 DA  D "C3'" 1 
ATOM 375   O "O3'" . DA  B 2 7   ? 61.679  42.872  22.448  1.00 8.68   ? 719 DA  D "O3'" 1 
ATOM 376   C "C2'" . DA  B 2 7   ? 62.026  40.535  21.775  1.00 8.96   ? 719 DA  D "C2'" 1 
ATOM 377   C "C1'" . DA  B 2 7   ? 62.956  40.173  22.921  1.00 10.09  ? 719 DA  D "C1'" 1 
ATOM 378   N N9    . DA  B 2 7   ? 63.656  38.889  22.842  1.00 26.49  ? 719 DA  D N9    1 
ATOM 379   C C8    . DA  B 2 7   ? 63.155  37.654  22.527  1.00 27.54  ? 719 DA  D C8    1 
ATOM 380   N N7    . DA  B 2 7   ? 64.047  36.690  22.597  1.00 25.91  ? 719 DA  D N7    1 
ATOM 381   C C5    . DA  B 2 7   ? 65.211  37.343  22.976  1.00 22.45  ? 719 DA  D C5    1 
ATOM 382   C C6    . DA  B 2 7   ? 66.518  36.886  23.225  1.00 22.45  ? 719 DA  D C6    1 
ATOM 383   N N6    . DA  B 2 7   ? 66.891  35.610  23.137  1.00 22.45  ? 719 DA  D N6    1 
ATOM 384   N N1    . DA  B 2 7   ? 67.445  37.799  23.579  1.00 22.45  ? 719 DA  D N1    1 
ATOM 385   C C2    . DA  B 2 7   ? 67.077  39.077  23.680  1.00 22.45  ? 719 DA  D C2    1 
ATOM 386   N N3    . DA  B 2 7   ? 65.884  39.627  23.478  1.00 22.45  ? 719 DA  D N3    1 
ATOM 387   C C4    . DA  B 2 7   ? 64.986  38.695  23.122  1.00 22.45  ? 719 DA  D C4    1 
ATOM 388   P P     . DG  B 2 8   ? 61.583  43.831  21.147  1.00 2.31   ? 720 DG  D P     1 
ATOM 389   O OP1   . DG  B 2 8   ? 61.186  45.188  21.594  1.00 20.01  ? 720 DG  D OP1   1 
ATOM 390   O OP2   . DG  B 2 8   ? 60.825  43.167  20.057  1.00 23.61  ? 720 DG  D OP2   1 
ATOM 391   O "O5'" . DG  B 2 8   ? 63.098  43.908  20.699  1.00 2.00   ? 720 DG  D "O5'" 1 
ATOM 392   C "C5'" . DG  B 2 8   ? 64.077  44.242  21.651  1.00 2.00   ? 720 DG  D "C5'" 1 
ATOM 393   C "C4'" . DG  B 2 8   ? 65.449  43.897  21.139  1.00 2.00   ? 720 DG  D "C4'" 1 
ATOM 394   O "O4'" . DG  B 2 8   ? 65.698  42.486  21.280  1.00 2.00   ? 720 DG  D "O4'" 1 
ATOM 395   C "C3'" . DG  B 2 8   ? 65.728  44.234  19.675  1.00 2.00   ? 720 DG  D "C3'" 1 
ATOM 396   O "O3'" . DG  B 2 8   ? 67.023  44.853  19.609  1.00 2.00   ? 720 DG  D "O3'" 1 
ATOM 397   C "C2'" . DG  B 2 8   ? 65.730  42.865  19.013  1.00 2.00   ? 720 DG  D "C2'" 1 
ATOM 398   C "C1'" . DG  B 2 8   ? 66.350  42.043  20.122  1.00 2.00   ? 720 DG  D "C1'" 1 
ATOM 399   N N9    . DG  B 2 8   ? 66.237  40.586  20.057  1.00 17.01  ? 720 DG  D N9    1 
ATOM 400   C C8    . DG  B 2 8   ? 65.102  39.826  19.909  1.00 15.40  ? 720 DG  D C8    1 
ATOM 401   N N7    . DG  B 2 8   ? 65.349  38.544  19.909  1.00 15.40  ? 720 DG  D N7    1 
ATOM 402   C C5    . DG  B 2 8   ? 66.719  38.458  20.062  1.00 15.40  ? 720 DG  D C5    1 
ATOM 403   C C6    . DG  B 2 8   ? 67.553  37.335  20.132  1.00 17.03  ? 720 DG  D C6    1 
ATOM 404   O O6    . DG  B 2 8   ? 67.244  36.145  20.071  1.00 16.23  ? 720 DG  D O6    1 
ATOM 405   N N1    . DG  B 2 8   ? 68.884  37.701  20.293  1.00 15.40  ? 720 DG  D N1    1 
ATOM 406   C C2    . DG  B 2 8   ? 69.342  38.980  20.365  1.00 15.40  ? 720 DG  D C2    1 
ATOM 407   N N2    . DG  B 2 8   ? 70.658  39.121  20.514  1.00 15.40  ? 720 DG  D N2    1 
ATOM 408   N N3    . DG  B 2 8   ? 68.573  40.040  20.298  1.00 15.40  ? 720 DG  D N3    1 
ATOM 409   C C4    . DG  B 2 8   ? 67.281  39.707  20.150  1.00 15.40  ? 720 DG  D C4    1 
ATOM 410   P P     . DT  B 2 9   ? 67.635  45.296  18.194  1.00 20.43  ? 721 DT  D P     1 
ATOM 411   O OP1   . DT  B 2 9   ? 68.225  46.647  18.374  1.00 36.35  ? 721 DT  D OP1   1 
ATOM 412   O OP2   . DT  B 2 9   ? 66.617  45.070  17.133  1.00 36.67  ? 721 DT  D OP2   1 
ATOM 413   O "O5'" . DT  B 2 9   ? 68.824  44.263  18.001  1.00 15.56  ? 721 DT  D "O5'" 1 
ATOM 414   C "C5'" . DT  B 2 9   ? 69.756  44.095  19.052  1.00 11.26  ? 721 DT  D "C5'" 1 
ATOM 415   C "C4'" . DT  B 2 9   ? 70.909  43.222  18.622  1.00 13.93  ? 721 DT  D "C4'" 1 
ATOM 416   O "O4'" . DT  B 2 9   ? 70.551  41.821  18.639  1.00 14.53  ? 721 DT  D "O4'" 1 
ATOM 417   C "C3'" . DT  B 2 9   ? 71.467  43.502  17.235  1.00 14.28  ? 721 DT  D "C3'" 1 
ATOM 418   O "O3'" . DT  B 2 9   ? 72.880  43.436  17.330  1.00 14.36  ? 721 DT  D "O3'" 1 
ATOM 419   C "C2'" . DT  B 2 9   ? 70.942  42.338  16.407  1.00 14.81  ? 721 DT  D "C2'" 1 
ATOM 420   C "C1'" . DT  B 2 9   ? 70.940  41.212  17.420  1.00 11.83  ? 721 DT  D "C1'" 1 
ATOM 421   N N1    . DT  B 2 9   ? 70.009  40.090  17.175  1.00 22.75  ? 721 DT  D N1    1 
ATOM 422   C C2    . DT  B 2 9   ? 70.501  38.791  17.227  1.00 23.12  ? 721 DT  D C2    1 
ATOM 423   O O2    . DT  B 2 9   ? 71.679  38.508  17.405  1.00 25.52  ? 721 DT  D O2    1 
ATOM 424   N N3    . DT  B 2 9   ? 69.558  37.823  17.055  1.00 19.98  ? 721 DT  D N3    1 
ATOM 425   C C4    . DT  B 2 9   ? 68.214  38.003  16.827  1.00 19.98  ? 721 DT  D C4    1 
ATOM 426   O O4    . DT  B 2 9   ? 67.481  37.018  16.700  1.00 19.98  ? 721 DT  D O4    1 
ATOM 427   C C5    . DT  B 2 9   ? 67.774  39.381  16.761  1.00 20.60  ? 721 DT  D C5    1 
ATOM 428   C C7    . DT  B 2 9   ? 66.329  39.677  16.510  1.00 19.98  ? 721 DT  D C7    1 
ATOM 429   C C6    . DT  B 2 9   ? 68.684  40.341  16.932  1.00 19.98  ? 721 DT  D C6    1 
ATOM 430   P P     . DC  B 2 10  ? 73.776  44.466  16.505  1.00 5.80   ? 722 DC  D P     1 
ATOM 431   O OP1   . DC  B 2 10  ? 74.632  45.261  17.435  1.00 8.94   ? 722 DC  D OP1   1 
ATOM 432   O OP2   . DC  B 2 10  ? 72.853  45.143  15.566  1.00 13.11  ? 722 DC  D OP2   1 
ATOM 433   O "O5'" . DC  B 2 10  ? 74.709  43.486  15.697  1.00 3.07   ? 722 DC  D "O5'" 1 
ATOM 434   C "C5'" . DC  B 2 10  ? 74.258  42.178  15.478  1.00 4.61   ? 722 DC  D "C5'" 1 
ATOM 435   C "C4'" . DC  B 2 10  ? 75.395  41.199  15.596  1.00 8.58   ? 722 DC  D "C4'" 1 
ATOM 436   O "O4'" . DC  B 2 10  ? 74.802  39.898  15.807  1.00 13.26  ? 722 DC  D "O4'" 1 
ATOM 437   C "C3'" . DC  B 2 10  ? 76.223  41.077  14.329  1.00 6.43   ? 722 DC  D "C3'" 1 
ATOM 438   O "O3'" . DC  B 2 10  ? 77.525  40.633  14.697  1.00 7.36   ? 722 DC  D "O3'" 1 
ATOM 439   C "C2'" . DC  B 2 10  ? 75.440  40.045  13.537  1.00 8.07   ? 722 DC  D "C2'" 1 
ATOM 440   C "C1'" . DC  B 2 10  ? 74.845  39.137  14.618  1.00 12.43  ? 722 DC  D "C1'" 1 
ATOM 441   N N1    . DC  B 2 10  ? 73.477  38.668  14.370  1.00 20.02  ? 722 DC  D N1    1 
ATOM 442   C C2    . DC  B 2 10  ? 73.181  37.323  14.588  1.00 22.67  ? 722 DC  D C2    1 
ATOM 443   O O2    . DC  B 2 10  ? 74.093  36.564  14.966  1.00 24.23  ? 722 DC  D O2    1 
ATOM 444   N N3    . DC  B 2 10  ? 71.909  36.882  14.379  1.00 23.07  ? 722 DC  D N3    1 
ATOM 445   C C4    . DC  B 2 10  ? 70.969  37.733  13.966  1.00 21.77  ? 722 DC  D C4    1 
ATOM 446   N N4    . DC  B 2 10  ? 69.736  37.265  13.779  1.00 20.71  ? 722 DC  D N4    1 
ATOM 447   C C5    . DC  B 2 10  ? 71.253  39.106  13.729  1.00 20.20  ? 722 DC  D C5    1 
ATOM 448   C C6    . DC  B 2 10  ? 72.507  39.526  13.942  1.00 20.23  ? 722 DC  D C6    1 
ATOM 449   P P     . DC  B 2 11  ? 78.643  40.372  13.577  1.00 33.48  ? 723 DC  D P     1 
ATOM 450   O OP1   . DC  B 2 11  ? 79.912  40.304  14.321  1.00 14.47  ? 723 DC  D OP1   1 
ATOM 451   O OP2   . DC  B 2 11  ? 78.496  41.340  12.455  1.00 18.48  ? 723 DC  D OP2   1 
ATOM 452   O "O5'" . DC  B 2 11  ? 78.298  38.932  12.998  1.00 34.56  ? 723 DC  D "O5'" 1 
ATOM 453   C "C5'" . DC  B 2 11  ? 78.796  37.757  13.618  1.00 38.03  ? 723 DC  D "C5'" 1 
ATOM 454   C "C4'" . DC  B 2 11  ? 78.392  36.538  12.821  1.00 42.25  ? 723 DC  D "C4'" 1 
ATOM 455   O "O4'" . DC  B 2 11  ? 76.945  36.435  12.805  1.00 41.92  ? 723 DC  D "O4'" 1 
ATOM 456   C "C3'" . DC  B 2 11  ? 78.828  36.539  11.349  1.00 44.11  ? 723 DC  D "C3'" 1 
ATOM 457   O "O3'" . DC  B 2 11  ? 79.233  35.209  10.944  1.00 50.43  ? 723 DC  D "O3'" 1 
ATOM 458   C "C2'" . DC  B 2 11  ? 77.554  36.938  10.624  1.00 43.87  ? 723 DC  D "C2'" 1 
ATOM 459   C "C1'" . DC  B 2 11  ? 76.526  36.228  11.475  1.00 40.77  ? 723 DC  D "C1'" 1 
ATOM 460   N N1    . DC  B 2 11  ? 75.135  36.674  11.338  1.00 21.08  ? 723 DC  D N1    1 
ATOM 461   C C2    . DC  B 2 11  ? 74.144  35.713  11.362  1.00 19.26  ? 723 DC  D C2    1 
ATOM 462   O O2    . DC  B 2 11  ? 74.473  34.533  11.486  1.00 13.90  ? 723 DC  D O2    1 
ATOM 463   N N3    . DC  B 2 11  ? 72.855  36.078  11.246  1.00 18.97  ? 723 DC  D N3    1 
ATOM 464   C C4    . DC  B 2 11  ? 72.539  37.363  11.097  1.00 22.47  ? 723 DC  D C4    1 
ATOM 465   N N4    . DC  B 2 11  ? 71.251  37.674  10.976  1.00 23.62  ? 723 DC  D N4    1 
ATOM 466   C C5    . DC  B 2 11  ? 73.534  38.379  11.064  1.00 24.67  ? 723 DC  D C5    1 
ATOM 467   C C6    . DC  B 2 11  ? 74.812  37.992  11.187  1.00 24.69  ? 723 DC  D C6    1 
ATOM 468   P P     . DC  B 2 12  ? 80.361  35.013  9.798   1.00 55.90  ? 724 DC  D P     1 
ATOM 469   O OP1   . DC  B 2 12  ? 81.278  33.949  10.292  1.00 57.78  ? 724 DC  D OP1   1 
ATOM 470   O OP2   . DC  B 2 12  ? 80.906  36.344  9.408   1.00 59.48  ? 724 DC  D OP2   1 
ATOM 471   O "O5'" . DC  B 2 12  ? 79.560  34.454  8.535   1.00 55.11  ? 724 DC  D "O5'" 1 
ATOM 472   C "C5'" . DC  B 2 12  ? 79.546  33.061  8.225   1.00 57.31  ? 724 DC  D "C5'" 1 
ATOM 473   C "C4'" . DC  B 2 12  ? 78.597  32.346  9.155   1.00 60.43  ? 724 DC  D "C4'" 1 
ATOM 474   O "O4'" . DC  B 2 12  ? 77.416  33.168  9.298   1.00 63.71  ? 724 DC  D "O4'" 1 
ATOM 475   C "C3'" . DC  B 2 12  ? 78.093  30.981  8.689   1.00 63.64  ? 724 DC  D "C3'" 1 
ATOM 476   O "O3'" . DC  B 2 12  ? 77.599  30.240  9.834   1.00 66.29  ? 724 DC  D "O3'" 1 
ATOM 477   C "C2'" . DC  B 2 12  ? 76.831  31.359  7.936   1.00 64.06  ? 724 DC  D "C2'" 1 
ATOM 478   C "C1'" . DC  B 2 12  ? 76.288  32.426  8.871   1.00 65.12  ? 724 DC  D "C1'" 1 
ATOM 479   N N1    . DC  B 2 12  ? 75.300  33.370  8.332   1.00 68.52  ? 724 DC  D N1    1 
ATOM 480   C C2    . DC  B 2 12  ? 74.259  32.882  7.555   1.00 70.00  ? 724 DC  D C2    1 
ATOM 481   O O2    . DC  B 2 12  ? 74.223  31.660  7.300   1.00 71.59  ? 724 DC  D O2    1 
ATOM 482   N N3    . DC  B 2 12  ? 73.319  33.744  7.096   1.00 69.54  ? 724 DC  D N3    1 
ATOM 483   C C4    . DC  B 2 12  ? 73.404  35.043  7.387   1.00 67.64  ? 724 DC  D C4    1 
ATOM 484   N N4    . DC  B 2 12  ? 72.454  35.854  6.922   1.00 64.29  ? 724 DC  D N4    1 
ATOM 485   C C5    . DC  B 2 12  ? 74.466  35.567  8.167   1.00 68.81  ? 724 DC  D C5    1 
ATOM 486   C C6    . DC  B 2 12  ? 75.385  34.705  8.611   1.00 68.11  ? 724 DC  D C6    1 
ATOM 487   O "O5'" . DT  C 1 1   ? 107.628 39.708  -4.828  1.00 101.39 ? 801 DT  G "O5'" 1 
ATOM 488   C "C5'" . DT  C 1 1   ? 107.251 38.628  -5.683  1.00 108.80 ? 801 DT  G "C5'" 1 
ATOM 489   C "C4'" . DT  C 1 1   ? 108.257 37.499  -5.714  1.00 110.39 ? 801 DT  G "C4'" 1 
ATOM 490   O "O4'" . DT  C 1 1   ? 107.791 36.475  -6.624  1.00 111.78 ? 801 DT  G "O4'" 1 
ATOM 491   C "C3'" . DT  C 1 1   ? 109.645 37.889  -6.214  1.00 113.95 ? 801 DT  G "C3'" 1 
ATOM 492   O "O3'" . DT  C 1 1   ? 110.625 37.062  -5.586  1.00 113.95 ? 801 DT  G "O3'" 1 
ATOM 493   C "C2'" . DT  C 1 1   ? 109.578 37.563  -7.694  1.00 113.95 ? 801 DT  G "C2'" 1 
ATOM 494   C "C1'" . DT  C 1 1   ? 108.714 36.316  -7.698  1.00 112.41 ? 801 DT  G "C1'" 1 
ATOM 495   N N1    . DT  C 1 1   ? 107.936 36.106  -8.937  1.00 125.23 ? 801 DT  G N1    1 
ATOM 496   C C2    . DT  C 1 1   ? 108.317 35.083  -9.780  1.00 125.23 ? 801 DT  G C2    1 
ATOM 497   O O2    . DT  C 1 1   ? 109.276 34.359  -9.563  1.00 125.23 ? 801 DT  G O2    1 
ATOM 498   N N3    . DT  C 1 1   ? 107.526 34.937  -10.896 1.00 125.23 ? 801 DT  G N3    1 
ATOM 499   C C4    . DT  C 1 1   ? 106.423 35.691  -11.245 1.00 125.23 ? 801 DT  G C4    1 
ATOM 500   O O4    . DT  C 1 1   ? 105.807 35.432  -12.275 1.00 125.23 ? 801 DT  G O4    1 
ATOM 501   C C5    . DT  C 1 1   ? 106.087 36.754  -10.322 1.00 125.23 ? 801 DT  G C5    1 
ATOM 502   C C7    . DT  C 1 1   ? 104.912 37.630  -10.617 1.00 122.54 ? 801 DT  G C7    1 
ATOM 503   C C6    . DT  C 1 1   ? 106.852 36.907  -9.232  1.00 124.34 ? 801 DT  G C6    1 
ATOM 504   P P     . DG  C 1 2   ? 112.155 37.543  -5.528  1.00 121.81 ? 802 DG  G P     1 
ATOM 505   O OP1   . DG  C 1 2   ? 112.430 38.407  -6.703  1.00 129.26 ? 802 DG  G OP1   1 
ATOM 506   O OP2   . DG  C 1 2   ? 112.968 36.318  -5.314  1.00 126.04 ? 802 DG  G OP2   1 
ATOM 507   O "O5'" . DG  C 1 2   ? 112.233 38.449  -4.218  1.00 121.81 ? 802 DG  G "O5'" 1 
ATOM 508   C "C5'" . DG  C 1 2   ? 111.711 39.780  -4.210  1.00 121.81 ? 802 DG  G "C5'" 1 
ATOM 509   C "C4'" . DG  C 1 2   ? 111.328 40.189  -2.804  1.00 121.43 ? 802 DG  G "C4'" 1 
ATOM 510   O "O4'" . DG  C 1 2   ? 110.281 39.315  -2.325  1.00 119.20 ? 802 DG  G "O4'" 1 
ATOM 511   C "C3'" . DG  C 1 2   ? 112.451 40.096  -1.774  1.00 121.80 ? 802 DG  G "C3'" 1 
ATOM 512   O "O3'" . DG  C 1 2   ? 112.337 41.150  -0.811  1.00 121.67 ? 802 DG  G "O3'" 1 
ATOM 513   C "C2'" . DG  C 1 2   ? 112.247 38.730  -1.140  1.00 115.85 ? 802 DG  G "C2'" 1 
ATOM 514   C "C1'" . DG  C 1 2   ? 110.749 38.470  -1.278  1.00 115.78 ? 802 DG  G "C1'" 1 
ATOM 515   N N9    . DG  C 1 2   ? 110.442 37.101  -1.670  1.00 120.33 ? 802 DG  G N9    1 
ATOM 516   C C8    . DG  C 1 2   ? 111.312 36.191  -2.222  1.00 118.53 ? 802 DG  G C8    1 
ATOM 517   N N7    . DG  C 1 2   ? 110.750 35.052  -2.515  1.00 117.81 ? 802 DG  G N7    1 
ATOM 518   C C5    . DG  C 1 2   ? 109.427 35.209  -2.124  1.00 122.22 ? 802 DG  G C5    1 
ATOM 519   C C6    . DG  C 1 2   ? 108.335 34.303  -2.197  1.00 123.95 ? 802 DG  G C6    1 
ATOM 520   O O6    . DG  C 1 2   ? 108.317 33.148  -2.640  1.00 123.93 ? 802 DG  G O6    1 
ATOM 521   N N1    . DG  C 1 2   ? 107.172 34.868  -1.688  1.00 129.81 ? 802 DG  G N1    1 
ATOM 522   C C2    . DG  C 1 2   ? 107.067 36.137  -1.176  1.00 129.87 ? 802 DG  G C2    1 
ATOM 523   N N2    . DG  C 1 2   ? 105.851 36.494  -0.735  1.00 129.97 ? 802 DG  G N2    1 
ATOM 524   N N3    . DG  C 1 2   ? 108.078 36.992  -1.103  1.00 129.27 ? 802 DG  G N3    1 
ATOM 525   C C4    . DG  C 1 2   ? 109.222 36.464  -1.592  1.00 123.18 ? 802 DG  G C4    1 
ATOM 526   P P     . DG  C 1 3   ? 113.642 41.638  -0.007  1.00 115.38 ? 803 DG  G P     1 
ATOM 527   O OP1   . DG  C 1 3   ? 113.582 43.119  0.112   1.00 120.25 ? 803 DG  G OP1   1 
ATOM 528   O OP2   . DG  C 1 3   ? 114.831 41.001  -0.629  1.00 121.47 ? 803 DG  G OP2   1 
ATOM 529   O "O5'" . DG  C 1 3   ? 113.459 41.002  1.444   1.00 115.43 ? 803 DG  G "O5'" 1 
ATOM 530   C "C5'" . DG  C 1 3   ? 112.762 41.714  2.464   1.00 114.00 ? 803 DG  G "C5'" 1 
ATOM 531   C "C4'" . DG  C 1 3   ? 112.339 40.780  3.574   1.00 102.08 ? 803 DG  G "C4'" 1 
ATOM 532   O "O4'" . DG  C 1 3   ? 111.391 39.803  3.074   1.00 100.22 ? 803 DG  G "O4'" 1 
ATOM 533   C "C3'" . DG  C 1 3   ? 113.449 39.973  4.257   1.00 98.12  ? 803 DG  G "C3'" 1 
ATOM 534   O "O3'" . DG  C 1 3   ? 113.156 39.909  5.659   1.00 97.65  ? 803 DG  G "O3'" 1 
ATOM 535   C "C2'" . DG  C 1 3   ? 113.280 38.589  3.658   1.00 101.97 ? 803 DG  G "C2'" 1 
ATOM 536   C "C1'" . DG  C 1 3   ? 111.771 38.530  3.564   1.00 105.57 ? 803 DG  G "C1'" 1 
ATOM 537   N N9    . DG  C 1 3   ? 111.203 37.499  2.700   1.00 119.82 ? 803 DG  G N9    1 
ATOM 538   C C8    . DG  C 1 3   ? 111.835 36.795  1.706   1.00 121.47 ? 803 DG  G C8    1 
ATOM 539   N N7    . DG  C 1 3   ? 111.062 35.908  1.135   1.00 121.47 ? 803 DG  G N7    1 
ATOM 540   C C5    . DG  C 1 3   ? 109.840 36.042  1.786   1.00 121.45 ? 803 DG  G C5    1 
ATOM 541   C C6    . DG  C 1 3   ? 108.608 35.345  1.601   1.00 121.47 ? 803 DG  G C6    1 
ATOM 542   O O6    . DG  C 1 3   ? 108.343 34.439  0.801   1.00 121.47 ? 803 DG  G O6    1 
ATOM 543   N N1    . DG  C 1 3   ? 107.627 35.803  2.474   1.00 121.47 ? 803 DG  G N1    1 
ATOM 544   C C2    . DG  C 1 3   ? 107.800 36.799  3.406   1.00 121.47 ? 803 DG  G C2    1 
ATOM 545   N N2    . DG  C 1 3   ? 106.732 37.101  4.158   1.00 119.22 ? 803 DG  G N2    1 
ATOM 546   N N3    . DG  C 1 3   ? 108.937 37.450  3.589   1.00 121.35 ? 803 DG  G N3    1 
ATOM 547   C C4    . DG  C 1 3   ? 109.909 37.026  2.752   1.00 121.44 ? 803 DG  G C4    1 
ATOM 548   P P     . DG  C 1 4   ? 114.202 39.229  6.673   1.00 65.59  ? 804 DG  G P     1 
ATOM 549   O OP1   . DG  C 1 4   ? 114.869 40.309  7.439   1.00 84.92  ? 804 DG  G OP1   1 
ATOM 550   O OP2   . DG  C 1 4   ? 115.019 38.240  5.927   1.00 91.91  ? 804 DG  G OP2   1 
ATOM 551   O "O5'" . DG  C 1 4   ? 113.275 38.432  7.688   1.00 68.02  ? 804 DG  G "O5'" 1 
ATOM 552   C "C5'" . DG  C 1 4   ? 112.168 39.067  8.315   1.00 66.95  ? 804 DG  G "C5'" 1 
ATOM 553   C "C4'" . DG  C 1 4   ? 111.202 38.024  8.818   1.00 66.08  ? 804 DG  G "C4'" 1 
ATOM 554   O "O4'" . DG  C 1 4   ? 110.822 37.205  7.689   1.00 68.83  ? 804 DG  G "O4'" 1 
ATOM 555   C "C3'" . DG  C 1 4   ? 111.806 37.069  9.847   1.00 63.93  ? 804 DG  G "C3'" 1 
ATOM 556   O "O3'" . DG  C 1 4   ? 110.804 36.654  10.778  1.00 65.12  ? 804 DG  G "O3'" 1 
ATOM 557   C "C2'" . DG  C 1 4   ? 112.257 35.892  9.007   1.00 69.88  ? 804 DG  G "C2'" 1 
ATOM 558   C "C1'" . DG  C 1 4   ? 111.217 35.860  7.903   1.00 68.59  ? 804 DG  G "C1'" 1 
ATOM 559   N N9    . DG  C 1 4   ? 111.724 35.335  6.641   1.00 95.09  ? 804 DG  G N9    1 
ATOM 560   C C8    . DG  C 1 4   ? 112.999 35.452  6.150   1.00 94.69  ? 804 DG  G C8    1 
ATOM 561   N N7    . DG  C 1 4   ? 113.157 34.872  4.993   1.00 100.03 ? 804 DG  G N7    1 
ATOM 562   C C5    . DG  C 1 4   ? 111.908 34.344  4.702   1.00 104.52 ? 804 DG  G C5    1 
ATOM 563   C C6    . DG  C 1 4   ? 111.464 33.605  3.576   1.00 105.08 ? 804 DG  G C6    1 
ATOM 564   O O6    . DG  C 1 4   ? 112.106 33.263  2.576   1.00 103.53 ? 804 DG  G O6    1 
ATOM 565   N N1    . DG  C 1 4   ? 110.120 33.261  3.689   1.00 104.07 ? 804 DG  G N1    1 
ATOM 566   C C2    . DG  C 1 4   ? 109.310 33.585  4.748   1.00 107.98 ? 804 DG  G C2    1 
ATOM 567   N N2    . DG  C 1 4   ? 108.041 33.161  4.672   1.00 109.40 ? 804 DG  G N2    1 
ATOM 568   N N3    . DG  C 1 4   ? 109.713 34.274  5.802   1.00 109.08 ? 804 DG  G N3    1 
ATOM 569   C C4    . DG  C 1 4   ? 111.014 34.619  5.712   1.00 103.47 ? 804 DG  G C4    1 
ATOM 570   P P     . DA  C 1 5   ? 111.221 36.241  12.269  1.00 66.22  ? 805 DA  G P     1 
ATOM 571   O OP1   . DA  C 1 5   ? 110.428 37.048  13.220  1.00 89.14  ? 805 DA  G OP1   1 
ATOM 572   O OP2   . DA  C 1 5   ? 112.700 36.264  12.340  1.00 94.31  ? 805 DA  G OP2   1 
ATOM 573   O "O5'" . DA  C 1 5   ? 110.728 34.737  12.392  1.00 65.68  ? 805 DA  G "O5'" 1 
ATOM 574   C "C5'" . DA  C 1 5   ? 109.347 34.418  12.313  1.00 68.10  ? 805 DA  G "C5'" 1 
ATOM 575   C "C4'" . DA  C 1 5   ? 109.168 32.934  12.108  1.00 63.41  ? 805 DA  G "C4'" 1 
ATOM 576   O "O4'" . DA  C 1 5   ? 109.591 32.558  10.773  1.00 66.03  ? 805 DA  G "O4'" 1 
ATOM 577   C "C3'" . DA  C 1 5   ? 109.977 32.065  13.072  1.00 49.48  ? 805 DA  G "C3'" 1 
ATOM 578   O "O3'" . DA  C 1 5   ? 109.198 30.948  13.480  1.00 28.14  ? 805 DA  G "O3'" 1 
ATOM 579   C "C2'" . DA  C 1 5   ? 111.121 31.566  12.214  1.00 48.42  ? 805 DA  G "C2'" 1 
ATOM 580   C "C1'" . DA  C 1 5   ? 110.436 31.428  10.870  1.00 58.84  ? 805 DA  G "C1'" 1 
ATOM 581   N N9    . DA  C 1 5   ? 111.328 31.412  9.711   1.00 76.04  ? 805 DA  G N9    1 
ATOM 582   C C8    . DA  C 1 5   ? 112.680 31.643  9.674   1.00 76.41  ? 805 DA  G C8    1 
ATOM 583   N N7    . DA  C 1 5   ? 113.206 31.509  8.481   1.00 78.63  ? 805 DA  G N7    1 
ATOM 584   C C5    . DA  C 1 5   ? 112.125 31.179  7.676   1.00 72.75  ? 805 DA  G C5    1 
ATOM 585   C C6    . DA  C 1 5   ? 112.015 30.909  6.302   1.00 66.91  ? 805 DA  G C6    1 
ATOM 586   N N6    . DA  C 1 5   ? 113.048 30.922  5.460   1.00 64.94  ? 805 DA  G N6    1 
ATOM 587   N N1    . DA  C 1 5   ? 110.790 30.619  5.814   1.00 66.07  ? 805 DA  G N1    1 
ATOM 588   C C2    . DA  C 1 5   ? 109.755 30.605  6.655   1.00 67.66  ? 805 DA  G C2    1 
ATOM 589   N N3    . DA  C 1 5   ? 109.730 30.840  7.962   1.00 72.94  ? 805 DA  G N3    1 
ATOM 590   C C4    . DA  C 1 5   ? 110.962 31.125  8.417   1.00 74.39  ? 805 DA  G C4    1 
ATOM 591   P P     . DC  C 1 6   ? 108.547 30.939  14.945  1.00 44.24  ? 806 DC  G P     1 
ATOM 592   O OP1   . DC  C 1 6   ? 107.445 31.945  14.966  1.00 60.49  ? 806 DC  G OP1   1 
ATOM 593   O OP2   . DC  C 1 6   ? 109.662 31.035  15.926  1.00 40.46  ? 806 DC  G OP2   1 
ATOM 594   O "O5'" . DC  C 1 6   ? 107.895 29.494  15.081  1.00 34.40  ? 806 DC  G "O5'" 1 
ATOM 595   C "C5'" . DC  C 1 6   ? 108.687 28.349  15.362  1.00 39.50  ? 806 DC  G "C5'" 1 
ATOM 596   C "C4'" . DC  C 1 6   ? 108.361 27.251  14.378  1.00 43.03  ? 806 DC  G "C4'" 1 
ATOM 597   O "O4'" . DC  C 1 6   ? 108.833 27.642  13.061  1.00 54.07  ? 806 DC  G "O4'" 1 
ATOM 598   C "C3'" . DC  C 1 6   ? 109.044 25.924  14.697  1.00 33.62  ? 806 DC  G "C3'" 1 
ATOM 599   O "O3'" . DC  C 1 6   ? 108.156 24.828  14.482  1.00 36.51  ? 806 DC  G "O3'" 1 
ATOM 600   C "C2'" . DC  C 1 6   ? 110.209 25.878  13.730  1.00 38.83  ? 806 DC  G "C2'" 1 
ATOM 601   C "C1'" . DC  C 1 6   ? 109.684 26.635  12.531  1.00 62.47  ? 806 DC  G "C1'" 1 
ATOM 602   N N1    . DC  C 1 6   ? 110.755 27.278  11.742  1.00 60.06  ? 806 DC  G N1    1 
ATOM 603   C C2    . DC  C 1 6   ? 110.443 27.871  10.510  1.00 57.11  ? 806 DC  G C2    1 
ATOM 604   O O2    . DC  C 1 6   ? 109.259 27.882  10.125  1.00 62.07  ? 806 DC  G O2    1 
ATOM 605   N N3    . DC  C 1 6   ? 111.440 28.416  9.771   1.00 42.48  ? 806 DC  G N3    1 
ATOM 606   C C4    . DC  C 1 6   ? 112.696 28.396  10.224  1.00 54.79  ? 806 DC  G C4    1 
ATOM 607   N N4    . DC  C 1 6   ? 113.643 28.938  9.465   1.00 65.66  ? 806 DC  G N4    1 
ATOM 608   C C5    . DC  C 1 6   ? 113.036 27.817  11.476  1.00 52.74  ? 806 DC  G C5    1 
ATOM 609   C C6    . DC  C 1 6   ? 112.047 27.279  12.196  1.00 54.30  ? 806 DC  G C6    1 
ATOM 610   P P     . DT  C 1 7   ? 108.396 23.450  15.272  1.00 62.14  ? 807 DT  G P     1 
ATOM 611   O OP1   . DT  C 1 7   ? 107.097 22.925  15.780  1.00 36.22  ? 807 DT  G OP1   1 
ATOM 612   O OP2   . DT  C 1 7   ? 109.513 23.676  16.225  1.00 63.51  ? 807 DT  G OP2   1 
ATOM 613   O "O5'" . DT  C 1 7   ? 108.918 22.481  14.127  1.00 68.74  ? 807 DT  G "O5'" 1 
ATOM 614   C "C5'" . DT  C 1 7   ? 109.849 22.950  13.171  1.00 62.15  ? 807 DT  G "C5'" 1 
ATOM 615   C "C4'" . DT  C 1 7   ? 110.069 21.918  12.095  1.00 56.54  ? 807 DT  G "C4'" 1 
ATOM 616   O "O4'" . DT  C 1 7   ? 111.060 22.446  11.183  1.00 60.55  ? 807 DT  G "O4'" 1 
ATOM 617   C "C3'" . DT  C 1 7   ? 110.648 20.604  12.605  1.00 41.27  ? 807 DT  G "C3'" 1 
ATOM 618   O "O3'" . DT  C 1 7   ? 110.263 19.547  11.715  1.00 56.13  ? 807 DT  G "O3'" 1 
ATOM 619   C "C2'" . DT  C 1 7   ? 112.143 20.865  12.568  1.00 56.36  ? 807 DT  G "C2'" 1 
ATOM 620   C "C1'" . DT  C 1 7   ? 112.298 21.753  11.338  1.00 57.45  ? 807 DT  G "C1'" 1 
ATOM 621   N N1    . DT  C 1 7   ? 113.370 22.771  11.438  1.00 75.35  ? 807 DT  G N1    1 
ATOM 622   C C2    . DT  C 1 7   ? 114.285 22.878  10.409  1.00 65.05  ? 807 DT  G C2    1 
ATOM 623   O O2    . DT  C 1 7   ? 114.281 22.154  9.428   1.00 67.08  ? 807 DT  G O2    1 
ATOM 624   N N3    . DT  C 1 7   ? 115.212 23.876  10.571  1.00 47.32  ? 807 DT  G N3    1 
ATOM 625   C C4    . DT  C 1 7   ? 115.314 24.755  11.631  1.00 66.40  ? 807 DT  G C4    1 
ATOM 626   O O4    . DT  C 1 7   ? 116.195 25.611  11.633  1.00 69.71  ? 807 DT  G O4    1 
ATOM 627   C C5    . DT  C 1 7   ? 114.332 24.574  12.679  1.00 79.86  ? 807 DT  G C5    1 
ATOM 628   C C7    . DT  C 1 7   ? 114.363 25.474  13.873  1.00 79.67  ? 807 DT  G C7    1 
ATOM 629   C C6    . DT  C 1 7   ? 113.429 23.602  12.534  1.00 76.22  ? 807 DT  G C6    1 
ATOM 630   P P     . DT  C 1 8   ? 110.742 18.045  12.000  1.00 70.01  ? 808 DT  G P     1 
ATOM 631   O OP1   . DT  C 1 8   ? 110.065 17.165  11.008  1.00 81.93  ? 808 DT  G OP1   1 
ATOM 632   O OP2   . DT  C 1 8   ? 110.581 17.772  13.448  1.00 74.26  ? 808 DT  G OP2   1 
ATOM 633   O "O5'" . DT  C 1 8   ? 112.295 18.085  11.652  1.00 74.31  ? 808 DT  G "O5'" 1 
ATOM 634   C "C5'" . DT  C 1 8   ? 112.717 18.147  10.294  1.00 73.72  ? 808 DT  G "C5'" 1 
ATOM 635   C "C4'" . DT  C 1 8   ? 114.225 18.128  10.202  1.00 74.13  ? 808 DT  G "C4'" 1 
ATOM 636   O "O4'" . DT  C 1 8   ? 114.772 19.386  10.665  1.00 72.06  ? 808 DT  G "O4'" 1 
ATOM 637   C "C3'" . DT  C 1 8   ? 114.943 17.033  10.996  1.00 77.90  ? 808 DT  G "C3'" 1 
ATOM 638   O "O3'" . DT  C 1 8   ? 116.039 16.538  10.214  1.00 85.08  ? 808 DT  G "O3'" 1 
ATOM 639   C "C2'" . DT  C 1 8   ? 115.484 17.790  12.197  1.00 72.45  ? 808 DT  G "C2'" 1 
ATOM 640   C "C1'" . DT  C 1 8   ? 115.837 19.118  11.558  1.00 70.99  ? 808 DT  G "C1'" 1 
ATOM 641   N N1    . DT  C 1 8   ? 115.996 20.280  12.462  1.00 67.30  ? 808 DT  G N1    1 
ATOM 642   C C2    . DT  C 1 8   ? 116.797 21.314  12.028  1.00 69.85  ? 808 DT  G C2    1 
ATOM 643   O O2    . DT  C 1 8   ? 117.363 21.313  10.949  1.00 67.13  ? 808 DT  G O2    1 
ATOM 644   N N3    . DT  C 1 8   ? 116.915 22.357  12.914  1.00 69.13  ? 808 DT  G N3    1 
ATOM 645   C C4    . DT  C 1 8   ? 116.330 22.466  14.157  1.00 69.30  ? 808 DT  G C4    1 
ATOM 646   O O4    . DT  C 1 8   ? 116.535 23.459  14.841  1.00 66.12  ? 808 DT  G O4    1 
ATOM 647   C C5    . DT  C 1 8   ? 115.501 21.351  14.548  1.00 68.82  ? 808 DT  G C5    1 
ATOM 648   C C7    . DT  C 1 8   ? 114.824 21.383  15.881  1.00 70.90  ? 808 DT  G C7    1 
ATOM 649   C C6    . DT  C 1 8   ? 115.376 20.326  13.691  1.00 67.29  ? 808 DT  G C6    1 
ATOM 650   P P     . DT  C 1 9   ? 116.479 14.994  10.323  1.00 99.35  ? 809 DT  G P     1 
ATOM 651   O OP1   . DT  C 1 9   ? 115.581 14.197  9.452   1.00 96.75  ? 809 DT  G OP1   1 
ATOM 652   O OP2   . DT  C 1 9   ? 116.604 14.645  11.766  1.00 75.13  ? 809 DT  G OP2   1 
ATOM 653   O "O5'" . DT  C 1 9   ? 117.927 14.995  9.660   1.00 102.08 ? 809 DT  G "O5'" 1 
ATOM 654   C "C5'" . DT  C 1 9   ? 118.116 15.522  8.347   1.00 106.45 ? 809 DT  G "C5'" 1 
ATOM 655   C "C4'" . DT  C 1 9   ? 119.428 16.271  8.249   1.00 108.78 ? 809 DT  G "C4'" 1 
ATOM 656   O "O4'" . DT  C 1 9   ? 119.425 17.408  9.152   1.00 109.77 ? 809 DT  G "O4'" 1 
ATOM 657   C "C3'" . DT  C 1 9   ? 120.689 15.473  8.589   1.00 108.48 ? 809 DT  G "C3'" 1 
ATOM 658   O "O3'" . DT  C 1 9   ? 121.761 15.864  7.712   1.00 97.69  ? 809 DT  G "O3'" 1 
ATOM 659   C "C2'" . DT  C 1 9   ? 121.003 15.923  10.004  1.00 109.91 ? 809 DT  G "C2'" 1 
ATOM 660   C "C1'" . DT  C 1 9   ? 120.615 17.383  9.922   1.00 107.21 ? 809 DT  G "C1'" 1 
ATOM 661   N N1    . DT  C 1 9   ? 120.343 18.018  11.212  1.00 102.65 ? 809 DT  G N1    1 
ATOM 662   C C2    . DT  C 1 9   ? 121.002 19.183  11.507  1.00 104.74 ? 809 DT  G C2    1 
ATOM 663   O O2    . DT  C 1 9   ? 121.805 19.703  10.751  1.00 106.58 ? 809 DT  G O2    1 
ATOM 664   N N3    . DT  C 1 9   ? 120.689 19.723  12.729  1.00 100.84 ? 809 DT  G N3    1 
ATOM 665   C C4    . DT  C 1 9   ? 119.801 19.220  13.660  1.00 99.55  ? 809 DT  G C4    1 
ATOM 666   O O4    . DT  C 1 9   ? 119.614 19.817  14.715  1.00 98.88  ? 809 DT  G O4    1 
ATOM 667   C C5    . DT  C 1 9   ? 119.149 17.987  13.281  1.00 99.01  ? 809 DT  G C5    1 
ATOM 668   C C7    . DT  C 1 9   ? 118.170 17.361  14.222  1.00 104.56 ? 809 DT  G C7    1 
ATOM 669   C C6    . DT  C 1 9   ? 119.453 17.456  12.094  1.00 99.38  ? 809 DT  G C6    1 
ATOM 670   P P     . DC  C 1 10  ? 123.244 15.280  7.943   1.00 92.74  ? 810 DC  G P     1 
ATOM 671   O OP1   . DC  C 1 10  ? 123.763 14.772  6.645   1.00 85.80  ? 810 DC  G OP1   1 
ATOM 672   O OP2   . DC  C 1 10  ? 123.189 14.374  9.126   1.00 71.34  ? 810 DC  G OP2   1 
ATOM 673   O "O5'" . DC  C 1 10  ? 124.111 16.552  8.353   1.00 99.37  ? 810 DC  G "O5'" 1 
ATOM 674   C "C5'" . DC  C 1 10  ? 123.752 17.335  9.487   1.00 102.32 ? 810 DC  G "C5'" 1 
ATOM 675   C "C4'" . DC  C 1 10  ? 124.916 18.183  9.942   1.00 97.49  ? 810 DC  G "C4'" 1 
ATOM 676   O "O4'" . DC  C 1 10  ? 124.447 18.998  11.043  1.00 95.77  ? 810 DC  G "O4'" 1 
ATOM 677   C "C3'" . DC  C 1 10  ? 126.109 17.391  10.480  1.00 100.03 ? 810 DC  G "C3'" 1 
ATOM 678   O "O3'" . DC  C 1 10  ? 127.335 18.065  10.161  1.00 110.79 ? 810 DC  G "O3'" 1 
ATOM 679   C "C2'" . DC  C 1 10  ? 125.856 17.357  11.975  1.00 90.20  ? 810 DC  G "C2'" 1 
ATOM 680   C "C1'" . DC  C 1 10  ? 125.157 18.681  12.229  1.00 86.43  ? 810 DC  G "C1'" 1 
ATOM 681   N N1    . DC  C 1 10  ? 124.193 18.639  13.334  1.00 68.27  ? 810 DC  G N1    1 
ATOM 682   C C2    . DC  C 1 10  ? 124.288 19.597  14.334  1.00 65.98  ? 810 DC  G C2    1 
ATOM 683   O O2    . DC  C 1 10  ? 125.168 20.458  14.242  1.00 52.50  ? 810 DC  G O2    1 
ATOM 684   N N3    . DC  C 1 10  ? 123.423 19.561  15.374  1.00 72.03  ? 810 DC  G N3    1 
ATOM 685   C C4    . DC  C 1 10  ? 122.490 18.610  15.430  1.00 68.19  ? 810 DC  G C4    1 
ATOM 686   N N4    . DC  C 1 10  ? 121.666 18.604  16.478  1.00 70.78  ? 810 DC  G N4    1 
ATOM 687   C C5    . DC  C 1 10  ? 122.364 17.620  14.414  1.00 64.13  ? 810 DC  G C5    1 
ATOM 688   C C6    . DC  C 1 10  ? 123.227 17.674  13.393  1.00 66.51  ? 810 DC  G C6    1 
ATOM 689   P P     . DC  C 1 11  ? 128.732 17.533  10.764  1.00 101.20 ? 811 DC  G P     1 
ATOM 690   O OP1   . DC  C 1 11  ? 129.766 17.718  9.717   1.00 86.88  ? 811 DC  G OP1   1 
ATOM 691   O OP2   . DC  C 1 11  ? 128.525 16.186  11.364  1.00 88.70  ? 811 DC  G OP2   1 
ATOM 692   O "O5'" . DC  C 1 11  ? 129.037 18.558  11.944  1.00 101.48 ? 811 DC  G "O5'" 1 
ATOM 693   C "C5'" . DC  C 1 11  ? 130.134 18.367  12.832  1.00 108.99 ? 811 DC  G "C5'" 1 
ATOM 694   C "C4'" . DC  C 1 11  ? 130.416 19.648  13.585  1.00 112.34 ? 811 DC  G "C4'" 1 
ATOM 695   O "O4'" . DC  C 1 11  ? 129.184 20.119  14.185  1.00 108.71 ? 811 DC  G "O4'" 1 
ATOM 696   C "C3'" . DC  C 1 11  ? 131.425 19.504  14.724  1.00 113.98 ? 811 DC  G "C3'" 1 
ATOM 697   O "O3'" . DC  C 1 11  ? 132.300 20.637  14.791  1.00 112.81 ? 811 DC  G "O3'" 1 
ATOM 698   C "C2'" . DC  C 1 11  ? 130.556 19.394  15.964  1.00 109.23 ? 811 DC  G "C2'" 1 
ATOM 699   C "C1'" . DC  C 1 11  ? 129.293 20.165  15.602  1.00 101.15 ? 811 DC  G "C1'" 1 
ATOM 700   N N1    . DC  C 1 11  ? 128.077 19.553  16.168  1.00 78.20  ? 811 DC  G N1    1 
ATOM 701   C C2    . DC  C 1 11  ? 127.500 20.121  17.311  1.00 70.89  ? 811 DC  G C2    1 
ATOM 702   O O2    . DC  C 1 11  ? 127.995 21.156  17.786  1.00 63.50  ? 811 DC  G O2    1 
ATOM 703   N N3    . DC  C 1 11  ? 126.417 19.529  17.864  1.00 64.55  ? 811 DC  G N3    1 
ATOM 704   C C4    . DC  C 1 11  ? 125.907 18.424  17.316  1.00 61.41  ? 811 DC  G C4    1 
ATOM 705   N N4    . DC  C 1 11  ? 124.846 17.868  17.899  1.00 58.93  ? 811 DC  G N4    1 
ATOM 706   C C5    . DC  C 1 11  ? 126.463 17.836  16.144  1.00 69.12  ? 811 DC  G C5    1 
ATOM 707   C C6    . DC  C 1 11  ? 127.534 18.430  15.606  1.00 73.07  ? 811 DC  G C6    1 
ATOM 708   P P     . DT  C 1 12  ? 133.848 20.428  15.190  1.00 112.78 ? 812 DT  G P     1 
ATOM 709   O OP1   . DT  C 1 12  ? 134.613 21.531  14.553  1.00 118.62 ? 812 DT  G OP1   1 
ATOM 710   O OP2   . DT  C 1 12  ? 134.227 19.018  14.909  1.00 114.99 ? 812 DT  G OP2   1 
ATOM 711   O "O5'" . DT  C 1 12  ? 133.870 20.648  16.769  1.00 104.46 ? 812 DT  G "O5'" 1 
ATOM 712   C "C5'" . DT  C 1 12  ? 133.828 21.965  17.311  1.00 101.78 ? 812 DT  G "C5'" 1 
ATOM 713   C "C4'" . DT  C 1 12  ? 132.399 22.363  17.593  1.00 105.75 ? 812 DT  G "C4'" 1 
ATOM 714   O "O4'" . DT  C 1 12  ? 131.930 21.623  18.746  1.00 107.40 ? 812 DT  G "O4'" 1 
ATOM 715   C "C3'" . DT  C 1 12  ? 132.200 23.840  17.944  1.00 112.66 ? 812 DT  G "C3'" 1 
ATOM 716   O "O3'" . DT  C 1 12  ? 130.876 24.266  17.598  1.00 113.75 ? 812 DT  G "O3'" 1 
ATOM 717   C "C2'" . DT  C 1 12  ? 132.243 23.835  19.457  1.00 112.89 ? 812 DT  G "C2'" 1 
ATOM 718   C "C1'" . DT  C 1 12  ? 131.547 22.526  19.772  1.00 111.84 ? 812 DT  G "C1'" 1 
ATOM 719   N N1    . DT  C 1 12  ? 131.928 21.942  21.067  1.00 118.13 ? 812 DT  G N1    1 
ATOM 720   C C2    . DT  C 1 12  ? 131.299 22.423  22.191  1.00 118.62 ? 812 DT  G C2    1 
ATOM 721   O O2    . DT  C 1 12  ? 130.452 23.303  22.158  1.00 117.45 ? 812 DT  G O2    1 
ATOM 722   N N3    . DT  C 1 12  ? 131.698 21.837  23.364  1.00 118.41 ? 812 DT  G N3    1 
ATOM 723   C C4    . DT  C 1 12  ? 132.642 20.843  23.522  1.00 118.62 ? 812 DT  G C4    1 
ATOM 724   O O4    . DT  C 1 12  ? 132.894 20.416  24.646  1.00 118.62 ? 812 DT  G O4    1 
ATOM 725   C C5    . DT  C 1 12  ? 133.264 20.383  22.295  1.00 118.62 ? 812 DT  G C5    1 
ATOM 726   C C7    . DT  C 1 12  ? 134.299 19.302  22.362  1.00 118.62 ? 812 DT  G C7    1 
ATOM 727   C C6    . DT  C 1 12  ? 132.881 20.949  21.145  1.00 118.62 ? 812 DT  G C6    1 
ATOM 728   O "O5'" . DA  D 2 1   ? 126.610 16.567  31.086  1.00 112.18 ? 813 DA  H "O5'" 1 
ATOM 729   C "C5'" . DA  D 2 1   ? 127.503 16.886  30.021  1.00 112.18 ? 813 DA  H "C5'" 1 
ATOM 730   C "C4'" . DA  D 2 1   ? 126.760 17.477  28.849  1.00 109.90 ? 813 DA  H "C4'" 1 
ATOM 731   O "O4'" . DA  D 2 1   ? 127.705 17.910  27.846  1.00 105.44 ? 813 DA  H "O4'" 1 
ATOM 732   C "C3'" . DA  D 2 1   ? 125.806 16.511  28.146  1.00 111.03 ? 813 DA  H "C3'" 1 
ATOM 733   O "O3'" . DA  D 2 1   ? 124.632 17.209  27.723  1.00 112.18 ? 813 DA  H "O3'" 1 
ATOM 734   C "C2'" . DA  D 2 1   ? 126.605 16.049  26.940  1.00 108.09 ? 813 DA  H "C2'" 1 
ATOM 735   C "C1'" . DA  D 2 1   ? 127.434 17.278  26.605  1.00 105.08 ? 813 DA  H "C1'" 1 
ATOM 736   N N9    . DA  D 2 1   ? 128.716 16.987  25.962  1.00 119.41 ? 813 DA  H N9    1 
ATOM 737   C C8    . DA  D 2 1   ? 128.954 16.752  24.630  1.00 116.78 ? 813 DA  H C8    1 
ATOM 738   N N7    . DA  D 2 1   ? 130.214 16.513  24.351  1.00 118.89 ? 813 DA  H N7    1 
ATOM 739   C C5    . DA  D 2 1   ? 130.851 16.597  25.581  1.00 119.21 ? 813 DA  H C5    1 
ATOM 740   C C6    . DA  D 2 1   ? 132.203 16.442  25.971  1.00 115.27 ? 813 DA  H C6    1 
ATOM 741   N N6    . DA  D 2 1   ? 133.193 16.154  25.123  1.00 104.98 ? 813 DA  H N6    1 
ATOM 742   N N1    . DA  D 2 1   ? 132.502 16.592  27.280  1.00 113.61 ? 813 DA  H N1    1 
ATOM 743   C C2    . DA  D 2 1   ? 131.511 16.879  28.134  1.00 113.78 ? 813 DA  H C2    1 
ATOM 744   N N3    . DA  D 2 1   ? 130.209 17.047  27.894  1.00 113.77 ? 813 DA  H N3    1 
ATOM 745   C C4    . DA  D 2 1   ? 129.943 16.892  26.585  1.00 120.44 ? 813 DA  H C4    1 
ATOM 746   P P     . DA  D 2 2   ? 123.436 17.463  28.769  1.00 120.60 ? 814 DA  H P     1 
ATOM 747   O OP1   . DA  D 2 2   ? 123.721 16.704  30.015  1.00 108.54 ? 814 DA  H OP1   1 
ATOM 748   O OP2   . DA  D 2 2   ? 122.147 17.252  28.059  1.00 112.06 ? 814 DA  H OP2   1 
ATOM 749   O "O5'" . DA  D 2 2   ? 123.554 19.015  29.104  1.00 120.88 ? 814 DA  H "O5'" 1 
ATOM 750   C "C5'" . DA  D 2 2   ? 124.616 19.517  29.916  1.00 119.46 ? 814 DA  H "C5'" 1 
ATOM 751   C "C4'" . DA  D 2 2   ? 125.113 20.829  29.357  1.00 118.23 ? 814 DA  H "C4'" 1 
ATOM 752   O "O4'" . DA  D 2 2   ? 125.805 20.573  28.112  1.00 114.06 ? 814 DA  H "O4'" 1 
ATOM 753   C "C3'" . DA  D 2 2   ? 123.993 21.815  29.030  1.00 118.87 ? 814 DA  H "C3'" 1 
ATOM 754   O "O3'" . DA  D 2 2   ? 124.374 23.154  29.358  1.00 120.88 ? 814 DA  H "O3'" 1 
ATOM 755   C "C2'" . DA  D 2 2   ? 123.794 21.647  27.533  1.00 119.63 ? 814 DA  H "C2'" 1 
ATOM 756   C "C1'" . DA  D 2 2   ? 125.176 21.260  27.037  1.00 115.04 ? 814 DA  H "C1'" 1 
ATOM 757   N N9    . DA  D 2 2   ? 125.163 20.357  25.886  1.00 104.41 ? 814 DA  H N9    1 
ATOM 758   C C8    . DA  D 2 2   ? 124.217 19.415  25.566  1.00 107.04 ? 814 DA  H C8    1 
ATOM 759   N N7    . DA  D 2 2   ? 124.487 18.741  24.477  1.00 111.70 ? 814 DA  H N7    1 
ATOM 760   C C5    . DA  D 2 2   ? 125.690 19.276  24.044  1.00 106.49 ? 814 DA  H C5    1 
ATOM 761   C C6    . DA  D 2 2   ? 126.508 18.990  22.939  1.00 107.24 ? 814 DA  H C6    1 
ATOM 762   N N6    . DA  D 2 2   ? 126.224 18.054  22.031  1.00 91.94  ? 814 DA  H N6    1 
ATOM 763   N N1    . DA  D 2 2   ? 127.644 19.706  22.796  1.00 108.32 ? 814 DA  H N1    1 
ATOM 764   C C2    . DA  D 2 2   ? 127.927 20.647  23.707  1.00 105.11 ? 814 DA  H C2    1 
ATOM 765   N N3    . DA  D 2 2   ? 127.237 21.010  24.787  1.00 102.93 ? 814 DA  H N3    1 
ATOM 766   C C4    . DA  D 2 2   ? 126.116 20.277  24.899  1.00 103.81 ? 814 DA  H C4    1 
ATOM 767   P P     . DG  D 2 3   ? 123.260 24.310  29.380  1.00 113.27 ? 815 DG  H P     1 
ATOM 768   O OP1   . DG  D 2 3   ? 123.954 25.619  29.308  1.00 104.60 ? 815 DG  H OP1   1 
ATOM 769   O OP2   . DG  D 2 3   ? 122.326 24.036  30.502  1.00 104.42 ? 815 DG  H OP2   1 
ATOM 770   O "O5'" . DG  D 2 3   ? 122.474 24.078  28.017  1.00 107.85 ? 815 DG  H "O5'" 1 
ATOM 771   C "C5'" . DG  D 2 3   ? 122.136 25.174  27.183  1.00 103.33 ? 815 DG  H "C5'" 1 
ATOM 772   C "C4'" . DG  D 2 3   ? 123.375 25.702  26.499  1.00 100.41 ? 815 DG  H "C4'" 1 
ATOM 773   O "O4'" . DG  D 2 3   ? 124.002 24.634  25.747  1.00 102.53 ? 815 DG  H "O4'" 1 
ATOM 774   C "C3'" . DG  D 2 3   ? 123.103 26.825  25.502  1.00 102.31 ? 815 DG  H "C3'" 1 
ATOM 775   O "O3'" . DG  D 2 3   ? 124.100 27.840  25.599  1.00 91.86  ? 815 DG  H "O3'" 1 
ATOM 776   C "C2'" . DG  D 2 3   ? 123.157 26.134  24.153  1.00 105.88 ? 815 DG  H "C2'" 1 
ATOM 777   C "C1'" . DG  D 2 3   ? 124.138 25.004  24.383  1.00 107.95 ? 815 DG  H "C1'" 1 
ATOM 778   N N9    . DG  D 2 3   ? 123.844 23.829  23.574  1.00 106.35 ? 815 DG  H N9    1 
ATOM 779   C C8    . DG  D 2 3   ? 122.833 22.919  23.771  1.00 102.68 ? 815 DG  H C8    1 
ATOM 780   N N7    . DG  D 2 3   ? 122.812 21.975  22.871  1.00 105.14 ? 815 DG  H N7    1 
ATOM 781   C C5    . DG  D 2 3   ? 123.874 22.277  22.029  1.00 107.04 ? 815 DG  H C5    1 
ATOM 782   C C6    . DG  D 2 3   ? 124.351 21.610  20.873  1.00 106.14 ? 815 DG  H C6    1 
ATOM 783   O O6    . DG  D 2 3   ? 123.916 20.586  20.338  1.00 106.25 ? 815 DG  H O6    1 
ATOM 784   N N1    . DG  D 2 3   ? 125.451 22.257  20.330  1.00 106.18 ? 815 DG  H N1    1 
ATOM 785   C C2    . DG  D 2 3   ? 126.022 23.399  20.831  1.00 107.04 ? 815 DG  H C2    1 
ATOM 786   N N2    . DG  D 2 3   ? 127.079 23.872  20.160  1.00 104.93 ? 815 DG  H N2    1 
ATOM 787   N N3    . DG  D 2 3   ? 125.590 24.031  21.906  1.00 107.04 ? 815 DG  H N3    1 
ATOM 788   C C4    . DG  D 2 3   ? 124.521 23.418  22.452  1.00 107.04 ? 815 DG  H C4    1 
ATOM 789   P P     . DG  D 2 4   ? 124.008 29.129  24.650  1.00 34.96  ? 816 DG  H P     1 
ATOM 790   O OP1   . DG  D 2 4   ? 125.125 30.041  25.012  1.00 71.81  ? 816 DG  H OP1   1 
ATOM 791   O OP2   . DG  D 2 4   ? 122.613 29.639  24.668  1.00 81.14  ? 816 DG  H OP2   1 
ATOM 792   O "O5'" . DG  D 2 4   ? 124.305 28.535  23.208  1.00 28.19  ? 816 DG  H "O5'" 1 
ATOM 793   C "C5'" . DG  D 2 4   ? 124.015 29.295  22.054  1.00 28.08  ? 816 DG  H "C5'" 1 
ATOM 794   C "C4'" . DG  D 2 4   ? 125.154 29.205  21.072  1.00 35.37  ? 816 DG  H "C4'" 1 
ATOM 795   O "O4'" . DG  D 2 4   ? 125.375 27.809  20.778  1.00 46.72  ? 816 DG  H "O4'" 1 
ATOM 796   C "C3'" . DG  D 2 4   ? 124.821 29.862  19.739  1.00 38.25  ? 816 DG  H "C3'" 1 
ATOM 797   O "O3'" . DG  D 2 4   ? 125.996 30.377  19.126  1.00 37.94  ? 816 DG  H "O3'" 1 
ATOM 798   C "C2'" . DG  D 2 4   ? 124.262 28.716  18.928  1.00 46.99  ? 816 DG  H "C2'" 1 
ATOM 799   C "C1'" . DG  D 2 4   ? 125.119 27.563  19.406  1.00 51.31  ? 816 DG  H "C1'" 1 
ATOM 800   N N9    . DG  D 2 4   ? 124.497 26.248  19.287  1.00 92.76  ? 816 DG  H N9    1 
ATOM 801   C C8    . DG  D 2 4   ? 123.521 25.706  20.090  1.00 98.12  ? 816 DG  H C8    1 
ATOM 802   N N7    . DG  D 2 4   ? 123.169 24.502  19.726  1.00 97.47  ? 816 DG  H N7    1 
ATOM 803   C C5    . DG  D 2 4   ? 123.959 24.235  18.618  1.00 90.11  ? 816 DG  H C5    1 
ATOM 804   C C6    . DG  D 2 4   ? 124.028 23.084  17.790  1.00 83.92  ? 816 DG  H C6    1 
ATOM 805   O O6    . DG  D 2 4   ? 123.383 22.035  17.873  1.00 77.04  ? 816 DG  H O6    1 
ATOM 806   N N1    . DG  D 2 4   ? 124.967 23.239  16.778  1.00 82.59  ? 816 DG  H N1    1 
ATOM 807   C C2    . DG  D 2 4   ? 125.744 24.353  16.583  1.00 86.29  ? 816 DG  H C2    1 
ATOM 808   N N2    . DG  D 2 4   ? 126.596 24.310  15.549  1.00 91.32  ? 816 DG  H N2    1 
ATOM 809   N N3    . DG  D 2 4   ? 125.692 25.431  17.344  1.00 87.24  ? 816 DG  H N3    1 
ATOM 810   C C4    . DG  D 2 4   ? 124.784 25.302  18.334  1.00 91.20  ? 816 DG  H C4    1 
ATOM 811   P P     . DA  D 2 5   ? 125.879 31.153  17.730  1.00 48.66  ? 817 DA  H P     1 
ATOM 812   O OP1   . DA  D 2 5   ? 127.199 31.740  17.416  1.00 88.58  ? 817 DA  H OP1   1 
ATOM 813   O OP2   . DA  D 2 5   ? 124.685 32.025  17.793  1.00 96.60  ? 817 DA  H OP2   1 
ATOM 814   O "O5'" . DA  D 2 5   ? 125.598 29.998  16.675  1.00 39.16  ? 817 DA  H "O5'" 1 
ATOM 815   C "C5'" . DA  D 2 5   ? 126.673 29.218  16.165  1.00 33.74  ? 817 DA  H "C5'" 1 
ATOM 816   C "C4'" . DA  D 2 5   ? 126.188 28.302  15.065  1.00 24.76  ? 817 DA  H "C4'" 1 
ATOM 817   O "O4'" . DA  D 2 5   ? 125.345 27.271  15.623  1.00 15.70  ? 817 DA  H "O4'" 1 
ATOM 818   C "C3'" . DA  D 2 5   ? 125.370 28.958  13.955  1.00 22.51  ? 817 DA  H "C3'" 1 
ATOM 819   O "O3'" . DA  D 2 5   ? 125.704 28.338  12.716  1.00 35.39  ? 817 DA  H "O3'" 1 
ATOM 820   C "C2'" . DA  D 2 5   ? 123.944 28.593  14.320  1.00 20.12  ? 817 DA  H "C2'" 1 
ATOM 821   C "C1'" . DA  D 2 5   ? 124.132 27.204  14.898  1.00 25.79  ? 817 DA  H "C1'" 1 
ATOM 822   N N9    . DA  D 2 5   ? 123.097 26.736  15.820  1.00 69.36  ? 817 DA  H N9    1 
ATOM 823   C C8    . DA  D 2 5   ? 122.503 27.425  16.845  1.00 72.14  ? 817 DA  H C8    1 
ATOM 824   N N7    . DA  D 2 5   ? 121.645 26.717  17.538  1.00 82.05  ? 817 DA  H N7    1 
ATOM 825   C C5    . DA  D 2 5   ? 121.661 25.478  16.918  1.00 71.90  ? 817 DA  H C5    1 
ATOM 826   C C6    . DA  D 2 5   ? 120.971 24.280  17.182  1.00 69.94  ? 817 DA  H C6    1 
ATOM 827   N N6    . DA  D 2 5   ? 120.094 24.135  18.183  1.00 77.47  ? 817 DA  H N6    1 
ATOM 828   N N1    . DA  D 2 5   ? 121.216 23.223  16.375  1.00 64.56  ? 817 DA  H N1    1 
ATOM 829   C C2    . DA  D 2 5   ? 122.097 23.372  15.373  1.00 57.71  ? 817 DA  H C2    1 
ATOM 830   N N3    . DA  D 2 5   ? 122.809 24.449  15.024  1.00 56.60  ? 817 DA  H N3    1 
ATOM 831   C C4    . DA  D 2 5   ? 122.543 25.478  15.847  1.00 66.35  ? 817 DA  H C4    1 
ATOM 832   P P     . DA  D 2 6   ? 125.754 29.213  11.377  1.00 83.46  ? 818 DA  H P     1 
ATOM 833   O OP1   . DA  D 2 6   ? 126.984 30.038  11.427  1.00 87.14  ? 818 DA  H OP1   1 
ATOM 834   O OP2   . DA  D 2 6   ? 124.431 29.866  11.219  1.00 84.32  ? 818 DA  H OP2   1 
ATOM 835   O "O5'" . DA  D 2 6   ? 125.923 28.129  10.222  1.00 93.77  ? 818 DA  H "O5'" 1 
ATOM 836   C "C5'" . DA  D 2 6   ? 127.065 27.274  10.184  1.00 86.84  ? 818 DA  H "C5'" 1 
ATOM 837   C "C4'" . DA  D 2 6   ? 126.657 25.853  9.862   1.00 77.71  ? 818 DA  H "C4'" 1 
ATOM 838   O "O4'" . DA  D 2 6   ? 125.721 25.398  10.868  1.00 72.61  ? 818 DA  H "O4'" 1 
ATOM 839   C "C3'" . DA  D 2 6   ? 125.962 25.650  8.515   1.00 78.79  ? 818 DA  H "C3'" 1 
ATOM 840   O "O3'" . DA  D 2 6   ? 126.369 24.409  7.931   1.00 90.20  ? 818 DA  H "O3'" 1 
ATOM 841   C "C2'" . DA  D 2 6   ? 124.492 25.602  8.877   1.00 73.84  ? 818 DA  H "C2'" 1 
ATOM 842   C "C1'" . DA  D 2 6   ? 124.508 24.981  10.261  1.00 71.54  ? 818 DA  H "C1'" 1 
ATOM 843   N N9    . DA  D 2 6   ? 123.407 25.449  11.101  1.00 75.15  ? 818 DA  H N9    1 
ATOM 844   C C8    . DA  D 2 6   ? 123.096 26.749  11.400  1.00 71.00  ? 818 DA  H C8    1 
ATOM 845   N N7    . DA  D 2 6   ? 122.025 26.876  12.139  1.00 74.69  ? 818 DA  H N7    1 
ATOM 846   C C5    . DA  D 2 6   ? 121.604 25.570  12.350  1.00 82.09  ? 818 DA  H C5    1 
ATOM 847   C C6    . DA  D 2 6   ? 120.512 25.027  13.052  1.00 85.96  ? 818 DA  H C6    1 
ATOM 848   N N6    . DA  D 2 6   ? 119.604 25.762  13.699  1.00 89.62  ? 818 DA  H N6    1 
ATOM 849   N N1    . DA  D 2 6   ? 120.379 23.684  13.061  1.00 83.26  ? 818 DA  H N1    1 
ATOM 850   C C2    . DA  D 2 6   ? 121.289 22.947  12.409  1.00 80.42  ? 818 DA  H C2    1 
ATOM 851   N N3    . DA  D 2 6   ? 122.355 23.340  11.718  1.00 82.34  ? 818 DA  H N3    1 
ATOM 852   C C4    . DA  D 2 6   ? 122.455 24.680  11.725  1.00 77.90  ? 818 DA  H C4    1 
ATOM 853   P P     . DA  D 2 7   ? 126.068 24.122  6.381   1.00 110.19 ? 819 DA  H P     1 
ATOM 854   O OP1   . DA  D 2 7   ? 126.967 23.031  5.927   1.00 107.95 ? 819 DA  H OP1   1 
ATOM 855   O OP2   . DA  D 2 7   ? 126.073 25.420  5.664   1.00 111.43 ? 819 DA  H OP2   1 
ATOM 856   O "O5'" . DA  D 2 7   ? 124.579 23.565  6.387   1.00 113.11 ? 819 DA  H "O5'" 1 
ATOM 857   C "C5'" . DA  D 2 7   ? 124.318 22.199  6.703   1.00 115.46 ? 819 DA  H "C5'" 1 
ATOM 858   C "C4'" . DA  D 2 7   ? 122.951 21.792  6.202   1.00 107.18 ? 819 DA  H "C4'" 1 
ATOM 859   O "O4'" . DA  D 2 7   ? 121.923 22.377  7.040   1.00 105.06 ? 819 DA  H "O4'" 1 
ATOM 860   C "C3'" . DA  D 2 7   ? 122.635 22.232  4.771   1.00 102.66 ? 819 DA  H "C3'" 1 
ATOM 861   O "O3'" . DA  D 2 7   ? 121.888 21.214  4.092   1.00 90.20  ? 819 DA  H "O3'" 1 
ATOM 862   C "C2'" . DA  D 2 7   ? 121.782 23.470  4.976   1.00 104.29 ? 819 DA  H "C2'" 1 
ATOM 863   C "C1'" . DA  D 2 7   ? 121.016 23.115  6.235   1.00 99.84  ? 819 DA  H "C1'" 1 
ATOM 864   N N9    . DA  D 2 7   ? 120.555 24.267  7.007   1.00 72.02  ? 819 DA  H N9    1 
ATOM 865   C C8    . DA  D 2 7   ? 120.726 25.604  6.732   1.00 76.04  ? 819 DA  H C8    1 
ATOM 866   N N7    . DA  D 2 7   ? 120.179 26.399  7.616   1.00 76.03  ? 819 DA  H N7    1 
ATOM 867   C C5    . DA  D 2 7   ? 119.615 25.529  8.543   1.00 77.50  ? 819 DA  H C5    1 
ATOM 868   C C6    . DA  D 2 7   ? 118.889 25.744  9.734   1.00 76.35  ? 819 DA  H C6    1 
ATOM 869   N N6    . DA  D 2 7   ? 118.588 26.959  10.215  1.00 67.82  ? 819 DA  H N6    1 
ATOM 870   N N1    . DA  D 2 7   ? 118.476 24.654  10.422  1.00 70.77  ? 819 DA  H N1    1 
ATOM 871   C C2    . DA  D 2 7   ? 118.772 23.439  9.939   1.00 64.05  ? 819 DA  H C2    1 
ATOM 872   N N3    . DA  D 2 7   ? 119.441 23.111  8.836   1.00 69.69  ? 819 DA  H N3    1 
ATOM 873   C C4    . DA  D 2 7   ? 119.840 24.213  8.178   1.00 75.22  ? 819 DA  H C4    1 
ATOM 874   P P     . DG  D 2 8   ? 121.272 21.512  2.639   1.00 76.73  ? 820 DG  H P     1 
ATOM 875   O OP1   . DG  D 2 8   ? 121.916 20.615  1.655   1.00 71.51  ? 820 DG  H OP1   1 
ATOM 876   O OP2   . DG  D 2 8   ? 121.325 22.969  2.432   1.00 70.58  ? 820 DG  H OP2   1 
ATOM 877   O "O5'" . DG  D 2 8   ? 119.742 21.108  2.792   1.00 75.10  ? 820 DG  H "O5'" 1 
ATOM 878   C "C5'" . DG  D 2 8   ? 119.379 19.984  3.585   1.00 75.91  ? 820 DG  H "C5'" 1 
ATOM 879   C "C4'" . DG  D 2 8   ? 117.967 20.129  4.101   1.00 87.40  ? 820 DG  H "C4'" 1 
ATOM 880   O "O4'" . DG  D 2 8   ? 117.884 21.193  5.086   1.00 97.57  ? 820 DG  H "O4'" 1 
ATOM 881   C "C3'" . DG  D 2 8   ? 116.918 20.453  3.033   1.00 98.83  ? 820 DG  H "C3'" 1 
ATOM 882   O "O3'" . DG  D 2 8   ? 115.709 19.735  3.314   1.00 107.12 ? 820 DG  H "O3'" 1 
ATOM 883   C "C2'" . DG  D 2 8   ? 116.699 21.944  3.211   1.00 100.62 ? 820 DG  H "C2'" 1 
ATOM 884   C "C1'" . DG  D 2 8   ? 116.847 22.091  4.716   1.00 100.99 ? 820 DG  H "C1'" 1 
ATOM 885   N N9    . DG  D 2 8   ? 117.222 23.427  5.166   1.00 118.39 ? 820 DG  H N9    1 
ATOM 886   C C8    . DG  D 2 8   ? 118.317 24.155  4.775   1.00 121.93 ? 820 DG  H C8    1 
ATOM 887   N N7    . DG  D 2 8   ? 118.391 25.321  5.355   1.00 120.89 ? 820 DG  H N7    1 
ATOM 888   C C5    . DG  D 2 8   ? 117.275 25.365  6.177   1.00 123.26 ? 820 DG  H C5    1 
ATOM 889   C C6    . DG  D 2 8   ? 116.827 26.380  7.055   1.00 125.34 ? 820 DG  H C6    1 
ATOM 890   O O6    . DG  D 2 8   ? 117.347 27.475  7.293   1.00 132.81 ? 820 DG  H O6    1 
ATOM 891   N N1    . DG  D 2 8   ? 115.646 26.019  7.694   1.00 124.79 ? 820 DG  H N1    1 
ATOM 892   C C2    . DG  D 2 8   ? 114.983 24.832  7.513   1.00 125.86 ? 820 DG  H C2    1 
ATOM 893   N N2    . DG  D 2 8   ? 113.853 24.676  8.217   1.00 128.16 ? 820 DG  H N2    1 
ATOM 894   N N3    . DG  D 2 8   ? 115.395 23.871  6.702   1.00 123.68 ? 820 DG  H N3    1 
ATOM 895   C C4    . DG  D 2 8   ? 116.541 24.205  6.070   1.00 122.86 ? 820 DG  H C4    1 
ATOM 896   P P     . DT  D 2 9   ? 114.565 19.627  2.192   1.00 121.36 ? 821 DT  H P     1 
ATOM 897   O OP1   . DT  D 2 9   ? 114.285 18.194  1.924   1.00 117.71 ? 821 DT  H OP1   1 
ATOM 898   O OP2   . DT  D 2 9   ? 114.956 20.521  1.072   1.00 108.73 ? 821 DT  H OP2   1 
ATOM 899   O "O5'" . DT  D 2 9   ? 113.282 20.239  2.907   1.00 118.36 ? 821 DT  H "O5'" 1 
ATOM 900   C "C5'" . DT  D 2 9   ? 113.397 21.303  3.854   1.00 121.44 ? 821 DT  H "C5'" 1 
ATOM 901   C "C4'" . DT  D 2 9   ? 112.213 21.279  4.790   1.00 123.75 ? 821 DT  H "C4'" 1 
ATOM 902   O "O4'" . DT  D 2 9   ? 112.301 22.363  5.752   1.00 123.75 ? 821 DT  H "O4'" 1 
ATOM 903   C "C3'" . DT  D 2 9   ? 110.880 21.467  4.068   1.00 123.75 ? 821 DT  H "C3'" 1 
ATOM 904   O "O3'" . DT  D 2 9   ? 109.881 20.623  4.638   1.00 119.39 ? 821 DT  H "O3'" 1 
ATOM 905   C "C2'" . DT  D 2 9   ? 110.544 22.922  4.327   1.00 123.26 ? 821 DT  H "C2'" 1 
ATOM 906   C "C1'" . DT  D 2 9   ? 111.091 23.104  5.726   1.00 123.75 ? 821 DT  H "C1'" 1 
ATOM 907   N N1    . DT  D 2 9   ? 111.390 24.499  6.080   1.00 119.07 ? 821 DT  H N1    1 
ATOM 908   C C2    . DT  D 2 9   ? 110.846 24.994  7.240   1.00 115.18 ? 821 DT  H C2    1 
ATOM 909   O O2    . DT  D 2 9   ? 110.133 24.336  7.976   1.00 111.08 ? 821 DT  H O2    1 
ATOM 910   N N3    . DT  D 2 9   ? 111.165 26.299  7.507   1.00 112.00 ? 821 DT  H N3    1 
ATOM 911   C C4    . DT  D 2 9   ? 111.954 27.138  6.747   1.00 113.65 ? 821 DT  H C4    1 
ATOM 912   O O4    . DT  D 2 9   ? 112.150 28.289  7.120   1.00 113.75 ? 821 DT  H O4    1 
ATOM 913   C C5    . DT  D 2 9   ? 112.492 26.549  5.537   1.00 116.30 ? 821 DT  H C5    1 
ATOM 914   C C7    . DT  D 2 9   ? 113.358 27.379  4.641   1.00 117.49 ? 821 DT  H C7    1 
ATOM 915   C C6    . DT  D 2 9   ? 112.187 25.275  5.269   1.00 117.24 ? 821 DT  H C6    1 
ATOM 916   P P     . DC  D 2 10  ? 108.360 20.766  4.152   1.00 105.54 ? 822 DC  H P     1 
ATOM 917   O OP1   . DC  D 2 10  ? 107.579 19.656  4.752   1.00 97.77  ? 822 DC  H OP1   1 
ATOM 918   O OP2   . DC  D 2 10  ? 108.368 20.954  2.673   1.00 98.20  ? 822 DC  H OP2   1 
ATOM 919   O "O5'" . DC  D 2 10  ? 107.890 22.135  4.815   1.00 113.27 ? 822 DC  H "O5'" 1 
ATOM 920   C "C5'" . DC  D 2 10  ? 107.801 22.270  6.233   1.00 113.27 ? 822 DC  H "C5'" 1 
ATOM 921   C "C4'" . DC  D 2 10  ? 107.112 23.567  6.586   1.00 112.33 ? 822 DC  H "C4'" 1 
ATOM 922   O "O4'" . DC  D 2 10  ? 107.996 24.677  6.292   1.00 108.84 ? 822 DC  H "O4'" 1 
ATOM 923   C "C3'" . DC  D 2 10  ? 105.832 23.817  5.783   1.00 113.00 ? 822 DC  H "C3'" 1 
ATOM 924   O "O3'" . DC  D 2 10  ? 104.799 24.374  6.603   1.00 113.27 ? 822 DC  H "O3'" 1 
ATOM 925   C "C2'" . DC  D 2 10  ? 106.265 24.814  4.723   1.00 110.27 ? 822 DC  H "C2'" 1 
ATOM 926   C "C1'" . DC  D 2 10  ? 107.327 25.609  5.454   1.00 109.06 ? 822 DC  H "C1'" 1 
ATOM 927   N N1    . DC  D 2 10  ? 108.324 26.251  4.582   1.00 100.20 ? 822 DC  H N1    1 
ATOM 928   C C2    . DC  D 2 10  ? 108.720 27.561  4.867   1.00 97.49  ? 822 DC  H C2    1 
ATOM 929   O O2    . DC  D 2 10  ? 108.231 28.132  5.851   1.00 105.57 ? 822 DC  H O2    1 
ATOM 930   N N3    . DC  D 2 10  ? 109.624 28.171  4.068   1.00 93.57  ? 822 DC  H N3    1 
ATOM 931   C C4    . DC  D 2 10  ? 110.130 27.522  3.020   1.00 93.59  ? 822 DC  H C4    1 
ATOM 932   N N4    . DC  D 2 10  ? 111.015 28.163  2.260   1.00 95.10  ? 822 DC  H N4    1 
ATOM 933   C C5    . DC  D 2 10  ? 109.747 26.186  2.706   1.00 100.99 ? 822 DC  H C5    1 
ATOM 934   C C6    . DC  D 2 10  ? 108.852 25.593  3.506   1.00 102.56 ? 822 DC  H C6    1 
ATOM 935   P P     . DC  D 2 11  ? 103.282 24.403  6.062   1.00 112.87 ? 823 DC  H P     1 
ATOM 936   O OP1   . DC  D 2 11  ? 102.466 25.133  7.061   1.00 92.32  ? 823 DC  H OP1   1 
ATOM 937   O OP2   . DC  D 2 11  ? 102.895 23.023  5.673   1.00 102.05 ? 823 DC  H OP2   1 
ATOM 938   O "O5'" . DC  D 2 11  ? 103.362 25.290  4.742   1.00 109.84 ? 823 DC  H "O5'" 1 
ATOM 939   C "C5'" . DC  D 2 11  ? 102.404 26.315  4.494   1.00 107.89 ? 823 DC  H "C5'" 1 
ATOM 940   C "C4'" . DC  D 2 11  ? 102.702 27.517  5.361   1.00 107.85 ? 823 DC  H "C4'" 1 
ATOM 941   O "O4'" . DC  D 2 11  ? 104.032 28.018  5.080   1.00 99.44  ? 823 DC  H "O4'" 1 
ATOM 942   C "C3'" . DC  D 2 11  ? 101.754 28.703  5.170   1.00 111.34 ? 823 DC  H "C3'" 1 
ATOM 943   O "O3'" . DC  D 2 11  ? 101.492 29.320  6.436   1.00 114.29 ? 823 DC  H "O3'" 1 
ATOM 944   C "C2'" . DC  D 2 11  ? 102.554 29.648  4.294   1.00 106.35 ? 823 DC  H "C2'" 1 
ATOM 945   C "C1'" . DC  D 2 11  ? 103.965 29.408  4.797   1.00 101.06 ? 823 DC  H "C1'" 1 
ATOM 946   N N1    . DC  D 2 11  ? 105.037 29.736  3.841   1.00 85.62  ? 823 DC  H N1    1 
ATOM 947   C C2    . DC  D 2 11  ? 106.304 30.057  4.336   1.00 85.78  ? 823 DC  H C2    1 
ATOM 948   O O2    . DC  D 2 11  ? 106.486 30.064  5.562   1.00 88.11  ? 823 DC  H O2    1 
ATOM 949   N N3    . DC  D 2 11  ? 107.298 30.355  3.469   1.00 81.78  ? 823 DC  H N3    1 
ATOM 950   C C4    . DC  D 2 11  ? 107.062 30.344  2.156   1.00 77.31  ? 823 DC  H C4    1 
ATOM 951   N N4    . DC  D 2 11  ? 108.067 30.644  1.334   1.00 74.47  ? 823 DC  H N4    1 
ATOM 952   C C5    . DC  D 2 11  ? 105.780 30.025  1.625   1.00 81.78  ? 823 DC  H C5    1 
ATOM 953   C C6    . DC  D 2 11  ? 104.805 29.728  2.495   1.00 81.61  ? 823 DC  H C6    1 
ATOM 954   P P     . DC  D 2 12  ? 100.024 29.889  6.760   1.00 114.45 ? 824 DC  H P     1 
ATOM 955   O OP1   . DC  D 2 12  ? 99.123  28.734  7.006   1.00 121.89 ? 824 DC  H OP1   1 
ATOM 956   O OP2   . DC  D 2 12  ? 99.681  30.877  5.705   1.00 120.69 ? 824 DC  H OP2   1 
ATOM 957   O "O5'" . DC  D 2 12  ? 100.210 30.675  8.134   1.00 112.94 ? 824 DC  H "O5'" 1 
ATOM 958   C "C5'" . DC  D 2 12  ? 99.695  31.994  8.293   1.00 110.69 ? 824 DC  H "C5'" 1 
ATOM 959   C "C4'" . DC  D 2 12  ? 100.793 32.924  8.749   1.00 109.27 ? 824 DC  H "C4'" 1 
ATOM 960   O "O4'" . DC  D 2 12  ? 101.909 32.806  7.835   1.00 107.99 ? 824 DC  H "O4'" 1 
ATOM 961   C "C3'" . DC  D 2 12  ? 100.415 34.405  8.746   1.00 111.73 ? 824 DC  H "C3'" 1 
ATOM 962   O "O3'" . DC  D 2 12  ? 101.237 35.100  9.687   1.00 114.45 ? 824 DC  H "O3'" 1 
ATOM 963   C "C2'" . DC  D 2 12  ? 100.842 34.851  7.359   1.00 111.88 ? 824 DC  H "C2'" 1 
ATOM 964   C "C1'" . DC  D 2 12  ? 102.102 34.028  7.127   1.00 111.85 ? 824 DC  H "C1'" 1 
ATOM 965   N N1    . DC  D 2 12  ? 102.387 33.692  5.717   1.00 121.85 ? 824 DC  H N1    1 
ATOM 966   C C2    . DC  D 2 12  ? 103.619 34.065  5.166   1.00 121.89 ? 824 DC  H C2    1 
ATOM 967   O O2    . DC  D 2 12  ? 104.426 34.689  5.866   1.00 116.79 ? 824 DC  H O2    1 
ATOM 968   N N3    . DC  D 2 12  ? 103.897 33.735  3.885   1.00 120.88 ? 824 DC  H N3    1 
ATOM 969   C C4    . DC  D 2 12  ? 103.002 33.066  3.160   1.00 121.85 ? 824 DC  H C4    1 
ATOM 970   N N4    . DC  D 2 12  ? 103.323 32.752  1.905   1.00 121.89 ? 824 DC  H N4    1 
ATOM 971   C C5    . DC  D 2 12  ? 101.736 32.685  3.688   1.00 117.06 ? 824 DC  H C5    1 
ATOM 972   C C6    . DC  D 2 12  ? 101.472 33.016  4.958   1.00 117.11 ? 824 DC  H C6    1 
ATOM 973   N N     . ALA E 3 2   ? 98.310  49.339  55.938  1.00 39.79  ? 19  ALA A N     1 
ATOM 974   C CA    . ALA E 3 2   ? 99.528  48.728  56.537  1.00 41.42  ? 19  ALA A CA    1 
ATOM 975   C C     . ALA E 3 2   ? 99.365  47.210  56.552  1.00 39.76  ? 19  ALA A C     1 
ATOM 976   O O     . ALA E 3 2   ? 99.170  46.614  57.613  1.00 58.77  ? 19  ALA A O     1 
ATOM 977   C CB    . ALA E 3 2   ? 99.726  49.262  57.961  1.00 48.20  ? 19  ALA A CB    1 
ATOM 978   N N     . TYR E 3 3   ? 99.438  46.604  55.364  1.00 60.62  ? 20  TYR A N     1 
ATOM 979   C CA    . TYR E 3 3   ? 99.301  45.156  55.155  1.00 61.79  ? 20  TYR A CA    1 
ATOM 980   C C     . TYR E 3 3   ? 97.830  44.738  55.079  1.00 61.15  ? 20  TYR A C     1 
ATOM 981   O O     . TYR E 3 3   ? 96.968  45.370  55.691  1.00 43.65  ? 20  TYR A O     1 
ATOM 982   C CB    . TYR E 3 3   ? 100.028 44.385  56.274  1.00 50.33  ? 20  TYR A CB    1 
ATOM 983   C CG    . TYR E 3 3   ? 99.929  42.876  56.196  1.00 50.26  ? 20  TYR A CG    1 
ATOM 984   C CD1   . TYR E 3 3   ? 100.262 42.187  55.025  1.00 50.44  ? 20  TYR A CD1   1 
ATOM 985   C CD2   . TYR E 3 3   ? 99.532  42.129  57.307  1.00 50.81  ? 20  TYR A CD2   1 
ATOM 986   C CE1   . TYR E 3 3   ? 100.207 40.786  54.967  1.00 52.10  ? 20  TYR A CE1   1 
ATOM 987   C CE2   . TYR E 3 3   ? 99.473  40.732  57.256  1.00 50.42  ? 20  TYR A CE2   1 
ATOM 988   C CZ    . TYR E 3 3   ? 99.813  40.072  56.087  1.00 50.74  ? 20  TYR A CZ    1 
ATOM 989   O OH    . TYR E 3 3   ? 99.773  38.700  56.043  1.00 42.89  ? 20  TYR A OH    1 
ATOM 990   N N     . VAL E 3 4   ? 97.545  43.689  54.304  1.00 62.38  ? 21  VAL A N     1 
ATOM 991   C CA    . VAL E 3 4   ? 96.176  43.179  54.159  1.00 62.19  ? 21  VAL A CA    1 
ATOM 992   C C     . VAL E 3 4   ? 96.110  41.886  53.329  1.00 62.43  ? 21  VAL A C     1 
ATOM 993   O O     . VAL E 3 4   ? 96.947  41.636  52.462  1.00 55.10  ? 21  VAL A O     1 
ATOM 994   C CB    . VAL E 3 4   ? 95.245  44.236  53.513  1.00 50.40  ? 21  VAL A CB    1 
ATOM 995   C CG1   . VAL E 3 4   ? 95.394  44.210  52.008  1.00 50.19  ? 21  VAL A CG1   1 
ATOM 996   C CG2   . VAL E 3 4   ? 93.812  43.986  53.917  1.00 51.02  ? 21  VAL A CG2   1 
ATOM 997   N N     . GLU E 3 5   ? 95.112  41.061  53.618  1.00 72.55  ? 22  GLU A N     1 
ATOM 998   C CA    . GLU E 3 5   ? 94.925  39.805  52.907  1.00 75.79  ? 22  GLU A CA    1 
ATOM 999   C C     . GLU E 3 5   ? 93.451  39.405  53.038  1.00 75.37  ? 22  GLU A C     1 
ATOM 1000  O O     . GLU E 3 5   ? 92.861  39.476  54.121  1.00 46.76  ? 22  GLU A O     1 
ATOM 1001  C CB    . GLU E 3 5   ? 95.845  38.706  53.481  1.00 53.66  ? 22  GLU A CB    1 
ATOM 1002  C CG    . GLU E 3 5   ? 95.365  38.058  54.803  1.00 58.90  ? 22  GLU A CG    1 
ATOM 1003  C CD    . GLU E 3 5   ? 96.210  38.414  56.041  1.00 62.21  ? 22  GLU A CD    1 
ATOM 1004  O OE1   . GLU E 3 5   ? 95.928  37.852  57.121  1.00 61.27  ? 22  GLU A OE1   1 
ATOM 1005  O OE2   . GLU E 3 5   ? 97.143  39.242  55.942  1.00 61.53  ? 22  GLU A OE2   1 
ATOM 1006  N N     . ILE E 3 6   ? 92.850  39.003  51.926  1.00 54.72  ? 23  ILE A N     1 
ATOM 1007  C CA    . ILE E 3 6   ? 91.452  38.612  51.935  1.00 53.73  ? 23  ILE A CA    1 
ATOM 1008  C C     . ILE E 3 6   ? 91.226  37.328  52.726  1.00 56.12  ? 23  ILE A C     1 
ATOM 1009  O O     . ILE E 3 6   ? 91.871  36.313  52.470  1.00 67.07  ? 23  ILE A O     1 
ATOM 1010  C CB    . ILE E 3 6   ? 90.929  38.407  50.496  1.00 54.45  ? 23  ILE A CB    1 
ATOM 1011  C CG1   . ILE E 3 6   ? 90.834  39.758  49.770  1.00 50.27  ? 23  ILE A CG1   1 
ATOM 1012  C CG2   . ILE E 3 6   ? 89.577  37.708  50.536  1.00 54.06  ? 23  ILE A CG2   1 
ATOM 1013  C CD1   . ILE E 3 6   ? 90.404  39.655  48.321  1.00 44.99  ? 23  ILE A CD1   1 
ATOM 1014  N N     . ILE E 3 7   ? 90.318  37.386  53.696  1.00 33.45  ? 24  ILE A N     1 
ATOM 1015  C CA    . ILE E 3 7   ? 89.977  36.220  54.511  1.00 33.30  ? 24  ILE A CA    1 
ATOM 1016  C C     . ILE E 3 7   ? 88.989  35.327  53.716  1.00 35.26  ? 24  ILE A C     1 
ATOM 1017  O O     . ILE E 3 7   ? 89.134  34.106  53.677  1.00 46.36  ? 24  ILE A O     1 
ATOM 1018  C CB    . ILE E 3 7   ? 89.327  36.673  55.868  1.00 43.90  ? 24  ILE A CB    1 
ATOM 1019  C CG1   . ILE E 3 7   ? 89.510  35.608  56.946  1.00 42.65  ? 24  ILE A CG1   1 
ATOM 1020  C CG2   . ILE E 3 7   ? 87.833  36.914  55.695  1.00 44.72  ? 24  ILE A CG2   1 
ATOM 1021  C CD1   . ILE E 3 7   ? 89.046  36.069  58.309  1.00 40.24  ? 24  ILE A CD1   1 
ATOM 1022  N N     . GLU E 3 8   ? 88.004  35.954  53.069  1.00 60.19  ? 25  GLU A N     1 
ATOM 1023  C CA    . GLU E 3 8   ? 86.984  35.252  52.279  1.00 60.05  ? 25  GLU A CA    1 
ATOM 1024  C C     . GLU E 3 8   ? 87.049  35.574  50.783  1.00 59.55  ? 25  GLU A C     1 
ATOM 1025  O O     . GLU E 3 8   ? 86.429  36.536  50.331  1.00 85.79  ? 25  GLU A O     1 
ATOM 1026  C CB    . GLU E 3 8   ? 85.591  35.612  52.794  1.00 82.09  ? 25  GLU A CB    1 
ATOM 1027  C CG    . GLU E 3 8   ? 84.972  34.539  53.646  1.00 87.58  ? 25  GLU A CG    1 
ATOM 1028  C CD    . GLU E 3 8   ? 84.622  33.305  52.840  1.00 89.95  ? 25  GLU A CD    1 
ATOM 1029  O OE1   . GLU E 3 8   ? 83.712  33.389  51.984  1.00 89.57  ? 25  GLU A OE1   1 
ATOM 1030  O OE2   . GLU E 3 8   ? 85.262  32.256  53.061  1.00 90.13  ? 25  GLU A OE2   1 
ATOM 1031  N N     . GLN E 3 9   ? 87.776  34.757  50.020  1.00 66.53  ? 26  GLN A N     1 
ATOM 1032  C CA    . GLN E 3 9   ? 87.929  34.963  48.574  1.00 64.41  ? 26  GLN A CA    1 
ATOM 1033  C C     . GLN E 3 9   ? 86.599  34.924  47.818  1.00 64.02  ? 26  GLN A C     1 
ATOM 1034  O O     . GLN E 3 9   ? 85.853  33.947  47.905  1.00 89.28  ? 26  GLN A O     1 
ATOM 1035  C CB    . GLN E 3 9   ? 88.831  33.885  47.978  1.00 74.71  ? 26  GLN A CB    1 
ATOM 1036  C CG    . GLN E 3 9   ? 88.130  32.546  47.890  1.00 69.56  ? 26  GLN A CG    1 
ATOM 1037  C CD    . GLN E 3 9   ? 88.842  31.558  47.021  1.00 66.61  ? 26  GLN A CD    1 
ATOM 1038  O OE1   . GLN E 3 9   ? 89.867  30.999  47.408  1.00 63.54  ? 26  GLN A OE1   1 
ATOM 1039  N NE2   . GLN E 3 9   ? 88.304  31.335  45.825  1.00 67.95  ? 26  GLN A NE2   1 
ATOM 1040  N N     . PRO E 3 10  ? 86.285  35.982  47.056  1.00 92.99  ? 27  PRO A N     1 
ATOM 1041  C CA    . PRO E 3 10  ? 85.030  35.993  46.309  1.00 90.31  ? 27  PRO A CA    1 
ATOM 1042  C C     . PRO E 3 10  ? 84.772  34.679  45.571  1.00 86.80  ? 27  PRO A C     1 
ATOM 1043  O O     . PRO E 3 10  ? 85.671  33.843  45.420  1.00 32.45  ? 27  PRO A O     1 
ATOM 1044  C CB    . PRO E 3 10  ? 85.222  37.172  45.370  1.00 33.54  ? 27  PRO A CB    1 
ATOM 1045  C CG    . PRO E 3 10  ? 85.921  38.133  46.230  1.00 31.21  ? 27  PRO A CG    1 
ATOM 1046  C CD    . PRO E 3 10  ? 86.975  37.276  46.910  1.00 35.19  ? 27  PRO A CD    1 
ATOM 1047  N N     . LYS E 3 11  ? 83.533  34.512  45.126  1.00 88.90  ? 28  LYS A N     1 
ATOM 1048  C CA    . LYS E 3 11  ? 83.109  33.318  44.410  1.00 90.25  ? 28  LYS A CA    1 
ATOM 1049  C C     . LYS E 3 11  ? 83.904  33.123  43.116  1.00 91.91  ? 28  LYS A C     1 
ATOM 1050  O O     . LYS E 3 11  ? 84.414  34.093  42.545  1.00 78.75  ? 28  LYS A O     1 
ATOM 1051  C CB    . LYS E 3 11  ? 81.615  33.432  44.110  1.00 81.07  ? 28  LYS A CB    1 
ATOM 1052  C CG    . LYS E 3 11  ? 80.953  32.147  43.625  1.00 75.41  ? 28  LYS A CG    1 
ATOM 1053  C CD    . LYS E 3 11  ? 79.500  32.083  44.083  1.00 72.89  ? 28  LYS A CD    1 
ATOM 1054  C CE    . LYS E 3 11  ? 79.424  31.850  45.581  1.00 69.10  ? 28  LYS A CE    1 
ATOM 1055  N NZ    . LYS E 3 11  ? 80.236  32.835  46.349  1.00 68.88  ? 28  LYS A NZ    1 
ATOM 1056  N N     . GLN E 3 12  ? 84.010  31.873  42.659  1.00 89.99  ? 29  GLN A N     1 
ATOM 1057  C CA    . GLN E 3 12  ? 84.747  31.547  41.432  1.00 91.63  ? 29  GLN A CA    1 
ATOM 1058  C C     . GLN E 3 12  ? 83.828  31.553  40.205  1.00 92.93  ? 29  GLN A C     1 
ATOM 1059  O O     . GLN E 3 12  ? 83.278  32.595  39.833  1.00 74.86  ? 29  GLN A O     1 
ATOM 1060  C CB    . GLN E 3 12  ? 85.432  30.172  41.568  1.00 64.05  ? 29  GLN A CB    1 
ATOM 1061  C CG    . GLN E 3 12  ? 86.261  29.703  40.348  1.00 62.48  ? 29  GLN A CG    1 
ATOM 1062  C CD    . GLN E 3 12  ? 87.646  30.336  40.266  1.00 61.06  ? 29  GLN A CD    1 
ATOM 1063  O OE1   . GLN E 3 12  ? 87.787  31.558  40.195  1.00 56.88  ? 29  GLN A OE1   1 
ATOM 1064  N NE2   . GLN E 3 12  ? 88.677  29.496  40.270  1.00 62.40  ? 29  GLN A NE2   1 
ATOM 1065  N N     . ARG E 3 13  ? 83.667  30.387  39.584  1.00 89.77  ? 30  ARG A N     1 
ATOM 1066  C CA    . ARG E 3 13  ? 82.832  30.246  38.398  1.00 90.07  ? 30  ARG A CA    1 
ATOM 1067  C C     . ARG E 3 13  ? 81.423  29.770  38.749  1.00 89.52  ? 30  ARG A C     1 
ATOM 1068  O O     . ARG E 3 13  ? 81.197  28.581  38.973  1.00 50.40  ? 30  ARG A O     1 
ATOM 1069  C CB    . ARG E 3 13  ? 83.490  29.270  37.413  1.00 52.03  ? 30  ARG A CB    1 
ATOM 1070  C CG    . ARG E 3 13  ? 82.726  29.089  36.108  1.00 55.49  ? 30  ARG A CG    1 
ATOM 1071  C CD    . ARG E 3 13  ? 83.472  28.231  35.062  1.00 57.13  ? 30  ARG A CD    1 
ATOM 1072  N NE    . ARG E 3 13  ? 84.505  28.970  34.334  1.00 58.13  ? 30  ARG A NE    1 
ATOM 1073  C CZ    . ARG E 3 13  ? 85.727  29.201  34.799  1.00 57.78  ? 30  ARG A CZ    1 
ATOM 1074  N NH1   . ARG E 3 13  ? 86.074  28.747  35.992  1.00 56.76  ? 30  ARG A NH1   1 
ATOM 1075  N NH2   . ARG E 3 13  ? 86.603  29.890  34.078  1.00 58.01  ? 30  ARG A NH2   1 
ATOM 1076  N N     . GLY E 3 14  ? 80.482  30.712  38.801  1.00 73.13  ? 31  GLY A N     1 
ATOM 1077  C CA    . GLY E 3 14  ? 79.108  30.375  39.124  1.00 70.02  ? 31  GLY A CA    1 
ATOM 1078  C C     . GLY E 3 14  ? 78.145  31.553  39.107  1.00 70.75  ? 31  GLY A C     1 
ATOM 1079  O O     . GLY E 3 14  ? 77.025  31.427  38.610  1.00 73.98  ? 31  GLY A O     1 
ATOM 1080  N N     . MET E 3 15  ? 78.564  32.701  39.641  1.00 90.76  ? 32  MET A N     1 
ATOM 1081  C CA    . MET E 3 15  ? 77.687  33.871  39.683  1.00 88.98  ? 32  MET A CA    1 
ATOM 1082  C C     . MET E 3 15  ? 77.361  34.340  38.271  1.00 88.74  ? 32  MET A C     1 
ATOM 1083  O O     . MET E 3 15  ? 77.962  33.876  37.308  1.00 60.35  ? 32  MET A O     1 
ATOM 1084  C CB    . MET E 3 15  ? 78.337  35.006  40.478  1.00 45.45  ? 32  MET A CB    1 
ATOM 1085  C CG    . MET E 3 15  ? 77.359  36.105  40.889  1.00 44.85  ? 32  MET A CG    1 
ATOM 1086  S SD    . MET E 3 15  ? 78.139  37.540  41.710  1.00 41.60  ? 32  MET A SD    1 
ATOM 1087  C CE    . MET E 3 15  ? 76.950  38.874  41.247  1.00 40.47  ? 32  MET A CE    1 
ATOM 1088  N N     . ARG E 3 16  ? 76.413  35.260  38.145  1.00 18.20  ? 33  ARG A N     1 
ATOM 1089  C CA    . ARG E 3 16  ? 76.024  35.745  36.829  1.00 12.41  ? 33  ARG A CA    1 
ATOM 1090  C C     . ARG E 3 16  ? 76.024  37.258  36.822  1.00 8.96   ? 33  ARG A C     1 
ATOM 1091  O O     . ARG E 3 16  ? 75.462  37.901  37.701  1.00 33.49  ? 33  ARG A O     1 
ATOM 1092  C CB    . ARG E 3 16  ? 74.631  35.217  36.468  1.00 26.29  ? 33  ARG A CB    1 
ATOM 1093  C CG    . ARG E 3 16  ? 74.218  35.415  35.020  1.00 23.09  ? 33  ARG A CG    1 
ATOM 1094  C CD    . ARG E 3 16  ? 72.987  34.559  34.664  1.00 18.06  ? 33  ARG A CD    1 
ATOM 1095  N NE    . ARG E 3 16  ? 71.710  35.295  34.642  1.00 13.74  ? 33  ARG A NE    1 
ATOM 1096  C CZ    . ARG E 3 16  ? 70.502  34.747  34.446  1.00 10.43  ? 33  ARG A CZ    1 
ATOM 1097  N NH1   . ARG E 3 16  ? 70.358  33.439  34.251  1.00 6.00   ? 33  ARG A NH1   1 
ATOM 1098  N NH2   . ARG E 3 16  ? 69.427  35.525  34.440  1.00 11.32  ? 33  ARG A NH2   1 
ATOM 1099  N N     . PHE E 3 17  ? 76.658  37.828  35.811  1.00 32.33  ? 34  PHE A N     1 
ATOM 1100  C CA    . PHE E 3 17  ? 76.740  39.273  35.683  1.00 36.33  ? 34  PHE A CA    1 
ATOM 1101  C C     . PHE E 3 17  ? 75.399  39.921  35.348  1.00 37.58  ? 34  PHE A C     1 
ATOM 1102  O O     . PHE E 3 17  ? 74.816  39.680  34.295  1.00 46.27  ? 34  PHE A O     1 
ATOM 1103  C CB    . PHE E 3 17  ? 77.787  39.624  34.629  1.00 28.85  ? 34  PHE A CB    1 
ATOM 1104  C CG    . PHE E 3 17  ? 79.205  39.402  35.088  1.00 32.75  ? 34  PHE A CG    1 
ATOM 1105  C CD1   . PHE E 3 17  ? 79.557  38.252  35.783  1.00 33.55  ? 34  PHE A CD1   1 
ATOM 1106  C CD2   . PHE E 3 17  ? 80.190  40.335  34.809  1.00 31.95  ? 34  PHE A CD2   1 
ATOM 1107  C CE1   . PHE E 3 17  ? 80.868  38.035  36.188  1.00 30.95  ? 34  PHE A CE1   1 
ATOM 1108  C CE2   . PHE E 3 17  ? 81.497  40.128  35.209  1.00 30.00  ? 34  PHE A CE2   1 
ATOM 1109  C CZ    . PHE E 3 17  ? 81.838  38.974  35.899  1.00 30.88  ? 34  PHE A CZ    1 
ATOM 1110  N N     . ARG E 3 18  ? 74.925  40.756  36.260  1.00 31.16  ? 35  ARG A N     1 
ATOM 1111  C CA    . ARG E 3 18  ? 73.654  41.431  36.083  1.00 30.76  ? 35  ARG A CA    1 
ATOM 1112  C C     . ARG E 3 18  ? 73.863  42.789  35.434  1.00 29.66  ? 35  ARG A C     1 
ATOM 1113  O O     . ARG E 3 18  ? 74.991  43.272  35.369  1.00 42.49  ? 35  ARG A O     1 
ATOM 1114  C CB    . ARG E 3 18  ? 72.981  41.587  37.440  1.00 40.45  ? 35  ARG A CB    1 
ATOM 1115  C CG    . ARG E 3 18  ? 73.212  40.399  38.377  1.00 43.89  ? 35  ARG A CG    1 
ATOM 1116  C CD    . ARG E 3 18  ? 72.633  39.094  37.837  1.00 44.87  ? 35  ARG A CD    1 
ATOM 1117  N NE    . ARG E 3 18  ? 71.206  39.205  37.548  1.00 44.96  ? 35  ARG A NE    1 
ATOM 1118  C CZ    . ARG E 3 18  ? 70.404  38.172  37.313  1.00 44.67  ? 35  ARG A CZ    1 
ATOM 1119  N NH1   . ARG E 3 18  ? 70.879  36.934  37.338  1.00 39.29  ? 35  ARG A NH1   1 
ATOM 1120  N NH2   . ARG E 3 18  ? 69.124  38.382  37.040  1.00 48.10  ? 35  ARG A NH2   1 
ATOM 1121  N N     . TYR E 3 19  ? 72.777  43.397  34.955  1.00 27.05  ? 36  TYR A N     1 
ATOM 1122  C CA    . TYR E 3 19  ? 72.842  44.703  34.292  1.00 24.20  ? 36  TYR A CA    1 
ATOM 1123  C C     . TYR E 3 19  ? 72.116  45.780  35.058  1.00 25.78  ? 36  TYR A C     1 
ATOM 1124  O O     . TYR E 3 19  ? 71.625  45.552  36.159  1.00 27.17  ? 36  TYR A O     1 
ATOM 1125  C CB    . TYR E 3 19  ? 72.208  44.665  32.911  1.00 13.84  ? 36  TYR A CB    1 
ATOM 1126  C CG    . TYR E 3 19  ? 72.838  43.723  31.941  1.00 13.82  ? 36  TYR A CG    1 
ATOM 1127  C CD1   . TYR E 3 19  ? 72.978  42.377  32.247  1.00 13.69  ? 36  TYR A CD1   1 
ATOM 1128  C CD2   . TYR E 3 19  ? 73.191  44.152  30.659  1.00 15.75  ? 36  TYR A CD2   1 
ATOM 1129  C CE1   . TYR E 3 19  ? 73.435  41.478  31.308  1.00 13.87  ? 36  TYR A CE1   1 
ATOM 1130  C CE2   . TYR E 3 19  ? 73.653  43.266  29.709  1.00 12.24  ? 36  TYR A CE2   1 
ATOM 1131  C CZ    . TYR E 3 19  ? 73.764  41.926  30.044  1.00 13.68  ? 36  TYR A CZ    1 
ATOM 1132  O OH    . TYR E 3 19  ? 74.158  41.017  29.103  1.00 13.60  ? 36  TYR A OH    1 
ATOM 1133  N N     . LYS E 3 20  ? 72.062  46.960  34.448  1.00 71.54  ? 37  LYS A N     1 
ATOM 1134  C CA    . LYS E 3 20  ? 71.370  48.094  35.036  1.00 73.77  ? 37  LYS A CA    1 
ATOM 1135  C C     . LYS E 3 20  ? 69.900  47.741  34.895  1.00 73.24  ? 37  LYS A C     1 
ATOM 1136  O O     . LYS E 3 20  ? 69.241  47.395  35.874  1.00 68.47  ? 37  LYS A O     1 
ATOM 1137  C CB    . LYS E 3 20  ? 71.681  49.380  34.262  1.00 66.90  ? 37  LYS A CB    1 
ATOM 1138  C CG    . LYS E 3 20  ? 72.535  50.398  35.026  1.00 65.51  ? 37  LYS A CG    1 
ATOM 1139  C CD    . LYS E 3 20  ? 72.942  51.566  34.128  1.00 64.38  ? 37  LYS A CD    1 
ATOM 1140  C CE    . LYS E 3 20  ? 71.738  52.330  33.599  1.00 62.32  ? 37  LYS A CE    1 
ATOM 1141  N NZ    . LYS E 3 20  ? 72.131  53.335  32.569  1.00 57.92  ? 37  LYS A NZ    1 
ATOM 1142  N N     . CYS E 3 21  ? 69.402  47.803  33.665  1.00 43.30  ? 38  CYS A N     1 
ATOM 1143  C CA    . CYS E 3 21  ? 68.017  47.466  33.386  1.00 43.64  ? 38  CYS A CA    1 
ATOM 1144  C C     . CYS E 3 21  ? 67.697  46.253  34.231  1.00 42.65  ? 38  CYS A C     1 
ATOM 1145  O O     . CYS E 3 21  ? 66.611  46.122  34.782  1.00 18.71  ? 38  CYS A O     1 
ATOM 1146  C CB    . CYS E 3 21  ? 67.847  47.098  31.916  1.00 37.64  ? 38  CYS A CB    1 
ATOM 1147  S SG    . CYS E 3 21  ? 68.539  45.480  31.460  1.00 42.22  ? 38  CYS A SG    1 
ATOM 1148  N N     . GLU E 3 22  ? 68.679  45.369  34.329  1.00 28.23  ? 39  GLU A N     1 
ATOM 1149  C CA    . GLU E 3 22  ? 68.554  44.135  35.094  1.00 32.77  ? 39  GLU A CA    1 
ATOM 1150  C C     . GLU E 3 22  ? 68.135  44.408  36.530  1.00 36.06  ? 39  GLU A C     1 
ATOM 1151  O O     . GLU E 3 22  ? 68.351  45.501  37.057  1.00 48.41  ? 39  GLU A O     1 
ATOM 1152  C CB    . GLU E 3 22  ? 69.888  43.384  35.081  1.00 38.92  ? 39  GLU A CB    1 
ATOM 1153  C CG    . GLU E 3 22  ? 70.024  42.342  33.998  1.00 36.31  ? 39  GLU A CG    1 
ATOM 1154  C CD    . GLU E 3 22  ? 69.465  41.034  34.448  1.00 34.88  ? 39  GLU A CD    1 
ATOM 1155  O OE1   . GLU E 3 22  ? 69.550  40.040  33.692  1.00 35.18  ? 39  GLU A OE1   1 
ATOM 1156  O OE2   . GLU E 3 22  ? 68.943  41.010  35.581  1.00 34.93  ? 39  GLU A OE2   1 
ATOM 1157  N N     . GLY E 3 23  ? 67.540  43.395  37.153  1.00 49.17  ? 40  GLY A N     1 
ATOM 1158  C CA    . GLY E 3 23  ? 67.093  43.522  38.523  1.00 54.79  ? 40  GLY A CA    1 
ATOM 1159  C C     . GLY E 3 23  ? 68.151  44.196  39.360  1.00 58.93  ? 40  GLY A C     1 
ATOM 1160  O O     . GLY E 3 23  ? 69.238  43.655  39.552  1.00 53.74  ? 40  GLY A O     1 
ATOM 1161  N N     . ARG E 3 24  ? 67.837  45.398  39.829  1.00 73.38  ? 41  ARG A N     1 
ATOM 1162  C CA    . ARG E 3 24  ? 68.743  46.166  40.667  1.00 76.28  ? 41  ARG A CA    1 
ATOM 1163  C C     . ARG E 3 24  ? 68.480  45.684  42.094  1.00 76.58  ? 41  ARG A C     1 
ATOM 1164  O O     . ARG E 3 24  ? 67.447  45.064  42.363  1.00 83.34  ? 41  ARG A O     1 
ATOM 1165  C CB    . ARG E 3 24  ? 68.447  47.663  40.529  1.00 87.97  ? 41  ARG A CB    1 
ATOM 1166  C CG    . ARG E 3 24  ? 68.302  48.124  39.081  1.00 87.76  ? 41  ARG A CG    1 
ATOM 1167  C CD    . ARG E 3 24  ? 68.130  49.643  38.945  1.00 88.84  ? 41  ARG A CD    1 
ATOM 1168  N NE    . ARG E 3 24  ? 67.942  50.044  37.547  1.00 86.82  ? 41  ARG A NE    1 
ATOM 1169  C CZ    . ARG E 3 24  ? 68.079  51.286  37.080  1.00 83.61  ? 41  ARG A CZ    1 
ATOM 1170  N NH1   . ARG E 3 24  ? 68.410  52.282  37.894  1.00 79.32  ? 41  ARG A NH1   1 
ATOM 1171  N NH2   . ARG E 3 24  ? 67.893  51.532  35.788  1.00 82.92  ? 41  ARG A NH2   1 
ATOM 1172  N N     . SER E 3 25  ? 69.413  45.952  43.002  1.00 85.43  ? 42  SER A N     1 
ATOM 1173  C CA    . SER E 3 25  ? 69.275  45.513  44.387  1.00 89.00  ? 42  SER A CA    1 
ATOM 1174  C C     . SER E 3 25  ? 68.959  44.022  44.399  1.00 89.76  ? 42  SER A C     1 
ATOM 1175  O O     . SER E 3 25  ? 68.614  43.452  45.437  1.00 103.89 ? 42  SER A O     1 
ATOM 1176  C CB    . SER E 3 25  ? 68.152  46.279  45.089  1.00 102.93 ? 42  SER A CB    1 
ATOM 1177  O OG    . SER E 3 25  ? 68.076  45.915  46.457  1.00 99.35  ? 42  SER A OG    1 
ATOM 1178  N N     . ALA E 3 26  ? 69.083  43.403  43.228  1.00 93.86  ? 43  ALA A N     1 
ATOM 1179  C CA    . ALA E 3 26  ? 68.809  41.985  43.057  1.00 93.68  ? 43  ALA A CA    1 
ATOM 1180  C C     . ALA E 3 26  ? 70.072  41.164  43.289  1.00 92.01  ? 43  ALA A C     1 
ATOM 1181  O O     . ALA E 3 26  ? 70.942  41.103  42.423  1.00 90.02  ? 43  ALA A O     1 
ATOM 1182  C CB    . ALA E 3 26  ? 68.269  41.728  41.653  1.00 92.97  ? 43  ALA A CB    1 
ATOM 1183  N N     . GLY E 3 27  ? 70.167  40.546  44.464  1.00 82.62  ? 44  GLY A N     1 
ATOM 1184  C CA    . GLY E 3 27  ? 71.325  39.729  44.783  1.00 80.97  ? 44  GLY A CA    1 
ATOM 1185  C C     . GLY E 3 27  ? 72.389  40.446  45.592  1.00 79.08  ? 44  GLY A C     1 
ATOM 1186  O O     . GLY E 3 27  ? 72.079  41.140  46.567  1.00 67.75  ? 44  GLY A O     1 
ATOM 1187  N N     . SER E 3 28  ? 73.642  40.265  45.175  1.00 84.07  ? 45  SER A N     1 
ATOM 1188  C CA    . SER E 3 28  ? 74.813  40.865  45.817  1.00 81.07  ? 45  SER A CA    1 
ATOM 1189  C C     . SER E 3 28  ? 76.056  40.102  45.356  1.00 79.79  ? 45  SER A C     1 
ATOM 1190  O O     . SER E 3 28  ? 76.082  39.526  44.264  1.00 72.49  ? 45  SER A O     1 
ATOM 1191  C CB    . SER E 3 28  ? 74.701  40.780  47.347  1.00 71.64  ? 45  SER A CB    1 
ATOM 1192  O OG    . SER E 3 28  ? 75.859  41.292  47.983  1.00 72.30  ? 45  SER A OG    1 
ATOM 1193  N N     . ILE E 3 29  ? 77.086  40.099  46.195  1.00 76.85  ? 46  ILE A N     1 
ATOM 1194  C CA    . ILE E 3 29  ? 78.317  39.398  45.872  1.00 76.14  ? 46  ILE A CA    1 
ATOM 1195  C C     . ILE E 3 29  ? 78.605  38.361  46.948  1.00 75.44  ? 46  ILE A C     1 
ATOM 1196  O O     . ILE E 3 29  ? 78.887  38.706  48.099  1.00 73.52  ? 46  ILE A O     1 
ATOM 1197  C CB    . ILE E 3 29  ? 79.514  40.367  45.774  1.00 79.11  ? 46  ILE A CB    1 
ATOM 1198  C CG1   . ILE E 3 29  ? 79.150  41.559  44.881  1.00 76.72  ? 46  ILE A CG1   1 
ATOM 1199  C CG2   . ILE E 3 29  ? 80.726  39.637  45.214  1.00 79.02  ? 46  ILE A CG2   1 
ATOM 1200  C CD1   . ILE E 3 29  ? 78.587  41.191  43.514  1.00 72.52  ? 46  ILE A CD1   1 
ATOM 1201  N N     . PRO E 3 30  ? 78.516  37.070  46.582  1.00 33.68  ? 47  PRO A N     1 
ATOM 1202  C CA    . PRO E 3 30  ? 78.751  35.918  47.456  1.00 33.08  ? 47  PRO A CA    1 
ATOM 1203  C C     . PRO E 3 30  ? 80.229  35.610  47.743  1.00 30.76  ? 47  PRO A C     1 
ATOM 1204  O O     . PRO E 3 30  ? 81.094  35.769  46.877  1.00 82.25  ? 47  PRO A O     1 
ATOM 1205  C CB    . PRO E 3 30  ? 78.061  34.786  46.702  1.00 85.22  ? 47  PRO A CB    1 
ATOM 1206  C CG    . PRO E 3 30  ? 78.340  35.143  45.288  1.00 84.71  ? 47  PRO A CG    1 
ATOM 1207  C CD    . PRO E 3 30  ? 78.003  36.617  45.276  1.00 84.70  ? 47  PRO A CD    1 
ATOM 1208  N N     . GLY E 3 31  ? 80.489  35.143  48.962  1.00 76.46  ? 48  GLY A N     1 
ATOM 1209  C CA    . GLY E 3 31  ? 81.840  34.812  49.380  1.00 79.52  ? 48  GLY A CA    1 
ATOM 1210  C C     . GLY E 3 31  ? 82.297  33.388  49.111  1.00 79.42  ? 48  GLY A C     1 
ATOM 1211  O O     . GLY E 3 31  ? 81.560  32.553  48.582  1.00 74.80  ? 48  GLY A O     1 
ATOM 1212  N N     . GLU E 3 32  ? 83.539  33.125  49.496  1.00 79.38  ? 49  GLU A N     1 
ATOM 1213  C CA    . GLU E 3 32  ? 84.197  31.829  49.315  1.00 79.43  ? 49  GLU A CA    1 
ATOM 1214  C C     . GLU E 3 32  ? 83.363  30.600  49.710  1.00 79.40  ? 49  GLU A C     1 
ATOM 1215  O O     . GLU E 3 32  ? 82.814  29.900  48.841  1.00 55.66  ? 49  GLU A O     1 
ATOM 1216  C CB    . GLU E 3 32  ? 85.534  31.854  50.091  1.00 65.33  ? 49  GLU A CB    1 
ATOM 1217  C CG    . GLU E 3 32  ? 86.413  30.600  50.003  1.00 68.35  ? 49  GLU A CG    1 
ATOM 1218  C CD    . GLU E 3 32  ? 87.819  30.831  50.549  1.00 69.98  ? 49  GLU A CD    1 
ATOM 1219  O OE1   . GLU E 3 32  ? 87.949  31.295  51.703  1.00 71.09  ? 49  GLU A OE1   1 
ATOM 1220  O OE2   . GLU E 3 32  ? 88.793  30.548  49.817  1.00 71.42  ? 49  GLU A OE2   1 
ATOM 1221  N N     . ARG E 3 33  ? 83.289  30.358  51.022  1.00 51.26  ? 50  ARG A N     1 
ATOM 1222  C CA    . ARG E 3 33  ? 82.571  29.224  51.606  1.00 53.27  ? 50  ARG A CA    1 
ATOM 1223  C C     . ARG E 3 33  ? 81.075  29.463  51.675  1.00 54.64  ? 50  ARG A C     1 
ATOM 1224  O O     . ARG E 3 33  ? 80.365  28.777  52.413  1.00 78.68  ? 50  ARG A O     1 
ATOM 1225  C CB    . ARG E 3 33  ? 83.093  28.951  53.019  1.00 89.14  ? 50  ARG A CB    1 
ATOM 1226  C CG    . ARG E 3 33  ? 84.612  28.760  53.120  1.00 90.53  ? 50  ARG A CG    1 
ATOM 1227  C CD    . ARG E 3 33  ? 85.059  28.572  54.575  1.00 89.90  ? 50  ARG A CD    1 
ATOM 1228  N NE    . ARG E 3 33  ? 86.511  28.464  54.703  1.00 92.85  ? 50  ARG A NE    1 
ATOM 1229  C CZ    . ARG E 3 33  ? 87.159  28.389  55.862  1.00 94.18  ? 50  ARG A CZ    1 
ATOM 1230  N NH1   . ARG E 3 33  ? 86.491  28.412  57.012  1.00 94.91  ? 50  ARG A NH1   1 
ATOM 1231  N NH2   . ARG E 3 33  ? 88.481  28.289  55.874  1.00 95.41  ? 50  ARG A NH2   1 
ATOM 1232  N N     . SER E 3 34  ? 80.610  30.442  50.902  1.00 63.22  ? 51  SER A N     1 
ATOM 1233  C CA    . SER E 3 34  ? 79.196  30.798  50.843  1.00 64.32  ? 51  SER A CA    1 
ATOM 1234  C C     . SER E 3 34  ? 78.307  29.571  50.777  1.00 64.35  ? 51  SER A C     1 
ATOM 1235  O O     . SER E 3 34  ? 78.769  28.471  50.482  1.00 55.94  ? 51  SER A O     1 
ATOM 1236  C CB    . SER E 3 34  ? 78.926  31.672  49.618  1.00 61.30  ? 51  SER A CB    1 
ATOM 1237  O OG    . SER E 3 34  ? 77.539  31.924  49.466  1.00 61.52  ? 51  SER A OG    1 
ATOM 1238  N N     . THR E 3 35  ? 77.020  29.762  51.033  1.00 71.70  ? 52  THR A N     1 
ATOM 1239  C CA    . THR E 3 35  ? 76.102  28.641  50.997  1.00 70.29  ? 52  THR A CA    1 
ATOM 1240  C C     . THR E 3 35  ? 74.663  29.045  50.711  1.00 68.95  ? 52  THR A C     1 
ATOM 1241  O O     . THR E 3 35  ? 74.300  30.225  50.769  1.00 84.59  ? 52  THR A O     1 
ATOM 1242  C CB    . THR E 3 35  ? 76.157  27.851  52.323  1.00 94.79  ? 52  THR A CB    1 
ATOM 1243  O OG1   . THR E 3 35  ? 77.512  27.461  52.584  1.00 94.43  ? 52  THR A OG1   1 
ATOM 1244  C CG2   . THR E 3 35  ? 75.290  26.596  52.247  1.00 94.55  ? 52  THR A CG2   1 
ATOM 1245  N N     . ASP E 3 36  ? 73.862  28.035  50.387  1.00 81.35  ? 53  ASP A N     1 
ATOM 1246  C CA    . ASP E 3 36  ? 72.447  28.174  50.075  1.00 81.95  ? 53  ASP A CA    1 
ATOM 1247  C C     . ASP E 3 36  ? 71.640  28.427  51.333  1.00 81.30  ? 53  ASP A C     1 
ATOM 1248  O O     . ASP E 3 36  ? 70.412  28.539  51.281  1.00 75.80  ? 53  ASP A O     1 
ATOM 1249  C CB    . ASP E 3 36  ? 71.957  26.886  49.427  1.00 77.86  ? 53  ASP A CB    1 
ATOM 1250  C CG    . ASP E 3 36  ? 72.703  25.667  49.946  1.00 78.32  ? 53  ASP A CG    1 
ATOM 1251  O OD1   . ASP E 3 36  ? 73.812  25.395  49.431  1.00 79.12  ? 53  ASP A OD1   1 
ATOM 1252  O OD2   . ASP E 3 36  ? 72.196  24.999  50.877  1.00 75.93  ? 53  ASP A OD2   1 
ATOM 1253  N N     . THR E 3 37  ? 72.336  28.516  52.459  1.00 65.72  ? 54  THR A N     1 
ATOM 1254  C CA    . THR E 3 37  ? 71.694  28.730  53.746  1.00 66.18  ? 54  THR A CA    1 
ATOM 1255  C C     . THR E 3 37  ? 72.482  29.725  54.613  1.00 66.82  ? 54  THR A C     1 
ATOM 1256  O O     . THR E 3 37  ? 71.989  30.242  55.620  1.00 67.77  ? 54  THR A O     1 
ATOM 1257  C CB    . THR E 3 37  ? 71.563  27.385  54.456  1.00 75.72  ? 54  THR A CB    1 
ATOM 1258  O OG1   . THR E 3 37  ? 72.734  26.604  54.188  1.00 74.67  ? 54  THR A OG1   1 
ATOM 1259  C CG2   . THR E 3 37  ? 70.344  26.625  53.950  1.00 77.41  ? 54  THR A CG2   1 
ATOM 1260  N N     . THR E 3 38  ? 73.715  29.988  54.197  1.00 83.60  ? 55  THR A N     1 
ATOM 1261  C CA    . THR E 3 38  ? 74.598  30.927  54.882  1.00 84.67  ? 55  THR A CA    1 
ATOM 1262  C C     . THR E 3 38  ? 75.484  31.568  53.797  1.00 85.34  ? 55  THR A C     1 
ATOM 1263  O O     . THR E 3 38  ? 76.179  30.874  53.051  1.00 71.50  ? 55  THR A O     1 
ATOM 1264  C CB    . THR E 3 38  ? 75.437  30.194  55.960  1.00 54.51  ? 55  THR A CB    1 
ATOM 1265  O OG1   . THR E 3 38  ? 74.560  29.731  56.997  1.00 52.32  ? 55  THR A OG1   1 
ATOM 1266  C CG2   . THR E 3 38  ? 76.476  31.122  56.568  1.00 53.62  ? 55  THR A CG2   1 
ATOM 1267  N N     . LYS E 3 39  ? 75.432  32.895  53.705  1.00 89.80  ? 56  LYS A N     1 
ATOM 1268  C CA    . LYS E 3 39  ? 76.176  33.647  52.696  1.00 89.47  ? 56  LYS A CA    1 
ATOM 1269  C C     . LYS E 3 39  ? 77.663  33.916  52.973  1.00 90.68  ? 56  LYS A C     1 
ATOM 1270  O O     . LYS E 3 39  ? 78.533  33.140  52.563  1.00 68.64  ? 56  LYS A O     1 
ATOM 1271  C CB    . LYS E 3 39  ? 75.449  34.977  52.419  1.00 72.78  ? 56  LYS A CB    1 
ATOM 1272  C CG    . LYS E 3 39  ? 75.181  35.885  53.662  1.00 66.68  ? 56  LYS A CG    1 
ATOM 1273  C CD    . LYS E 3 39  ? 74.026  35.379  54.539  1.00 61.87  ? 56  LYS A CD    1 
ATOM 1274  C CE    . LYS E 3 39  ? 73.685  36.346  55.672  1.00 57.99  ? 56  LYS A CE    1 
ATOM 1275  N NZ    . LYS E 3 39  ? 72.507  35.878  56.474  1.00 51.47  ? 56  LYS A NZ    1 
ATOM 1276  N N     . THR E 3 40  ? 77.943  35.031  53.648  1.00 99.21  ? 57  THR A N     1 
ATOM 1277  C CA    . THR E 3 40  ? 79.303  35.446  53.989  1.00 98.78  ? 57  THR A CA    1 
ATOM 1278  C C     . THR E 3 40  ? 79.982  36.169  52.824  1.00 98.39  ? 57  THR A C     1 
ATOM 1279  O O     . THR E 3 40  ? 80.529  35.529  51.925  1.00 101.79 ? 57  THR A O     1 
ATOM 1280  C CB    . THR E 3 40  ? 80.184  34.247  54.386  1.00 97.01  ? 57  THR A CB    1 
ATOM 1281  O OG1   . THR E 3 40  ? 79.498  33.448  55.358  1.00 96.61  ? 57  THR A OG1   1 
ATOM 1282  C CG2   . THR E 3 40  ? 81.494  34.732  54.979  1.00 96.64  ? 57  THR A CG2   1 
ATOM 1283  N N     . HIS E 3 41  ? 79.947  37.499  52.852  1.00 68.89  ? 58  HIS A N     1 
ATOM 1284  C CA    . HIS E 3 41  ? 80.555  38.320  51.810  1.00 67.57  ? 58  HIS A CA    1 
ATOM 1285  C C     . HIS E 3 41  ? 82.056  38.505  51.988  1.00 68.89  ? 58  HIS A C     1 
ATOM 1286  O O     . HIS E 3 41  ? 82.634  38.066  52.983  1.00 70.68  ? 58  HIS A O     1 
ATOM 1287  C CB    . HIS E 3 41  ? 79.917  39.705  51.788  1.00 72.09  ? 58  HIS A CB    1 
ATOM 1288  C CG    . HIS E 3 41  ? 78.482  39.704  51.386  1.00 71.13  ? 58  HIS A CG    1 
ATOM 1289  N ND1   . HIS E 3 41  ? 77.854  40.826  50.888  1.00 69.07  ? 58  HIS A ND1   1 
ATOM 1290  C CD2   . HIS E 3 41  ? 77.547  38.727  51.413  1.00 71.29  ? 58  HIS A CD2   1 
ATOM 1291  C CE1   . HIS E 3 41  ? 76.593  40.539  50.624  1.00 70.56  ? 58  HIS A CE1   1 
ATOM 1292  N NE2   . HIS E 3 41  ? 76.381  39.271  50.934  1.00 71.25  ? 58  HIS A NE2   1 
ATOM 1293  N N     . PRO E 3 42  ? 82.707  39.169  51.013  1.00 55.57  ? 59  PRO A N     1 
ATOM 1294  C CA    . PRO E 3 42  ? 84.150  39.431  51.050  1.00 51.81  ? 59  PRO A CA    1 
ATOM 1295  C C     . PRO E 3 42  ? 84.539  40.317  52.227  1.00 48.65  ? 59  PRO A C     1 
ATOM 1296  O O     . PRO E 3 42  ? 83.923  41.346  52.474  1.00 43.96  ? 59  PRO A O     1 
ATOM 1297  C CB    . PRO E 3 42  ? 84.406  40.119  49.711  1.00 57.26  ? 59  PRO A CB    1 
ATOM 1298  C CG    . PRO E 3 42  ? 83.420  39.472  48.822  1.00 59.37  ? 59  PRO A CG    1 
ATOM 1299  C CD    . PRO E 3 42  ? 82.171  39.478  49.674  1.00 60.12  ? 59  PRO A CD    1 
ATOM 1300  N N     . THR E 3 43  ? 85.566  39.908  52.955  1.00 63.32  ? 60  THR A N     1 
ATOM 1301  C CA    . THR E 3 43  ? 86.018  40.679  54.096  1.00 62.08  ? 60  THR A CA    1 
ATOM 1302  C C     . THR E 3 43  ? 87.538  40.614  54.137  1.00 62.96  ? 60  THR A C     1 
ATOM 1303  O O     . THR E 3 43  ? 88.129  39.538  54.030  1.00 72.18  ? 60  THR A O     1 
ATOM 1304  C CB    . THR E 3 43  ? 85.439  40.116  55.423  1.00 67.56  ? 60  THR A CB    1 
ATOM 1305  O OG1   . THR E 3 43  ? 86.144  38.925  55.789  1.00 64.64  ? 60  THR A OG1   1 
ATOM 1306  C CG2   . THR E 3 43  ? 83.952  39.773  55.261  1.00 65.05  ? 60  THR A CG2   1 
ATOM 1307  N N     . ILE E 3 44  ? 88.167  41.774  54.277  1.00 74.47  ? 61  ILE A N     1 
ATOM 1308  C CA    . ILE E 3 44  ? 89.622  41.856  54.332  1.00 74.89  ? 61  ILE A CA    1 
ATOM 1309  C C     . ILE E 3 44  ? 90.107  42.170  55.749  1.00 74.45  ? 61  ILE A C     1 
ATOM 1310  O O     . ILE E 3 44  ? 89.641  43.126  56.384  1.00 86.52  ? 61  ILE A O     1 
ATOM 1311  C CB    . ILE E 3 44  ? 90.141  42.932  53.365  1.00 77.25  ? 61  ILE A CB    1 
ATOM 1312  C CG1   . ILE E 3 44  ? 89.483  44.283  53.680  1.00 76.47  ? 61  ILE A CG1   1 
ATOM 1313  C CG2   . ILE E 3 44  ? 89.851  42.502  51.937  1.00 77.49  ? 61  ILE A CG2   1 
ATOM 1314  C CD1   . ILE E 3 44  ? 89.969  45.437  52.821  1.00 76.76  ? 61  ILE A CD1   1 
ATOM 1315  N N     . LYS E 3 45  ? 91.045  41.358  56.238  1.00 74.08  ? 62  LYS A N     1 
ATOM 1316  C CA    . LYS E 3 45  ? 91.593  41.525  57.582  1.00 74.42  ? 62  LYS A CA    1 
ATOM 1317  C C     . LYS E 3 45  ? 92.938  42.234  57.577  1.00 75.20  ? 62  LYS A C     1 
ATOM 1318  O O     . LYS E 3 45  ? 93.898  41.760  56.971  1.00 85.06  ? 62  LYS A O     1 
ATOM 1319  C CB    . LYS E 3 45  ? 91.759  40.164  58.258  1.00 78.72  ? 62  LYS A CB    1 
ATOM 1320  C CG    . LYS E 3 45  ? 92.145  40.252  59.721  1.00 77.10  ? 62  LYS A CG    1 
ATOM 1321  C CD    . LYS E 3 45  ? 93.043  39.096  60.115  1.00 75.90  ? 62  LYS A CD    1 
ATOM 1322  C CE    . LYS E 3 45  ? 94.376  39.159  59.369  1.00 73.30  ? 62  LYS A CE    1 
ATOM 1323  N NZ    . LYS E 3 45  ? 95.280  38.020  59.709  1.00 70.25  ? 62  LYS A NZ    1 
ATOM 1324  N N     . ILE E 3 46  ? 92.999  43.367  58.265  1.00 99.66  ? 63  ILE A N     1 
ATOM 1325  C CA    . ILE E 3 46  ? 94.230  44.137  58.362  1.00 102.28 ? 63  ILE A CA    1 
ATOM 1326  C C     . ILE E 3 46  ? 94.988  43.676  59.603  1.00 104.94 ? 63  ILE A C     1 
ATOM 1327  O O     . ILE E 3 46  ? 94.936  44.327  60.650  1.00 74.70  ? 63  ILE A O     1 
ATOM 1328  C CB    . ILE E 3 46  ? 93.938  45.630  58.511  1.00 63.43  ? 63  ILE A CB    1 
ATOM 1329  C CG1   . ILE E 3 46  ? 92.957  46.081  57.427  1.00 62.37  ? 63  ILE A CG1   1 
ATOM 1330  C CG2   . ILE E 3 46  ? 95.243  46.408  58.441  1.00 64.52  ? 63  ILE A CG2   1 
ATOM 1331  C CD1   . ILE E 3 46  ? 92.560  47.552  57.519  1.00 64.31  ? 63  ILE A CD1   1 
ATOM 1332  N N     . ASN E 3 47  ? 95.691  42.554  59.485  1.00 110.06 ? 64  ASN A N     1 
ATOM 1333  C CA    . ASN E 3 47  ? 96.434  42.012  60.615  1.00 112.76 ? 64  ASN A CA    1 
ATOM 1334  C C     . ASN E 3 47  ? 97.288  43.066  61.300  1.00 114.01 ? 64  ASN A C     1 
ATOM 1335  O O     . ASN E 3 47  ? 97.986  43.845  60.644  1.00 107.71 ? 64  ASN A O     1 
ATOM 1336  C CB    . ASN E 3 47  ? 97.321  40.847  60.176  1.00 104.63 ? 64  ASN A CB    1 
ATOM 1337  C CG    . ASN E 3 47  ? 97.906  40.089  61.356  1.00 105.79 ? 64  ASN A CG    1 
ATOM 1338  O OD1   . ASN E 3 47  ? 98.665  39.136  61.180  1.00 104.13 ? 64  ASN A OD1   1 
ATOM 1339  N ND2   . ASN E 3 47  ? 97.549  40.508  62.570  1.00 105.32 ? 64  ASN A ND2   1 
ATOM 1340  N N     . GLY E 3 48  ? 97.226  43.078  62.628  1.00 84.07  ? 65  GLY A N     1 
ATOM 1341  C CA    . GLY E 3 48  ? 97.995  44.041  63.385  1.00 83.37  ? 65  GLY A CA    1 
ATOM 1342  C C     . GLY E 3 48  ? 97.231  45.340  63.508  1.00 82.76  ? 65  GLY A C     1 
ATOM 1343  O O     . GLY E 3 48  ? 96.315  45.440  64.326  1.00 89.21  ? 65  GLY A O     1 
ATOM 1344  N N     . TYR E 3 49  ? 97.595  46.328  62.690  1.00 70.92  ? 66  TYR A N     1 
ATOM 1345  C CA    . TYR E 3 49  ? 96.936  47.631  62.716  1.00 68.08  ? 66  TYR A CA    1 
ATOM 1346  C C     . TYR E 3 49  ? 95.410  47.504  62.741  1.00 68.21  ? 66  TYR A C     1 
ATOM 1347  O O     . TYR E 3 49  ? 94.840  46.649  62.063  1.00 107.60 ? 66  TYR A O     1 
ATOM 1348  C CB    . TYR E 3 49  ? 97.343  48.464  61.504  1.00 95.39  ? 66  TYR A CB    1 
ATOM 1349  C CG    . TYR E 3 49  ? 96.699  49.823  61.513  1.00 94.73  ? 66  TYR A CG    1 
ATOM 1350  C CD1   . TYR E 3 49  ? 97.365  50.928  62.036  1.00 93.34  ? 66  TYR A CD1   1 
ATOM 1351  C CD2   . TYR E 3 49  ? 95.395  49.996  61.056  1.00 93.49  ? 66  TYR A CD2   1 
ATOM 1352  C CE1   . TYR E 3 49  ? 96.745  52.171  62.106  1.00 92.25  ? 66  TYR A CE1   1 
ATOM 1353  C CE2   . TYR E 3 49  ? 94.767  51.227  61.123  1.00 91.36  ? 66  TYR A CE2   1 
ATOM 1354  C CZ    . TYR E 3 49  ? 95.446  52.311  61.647  1.00 91.00  ? 66  TYR A CZ    1 
ATOM 1355  O OH    . TYR E 3 49  ? 94.823  53.535  61.695  1.00 92.41  ? 66  TYR A OH    1 
ATOM 1356  N N     . THR E 3 50  ? 94.756  48.367  63.515  1.00 54.89  ? 67  THR A N     1 
ATOM 1357  C CA    . THR E 3 50  ? 93.303  48.352  63.633  1.00 53.18  ? 67  THR A CA    1 
ATOM 1358  C C     . THR E 3 50  ? 92.811  49.715  64.085  1.00 52.05  ? 67  THR A C     1 
ATOM 1359  O O     . THR E 3 50  ? 93.093  50.144  65.203  1.00 84.42  ? 67  THR A O     1 
ATOM 1360  C CB    . THR E 3 50  ? 92.828  47.322  64.676  1.00 91.11  ? 67  THR A CB    1 
ATOM 1361  O OG1   . THR E 3 50  ? 93.486  46.070  64.455  1.00 91.51  ? 67  THR A OG1   1 
ATOM 1362  C CG2   . THR E 3 50  ? 91.323  47.122  64.572  1.00 90.20  ? 67  THR A CG2   1 
ATOM 1363  N N     . GLY E 3 51  ? 92.070  50.392  63.216  1.00 80.71  ? 68  GLY A N     1 
ATOM 1364  C CA    . GLY E 3 51  ? 91.550  51.705  63.557  1.00 80.35  ? 68  GLY A CA    1 
ATOM 1365  C C     . GLY E 3 51  ? 90.829  52.366  62.395  1.00 80.29  ? 68  GLY A C     1 
ATOM 1366  O O     . GLY E 3 51  ? 90.351  51.685  61.481  1.00 73.91  ? 68  GLY A O     1 
ATOM 1367  N N     . PRO E 3 52  ? 90.733  53.701  62.395  1.00 79.90  ? 69  PRO A N     1 
ATOM 1368  C CA    . PRO E 3 52  ? 90.044  54.368  61.289  1.00 79.99  ? 69  PRO A CA    1 
ATOM 1369  C C     . PRO E 3 52  ? 90.747  54.092  59.967  1.00 80.49  ? 69  PRO A C     1 
ATOM 1370  O O     . PRO E 3 52  ? 91.953  53.840  59.936  1.00 97.39  ? 69  PRO A O     1 
ATOM 1371  C CB    . PRO E 3 52  ? 90.107  55.839  61.686  1.00 92.27  ? 69  PRO A CB    1 
ATOM 1372  C CG    . PRO E 3 52  ? 91.409  55.922  62.422  1.00 90.98  ? 69  PRO A CG    1 
ATOM 1373  C CD    . PRO E 3 52  ? 91.377  54.681  63.287  1.00 91.70  ? 69  PRO A CD    1 
ATOM 1374  N N     . GLY E 3 53  ? 89.987  54.131  58.879  1.00 81.20  ? 70  GLY A N     1 
ATOM 1375  C CA    . GLY E 3 53  ? 90.559  53.886  57.569  1.00 81.60  ? 70  GLY A CA    1 
ATOM 1376  C C     . GLY E 3 53  ? 89.506  54.055  56.497  1.00 82.00  ? 70  GLY A C     1 
ATOM 1377  O O     . GLY E 3 53  ? 88.318  53.892  56.761  1.00 82.65  ? 70  GLY A O     1 
ATOM 1378  N N     . THR E 3 54  ? 89.926  54.405  55.291  1.00 80.36  ? 71  THR A N     1 
ATOM 1379  C CA    . THR E 3 54  ? 88.983  54.570  54.196  1.00 77.84  ? 71  THR A CA    1 
ATOM 1380  C C     . THR E 3 54  ? 89.131  53.337  53.317  1.00 77.52  ? 71  THR A C     1 
ATOM 1381  O O     . THR E 3 54  ? 90.127  52.613  53.426  1.00 98.81  ? 71  THR A O     1 
ATOM 1382  C CB    . THR E 3 54  ? 89.304  55.822  53.358  1.00 86.77  ? 71  THR A CB    1 
ATOM 1383  O OG1   . THR E 3 54  ? 89.302  56.973  54.205  1.00 86.69  ? 71  THR A OG1   1 
ATOM 1384  C CG2   . THR E 3 54  ? 88.268  56.015  52.264  1.00 84.18  ? 71  THR A CG2   1 
ATOM 1385  N N     . VAL E 3 55  ? 88.143  53.082  52.465  1.00 52.72  ? 72  VAL A N     1 
ATOM 1386  C CA    . VAL E 3 55  ? 88.217  51.937  51.566  1.00 50.58  ? 72  VAL A CA    1 
ATOM 1387  C C     . VAL E 3 55  ? 87.550  52.231  50.261  1.00 48.30  ? 72  VAL A C     1 
ATOM 1388  O O     . VAL E 3 55  ? 86.446  52.757  50.222  1.00 61.42  ? 72  VAL A O     1 
ATOM 1389  C CB    . VAL E 3 55  ? 87.557  50.667  52.145  1.00 67.96  ? 72  VAL A CB    1 
ATOM 1390  C CG1   . VAL E 3 55  ? 86.135  50.955  52.549  1.00 68.30  ? 72  VAL A CG1   1 
ATOM 1391  C CG2   . VAL E 3 55  ? 87.591  49.552  51.103  1.00 64.20  ? 72  VAL A CG2   1 
ATOM 1392  N N     . ARG E 3 56  ? 88.250  51.895  49.190  1.00 76.14  ? 73  ARG A N     1 
ATOM 1393  C CA    . ARG E 3 56  ? 87.731  52.082  47.857  1.00 73.25  ? 73  ARG A CA    1 
ATOM 1394  C C     . ARG E 3 56  ? 87.878  50.755  47.153  1.00 71.40  ? 73  ARG A C     1 
ATOM 1395  O O     . ARG E 3 56  ? 88.969  50.430  46.698  1.00 81.47  ? 73  ARG A O     1 
ATOM 1396  C CB    . ARG E 3 56  ? 88.528  53.136  47.094  1.00 60.99  ? 73  ARG A CB    1 
ATOM 1397  C CG    . ARG E 3 56  ? 88.315  53.020  45.596  1.00 54.80  ? 73  ARG A CG    1 
ATOM 1398  C CD    . ARG E 3 56  ? 89.039  54.076  44.801  1.00 55.26  ? 73  ARG A CD    1 
ATOM 1399  N NE    . ARG E 3 56  ? 88.497  55.401  45.069  1.00 49.51  ? 73  ARG A NE    1 
ATOM 1400  C CZ    . ARG E 3 56  ? 88.556  56.413  44.213  1.00 48.93  ? 73  ARG A CZ    1 
ATOM 1401  N NH1   . ARG E 3 56  ? 89.134  56.252  43.027  1.00 43.34  ? 73  ARG A NH1   1 
ATOM 1402  N NH2   . ARG E 3 56  ? 88.028  57.583  44.543  1.00 48.69  ? 73  ARG A NH2   1 
ATOM 1403  N N     . ILE E 3 57  ? 86.811  49.970  47.071  1.00 51.20  ? 74  ILE A N     1 
ATOM 1404  C CA    . ILE E 3 57  ? 86.937  48.697  46.379  1.00 48.25  ? 74  ILE A CA    1 
ATOM 1405  C C     . ILE E 3 57  ? 86.604  48.897  44.905  1.00 46.15  ? 74  ILE A C     1 
ATOM 1406  O O     . ILE E 3 57  ? 85.717  49.679  44.553  1.00 51.05  ? 74  ILE A O     1 
ATOM 1407  C CB    . ILE E 3 57  ? 86.007  47.606  46.947  1.00 54.24  ? 74  ILE A CB    1 
ATOM 1408  C CG1   . ILE E 3 57  ? 86.171  47.491  48.462  1.00 52.45  ? 74  ILE A CG1   1 
ATOM 1409  C CG2   . ILE E 3 57  ? 86.383  46.256  46.331  1.00 52.14  ? 74  ILE A CG2   1 
ATOM 1410  C CD1   . ILE E 3 57  ? 85.045  46.708  49.121  1.00 49.45  ? 74  ILE A CD1   1 
ATOM 1411  N N     . SER E 3 58  ? 87.332  48.191  44.047  1.00 51.04  ? 75  SER A N     1 
ATOM 1412  C CA    . SER E 3 58  ? 87.135  48.281  42.608  1.00 47.69  ? 75  SER A CA    1 
ATOM 1413  C C     . SER E 3 58  ? 87.410  46.949  41.915  1.00 44.40  ? 75  SER A C     1 
ATOM 1414  O O     . SER E 3 58  ? 88.099  46.068  42.447  1.00 27.95  ? 75  SER A O     1 
ATOM 1415  C CB    . SER E 3 58  ? 88.018  49.391  42.029  1.00 38.99  ? 75  SER A CB    1 
ATOM 1416  O OG    . SER E 3 58  ? 89.093  49.686  42.909  1.00 30.80  ? 75  SER A OG    1 
ATOM 1417  N N     . LEU E 3 59  ? 86.860  46.821  40.715  1.00 35.67  ? 76  LEU A N     1 
ATOM 1418  C CA    . LEU E 3 59  ? 86.975  45.608  39.918  1.00 33.86  ? 76  LEU A CA    1 
ATOM 1419  C C     . LEU E 3 59  ? 88.018  45.776  38.809  1.00 32.32  ? 76  LEU A C     1 
ATOM 1420  O O     . LEU E 3 59  ? 87.998  46.773  38.087  1.00 33.56  ? 76  LEU A O     1 
ATOM 1421  C CB    . LEU E 3 59  ? 85.595  45.299  39.331  1.00 36.51  ? 76  LEU A CB    1 
ATOM 1422  C CG    . LEU E 3 59  ? 85.121  43.854  39.159  1.00 36.18  ? 76  LEU A CG    1 
ATOM 1423  C CD1   . LEU E 3 59  ? 85.478  43.024  40.382  1.00 35.96  ? 76  LEU A CD1   1 
ATOM 1424  C CD2   . LEU E 3 59  ? 83.613  43.862  38.927  1.00 36.15  ? 76  LEU A CD2   1 
ATOM 1425  N N     . VAL E 3 60  ? 88.928  44.807  38.683  1.00 3.93   ? 77  VAL A N     1 
ATOM 1426  C CA    . VAL E 3 60  ? 89.972  44.871  37.665  1.00 2.00   ? 77  VAL A CA    1 
ATOM 1427  C C     . VAL E 3 60  ? 90.126  43.594  36.830  1.00 2.00   ? 77  VAL A C     1 
ATOM 1428  O O     . VAL E 3 60  ? 89.775  42.500  37.266  1.00 2.00   ? 77  VAL A O     1 
ATOM 1429  C CB    . VAL E 3 60  ? 91.348  45.212  38.297  1.00 24.62  ? 77  VAL A CB    1 
ATOM 1430  C CG1   . VAL E 3 60  ? 91.351  46.634  38.813  1.00 22.20  ? 77  VAL A CG1   1 
ATOM 1431  C CG2   . VAL E 3 60  ? 91.657  44.257  39.421  1.00 20.50  ? 77  VAL A CG2   1 
ATOM 1432  N N     . THR E 3 61  ? 90.672  43.749  35.628  1.00 2.00   ? 78  THR A N     1 
ATOM 1433  C CA    . THR E 3 61  ? 90.876  42.636  34.697  1.00 2.00   ? 78  THR A CA    1 
ATOM 1434  C C     . THR E 3 61  ? 91.606  41.449  35.317  1.00 2.00   ? 78  THR A C     1 
ATOM 1435  O O     . THR E 3 61  ? 92.242  41.558  36.355  1.00 2.00   ? 78  THR A O     1 
ATOM 1436  C CB    . THR E 3 61  ? 91.683  43.090  33.496  1.00 7.43   ? 78  THR A CB    1 
ATOM 1437  O OG1   . THR E 3 61  ? 93.013  43.398  33.926  1.00 7.43   ? 78  THR A OG1   1 
ATOM 1438  C CG2   . THR E 3 61  ? 91.069  44.331  32.878  1.00 7.43   ? 78  THR A CG2   1 
ATOM 1439  N N     . LYS E 3 62  ? 91.541  40.314  34.643  1.00 12.34  ? 79  LYS A N     1 
ATOM 1440  C CA    . LYS E 3 62  ? 92.170  39.114  35.149  1.00 12.34  ? 79  LYS A CA    1 
ATOM 1441  C C     . LYS E 3 62  ? 93.687  39.037  35.052  1.00 15.58  ? 79  LYS A C     1 
ATOM 1442  O O     . LYS E 3 62  ? 94.355  38.791  36.054  1.00 16.54  ? 79  LYS A O     1 
ATOM 1443  C CB    . LYS E 3 62  ? 91.562  37.894  34.463  1.00 2.78   ? 79  LYS A CB    1 
ATOM 1444  C CG    . LYS E 3 62  ? 92.188  36.579  34.867  1.00 2.78   ? 79  LYS A CG    1 
ATOM 1445  C CD    . LYS E 3 62  ? 91.464  35.415  34.219  1.00 4.06   ? 79  LYS A CD    1 
ATOM 1446  C CE    . LYS E 3 62  ? 91.632  35.443  32.695  1.00 4.78   ? 79  LYS A CE    1 
ATOM 1447  N NZ    . LYS E 3 62  ? 90.900  34.361  31.959  1.00 6.36   ? 79  LYS A NZ    1 
ATOM 1448  N N     . ASP E 3 63  ? 94.225  39.276  33.855  1.00 25.18  ? 80  ASP A N     1 
ATOM 1449  C CA    . ASP E 3 63  ? 95.665  39.151  33.590  1.00 27.69  ? 80  ASP A CA    1 
ATOM 1450  C C     . ASP E 3 63  ? 96.683  40.280  33.887  1.00 29.39  ? 80  ASP A C     1 
ATOM 1451  O O     . ASP E 3 63  ? 96.347  41.466  33.918  1.00 12.00  ? 80  ASP A O     1 
ATOM 1452  C CB    . ASP E 3 63  ? 95.815  38.635  32.155  1.00 32.19  ? 80  ASP A CB    1 
ATOM 1453  C CG    . ASP E 3 63  ? 95.330  37.188  32.019  1.00 34.99  ? 80  ASP A CG    1 
ATOM 1454  O OD1   . ASP E 3 63  ? 95.056  36.727  30.882  1.00 36.54  ? 80  ASP A OD1   1 
ATOM 1455  O OD2   . ASP E 3 63  ? 95.231  36.509  33.074  1.00 32.66  ? 80  ASP A OD2   1 
ATOM 1456  N N     . PRO E 3 64  ? 97.956  39.891  34.102  1.00 24.67  ? 81  PRO A N     1 
ATOM 1457  C CA    . PRO E 3 64  ? 99.121  40.708  34.412  1.00 28.71  ? 81  PRO A CA    1 
ATOM 1458  C C     . PRO E 3 64  ? 98.906  42.194  34.536  1.00 32.18  ? 81  PRO A C     1 
ATOM 1459  O O     . PRO E 3 64  ? 98.881  42.700  35.650  1.00 72.87  ? 81  PRO A O     1 
ATOM 1460  C CB    . PRO E 3 64  ? 100.094 40.284  33.347  1.00 79.17  ? 81  PRO A CB    1 
ATOM 1461  C CG    . PRO E 3 64  ? 99.937  38.798  33.446  1.00 81.45  ? 81  PRO A CG    1 
ATOM 1462  C CD    . PRO E 3 64  ? 98.419  38.595  33.571  1.00 76.75  ? 81  PRO A CD    1 
ATOM 1463  N N     . PRO E 3 65  ? 98.784  42.935  33.428  1.00 31.31  ? 82  PRO A N     1 
ATOM 1464  C CA    . PRO E 3 65  ? 98.568  44.348  33.776  1.00 31.09  ? 82  PRO A CA    1 
ATOM 1465  C C     . PRO E 3 65  ? 97.102  44.558  34.179  1.00 30.09  ? 82  PRO A C     1 
ATOM 1466  O O     . PRO E 3 65  ? 96.248  44.885  33.360  1.00 19.12  ? 82  PRO A O     1 
ATOM 1467  C CB    . PRO E 3 65  ? 98.977  45.095  32.504  1.00 20.79  ? 82  PRO A CB    1 
ATOM 1468  C CG    . PRO E 3 65  ? 98.714  44.088  31.407  1.00 22.99  ? 82  PRO A CG    1 
ATOM 1469  C CD    . PRO E 3 65  ? 99.164  42.773  32.014  1.00 21.93  ? 82  PRO A CD    1 
ATOM 1470  N N     . HIS E 3 66  ? 96.825  44.352  35.462  1.00 20.05  ? 83  HIS A N     1 
ATOM 1471  C CA    . HIS E 3 66  ? 95.475  44.471  36.011  1.00 18.00  ? 83  HIS A CA    1 
ATOM 1472  C C     . HIS E 3 66  ? 94.910  45.890  35.958  1.00 17.98  ? 83  HIS A C     1 
ATOM 1473  O O     . HIS E 3 66  ? 94.971  46.644  36.939  1.00 34.85  ? 83  HIS A O     1 
ATOM 1474  C CB    . HIS E 3 66  ? 95.436  43.930  37.457  1.00 21.37  ? 83  HIS A CB    1 
ATOM 1475  C CG    . HIS E 3 66  ? 95.705  42.456  37.558  1.00 22.33  ? 83  HIS A CG    1 
ATOM 1476  N ND1   . HIS E 3 66  ? 96.955  41.909  37.363  1.00 22.89  ? 83  HIS A ND1   1 
ATOM 1477  C CD2   . HIS E 3 66  ? 94.868  41.410  37.755  1.00 21.62  ? 83  HIS A CD2   1 
ATOM 1478  C CE1   . HIS E 3 66  ? 96.878  40.594  37.429  1.00 23.40  ? 83  HIS A CE1   1 
ATOM 1479  N NE2   . HIS E 3 66  ? 95.622  40.263  37.664  1.00 21.62  ? 83  HIS A NE2   1 
ATOM 1480  N N     . ARG E 3 67  ? 94.353  46.235  34.800  1.00 2.00   ? 84  ARG A N     1 
ATOM 1481  C CA    . ARG E 3 67  ? 93.760  47.536  34.549  1.00 2.00   ? 84  ARG A CA    1 
ATOM 1482  C C     . ARG E 3 67  ? 92.409  47.572  35.231  1.00 2.00   ? 84  ARG A C     1 
ATOM 1483  O O     . ARG E 3 67  ? 91.865  46.530  35.610  1.00 2.00   ? 84  ARG A O     1 
ATOM 1484  C CB    . ARG E 3 67  ? 93.538  47.694  33.054  1.00 19.62  ? 84  ARG A CB    1 
ATOM 1485  C CG    . ARG E 3 67  ? 94.649  47.098  32.191  1.00 19.91  ? 84  ARG A CG    1 
ATOM 1486  C CD    . ARG E 3 67  ? 94.394  47.339  30.691  1.00 19.02  ? 84  ARG A CD    1 
ATOM 1487  N NE    . ARG E 3 67  ? 93.338  46.487  30.151  1.00 19.49  ? 84  ARG A NE    1 
ATOM 1488  C CZ    . ARG E 3 67  ? 92.761  46.652  28.964  1.00 15.39  ? 84  ARG A CZ    1 
ATOM 1489  N NH1   . ARG E 3 67  ? 93.129  47.650  28.160  1.00 14.62  ? 84  ARG A NH1   1 
ATOM 1490  N NH2   . ARG E 3 67  ? 91.804  45.813  28.590  1.00 19.67  ? 84  ARG A NH2   1 
ATOM 1491  N N     . PRO E 3 68  ? 91.836  48.770  35.405  1.00 18.89  ? 85  PRO A N     1 
ATOM 1492  C CA    . PRO E 3 68  ? 90.527  48.753  36.053  1.00 22.31  ? 85  PRO A CA    1 
ATOM 1493  C C     . PRO E 3 68  ? 89.504  48.201  35.061  1.00 23.30  ? 85  PRO A C     1 
ATOM 1494  O O     . PRO E 3 68  ? 89.464  48.628  33.899  1.00 43.32  ? 85  PRO A O     1 
ATOM 1495  C CB    . PRO E 3 68  ? 90.293  50.230  36.394  1.00 29.87  ? 85  PRO A CB    1 
ATOM 1496  C CG    . PRO E 3 68  ? 91.023  50.958  35.309  1.00 28.01  ? 85  PRO A CG    1 
ATOM 1497  C CD    . PRO E 3 68  ? 92.305  50.155  35.197  1.00 27.17  ? 85  PRO A CD    1 
ATOM 1498  N N     . HIS E 3 69  ? 88.693  47.248  35.517  1.00 18.72  ? 86  HIS A N     1 
ATOM 1499  C CA    . HIS E 3 69  ? 87.668  46.640  34.675  1.00 17.38  ? 86  HIS A CA    1 
ATOM 1500  C C     . HIS E 3 69  ? 86.459  47.560  34.421  1.00 18.49  ? 86  HIS A C     1 
ATOM 1501  O O     . HIS E 3 69  ? 86.044  48.323  35.293  1.00 18.17  ? 86  HIS A O     1 
ATOM 1502  C CB    . HIS E 3 69  ? 87.214  45.329  35.291  1.00 20.93  ? 86  HIS A CB    1 
ATOM 1503  C CG    . HIS E 3 69  ? 86.646  44.388  34.293  1.00 20.41  ? 86  HIS A CG    1 
ATOM 1504  N ND1   . HIS E 3 69  ? 85.378  44.535  33.777  1.00 19.91  ? 86  HIS A ND1   1 
ATOM 1505  C CD2   . HIS E 3 69  ? 87.212  43.367  33.613  1.00 19.20  ? 86  HIS A CD2   1 
ATOM 1506  C CE1   . HIS E 3 69  ? 85.190  43.648  32.815  1.00 17.62  ? 86  HIS A CE1   1 
ATOM 1507  N NE2   . HIS E 3 69  ? 86.290  42.928  32.695  1.00 19.55  ? 86  HIS A NE2   1 
ATOM 1508  N N     . PRO E 3 70  ? 85.867  47.486  33.220  1.00 25.07  ? 87  PRO A N     1 
ATOM 1509  C CA    . PRO E 3 70  ? 84.712  48.324  32.867  1.00 26.64  ? 87  PRO A CA    1 
ATOM 1510  C C     . PRO E 3 70  ? 83.494  48.243  33.781  1.00 25.75  ? 87  PRO A C     1 
ATOM 1511  O O     . PRO E 3 70  ? 83.010  49.250  34.289  1.00 26.98  ? 87  PRO A O     1 
ATOM 1512  C CB    . PRO E 3 70  ? 84.374  47.875  31.445  1.00 16.93  ? 87  PRO A CB    1 
ATOM 1513  C CG    . PRO E 3 70  ? 85.677  47.376  30.908  1.00 14.74  ? 87  PRO A CG    1 
ATOM 1514  C CD    . PRO E 3 70  ? 86.253  46.627  32.088  1.00 17.04  ? 87  PRO A CD    1 
ATOM 1515  N N     . HIS E 3 71  ? 82.986  47.039  33.964  1.00 11.58  ? 88  HIS A N     1 
ATOM 1516  C CA    . HIS E 3 71  ? 81.819  46.825  34.790  1.00 11.58  ? 88  HIS A CA    1 
ATOM 1517  C C     . HIS E 3 71  ? 81.776  47.684  36.039  1.00 14.26  ? 88  HIS A C     1 
ATOM 1518  O O     . HIS E 3 71  ? 82.787  47.831  36.722  1.00 30.59  ? 88  HIS A O     1 
ATOM 1519  C CB    . HIS E 3 71  ? 81.772  45.365  35.194  1.00 22.37  ? 88  HIS A CB    1 
ATOM 1520  C CG    . HIS E 3 71  ? 81.636  44.440  34.033  1.00 17.58  ? 88  HIS A CG    1 
ATOM 1521  N ND1   . HIS E 3 71  ? 81.936  43.097  34.107  1.00 14.93  ? 88  HIS A ND1   1 
ATOM 1522  C CD2   . HIS E 3 71  ? 81.239  44.670  32.757  1.00 17.95  ? 88  HIS A CD2   1 
ATOM 1523  C CE1   . HIS E 3 71  ? 81.734  42.542  32.927  1.00 14.93  ? 88  HIS A CE1   1 
ATOM 1524  N NE2   . HIS E 3 71  ? 81.312  43.474  32.089  1.00 20.30  ? 88  HIS A NE2   1 
ATOM 1525  N N     . GLU E 3 72  ? 80.614  48.252  36.351  1.00 15.84  ? 89  GLU A N     1 
ATOM 1526  C CA    . GLU E 3 72  ? 80.507  49.031  37.570  1.00 18.25  ? 89  GLU A CA    1 
ATOM 1527  C C     . GLU E 3 72  ? 80.503  48.076  38.752  1.00 19.79  ? 89  GLU A C     1 
ATOM 1528  O O     . GLU E 3 72  ? 81.013  46.954  38.684  1.00 41.00  ? 89  GLU A O     1 
ATOM 1529  C CB    . GLU E 3 72  ? 79.222  49.850  37.607  1.00 46.28  ? 89  GLU A CB    1 
ATOM 1530  C CG    . GLU E 3 72  ? 79.359  51.249  37.044  1.00 52.16  ? 89  GLU A CG    1 
ATOM 1531  C CD    . GLU E 3 72  ? 79.513  51.248  35.545  1.00 55.01  ? 89  GLU A CD    1 
ATOM 1532  O OE1   . GLU E 3 72  ? 79.471  52.342  34.928  1.00 55.82  ? 89  GLU A OE1   1 
ATOM 1533  O OE2   . GLU E 3 72  ? 79.674  50.143  34.987  1.00 54.33  ? 89  GLU A OE2   1 
ATOM 1534  N N     . LEU E 3 73  ? 79.919  48.529  39.845  1.00 50.06  ? 90  LEU A N     1 
ATOM 1535  C CA    . LEU E 3 73  ? 79.853  47.708  41.031  1.00 52.43  ? 90  LEU A CA    1 
ATOM 1536  C C     . LEU E 3 73  ? 78.888  48.387  41.983  1.00 53.89  ? 90  LEU A C     1 
ATOM 1537  O O     . LEU E 3 73  ? 79.083  48.389  43.196  1.00 63.13  ? 90  LEU A O     1 
ATOM 1538  C CB    . LEU E 3 73  ? 81.247  47.564  41.649  1.00 44.18  ? 90  LEU A CB    1 
ATOM 1539  C CG    . LEU E 3 73  ? 81.376  46.615  42.840  1.00 43.22  ? 90  LEU A CG    1 
ATOM 1540  C CD1   . LEU E 3 73  ? 80.505  45.404  42.648  1.00 38.77  ? 90  LEU A CD1   1 
ATOM 1541  C CD2   . LEU E 3 73  ? 82.828  46.215  43.003  1.00 41.07  ? 90  LEU A CD2   1 
ATOM 1542  N N     . VAL E 3 74  ? 77.834  48.954  41.400  1.00 79.54  ? 91  VAL A N     1 
ATOM 1543  C CA    . VAL E 3 74  ? 76.801  49.656  42.149  1.00 80.29  ? 91  VAL A CA    1 
ATOM 1544  C C     . VAL E 3 74  ? 76.340  48.884  43.389  1.00 79.82  ? 91  VAL A C     1 
ATOM 1545  O O     . VAL E 3 74  ? 76.417  47.647  43.446  1.00 62.82  ? 91  VAL A O     1 
ATOM 1546  C CB    . VAL E 3 74  ? 75.576  49.989  41.240  1.00 64.25  ? 91  VAL A CB    1 
ATOM 1547  C CG1   . VAL E 3 74  ? 75.944  51.068  40.232  1.00 63.96  ? 91  VAL A CG1   1 
ATOM 1548  C CG2   . VAL E 3 74  ? 75.117  48.746  40.505  1.00 64.10  ? 91  VAL A CG2   1 
ATOM 1549  N N     . GLY E 3 75  ? 75.873  49.644  44.378  1.00 54.16  ? 92  GLY A N     1 
ATOM 1550  C CA    . GLY E 3 75  ? 75.413  49.089  45.642  1.00 52.78  ? 92  GLY A CA    1 
ATOM 1551  C C     . GLY E 3 75  ? 75.583  50.146  46.721  1.00 51.39  ? 92  GLY A C     1 
ATOM 1552  O O     . GLY E 3 75  ? 75.753  51.317  46.399  1.00 55.35  ? 92  GLY A O     1 
ATOM 1553  N N     . LYS E 3 76  ? 75.549  49.759  47.992  1.00 76.91  ? 93  LYS A N     1 
ATOM 1554  C CA    . LYS E 3 76  ? 75.698  50.741  49.064  1.00 77.90  ? 93  LYS A CA    1 
ATOM 1555  C C     . LYS E 3 76  ? 76.986  51.552  48.946  1.00 79.90  ? 93  LYS A C     1 
ATOM 1556  O O     . LYS E 3 76  ? 78.080  50.990  48.847  1.00 55.85  ? 93  LYS A O     1 
ATOM 1557  C CB    . LYS E 3 76  ? 75.645  50.047  50.427  1.00 53.37  ? 93  LYS A CB    1 
ATOM 1558  C CG    . LYS E 3 76  ? 76.200  50.869  51.583  1.00 52.03  ? 93  LYS A CG    1 
ATOM 1559  C CD    . LYS E 3 76  ? 75.376  52.122  51.859  1.00 50.29  ? 93  LYS A CD    1 
ATOM 1560  C CE    . LYS E 3 76  ? 74.092  51.809  52.615  1.00 48.62  ? 93  LYS A CE    1 
ATOM 1561  N NZ    . LYS E 3 76  ? 74.378  51.194  53.944  1.00 49.75  ? 93  LYS A NZ    1 
ATOM 1562  N N     . ASP E 3 77  ? 76.845  52.876  48.955  1.00 57.62  ? 94  ASP A N     1 
ATOM 1563  C CA    . ASP E 3 77  ? 77.980  53.790  48.868  1.00 59.52  ? 94  ASP A CA    1 
ATOM 1564  C C     . ASP E 3 77  ? 78.791  53.744  47.577  1.00 60.30  ? 94  ASP A C     1 
ATOM 1565  O O     . ASP E 3 77  ? 79.500  54.698  47.261  1.00 58.91  ? 94  ASP A O     1 
ATOM 1566  C CB    . ASP E 3 77  ? 78.928  53.561  50.046  1.00 65.07  ? 94  ASP A CB    1 
ATOM 1567  C CG    . ASP E 3 77  ? 78.657  54.504  51.204  1.00 66.22  ? 94  ASP A CG    1 
ATOM 1568  O OD1   . ASP E 3 77  ? 78.753  55.739  50.997  1.00 64.34  ? 94  ASP A OD1   1 
ATOM 1569  O OD2   . ASP E 3 77  ? 78.353  54.009  52.317  1.00 67.90  ? 94  ASP A OD2   1 
ATOM 1570  N N     . CYS E 3 78  ? 78.700  52.641  46.841  1.00 44.25  ? 95  CYS A N     1 
ATOM 1571  C CA    . CYS E 3 78  ? 79.442  52.487  45.593  1.00 44.33  ? 95  CYS A CA    1 
ATOM 1572  C C     . CYS E 3 78  ? 79.203  53.687  44.686  1.00 45.95  ? 95  CYS A C     1 
ATOM 1573  O O     . CYS E 3 78  ? 78.060  54.075  44.443  1.00 72.08  ? 95  CYS A O     1 
ATOM 1574  C CB    . CYS E 3 78  ? 79.014  51.197  44.898  1.00 69.42  ? 95  CYS A CB    1 
ATOM 1575  S SG    . CYS E 3 78  ? 79.029  49.758  46.001  1.00 69.40  ? 95  CYS A SG    1 
ATOM 1576  N N     . ARG E 3 79  ? 80.284  54.279  44.189  1.00 67.05  ? 96  ARG A N     1 
ATOM 1577  C CA    . ARG E 3 79  ? 80.156  55.454  43.334  1.00 65.83  ? 96  ARG A CA    1 
ATOM 1578  C C     . ARG E 3 79  ? 80.831  55.280  41.987  1.00 64.93  ? 96  ARG A C     1 
ATOM 1579  O O     . ARG E 3 79  ? 81.773  54.508  41.849  1.00 65.13  ? 96  ARG A O     1 
ATOM 1580  C CB    . ARG E 3 79  ? 80.734  56.689  44.040  1.00 75.33  ? 96  ARG A CB    1 
ATOM 1581  C CG    . ARG E 3 79  ? 80.184  56.934  45.451  1.00 76.96  ? 96  ARG A CG    1 
ATOM 1582  C CD    . ARG E 3 79  ? 78.678  57.256  45.462  1.00 77.04  ? 96  ARG A CD    1 
ATOM 1583  N NE    . ARG E 3 79  ? 78.122  57.232  46.821  1.00 78.49  ? 96  ARG A NE    1 
ATOM 1584  C CZ    . ARG E 3 79  ? 76.935  57.730  47.171  1.00 77.83  ? 96  ARG A CZ    1 
ATOM 1585  N NH1   . ARG E 3 79  ? 76.152  58.304  46.267  1.00 75.90  ? 96  ARG A NH1   1 
ATOM 1586  N NH2   . ARG E 3 79  ? 76.532  57.652  48.434  1.00 78.36  ? 96  ARG A NH2   1 
ATOM 1587  N N     . ASP E 3 80  ? 80.328  56.026  41.009  1.00 20.77  ? 97  ASP A N     1 
ATOM 1588  C CA    . ASP E 3 80  ? 80.802  56.035  39.626  1.00 18.77  ? 97  ASP A CA    1 
ATOM 1589  C C     . ASP E 3 80  ? 81.233  54.701  39.059  1.00 16.84  ? 97  ASP A C     1 
ATOM 1590  O O     . ASP E 3 80  ? 81.485  54.580  37.863  1.00 45.29  ? 97  ASP A O     1 
ATOM 1591  C CB    . ASP E 3 80  ? 81.924  57.049  39.469  1.00 64.66  ? 97  ASP A CB    1 
ATOM 1592  C CG    . ASP E 3 80  ? 81.490  58.442  39.862  1.00 69.66  ? 97  ASP A CG    1 
ATOM 1593  O OD1   . ASP E 3 80  ? 81.390  58.717  41.082  1.00 73.50  ? 97  ASP A OD1   1 
ATOM 1594  O OD2   . ASP E 3 80  ? 81.230  59.256  38.948  1.00 70.82  ? 97  ASP A OD2   1 
ATOM 1595  N N     . GLY E 3 81  ? 81.290  53.695  39.916  1.00 28.57  ? 98  GLY A N     1 
ATOM 1596  C CA    . GLY E 3 81  ? 81.690  52.373  39.492  1.00 28.95  ? 98  GLY A CA    1 
ATOM 1597  C C     . GLY E 3 81  ? 82.464  51.686  40.600  1.00 28.58  ? 98  GLY A C     1 
ATOM 1598  O O     . GLY E 3 81  ? 82.228  50.513  40.912  1.00 73.18  ? 98  GLY A O     1 
ATOM 1599  N N     . TYR E 3 82  ? 83.397  52.416  41.198  1.00 47.46  ? 99  TYR A N     1 
ATOM 1600  C CA    . TYR E 3 82  ? 84.204  51.865  42.277  1.00 50.05  ? 99  TYR A CA    1 
ATOM 1601  C C     . TYR E 3 82  ? 83.390  51.899  43.557  1.00 52.08  ? 99  TYR A C     1 
ATOM 1602  O O     . TYR E 3 82  ? 82.271  52.428  43.599  1.00 62.96  ? 99  TYR A O     1 
ATOM 1603  C CB    . TYR E 3 82  ? 85.478  52.696  42.469  1.00 60.11  ? 99  TYR A CB    1 
ATOM 1604  C CG    . TYR E 3 82  ? 85.190  54.125  42.881  1.00 60.63  ? 99  TYR A CG    1 
ATOM 1605  C CD1   . TYR E 3 82  ? 84.934  54.449  44.219  1.00 60.76  ? 99  TYR A CD1   1 
ATOM 1606  C CD2   . TYR E 3 82  ? 85.072  55.140  41.923  1.00 60.45  ? 99  TYR A CD2   1 
ATOM 1607  C CE1   . TYR E 3 82  ? 84.554  55.751  44.593  1.00 59.44  ? 99  TYR A CE1   1 
ATOM 1608  C CE2   . TYR E 3 82  ? 84.695  56.444  42.291  1.00 58.62  ? 99  TYR A CE2   1 
ATOM 1609  C CZ    . TYR E 3 82  ? 84.432  56.734  43.624  1.00 57.45  ? 99  TYR A CZ    1 
ATOM 1610  O OH    . TYR E 3 82  ? 84.011  57.986  43.989  1.00 57.30  ? 99  TYR A OH    1 
ATOM 1611  N N     . TYR E 3 83  ? 83.962  51.329  44.603  1.00 64.37  ? 100 TYR A N     1 
ATOM 1612  C CA    . TYR E 3 83  ? 83.316  51.324  45.897  1.00 65.74  ? 100 TYR A CA    1 
ATOM 1613  C C     . TYR E 3 83  ? 84.107  52.298  46.761  1.00 68.64  ? 100 TYR A C     1 
ATOM 1614  O O     . TYR E 3 83  ? 85.295  52.517  46.501  1.00 43.02  ? 100 TYR A O     1 
ATOM 1615  C CB    . TYR E 3 83  ? 83.357  49.916  46.497  1.00 59.85  ? 100 TYR A CB    1 
ATOM 1616  C CG    . TYR E 3 83  ? 83.233  49.902  48.007  1.00 59.38  ? 100 TYR A CG    1 
ATOM 1617  C CD1   . TYR E 3 83  ? 84.363  49.956  48.814  1.00 58.48  ? 100 TYR A CD1   1 
ATOM 1618  C CD2   . TYR E 3 83  ? 81.981  49.864  48.625  1.00 57.54  ? 100 TYR A CD2   1 
ATOM 1619  C CE1   . TYR E 3 83  ? 84.258  49.969  50.188  1.00 54.87  ? 100 TYR A CE1   1 
ATOM 1620  C CE2   . TYR E 3 83  ? 81.864  49.880  50.004  1.00 55.30  ? 100 TYR A CE2   1 
ATOM 1621  C CZ    . TYR E 3 83  ? 83.007  49.928  50.783  1.00 54.65  ? 100 TYR A CZ    1 
ATOM 1622  O OH    . TYR E 3 83  ? 82.898  49.906  52.160  1.00 55.56  ? 100 TYR A OH    1 
ATOM 1623  N N     . GLU E 3 84  ? 83.440  52.894  47.755  1.00 62.51  ? 101 GLU A N     1 
ATOM 1624  C CA    . GLU E 3 84  ? 84.077  53.833  48.688  1.00 64.41  ? 101 GLU A CA    1 
ATOM 1625  C C     . GLU E 3 84  ? 83.233  54.169  49.921  1.00 65.23  ? 101 GLU A C     1 
ATOM 1626  O O     . GLU E 3 84  ? 82.079  54.571  49.811  1.00 63.11  ? 101 GLU A O     1 
ATOM 1627  C CB    . GLU E 3 84  ? 84.470  55.131  47.979  1.00 55.03  ? 101 GLU A CB    1 
ATOM 1628  C CG    . GLU E 3 84  ? 85.522  55.907  48.759  1.00 56.84  ? 101 GLU A CG    1 
ATOM 1629  C CD    . GLU E 3 84  ? 86.251  56.939  47.925  1.00 57.99  ? 101 GLU A CD    1 
ATOM 1630  O OE1   . GLU E 3 84  ? 85.614  57.945  47.562  1.00 58.13  ? 101 GLU A OE1   1 
ATOM 1631  O OE2   . GLU E 3 84  ? 87.455  56.741  47.631  1.00 57.51  ? 101 GLU A OE2   1 
ATOM 1632  N N     . ALA E 3 85  ? 83.828  54.002  51.096  1.00 81.66  ? 102 ALA A N     1 
ATOM 1633  C CA    . ALA E 3 85  ? 83.146  54.274  52.354  1.00 80.33  ? 102 ALA A CA    1 
ATOM 1634  C C     . ALA E 3 85  ? 84.127  54.048  53.505  1.00 81.02  ? 102 ALA A C     1 
ATOM 1635  O O     . ALA E 3 85  ? 85.055  53.247  53.387  1.00 56.63  ? 102 ALA A O     1 
ATOM 1636  C CB    . ALA E 3 85  ? 81.945  53.351  52.501  1.00 50.99  ? 102 ALA A CB    1 
ATOM 1637  N N     . ASP E 3 86  ? 83.934  54.750  54.616  1.00 69.33  ? 103 ASP A N     1 
ATOM 1638  C CA    . ASP E 3 86  ? 84.834  54.586  55.751  1.00 69.38  ? 103 ASP A CA    1 
ATOM 1639  C C     . ASP E 3 86  ? 84.705  53.174  56.332  1.00 69.41  ? 103 ASP A C     1 
ATOM 1640  O O     . ASP E 3 86  ? 83.669  52.523  56.180  1.00 91.38  ? 103 ASP A O     1 
ATOM 1641  C CB    . ASP E 3 86  ? 84.536  55.641  56.826  1.00 86.21  ? 103 ASP A CB    1 
ATOM 1642  C CG    . ASP E 3 86  ? 84.814  57.058  56.348  1.00 86.24  ? 103 ASP A CG    1 
ATOM 1643  O OD1   . ASP E 3 86  ? 85.959  57.342  55.943  1.00 84.68  ? 103 ASP A OD1   1 
ATOM 1644  O OD2   . ASP E 3 86  ? 83.887  57.891  56.382  1.00 83.70  ? 103 ASP A OD2   1 
ATOM 1645  N N     . LEU E 3 87  ? 85.770  52.703  56.983  1.00 95.92  ? 104 LEU A N     1 
ATOM 1646  C CA    . LEU E 3 87  ? 85.796  51.371  57.592  1.00 98.92  ? 104 LEU A CA    1 
ATOM 1647  C C     . LEU E 3 87  ? 85.679  51.461  59.111  1.00 99.79  ? 104 LEU A C     1 
ATOM 1648  O O     . LEU E 3 87  ? 86.340  52.290  59.744  1.00 52.62  ? 104 LEU A O     1 
ATOM 1649  C CB    . LEU E 3 87  ? 87.093  50.631  57.207  1.00 56.77  ? 104 LEU A CB    1 
ATOM 1650  C CG    . LEU E 3 87  ? 88.449  51.302  57.495  1.00 58.87  ? 104 LEU A CG    1 
ATOM 1651  C CD1   . LEU E 3 87  ? 89.008  50.782  58.802  1.00 58.75  ? 104 LEU A CD1   1 
ATOM 1652  C CD2   . LEU E 3 87  ? 89.437  51.028  56.364  1.00 59.13  ? 104 LEU A CD2   1 
ATOM 1653  N N     . CYS E 3 88  ? 84.827  50.614  59.688  1.00 114.67 ? 105 CYS A N     1 
ATOM 1654  C CA    . CYS E 3 88  ? 84.629  50.590  61.136  1.00 114.67 ? 105 CYS A CA    1 
ATOM 1655  C C     . CYS E 3 88  ? 85.925  50.991  61.851  1.00 114.67 ? 105 CYS A C     1 
ATOM 1656  O O     . CYS E 3 88  ? 86.920  50.260  61.823  1.00 63.20  ? 105 CYS A O     1 
ATOM 1657  C CB    . CYS E 3 88  ? 84.200  49.184  61.611  1.00 68.53  ? 105 CYS A CB    1 
ATOM 1658  S SG    . CYS E 3 88  ? 82.469  48.688  61.304  1.00 65.38  ? 105 CYS A SG    1 
ATOM 1659  N N     . PRO E 3 89  ? 85.943  52.180  62.471  1.00 120.73 ? 106 PRO A N     1 
ATOM 1660  C CA    . PRO E 3 89  ? 87.161  52.594  63.169  1.00 120.73 ? 106 PRO A CA    1 
ATOM 1661  C C     . PRO E 3 89  ? 87.238  52.007  64.582  1.00 120.73 ? 106 PRO A C     1 
ATOM 1662  O O     . PRO E 3 89  ? 87.797  52.621  65.493  1.00 73.63  ? 106 PRO A O     1 
ATOM 1663  C CB    . PRO E 3 89  ? 87.058  54.116  63.157  1.00 68.10  ? 106 PRO A CB    1 
ATOM 1664  C CG    . PRO E 3 89  ? 85.591  54.341  63.260  1.00 66.08  ? 106 PRO A CG    1 
ATOM 1665  C CD    . PRO E 3 89  ? 85.023  53.318  62.299  1.00 68.59  ? 106 PRO A CD    1 
ATOM 1666  N N     . ASP E 3 90  ? 86.671  50.814  64.753  1.00 61.51  ? 107 ASP A N     1 
ATOM 1667  C CA    . ASP E 3 90  ? 86.680  50.136  66.044  1.00 62.54  ? 107 ASP A CA    1 
ATOM 1668  C C     . ASP E 3 90  ? 87.115  48.679  65.884  1.00 64.19  ? 107 ASP A C     1 
ATOM 1669  O O     . ASP E 3 90  ? 87.669  48.090  66.808  1.00 78.05  ? 107 ASP A O     1 
ATOM 1670  C CB    . ASP E 3 90  ? 85.288  50.195  66.695  1.00 82.53  ? 107 ASP A CB    1 
ATOM 1671  C CG    . ASP E 3 90  ? 85.313  49.835  68.183  1.00 81.59  ? 107 ASP A CG    1 
ATOM 1672  O OD1   . ASP E 3 90  ? 84.224  49.669  68.779  1.00 80.36  ? 107 ASP A OD1   1 
ATOM 1673  O OD2   . ASP E 3 90  ? 86.418  49.727  68.759  1.00 80.65  ? 107 ASP A OD2   1 
ATOM 1674  N N     . ARG E 3 91  ? 86.859  48.100  64.714  1.00 77.02  ? 108 ARG A N     1 
ATOM 1675  C CA    . ARG E 3 91  ? 87.235  46.715  64.442  1.00 74.91  ? 108 ARG A CA    1 
ATOM 1676  C C     . ARG E 3 91  ? 88.253  46.683  63.302  1.00 74.80  ? 108 ARG A C     1 
ATOM 1677  O O     . ARG E 3 91  ? 88.525  47.707  62.675  1.00 82.68  ? 108 ARG A O     1 
ATOM 1678  C CB    . ARG E 3 91  ? 85.986  45.902  64.085  1.00 84.32  ? 108 ARG A CB    1 
ATOM 1679  C CG    . ARG E 3 91  ? 86.244  44.524  63.495  1.00 81.83  ? 108 ARG A CG    1 
ATOM 1680  C CD    . ARG E 3 91  ? 84.950  43.709  63.388  1.00 78.42  ? 108 ARG A CD    1 
ATOM 1681  N NE    . ARG E 3 91  ? 83.820  44.499  62.905  1.00 75.81  ? 108 ARG A NE    1 
ATOM 1682  C CZ    . ARG E 3 91  ? 83.782  45.115  61.730  1.00 72.62  ? 108 ARG A CZ    1 
ATOM 1683  N NH1   . ARG E 3 91  ? 84.811  45.040  60.896  1.00 68.37  ? 108 ARG A NH1   1 
ATOM 1684  N NH2   . ARG E 3 91  ? 82.712  45.819  61.394  1.00 71.83  ? 108 ARG A NH2   1 
ATOM 1685  N N     . SER E 3 92  ? 88.829  45.515  63.047  1.00 72.63  ? 109 SER A N     1 
ATOM 1686  C CA    . SER E 3 92  ? 89.813  45.379  61.980  1.00 72.05  ? 109 SER A CA    1 
ATOM 1687  C C     . SER E 3 92  ? 89.164  44.868  60.695  1.00 71.02  ? 109 SER A C     1 
ATOM 1688  O O     . SER E 3 92  ? 88.729  45.654  59.850  1.00 96.66  ? 109 SER A O     1 
ATOM 1689  C CB    . SER E 3 92  ? 90.929  44.425  62.416  1.00 108.17 ? 109 SER A CB    1 
ATOM 1690  O OG    . SER E 3 92  ? 90.416  43.145  62.751  1.00 108.63 ? 109 SER A OG    1 
ATOM 1691  N N     . ILE E 3 93  ? 89.106  43.546  60.557  1.00 78.59  ? 110 ILE A N     1 
ATOM 1692  C CA    . ILE E 3 93  ? 88.510  42.909  59.392  1.00 79.47  ? 110 ILE A CA    1 
ATOM 1693  C C     . ILE E 3 93  ? 87.118  43.489  59.126  1.00 78.92  ? 110 ILE A C     1 
ATOM 1694  O O     . ILE E 3 93  ? 86.150  43.185  59.823  1.00 49.55  ? 110 ILE A O     1 
ATOM 1695  C CB    . ILE E 3 93  ? 88.440  41.370  59.594  1.00 44.96  ? 110 ILE A CB    1 
ATOM 1696  C CG1   . ILE E 3 93  ? 87.734  40.704  58.410  1.00 46.58  ? 110 ILE A CG1   1 
ATOM 1697  C CG2   . ILE E 3 93  ? 87.765  41.055  60.903  1.00 43.60  ? 110 ILE A CG2   1 
ATOM 1698  C CD1   . ILE E 3 93  ? 87.800  39.181  58.432  1.00 47.08  ? 110 ILE A CD1   1 
ATOM 1699  N N     . HIS E 3 94  ? 87.040  44.338  58.105  1.00 48.44  ? 111 HIS A N     1 
ATOM 1700  C CA    . HIS E 3 94  ? 85.802  45.005  57.725  1.00 45.66  ? 111 HIS A CA    1 
ATOM 1701  C C     . HIS E 3 94  ? 85.190  44.320  56.492  1.00 42.32  ? 111 HIS A C     1 
ATOM 1702  O O     . HIS E 3 94  ? 85.856  44.165  55.465  1.00 90.01  ? 111 HIS A O     1 
ATOM 1703  C CB    . HIS E 3 94  ? 86.127  46.482  57.457  1.00 94.14  ? 111 HIS A CB    1 
ATOM 1704  C CG    . HIS E 3 94  ? 84.927  47.367  57.338  1.00 93.23  ? 111 HIS A CG    1 
ATOM 1705  N ND1   . HIS E 3 94  ? 83.839  47.264  58.177  1.00 92.75  ? 111 HIS A ND1   1 
ATOM 1706  C CD2   . HIS E 3 94  ? 84.664  48.398  56.502  1.00 92.59  ? 111 HIS A CD2   1 
ATOM 1707  C CE1   . HIS E 3 94  ? 82.955  48.194  57.862  1.00 93.12  ? 111 HIS A CE1   1 
ATOM 1708  N NE2   . HIS E 3 94  ? 83.431  48.896  56.850  1.00 95.48  ? 111 HIS A NE2   1 
ATOM 1709  N N     . SER E 3 95  ? 83.925  43.906  56.609  1.00 44.89  ? 112 SER A N     1 
ATOM 1710  C CA    . SER E 3 95  ? 83.189  43.223  55.530  1.00 44.02  ? 112 SER A CA    1 
ATOM 1711  C C     . SER E 3 95  ? 82.430  44.171  54.560  1.00 44.65  ? 112 SER A C     1 
ATOM 1712  O O     . SER E 3 95  ? 82.428  45.392  54.754  1.00 87.67  ? 112 SER A O     1 
ATOM 1713  C CB    . SER E 3 95  ? 82.206  42.235  56.154  1.00 78.57  ? 112 SER A CB    1 
ATOM 1714  O OG    . SER E 3 95  ? 82.826  41.546  57.223  1.00 75.05  ? 112 SER A OG    1 
ATOM 1715  N N     . PHE E 3 96  ? 81.785  43.610  53.528  1.00 81.01  ? 113 PHE A N     1 
ATOM 1716  C CA    . PHE E 3 96  ? 81.048  44.412  52.529  1.00 79.50  ? 113 PHE A CA    1 
ATOM 1717  C C     . PHE E 3 96  ? 79.781  43.726  51.992  1.00 80.27  ? 113 PHE A C     1 
ATOM 1718  O O     . PHE E 3 96  ? 79.843  42.978  51.009  1.00 90.91  ? 113 PHE A O     1 
ATOM 1719  C CB    . PHE E 3 96  ? 81.962  44.732  51.339  1.00 82.67  ? 113 PHE A CB    1 
ATOM 1720  C CG    . PHE E 3 96  ? 83.348  45.115  51.741  1.00 85.20  ? 113 PHE A CG    1 
ATOM 1721  C CD1   . PHE E 3 96  ? 83.609  46.372  52.274  1.00 85.76  ? 113 PHE A CD1   1 
ATOM 1722  C CD2   . PHE E 3 96  ? 84.384  44.188  51.670  1.00 85.31  ? 113 PHE A CD2   1 
ATOM 1723  C CE1   . PHE E 3 96  ? 84.885  46.700  52.739  1.00 84.53  ? 113 PHE A CE1   1 
ATOM 1724  C CE2   . PHE E 3 96  ? 85.663  44.502  52.132  1.00 85.37  ? 113 PHE A CE2   1 
ATOM 1725  C CZ    . PHE E 3 96  ? 85.914  45.759  52.669  1.00 84.51  ? 113 PHE A CZ    1 
ATOM 1726  N N     . GLN E 3 97  ? 78.638  43.984  52.628  1.00 63.22  ? 114 GLN A N     1 
ATOM 1727  C CA    . GLN E 3 97  ? 77.366  43.399  52.190  1.00 64.02  ? 114 GLN A CA    1 
ATOM 1728  C C     . GLN E 3 97  ? 76.506  44.460  51.518  1.00 65.22  ? 114 GLN A C     1 
ATOM 1729  O O     . GLN E 3 97  ? 75.627  45.047  52.151  1.00 87.32  ? 114 GLN A O     1 
ATOM 1730  C CB    . GLN E 3 97  ? 76.595  42.796  53.371  1.00 83.57  ? 114 GLN A CB    1 
ATOM 1731  C CG    . GLN E 3 97  ? 77.061  41.405  53.810  1.00 86.88  ? 114 GLN A CG    1 
ATOM 1732  C CD    . GLN E 3 97  ? 78.086  41.432  54.932  1.00 89.01  ? 114 GLN A CD    1 
ATOM 1733  O OE1   . GLN E 3 97  ? 77.778  41.818  56.060  1.00 86.27  ? 114 GLN A OE1   1 
ATOM 1734  N NE2   . GLN E 3 97  ? 79.313  41.022  54.626  1.00 92.53  ? 114 GLN A NE2   1 
ATOM 1735  N N     . ASN E 3 98  ? 76.768  44.702  50.235  1.00 82.03  ? 115 ASN A N     1 
ATOM 1736  C CA    . ASN E 3 98  ? 76.028  45.700  49.467  1.00 79.91  ? 115 ASN A CA    1 
ATOM 1737  C C     . ASN E 3 98  ? 76.596  45.905  48.064  1.00 76.80  ? 115 ASN A C     1 
ATOM 1738  O O     . ASN E 3 98  ? 76.351  46.935  47.437  1.00 50.74  ? 115 ASN A O     1 
ATOM 1739  C CB    . ASN E 3 98  ? 76.031  47.033  50.217  1.00 73.26  ? 115 ASN A CB    1 
ATOM 1740  C CG    . ASN E 3 98  ? 77.409  47.399  50.778  1.00 76.59  ? 115 ASN A CG    1 
ATOM 1741  O OD1   . ASN E 3 98  ? 78.370  47.602  50.029  1.00 77.98  ? 115 ASN A OD1   1 
ATOM 1742  N ND2   . ASN E 3 98  ? 77.502  47.487  52.104  1.00 75.13  ? 115 ASN A ND2   1 
ATOM 1743  N N     . LEU E 3 99  ? 77.328  44.910  47.571  1.00 52.22  ? 116 LEU A N     1 
ATOM 1744  C CA    . LEU E 3 99  ? 77.971  44.987  46.257  1.00 48.04  ? 116 LEU A CA    1 
ATOM 1745  C C     . LEU E 3 99  ? 77.281  44.281  45.088  1.00 46.92  ? 116 LEU A C     1 
ATOM 1746  O O     . LEU E 3 99  ? 76.929  43.105  45.170  1.00 83.94  ? 116 LEU A O     1 
ATOM 1747  C CB    . LEU E 3 99  ? 79.410  44.475  46.373  1.00 71.23  ? 116 LEU A CB    1 
ATOM 1748  C CG    . LEU E 3 99  ? 80.385  45.417  47.083  1.00 69.86  ? 116 LEU A CG    1 
ATOM 1749  C CD1   . LEU E 3 99  ? 81.746  44.753  47.269  1.00 68.55  ? 116 LEU A CD1   1 
ATOM 1750  C CD2   . LEU E 3 99  ? 80.513  46.688  46.262  1.00 66.51  ? 116 LEU A CD2   1 
ATOM 1751  N N     . GLY E 3 100 ? 77.094  45.015  43.994  1.00 64.17  ? 117 GLY A N     1 
ATOM 1752  C CA    . GLY E 3 100 ? 76.464  44.443  42.815  1.00 63.76  ? 117 GLY A CA    1 
ATOM 1753  C C     . GLY E 3 100 ? 77.330  44.696  41.594  1.00 62.68  ? 117 GLY A C     1 
ATOM 1754  O O     . GLY E 3 100 ? 77.908  45.780  41.485  1.00 57.20  ? 117 GLY A O     1 
ATOM 1755  N N     . ILE E 3 101 ? 77.421  43.723  40.679  1.00 40.57  ? 118 ILE A N     1 
ATOM 1756  C CA    . ILE E 3 101 ? 78.255  43.873  39.480  1.00 35.57  ? 118 ILE A CA    1 
ATOM 1757  C C     . ILE E 3 101 ? 77.522  44.202  38.179  1.00 34.33  ? 118 ILE A C     1 
ATOM 1758  O O     . ILE E 3 101 ? 77.149  43.309  37.417  1.00 33.28  ? 118 ILE A O     1 
ATOM 1759  C CB    . ILE E 3 101 ? 79.103  42.610  39.227  1.00 23.74  ? 118 ILE A CB    1 
ATOM 1760  C CG1   . ILE E 3 101 ? 80.099  42.400  40.370  1.00 22.64  ? 118 ILE A CG1   1 
ATOM 1761  C CG2   . ILE E 3 101 ? 79.831  42.734  37.887  1.00 24.63  ? 118 ILE A CG2   1 
ATOM 1762  C CD1   . ILE E 3 101 ? 81.251  41.457  40.006  1.00 14.85  ? 118 ILE A CD1   1 
ATOM 1763  N N     . GLN E 3 102 ? 77.382  45.493  37.903  1.00 18.90  ? 119 GLN A N     1 
ATOM 1764  C CA    . GLN E 3 102 ? 76.668  45.953  36.717  1.00 15.41  ? 119 GLN A CA    1 
ATOM 1765  C C     . GLN E 3 102 ? 77.482  45.768  35.442  1.00 15.41  ? 119 GLN A C     1 
ATOM 1766  O O     . GLN E 3 102 ? 78.173  46.682  34.995  1.00 46.17  ? 119 GLN A O     1 
ATOM 1767  C CB    . GLN E 3 102 ? 76.299  47.431  36.853  1.00 48.77  ? 119 GLN A CB    1 
ATOM 1768  C CG    . GLN E 3 102 ? 74.857  47.681  37.252  1.00 52.59  ? 119 GLN A CG    1 
ATOM 1769  C CD    . GLN E 3 102 ? 74.533  49.158  37.352  1.00 20.00  ? 119 GLN A CD    1 
ATOM 1770  O OE1   . GLN E 3 102 ? 73.413  49.536  37.693  1.00 20.00  ? 119 GLN A OE1   1 
ATOM 1771  N NE2   . GLN E 3 102 ? 75.362  50.165  37.101  1.00 20.00  ? 119 GLN A NE2   1 
ATOM 1772  N N     . CYS E 3 103 ? 77.442  44.552  34.836  1.00 12.46  ? 120 CYS A N     1 
ATOM 1773  C CA    . CYS E 3 103 ? 78.174  44.348  33.589  1.00 12.46  ? 120 CYS A CA    1 
ATOM 1774  C C     . CYS E 3 103 ? 77.600  45.327  32.552  1.00 12.46  ? 120 CYS A C     1 
ATOM 1775  O O     . CYS E 3 103 ? 76.403  45.587  32.535  1.00 15.23  ? 120 CYS A O     1 
ATOM 1776  C CB    . CYS E 3 103 ? 78.037  42.906  33.100  1.00 2.00   ? 120 CYS A CB    1 
ATOM 1777  S SG    . CYS E 3 103 ? 76.349  42.363  32.861  1.00 8.38   ? 120 CYS A SG    1 
ATOM 1778  N N     . VAL E 3 104 ? 78.461  45.868  31.701  1.00 17.71  ? 121 VAL A N     1 
ATOM 1779  C CA    . VAL E 3 104 ? 78.052  46.846  30.703  1.00 17.42  ? 121 VAL A CA    1 
ATOM 1780  C C     . VAL E 3 104 ? 77.868  46.236  29.328  1.00 14.98  ? 121 VAL A C     1 
ATOM 1781  O O     . VAL E 3 104 ? 78.300  45.107  29.090  1.00 14.74  ? 121 VAL A O     1 
ATOM 1782  C CB    . VAL E 3 104 ? 79.108  47.946  30.591  1.00 14.73  ? 121 VAL A CB    1 
ATOM 1783  C CG1   . VAL E 3 104 ? 79.309  48.591  31.941  1.00 14.23  ? 121 VAL A CG1   1 
ATOM 1784  C CG2   . VAL E 3 104 ? 80.423  47.358  30.114  1.00 10.68  ? 121 VAL A CG2   1 
ATOM 1785  N N     . LYS E 3 105 ? 77.230  46.977  28.424  1.00 2.00   ? 122 LYS A N     1 
ATOM 1786  C CA    . LYS E 3 105 ? 77.030  46.507  27.046  1.00 2.00   ? 122 LYS A CA    1 
ATOM 1787  C C     . LYS E 3 105 ? 78.249  46.910  26.214  1.00 2.00   ? 122 LYS A C     1 
ATOM 1788  O O     . LYS E 3 105 ? 78.912  47.912  26.515  1.00 7.37   ? 122 LYS A O     1 
ATOM 1789  C CB    . LYS E 3 105 ? 75.801  47.153  26.395  1.00 35.47  ? 122 LYS A CB    1 
ATOM 1790  C CG    . LYS E 3 105 ? 74.522  47.148  27.217  1.00 37.05  ? 122 LYS A CG    1 
ATOM 1791  C CD    . LYS E 3 105 ? 74.599  48.156  28.328  1.00 35.35  ? 122 LYS A CD    1 
ATOM 1792  C CE    . LYS E 3 105 ? 73.282  48.278  29.061  1.00 39.36  ? 122 LYS A CE    1 
ATOM 1793  N NZ    . LYS E 3 105 ? 73.455  49.158  30.271  1.00 42.97  ? 122 LYS A NZ    1 
ATOM 1794  N N     . LYS E 3 106 ? 78.556  46.150  25.167  1.00 18.16  ? 123 LYS A N     1 
ATOM 1795  C CA    . LYS E 3 106 ? 79.680  46.545  24.326  1.00 21.68  ? 123 LYS A CA    1 
ATOM 1796  C C     . LYS E 3 106 ? 79.425  48.002  23.924  1.00 22.88  ? 123 LYS A C     1 
ATOM 1797  O O     . LYS E 3 106 ? 80.325  48.842  23.986  1.00 51.59  ? 123 LYS A O     1 
ATOM 1798  C CB    . LYS E 3 106 ? 79.763  45.686  23.071  1.00 46.19  ? 123 LYS A CB    1 
ATOM 1799  C CG    . LYS E 3 106 ? 81.050  45.908  22.260  1.00 51.54  ? 123 LYS A CG    1 
ATOM 1800  C CD    . LYS E 3 106 ? 82.276  45.420  23.038  1.00 55.93  ? 123 LYS A CD    1 
ATOM 1801  C CE    . LYS E 3 106 ? 83.479  45.139  22.136  1.00 57.25  ? 123 LYS A CE    1 
ATOM 1802  N NZ    . LYS E 3 106 ? 84.543  44.381  22.869  1.00 54.80  ? 123 LYS A NZ    1 
ATOM 1803  N N     . ARG E 3 107 ? 78.184  48.279  23.522  1.00 44.54  ? 124 ARG A N     1 
ATOM 1804  C CA    . ARG E 3 107 ? 77.750  49.617  23.112  1.00 45.71  ? 124 ARG A CA    1 
ATOM 1805  C C     . ARG E 3 107 ? 78.527  50.634  23.933  1.00 44.91  ? 124 ARG A C     1 
ATOM 1806  O O     . ARG E 3 107 ? 79.474  51.245  23.443  1.00 39.13  ? 124 ARG A O     1 
ATOM 1807  C CB    . ARG E 3 107 ? 76.236  49.776  23.365  1.00 53.34  ? 124 ARG A CB    1 
ATOM 1808  C CG    . ARG E 3 107 ? 75.605  51.067  22.844  1.00 53.54  ? 124 ARG A CG    1 
ATOM 1809  C CD    . ARG E 3 107 ? 74.980  51.930  23.961  1.00 55.00  ? 124 ARG A CD    1 
ATOM 1810  N NE    . ARG E 3 107 ? 73.847  51.297  24.651  1.00 60.52  ? 124 ARG A NE    1 
ATOM 1811  C CZ    . ARG E 3 107 ? 73.129  51.867  25.628  1.00 62.22  ? 124 ARG A CZ    1 
ATOM 1812  N NH1   . ARG E 3 107 ? 73.411  53.095  26.051  1.00 58.58  ? 124 ARG A NH1   1 
ATOM 1813  N NH2   . ARG E 3 107 ? 72.121  51.203  26.187  1.00 63.90  ? 124 ARG A NH2   1 
ATOM 1814  N N     . ASP E 3 108 ? 78.132  50.784  25.193  1.00 14.75  ? 125 ASP A N     1 
ATOM 1815  C CA    . ASP E 3 108 ? 78.781  51.715  26.106  1.00 17.96  ? 125 ASP A CA    1 
ATOM 1816  C C     . ASP E 3 108 ? 79.955  51.093  26.866  1.00 20.07  ? 125 ASP A C     1 
ATOM 1817  O O     . ASP E 3 108 ? 79.863  50.818  28.057  1.00 38.06  ? 125 ASP A O     1 
ATOM 1818  C CB    . ASP E 3 108 ? 77.764  52.315  27.107  1.00 37.65  ? 125 ASP A CB    1 
ATOM 1819  C CG    . ASP E 3 108 ? 76.610  51.362  27.455  1.00 40.44  ? 125 ASP A CG    1 
ATOM 1820  O OD1   . ASP E 3 108 ? 75.770  51.109  26.571  1.00 43.28  ? 125 ASP A OD1   1 
ATOM 1821  O OD2   . ASP E 3 108 ? 76.529  50.876  28.611  1.00 40.49  ? 125 ASP A OD2   1 
ATOM 1822  N N     . LEU E 3 109 ? 81.061  50.886  26.154  1.00 71.02  ? 126 LEU A N     1 
ATOM 1823  C CA    . LEU E 3 109 ? 82.287  50.308  26.714  1.00 68.84  ? 126 LEU A CA    1 
ATOM 1824  C C     . LEU E 3 109 ? 83.362  51.392  26.728  1.00 68.72  ? 126 LEU A C     1 
ATOM 1825  O O     . LEU E 3 109 ? 83.922  51.741  27.771  1.00 37.75  ? 126 LEU A O     1 
ATOM 1826  C CB    . LEU E 3 109 ? 82.763  49.147  25.841  1.00 33.68  ? 126 LEU A CB    1 
ATOM 1827  C CG    . LEU E 3 109 ? 83.996  48.389  26.321  1.00 30.48  ? 126 LEU A CG    1 
ATOM 1828  C CD1   . LEU E 3 109 ? 83.546  47.213  27.170  1.00 29.47  ? 126 LEU A CD1   1 
ATOM 1829  C CD2   . LEU E 3 109 ? 84.810  47.909  25.119  1.00 23.79  ? 126 LEU A CD2   1 
ATOM 1830  N N     . GLU E 3 110 ? 83.647  51.894  25.534  1.00 58.59  ? 127 GLU A N     1 
ATOM 1831  C CA    . GLU E 3 110 ? 84.603  52.970  25.317  1.00 62.97  ? 127 GLU A CA    1 
ATOM 1832  C C     . GLU E 3 110 ? 84.337  53.963  26.449  1.00 62.48  ? 127 GLU A C     1 
ATOM 1833  O O     . GLU E 3 110 ? 85.238  54.341  27.200  1.00 56.00  ? 127 GLU A O     1 
ATOM 1834  C CB    . GLU E 3 110 ? 84.298  53.595  23.949  1.00 61.73  ? 127 GLU A CB    1 
ATOM 1835  C CG    . GLU E 3 110 ? 85.243  54.658  23.426  1.00 65.39  ? 127 GLU A CG    1 
ATOM 1836  C CD    . GLU E 3 110 ? 84.828  55.153  22.037  1.00 70.08  ? 127 GLU A CD    1 
ATOM 1837  O OE1   . GLU E 3 110 ? 83.705  55.692  21.898  1.00 75.46  ? 127 GLU A OE1   1 
ATOM 1838  O OE2   . GLU E 3 110 ? 85.619  54.997  21.082  1.00 67.71  ? 127 GLU A OE2   1 
ATOM 1839  N N     . GLN E 3 111 ? 83.069  54.348  26.565  1.00 23.48  ? 128 GLN A N     1 
ATOM 1840  C CA    . GLN E 3 111 ? 82.595  55.277  27.587  1.00 21.11  ? 128 GLN A CA    1 
ATOM 1841  C C     . GLN E 3 111 ? 82.907  54.725  28.969  1.00 19.04  ? 128 GLN A C     1 
ATOM 1842  O O     . GLN E 3 111 ? 83.539  55.400  29.770  1.00 34.58  ? 128 GLN A O     1 
ATOM 1843  C CB    . GLN E 3 111 ? 81.080  55.458  27.451  1.00 46.82  ? 128 GLN A CB    1 
ATOM 1844  C CG    . GLN E 3 111 ? 80.611  55.497  25.994  1.00 51.51  ? 128 GLN A CG    1 
ATOM 1845  C CD    . GLN E 3 111 ? 79.132  55.145  25.813  1.00 55.14  ? 128 GLN A CD    1 
ATOM 1846  O OE1   . GLN E 3 111 ? 78.697  54.797  24.707  1.00 58.35  ? 128 GLN A OE1   1 
ATOM 1847  N NE2   . GLN E 3 111 ? 78.356  55.241  26.895  1.00 49.88  ? 128 GLN A NE2   1 
ATOM 1848  N N     . ALA E 3 112 ? 82.459  53.492  29.221  1.00 27.73  ? 129 ALA A N     1 
ATOM 1849  C CA    . ALA E 3 112 ? 82.625  52.800  30.507  1.00 30.88  ? 129 ALA A CA    1 
ATOM 1850  C C     . ALA E 3 112 ? 84.031  52.826  31.080  1.00 32.87  ? 129 ALA A C     1 
ATOM 1851  O O     . ALA E 3 112 ? 84.205  53.114  32.272  1.00 32.66  ? 129 ALA A O     1 
ATOM 1852  C CB    . ALA E 3 112 ? 82.149  51.362  30.392  1.00 31.11  ? 129 ALA A CB    1 
ATOM 1853  N N     . ILE E 3 113 ? 85.024  52.491  30.256  1.00 38.48  ? 130 ILE A N     1 
ATOM 1854  C CA    . ILE E 3 113 ? 86.405  52.532  30.719  1.00 36.02  ? 130 ILE A CA    1 
ATOM 1855  C C     . ILE E 3 113 ? 86.779  54.007  30.713  1.00 38.72  ? 130 ILE A C     1 
ATOM 1856  O O     . ILE E 3 113 ? 87.427  54.488  31.641  1.00 39.58  ? 130 ILE A O     1 
ATOM 1857  C CB    . ILE E 3 113 ? 87.384  51.698  29.808  1.00 20.42  ? 130 ILE A CB    1 
ATOM 1858  C CG1   . ILE E 3 113 ? 88.833  52.086  30.094  1.00 19.42  ? 130 ILE A CG1   1 
ATOM 1859  C CG2   . ILE E 3 113 ? 87.121  51.948  28.327  1.00 17.15  ? 130 ILE A CG2   1 
ATOM 1860  C CD1   . ILE E 3 113 ? 89.215  52.063  31.542  1.00 14.87  ? 130 ILE A CD1   1 
ATOM 1861  N N     . SER E 3 114 ? 86.326  54.730  29.686  1.00 30.48  ? 131 SER A N     1 
ATOM 1862  C CA    . SER E 3 114 ? 86.599  56.165  29.577  1.00 30.80  ? 131 SER A CA    1 
ATOM 1863  C C     . SER E 3 114 ? 86.122  56.933  30.809  1.00 31.48  ? 131 SER A C     1 
ATOM 1864  O O     . SER E 3 114 ? 86.408  58.125  30.959  1.00 34.08  ? 131 SER A O     1 
ATOM 1865  C CB    . SER E 3 114 ? 85.925  56.761  28.343  1.00 36.55  ? 131 SER A CB    1 
ATOM 1866  O OG    . SER E 3 114 ? 86.178  58.152  28.259  1.00 40.51  ? 131 SER A OG    1 
ATOM 1867  N N     . GLN E 3 115 ? 85.365  56.257  31.669  1.00 25.64  ? 132 GLN A N     1 
ATOM 1868  C CA    . GLN E 3 115 ? 84.884  56.860  32.899  1.00 27.89  ? 132 GLN A CA    1 
ATOM 1869  C C     . GLN E 3 115 ? 85.979  56.562  33.904  1.00 28.05  ? 132 GLN A C     1 
ATOM 1870  O O     . GLN E 3 115 ? 86.444  57.446  34.618  1.00 64.69  ? 132 GLN A O     1 
ATOM 1871  C CB    . GLN E 3 115 ? 83.564  56.227  33.356  1.00 69.54  ? 132 GLN A CB    1 
ATOM 1872  C CG    . GLN E 3 115 ? 83.112  56.687  34.753  1.00 72.57  ? 132 GLN A CG    1 
ATOM 1873  C CD    . GLN E 3 115 ? 81.689  56.246  35.113  1.00 75.58  ? 132 GLN A CD    1 
ATOM 1874  O OE1   . GLN E 3 115 ? 81.243  56.408  36.255  1.00 75.98  ? 132 GLN A OE1   1 
ATOM 1875  N NE2   . GLN E 3 115 ? 80.971  55.694  34.135  1.00 74.71  ? 132 GLN A NE2   1 
ATOM 1876  N N     . ARG E 3 116 ? 86.402  55.303  33.925  1.00 54.22  ? 133 ARG A N     1 
ATOM 1877  C CA    . ARG E 3 116 ? 87.446  54.861  34.836  1.00 53.59  ? 133 ARG A CA    1 
ATOM 1878  C C     . ARG E 3 116 ? 88.553  55.893  34.961  1.00 52.99  ? 133 ARG A C     1 
ATOM 1879  O O     . ARG E 3 116 ? 89.019  56.178  36.064  1.00 57.08  ? 133 ARG A O     1 
ATOM 1880  C CB    . ARG E 3 116 ? 88.026  53.508  34.385  1.00 43.14  ? 133 ARG A CB    1 
ATOM 1881  C CG    . ARG E 3 116 ? 87.266  52.314  34.935  1.00 43.31  ? 133 ARG A CG    1 
ATOM 1882  C CD    . ARG E 3 116 ? 85.806  52.359  34.516  1.00 45.22  ? 133 ARG A CD    1 
ATOM 1883  N NE    . ARG E 3 116 ? 84.922  51.708  35.482  1.00 45.27  ? 133 ARG A NE    1 
ATOM 1884  C CZ    . ARG E 3 116 ? 83.606  51.581  35.322  1.00 43.68  ? 133 ARG A CZ    1 
ATOM 1885  N NH1   . ARG E 3 116 ? 83.016  52.056  34.229  1.00 39.69  ? 133 ARG A NH1   1 
ATOM 1886  N NH2   . ARG E 3 116 ? 82.878  50.979  36.253  1.00 42.15  ? 133 ARG A NH2   1 
ATOM 1887  N N     . ILE E 3 117 ? 88.963  56.471  33.839  1.00 58.60  ? 134 ILE A N     1 
ATOM 1888  C CA    . ILE E 3 117 ? 90.022  57.463  33.893  1.00 58.14  ? 134 ILE A CA    1 
ATOM 1889  C C     . ILE E 3 117 ? 89.466  58.826  34.300  1.00 59.44  ? 134 ILE A C     1 
ATOM 1890  O O     . ILE E 3 117 ? 89.831  59.359  35.351  1.00 60.80  ? 134 ILE A O     1 
ATOM 1891  C CB    . ILE E 3 117 ? 90.784  57.574  32.538  1.00 56.23  ? 134 ILE A CB    1 
ATOM 1892  C CG1   . ILE E 3 117 ? 89.849  58.052  31.422  1.00 52.48  ? 134 ILE A CG1   1 
ATOM 1893  C CG2   . ILE E 3 117 ? 91.378  56.221  32.179  1.00 54.67  ? 134 ILE A CG2   1 
ATOM 1894  C CD1   . ILE E 3 117 ? 90.563  58.413  30.125  1.00 53.86  ? 134 ILE A CD1   1 
ATOM 1895  N N     . GLN E 3 118 ? 88.564  59.378  33.490  1.00 50.13  ? 135 GLN A N     1 
ATOM 1896  C CA    . GLN E 3 118 ? 87.988  60.680  33.788  1.00 53.45  ? 135 GLN A CA    1 
ATOM 1897  C C     . GLN E 3 118 ? 87.430  60.735  35.217  1.00 54.28  ? 135 GLN A C     1 
ATOM 1898  O O     . GLN E 3 118 ? 87.050  61.800  35.702  1.00 64.77  ? 135 GLN A O     1 
ATOM 1899  C CB    . GLN E 3 118 ? 86.893  61.026  32.771  1.00 65.71  ? 135 GLN A CB    1 
ATOM 1900  C CG    . GLN E 3 118 ? 85.475  60.662  33.190  1.00 66.08  ? 135 GLN A CG    1 
ATOM 1901  C CD    . GLN E 3 118 ? 84.487  61.794  32.918  1.00 69.10  ? 135 GLN A CD    1 
ATOM 1902  O OE1   . GLN E 3 118 ? 84.619  62.893  33.463  1.00 66.77  ? 135 GLN A OE1   1 
ATOM 1903  N NE2   . GLN E 3 118 ? 83.496  61.530  32.071  1.00 69.52  ? 135 GLN A NE2   1 
ATOM 1904  N N     . THR E 3 119 ? 87.392  59.590  35.894  1.00 4.98   ? 136 THR A N     1 
ATOM 1905  C CA    . THR E 3 119 ? 86.889  59.551  37.255  1.00 5.97   ? 136 THR A CA    1 
ATOM 1906  C C     . THR E 3 119 ? 87.954  58.969  38.168  1.00 3.05   ? 136 THR A C     1 
ATOM 1907  O O     . THR E 3 119 ? 87.690  58.639  39.324  1.00 37.12  ? 136 THR A O     1 
ATOM 1908  C CB    . THR E 3 119 ? 85.597  58.710  37.354  1.00 68.06  ? 136 THR A CB    1 
ATOM 1909  O OG1   . THR E 3 119 ? 84.865  59.102  38.522  1.00 73.59  ? 136 THR A OG1   1 
ATOM 1910  C CG2   . THR E 3 119 ? 85.921  57.216  37.440  1.00 71.15  ? 136 THR A CG2   1 
ATOM 1911  N N     . ASN E 3 120 ? 89.165  58.858  37.641  1.00 33.00  ? 137 ASN A N     1 
ATOM 1912  C CA    . ASN E 3 120 ? 90.278  58.322  38.412  1.00 28.21  ? 137 ASN A CA    1 
ATOM 1913  C C     . ASN E 3 120 ? 89.886  57.014  39.091  1.00 25.07  ? 137 ASN A C     1 
ATOM 1914  O O     . ASN E 3 120 ? 89.243  56.998  40.147  1.00 59.19  ? 137 ASN A O     1 
ATOM 1915  C CB    . ASN E 3 120 ? 90.737  59.339  39.456  1.00 69.97  ? 137 ASN A CB    1 
ATOM 1916  C CG    . ASN E 3 120 ? 91.539  60.477  38.852  1.00 69.85  ? 137 ASN A CG    1 
ATOM 1917  O OD1   . ASN E 3 120 ? 91.465  61.620  39.314  1.00 71.94  ? 137 ASN A OD1   1 
ATOM 1918  N ND2   . ASN E 3 120 ? 92.321  60.167  37.822  1.00 69.28  ? 137 ASN A ND2   1 
ATOM 1919  N N     . ASN E 3 121 ? 90.295  55.921  38.458  1.00 68.36  ? 138 ASN A N     1 
ATOM 1920  C CA    . ASN E 3 121 ? 90.026  54.572  38.924  1.00 67.34  ? 138 ASN A CA    1 
ATOM 1921  C C     . ASN E 3 121 ? 91.230  53.780  38.404  1.00 64.33  ? 138 ASN A C     1 
ATOM 1922  O O     . ASN E 3 121 ? 91.453  53.722  37.190  1.00 47.35  ? 138 ASN A O     1 
ATOM 1923  C CB    . ASN E 3 121 ? 88.719  54.087  38.294  1.00 26.24  ? 138 ASN A CB    1 
ATOM 1924  C CG    . ASN E 3 121 ? 87.988  53.076  39.161  1.00 28.25  ? 138 ASN A CG    1 
ATOM 1925  O OD1   . ASN E 3 121 ? 86.775  52.906  39.026  1.00 30.22  ? 138 ASN A OD1   1 
ATOM 1926  N ND2   . ASN E 3 121 ? 88.716  52.395  40.048  1.00 28.63  ? 138 ASN A ND2   1 
ATOM 1927  N N     . ASN E 3 122 ? 92.021  53.188  39.300  1.00 55.89  ? 139 ASN A N     1 
ATOM 1928  C CA    . ASN E 3 122 ? 93.212  52.467  38.841  1.00 53.36  ? 139 ASN A CA    1 
ATOM 1929  C C     . ASN E 3 122 ? 94.091  51.897  39.966  1.00 52.57  ? 139 ASN A C     1 
ATOM 1930  O O     . ASN E 3 122 ? 95.252  52.277  40.099  1.00 37.12  ? 139 ASN A O     1 
ATOM 1931  C CB    . ASN E 3 122 ? 94.055  53.419  37.981  1.00 18.66  ? 139 ASN A CB    1 
ATOM 1932  C CG    . ASN E 3 122 ? 95.188  52.727  37.278  1.00 22.27  ? 139 ASN A CG    1 
ATOM 1933  O OD1   . ASN E 3 122 ? 95.833  51.830  37.831  1.00 25.82  ? 139 ASN A OD1   1 
ATOM 1934  N ND2   . ASN E 3 122 ? 95.456  53.151  36.045  1.00 23.87  ? 139 ASN A ND2   1 
ATOM 1935  N N     . PRO E 3 123 ? 93.565  50.958  40.768  1.00 21.65  ? 140 PRO A N     1 
ATOM 1936  C CA    . PRO E 3 123 ? 94.328  50.355  41.866  1.00 21.57  ? 140 PRO A CA    1 
ATOM 1937  C C     . PRO E 3 123 ? 95.800  50.020  41.612  1.00 21.93  ? 140 PRO A C     1 
ATOM 1938  O O     . PRO E 3 123 ? 96.516  49.690  42.560  1.00 43.16  ? 140 PRO A O     1 
ATOM 1939  C CB    . PRO E 3 123 ? 93.524  49.101  42.208  1.00 33.30  ? 140 PRO A CB    1 
ATOM 1940  C CG    . PRO E 3 123 ? 92.813  48.789  40.938  1.00 34.80  ? 140 PRO A CG    1 
ATOM 1941  C CD    . PRO E 3 123 ? 92.362  50.159  40.494  1.00 35.69  ? 140 PRO A CD    1 
ATOM 1942  N N     . PHE E 3 124 ? 96.267  50.069  40.363  1.00 3.87   ? 141 PHE A N     1 
ATOM 1943  C CA    . PHE E 3 124 ? 97.671  49.772  40.096  1.00 2.00   ? 141 PHE A CA    1 
ATOM 1944  C C     . PHE E 3 124 ? 98.319  50.850  39.251  1.00 2.00   ? 141 PHE A C     1 
ATOM 1945  O O     . PHE E 3 124 ? 99.278  50.602  38.552  1.00 7.56   ? 141 PHE A O     1 
ATOM 1946  C CB    . PHE E 3 124 ? 97.811  48.422  39.424  1.00 15.48  ? 141 PHE A CB    1 
ATOM 1947  C CG    . PHE E 3 124 ? 97.461  47.283  40.305  1.00 18.15  ? 141 PHE A CG    1 
ATOM 1948  C CD1   . PHE E 3 124 ? 98.439  46.425  40.764  1.00 22.69  ? 141 PHE A CD1   1 
ATOM 1949  C CD2   . PHE E 3 124 ? 96.161  47.076  40.692  1.00 17.70  ? 141 PHE A CD2   1 
ATOM 1950  C CE1   . PHE E 3 124 ? 98.134  45.361  41.603  1.00 24.09  ? 141 PHE A CE1   1 
ATOM 1951  C CE2   . PHE E 3 124 ? 95.837  46.020  41.529  1.00 23.57  ? 141 PHE A CE2   1 
ATOM 1952  C CZ    . PHE E 3 124 ? 96.829  45.158  41.989  1.00 24.71  ? 141 PHE A CZ    1 
ATOM 1953  N N     . HIS E 3 125 ? 97.799  52.064  39.365  1.00 35.66  ? 142 HIS A N     1 
ATOM 1954  C CA    . HIS E 3 125 ? 98.287  53.218  38.622  1.00 40.50  ? 142 HIS A CA    1 
ATOM 1955  C C     . HIS E 3 125 ? 98.801  52.824  37.247  1.00 40.24  ? 142 HIS A C     1 
ATOM 1956  O O     . HIS E 3 125 ? 99.797  53.348  36.767  1.00 46.43  ? 142 HIS A O     1 
ATOM 1957  C CB    . HIS E 3 125 ? 99.375  53.952  39.410  1.00 59.87  ? 142 HIS A CB    1 
ATOM 1958  C CG    . HIS E 3 125 ? 99.498  55.409  39.064  1.00 68.23  ? 142 HIS A CG    1 
ATOM 1959  N ND1   . HIS E 3 125 ? 99.716  55.858  37.778  1.00 73.94  ? 142 HIS A ND1   1 
ATOM 1960  C CD2   . HIS E 3 125 ? 99.442  56.516  39.842  1.00 72.51  ? 142 HIS A CD2   1 
ATOM 1961  C CE1   . HIS E 3 125 ? 99.789  57.179  37.780  1.00 76.14  ? 142 HIS A CE1   1 
ATOM 1962  N NE2   . HIS E 3 125 ? 99.626  57.604  39.019  1.00 75.70  ? 142 HIS A NE2   1 
ATOM 1963  N N     . VAL E 3 126 ? 98.100  51.886  36.623  1.00 17.38  ? 143 VAL A N     1 
ATOM 1964  C CA    . VAL E 3 126 ? 98.434  51.425  35.285  1.00 14.44  ? 143 VAL A CA    1 
ATOM 1965  C C     . VAL E 3 126 ? 98.316  52.571  34.291  1.00 14.25  ? 143 VAL A C     1 
ATOM 1966  O O     . VAL E 3 126 ? 97.327  53.317  34.289  1.00 14.25  ? 143 VAL A O     1 
ATOM 1967  C CB    . VAL E 3 126 ? 97.464  50.322  34.825  1.00 20.10  ? 143 VAL A CB    1 
ATOM 1968  C CG1   . VAL E 3 126 ? 97.444  50.221  33.290  1.00 17.39  ? 143 VAL A CG1   1 
ATOM 1969  C CG2   . VAL E 3 126 ? 97.874  48.994  35.427  1.00 17.39  ? 143 VAL A CG2   1 
ATOM 1970  N N     . PRO E 3 127 ? 99.310  52.704  33.410  1.00 30.06  ? 144 PRO A N     1 
ATOM 1971  C CA    . PRO E 3 127 ? 99.342  53.752  32.388  1.00 31.81  ? 144 PRO A CA    1 
ATOM 1972  C C     . PRO E 3 127 ? 98.022  53.813  31.628  1.00 31.63  ? 144 PRO A C     1 
ATOM 1973  O O     . PRO E 3 127 ? 97.402  52.788  31.360  1.00 19.48  ? 144 PRO A O     1 
ATOM 1974  C CB    . PRO E 3 127 ? 100.492 53.321  31.482  1.00 21.39  ? 144 PRO A CB    1 
ATOM 1975  C CG    . PRO E 3 127 ? 101.393 52.587  32.397  1.00 23.48  ? 144 PRO A CG    1 
ATOM 1976  C CD    . PRO E 3 127 ? 100.442 51.778  33.256  1.00 20.19  ? 144 PRO A CD    1 
ATOM 1977  N N     . ILE E 3 128 ? 97.621  55.027  31.275  1.00 15.34  ? 145 ILE A N     1 
ATOM 1978  C CA    . ILE E 3 128 ? 96.382  55.293  30.547  1.00 14.81  ? 145 ILE A CA    1 
ATOM 1979  C C     . ILE E 3 128 ? 96.373  54.694  29.133  1.00 12.45  ? 145 ILE A C     1 
ATOM 1980  O O     . ILE E 3 128 ? 95.304  54.378  28.601  1.00 12.18  ? 145 ILE A O     1 
ATOM 1981  C CB    . ILE E 3 128 ? 96.137  56.831  30.429  1.00 23.68  ? 145 ILE A CB    1 
ATOM 1982  C CG1   . ILE E 3 128 ? 96.102  57.485  31.824  1.00 22.66  ? 145 ILE A CG1   1 
ATOM 1983  C CG2   . ILE E 3 128 ? 94.876  57.096  29.628  1.00 25.65  ? 145 ILE A CG2   1 
ATOM 1984  C CD1   . ILE E 3 128 ? 95.073  56.951  32.804  1.00 22.63  ? 145 ILE A CD1   1 
ATOM 1985  N N     . GLU E 3 129 ? 97.556  54.545  28.530  1.00 10.67  ? 146 GLU A N     1 
ATOM 1986  C CA    . GLU E 3 129 ? 97.670  54.004  27.173  1.00 10.67  ? 146 GLU A CA    1 
ATOM 1987  C C     . GLU E 3 129 ? 97.350  52.521  27.161  1.00 10.67  ? 146 GLU A C     1 
ATOM 1988  O O     . GLU E 3 129 ? 97.238  51.897  26.103  1.00 43.50  ? 146 GLU A O     1 
ATOM 1989  C CB    . GLU E 3 129 ? 99.087  54.174  26.637  1.00 60.31  ? 146 GLU A CB    1 
ATOM 1990  C CG    . GLU E 3 129 ? 99.773  55.484  26.954  1.00 64.18  ? 146 GLU A CG    1 
ATOM 1991  C CD    . GLU E 3 129 ? 101.154 55.575  26.309  1.00 69.71  ? 146 GLU A CD    1 
ATOM 1992  O OE1   . GLU E 3 129 ? 101.233 55.675  25.060  1.00 73.73  ? 146 GLU A OE1   1 
ATOM 1993  O OE2   . GLU E 3 129 ? 102.162 55.534  27.048  1.00 65.88  ? 146 GLU A OE2   1 
ATOM 1994  N N     . GLU E 3 130 ? 97.233  51.955  28.350  1.00 6.56   ? 147 GLU A N     1 
ATOM 1995  C CA    . GLU E 3 130 ? 96.942  50.544  28.479  1.00 6.56   ? 147 GLU A CA    1 
ATOM 1996  C C     . GLU E 3 130 ? 95.506  50.403  28.947  1.00 6.56   ? 147 GLU A C     1 
ATOM 1997  O O     . GLU E 3 130 ? 94.932  49.303  28.980  1.00 7.70   ? 147 GLU A O     1 
ATOM 1998  C CB    . GLU E 3 130 ? 97.890  49.920  29.499  1.00 16.59  ? 147 GLU A CB    1 
ATOM 1999  C CG    . GLU E 3 130 ? 99.337  49.953  29.081  1.00 23.92  ? 147 GLU A CG    1 
ATOM 2000  C CD    . GLU E 3 130 ? 100.221 49.200  30.057  1.00 26.14  ? 147 GLU A CD    1 
ATOM 2001  O OE1   . GLU E 3 130 ? 99.825  48.069  30.432  1.00 26.39  ? 147 GLU A OE1   1 
ATOM 2002  O OE2   . GLU E 3 130 ? 101.301 49.725  30.444  1.00 26.66  ? 147 GLU A OE2   1 
ATOM 2003  N N     . GLN E 3 131 ? 94.936  51.545  29.293  1.00 15.69  ? 148 GLN A N     1 
ATOM 2004  C CA    . GLN E 3 131 ? 93.581  51.612  29.800  1.00 17.46  ? 148 GLN A CA    1 
ATOM 2005  C C     . GLN E 3 131 ? 92.564  51.592  28.685  1.00 17.21  ? 148 GLN A C     1 
ATOM 2006  O O     . GLN E 3 131 ? 91.503  52.168  28.816  1.00 11.30  ? 148 GLN A O     1 
ATOM 2007  C CB    . GLN E 3 131 ? 93.415  52.884  30.633  1.00 34.20  ? 148 GLN A CB    1 
ATOM 2008  C CG    . GLN E 3 131 ? 93.970  52.800  32.045  1.00 33.87  ? 148 GLN A CG    1 
ATOM 2009  C CD    . GLN E 3 131 ? 92.850  52.684  33.048  1.00 35.52  ? 148 GLN A CD    1 
ATOM 2010  O OE1   . GLN E 3 131 ? 92.006  51.795  32.936  1.00 38.26  ? 148 GLN A OE1   1 
ATOM 2011  N NE2   . GLN E 3 131 ? 92.815  53.593  34.025  1.00 33.66  ? 148 GLN A NE2   1 
ATOM 2012  N N     . ARG E 3 132 ? 92.900  50.916  27.593  1.00 23.94  ? 149 ARG A N     1 
ATOM 2013  C CA    . ARG E 3 132 ? 92.015  50.804  26.438  1.00 24.62  ? 149 ARG A CA    1 
ATOM 2014  C C     . ARG E 3 132 ? 92.322  49.565  25.578  1.00 22.19  ? 149 ARG A C     1 
ATOM 2015  O O     . ARG E 3 132 ? 93.290  48.831  25.814  1.00 39.95  ? 149 ARG A O     1 
ATOM 2016  C CB    . ARG E 3 132 ? 92.090  52.090  25.600  1.00 54.77  ? 149 ARG A CB    1 
ATOM 2017  C CG    . ARG E 3 132 ? 93.511  52.573  25.262  1.00 60.85  ? 149 ARG A CG    1 
ATOM 2018  C CD    . ARG E 3 132 ? 93.534  54.079  24.907  1.00 68.97  ? 149 ARG A CD    1 
ATOM 2019  N NE    . ARG E 3 132 ? 94.881  54.601  24.652  1.00 72.85  ? 149 ARG A NE    1 
ATOM 2020  C CZ    . ARG E 3 132 ? 95.548  54.462  23.507  1.00 73.86  ? 149 ARG A CZ    1 
ATOM 2021  N NH1   . ARG E 3 132 ? 95.006  53.819  22.479  1.00 73.72  ? 149 ARG A NH1   1 
ATOM 2022  N NH2   . ARG E 3 132 ? 96.770  54.964  23.391  1.00 73.84  ? 149 ARG A NH2   1 
ATOM 2023  N N     . GLY E 3 133 ? 91.478  49.341  24.580  1.00 48.92  ? 150 GLY A N     1 
ATOM 2024  C CA    . GLY E 3 133 ? 91.640  48.194  23.710  1.00 47.07  ? 150 GLY A CA    1 
ATOM 2025  C C     . GLY E 3 133 ? 90.695  47.083  24.131  1.00 47.20  ? 150 GLY A C     1 
ATOM 2026  O O     . GLY E 3 133 ? 89.739  47.297  24.878  1.00 42.74  ? 150 GLY A O     1 
ATOM 2027  N N     . ASP E 3 134 ? 90.952  45.882  23.640  1.00 5.54   ? 151 ASP A N     1 
ATOM 2028  C CA    . ASP E 3 134 ? 90.127  44.742  23.991  1.00 5.10   ? 151 ASP A CA    1 
ATOM 2029  C C     . ASP E 3 134 ? 90.191  44.436  25.483  1.00 5.10   ? 151 ASP A C     1 
ATOM 2030  O O     . ASP E 3 134 ? 91.267  44.434  26.049  1.00 6.57   ? 151 ASP A O     1 
ATOM 2031  C CB    . ASP E 3 134 ? 90.594  43.528  23.196  1.00 28.26  ? 151 ASP A CB    1 
ATOM 2032  C CG    . ASP E 3 134 ? 90.031  43.508  21.806  1.00 32.42  ? 151 ASP A CG    1 
ATOM 2033  O OD1   . ASP E 3 134 ? 90.696  42.949  20.907  1.00 36.83  ? 151 ASP A OD1   1 
ATOM 2034  O OD2   . ASP E 3 134 ? 88.913  44.050  21.624  1.00 35.33  ? 151 ASP A OD2   1 
ATOM 2035  N N     . TYR E 3 135 ? 89.030  44.205  26.098  1.00 17.44  ? 152 TYR A N     1 
ATOM 2036  C CA    . TYR E 3 135 ? 88.892  43.840  27.521  1.00 17.44  ? 152 TYR A CA    1 
ATOM 2037  C C     . TYR E 3 135 ? 87.997  42.605  27.554  1.00 18.29  ? 152 TYR A C     1 
ATOM 2038  O O     . TYR E 3 135 ? 87.116  42.471  26.710  1.00 26.50  ? 152 TYR A O     1 
ATOM 2039  C CB    . TYR E 3 135 ? 88.169  44.910  28.336  1.00 16.45  ? 152 TYR A CB    1 
ATOM 2040  C CG    . TYR E 3 135 ? 88.969  46.133  28.711  1.00 21.19  ? 152 TYR A CG    1 
ATOM 2041  C CD1   . TYR E 3 135 ? 89.269  47.112  27.767  1.00 22.62  ? 152 TYR A CD1   1 
ATOM 2042  C CD2   . TYR E 3 135 ? 89.395  46.322  30.024  1.00 23.00  ? 152 TYR A CD2   1 
ATOM 2043  C CE1   . TYR E 3 135 ? 89.967  48.241  28.118  1.00 19.96  ? 152 TYR A CE1   1 
ATOM 2044  C CE2   . TYR E 3 135 ? 90.094  47.457  30.391  1.00 23.34  ? 152 TYR A CE2   1 
ATOM 2045  C CZ    . TYR E 3 135 ? 90.383  48.413  29.430  1.00 21.56  ? 152 TYR A CZ    1 
ATOM 2046  O OH    . TYR E 3 135 ? 91.135  49.521  29.777  1.00 27.39  ? 152 TYR A OH    1 
ATOM 2047  N N     . ASP E 3 136 ? 88.206  41.713  28.519  1.00 33.67  ? 153 ASP A N     1 
ATOM 2048  C CA    . ASP E 3 136 ? 87.376  40.518  28.636  1.00 30.28  ? 153 ASP A CA    1 
ATOM 2049  C C     . ASP E 3 136 ? 86.216  40.862  29.555  1.00 32.15  ? 153 ASP A C     1 
ATOM 2050  O O     . ASP E 3 136 ? 86.431  41.345  30.659  1.00 14.38  ? 153 ASP A O     1 
ATOM 2051  C CB    . ASP E 3 136 ? 88.167  39.368  29.237  1.00 10.72  ? 153 ASP A CB    1 
ATOM 2052  C CG    . ASP E 3 136 ? 87.323  38.154  29.450  1.00 11.31  ? 153 ASP A CG    1 
ATOM 2053  O OD1   . ASP E 3 136 ? 87.862  37.067  29.675  1.00 13.30  ? 153 ASP A OD1   1 
ATOM 2054  O OD2   . ASP E 3 136 ? 86.091  38.274  29.396  1.00 11.75  ? 153 ASP A OD2   1 
ATOM 2055  N N     . LEU E 3 137 ? 84.988  40.599  29.128  1.00 13.15  ? 154 LEU A N     1 
ATOM 2056  C CA    . LEU E 3 137 ? 83.849  40.937  29.967  1.00 14.37  ? 154 LEU A CA    1 
ATOM 2057  C C     . LEU E 3 137 ? 83.254  39.813  30.781  1.00 17.54  ? 154 LEU A C     1 
ATOM 2058  O O     . LEU E 3 137 ? 82.240  40.007  31.451  1.00 22.24  ? 154 LEU A O     1 
ATOM 2059  C CB    . LEU E 3 137 ? 82.751  41.536  29.116  1.00 2.59   ? 154 LEU A CB    1 
ATOM 2060  C CG    . LEU E 3 137 ? 83.326  42.620  28.238  1.00 2.59   ? 154 LEU A CG    1 
ATOM 2061  C CD1   . LEU E 3 137 ? 83.714  42.033  26.919  1.00 2.59   ? 154 LEU A CD1   1 
ATOM 2062  C CD2   . LEU E 3 137 ? 82.303  43.669  28.017  1.00 2.59   ? 154 LEU A CD2   1 
ATOM 2063  N N     . ASN E 3 138 ? 83.862  38.640  30.724  1.00 16.98  ? 155 ASN A N     1 
ATOM 2064  C CA    . ASN E 3 138 ? 83.335  37.507  31.464  1.00 16.98  ? 155 ASN A CA    1 
ATOM 2065  C C     . ASN E 3 138 ? 84.222  37.136  32.638  1.00 16.98  ? 155 ASN A C     1 
ATOM 2066  O O     . ASN E 3 138 ? 83.936  36.191  33.353  1.00 35.10  ? 155 ASN A O     1 
ATOM 2067  C CB    . ASN E 3 138 ? 83.191  36.288  30.543  1.00 33.05  ? 155 ASN A CB    1 
ATOM 2068  C CG    . ASN E 3 138 ? 82.371  36.584  29.282  1.00 32.67  ? 155 ASN A CG    1 
ATOM 2069  O OD1   . ASN E 3 138 ? 81.252  37.119  29.352  1.00 29.83  ? 155 ASN A OD1   1 
ATOM 2070  N ND2   . ASN E 3 138 ? 82.920  36.212  28.123  1.00 32.31  ? 155 ASN A ND2   1 
ATOM 2071  N N     . ALA E 3 139 ? 85.300  37.878  32.839  1.00 42.00  ? 156 ALA A N     1 
ATOM 2072  C CA    . ALA E 3 139 ? 86.204  37.573  33.934  1.00 44.52  ? 156 ALA A CA    1 
ATOM 2073  C C     . ALA E 3 139 ? 86.697  38.864  34.564  1.00 47.65  ? 156 ALA A C     1 
ATOM 2074  O O     . ALA E 3 139 ? 87.126  39.767  33.844  1.00 11.16  ? 156 ALA A O     1 
ATOM 2075  C CB    . ALA E 3 139 ? 87.367  36.756  33.416  1.00 5.77   ? 156 ALA A CB    1 
ATOM 2076  N N     . VAL E 3 140 ? 86.625  38.947  35.898  1.00 6.43   ? 157 VAL A N     1 
ATOM 2077  C CA    . VAL E 3 140 ? 87.052  40.131  36.649  1.00 6.43   ? 157 VAL A CA    1 
ATOM 2078  C C     . VAL E 3 140 ? 87.638  39.779  38.006  1.00 6.43   ? 157 VAL A C     1 
ATOM 2079  O O     . VAL E 3 140 ? 87.388  38.692  38.522  1.00 23.54  ? 157 VAL A O     1 
ATOM 2080  C CB    . VAL E 3 140 ? 85.881  41.059  36.924  1.00 10.84  ? 157 VAL A CB    1 
ATOM 2081  C CG1   . VAL E 3 140 ? 85.362  41.647  35.659  1.00 12.18  ? 157 VAL A CG1   1 
ATOM 2082  C CG2   . VAL E 3 140 ? 84.805  40.289  37.590  1.00 16.05  ? 157 VAL A CG2   1 
ATOM 2083  N N     . ARG E 3 141 ? 88.397  40.712  38.586  1.00 28.96  ? 158 ARG A N     1 
ATOM 2084  C CA    . ARG E 3 141 ? 89.006  40.550  39.912  1.00 30.24  ? 158 ARG A CA    1 
ATOM 2085  C C     . ARG E 3 141 ? 88.727  41.765  40.792  1.00 27.47  ? 158 ARG A C     1 
ATOM 2086  O O     . ARG E 3 141 ? 88.615  42.886  40.306  1.00 17.74  ? 158 ARG A O     1 
ATOM 2087  C CB    . ARG E 3 141 ? 90.523  40.354  39.802  1.00 19.51  ? 158 ARG A CB    1 
ATOM 2088  C CG    . ARG E 3 141 ? 90.945  38.921  39.537  1.00 20.76  ? 158 ARG A CG    1 
ATOM 2089  C CD    . ARG E 3 141 ? 92.416  38.777  39.151  1.00 22.65  ? 158 ARG A CD    1 
ATOM 2090  N NE    . ARG E 3 141 ? 92.741  37.367  38.945  1.00 24.97  ? 158 ARG A NE    1 
ATOM 2091  C CZ    . ARG E 3 141 ? 93.851  36.912  38.372  1.00 30.08  ? 158 ARG A CZ    1 
ATOM 2092  N NH1   . ARG E 3 141 ? 94.775  37.751  37.930  1.00 30.90  ? 158 ARG A NH1   1 
ATOM 2093  N NH2   . ARG E 3 141 ? 94.042  35.607  38.242  1.00 30.51  ? 158 ARG A NH2   1 
ATOM 2094  N N     . LEU E 3 142 ? 88.612  41.538  42.095  1.00 27.14  ? 159 LEU A N     1 
ATOM 2095  C CA    . LEU E 3 142 ? 88.348  42.624  43.035  1.00 31.36  ? 159 LEU A CA    1 
ATOM 2096  C C     . LEU E 3 142 ? 89.652  43.133  43.614  1.00 33.24  ? 159 LEU A C     1 
ATOM 2097  O O     . LEU E 3 142 ? 90.545  42.344  43.946  1.00 72.46  ? 159 LEU A O     1 
ATOM 2098  C CB    . LEU E 3 142 ? 87.478  42.153  44.195  1.00 56.59  ? 159 LEU A CB    1 
ATOM 2099  C CG    . LEU E 3 142 ? 86.001  41.878  43.984  1.00 54.82  ? 159 LEU A CG    1 
ATOM 2100  C CD1   . LEU E 3 142 ? 85.440  41.314  45.273  1.00 50.50  ? 159 LEU A CD1   1 
ATOM 2101  C CD2   . LEU E 3 142 ? 85.278  43.154  43.600  1.00 50.31  ? 159 LEU A CD2   1 
ATOM 2102  N N     . CYS E 3 143 ? 89.755  44.449  43.763  1.00 26.51  ? 160 CYS A N     1 
ATOM 2103  C CA    . CYS E 3 143 ? 90.977  45.025  44.290  1.00 27.88  ? 160 CYS A CA    1 
ATOM 2104  C C     . CYS E 3 143 ? 90.692  45.835  45.517  1.00 26.94  ? 160 CYS A C     1 
ATOM 2105  O O     . CYS E 3 143 ? 89.623  46.424  45.636  1.00 37.19  ? 160 CYS A O     1 
ATOM 2106  C CB    . CYS E 3 143 ? 91.647  45.917  43.251  1.00 59.03  ? 160 CYS A CB    1 
ATOM 2107  S SG    . CYS E 3 143 ? 93.334  46.361  43.703  1.00 64.52  ? 160 CYS A SG    1 
ATOM 2108  N N     . PHE E 3 144 ? 91.668  45.877  46.418  1.00 60.65  ? 161 PHE A N     1 
ATOM 2109  C CA    . PHE E 3 144 ? 91.500  46.610  47.655  1.00 60.01  ? 161 PHE A CA    1 
ATOM 2110  C C     . PHE E 3 144 ? 92.492  47.722  47.925  1.00 60.48  ? 161 PHE A C     1 
ATOM 2111  O O     . PHE E 3 144 ? 93.421  47.570  48.723  1.00 70.37  ? 161 PHE A O     1 
ATOM 2112  C CB    . PHE E 3 144 ? 91.468  45.639  48.837  1.00 35.09  ? 161 PHE A CB    1 
ATOM 2113  C CG    . PHE E 3 144 ? 90.239  44.777  48.859  1.00 33.52  ? 161 PHE A CG    1 
ATOM 2114  C CD1   . PHE E 3 144 ? 90.304  43.433  48.503  1.00 30.65  ? 161 PHE A CD1   1 
ATOM 2115  C CD2   . PHE E 3 144 ? 88.999  45.326  49.194  1.00 30.30  ? 161 PHE A CD2   1 
ATOM 2116  C CE1   . PHE E 3 144 ? 89.156  42.649  48.480  1.00 29.70  ? 161 PHE A CE1   1 
ATOM 2117  C CE2   . PHE E 3 144 ? 87.841  44.552  49.173  1.00 31.83  ? 161 PHE A CE2   1 
ATOM 2118  C CZ    . PHE E 3 144 ? 87.918  43.210  48.815  1.00 30.80  ? 161 PHE A CZ    1 
ATOM 2119  N N     . GLN E 3 145 ? 92.280  48.854  47.263  1.00 72.08  ? 162 GLN A N     1 
ATOM 2120  C CA    . GLN E 3 145 ? 93.117  50.028  47.458  1.00 73.40  ? 162 GLN A CA    1 
ATOM 2121  C C     . GLN E 3 145 ? 92.750  50.537  48.855  1.00 76.61  ? 162 GLN A C     1 
ATOM 2122  O O     . GLN E 3 145 ? 92.051  51.542  48.988  1.00 68.16  ? 162 GLN A O     1 
ATOM 2123  C CB    . GLN E 3 145 ? 92.761  51.092  46.428  1.00 57.00  ? 162 GLN A CB    1 
ATOM 2124  C CG    . GLN E 3 145 ? 92.168  50.535  45.145  1.00 51.79  ? 162 GLN A CG    1 
ATOM 2125  C CD    . GLN E 3 145 ? 91.666  51.624  44.222  1.00 48.60  ? 162 GLN A CD    1 
ATOM 2126  O OE1   . GLN E 3 145 ? 92.409  52.545  43.869  1.00 49.52  ? 162 GLN A OE1   1 
ATOM 2127  N NE2   . GLN E 3 145 ? 90.403  51.529  43.824  1.00 47.17  ? 162 GLN A NE2   1 
ATOM 2128  N N     . VAL E 3 146 ? 93.206  49.829  49.887  1.00 86.36  ? 163 VAL A N     1 
ATOM 2129  C CA    . VAL E 3 146 ? 92.908  50.190  51.272  1.00 90.58  ? 163 VAL A CA    1 
ATOM 2130  C C     . VAL E 3 146 ? 93.946  51.105  51.943  1.00 93.16  ? 163 VAL A C     1 
ATOM 2131  O O     . VAL E 3 146 ? 95.128  50.762  52.057  1.00 66.33  ? 163 VAL A O     1 
ATOM 2132  C CB    . VAL E 3 146 ? 92.732  48.926  52.125  1.00 62.49  ? 163 VAL A CB    1 
ATOM 2133  C CG1   . VAL E 3 146 ? 93.900  47.966  51.871  1.00 62.66  ? 163 VAL A CG1   1 
ATOM 2134  C CG2   . VAL E 3 146 ? 92.637  49.309  53.606  1.00 59.68  ? 163 VAL A CG2   1 
ATOM 2135  N N     . THR E 3 147 ? 93.478  52.264  52.402  1.00 81.03  ? 164 THR A N     1 
ATOM 2136  C CA    . THR E 3 147 ? 94.329  53.262  53.054  1.00 82.47  ? 164 THR A CA    1 
ATOM 2137  C C     . THR E 3 147 ? 94.006  53.421  54.542  1.00 82.66  ? 164 THR A C     1 
ATOM 2138  O O     . THR E 3 147 ? 92.847  53.351  54.950  1.00 72.74  ? 164 THR A O     1 
ATOM 2139  C CB    . THR E 3 147 ? 94.179  54.661  52.372  1.00 74.16  ? 164 THR A CB    1 
ATOM 2140  O OG1   . THR E 3 147 ? 94.649  54.594  51.018  1.00 75.61  ? 164 THR A OG1   1 
ATOM 2141  C CG2   . THR E 3 147 ? 94.978  55.724  53.127  1.00 74.77  ? 164 THR A CG2   1 
ATOM 2142  N N     . VAL E 3 148 ? 95.043  53.634  55.348  1.00 65.06  ? 165 VAL A N     1 
ATOM 2143  C CA    . VAL E 3 148 ? 94.877  53.829  56.781  1.00 67.55  ? 165 VAL A CA    1 
ATOM 2144  C C     . VAL E 3 148 ? 95.858  54.882  57.270  1.00 68.41  ? 165 VAL A C     1 
ATOM 2145  O O     . VAL E 3 148 ? 96.504  55.568  56.480  1.00 73.57  ? 165 VAL A O     1 
ATOM 2146  C CB    . VAL E 3 148 ? 95.130  52.532  57.586  1.00 80.04  ? 165 VAL A CB    1 
ATOM 2147  C CG1   . VAL E 3 148 ? 94.231  51.415  57.081  1.00 81.57  ? 165 VAL A CG1   1 
ATOM 2148  C CG2   . VAL E 3 148 ? 96.592  52.139  57.495  1.00 79.61  ? 165 VAL A CG2   1 
ATOM 2149  N N     . ARG E 3 149 ? 95.965  54.999  58.585  1.00 90.37  ? 166 ARG A N     1 
ATOM 2150  C CA    . ARG E 3 149 ? 96.861  55.964  59.185  1.00 94.33  ? 166 ARG A CA    1 
ATOM 2151  C C     . ARG E 3 149 ? 98.280  55.404  59.186  1.00 95.73  ? 166 ARG A C     1 
ATOM 2152  O O     . ARG E 3 149 ? 98.500  54.269  58.769  1.00 112.73 ? 166 ARG A O     1 
ATOM 2153  C CB    . ARG E 3 149 ? 96.394  56.262  60.604  1.00 114.02 ? 166 ARG A CB    1 
ATOM 2154  C CG    . ARG E 3 149 ? 94.904  56.570  60.689  1.00 114.49 ? 166 ARG A CG    1 
ATOM 2155  C CD    . ARG E 3 149 ? 94.527  57.758  59.807  1.00 114.49 ? 166 ARG A CD    1 
ATOM 2156  N NE    . ARG E 3 149 ? 93.106  58.102  59.892  1.00 114.49 ? 166 ARG A NE    1 
ATOM 2157  C CZ    . ARG E 3 149 ? 92.116  57.364  59.394  1.00 114.49 ? 166 ARG A CZ    1 
ATOM 2158  N NH1   . ARG E 3 149 ? 92.382  56.226  58.765  1.00 114.49 ? 166 ARG A NH1   1 
ATOM 2159  N NH2   . ARG E 3 149 ? 90.856  57.764  59.528  1.00 114.49 ? 166 ARG A NH2   1 
ATOM 2160  N N     . ASP E 3 150 ? 99.235  56.213  59.643  1.00 81.65  ? 167 ASP A N     1 
ATOM 2161  C CA    . ASP E 3 150 ? 100.649 55.828  59.713  1.00 81.71  ? 167 ASP A CA    1 
ATOM 2162  C C     . ASP E 3 150 ? 100.998 55.545  61.178  1.00 81.56  ? 167 ASP A C     1 
ATOM 2163  O O     . ASP E 3 150 ? 100.110 55.553  62.033  1.00 92.32  ? 167 ASP A O     1 
ATOM 2164  C CB    . ASP E 3 150 ? 101.520 56.975  59.170  1.00 92.53  ? 167 ASP A CB    1 
ATOM 2165  C CG    . ASP E 3 150 ? 102.312 56.582  57.922  1.00 93.26  ? 167 ASP A CG    1 
ATOM 2166  O OD1   . ASP E 3 150 ? 103.296 55.821  58.039  1.00 92.04  ? 167 ASP A OD1   1 
ATOM 2167  O OD2   . ASP E 3 150 ? 101.949 57.034  56.816  1.00 93.96  ? 167 ASP A OD2   1 
ATOM 2168  N N     . PRO E 3 151 ? 102.282 55.275  61.490  1.00 81.07  ? 168 PRO A N     1 
ATOM 2169  C CA    . PRO E 3 151 ? 102.600 55.012  62.898  1.00 81.81  ? 168 PRO A CA    1 
ATOM 2170  C C     . PRO E 3 151 ? 102.111 56.149  63.805  1.00 81.67  ? 168 PRO A C     1 
ATOM 2171  O O     . PRO E 3 151 ? 101.856 55.953  65.000  1.00 85.52  ? 168 PRO A O     1 
ATOM 2172  C CB    . PRO E 3 151 ? 104.129 54.861  62.889  1.00 97.45  ? 168 PRO A CB    1 
ATOM 2173  C CG    . PRO E 3 151 ? 104.560 55.609  61.647  1.00 96.80  ? 168 PRO A CG    1 
ATOM 2174  C CD    . PRO E 3 151 ? 103.499 55.203  60.666  1.00 96.92  ? 168 PRO A CD    1 
ATOM 2175  N N     . ALA E 3 152 ? 101.973 57.330  63.208  1.00 121.26 ? 169 ALA A N     1 
ATOM 2176  C CA    . ALA E 3 152 ? 101.505 58.519  63.913  1.00 121.26 ? 169 ALA A CA    1 
ATOM 2177  C C     . ALA E 3 152 ? 100.064 58.837  63.500  1.00 121.26 ? 169 ALA A C     1 
ATOM 2178  O O     . ALA E 3 152 ? 99.122  58.189  63.968  1.00 104.10 ? 169 ALA A O     1 
ATOM 2179  C CB    . ALA E 3 152 ? 102.417 59.704  63.603  1.00 94.12  ? 169 ALA A CB    1 
ATOM 2180  N N     . GLY E 3 153 ? 99.896  59.824  62.619  1.00 91.39  ? 170 GLY A N     1 
ATOM 2181  C CA    . GLY E 3 153 ? 98.561  60.197  62.178  1.00 89.27  ? 170 GLY A CA    1 
ATOM 2182  C C     . GLY E 3 153 ? 98.478  60.793  60.782  1.00 87.98  ? 170 GLY A C     1 
ATOM 2183  O O     . GLY E 3 153 ? 97.836  61.825  60.586  1.00 104.57 ? 170 GLY A O     1 
ATOM 2184  N N     . ARG E 3 154 ? 99.128  60.154  59.811  1.00 71.20  ? 171 ARG A N     1 
ATOM 2185  C CA    . ARG E 3 154 ? 99.096  60.627  58.429  1.00 69.55  ? 171 ARG A CA    1 
ATOM 2186  C C     . ARG E 3 154 ? 98.419  59.590  57.515  1.00 69.26  ? 171 ARG A C     1 
ATOM 2187  O O     . ARG E 3 154 ? 98.105  58.472  57.950  1.00 84.77  ? 171 ARG A O     1 
ATOM 2188  C CB    . ARG E 3 154 ? 100.514 60.917  57.924  1.00 75.00  ? 171 ARG A CB    1 
ATOM 2189  C CG    . ARG E 3 154 ? 100.895 62.394  57.920  1.00 71.21  ? 171 ARG A CG    1 
ATOM 2190  C CD    . ARG E 3 154 ? 101.528 62.850  59.237  1.00 69.49  ? 171 ARG A CD    1 
ATOM 2191  N NE    . ARG E 3 154 ? 100.623 62.749  60.384  1.00 69.49  ? 171 ARG A NE    1 
ATOM 2192  C CZ    . ARG E 3 154 ? 100.990 62.943  61.651  1.00 68.38  ? 171 ARG A CZ    1 
ATOM 2193  N NH1   . ARG E 3 154 ? 102.248 63.250  61.939  1.00 68.46  ? 171 ARG A NH1   1 
ATOM 2194  N NH2   . ARG E 3 154 ? 100.105 62.821  62.632  1.00 66.08  ? 171 ARG A NH2   1 
ATOM 2195  N N     . PRO E 3 155 ? 98.164  59.958  56.241  1.00 94.02  ? 172 PRO A N     1 
ATOM 2196  C CA    . PRO E 3 155 ? 97.523  59.062  55.265  1.00 93.94  ? 172 PRO A CA    1 
ATOM 2197  C C     . PRO E 3 155 ? 98.417  57.943  54.696  1.00 93.18  ? 172 PRO A C     1 
ATOM 2198  O O     . PRO E 3 155 ? 98.903  58.037  53.562  1.00 62.79  ? 172 PRO A O     1 
ATOM 2199  C CB    . PRO E 3 155 ? 97.035  60.029  54.187  1.00 56.32  ? 172 PRO A CB    1 
ATOM 2200  C CG    . PRO E 3 155 ? 98.038  61.133  54.245  1.00 56.79  ? 172 PRO A CG    1 
ATOM 2201  C CD    . PRO E 3 155 ? 98.212  61.340  55.721  1.00 57.67  ? 172 PRO A CD    1 
ATOM 2202  N N     . LEU E 3 156 ? 98.617  56.889  55.491  1.00 120.80 ? 173 LEU A N     1 
ATOM 2203  C CA    . LEU E 3 156 ? 99.436  55.735  55.098  1.00 118.65 ? 173 LEU A CA    1 
ATOM 2204  C C     . LEU E 3 156 ? 98.582  54.785  54.265  1.00 117.80 ? 173 LEU A C     1 
ATOM 2205  O O     . LEU E 3 156 ? 97.802  54.001  54.817  1.00 70.75  ? 173 LEU A O     1 
ATOM 2206  C CB    . LEU E 3 156 ? 99.963  54.994  56.346  1.00 41.31  ? 173 LEU A CB    1 
ATOM 2207  C CG    . LEU E 3 156 ? 100.971 53.829  56.216  1.00 38.79  ? 173 LEU A CG    1 
ATOM 2208  C CD1   . LEU E 3 156 ? 101.483 53.428  57.587  1.00 35.87  ? 173 LEU A CD1   1 
ATOM 2209  C CD2   . LEU E 3 156 ? 100.333 52.620  55.554  1.00 36.68  ? 173 LEU A CD2   1 
ATOM 2210  N N     . LEU E 3 157 ? 98.736  54.857  52.944  1.00 72.39  ? 174 LEU A N     1 
ATOM 2211  C CA    . LEU E 3 157 ? 97.979  54.015  52.020  1.00 67.80  ? 174 LEU A CA    1 
ATOM 2212  C C     . LEU E 3 157 ? 98.597  52.627  51.941  1.00 66.13  ? 174 LEU A C     1 
ATOM 2213  O O     . LEU E 3 157 ? 99.806  52.512  51.768  1.00 83.78  ? 174 LEU A O     1 
ATOM 2214  C CB    . LEU E 3 157 ? 97.993  54.626  50.614  1.00 88.26  ? 174 LEU A CB    1 
ATOM 2215  C CG    . LEU E 3 157 ? 97.969  56.143  50.421  1.00 87.38  ? 174 LEU A CG    1 
ATOM 2216  C CD1   . LEU E 3 157 ? 99.257  56.753  50.962  1.00 87.57  ? 174 LEU A CD1   1 
ATOM 2217  C CD2   . LEU E 3 157 ? 97.827  56.455  48.939  1.00 83.37  ? 174 LEU A CD2   1 
ATOM 2218  N N     . LEU E 3 158 ? 97.793  51.571  52.057  1.00 31.93  ? 175 LEU A N     1 
ATOM 2219  C CA    . LEU E 3 158 ? 98.370  50.230  51.952  1.00 29.98  ? 175 LEU A CA    1 
ATOM 2220  C C     . LEU E 3 158 ? 98.164  49.593  50.576  1.00 30.98  ? 175 LEU A C     1 
ATOM 2221  O O     . LEU E 3 158 ? 97.135  49.798  49.925  1.00 93.37  ? 175 LEU A O     1 
ATOM 2222  C CB    . LEU E 3 158 ? 97.823  49.302  53.030  1.00 77.42  ? 175 LEU A CB    1 
ATOM 2223  C CG    . LEU E 3 158 ? 98.601  47.984  53.145  1.00 74.51  ? 175 LEU A CG    1 
ATOM 2224  C CD1   . LEU E 3 158 ? 98.128  46.976  52.111  1.00 73.33  ? 175 LEU A CD1   1 
ATOM 2225  C CD2   . LEU E 3 158 ? 100.093 48.266  53.000  1.00 70.37  ? 175 LEU A CD2   1 
ATOM 2226  N N     . THR E 3 159 ? 99.157  48.807  50.156  1.00 103.17 ? 176 THR A N     1 
ATOM 2227  C CA    . THR E 3 159 ? 99.169  48.127  48.858  1.00 102.03 ? 176 THR A CA    1 
ATOM 2228  C C     . THR E 3 159 ? 97.989  47.236  48.488  1.00 99.07  ? 176 THR A C     1 
ATOM 2229  O O     . THR E 3 159 ? 97.642  46.294  49.206  1.00 82.27  ? 176 THR A O     1 
ATOM 2230  C CB    . THR E 3 159 ? 100.443 47.272  48.686  1.00 84.80  ? 176 THR A CB    1 
ATOM 2231  O OG1   . THR E 3 159 ? 101.590 48.127  48.601  1.00 87.08  ? 176 THR A OG1   1 
ATOM 2232  C CG2   . THR E 3 159 ? 100.348 46.420  47.423  1.00 86.36  ? 176 THR A CG2   1 
ATOM 2233  N N     . PRO E 3 160 ? 97.388  47.510  47.320  1.00 30.62  ? 177 PRO A N     1 
ATOM 2234  C CA    . PRO E 3 160 ? 96.246  46.809  46.733  1.00 28.94  ? 177 PRO A CA    1 
ATOM 2235  C C     . PRO E 3 160 ? 96.507  45.314  46.530  1.00 25.81  ? 177 PRO A C     1 
ATOM 2236  O O     . PRO E 3 160 ? 97.656  44.875  46.464  1.00 41.84  ? 177 PRO A O     1 
ATOM 2237  C CB    . PRO E 3 160 ? 96.059  47.522  45.396  1.00 40.99  ? 177 PRO A CB    1 
ATOM 2238  C CG    . PRO E 3 160 ? 96.607  48.883  45.642  1.00 41.04  ? 177 PRO A CG    1 
ATOM 2239  C CD    . PRO E 3 160 ? 97.841  48.597  46.429  1.00 40.40  ? 177 PRO A CD    1 
ATOM 2240  N N     . VAL E 3 161 ? 95.429  44.544  46.423  1.00 95.37  ? 178 VAL A N     1 
ATOM 2241  C CA    . VAL E 3 161 ? 95.519  43.104  46.208  1.00 91.75  ? 178 VAL A CA    1 
ATOM 2242  C C     . VAL E 3 161 ? 94.272  42.581  45.512  1.00 90.40  ? 178 VAL A C     1 
ATOM 2243  O O     . VAL E 3 161 ? 93.140  42.818  45.936  1.00 35.85  ? 178 VAL A O     1 
ATOM 2244  C CB    . VAL E 3 161 ? 95.726  42.358  47.518  1.00 35.74  ? 178 VAL A CB    1 
ATOM 2245  C CG1   . VAL E 3 161 ? 97.215  42.295  47.834  1.00 33.71  ? 178 VAL A CG1   1 
ATOM 2246  C CG2   . VAL E 3 161 ? 94.973  43.075  48.641  1.00 33.77  ? 178 VAL A CG2   1 
ATOM 2247  N N     . LEU E 3 162 ? 94.496  41.851  44.432  1.00 36.37  ? 179 LEU A N     1 
ATOM 2248  C CA    . LEU E 3 162 ? 93.403  41.340  43.644  1.00 34.71  ? 179 LEU A CA    1 
ATOM 2249  C C     . LEU E 3 162 ? 92.777  40.113  44.281  1.00 36.39  ? 179 LEU A C     1 
ATOM 2250  O O     . LEU E 3 162 ? 93.471  39.252  44.837  1.00 57.06  ? 179 LEU A O     1 
ATOM 2251  C CB    . LEU E 3 162 ? 93.892  40.998  42.228  1.00 40.77  ? 179 LEU A CB    1 
ATOM 2252  C CG    . LEU E 3 162 ? 94.770  41.964  41.414  1.00 39.17  ? 179 LEU A CG    1 
ATOM 2253  C CD1   . LEU E 3 162 ? 94.061  43.273  41.141  1.00 33.05  ? 179 LEU A CD1   1 
ATOM 2254  C CD2   . LEU E 3 162 ? 96.048  42.193  42.170  1.00 36.77  ? 179 LEU A CD2   1 
ATOM 2255  N N     . SER E 3 163 ? 91.454  40.045  44.176  1.00 26.88  ? 180 SER A N     1 
ATOM 2256  C CA    . SER E 3 163 ? 90.690  38.929  44.713  1.00 27.07  ? 180 SER A CA    1 
ATOM 2257  C C     . SER E 3 163 ? 90.571  37.915  43.603  1.00 26.59  ? 180 SER A C     1 
ATOM 2258  O O     . SER E 3 163 ? 90.392  38.298  42.452  1.00 49.15  ? 180 SER A O     1 
ATOM 2259  C CB    . SER E 3 163 ? 89.289  39.385  45.091  1.00 50.75  ? 180 SER A CB    1 
ATOM 2260  O OG    . SER E 3 163 ? 88.541  39.652  43.920  1.00 52.04  ? 180 SER A OG    1 
ATOM 2261  N N     . HIS E 3 164 ? 90.657  36.636  43.943  1.00 19.03  ? 181 HIS A N     1 
ATOM 2262  C CA    . HIS E 3 164 ? 90.550  35.569  42.952  1.00 22.51  ? 181 HIS A CA    1 
ATOM 2263  C C     . HIS E 3 164 ? 89.609  35.903  41.804  1.00 23.05  ? 181 HIS A C     1 
ATOM 2264  O O     . HIS E 3 164 ? 88.731  36.754  41.925  1.00 50.82  ? 181 HIS A O     1 
ATOM 2265  C CB    . HIS E 3 164 ? 90.094  34.278  43.616  1.00 51.54  ? 181 HIS A CB    1 
ATOM 2266  C CG    . HIS E 3 164 ? 91.181  33.582  44.360  1.00 58.48  ? 181 HIS A CG    1 
ATOM 2267  N ND1   . HIS E 3 164 ? 92.368  33.220  43.762  1.00 61.97  ? 181 HIS A ND1   1 
ATOM 2268  C CD2   . HIS E 3 164 ? 91.274  33.195  45.651  1.00 60.17  ? 181 HIS A CD2   1 
ATOM 2269  C CE1   . HIS E 3 164 ? 93.149  32.639  44.655  1.00 62.24  ? 181 HIS A CE1   1 
ATOM 2270  N NE2   . HIS E 3 164 ? 92.508  32.611  45.810  1.00 61.00  ? 181 HIS A NE2   1 
ATOM 2271  N N     . PRO E 3 165 ? 89.780  35.229  40.665  1.00 44.62  ? 182 PRO A N     1 
ATOM 2272  C CA    . PRO E 3 165 ? 88.932  35.474  39.505  1.00 42.53  ? 182 PRO A CA    1 
ATOM 2273  C C     . PRO E 3 165 ? 87.451  35.332  39.813  1.00 42.15  ? 182 PRO A C     1 
ATOM 2274  O O     . PRO E 3 165 ? 87.051  34.672  40.765  1.00 25.79  ? 182 PRO A O     1 
ATOM 2275  C CB    . PRO E 3 165 ? 89.388  34.407  38.520  1.00 29.73  ? 182 PRO A CB    1 
ATOM 2276  C CG    . PRO E 3 165 ? 90.790  34.165  38.882  1.00 32.30  ? 182 PRO A CG    1 
ATOM 2277  C CD    . PRO E 3 165 ? 90.749  34.159  40.383  1.00 34.63  ? 182 PRO A CD    1 
ATOM 2278  N N     . ILE E 3 166 ? 86.637  35.973  38.997  1.00 51.23  ? 183 ILE A N     1 
ATOM 2279  C CA    . ILE E 3 166 ? 85.194  35.875  39.116  1.00 51.11  ? 183 ILE A CA    1 
ATOM 2280  C C     . ILE E 3 166 ? 84.712  35.841  37.665  1.00 55.49  ? 183 ILE A C     1 
ATOM 2281  O O     . ILE E 3 166 ? 85.193  36.600  36.814  1.00 46.83  ? 183 ILE A O     1 
ATOM 2282  C CB    . ILE E 3 166 ? 84.588  37.072  39.856  1.00 10.29  ? 183 ILE A CB    1 
ATOM 2283  C CG1   . ILE E 3 166 ? 84.929  37.006  41.346  1.00 8.76   ? 183 ILE A CG1   1 
ATOM 2284  C CG2   . ILE E 3 166 ? 83.083  37.074  39.647  1.00 9.60   ? 183 ILE A CG2   1 
ATOM 2285  C CD1   . ILE E 3 166 ? 84.252  38.102  42.166  1.00 6.19   ? 183 ILE A CD1   1 
ATOM 2286  N N     . PHE E 3 167 ? 83.763  34.962  37.378  1.00 55.83  ? 184 PHE A N     1 
ATOM 2287  C CA    . PHE E 3 167 ? 83.307  34.820  36.008  1.00 56.74  ? 184 PHE A CA    1 
ATOM 2288  C C     . PHE E 3 167 ? 81.808  34.941  35.738  1.00 59.46  ? 184 PHE A C     1 
ATOM 2289  O O     . PHE E 3 167 ? 80.978  34.532  36.545  1.00 44.69  ? 184 PHE A O     1 
ATOM 2290  C CB    . PHE E 3 167 ? 83.800  33.484  35.487  1.00 22.28  ? 184 PHE A CB    1 
ATOM 2291  C CG    . PHE E 3 167 ? 85.250  33.223  35.766  1.00 18.37  ? 184 PHE A CG    1 
ATOM 2292  C CD1   . PHE E 3 167 ? 86.181  33.186  34.715  1.00 14.57  ? 184 PHE A CD1   1 
ATOM 2293  C CD2   . PHE E 3 167 ? 85.682  32.930  37.064  1.00 17.53  ? 184 PHE A CD2   1 
ATOM 2294  C CE1   . PHE E 3 167 ? 87.534  32.842  34.952  1.00 14.40  ? 184 PHE A CE1   1 
ATOM 2295  C CE2   . PHE E 3 167 ? 87.018  32.590  37.309  1.00 15.42  ? 184 PHE A CE2   1 
ATOM 2296  C CZ    . PHE E 3 167 ? 87.947  32.544  36.245  1.00 15.80  ? 184 PHE A CZ    1 
ATOM 2297  N N     . ASP E 3 168 ? 81.480  35.496  34.577  1.00 55.31  ? 185 ASP A N     1 
ATOM 2298  C CA    . ASP E 3 168 ? 80.101  35.671  34.148  1.00 55.86  ? 185 ASP A CA    1 
ATOM 2299  C C     . ASP E 3 168 ? 79.559  34.278  33.933  1.00 58.00  ? 185 ASP A C     1 
ATOM 2300  O O     . ASP E 3 168 ? 80.201  33.455  33.277  1.00 48.45  ? 185 ASP A O     1 
ATOM 2301  C CB    . ASP E 3 168 ? 80.057  36.453  32.827  1.00 48.01  ? 185 ASP A CB    1 
ATOM 2302  C CG    . ASP E 3 168 ? 78.701  37.094  32.557  1.00 44.61  ? 185 ASP A CG    1 
ATOM 2303  O OD1   . ASP E 3 168 ? 78.590  37.837  31.549  1.00 46.28  ? 185 ASP A OD1   1 
ATOM 2304  O OD2   . ASP E 3 168 ? 77.758  36.857  33.349  1.00 42.75  ? 185 ASP A OD2   1 
ATOM 2305  N N     . ASN E 3 169 ? 78.387  34.007  34.492  1.00 36.17  ? 186 ASN A N     1 
ATOM 2306  C CA    . ASN E 3 169 ? 77.801  32.691  34.324  1.00 33.10  ? 186 ASN A CA    1 
ATOM 2307  C C     . ASN E 3 169 ? 77.090  32.599  32.991  1.00 30.47  ? 186 ASN A C     1 
ATOM 2308  O O     . ASN E 3 169 ? 77.083  31.546  32.365  1.00 32.45  ? 186 ASN A O     1 
ATOM 2309  C CB    . ASN E 3 169 ? 76.817  32.382  35.441  1.00 47.13  ? 186 ASN A CB    1 
ATOM 2310  C CG    . ASN E 3 169 ? 76.518  30.910  35.539  1.00 47.15  ? 186 ASN A CG    1 
ATOM 2311  O OD1   . ASN E 3 169 ? 75.856  30.462  36.474  1.00 47.43  ? 186 ASN A OD1   1 
ATOM 2312  N ND2   . ASN E 3 169 ? 77.011  30.138  34.572  1.00 46.82  ? 186 ASN A ND2   1 
ATOM 2313  N N     . ARG E 3 170 ? 76.495  33.708  32.556  1.00 26.03  ? 187 ARG A N     1 
ATOM 2314  C CA    . ARG E 3 170 ? 75.791  33.731  31.287  1.00 27.47  ? 187 ARG A CA    1 
ATOM 2315  C C     . ARG E 3 170 ? 76.704  33.327  30.143  1.00 27.66  ? 187 ARG A C     1 
ATOM 2316  O O     . ARG E 3 170 ? 76.373  32.430  29.379  1.00 46.78  ? 187 ARG A O     1 
ATOM 2317  C CB    . ARG E 3 170 ? 75.165  35.105  31.028  1.00 32.14  ? 187 ARG A CB    1 
ATOM 2318  C CG    . ARG E 3 170 ? 73.654  35.146  31.328  1.00 35.40  ? 187 ARG A CG    1 
ATOM 2319  C CD    . ARG E 3 170 ? 72.971  36.449  30.866  1.00 36.17  ? 187 ARG A CD    1 
ATOM 2320  N NE    . ARG E 3 170 ? 72.971  37.502  31.882  1.00 39.14  ? 187 ARG A NE    1 
ATOM 2321  C CZ    . ARG E 3 170 ? 71.886  37.919  32.532  1.00 41.94  ? 187 ARG A CZ    1 
ATOM 2322  N NH1   . ARG E 3 170 ? 70.702  37.379  32.276  1.00 44.22  ? 187 ARG A NH1   1 
ATOM 2323  N NH2   . ARG E 3 170 ? 71.985  38.871  33.450  1.00 42.46  ? 187 ARG A NH2   1 
ATOM 2324  N N     . ALA E 3 171 ? 77.861  33.950  30.023  1.00 7.62   ? 188 ALA A N     1 
ATOM 2325  C CA    . ALA E 3 171 ? 78.747  33.569  28.933  1.00 6.89   ? 188 ALA A CA    1 
ATOM 2326  C C     . ALA E 3 171 ? 78.841  32.042  28.865  1.00 9.18   ? 188 ALA A C     1 
ATOM 2327  O O     . ALA E 3 171 ? 79.397  31.396  29.753  1.00 22.56  ? 188 ALA A O     1 
ATOM 2328  C CB    . ALA E 3 171 ? 80.119  34.173  29.135  1.00 31.73  ? 188 ALA A CB    1 
ATOM 2329  N N     . PRO E 3 172 ? 78.298  31.445  27.795  1.00 24.50  ? 189 PRO A N     1 
ATOM 2330  C CA    . PRO E 3 172 ? 78.287  29.997  27.561  1.00 26.05  ? 189 PRO A CA    1 
ATOM 2331  C C     . PRO E 3 172 ? 79.646  29.311  27.585  1.00 25.30  ? 189 PRO A C     1 
ATOM 2332  O O     . PRO E 3 172 ? 79.737  28.108  27.360  1.00 61.69  ? 189 PRO A O     1 
ATOM 2333  C CB    . PRO E 3 172 ? 77.628  29.874  26.193  1.00 85.39  ? 189 PRO A CB    1 
ATOM 2334  C CG    . PRO E 3 172 ? 76.741  31.065  26.137  1.00 84.10  ? 189 PRO A CG    1 
ATOM 2335  C CD    . PRO E 3 172 ? 77.610  32.149  26.704  1.00 83.65  ? 189 PRO A CD    1 
ATOM 2336  N N     . ASN E 3 173 ? 80.701  30.071  27.843  1.00 29.39  ? 190 ASN A N     1 
ATOM 2337  C CA    . ASN E 3 173 ? 82.042  29.497  27.884  1.00 29.03  ? 190 ASN A CA    1 
ATOM 2338  C C     . ASN E 3 173 ? 82.805  30.051  29.086  1.00 28.55  ? 190 ASN A C     1 
ATOM 2339  O O     . ASN E 3 173 ? 84.033  30.047  29.137  1.00 21.30  ? 190 ASN A O     1 
ATOM 2340  C CB    . ASN E 3 173 ? 82.775  29.833  26.596  1.00 17.30  ? 190 ASN A CB    1 
ATOM 2341  C CG    . ASN E 3 173 ? 83.151  31.278  26.522  1.00 15.05  ? 190 ASN A CG    1 
ATOM 2342  O OD1   . ASN E 3 173 ? 82.313  32.152  26.715  1.00 13.11  ? 190 ASN A OD1   1 
ATOM 2343  N ND2   . ASN E 3 173 ? 84.418  31.548  26.250  1.00 14.40  ? 190 ASN A ND2   1 
ATOM 2344  N N     . THR E 3 174 ? 82.040  30.524  30.055  1.00 17.91  ? 191 THR A N     1 
ATOM 2345  C CA    . THR E 3 174 ? 82.564  31.096  31.278  1.00 13.84  ? 191 THR A CA    1 
ATOM 2346  C C     . THR E 3 174 ? 81.644  30.518  32.351  1.00 13.48  ? 191 THR A C     1 
ATOM 2347  O O     . THR E 3 174 ? 81.921  30.574  33.550  1.00 31.80  ? 191 THR A O     1 
ATOM 2348  C CB    . THR E 3 174 ? 82.406  32.633  31.243  1.00 48.60  ? 191 THR A CB    1 
ATOM 2349  O OG1   . THR E 3 174 ? 83.094  33.161  30.101  1.00 46.37  ? 191 THR A OG1   1 
ATOM 2350  C CG2   . THR E 3 174 ? 82.960  33.260  32.495  1.00 50.18  ? 191 THR A CG2   1 
ATOM 2351  N N     . ALA E 3 175 ? 80.542  29.945  31.871  1.00 49.29  ? 192 ALA A N     1 
ATOM 2352  C CA    . ALA E 3 175 ? 79.510  29.359  32.715  1.00 48.72  ? 192 ALA A CA    1 
ATOM 2353  C C     . ALA E 3 175 ? 79.924  28.086  33.413  1.00 45.66  ? 192 ALA A C     1 
ATOM 2354  O O     . ALA E 3 175 ? 80.953  27.486  33.094  1.00 26.64  ? 192 ALA A O     1 
ATOM 2355  C CB    . ALA E 3 175 ? 78.266  29.093  31.884  1.00 32.18  ? 192 ALA A CB    1 
ATOM 2356  N N     . GLU E 3 176 ? 79.104  27.681  34.372  1.00 19.48  ? 193 GLU A N     1 
ATOM 2357  C CA    . GLU E 3 176 ? 79.354  26.462  35.102  1.00 20.19  ? 193 GLU A CA    1 
ATOM 2358  C C     . GLU E 3 176 ? 78.754  25.291  34.308  1.00 17.64  ? 193 GLU A C     1 
ATOM 2359  O O     . GLU E 3 176 ? 77.550  25.228  34.064  1.00 18.26  ? 193 GLU A O     1 
ATOM 2360  C CB    . GLU E 3 176 ? 78.738  26.553  36.501  1.00 55.21  ? 193 GLU A CB    1 
ATOM 2361  C CG    . GLU E 3 176 ? 78.593  25.206  37.205  1.00 56.45  ? 193 GLU A CG    1 
ATOM 2362  C CD    . GLU E 3 176 ? 79.702  24.907  38.201  1.00 58.60  ? 193 GLU A CD    1 
ATOM 2363  O OE1   . GLU E 3 176 ? 79.661  25.487  39.310  1.00 62.21  ? 193 GLU A OE1   1 
ATOM 2364  O OE2   . GLU E 3 176 ? 80.607  24.097  37.879  1.00 57.05  ? 193 GLU A OE2   1 
ATOM 2365  N N     . LEU E 3 177 ? 79.627  24.381  33.886  1.00 8.21   ? 194 LEU A N     1 
ATOM 2366  C CA    . LEU E 3 177 ? 79.261  23.193  33.129  1.00 7.35   ? 194 LEU A CA    1 
ATOM 2367  C C     . LEU E 3 177 ? 78.490  22.242  34.017  1.00 8.87   ? 194 LEU A C     1 
ATOM 2368  O O     . LEU E 3 177 ? 79.078  21.641  34.903  1.00 11.90  ? 194 LEU A O     1 
ATOM 2369  C CB    . LEU E 3 177 ? 80.522  22.487  32.663  1.00 15.97  ? 194 LEU A CB    1 
ATOM 2370  C CG    . LEU E 3 177 ? 80.691  22.299  31.160  1.00 14.35  ? 194 LEU A CG    1 
ATOM 2371  C CD1   . LEU E 3 177 ? 80.762  23.677  30.505  1.00 13.67  ? 194 LEU A CD1   1 
ATOM 2372  C CD2   . LEU E 3 177 ? 81.959  21.467  30.857  1.00 13.67  ? 194 LEU A CD2   1 
ATOM 2373  N N     . LYS E 3 178 ? 77.190  22.098  33.781  1.00 34.54  ? 195 LYS A N     1 
ATOM 2374  C CA    . LYS E 3 178 ? 76.346  21.197  34.573  1.00 37.13  ? 195 LYS A CA    1 
ATOM 2375  C C     . LYS E 3 178 ? 75.817  20.017  33.759  1.00 36.15  ? 195 LYS A C     1 
ATOM 2376  O O     . LYS E 3 178 ? 75.747  20.089  32.538  1.00 27.15  ? 195 LYS A O     1 
ATOM 2377  C CB    . LYS E 3 178 ? 75.148  21.951  35.130  1.00 29.36  ? 195 LYS A CB    1 
ATOM 2378  C CG    . LYS E 3 178 ? 75.444  22.869  36.301  1.00 35.93  ? 195 LYS A CG    1 
ATOM 2379  C CD    . LYS E 3 178 ? 75.695  22.103  37.603  1.00 40.43  ? 195 LYS A CD    1 
ATOM 2380  C CE    . LYS E 3 178 ? 75.464  23.014  38.831  1.00 40.55  ? 195 LYS A CE    1 
ATOM 2381  N NZ    . LYS E 3 178 ? 75.860  22.391  40.141  1.00 33.50  ? 195 LYS A NZ    1 
ATOM 2382  N N     . ILE E 3 179 ? 75.437  18.945  34.453  1.00 44.43  ? 196 ILE A N     1 
ATOM 2383  C CA    . ILE E 3 179 ? 74.872  17.737  33.856  1.00 42.67  ? 196 ILE A CA    1 
ATOM 2384  C C     . ILE E 3 179 ? 73.530  17.531  34.568  1.00 43.02  ? 196 ILE A C     1 
ATOM 2385  O O     . ILE E 3 179 ? 73.468  16.959  35.657  1.00 30.66  ? 196 ILE A O     1 
ATOM 2386  C CB    . ILE E 3 179 ? 75.799  16.555  34.094  1.00 30.06  ? 196 ILE A CB    1 
ATOM 2387  C CG1   . ILE E 3 179 ? 76.829  16.918  35.171  1.00 30.67  ? 196 ILE A CG1   1 
ATOM 2388  C CG2   . ILE E 3 179 ? 76.491  16.180  32.810  1.00 24.05  ? 196 ILE A CG2   1 
ATOM 2389  C CD1   . ILE E 3 179 ? 76.213  17.298  36.545  1.00 33.51  ? 196 ILE A CD1   1 
ATOM 2390  N N     . CYS E 3 180 ? 72.463  18.012  33.942  1.00 67.59  ? 197 CYS A N     1 
ATOM 2391  C CA    . CYS E 3 180 ? 71.140  17.959  34.525  1.00 65.74  ? 197 CYS A CA    1 
ATOM 2392  C C     . CYS E 3 180 ? 70.442  16.601  34.630  1.00 65.10  ? 197 CYS A C     1 
ATOM 2393  O O     . CYS E 3 180 ? 69.693  16.367  35.581  1.00 17.28  ? 197 CYS A O     1 
ATOM 2394  C CB    . CYS E 3 180 ? 70.288  18.988  33.803  1.00 20.50  ? 197 CYS A CB    1 
ATOM 2395  S SG    . CYS E 3 180 ? 70.908  20.681  34.123  1.00 25.93  ? 197 CYS A SG    1 
ATOM 2396  N N     . ARG E 3 181 ? 70.683  15.706  33.677  1.00 2.00   ? 198 ARG A N     1 
ATOM 2397  C CA    . ARG E 3 181 ? 70.077  14.379  33.716  1.00 2.00   ? 198 ARG A CA    1 
ATOM 2398  C C     . ARG E 3 181 ? 70.346  13.597  32.460  1.00 2.00   ? 198 ARG A C     1 
ATOM 2399  O O     . ARG E 3 181 ? 70.452  14.162  31.381  1.00 2.00   ? 198 ARG A O     1 
ATOM 2400  C CB    . ARG E 3 181 ? 68.577  14.464  33.929  1.00 10.12  ? 198 ARG A CB    1 
ATOM 2401  C CG    . ARG E 3 181 ? 67.769  14.391  32.687  1.00 9.29   ? 198 ARG A CG    1 
ATOM 2402  C CD    . ARG E 3 181 ? 66.341  14.823  32.968  1.00 8.36   ? 198 ARG A CD    1 
ATOM 2403  N NE    . ARG E 3 181 ? 65.512  13.758  33.525  1.00 11.53  ? 198 ARG A NE    1 
ATOM 2404  C CZ    . ARG E 3 181 ? 64.353  13.976  34.144  1.00 9.63   ? 198 ARG A CZ    1 
ATOM 2405  N NH1   . ARG E 3 181 ? 63.892  15.216  34.291  1.00 10.47  ? 198 ARG A NH1   1 
ATOM 2406  N NH2   . ARG E 3 181 ? 63.652  12.954  34.606  1.00 10.73  ? 198 ARG A NH2   1 
ATOM 2407  N N     . VAL E 3 182 ? 70.464  12.285  32.604  1.00 63.50  ? 199 VAL A N     1 
ATOM 2408  C CA    . VAL E 3 182 ? 70.715  11.392  31.475  1.00 67.97  ? 199 VAL A CA    1 
ATOM 2409  C C     . VAL E 3 182 ? 69.751  10.214  31.524  1.00 71.07  ? 199 VAL A C     1 
ATOM 2410  O O     . VAL E 3 182 ? 69.264  9.848   32.600  1.00 19.15  ? 199 VAL A O     1 
ATOM 2411  C CB    . VAL E 3 182 ? 72.154  10.811  31.488  1.00 11.52  ? 199 VAL A CB    1 
ATOM 2412  C CG1   . VAL E 3 182 ? 73.125  11.828  30.974  1.00 13.03  ? 199 VAL A CG1   1 
ATOM 2413  C CG2   . VAL E 3 182 ? 72.541  10.377  32.892  1.00 14.80  ? 199 VAL A CG2   1 
ATOM 2414  N N     . ASN E 3 183 ? 69.486  9.617   30.364  1.00 24.40  ? 200 ASN A N     1 
ATOM 2415  C CA    . ASN E 3 183 ? 68.583  8.473   30.279  1.00 24.40  ? 200 ASN A CA    1 
ATOM 2416  C C     . ASN E 3 183 ? 69.280  7.222   30.806  1.00 24.40  ? 200 ASN A C     1 
ATOM 2417  O O     . ASN E 3 183 ? 68.954  6.724   31.879  1.00 43.48  ? 200 ASN A O     1 
ATOM 2418  C CB    . ASN E 3 183 ? 68.161  8.259   28.835  1.00 36.60  ? 200 ASN A CB    1 
ATOM 2419  C CG    . ASN E 3 183 ? 69.341  8.178   27.900  1.00 38.14  ? 200 ASN A CG    1 
ATOM 2420  O OD1   . ASN E 3 183 ? 69.185  7.922   26.705  1.00 38.90  ? 200 ASN A OD1   1 
ATOM 2421  N ND2   . ASN E 3 183 ? 70.536  8.397   28.438  1.00 39.74  ? 200 ASN A ND2   1 
ATOM 2422  N N     . ARG E 3 184 ? 70.249  6.714   30.063  1.00 29.45  ? 201 ARG A N     1 
ATOM 2423  C CA    . ARG E 3 184 ? 70.964  5.531   30.508  1.00 29.88  ? 201 ARG A CA    1 
ATOM 2424  C C     . ARG E 3 184 ? 71.844  5.905   31.701  1.00 31.38  ? 201 ARG A C     1 
ATOM 2425  O O     . ARG E 3 184 ? 72.193  7.067   31.867  1.00 41.06  ? 201 ARG A O     1 
ATOM 2426  C CB    . ARG E 3 184 ? 71.828  4.984   29.381  1.00 39.71  ? 201 ARG A CB    1 
ATOM 2427  C CG    . ARG E 3 184 ? 71.615  3.523   29.119  1.00 36.57  ? 201 ARG A CG    1 
ATOM 2428  C CD    . ARG E 3 184 ? 72.415  3.075   27.935  1.00 37.11  ? 201 ARG A CD    1 
ATOM 2429  N NE    . ARG E 3 184 ? 71.797  1.912   27.324  1.00 39.33  ? 201 ARG A NE    1 
ATOM 2430  C CZ    . ARG E 3 184 ? 71.419  1.846   26.048  1.00 41.25  ? 201 ARG A CZ    1 
ATOM 2431  N NH1   . ARG E 3 184 ? 71.599  2.886   25.231  1.00 36.96  ? 201 ARG A NH1   1 
ATOM 2432  N NH2   . ARG E 3 184 ? 70.842  0.735   25.585  1.00 42.04  ? 201 ARG A NH2   1 
ATOM 2433  N N     . ASN E 3 185 ? 72.191  4.921   32.528  1.00 14.76  ? 202 ASN A N     1 
ATOM 2434  C CA    . ASN E 3 185 ? 73.021  5.129   33.719  1.00 18.61  ? 202 ASN A CA    1 
ATOM 2435  C C     . ASN E 3 185 ? 74.089  4.060   33.753  1.00 21.86  ? 202 ASN A C     1 
ATOM 2436  O O     . ASN E 3 185 ? 74.992  4.108   34.584  1.00 48.70  ? 202 ASN A O     1 
ATOM 2437  C CB    . ASN E 3 185 ? 72.202  4.977   35.011  1.00 39.53  ? 202 ASN A CB    1 
ATOM 2438  C CG    . ASN E 3 185 ? 71.947  6.300   35.716  1.00 43.31  ? 202 ASN A CG    1 
ATOM 2439  O OD1   . ASN E 3 185 ? 72.851  7.122   35.886  1.00 41.79  ? 202 ASN A OD1   1 
ATOM 2440  N ND2   . ASN E 3 185 ? 70.711  6.501   36.151  1.00 43.56  ? 202 ASN A ND2   1 
ATOM 2441  N N     . SER E 3 186 ? 73.974  3.092   32.851  1.00 18.70  ? 203 SER A N     1 
ATOM 2442  C CA    . SER E 3 186 ? 74.906  1.975   32.800  1.00 17.91  ? 203 SER A CA    1 
ATOM 2443  C C     . SER E 3 186 ? 75.174  1.501   31.387  1.00 19.01  ? 203 SER A C     1 
ATOM 2444  O O     . SER E 3 186 ? 74.575  2.000   30.436  1.00 41.69  ? 203 SER A O     1 
ATOM 2445  C CB    . SER E 3 186 ? 74.350  0.824   33.634  1.00 47.91  ? 203 SER A CB    1 
ATOM 2446  O OG    . SER E 3 186 ? 72.930  0.889   33.717  1.00 44.11  ? 203 SER A OG    1 
ATOM 2447  N N     . GLY E 3 187 ? 76.066  0.527   31.246  1.00 38.20  ? 204 GLY A N     1 
ATOM 2448  C CA    . GLY E 3 187 ? 76.395  0.031   29.918  1.00 42.69  ? 204 GLY A CA    1 
ATOM 2449  C C     . GLY E 3 187 ? 77.412  -1.093  29.920  1.00 45.13  ? 204 GLY A C     1 
ATOM 2450  O O     . GLY E 3 187 ? 77.993  -1.417  30.961  1.00 58.05  ? 204 GLY A O     1 
ATOM 2451  N N     . SER E 3 188 ? 77.632  -1.682  28.748  1.00 53.74  ? 205 SER A N     1 
ATOM 2452  C CA    . SER E 3 188 ? 78.575  -2.781  28.598  1.00 57.11  ? 205 SER A CA    1 
ATOM 2453  C C     . SER E 3 188 ? 80.019  -2.312  28.429  1.00 59.42  ? 205 SER A C     1 
ATOM 2454  O O     . SER E 3 188 ? 80.304  -1.322  27.752  1.00 44.72  ? 205 SER A O     1 
ATOM 2455  C CB    . SER E 3 188 ? 78.201  -3.629  27.387  1.00 54.18  ? 205 SER A CB    1 
ATOM 2456  O OG    . SER E 3 188 ? 78.512  -2.943  26.190  1.00 55.33  ? 205 SER A OG    1 
ATOM 2457  N N     . CYS E 3 189 ? 80.928  -3.051  29.047  1.00 53.76  ? 206 CYS A N     1 
ATOM 2458  C CA    . CYS E 3 189 ? 82.350  -2.761  28.978  1.00 53.67  ? 206 CYS A CA    1 
ATOM 2459  C C     . CYS E 3 189 ? 82.783  -2.596  27.521  1.00 50.78  ? 206 CYS A C     1 
ATOM 2460  O O     . CYS E 3 189 ? 83.795  -1.961  27.227  1.00 43.19  ? 206 CYS A O     1 
ATOM 2461  C CB    . CYS E 3 189 ? 83.128  -3.923  29.600  1.00 48.67  ? 206 CYS A CB    1 
ATOM 2462  S SG    . CYS E 3 189 ? 83.079  -5.419  28.579  1.00 56.15  ? 206 CYS A SG    1 
ATOM 2463  N N     . LEU E 3 190 ? 82.022  -3.188  26.610  1.00 48.53  ? 207 LEU A N     1 
ATOM 2464  C CA    . LEU E 3 190 ? 82.338  -3.116  25.186  1.00 48.30  ? 207 LEU A CA    1 
ATOM 2465  C C     . LEU E 3 190 ? 82.125  -1.693  24.651  1.00 46.36  ? 207 LEU A C     1 
ATOM 2466  O O     . LEU E 3 190 ? 82.682  -1.311  23.616  1.00 88.48  ? 207 LEU A O     1 
ATOM 2467  C CB    . LEU E 3 190 ? 81.456  -4.107  24.411  1.00 88.61  ? 207 LEU A CB    1 
ATOM 2468  C CG    . LEU E 3 190 ? 82.021  -4.831  23.182  1.00 86.73  ? 207 LEU A CG    1 
ATOM 2469  C CD1   . LEU E 3 190 ? 80.891  -5.606  22.518  1.00 83.23  ? 207 LEU A CD1   1 
ATOM 2470  C CD2   . LEU E 3 190 ? 82.633  -3.845  22.193  1.00 86.89  ? 207 LEU A CD2   1 
ATOM 2471  N N     . GLY E 3 191 ? 81.312  -0.916  25.367  1.00 43.52  ? 208 GLY A N     1 
ATOM 2472  C CA    . GLY E 3 191 ? 81.036  0.452   24.959  1.00 41.59  ? 208 GLY A CA    1 
ATOM 2473  C C     . GLY E 3 191 ? 80.217  0.588   23.687  1.00 40.32  ? 208 GLY A C     1 
ATOM 2474  O O     . GLY E 3 191 ? 80.232  -0.292  22.824  1.00 44.37  ? 208 GLY A O     1 
ATOM 2475  N N     . GLY E 3 192 ? 79.498  1.702   23.570  1.00 36.23  ? 209 GLY A N     1 
ATOM 2476  C CA    . GLY E 3 192 ? 78.680  1.941   22.391  1.00 33.94  ? 209 GLY A CA    1 
ATOM 2477  C C     . GLY E 3 192 ? 77.214  2.166   22.724  1.00 32.59  ? 209 GLY A C     1 
ATOM 2478  O O     . GLY E 3 192 ? 76.365  2.320   21.844  1.00 34.48  ? 209 GLY A O     1 
ATOM 2479  N N     . ASP E 3 193 ? 76.908  2.171   24.012  1.00 20.94  ? 210 ASP A N     1 
ATOM 2480  C CA    . ASP E 3 193 ? 75.549  2.400   24.426  1.00 21.11  ? 210 ASP A CA    1 
ATOM 2481  C C     . ASP E 3 193 ? 75.195  3.876   24.220  1.00 19.60  ? 210 ASP A C     1 
ATOM 2482  O O     . ASP E 3 193 ? 75.683  4.749   24.944  1.00 40.76  ? 210 ASP A O     1 
ATOM 2483  C CB    . ASP E 3 193 ? 75.371  2.036   25.900  1.00 35.71  ? 210 ASP A CB    1 
ATOM 2484  C CG    . ASP E 3 193 ? 75.611  0.574   26.170  1.00 39.93  ? 210 ASP A CG    1 
ATOM 2485  O OD1   . ASP E 3 193 ? 75.229  0.105   27.274  1.00 44.65  ? 210 ASP A OD1   1 
ATOM 2486  O OD2   . ASP E 3 193 ? 76.184  -0.093  25.276  1.00 40.39  ? 210 ASP A OD2   1 
ATOM 2487  N N     . GLU E 3 194 ? 74.353  4.156   23.232  1.00 32.99  ? 211 GLU A N     1 
ATOM 2488  C CA    . GLU E 3 194 ? 73.932  5.522   22.979  1.00 31.01  ? 211 GLU A CA    1 
ATOM 2489  C C     . GLU E 3 194 ? 73.288  6.112   24.236  1.00 29.89  ? 211 GLU A C     1 
ATOM 2490  O O     . GLU E 3 194 ? 72.524  5.451   24.941  1.00 29.08  ? 211 GLU A O     1 
ATOM 2491  C CB    . GLU E 3 194 ? 72.959  5.543   21.806  1.00 38.18  ? 211 GLU A CB    1 
ATOM 2492  C CG    . GLU E 3 194 ? 72.376  6.895   21.509  1.00 36.30  ? 211 GLU A CG    1 
ATOM 2493  C CD    . GLU E 3 194 ? 71.785  6.942   20.120  1.00 38.69  ? 211 GLU A CD    1 
ATOM 2494  O OE1   . GLU E 3 194 ? 72.551  6.822   19.133  1.00 32.48  ? 211 GLU A OE1   1 
ATOM 2495  O OE2   . GLU E 3 194 ? 70.552  7.087   20.015  1.00 38.62  ? 211 GLU A OE2   1 
ATOM 2496  N N     . ILE E 3 195 ? 73.611  7.364   24.517  1.00 12.32  ? 212 ILE A N     1 
ATOM 2497  C CA    . ILE E 3 195 ? 73.077  8.027   25.686  1.00 9.79   ? 212 ILE A CA    1 
ATOM 2498  C C     . ILE E 3 195 ? 72.585  9.424   25.352  1.00 10.17  ? 212 ILE A C     1 
ATOM 2499  O O     . ILE E 3 195 ? 73.084  10.084  24.442  1.00 7.67   ? 212 ILE A O     1 
ATOM 2500  C CB    . ILE E 3 195 ? 74.154  8.068   26.801  1.00 12.12  ? 212 ILE A CB    1 
ATOM 2501  C CG1   . ILE E 3 195 ? 74.344  6.646   27.334  1.00 12.12  ? 212 ILE A CG1   1 
ATOM 2502  C CG2   . ILE E 3 195 ? 73.771  9.050   27.903  1.00 17.89  ? 212 ILE A CG2   1 
ATOM 2503  C CD1   . ILE E 3 195 ? 75.445  6.473   28.326  1.00 12.12  ? 212 ILE A CD1   1 
ATOM 2504  N N     . PHE E 3 196 ? 71.556  9.843   26.068  1.00 24.30  ? 213 PHE A N     1 
ATOM 2505  C CA    . PHE E 3 196 ? 71.005  11.159  25.892  1.00 23.46  ? 213 PHE A CA    1 
ATOM 2506  C C     . PHE E 3 196 ? 71.366  11.881  27.177  1.00 24.92  ? 213 PHE A C     1 
ATOM 2507  O O     . PHE E 3 196 ? 70.999  11.455  28.281  1.00 15.24  ? 213 PHE A O     1 
ATOM 2508  C CB    . PHE E 3 196 ? 69.496  11.078  25.664  1.00 2.00   ? 213 PHE A CB    1 
ATOM 2509  C CG    . PHE E 3 196 ? 69.128  10.771  24.241  1.00 2.00   ? 213 PHE A CG    1 
ATOM 2510  C CD1   . PHE E 3 196 ? 69.765  9.738   23.549  1.00 2.00   ? 213 PHE A CD1   1 
ATOM 2511  C CD2   . PHE E 3 196 ? 68.166  11.535  23.570  1.00 2.00   ? 213 PHE A CD2   1 
ATOM 2512  C CE1   . PHE E 3 196 ? 69.459  9.464   22.197  1.00 2.00   ? 213 PHE A CE1   1 
ATOM 2513  C CE2   . PHE E 3 196 ? 67.851  11.270  22.213  1.00 2.00   ? 213 PHE A CE2   1 
ATOM 2514  C CZ    . PHE E 3 196 ? 68.507  10.230  21.534  1.00 2.00   ? 213 PHE A CZ    1 
ATOM 2515  N N     . LEU E 3 197 ? 72.138  12.950  27.029  1.00 22.76  ? 214 LEU A N     1 
ATOM 2516  C CA    . LEU E 3 197 ? 72.564  13.724  28.167  1.00 22.76  ? 214 LEU A CA    1 
ATOM 2517  C C     . LEU E 3 197 ? 71.958  15.090  28.059  1.00 23.50  ? 214 LEU A C     1 
ATOM 2518  O O     . LEU E 3 197 ? 72.244  15.817  27.117  1.00 29.83  ? 214 LEU A O     1 
ATOM 2519  C CB    . LEU E 3 197 ? 74.094  13.828  28.194  1.00 11.42  ? 214 LEU A CB    1 
ATOM 2520  C CG    . LEU E 3 197 ? 74.645  14.431  29.497  1.00 9.96   ? 214 LEU A CG    1 
ATOM 2521  C CD1   . LEU E 3 197 ? 75.997  13.809  29.797  1.00 9.96   ? 214 LEU A CD1   1 
ATOM 2522  C CD2   . LEU E 3 197 ? 74.719  15.954  29.396  1.00 9.96   ? 214 LEU A CD2   1 
ATOM 2523  N N     . LEU E 3 198 ? 71.091  15.423  29.004  1.00 18.77  ? 215 LEU A N     1 
ATOM 2524  C CA    . LEU E 3 198 ? 70.481  16.742  29.010  1.00 20.49  ? 215 LEU A CA    1 
ATOM 2525  C C     . LEU E 3 198 ? 71.408  17.559  29.887  1.00 23.17  ? 215 LEU A C     1 
ATOM 2526  O O     . LEU E 3 198 ? 71.792  17.116  30.973  1.00 27.75  ? 215 LEU A O     1 
ATOM 2527  C CB    . LEU E 3 198 ? 69.071  16.690  29.602  1.00 7.00   ? 215 LEU A CB    1 
ATOM 2528  C CG    . LEU E 3 198 ? 68.022  15.931  28.779  1.00 7.00   ? 215 LEU A CG    1 
ATOM 2529  C CD1   . LEU E 3 198 ? 66.681  16.220  29.407  1.00 10.46  ? 215 LEU A CD1   1 
ATOM 2530  C CD2   . LEU E 3 198 ? 68.014  16.349  27.317  1.00 7.00   ? 215 LEU A CD2   1 
ATOM 2531  N N     . CYS E 3 199 ? 71.777  18.744  29.420  1.00 46.21  ? 216 CYS A N     1 
ATOM 2532  C CA    . CYS E 3 199 ? 72.701  19.560  30.180  1.00 44.59  ? 216 CYS A CA    1 
ATOM 2533  C C     . CYS E 3 199 ? 72.451  21.042  29.995  1.00 47.17  ? 216 CYS A C     1 
ATOM 2534  O O     . CYS E 3 199 ? 71.659  21.448  29.154  1.00 15.62  ? 216 CYS A O     1 
ATOM 2535  C CB    . CYS E 3 199 ? 74.100  19.258  29.708  1.00 8.71   ? 216 CYS A CB    1 
ATOM 2536  S SG    . CYS E 3 199 ? 74.367  20.003  28.064  1.00 6.23   ? 216 CYS A SG    1 
ATOM 2537  N N     . ASP E 3 200 ? 73.161  21.846  30.778  1.00 27.90  ? 217 ASP A N     1 
ATOM 2538  C CA    . ASP E 3 200 ? 73.035  23.292  30.686  1.00 28.25  ? 217 ASP A CA    1 
ATOM 2539  C C     . ASP E 3 200 ? 73.699  23.783  29.404  1.00 26.03  ? 217 ASP A C     1 
ATOM 2540  O O     . ASP E 3 200 ? 74.517  23.080  28.808  1.00 18.85  ? 217 ASP A O     1 
ATOM 2541  C CB    . ASP E 3 200 ? 73.669  23.978  31.905  1.00 40.35  ? 217 ASP A CB    1 
ATOM 2542  C CG    . ASP E 3 200 ? 72.677  24.210  33.030  1.00 44.13  ? 217 ASP A CG    1 
ATOM 2543  O OD1   . ASP E 3 200 ? 73.045  24.860  34.030  1.00 47.90  ? 217 ASP A OD1   1 
ATOM 2544  O OD2   . ASP E 3 200 ? 71.525  23.740  32.921  1.00 45.44  ? 217 ASP A OD2   1 
ATOM 2545  N N     . LYS E 3 201 ? 73.332  24.993  28.992  1.00 6.17   ? 218 LYS A N     1 
ATOM 2546  C CA    . LYS E 3 201 ? 73.858  25.607  27.787  1.00 6.17   ? 218 LYS A CA    1 
ATOM 2547  C C     . LYS E 3 201 ? 75.331  25.245  27.655  1.00 6.17   ? 218 LYS A C     1 
ATOM 2548  O O     . LYS E 3 201 ? 76.104  25.399  28.602  1.00 34.68  ? 218 LYS A O     1 
ATOM 2549  C CB    . LYS E 3 201 ? 73.677  27.127  27.871  1.00 48.00  ? 218 LYS A CB    1 
ATOM 2550  C CG    . LYS E 3 201 ? 73.506  27.859  26.533  1.00 46.37  ? 218 LYS A CG    1 
ATOM 2551  C CD    . LYS E 3 201 ? 73.059  29.318  26.757  1.00 48.39  ? 218 LYS A CD    1 
ATOM 2552  C CE    . LYS E 3 201 ? 74.059  30.081  27.658  1.00 55.01  ? 218 LYS A CE    1 
ATOM 2553  N NZ    . LYS E 3 201 ? 73.680  31.496  27.969  1.00 54.52  ? 218 LYS A NZ    1 
ATOM 2554  N N     . VAL E 3 202 ? 75.695  24.716  26.489  1.00 14.71  ? 219 VAL A N     1 
ATOM 2555  C CA    . VAL E 3 202 ? 77.077  24.339  26.199  1.00 14.71  ? 219 VAL A CA    1 
ATOM 2556  C C     . VAL E 3 202 ? 77.363  24.723  24.757  1.00 14.71  ? 219 VAL A C     1 
ATOM 2557  O O     . VAL E 3 202 ? 76.444  24.857  23.958  1.00 15.61  ? 219 VAL A O     1 
ATOM 2558  C CB    . VAL E 3 202 ? 77.330  22.828  26.309  1.00 8.05   ? 219 VAL A CB    1 
ATOM 2559  C CG1   . VAL E 3 202 ? 76.709  22.276  27.563  1.00 9.22   ? 219 VAL A CG1   1 
ATOM 2560  C CG2   . VAL E 3 202 ? 76.808  22.129  25.062  1.00 8.05   ? 219 VAL A CG2   1 
ATOM 2561  N N     . GLN E 3 203 ? 78.632  24.893  24.422  1.00 10.82  ? 220 GLN A N     1 
ATOM 2562  C CA    . GLN E 3 203 ? 78.963  25.258  23.063  1.00 10.52  ? 220 GLN A CA    1 
ATOM 2563  C C     . GLN E 3 203 ? 79.547  24.060  22.313  1.00 10.62  ? 220 GLN A C     1 
ATOM 2564  O O     . GLN E 3 203 ? 80.670  23.607  22.571  1.00 4.39   ? 220 GLN A O     1 
ATOM 2565  C CB    . GLN E 3 203 ? 79.906  26.437  23.093  1.00 12.15  ? 220 GLN A CB    1 
ATOM 2566  C CG    . GLN E 3 203 ? 79.334  27.596  23.829  1.00 11.08  ? 220 GLN A CG    1 
ATOM 2567  C CD    . GLN E 3 203 ? 80.091  28.836  23.511  1.00 11.08  ? 220 GLN A CD    1 
ATOM 2568  O OE1   . GLN E 3 203 ? 80.693  28.929  22.441  1.00 17.17  ? 220 GLN A OE1   1 
ATOM 2569  N NE2   . GLN E 3 203 ? 80.063  29.815  24.416  1.00 11.08  ? 220 GLN A NE2   1 
ATOM 2570  N N     . LYS E 3 204 ? 78.751  23.547  21.383  1.00 19.81  ? 221 LYS A N     1 
ATOM 2571  C CA    . LYS E 3 204 ? 79.136  22.368  20.623  1.00 22.87  ? 221 LYS A CA    1 
ATOM 2572  C C     . LYS E 3 204 ? 80.564  22.360  20.121  1.00 22.82  ? 221 LYS A C     1 
ATOM 2573  O O     . LYS E 3 204 ? 81.241  21.329  20.185  1.00 17.22  ? 221 LYS A O     1 
ATOM 2574  C CB    . LYS E 3 204 ? 78.164  22.114  19.456  1.00 12.60  ? 221 LYS A CB    1 
ATOM 2575  C CG    . LYS E 3 204 ? 77.937  23.258  18.512  1.00 12.60  ? 221 LYS A CG    1 
ATOM 2576  C CD    . LYS E 3 204 ? 77.084  22.793  17.358  1.00 12.60  ? 221 LYS A CD    1 
ATOM 2577  C CE    . LYS E 3 204 ? 76.914  23.876  16.299  1.00 16.56  ? 221 LYS A CE    1 
ATOM 2578  N NZ    . LYS E 3 204 ? 76.098  25.033  16.772  1.00 20.50  ? 221 LYS A NZ    1 
ATOM 2579  N N     . GLU E 3 205 ? 81.028  23.498  19.628  1.00 2.00   ? 222 GLU A N     1 
ATOM 2580  C CA    . GLU E 3 205 ? 82.391  23.565  19.118  1.00 2.00   ? 222 GLU A CA    1 
ATOM 2581  C C     . GLU E 3 205 ? 83.369  23.284  20.243  1.00 2.00   ? 222 GLU A C     1 
ATOM 2582  O O     . GLU E 3 205 ? 84.469  22.774  20.006  1.00 27.75  ? 222 GLU A O     1 
ATOM 2583  C CB    . GLU E 3 205 ? 82.693  24.951  18.558  1.00 30.76  ? 222 GLU A CB    1 
ATOM 2584  C CG    . GLU E 3 205 ? 81.664  25.459  17.592  1.00 36.89  ? 222 GLU A CG    1 
ATOM 2585  C CD    . GLU E 3 205 ? 80.861  26.607  18.155  1.00 40.85  ? 222 GLU A CD    1 
ATOM 2586  O OE1   . GLU E 3 205 ? 79.919  27.063  17.465  1.00 43.27  ? 222 GLU A OE1   1 
ATOM 2587  O OE2   . GLU E 3 205 ? 81.180  27.053  19.283  1.00 35.16  ? 222 GLU A OE2   1 
ATOM 2588  N N     . ASP E 3 206 ? 82.947  23.598  21.470  1.00 8.58   ? 223 ASP A N     1 
ATOM 2589  C CA    . ASP E 3 206 ? 83.797  23.471  22.643  1.00 8.58   ? 223 ASP A CA    1 
ATOM 2590  C C     . ASP E 3 206 ? 83.170  22.705  23.813  1.00 8.58   ? 223 ASP A C     1 
ATOM 2591  O O     . ASP E 3 206 ? 82.774  23.309  24.816  1.00 8.58   ? 223 ASP A O     1 
ATOM 2592  C CB    . ASP E 3 206 ? 84.182  24.883  23.109  1.00 9.16   ? 223 ASP A CB    1 
ATOM 2593  C CG    . ASP E 3 206 ? 85.305  24.884  24.140  1.00 9.16   ? 223 ASP A CG    1 
ATOM 2594  O OD1   . ASP E 3 206 ? 86.463  24.550  23.759  1.00 9.92   ? 223 ASP A OD1   1 
ATOM 2595  O OD2   . ASP E 3 206 ? 85.035  25.224  25.322  1.00 9.16   ? 223 ASP A OD2   1 
ATOM 2596  N N     . ILE E 3 207 ? 83.070  21.384  23.711  1.00 51.01  ? 224 ILE A N     1 
ATOM 2597  C CA    . ILE E 3 207 ? 82.506  20.603  24.814  1.00 51.79  ? 224 ILE A CA    1 
ATOM 2598  C C     . ILE E 3 207 ? 82.804  19.136  24.610  1.00 51.98  ? 224 ILE A C     1 
ATOM 2599  O O     . ILE E 3 207 ? 82.847  18.666  23.466  1.00 17.02  ? 224 ILE A O     1 
ATOM 2600  C CB    . ILE E 3 207 ? 80.984  20.732  24.903  1.00 26.48  ? 224 ILE A CB    1 
ATOM 2601  C CG1   . ILE E 3 207 ? 80.485  20.097  26.211  1.00 23.03  ? 224 ILE A CG1   1 
ATOM 2602  C CG2   . ILE E 3 207 ? 80.344  20.027  23.710  1.00 27.90  ? 224 ILE A CG2   1 
ATOM 2603  C CD1   . ILE E 3 207 ? 78.957  19.884  26.273  1.00 21.04  ? 224 ILE A CD1   1 
ATOM 2604  N N     . GLU E 3 208 ? 82.997  18.423  25.723  1.00 22.90  ? 225 GLU A N     1 
ATOM 2605  C CA    . GLU E 3 208 ? 83.280  16.988  25.694  1.00 25.44  ? 225 GLU A CA    1 
ATOM 2606  C C     . GLU E 3 208 ? 82.630  16.252  26.862  1.00 27.54  ? 225 GLU A C     1 
ATOM 2607  O O     . GLU E 3 208 ? 82.253  16.865  27.873  1.00 29.15  ? 225 GLU A O     1 
ATOM 2608  C CB    . GLU E 3 208 ? 84.797  16.744  25.677  1.00 30.82  ? 225 GLU A CB    1 
ATOM 2609  C CG    . GLU E 3 208 ? 85.493  17.480  24.532  1.00 30.14  ? 225 GLU A CG    1 
ATOM 2610  C CD    . GLU E 3 208 ? 86.806  16.853  24.096  1.00 28.86  ? 225 GLU A CD    1 
ATOM 2611  O OE1   . GLU E 3 208 ? 87.685  16.635  24.959  1.00 24.94  ? 225 GLU A OE1   1 
ATOM 2612  O OE2   . GLU E 3 208 ? 86.957  16.593  22.883  1.00 29.26  ? 225 GLU A OE2   1 
ATOM 2613  N N     . VAL E 3 209 ? 82.461  14.942  26.697  1.00 68.02  ? 226 VAL A N     1 
ATOM 2614  C CA    . VAL E 3 209 ? 81.885  14.109  27.750  1.00 74.35  ? 226 VAL A CA    1 
ATOM 2615  C C     . VAL E 3 209 ? 83.020  13.233  28.256  1.00 77.76  ? 226 VAL A C     1 
ATOM 2616  O O     . VAL E 3 209 ? 83.443  12.283  27.596  1.00 40.08  ? 226 VAL A O     1 
ATOM 2617  C CB    . VAL E 3 209 ? 80.774  13.222  27.231  1.00 25.06  ? 226 VAL A CB    1 
ATOM 2618  C CG1   . VAL E 3 209 ? 79.988  12.667  28.411  1.00 22.43  ? 226 VAL A CG1   1 
ATOM 2619  C CG2   . VAL E 3 209 ? 79.886  14.011  26.277  1.00 26.32  ? 226 VAL A CG2   1 
ATOM 2620  N N     . TYR E 3 210 ? 83.504  13.552  29.445  1.00 39.84  ? 227 TYR A N     1 
ATOM 2621  C CA    . TYR E 3 210 ? 84.642  12.847  30.003  1.00 38.61  ? 227 TYR A CA    1 
ATOM 2622  C C     . TYR E 3 210 ? 84.347  11.741  30.987  1.00 40.95  ? 227 TYR A C     1 
ATOM 2623  O O     . TYR E 3 210 ? 83.657  11.936  31.988  1.00 28.87  ? 227 TYR A O     1 
ATOM 2624  C CB    . TYR E 3 210 ? 85.598  13.850  30.663  1.00 31.69  ? 227 TYR A CB    1 
ATOM 2625  C CG    . TYR E 3 210 ? 87.012  13.349  30.805  1.00 28.08  ? 227 TYR A CG    1 
ATOM 2626  C CD1   . TYR E 3 210 ? 87.643  12.717  29.732  1.00 23.85  ? 227 TYR A CD1   1 
ATOM 2627  C CD2   . TYR E 3 210 ? 87.731  13.542  31.985  1.00 29.62  ? 227 TYR A CD2   1 
ATOM 2628  C CE1   . TYR E 3 210 ? 88.953  12.294  29.821  1.00 23.85  ? 227 TYR A CE1   1 
ATOM 2629  C CE2   . TYR E 3 210 ? 89.049  13.122  32.089  1.00 25.38  ? 227 TYR A CE2   1 
ATOM 2630  C CZ    . TYR E 3 210 ? 89.650  12.502  30.996  1.00 23.85  ? 227 TYR A CZ    1 
ATOM 2631  O OH    . TYR E 3 210 ? 90.960  12.109  31.038  1.00 23.85  ? 227 TYR A OH    1 
ATOM 2632  N N     . PHE E 3 211 ? 84.913  10.580  30.690  1.00 50.89  ? 228 PHE A N     1 
ATOM 2633  C CA    . PHE E 3 211 ? 84.780  9.406   31.533  1.00 52.97  ? 228 PHE A CA    1 
ATOM 2634  C C     . PHE E 3 211 ? 86.084  9.165   32.286  1.00 52.00  ? 228 PHE A C     1 
ATOM 2635  O O     . PHE E 3 211 ? 87.082  8.755   31.683  1.00 59.14  ? 228 PHE A O     1 
ATOM 2636  C CB    . PHE E 3 211 ? 84.443  8.200   30.664  1.00 58.34  ? 228 PHE A CB    1 
ATOM 2637  C CG    . PHE E 3 211 ? 83.011  8.139   30.277  1.00 57.58  ? 228 PHE A CG    1 
ATOM 2638  C CD1   . PHE E 3 211 ? 82.277  9.310   30.118  1.00 57.97  ? 228 PHE A CD1   1 
ATOM 2639  C CD2   . PHE E 3 211 ? 82.375  6.919   30.125  1.00 57.99  ? 228 PHE A CD2   1 
ATOM 2640  C CE1   . PHE E 3 211 ? 80.934  9.265   29.823  1.00 60.01  ? 228 PHE A CE1   1 
ATOM 2641  C CE2   . PHE E 3 211 ? 81.019  6.863   29.826  1.00 57.60  ? 228 PHE A CE2   1 
ATOM 2642  C CZ    . PHE E 3 211 ? 80.299  8.038   29.678  1.00 57.76  ? 228 PHE A CZ    1 
ATOM 2643  N N     . THR E 3 212 ? 86.082  9.420   33.594  1.00 53.97  ? 229 THR A N     1 
ATOM 2644  C CA    . THR E 3 212 ? 87.295  9.217   34.386  1.00 56.89  ? 229 THR A CA    1 
ATOM 2645  C C     . THR E 3 212 ? 87.457  7.775   34.841  1.00 58.27  ? 229 THR A C     1 
ATOM 2646  O O     . THR E 3 212 ? 87.378  6.845   34.037  1.00 81.40  ? 229 THR A O     1 
ATOM 2647  C CB    . THR E 3 212 ? 87.334  10.105  35.633  1.00 65.45  ? 229 THR A CB    1 
ATOM 2648  O OG1   . THR E 3 212 ? 86.233  9.776   36.483  1.00 67.36  ? 229 THR A OG1   1 
ATOM 2649  C CG2   . THR E 3 212 ? 87.269  11.561  35.246  1.00 70.13  ? 229 THR A CG2   1 
ATOM 2650  N N     . GLY E 3 213 ? 87.697  7.588   36.133  1.00 62.81  ? 230 GLY A N     1 
ATOM 2651  C CA    . GLY E 3 213 ? 87.871  6.246   36.651  1.00 62.25  ? 230 GLY A CA    1 
ATOM 2652  C C     . GLY E 3 213 ? 89.313  5.764   36.687  1.00 63.00  ? 230 GLY A C     1 
ATOM 2653  O O     . GLY E 3 213 ? 89.997  5.724   35.651  1.00 33.42  ? 230 GLY A O     1 
ATOM 2654  N N     . PRO E 3 214 ? 89.795  5.368   37.881  1.00 44.72  ? 231 PRO A N     1 
ATOM 2655  C CA    . PRO E 3 214 ? 91.144  4.869   38.158  1.00 41.13  ? 231 PRO A CA    1 
ATOM 2656  C C     . PRO E 3 214 ? 91.811  4.098   37.026  1.00 38.23  ? 231 PRO A C     1 
ATOM 2657  O O     . PRO E 3 214 ? 91.363  3.029   36.636  1.00 37.17  ? 231 PRO A O     1 
ATOM 2658  C CB    . PRO E 3 214 ? 90.931  4.002   39.391  1.00 45.81  ? 231 PRO A CB    1 
ATOM 2659  C CG    . PRO E 3 214 ? 89.932  4.802   40.156  1.00 48.35  ? 231 PRO A CG    1 
ATOM 2660  C CD    . PRO E 3 214 ? 88.944  5.245   39.085  1.00 49.63  ? 231 PRO A CD    1 
ATOM 2661  N N     . GLY E 3 215 ? 92.888  4.655   36.499  1.00 13.58  ? 232 GLY A N     1 
ATOM 2662  C CA    . GLY E 3 215 ? 93.615  3.980   35.447  1.00 14.03  ? 232 GLY A CA    1 
ATOM 2663  C C     . GLY E 3 215 ? 92.921  3.948   34.109  1.00 14.06  ? 232 GLY A C     1 
ATOM 2664  O O     . GLY E 3 215 ? 93.427  3.355   33.149  1.00 47.63  ? 232 GLY A O     1 
ATOM 2665  N N     . TRP E 3 216 ? 91.767  4.594   34.029  1.00 39.07  ? 233 TRP A N     1 
ATOM 2666  C CA    . TRP E 3 216 ? 91.024  4.613   32.779  1.00 38.32  ? 233 TRP A CA    1 
ATOM 2667  C C     . TRP E 3 216 ? 90.639  6.023   32.420  1.00 36.05  ? 233 TRP A C     1 
ATOM 2668  O O     . TRP E 3 216 ? 90.193  6.791   33.273  1.00 30.92  ? 233 TRP A O     1 
ATOM 2669  C CB    . TRP E 3 216 ? 89.748  3.763   32.903  1.00 40.71  ? 233 TRP A CB    1 
ATOM 2670  C CG    . TRP E 3 216 ? 88.945  3.657   31.612  1.00 41.31  ? 233 TRP A CG    1 
ATOM 2671  C CD1   . TRP E 3 216 ? 89.369  3.134   30.405  1.00 41.34  ? 233 TRP A CD1   1 
ATOM 2672  C CD2   . TRP E 3 216 ? 87.587  4.075   31.409  1.00 39.16  ? 233 TRP A CD2   1 
ATOM 2673  N NE1   . TRP E 3 216 ? 88.355  3.207   29.476  1.00 38.52  ? 233 TRP A NE1   1 
ATOM 2674  C CE2   . TRP E 3 216 ? 87.253  3.780   30.062  1.00 37.78  ? 233 TRP A CE2   1 
ATOM 2675  C CE3   . TRP E 3 216 ? 86.626  4.678   32.230  1.00 36.95  ? 233 TRP A CE3   1 
ATOM 2676  C CZ2   . TRP E 3 216 ? 85.997  4.062   29.524  1.00 37.06  ? 233 TRP A CZ2   1 
ATOM 2677  C CZ3   . TRP E 3 216 ? 85.377  4.962   31.693  1.00 37.86  ? 233 TRP A CZ3   1 
ATOM 2678  C CH2   . TRP E 3 216 ? 85.076  4.656   30.350  1.00 40.35  ? 233 TRP A CH2   1 
ATOM 2679  N N     . GLU E 3 217 ? 90.805  6.356   31.149  1.00 18.34  ? 234 GLU A N     1 
ATOM 2680  C CA    . GLU E 3 217 ? 90.441  7.671   30.670  1.00 17.01  ? 234 GLU A CA    1 
ATOM 2681  C C     . GLU E 3 217 ? 90.005  7.637   29.204  1.00 15.73  ? 234 GLU A C     1 
ATOM 2682  O O     . GLU E 3 217 ? 90.735  7.149   28.337  1.00 27.78  ? 234 GLU A O     1 
ATOM 2683  C CB    . GLU E 3 217 ? 91.605  8.636   30.919  1.00 39.86  ? 234 GLU A CB    1 
ATOM 2684  C CG    . GLU E 3 217 ? 91.647  9.091   32.391  1.00 40.92  ? 234 GLU A CG    1 
ATOM 2685  C CD    . GLU E 3 217 ? 92.951  9.757   32.803  1.00 38.92  ? 234 GLU A CD    1 
ATOM 2686  O OE1   . GLU E 3 217 ? 92.965  10.434  33.869  1.00 36.84  ? 234 GLU A OE1   1 
ATOM 2687  O OE2   . GLU E 3 217 ? 93.949  9.586   32.065  1.00 37.00  ? 234 GLU A OE2   1 
ATOM 2688  N N     . ALA E 3 218 ? 88.788  8.123   28.947  1.00 40.51  ? 235 ALA A N     1 
ATOM 2689  C CA    . ALA E 3 218 ? 88.246  8.180   27.594  1.00 38.33  ? 235 ALA A CA    1 
ATOM 2690  C C     . ALA E 3 218 ? 87.041  9.095   27.513  1.00 39.81  ? 235 ALA A C     1 
ATOM 2691  O O     . ALA E 3 218 ? 86.479  9.521   28.541  1.00 34.51  ? 235 ALA A O     1 
ATOM 2692  C CB    . ALA E 3 218 ? 87.878  6.804   27.108  1.00 38.01  ? 235 ALA A CB    1 
ATOM 2693  N N     . ARG E 3 219 ? 86.643  9.401   26.284  1.00 30.36  ? 236 ARG A N     1 
ATOM 2694  C CA    . ARG E 3 219 ? 85.504  10.281  26.082  1.00 29.42  ? 236 ARG A CA    1 
ATOM 2695  C C     . ARG E 3 219 ? 84.491  9.651   25.147  1.00 28.60  ? 236 ARG A C     1 
ATOM 2696  O O     . ARG E 3 219 ? 84.858  8.847   24.281  1.00 31.91  ? 236 ARG A O     1 
ATOM 2697  C CB    . ARG E 3 219 ? 85.971  11.612  25.503  1.00 41.24  ? 236 ARG A CB    1 
ATOM 2698  C CG    . ARG E 3 219 ? 87.022  12.321  26.322  1.00 39.63  ? 236 ARG A CG    1 
ATOM 2699  C CD    . ARG E 3 219 ? 87.794  13.245  25.422  1.00 44.25  ? 236 ARG A CD    1 
ATOM 2700  N NE    . ARG E 3 219 ? 88.264  12.521  24.247  1.00 48.00  ? 236 ARG A NE    1 
ATOM 2701  C CZ    . ARG E 3 219 ? 88.809  13.097  23.184  1.00 48.17  ? 236 ARG A CZ    1 
ATOM 2702  N NH1   . ARG E 3 219 ? 88.957  14.416  23.148  1.00 46.48  ? 236 ARG A NH1   1 
ATOM 2703  N NH2   . ARG E 3 219 ? 89.189  12.360  22.146  1.00 43.74  ? 236 ARG A NH2   1 
ATOM 2704  N N     . GLY E 3 220 ? 83.223  10.033  25.328  1.00 21.07  ? 237 GLY A N     1 
ATOM 2705  C CA    . GLY E 3 220 ? 82.135  9.528   24.498  1.00 21.38  ? 237 GLY A CA    1 
ATOM 2706  C C     . GLY E 3 220 ? 82.172  9.989   23.048  1.00 21.75  ? 237 GLY A C     1 
ATOM 2707  O O     . GLY E 3 220 ? 82.316  11.169  22.769  1.00 20.26  ? 237 GLY A O     1 
ATOM 2708  N N     . SER E 3 221 ? 82.047  9.071   22.109  1.00 17.72  ? 238 SER A N     1 
ATOM 2709  C CA    . SER E 3 221 ? 82.077  9.477   20.725  1.00 18.69  ? 238 SER A CA    1 
ATOM 2710  C C     . SER E 3 221 ? 80.753  10.123  20.306  1.00 20.46  ? 238 SER A C     1 
ATOM 2711  O O     . SER E 3 221 ? 79.680  9.573   20.578  1.00 47.51  ? 238 SER A O     1 
ATOM 2712  C CB    . SER E 3 221 ? 82.371  8.272   19.832  1.00 40.89  ? 238 SER A CB    1 
ATOM 2713  O OG    . SER E 3 221 ? 82.312  8.632   18.457  1.00 35.89  ? 238 SER A OG    1 
ATOM 2714  N N     . PHE E 3 222 ? 80.836  11.293  19.664  1.00 40.88  ? 239 PHE A N     1 
ATOM 2715  C CA    . PHE E 3 222 ? 79.667  12.017  19.151  1.00 40.72  ? 239 PHE A CA    1 
ATOM 2716  C C     . PHE E 3 222 ? 80.118  13.224  18.345  1.00 38.60  ? 239 PHE A C     1 
ATOM 2717  O O     . PHE E 3 222 ? 81.168  13.791  18.625  1.00 44.31  ? 239 PHE A O     1 
ATOM 2718  C CB    . PHE E 3 222 ? 78.731  12.477  20.280  1.00 26.04  ? 239 PHE A CB    1 
ATOM 2719  C CG    . PHE E 3 222 ? 79.212  13.678  21.031  1.00 27.10  ? 239 PHE A CG    1 
ATOM 2720  C CD1   . PHE E 3 222 ? 79.921  13.541  22.210  1.00 27.20  ? 239 PHE A CD1   1 
ATOM 2721  C CD2   . PHE E 3 222 ? 78.932  14.956  20.571  1.00 28.48  ? 239 PHE A CD2   1 
ATOM 2722  C CE1   . PHE E 3 222 ? 80.336  14.670  22.919  1.00 26.61  ? 239 PHE A CE1   1 
ATOM 2723  C CE2   . PHE E 3 222 ? 79.340  16.070  21.268  1.00 25.58  ? 239 PHE A CE2   1 
ATOM 2724  C CZ    . PHE E 3 222 ? 80.042  15.930  22.440  1.00 24.46  ? 239 PHE A CZ    1 
ATOM 2725  N N     . SER E 3 223 ? 79.340  13.627  17.347  1.00 19.57  ? 240 SER A N     1 
ATOM 2726  C CA    . SER E 3 223 ? 79.736  14.780  16.542  1.00 22.89  ? 240 SER A CA    1 
ATOM 2727  C C     . SER E 3 223 ? 79.037  16.052  17.013  1.00 24.15  ? 240 SER A C     1 
ATOM 2728  O O     . SER E 3 223 ? 78.304  16.025  17.990  1.00 36.48  ? 240 SER A O     1 
ATOM 2729  C CB    . SER E 3 223 ? 79.454  14.515  15.058  1.00 37.83  ? 240 SER A CB    1 
ATOM 2730  O OG    . SER E 3 223 ? 78.151  14.000  14.852  1.00 43.80  ? 240 SER A OG    1 
ATOM 2731  N N     . GLN E 3 224 ? 79.277  17.172  16.344  1.00 75.23  ? 241 GLN A N     1 
ATOM 2732  C CA    . GLN E 3 224 ? 78.627  18.407  16.753  1.00 72.94  ? 241 GLN A CA    1 
ATOM 2733  C C     . GLN E 3 224 ? 77.124  18.307  16.545  1.00 71.16  ? 241 GLN A C     1 
ATOM 2734  O O     . GLN E 3 224 ? 76.350  18.564  17.469  1.00 27.18  ? 241 GLN A O     1 
ATOM 2735  C CB    . GLN E 3 224 ? 79.183  19.597  15.978  1.00 18.62  ? 241 GLN A CB    1 
ATOM 2736  C CG    . GLN E 3 224 ? 80.631  19.920  16.338  1.00 21.49  ? 241 GLN A CG    1 
ATOM 2737  C CD    . GLN E 3 224 ? 81.052  21.342  15.955  1.00 23.34  ? 241 GLN A CD    1 
ATOM 2738  O OE1   . GLN E 3 224 ? 82.232  21.697  16.060  1.00 21.25  ? 241 GLN A OE1   1 
ATOM 2739  N NE2   . GLN E 3 224 ? 80.089  22.158  15.517  1.00 24.57  ? 241 GLN A NE2   1 
ATOM 2740  N N     . ALA E 3 225 ? 76.724  17.926  15.332  1.00 13.39  ? 242 ALA A N     1 
ATOM 2741  C CA    . ALA E 3 225 ? 75.315  17.771  14.972  1.00 13.39  ? 242 ALA A CA    1 
ATOM 2742  C C     . ALA E 3 225 ? 74.490  17.036  16.034  1.00 13.39  ? 242 ALA A C     1 
ATOM 2743  O O     . ALA E 3 225 ? 73.255  17.064  16.006  1.00 22.71  ? 242 ALA A O     1 
ATOM 2744  C CB    . ALA E 3 225 ? 75.214  17.054  13.647  1.00 23.11  ? 242 ALA A CB    1 
ATOM 2745  N N     . ASP E 3 226 ? 75.185  16.393  16.970  1.00 11.02  ? 243 ASP A N     1 
ATOM 2746  C CA    . ASP E 3 226 ? 74.558  15.645  18.061  1.00 14.58  ? 243 ASP A CA    1 
ATOM 2747  C C     . ASP E 3 226 ? 74.374  16.492  19.325  1.00 18.66  ? 243 ASP A C     1 
ATOM 2748  O O     . ASP E 3 226 ? 73.999  15.980  20.380  1.00 30.48  ? 243 ASP A O     1 
ATOM 2749  C CB    . ASP E 3 226 ? 75.400  14.414  18.415  1.00 32.16  ? 243 ASP A CB    1 
ATOM 2750  C CG    . ASP E 3 226 ? 75.410  13.363  17.321  1.00 30.95  ? 243 ASP A CG    1 
ATOM 2751  O OD1   . ASP E 3 226 ? 76.418  12.636  17.250  1.00 32.59  ? 243 ASP A OD1   1 
ATOM 2752  O OD2   . ASP E 3 226 ? 74.433  13.252  16.552  1.00 29.63  ? 243 ASP A OD2   1 
ATOM 2753  N N     . VAL E 3 227 ? 74.674  17.779  19.231  1.00 29.55  ? 244 VAL A N     1 
ATOM 2754  C CA    . VAL E 3 227 ? 74.477  18.665  20.370  1.00 28.37  ? 244 VAL A CA    1 
ATOM 2755  C C     . VAL E 3 227 ? 73.232  19.457  19.980  1.00 26.69  ? 244 VAL A C     1 
ATOM 2756  O O     . VAL E 3 227 ? 73.285  20.312  19.099  1.00 23.63  ? 244 VAL A O     1 
ATOM 2757  C CB    . VAL E 3 227 ? 75.689  19.640  20.586  1.00 10.55  ? 244 VAL A CB    1 
ATOM 2758  C CG1   . VAL E 3 227 ? 75.424  20.544  21.788  1.00 10.31  ? 244 VAL A CG1   1 
ATOM 2759  C CG2   . VAL E 3 227 ? 76.987  18.854  20.794  1.00 9.36   ? 244 VAL A CG2   1 
ATOM 2760  N N     . HIS E 3 228 ? 72.107  19.151  20.613  1.00 50.10  ? 245 HIS A N     1 
ATOM 2761  C CA    . HIS E 3 228 ? 70.844  19.821  20.311  1.00 47.56  ? 245 HIS A CA    1 
ATOM 2762  C C     . HIS E 3 228 ? 70.707  21.133  21.068  1.00 48.68  ? 245 HIS A C     1 
ATOM 2763  O O     . HIS E 3 228 ? 70.916  21.159  22.283  1.00 20.74  ? 245 HIS A O     1 
ATOM 2764  C CB    . HIS E 3 228 ? 69.685  18.913  20.694  1.00 11.55  ? 245 HIS A CB    1 
ATOM 2765  C CG    . HIS E 3 228 ? 68.343  19.437  20.304  1.00 11.72  ? 245 HIS A CG    1 
ATOM 2766  N ND1   . HIS E 3 228 ? 67.918  19.484  18.996  1.00 9.36   ? 245 HIS A ND1   1 
ATOM 2767  C CD2   . HIS E 3 228 ? 67.318  19.914  21.053  1.00 9.49   ? 245 HIS A CD2   1 
ATOM 2768  C CE1   . HIS E 3 228 ? 66.685  19.959  18.953  1.00 10.77  ? 245 HIS A CE1   1 
ATOM 2769  N NE2   . HIS E 3 228 ? 66.298  20.228  20.188  1.00 9.36   ? 245 HIS A NE2   1 
ATOM 2770  N N     . ARG E 3 229 ? 70.336  22.199  20.353  1.00 2.00   ? 246 ARG A N     1 
ATOM 2771  C CA    . ARG E 3 229 ? 70.160  23.523  20.940  1.00 2.00   ? 246 ARG A CA    1 
ATOM 2772  C C     . ARG E 3 229 ? 71.013  23.658  22.194  1.00 2.00   ? 246 ARG A C     1 
ATOM 2773  O O     . ARG E 3 229 ? 70.537  24.014  23.271  1.00 3.36   ? 246 ARG A O     1 
ATOM 2774  C CB    . ARG E 3 229 ? 68.694  23.744  21.259  1.00 30.14  ? 246 ARG A CB    1 
ATOM 2775  C CG    . ARG E 3 229 ? 67.880  24.122  20.052  1.00 30.95  ? 246 ARG A CG    1 
ATOM 2776  C CD    . ARG E 3 229 ? 68.321  23.354  18.821  1.00 42.31  ? 246 ARG A CD    1 
ATOM 2777  N NE    . ARG E 3 229 ? 67.545  23.734  17.639  1.00 44.96  ? 246 ARG A NE    1 
ATOM 2778  C CZ    . ARG E 3 229 ? 67.381  24.986  17.219  1.00 47.88  ? 246 ARG A CZ    1 
ATOM 2779  N NH1   . ARG E 3 229 ? 67.938  25.996  17.887  1.00 48.27  ? 246 ARG A NH1   1 
ATOM 2780  N NH2   . ARG E 3 229 ? 66.656  25.226  16.132  1.00 46.80  ? 246 ARG A NH2   1 
ATOM 2781  N N     . GLN E 3 230 ? 72.290  23.348  22.013  1.00 11.59  ? 247 GLN A N     1 
ATOM 2782  C CA    . GLN E 3 230 ? 73.282  23.385  23.072  1.00 11.59  ? 247 GLN A CA    1 
ATOM 2783  C C     . GLN E 3 230 ? 72.793  23.092  24.470  1.00 11.59  ? 247 GLN A C     1 
ATOM 2784  O O     . GLN E 3 230 ? 73.309  23.647  25.425  1.00 14.71  ? 247 GLN A O     1 
ATOM 2785  C CB    . GLN E 3 230 ? 74.045  24.717  23.059  1.00 10.66  ? 247 GLN A CB    1 
ATOM 2786  C CG    . GLN E 3 230 ? 73.278  25.949  22.620  1.00 11.48  ? 247 GLN A CG    1 
ATOM 2787  C CD    . GLN E 3 230 ? 74.198  27.013  22.018  1.00 15.07  ? 247 GLN A CD    1 
ATOM 2788  O OE1   . GLN E 3 230 ? 74.137  28.195  22.382  1.00 19.33  ? 247 GLN A OE1   1 
ATOM 2789  N NE2   . GLN E 3 230 ? 75.052  26.591  21.077  1.00 16.41  ? 247 GLN A NE2   1 
ATOM 2790  N N     . VAL E 3 231 ? 71.829  22.191  24.598  1.00 2.00   ? 248 VAL A N     1 
ATOM 2791  C CA    . VAL E 3 231 ? 71.309  21.847  25.909  1.00 2.00   ? 248 VAL A CA    1 
ATOM 2792  C C     . VAL E 3 231 ? 70.996  20.331  25.992  1.00 2.00   ? 248 VAL A C     1 
ATOM 2793  O O     . VAL E 3 231 ? 70.242  19.859  26.854  1.00 2.00   ? 248 VAL A O     1 
ATOM 2794  C CB    . VAL E 3 231 ? 70.080  22.740  26.197  1.00 16.53  ? 248 VAL A CB    1 
ATOM 2795  C CG1   . VAL E 3 231 ? 68.858  22.166  25.555  1.00 18.87  ? 248 VAL A CG1   1 
ATOM 2796  C CG2   . VAL E 3 231 ? 69.903  22.950  27.667  1.00 16.53  ? 248 VAL A CG2   1 
ATOM 2797  N N     . ALA E 3 232 ? 71.622  19.575  25.091  1.00 18.46  ? 249 ALA A N     1 
ATOM 2798  C CA    . ALA E 3 232 ? 71.471  18.122  25.025  1.00 18.30  ? 249 ALA A CA    1 
ATOM 2799  C C     . ALA E 3 232 ? 72.502  17.521  24.082  1.00 18.30  ? 249 ALA A C     1 
ATOM 2800  O O     . ALA E 3 232 ? 72.779  18.052  22.999  1.00 20.16  ? 249 ALA A O     1 
ATOM 2801  C CB    . ALA E 3 232 ? 70.084  17.747  24.562  1.00 20.31  ? 249 ALA A CB    1 
ATOM 2802  N N     . ILE E 3 233 ? 73.070  16.403  24.500  1.00 21.09  ? 250 ILE A N     1 
ATOM 2803  C CA    . ILE E 3 233 ? 74.065  15.744  23.692  1.00 20.43  ? 250 ILE A CA    1 
ATOM 2804  C C     . ILE E 3 233 ? 73.657  14.289  23.587  1.00 21.78  ? 250 ILE A C     1 
ATOM 2805  O O     . ILE E 3 233 ? 73.099  13.732  24.527  1.00 15.75  ? 250 ILE A O     1 
ATOM 2806  C CB    . ILE E 3 233 ? 75.449  15.857  24.349  1.00 16.48  ? 250 ILE A CB    1 
ATOM 2807  C CG1   . ILE E 3 233 ? 75.634  17.256  24.909  1.00 14.04  ? 250 ILE A CG1   1 
ATOM 2808  C CG2   . ILE E 3 233 ? 76.553  15.588  23.326  1.00 14.83  ? 250 ILE A CG2   1 
ATOM 2809  C CD1   . ILE E 3 233 ? 76.953  17.451  25.594  1.00 14.04  ? 250 ILE A CD1   1 
ATOM 2810  N N     . VAL E 3 234 ? 73.914  13.685  22.435  1.00 6.37   ? 251 VAL A N     1 
ATOM 2811  C CA    . VAL E 3 234 ? 73.585  12.287  22.211  1.00 7.71   ? 251 VAL A CA    1 
ATOM 2812  C C     . VAL E 3 234 ? 74.884  11.617  21.814  1.00 9.54   ? 251 VAL A C     1 
ATOM 2813  O O     . VAL E 3 234 ? 75.235  11.557  20.640  1.00 13.17  ? 251 VAL A O     1 
ATOM 2814  C CB    . VAL E 3 234 ? 72.537  12.112  21.083  1.00 29.37  ? 251 VAL A CB    1 
ATOM 2815  C CG1   . VAL E 3 234 ? 72.929  12.924  19.866  1.00 30.09  ? 251 VAL A CG1   1 
ATOM 2816  C CG2   . VAL E 3 234 ? 72.437  10.656  20.704  1.00 33.20  ? 251 VAL A CG2   1 
ATOM 2817  N N     . PHE E 3 235 ? 75.606  11.118  22.804  1.00 63.94  ? 252 PHE A N     1 
ATOM 2818  C CA    . PHE E 3 235 ? 76.884  10.473  22.547  1.00 65.48  ? 252 PHE A CA    1 
ATOM 2819  C C     . PHE E 3 235 ? 76.824  8.966   22.724  1.00 68.83  ? 252 PHE A C     1 
ATOM 2820  O O     . PHE E 3 235 ? 75.854  8.434   23.274  1.00 34.89  ? 252 PHE A O     1 
ATOM 2821  C CB    . PHE E 3 235 ? 77.931  11.036  23.497  1.00 2.00   ? 252 PHE A CB    1 
ATOM 2822  C CG    . PHE E 3 235 ? 77.626  10.805  24.958  1.00 2.00   ? 252 PHE A CG    1 
ATOM 2823  C CD1   . PHE E 3 235 ? 78.322  9.844   25.690  1.00 2.00   ? 252 PHE A CD1   1 
ATOM 2824  C CD2   . PHE E 3 235 ? 76.678  11.564  25.612  1.00 2.00   ? 252 PHE A CD2   1 
ATOM 2825  C CE1   . PHE E 3 235 ? 78.077  9.655   27.061  1.00 2.00   ? 252 PHE A CE1   1 
ATOM 2826  C CE2   . PHE E 3 235 ? 76.438  11.374  26.977  1.00 2.00   ? 252 PHE A CE2   1 
ATOM 2827  C CZ    . PHE E 3 235 ? 77.144  10.410  27.698  1.00 2.00   ? 252 PHE A CZ    1 
ATOM 2828  N N     . ARG E 3 236 ? 77.858  8.277   22.250  1.00 29.25  ? 253 ARG A N     1 
ATOM 2829  C CA    . ARG E 3 236 ? 77.934  6.827   22.407  1.00 30.31  ? 253 ARG A CA    1 
ATOM 2830  C C     . ARG E 3 236 ? 78.992  6.518   23.466  1.00 30.41  ? 253 ARG A C     1 
ATOM 2831  O O     . ARG E 3 236 ? 80.090  7.062   23.438  1.00 65.46  ? 253 ARG A O     1 
ATOM 2832  C CB    . ARG E 3 236 ? 78.262  6.151   21.070  1.00 77.40  ? 253 ARG A CB    1 
ATOM 2833  C CG    . ARG E 3 236 ? 79.631  6.480   20.507  1.00 84.63  ? 253 ARG A CG    1 
ATOM 2834  C CD    . ARG E 3 236 ? 80.745  5.554   21.042  1.00 89.72  ? 253 ARG A CD    1 
ATOM 2835  N NE    . ARG E 3 236 ? 80.585  4.161   20.616  1.00 92.73  ? 253 ARG A NE    1 
ATOM 2836  C CZ    . ARG E 3 236 ? 81.550  3.247   20.665  1.00 92.88  ? 253 ARG A CZ    1 
ATOM 2837  N NH1   . ARG E 3 236 ? 82.751  3.579   21.119  1.00 92.64  ? 253 ARG A NH1   1 
ATOM 2838  N NH2   . ARG E 3 236 ? 81.311  2.002   20.267  1.00 95.17  ? 253 ARG A NH2   1 
ATOM 2839  N N     . THR E 3 237 ? 78.638  5.662   24.413  1.00 26.71  ? 254 THR A N     1 
ATOM 2840  C CA    . THR E 3 237 ? 79.531  5.279   25.501  1.00 25.67  ? 254 THR A CA    1 
ATOM 2841  C C     . THR E 3 237 ? 80.836  4.698   25.006  1.00 28.11  ? 254 THR A C     1 
ATOM 2842  O O     . THR E 3 237 ? 80.852  3.900   24.074  1.00 47.41  ? 254 THR A O     1 
ATOM 2843  C CB    . THR E 3 237 ? 78.869  4.256   26.413  1.00 20.23  ? 254 THR A CB    1 
ATOM 2844  O OG1   . THR E 3 237 ? 78.278  4.939   27.523  1.00 16.19  ? 254 THR A OG1   1 
ATOM 2845  C CG2   . THR E 3 237 ? 79.872  3.246   26.894  1.00 14.71  ? 254 THR A CG2   1 
ATOM 2846  N N     . PRO E 3 238 ? 81.955  5.092   25.638  1.00 46.69  ? 255 PRO A N     1 
ATOM 2847  C CA    . PRO E 3 238 ? 83.314  4.640   25.304  1.00 46.44  ? 255 PRO A CA    1 
ATOM 2848  C C     . PRO E 3 238 ? 83.692  3.270   25.901  1.00 47.16  ? 255 PRO A C     1 
ATOM 2849  O O     . PRO E 3 238 ? 83.369  2.972   27.062  1.00 18.82  ? 255 PRO A O     1 
ATOM 2850  C CB    . PRO E 3 238 ? 84.182  5.760   25.859  1.00 15.75  ? 255 PRO A CB    1 
ATOM 2851  C CG    . PRO E 3 238 ? 83.434  6.125   27.136  1.00 15.75  ? 255 PRO A CG    1 
ATOM 2852  C CD    . PRO E 3 238 ? 81.989  6.160   26.658  1.00 15.75  ? 255 PRO A CD    1 
ATOM 2853  N N     . PRO E 3 239 ? 84.412  2.435   25.118  1.00 20.54  ? 256 PRO A N     1 
ATOM 2854  C CA    . PRO E 3 239 ? 84.861  1.089   25.513  1.00 20.94  ? 256 PRO A CA    1 
ATOM 2855  C C     . PRO E 3 239 ? 85.653  1.116   26.796  1.00 22.37  ? 256 PRO A C     1 
ATOM 2856  O O     . PRO E 3 239 ? 86.657  1.806   26.869  1.00 27.21  ? 256 PRO A O     1 
ATOM 2857  C CB    . PRO E 3 239 ? 85.760  0.654   24.351  1.00 12.94  ? 256 PRO A CB    1 
ATOM 2858  C CG    . PRO E 3 239 ? 85.249  1.440   23.183  1.00 15.53  ? 256 PRO A CG    1 
ATOM 2859  C CD    . PRO E 3 239 ? 84.991  2.802   23.813  1.00 16.12  ? 256 PRO A CD    1 
ATOM 2860  N N     . TYR E 3 240 ? 85.223  0.371   27.809  1.00 47.08  ? 257 TYR A N     1 
ATOM 2861  C CA    . TYR E 3 240 ? 85.994  0.347   29.043  1.00 51.87  ? 257 TYR A CA    1 
ATOM 2862  C C     . TYR E 3 240 ? 87.295  -0.421  28.812  1.00 54.09  ? 257 TYR A C     1 
ATOM 2863  O O     . TYR E 3 240 ? 87.444  -1.145  27.824  1.00 67.07  ? 257 TYR A O     1 
ATOM 2864  C CB    . TYR E 3 240 ? 85.248  -0.321  30.183  1.00 53.09  ? 257 TYR A CB    1 
ATOM 2865  C CG    . TYR E 3 240 ? 86.106  -0.376  31.421  1.00 53.18  ? 257 TYR A CG    1 
ATOM 2866  C CD1   . TYR E 3 240 ? 86.341  0.766   32.176  1.00 54.88  ? 257 TYR A CD1   1 
ATOM 2867  C CD2   . TYR E 3 240 ? 86.740  -1.556  31.800  1.00 53.91  ? 257 TYR A CD2   1 
ATOM 2868  C CE1   . TYR E 3 240 ? 87.181  0.736   33.276  1.00 57.16  ? 257 TYR A CE1   1 
ATOM 2869  C CE2   . TYR E 3 240 ? 87.587  -1.599  32.894  1.00 56.41  ? 257 TYR A CE2   1 
ATOM 2870  C CZ    . TYR E 3 240 ? 87.802  -0.448  33.631  1.00 58.54  ? 257 TYR A CZ    1 
ATOM 2871  O OH    . TYR E 3 240 ? 88.623  -0.481  34.733  1.00 61.51  ? 257 TYR A OH    1 
ATOM 2872  N N     . ALA E 3 241 ? 88.230  -0.259  29.740  1.00 41.61  ? 258 ALA A N     1 
ATOM 2873  C CA    . ALA E 3 241 ? 89.535  -0.906  29.662  1.00 42.39  ? 258 ALA A CA    1 
ATOM 2874  C C     . ALA E 3 241 ? 89.487  -2.427  29.584  1.00 43.49  ? 258 ALA A C     1 
ATOM 2875  O O     . ALA E 3 241 ? 90.298  -3.023  28.875  1.00 79.49  ? 258 ALA A O     1 
ATOM 2876  C CB    . ALA E 3 241 ? 90.383  -0.488  30.857  1.00 81.22  ? 258 ALA A CB    1 
ATOM 2877  N N     . ASP E 3 242 ? 88.556  -3.050  30.321  1.00 49.98  ? 259 ASP A N     1 
ATOM 2878  C CA    . ASP E 3 242 ? 88.424  -4.516  30.337  1.00 47.62  ? 259 ASP A CA    1 
ATOM 2879  C C     . ASP E 3 242 ? 87.303  -5.073  29.456  1.00 44.78  ? 259 ASP A C     1 
ATOM 2880  O O     . ASP E 3 242 ? 86.129  -5.082  29.833  1.00 46.97  ? 259 ASP A O     1 
ATOM 2881  C CB    . ASP E 3 242 ? 88.265  -5.042  31.770  1.00 55.07  ? 259 ASP A CB    1 
ATOM 2882  C CG    . ASP E 3 242 ? 88.855  -6.450  31.946  1.00 55.90  ? 259 ASP A CG    1 
ATOM 2883  O OD1   . ASP E 3 242 ? 88.945  -6.909  33.100  1.00 56.96  ? 259 ASP A OD1   1 
ATOM 2884  O OD2   . ASP E 3 242 ? 89.231  -7.099  30.937  1.00 58.02  ? 259 ASP A OD2   1 
ATOM 2885  N N     . PRO E 3 243 ? 87.677  -5.589  28.278  1.00 53.11  ? 260 PRO A N     1 
ATOM 2886  C CA    . PRO E 3 243 ? 86.773  -6.169  27.275  1.00 53.16  ? 260 PRO A CA    1 
ATOM 2887  C C     . PRO E 3 243 ? 86.015  -7.394  27.777  1.00 51.71  ? 260 PRO A C     1 
ATOM 2888  O O     . PRO E 3 243 ? 85.222  -7.982  27.046  1.00 34.98  ? 260 PRO A O     1 
ATOM 2889  C CB    . PRO E 3 243 ? 87.713  -6.539  26.119  1.00 37.81  ? 260 PRO A CB    1 
ATOM 2890  C CG    . PRO E 3 243 ? 88.993  -5.757  26.401  1.00 38.14  ? 260 PRO A CG    1 
ATOM 2891  C CD    . PRO E 3 243 ? 89.079  -5.816  27.898  1.00 39.68  ? 260 PRO A CD    1 
ATOM 2892  N N     . SER E 3 244 ? 86.279  -7.783  29.017  1.00 88.73  ? 261 SER A N     1 
ATOM 2893  C CA    . SER E 3 244 ? 85.620  -8.940  29.592  1.00 88.29  ? 261 SER A CA    1 
ATOM 2894  C C     . SER E 3 244 ? 85.498  -8.726  31.094  1.00 88.34  ? 261 SER A C     1 
ATOM 2895  O O     . SER E 3 244 ? 86.030  -9.484  31.894  1.00 30.17  ? 261 SER A O     1 
ATOM 2896  C CB    . SER E 3 244 ? 86.419  -10.217 29.269  1.00 38.06  ? 261 SER A CB    1 
ATOM 2897  O OG    . SER E 3 244 ? 86.608  -10.387 27.856  1.00 34.23  ? 261 SER A OG    1 
ATOM 2898  N N     . LEU E 3 245 ? 84.808  -7.657  31.467  1.00 31.08  ? 262 LEU A N     1 
ATOM 2899  C CA    . LEU E 3 245 ? 84.590  -7.339  32.873  1.00 33.11  ? 262 LEU A CA    1 
ATOM 2900  C C     . LEU E 3 245 ? 83.740  -8.450  33.489  1.00 33.72  ? 262 LEU A C     1 
ATOM 2901  O O     . LEU E 3 245 ? 83.267  -9.340  32.773  1.00 68.80  ? 262 LEU A O     1 
ATOM 2902  C CB    . LEU E 3 245 ? 83.879  -5.980  32.996  1.00 72.96  ? 262 LEU A CB    1 
ATOM 2903  C CG    . LEU E 3 245 ? 83.275  -5.536  34.341  1.00 71.77  ? 262 LEU A CG    1 
ATOM 2904  C CD1   . LEU E 3 245 ? 84.354  -5.255  35.370  1.00 71.80  ? 262 LEU A CD1   1 
ATOM 2905  C CD2   . LEU E 3 245 ? 82.439  -4.292  34.114  1.00 72.00  ? 262 LEU A CD2   1 
ATOM 2906  N N     . GLN E 3 246 ? 83.546  -8.404  34.809  1.00 37.44  ? 263 GLN A N     1 
ATOM 2907  C CA    . GLN E 3 246 ? 82.741  -9.417  35.497  1.00 40.59  ? 263 GLN A CA    1 
ATOM 2908  C C     . GLN E 3 246 ? 81.911  -8.915  36.682  1.00 41.58  ? 263 GLN A C     1 
ATOM 2909  O O     . GLN E 3 246 ? 81.406  -9.710  37.480  1.00 100.78 ? 263 GLN A O     1 
ATOM 2910  C CB    . GLN E 3 246 ? 83.628  -10.583 35.959  1.00 91.87  ? 263 GLN A CB    1 
ATOM 2911  C CG    . GLN E 3 246 ? 84.736  -10.221 36.938  1.00 92.81  ? 263 GLN A CG    1 
ATOM 2912  C CD    . GLN E 3 246 ? 85.387  -11.456 37.545  1.00 91.61  ? 263 GLN A CD    1 
ATOM 2913  O OE1   . GLN E 3 246 ? 86.352  -11.361 38.308  1.00 90.74  ? 263 GLN A OE1   1 
ATOM 2914  N NE2   . GLN E 3 246 ? 84.851  -12.627 37.209  1.00 88.95  ? 263 GLN A NE2   1 
ATOM 2915  N N     . ALA E 3 247 ? 81.763  -7.600  36.793  1.00 64.96  ? 264 ALA A N     1 
ATOM 2916  C CA    . ALA E 3 247 ? 80.992  -7.015  37.884  1.00 65.81  ? 264 ALA A CA    1 
ATOM 2917  C C     . ALA E 3 247 ? 80.874  -5.502  37.722  1.00 67.35  ? 264 ALA A C     1 
ATOM 2918  O O     . ALA E 3 247 ? 81.652  -4.874  36.993  1.00 65.14  ? 264 ALA A O     1 
ATOM 2919  C CB    . ALA E 3 247 ? 81.645  -7.352  39.226  1.00 57.23  ? 264 ALA A CB    1 
ATOM 2920  N N     . PRO E 3 248 ? 79.910  -4.891  38.427  1.00 86.12  ? 265 PRO A N     1 
ATOM 2921  C CA    . PRO E 3 248 ? 79.707  -3.445  38.342  1.00 85.78  ? 265 PRO A CA    1 
ATOM 2922  C C     . PRO E 3 248 ? 80.949  -2.656  38.729  1.00 85.43  ? 265 PRO A C     1 
ATOM 2923  O O     . PRO E 3 248 ? 81.440  -2.795  39.844  1.00 49.52  ? 265 PRO A O     1 
ATOM 2924  C CB    . PRO E 3 248 ? 78.567  -3.203  39.330  1.00 34.44  ? 265 PRO A CB    1 
ATOM 2925  C CG    . PRO E 3 248 ? 78.868  -4.188  40.403  1.00 32.87  ? 265 PRO A CG    1 
ATOM 2926  C CD    . PRO E 3 248 ? 79.188  -5.442  39.592  1.00 34.55  ? 265 PRO A CD    1 
ATOM 2927  N N     . VAL E 3 249 ? 81.458  -1.848  37.802  1.00 45.48  ? 266 VAL A N     1 
ATOM 2928  C CA    . VAL E 3 249 ? 82.614  -0.994  38.072  1.00 46.16  ? 266 VAL A CA    1 
ATOM 2929  C C     . VAL E 3 249 ? 82.171  0.455   37.884  1.00 45.94  ? 266 VAL A C     1 
ATOM 2930  O O     . VAL E 3 249 ? 82.508  1.099   36.896  1.00 30.03  ? 266 VAL A O     1 
ATOM 2931  C CB    . VAL E 3 249 ? 83.834  -1.314  37.135  1.00 43.62  ? 266 VAL A CB    1 
ATOM 2932  C CG1   . VAL E 3 249 ? 83.438  -1.227  35.649  1.00 43.54  ? 266 VAL A CG1   1 
ATOM 2933  C CG2   . VAL E 3 249 ? 84.981  -0.351  37.441  1.00 42.16  ? 266 VAL A CG2   1 
ATOM 2934  N N     . ARG E 3 250 ? 81.393  0.954   38.838  1.00 72.75  ? 267 ARG A N     1 
ATOM 2935  C CA    . ARG E 3 250 ? 80.885  2.314   38.763  1.00 72.80  ? 267 ARG A CA    1 
ATOM 2936  C C     . ARG E 3 250 ? 81.990  3.360   38.596  1.00 72.91  ? 267 ARG A C     1 
ATOM 2937  O O     . ARG E 3 250 ? 82.724  3.660   39.538  1.00 49.19  ? 267 ARG A O     1 
ATOM 2938  C CB    . ARG E 3 250 ? 80.026  2.623   39.994  1.00 57.05  ? 267 ARG A CB    1 
ATOM 2939  C CG    . ARG E 3 250 ? 80.609  2.171   41.308  1.00 60.12  ? 267 ARG A CG    1 
ATOM 2940  C CD    . ARG E 3 250 ? 79.775  2.696   42.464  1.00 62.41  ? 267 ARG A CD    1 
ATOM 2941  N NE    . ARG E 3 250 ? 78.436  2.116   42.517  1.00 60.48  ? 267 ARG A NE    1 
ATOM 2942  C CZ    . ARG E 3 250 ? 78.158  0.878   42.926  1.00 59.11  ? 267 ARG A CZ    1 
ATOM 2943  N NH1   . ARG E 3 250 ? 79.125  0.058   43.323  1.00 55.41  ? 267 ARG A NH1   1 
ATOM 2944  N NH2   . ARG E 3 250 ? 76.901  0.462   42.958  1.00 58.21  ? 267 ARG A NH2   1 
ATOM 2945  N N     . VAL E 3 251 ? 82.103  3.887   37.375  1.00 56.41  ? 268 VAL A N     1 
ATOM 2946  C CA    . VAL E 3 251 ? 83.091  4.908   37.034  1.00 52.85  ? 268 VAL A CA    1 
ATOM 2947  C C     . VAL E 3 251 ? 82.403  6.263   37.087  1.00 50.73  ? 268 VAL A C     1 
ATOM 2948  O O     . VAL E 3 251 ? 81.282  6.376   37.592  1.00 30.02  ? 268 VAL A O     1 
ATOM 2949  C CB    . VAL E 3 251 ? 83.672  4.713   35.608  1.00 20.06  ? 268 VAL A CB    1 
ATOM 2950  C CG1   . VAL E 3 251 ? 84.285  3.338   35.470  1.00 22.58  ? 268 VAL A CG1   1 
ATOM 2951  C CG2   . VAL E 3 251 ? 82.594  4.910   34.575  1.00 21.23  ? 268 VAL A CG2   1 
ATOM 2952  N N     . SER E 3 252 ? 83.068  7.300   36.585  1.00 50.79  ? 269 SER A N     1 
ATOM 2953  C CA    . SER E 3 252 ? 82.454  8.621   36.601  1.00 47.76  ? 269 SER A CA    1 
ATOM 2954  C C     . SER E 3 252 ? 82.427  9.317   35.266  1.00 47.25  ? 269 SER A C     1 
ATOM 2955  O O     . SER E 3 252 ? 83.370  9.256   34.473  1.00 44.12  ? 269 SER A O     1 
ATOM 2956  C CB    . SER E 3 252 ? 83.094  9.521   37.649  1.00 54.85  ? 269 SER A CB    1 
ATOM 2957  O OG    . SER E 3 252 ? 82.425  9.341   38.887  1.00 53.56  ? 269 SER A OG    1 
ATOM 2958  N N     . MET E 3 253 ? 81.310  9.988   35.037  1.00 77.43  ? 270 MET A N     1 
ATOM 2959  C CA    . MET E 3 253 ? 81.068  10.686  33.797  1.00 74.26  ? 270 MET A CA    1 
ATOM 2960  C C     . MET E 3 253 ? 80.829  12.164  34.040  1.00 72.11  ? 270 MET A C     1 
ATOM 2961  O O     . MET E 3 253 ? 80.039  12.555  34.907  1.00 23.88  ? 270 MET A O     1 
ATOM 2962  C CB    . MET E 3 253 ? 79.874  10.035  33.094  1.00 31.52  ? 270 MET A CB    1 
ATOM 2963  C CG    . MET E 3 253 ? 79.281  10.793  31.935  1.00 30.64  ? 270 MET A CG    1 
ATOM 2964  S SD    . MET E 3 253 ? 77.962  9.821   31.147  1.00 37.08  ? 270 MET A SD    1 
ATOM 2965  C CE    . MET E 3 253 ? 76.733  9.829   32.515  1.00 34.45  ? 270 MET A CE    1 
ATOM 2966  N N     . GLN E 3 254 ? 81.540  12.986  33.280  1.00 11.85  ? 271 GLN A N     1 
ATOM 2967  C CA    . GLN E 3 254 ? 81.384  14.417  33.420  1.00 11.78  ? 271 GLN A CA    1 
ATOM 2968  C C     . GLN E 3 254 ? 81.674  15.173  32.135  1.00 8.30   ? 271 GLN A C     1 
ATOM 2969  O O     . GLN E 3 254 ? 82.468  14.743  31.306  1.00 11.94  ? 271 GLN A O     1 
ATOM 2970  C CB    . GLN E 3 254 ? 82.266  14.923  34.555  1.00 45.25  ? 271 GLN A CB    1 
ATOM 2971  C CG    . GLN E 3 254 ? 83.742  14.683  34.338  1.00 48.14  ? 271 GLN A CG    1 
ATOM 2972  C CD    . GLN E 3 254 ? 84.501  14.604  35.643  1.00 48.14  ? 271 GLN A CD    1 
ATOM 2973  O OE1   . GLN E 3 254 ? 84.236  15.361  36.590  1.00 48.28  ? 271 GLN A OE1   1 
ATOM 2974  N NE2   . GLN E 3 254 ? 85.458  13.691  35.701  1.00 47.31  ? 271 GLN A NE2   1 
ATOM 2975  N N     . LEU E 3 255 ? 80.973  16.288  31.991  1.00 20.00  ? 272 LEU A N     1 
ATOM 2976  C CA    . LEU E 3 255 ? 81.073  17.195  30.857  1.00 18.78  ? 272 LEU A CA    1 
ATOM 2977  C C     . LEU E 3 255 ? 82.398  17.948  30.990  1.00 19.60  ? 272 LEU A C     1 
ATOM 2978  O O     . LEU E 3 255 ? 82.732  18.432  32.082  1.00 18.89  ? 272 LEU A O     1 
ATOM 2979  C CB    . LEU E 3 255 ? 79.921  18.189  30.956  1.00 2.00   ? 272 LEU A CB    1 
ATOM 2980  C CG    . LEU E 3 255 ? 78.791  18.485  29.971  1.00 2.00   ? 272 LEU A CG    1 
ATOM 2981  C CD1   . LEU E 3 255 ? 78.329  17.283  29.214  1.00 2.00   ? 272 LEU A CD1   1 
ATOM 2982  C CD2   . LEU E 3 255 ? 77.670  19.069  30.780  1.00 2.00   ? 272 LEU A CD2   1 
ATOM 2983  N N     . ARG E 3 256 ? 83.150  18.043  29.894  1.00 8.74   ? 273 ARG A N     1 
ATOM 2984  C CA    . ARG E 3 256 ? 84.429  18.752  29.906  1.00 8.74   ? 273 ARG A CA    1 
ATOM 2985  C C     . ARG E 3 256 ? 84.510  19.784  28.797  1.00 8.74   ? 273 ARG A C     1 
ATOM 2986  O O     . ARG E 3 256 ? 84.040  19.556  27.679  1.00 10.53  ? 273 ARG A O     1 
ATOM 2987  C CB    . ARG E 3 256 ? 85.612  17.781  29.772  1.00 25.89  ? 273 ARG A CB    1 
ATOM 2988  C CG    . ARG E 3 256 ? 86.925  18.462  29.311  1.00 33.76  ? 273 ARG A CG    1 
ATOM 2989  C CD    . ARG E 3 256 ? 88.200  17.772  29.829  1.00 34.96  ? 273 ARG A CD    1 
ATOM 2990  N NE    . ARG E 3 256 ? 89.393  18.127  29.060  1.00 36.84  ? 273 ARG A NE    1 
ATOM 2991  C CZ    . ARG E 3 256 ? 89.536  17.901  27.753  1.00 38.11  ? 273 ARG A CZ    1 
ATOM 2992  N NH1   . ARG E 3 256 ? 88.559  17.325  27.067  1.00 37.29  ? 273 ARG A NH1   1 
ATOM 2993  N NH2   . ARG E 3 256 ? 90.657  18.234  27.128  1.00 36.35  ? 273 ARG A NH2   1 
ATOM 2994  N N     . ARG E 3 257 ? 85.121  20.921  29.120  1.00 17.54  ? 274 ARG A N     1 
ATOM 2995  C CA    . ARG E 3 257 ? 85.289  22.001  28.166  1.00 17.54  ? 274 ARG A CA    1 
ATOM 2996  C C     . ARG E 3 257 ? 86.773  22.187  27.790  1.00 17.54  ? 274 ARG A C     1 
ATOM 2997  O O     . ARG E 3 257 ? 87.553  22.759  28.560  1.00 28.02  ? 274 ARG A O     1 
ATOM 2998  C CB    . ARG E 3 257 ? 84.724  23.286  28.766  1.00 14.68  ? 274 ARG A CB    1 
ATOM 2999  C CG    . ARG E 3 257 ? 84.868  24.511  27.868  1.00 12.15  ? 274 ARG A CG    1 
ATOM 3000  C CD    . ARG E 3 257 ? 84.091  25.679  28.438  1.00 8.93   ? 274 ARG A CD    1 
ATOM 3001  N NE    . ARG E 3 257 ? 84.425  25.925  29.835  1.00 8.93   ? 274 ARG A NE    1 
ATOM 3002  C CZ    . ARG E 3 257 ? 83.629  26.587  30.662  1.00 10.72  ? 274 ARG A CZ    1 
ATOM 3003  N NH1   . ARG E 3 257 ? 82.474  27.040  30.206  1.00 10.89  ? 274 ARG A NH1   1 
ATOM 3004  N NH2   . ARG E 3 257 ? 83.976  26.816  31.926  1.00 15.45  ? 274 ARG A NH2   1 
ATOM 3005  N N     . PRO E 3 258 ? 87.173  21.714  26.591  1.00 15.14  ? 275 PRO A N     1 
ATOM 3006  C CA    . PRO E 3 258 ? 88.555  21.826  26.123  1.00 16.41  ? 275 PRO A CA    1 
ATOM 3007  C C     . PRO E 3 258 ? 89.220  23.171  26.460  1.00 19.03  ? 275 PRO A C     1 
ATOM 3008  O O     . PRO E 3 258 ? 90.150  23.233  27.268  1.00 64.31  ? 275 PRO A O     1 
ATOM 3009  C CB    . PRO E 3 258 ? 88.428  21.595  24.619  1.00 47.89  ? 275 PRO A CB    1 
ATOM 3010  C CG    . PRO E 3 258 ? 87.313  20.649  24.540  1.00 51.41  ? 275 PRO A CG    1 
ATOM 3011  C CD    . PRO E 3 258 ? 86.307  21.232  25.502  1.00 47.77  ? 275 PRO A CD    1 
ATOM 3012  N N     . SER E 3 259 ? 88.737  24.235  25.825  1.00 11.12  ? 276 SER A N     1 
ATOM 3013  C CA    . SER E 3 259 ? 89.268  25.564  26.038  1.00 8.02   ? 276 SER A CA    1 
ATOM 3014  C C     . SER E 3 259 ? 89.558  25.804  27.515  1.00 6.85   ? 276 SER A C     1 
ATOM 3015  O O     . SER E 3 259 ? 90.687  25.706  27.953  1.00 28.71  ? 276 SER A O     1 
ATOM 3016  C CB    . SER E 3 259 ? 88.266  26.593  25.512  1.00 46.96  ? 276 SER A CB    1 
ATOM 3017  O OG    . SER E 3 259 ? 86.984  26.375  26.067  1.00 40.25  ? 276 SER A OG    1 
ATOM 3018  N N     . ASP E 3 260 ? 88.519  26.133  28.259  1.00 14.18  ? 277 ASP A N     1 
ATOM 3019  C CA    . ASP E 3 260 ? 88.609  26.385  29.684  1.00 17.76  ? 277 ASP A CA    1 
ATOM 3020  C C     . ASP E 3 260 ? 89.342  25.286  30.443  1.00 19.76  ? 277 ASP A C     1 
ATOM 3021  O O     . ASP E 3 260 ? 89.904  25.536  31.511  1.00 22.79  ? 277 ASP A O     1 
ATOM 3022  C CB    . ASP E 3 260 ? 87.202  26.485  30.264  1.00 34.27  ? 277 ASP A CB    1 
ATOM 3023  C CG    . ASP E 3 260 ? 86.960  27.783  30.979  1.00 36.75  ? 277 ASP A CG    1 
ATOM 3024  O OD1   . ASP E 3 260 ? 86.349  27.756  32.072  1.00 34.05  ? 277 ASP A OD1   1 
ATOM 3025  O OD2   . ASP E 3 260 ? 87.363  28.839  30.444  1.00 38.73  ? 277 ASP A OD2   1 
ATOM 3026  N N     . ARG E 3 261 ? 89.318  24.068  29.908  1.00 39.40  ? 278 ARG A N     1 
ATOM 3027  C CA    . ARG E 3 261 ? 89.932  22.934  30.597  1.00 44.87  ? 278 ARG A CA    1 
ATOM 3028  C C     . ARG E 3 261 ? 89.090  22.670  31.847  1.00 46.34  ? 278 ARG A C     1 
ATOM 3029  O O     . ARG E 3 261 ? 89.583  22.125  32.834  1.00 58.64  ? 278 ARG A O     1 
ATOM 3030  C CB    . ARG E 3 261 ? 91.368  23.235  31.056  1.00 59.86  ? 278 ARG A CB    1 
ATOM 3031  C CG    . ARG E 3 261 ? 92.459  23.157  29.999  1.00 66.94  ? 278 ARG A CG    1 
ATOM 3032  C CD    . ARG E 3 261 ? 93.820  23.456  30.631  1.00 71.84  ? 278 ARG A CD    1 
ATOM 3033  N NE    . ARG E 3 261 ? 94.896  23.588  29.650  1.00 78.29  ? 278 ARG A NE    1 
ATOM 3034  C CZ    . ARG E 3 261 ? 96.142  23.950  29.953  1.00 80.78  ? 278 ARG A CZ    1 
ATOM 3035  N NH1   . ARG E 3 261 ? 96.475  24.217  31.212  1.00 79.92  ? 278 ARG A NH1   1 
ATOM 3036  N NH2   . ARG E 3 261 ? 97.065  24.042  29.002  1.00 82.08  ? 278 ARG A NH2   1 
ATOM 3037  N N     . GLU E 3 262 ? 87.824  23.077  31.807  1.00 24.32  ? 279 GLU A N     1 
ATOM 3038  C CA    . GLU E 3 262 ? 86.930  22.880  32.942  1.00 24.54  ? 279 GLU A CA    1 
ATOM 3039  C C     . GLU E 3 262 ? 86.157  21.572  32.869  1.00 26.23  ? 279 GLU A C     1 
ATOM 3040  O O     . GLU E 3 262 ? 85.819  21.088  31.786  1.00 45.67  ? 279 GLU A O     1 
ATOM 3041  C CB    . GLU E 3 262 ? 85.962  24.049  33.068  1.00 54.40  ? 279 GLU A CB    1 
ATOM 3042  C CG    . GLU E 3 262 ? 86.610  25.291  33.603  1.00 54.77  ? 279 GLU A CG    1 
ATOM 3043  C CD    . GLU E 3 262 ? 87.121  25.085  35.001  1.00 53.77  ? 279 GLU A CD    1 
ATOM 3044  O OE1   . GLU E 3 262 ? 88.352  25.211  35.212  1.00 53.78  ? 279 GLU A OE1   1 
ATOM 3045  O OE2   . GLU E 3 262 ? 86.286  24.786  35.882  1.00 50.28  ? 279 GLU A OE2   1 
ATOM 3046  N N     . LEU E 3 263 ? 85.879  21.010  34.044  1.00 70.18  ? 280 LEU A N     1 
ATOM 3047  C CA    . LEU E 3 263 ? 85.173  19.736  34.166  1.00 69.00  ? 280 LEU A CA    1 
ATOM 3048  C C     . LEU E 3 263 ? 83.901  19.837  34.998  1.00 67.57  ? 280 LEU A C     1 
ATOM 3049  O O     . LEU E 3 263 ? 83.929  20.277  36.141  1.00 31.31  ? 280 LEU A O     1 
ATOM 3050  C CB    . LEU E 3 263 ? 86.112  18.681  34.789  1.00 15.13  ? 280 LEU A CB    1 
ATOM 3051  C CG    . LEU E 3 263 ? 87.075  17.918  33.873  1.00 14.02  ? 280 LEU A CG    1 
ATOM 3052  C CD1   . LEU E 3 263 ? 86.303  16.954  32.991  1.00 14.89  ? 280 LEU A CD1   1 
ATOM 3053  C CD2   . LEU E 3 263 ? 87.849  18.887  33.021  1.00 15.34  ? 280 LEU A CD2   1 
ATOM 3054  N N     . SER E 3 264 ? 82.787  19.413  34.420  1.00 30.16  ? 281 SER A N     1 
ATOM 3055  C CA    . SER E 3 264 ? 81.511  19.449  35.119  1.00 29.00  ? 281 SER A CA    1 
ATOM 3056  C C     . SER E 3 264 ? 81.563  18.540  36.339  1.00 28.26  ? 281 SER A C     1 
ATOM 3057  O O     . SER E 3 264 ? 82.480  17.724  36.471  1.00 41.82  ? 281 SER A O     1 
ATOM 3058  C CB    . SER E 3 264 ? 80.400  18.963  34.198  1.00 53.29  ? 281 SER A CB    1 
ATOM 3059  O OG    . SER E 3 264 ? 80.554  17.582  33.926  1.00 56.29  ? 281 SER A OG    1 
ATOM 3060  N N     . GLU E 3 265 ? 80.571  18.675  37.221  1.00 41.30  ? 282 GLU A N     1 
ATOM 3061  C CA    . GLU E 3 265 ? 80.518  17.831  38.405  1.00 41.28  ? 282 GLU A CA    1 
ATOM 3062  C C     . GLU E 3 265 ? 80.555  16.394  37.919  1.00 42.03  ? 282 GLU A C     1 
ATOM 3063  O O     . GLU E 3 265 ? 80.419  16.119  36.725  1.00 43.59  ? 282 GLU A O     1 
ATOM 3064  C CB    . GLU E 3 265 ? 79.235  18.069  39.206  1.00 52.78  ? 282 GLU A CB    1 
ATOM 3065  C CG    . GLU E 3 265 ? 79.230  19.341  40.065  1.00 54.14  ? 282 GLU A CG    1 
ATOM 3066  C CD    . GLU E 3 265 ? 79.518  19.081  41.538  1.00 53.49  ? 282 GLU A CD    1 
ATOM 3067  O OE1   . GLU E 3 265 ? 79.620  20.061  42.313  1.00 54.58  ? 282 GLU A OE1   1 
ATOM 3068  O OE2   . GLU E 3 265 ? 79.636  17.896  41.918  1.00 47.90  ? 282 GLU A OE2   1 
ATOM 3069  N N     . PRO E 3 266 ? 80.750  15.451  38.837  1.00 58.52  ? 283 PRO A N     1 
ATOM 3070  C CA    . PRO E 3 266 ? 80.800  14.051  38.426  1.00 60.05  ? 283 PRO A CA    1 
ATOM 3071  C C     . PRO E 3 266 ? 79.436  13.378  38.497  1.00 61.39  ? 283 PRO A C     1 
ATOM 3072  O O     . PRO E 3 266 ? 78.600  13.730  39.334  1.00 70.38  ? 283 PRO A O     1 
ATOM 3073  C CB    . PRO E 3 266 ? 81.764  13.458  39.430  1.00 73.56  ? 283 PRO A CB    1 
ATOM 3074  C CG    . PRO E 3 266 ? 81.309  14.144  40.696  1.00 73.19  ? 283 PRO A CG    1 
ATOM 3075  C CD    . PRO E 3 266 ? 81.138  15.594  40.252  1.00 73.32  ? 283 PRO A CD    1 
ATOM 3076  N N     . MET E 3 267 ? 79.225  12.414  37.608  1.00 82.40  ? 284 MET A N     1 
ATOM 3077  C CA    . MET E 3 267 ? 77.993  11.634  37.574  1.00 82.94  ? 284 MET A CA    1 
ATOM 3078  C C     . MET E 3 267 ? 78.450  10.192  37.355  1.00 82.65  ? 284 MET A C     1 
ATOM 3079  O O     . MET E 3 267 ? 79.347  9.942   36.545  1.00 37.94  ? 284 MET A O     1 
ATOM 3080  C CB    . MET E 3 267 ? 77.080  12.108  36.432  1.00 43.98  ? 284 MET A CB    1 
ATOM 3081  C CG    . MET E 3 267 ? 75.678  11.489  36.438  1.00 40.95  ? 284 MET A CG    1 
ATOM 3082  S SD    . MET E 3 267 ? 74.418  12.552  35.672  1.00 38.70  ? 284 MET A SD    1 
ATOM 3083  C CE    . MET E 3 267 ? 73.611  13.297  37.100  1.00 41.18  ? 284 MET A CE    1 
ATOM 3084  N N     . GLU E 3 268 ? 77.867  9.251   38.096  1.00 38.18  ? 285 GLU A N     1 
ATOM 3085  C CA    . GLU E 3 268 ? 78.261  7.851   37.957  1.00 37.94  ? 285 GLU A CA    1 
ATOM 3086  C C     . GLU E 3 268 ? 77.596  7.107   36.803  1.00 36.27  ? 285 GLU A C     1 
ATOM 3087  O O     . GLU E 3 268 ? 76.434  7.334   36.468  1.00 83.41  ? 285 GLU A O     1 
ATOM 3088  C CB    . GLU E 3 268 ? 78.029  7.081   39.260  1.00 68.48  ? 285 GLU A CB    1 
ATOM 3089  C CG    . GLU E 3 268 ? 76.710  7.368   39.934  1.00 75.74  ? 285 GLU A CG    1 
ATOM 3090  C CD    . GLU E 3 268 ? 76.686  8.739   40.556  1.00 78.81  ? 285 GLU A CD    1 
ATOM 3091  O OE1   . GLU E 3 268 ? 75.631  9.133   41.093  1.00 79.65  ? 285 GLU A OE1   1 
ATOM 3092  O OE2   . GLU E 3 268 ? 77.731  9.422   40.510  1.00 81.28  ? 285 GLU A OE2   1 
ATOM 3093  N N     . PHE E 3 269 ? 78.371  6.219   36.194  1.00 23.82  ? 286 PHE A N     1 
ATOM 3094  C CA    . PHE E 3 269 ? 77.917  5.401   35.088  1.00 21.49  ? 286 PHE A CA    1 
ATOM 3095  C C     . PHE E 3 269 ? 78.461  3.993   35.313  1.00 22.02  ? 286 PHE A C     1 
ATOM 3096  O O     . PHE E 3 269 ? 79.626  3.713   35.030  1.00 35.50  ? 286 PHE A O     1 
ATOM 3097  C CB    . PHE E 3 269 ? 78.439  5.951   33.776  1.00 18.58  ? 286 PHE A CB    1 
ATOM 3098  C CG    . PHE E 3 269 ? 78.228  5.032   32.599  1.00 19.27  ? 286 PHE A CG    1 
ATOM 3099  C CD1   . PHE E 3 269 ? 79.274  4.268   32.097  1.00 16.25  ? 286 PHE A CD1   1 
ATOM 3100  C CD2   . PHE E 3 269 ? 77.007  4.996   31.938  1.00 21.48  ? 286 PHE A CD2   1 
ATOM 3101  C CE1   . PHE E 3 269 ? 79.104  3.500   30.954  1.00 17.08  ? 286 PHE A CE1   1 
ATOM 3102  C CE2   . PHE E 3 269 ? 76.834  4.226   30.793  1.00 19.72  ? 286 PHE A CE2   1 
ATOM 3103  C CZ    . PHE E 3 269 ? 77.881  3.483   30.301  1.00 17.34  ? 286 PHE A CZ    1 
ATOM 3104  N N     . GLN E 3 270 ? 77.607  3.108   35.827  1.00 15.18  ? 287 GLN A N     1 
ATOM 3105  C CA    . GLN E 3 270 ? 77.996  1.733   36.104  1.00 15.18  ? 287 GLN A CA    1 
ATOM 3106  C C     . GLN E 3 270 ? 78.262  0.896   34.861  1.00 15.18  ? 287 GLN A C     1 
ATOM 3107  O O     . GLN E 3 270 ? 77.383  0.670   34.035  1.00 69.65  ? 287 GLN A O     1 
ATOM 3108  C CB    . GLN E 3 270 ? 76.933  1.037   36.948  1.00 66.96  ? 287 GLN A CB    1 
ATOM 3109  C CG    . GLN E 3 270 ? 76.820  1.545   38.372  1.00 70.64  ? 287 GLN A CG    1 
ATOM 3110  C CD    . GLN E 3 270 ? 75.925  0.657   39.226  1.00 75.26  ? 287 GLN A CD    1 
ATOM 3111  O OE1   . GLN E 3 270 ? 76.219  -0.519  39.440  1.00 77.63  ? 287 GLN A OE1   1 
ATOM 3112  N NE2   . GLN E 3 270 ? 74.822  1.217   39.711  1.00 74.78  ? 287 GLN A NE2   1 
ATOM 3113  N N     . TYR E 3 271 ? 79.495  0.438   34.743  1.00 60.40  ? 288 TYR A N     1 
ATOM 3114  C CA    . TYR E 3 271 ? 79.901  -0.390  33.627  1.00 62.20  ? 288 TYR A CA    1 
ATOM 3115  C C     . TYR E 3 271 ? 79.678  -1.862  34.000  1.00 63.44  ? 288 TYR A C     1 
ATOM 3116  O O     . TYR E 3 271 ? 80.401  -2.431  34.828  1.00 74.70  ? 288 TYR A O     1 
ATOM 3117  C CB    . TYR E 3 271 ? 81.378  -0.125  33.320  1.00 63.18  ? 288 TYR A CB    1 
ATOM 3118  C CG    . TYR E 3 271 ? 81.630  0.918   32.249  1.00 67.00  ? 288 TYR A CG    1 
ATOM 3119  C CD1   . TYR E 3 271 ? 81.451  0.610   30.902  1.00 68.10  ? 288 TYR A CD1   1 
ATOM 3120  C CD2   . TYR E 3 271 ? 82.077  2.201   32.576  1.00 68.52  ? 288 TYR A CD2   1 
ATOM 3121  C CE1   . TYR E 3 271 ? 81.720  1.543   29.903  1.00 69.55  ? 288 TYR A CE1   1 
ATOM 3122  C CE2   . TYR E 3 271 ? 82.347  3.145   31.582  1.00 69.10  ? 288 TYR A CE2   1 
ATOM 3123  C CZ    . TYR E 3 271 ? 82.165  2.804   30.246  1.00 70.25  ? 288 TYR A CZ    1 
ATOM 3124  O OH    . TYR E 3 271 ? 82.438  3.710   29.245  1.00 69.36  ? 288 TYR A OH    1 
ATOM 3125  N N     . LEU E 3 272 ? 78.669  -2.474  33.397  1.00 65.62  ? 289 LEU A N     1 
ATOM 3126  C CA    . LEU E 3 272 ? 78.376  -3.863  33.687  1.00 63.72  ? 289 LEU A CA    1 
ATOM 3127  C C     . LEU E 3 272 ? 79.133  -4.777  32.745  1.00 65.38  ? 289 LEU A C     1 
ATOM 3128  O O     . LEU E 3 272 ? 79.770  -4.329  31.776  1.00 36.39  ? 289 LEU A O     1 
ATOM 3129  C CB    . LEU E 3 272 ? 76.877  -4.106  33.583  1.00 15.51  ? 289 LEU A CB    1 
ATOM 3130  C CG    . LEU E 3 272 ? 75.974  -3.509  34.664  1.00 13.89  ? 289 LEU A CG    1 
ATOM 3131  C CD1   . LEU E 3 272 ? 76.577  -2.263  35.312  1.00 11.41  ? 289 LEU A CD1   1 
ATOM 3132  C CD2   . LEU E 3 272 ? 74.646  -3.185  34.011  1.00 14.28  ? 289 LEU A CD2   1 
ATOM 3133  N N     . PRO E 3 273 ? 79.096  -6.081  33.031  1.00 73.61  ? 290 PRO A N     1 
ATOM 3134  C CA    . PRO E 3 273 ? 79.803  -7.030  32.170  1.00 73.59  ? 290 PRO A CA    1 
ATOM 3135  C C     . PRO E 3 273 ? 79.046  -7.559  30.948  1.00 74.08  ? 290 PRO A C     1 
ATOM 3136  O O     . PRO E 3 273 ? 77.835  -7.781  30.988  1.00 52.45  ? 290 PRO A O     1 
ATOM 3137  C CB    . PRO E 3 273 ? 80.187  -8.151  33.147  1.00 36.47  ? 290 PRO A CB    1 
ATOM 3138  C CG    . PRO E 3 273 ? 79.052  -8.153  34.104  1.00 37.43  ? 290 PRO A CG    1 
ATOM 3139  C CD    . PRO E 3 273 ? 78.797  -6.680  34.348  1.00 36.87  ? 290 PRO A CD    1 
ATOM 3140  N N     . ASP E 3 274 ? 79.783  -7.718  29.854  1.00 14.55  ? 291 ASP A N     1 
ATOM 3141  C CA    . ASP E 3 274 ? 79.269  -8.309  28.624  1.00 16.91  ? 291 ASP A CA    1 
ATOM 3142  C C     . ASP E 3 274 ? 78.029  -7.693  28.010  1.00 16.96  ? 291 ASP A C     1 
ATOM 3143  O O     . ASP E 3 274 ? 78.013  -7.484  26.776  1.00 24.66  ? 291 ASP A O     1 
ATOM 3144  C CB    . ASP E 3 274 ? 79.001  -9.799  28.862  1.00 60.69  ? 291 ASP A CB    1 
ATOM 3145  C CG    . ASP E 3 274 ? 80.203  -10.528 29.466  1.00 63.03  ? 291 ASP A CG    1 
ATOM 3146  O OD1   . ASP E 3 274 ? 80.664  -10.158 30.579  1.00 62.40  ? 291 ASP A OD1   1 
ATOM 3147  O OD2   . ASP E 3 274 ? 80.682  -11.484 28.817  1.00 63.36  ? 291 ASP A OD2   1 
ATOM 3148  O OXT   . ASP E 3 274 ? 77.068  -7.478  28.767  1.00 58.95  ? 291 ASP A OXT   1 
ATOM 3149  N N     . GLY F 4 2   ? 33.313  49.157  -9.442  1.00 86.22  ? 39  GLY B N     1 
ATOM 3150  C CA    . GLY F 4 2   ? 32.123  48.255  -9.352  1.00 87.16  ? 39  GLY B CA    1 
ATOM 3151  C C     . GLY F 4 2   ? 32.412  46.959  -8.617  1.00 86.01  ? 39  GLY B C     1 
ATOM 3152  O O     . GLY F 4 2   ? 31.855  46.716  -7.545  1.00 44.86  ? 39  GLY B O     1 
ATOM 3153  N N     . PRO F 4 3   ? 33.295  46.116  -9.170  1.00 33.22  ? 40  PRO B N     1 
ATOM 3154  C CA    . PRO F 4 3   ? 33.725  44.814  -8.639  1.00 32.04  ? 40  PRO B CA    1 
ATOM 3155  C C     . PRO F 4 3   ? 34.267  44.771  -7.200  1.00 31.33  ? 40  PRO B C     1 
ATOM 3156  O O     . PRO F 4 3   ? 33.950  45.617  -6.358  1.00 36.04  ? 40  PRO B O     1 
ATOM 3157  C CB    . PRO F 4 3   ? 34.788  44.372  -9.639  1.00 55.36  ? 40  PRO B CB    1 
ATOM 3158  C CG    . PRO F 4 3   ? 35.368  45.689  -10.108 1.00 55.22  ? 40  PRO B CG    1 
ATOM 3159  C CD    . PRO F 4 3   ? 34.117  46.497  -10.331 1.00 55.00  ? 40  PRO B CD    1 
ATOM 3160  N N     . TYR F 4 4   ? 35.104  43.771  -6.941  1.00 60.39  ? 41  TYR B N     1 
ATOM 3161  C CA    . TYR F 4 4   ? 35.677  43.561  -5.625  1.00 60.29  ? 41  TYR B CA    1 
ATOM 3162  C C     . TYR F 4 4   ? 37.017  42.872  -5.734  1.00 60.31  ? 41  TYR B C     1 
ATOM 3163  O O     . TYR F 4 4   ? 37.459  42.517  -6.824  1.00 46.44  ? 41  TYR B O     1 
ATOM 3164  C CB    . TYR F 4 4   ? 34.753  42.672  -4.808  1.00 39.54  ? 41  TYR B CB    1 
ATOM 3165  C CG    . TYR F 4 4   ? 34.309  41.456  -5.579  1.00 42.93  ? 41  TYR B CG    1 
ATOM 3166  C CD1   . TYR F 4 4   ? 32.960  41.248  -5.872  1.00 45.54  ? 41  TYR B CD1   1 
ATOM 3167  C CD2   . TYR F 4 4   ? 35.238  40.543  -6.072  1.00 43.77  ? 41  TYR B CD2   1 
ATOM 3168  C CE1   . TYR F 4 4   ? 32.548  40.164  -6.642  1.00 46.20  ? 41  TYR B CE1   1 
ATOM 3169  C CE2   . TYR F 4 4   ? 34.841  39.453  -6.842  1.00 45.00  ? 41  TYR B CE2   1 
ATOM 3170  C CZ    . TYR F 4 4   ? 33.490  39.269  -7.127  1.00 47.49  ? 41  TYR B CZ    1 
ATOM 3171  O OH    . TYR F 4 4   ? 33.085  38.198  -7.897  1.00 50.17  ? 41  TYR B OH    1 
ATOM 3172  N N     . LEU F 4 5   ? 37.638  42.664  -4.577  1.00 28.22  ? 42  LEU B N     1 
ATOM 3173  C CA    . LEU F 4 5   ? 38.924  41.995  -4.478  1.00 27.16  ? 42  LEU B CA    1 
ATOM 3174  C C     . LEU F 4 5   ? 38.680  40.543  -4.059  1.00 27.15  ? 42  LEU B C     1 
ATOM 3175  O O     . LEU F 4 5   ? 37.585  40.185  -3.630  1.00 27.71  ? 42  LEU B O     1 
ATOM 3176  C CB    . LEU F 4 5   ? 39.785  42.691  -3.422  1.00 23.15  ? 42  LEU B CB    1 
ATOM 3177  C CG    . LEU F 4 5   ? 40.875  43.668  -3.847  1.00 22.04  ? 42  LEU B CG    1 
ATOM 3178  C CD1   . LEU F 4 5   ? 41.317  44.506  -2.652  1.00 20.82  ? 42  LEU B CD1   1 
ATOM 3179  C CD2   . LEU F 4 5   ? 42.044  42.894  -4.422  1.00 20.61  ? 42  LEU B CD2   1 
ATOM 3180  N N     . GLN F 4 6   ? 39.697  39.705  -4.192  1.00 29.85  ? 43  GLN B N     1 
ATOM 3181  C CA    . GLN F 4 6   ? 39.570  38.321  -3.784  1.00 32.78  ? 43  GLN B CA    1 
ATOM 3182  C C     . GLN F 4 6   ? 40.930  37.869  -3.251  1.00 33.46  ? 43  GLN B C     1 
ATOM 3183  O O     . GLN F 4 6   ? 41.951  37.926  -3.957  1.00 39.66  ? 43  GLN B O     1 
ATOM 3184  C CB    . GLN F 4 6   ? 39.107  37.456  -4.962  1.00 54.17  ? 43  GLN B CB    1 
ATOM 3185  C CG    . GLN F 4 6   ? 38.587  36.053  -4.579  1.00 59.48  ? 43  GLN B CG    1 
ATOM 3186  C CD    . GLN F 4 6   ? 37.477  36.064  -3.505  1.00 62.91  ? 43  GLN B CD    1 
ATOM 3187  O OE1   . GLN F 4 6   ? 37.741  35.814  -2.321  1.00 65.34  ? 43  GLN B OE1   1 
ATOM 3188  N NE2   . GLN F 4 6   ? 36.238  36.353  -3.921  1.00 61.91  ? 43  GLN B NE2   1 
ATOM 3189  N N     . ILE F 4 7   ? 40.936  37.442  -1.990  1.00 77.18  ? 44  ILE B N     1 
ATOM 3190  C CA    . ILE F 4 7   ? 42.151  36.988  -1.326  1.00 75.62  ? 44  ILE B CA    1 
ATOM 3191  C C     . ILE F 4 7   ? 42.712  35.708  -1.914  1.00 74.30  ? 44  ILE B C     1 
ATOM 3192  O O     . ILE F 4 7   ? 43.662  35.142  -1.350  1.00 47.21  ? 44  ILE B O     1 
ATOM 3193  C CB    . ILE F 4 7   ? 41.922  36.753  0.178   1.00 47.13  ? 44  ILE B CB    1 
ATOM 3194  C CG1   . ILE F 4 7   ? 40.447  36.411  0.439   1.00 47.08  ? 44  ILE B CG1   1 
ATOM 3195  C CG2   . ILE F 4 7   ? 42.388  37.964  0.967   1.00 43.76  ? 44  ILE B CG2   1 
ATOM 3196  C CD1   . ILE F 4 7   ? 39.965  35.119  -0.226  1.00 48.50  ? 44  ILE B CD1   1 
ATOM 3197  N N     . LEU F 4 8   ? 42.118  35.263  -3.030  1.00 27.92  ? 45  LEU B N     1 
ATOM 3198  C CA    . LEU F 4 8   ? 42.528  34.050  -3.750  1.00 21.90  ? 45  LEU B CA    1 
ATOM 3199  C C     . LEU F 4 8   ? 43.361  33.096  -2.907  1.00 21.54  ? 45  LEU B C     1 
ATOM 3200  O O     . LEU F 4 8   ? 42.836  32.124  -2.364  1.00 44.41  ? 45  LEU B O     1 
ATOM 3201  C CB    . LEU F 4 8   ? 43.302  34.430  -5.015  1.00 38.78  ? 45  LEU B CB    1 
ATOM 3202  C CG    . LEU F 4 8   ? 42.649  34.034  -6.347  1.00 35.34  ? 45  LEU B CG    1 
ATOM 3203  C CD1   . LEU F 4 8   ? 41.185  34.509  -6.407  1.00 31.05  ? 45  LEU B CD1   1 
ATOM 3204  C CD2   . LEU F 4 8   ? 43.469  34.615  -7.481  1.00 30.13  ? 45  LEU B CD2   1 
ATOM 3205  N N     . GLU F 4 9   ? 44.656  33.384  -2.794  1.00 62.07  ? 46  GLU B N     1 
ATOM 3206  C CA    . GLU F 4 9   ? 45.569  32.564  -1.998  1.00 63.44  ? 46  GLU B CA    1 
ATOM 3207  C C     . GLU F 4 9   ? 46.195  33.368  -0.850  1.00 60.70  ? 46  GLU B C     1 
ATOM 3208  O O     . GLU F 4 9   ? 47.154  34.119  -1.052  1.00 35.05  ? 46  GLU B O     1 
ATOM 3209  C CB    . GLU F 4 9   ? 46.678  32.001  -2.880  1.00 29.71  ? 46  GLU B CB    1 
ATOM 3210  C CG    . GLU F 4 9   ? 47.642  31.090  -2.157  1.00 35.35  ? 46  GLU B CG    1 
ATOM 3211  C CD    . GLU F 4 9   ? 48.795  30.640  -3.038  1.00 41.04  ? 46  GLU B CD    1 
ATOM 3212  O OE1   . GLU F 4 9   ? 49.556  29.749  -2.598  1.00 42.73  ? 46  GLU B OE1   1 
ATOM 3213  O OE2   . GLU F 4 9   ? 48.943  31.179  -4.163  1.00 42.43  ? 46  GLU B OE2   1 
ATOM 3214  N N     . GLN F 4 10  ? 45.652  33.200  0.353   1.00 6.47   ? 47  GLN B N     1 
ATOM 3215  C CA    . GLN F 4 10  ? 46.149  33.900  1.525   1.00 5.69   ? 47  GLN B CA    1 
ATOM 3216  C C     . GLN F 4 10  ? 47.569  33.462  1.855   1.00 5.69   ? 47  GLN B C     1 
ATOM 3217  O O     . GLN F 4 10  ? 48.164  32.665  1.136   1.00 27.12  ? 47  GLN B O     1 
ATOM 3218  C CB    . GLN F 4 10  ? 45.244  33.633  2.717   1.00 37.56  ? 47  GLN B CB    1 
ATOM 3219  C CG    . GLN F 4 10  ? 43.800  33.930  2.449   1.00 31.48  ? 47  GLN B CG    1 
ATOM 3220  C CD    . GLN F 4 10  ? 43.141  34.639  3.606   1.00 28.83  ? 47  GLN B CD    1 
ATOM 3221  O OE1   . GLN F 4 10  ? 41.920  34.595  3.769   1.00 27.48  ? 47  GLN B OE1   1 
ATOM 3222  N NE2   . GLN F 4 10  ? 43.944  35.317  4.411   1.00 27.18  ? 47  GLN B NE2   1 
ATOM 3223  N N     . PRO F 4 11  ? 48.144  34.021  2.942   1.00 79.82  ? 48  PRO B N     1 
ATOM 3224  C CA    . PRO F 4 11  ? 49.500  33.708  3.412   1.00 81.17  ? 48  PRO B CA    1 
ATOM 3225  C C     . PRO F 4 11  ? 49.483  32.456  4.291   1.00 82.30  ? 48  PRO B C     1 
ATOM 3226  O O     . PRO F 4 11  ? 48.444  32.139  4.883   1.00 31.42  ? 48  PRO B O     1 
ATOM 3227  C CB    . PRO F 4 11  ? 49.877  34.959  4.186   1.00 19.24  ? 48  PRO B CB    1 
ATOM 3228  C CG    . PRO F 4 11  ? 48.564  35.351  4.790   1.00 18.18  ? 48  PRO B CG    1 
ATOM 3229  C CD    . PRO F 4 11  ? 47.623  35.215  3.636   1.00 15.55  ? 48  PRO B CD    1 
ATOM 3230  N N     . LYS F 4 12  ? 50.625  31.767  4.390   1.00 37.38  ? 49  LYS B N     1 
ATOM 3231  C CA    . LYS F 4 12  ? 50.722  30.518  5.155   1.00 38.30  ? 49  LYS B CA    1 
ATOM 3232  C C     . LYS F 4 12  ? 50.254  30.605  6.606   1.00 36.98  ? 49  LYS B C     1 
ATOM 3233  O O     . LYS F 4 12  ? 49.965  29.588  7.222   1.00 47.94  ? 49  LYS B O     1 
ATOM 3234  C CB    . LYS F 4 12  ? 52.148  29.954  5.089   1.00 40.16  ? 49  LYS B CB    1 
ATOM 3235  C CG    . LYS F 4 12  ? 52.307  28.565  5.711   1.00 39.71  ? 49  LYS B CG    1 
ATOM 3236  C CD    . LYS F 4 12  ? 52.990  27.572  4.762   1.00 42.84  ? 49  LYS B CD    1 
ATOM 3237  C CE    . LYS F 4 12  ? 54.432  27.953  4.387   1.00 44.45  ? 49  LYS B CE    1 
ATOM 3238  N NZ    . LYS F 4 12  ? 55.125  26.916  3.535   1.00 35.17  ? 49  LYS B NZ    1 
ATOM 3239  N N     . GLN F 4 13  ? 50.177  31.813  7.148   1.00 13.39  ? 50  GLN B N     1 
ATOM 3240  C CA    . GLN F 4 13  ? 49.687  32.031  8.516   1.00 12.81  ? 50  GLN B CA    1 
ATOM 3241  C C     . GLN F 4 13  ? 50.541  31.590  9.705   1.00 8.50   ? 50  GLN B C     1 
ATOM 3242  O O     . GLN F 4 13  ? 50.323  32.068  10.822  1.00 32.50  ? 50  GLN B O     1 
ATOM 3243  C CB    . GLN F 4 13  ? 48.277  31.452  8.681   1.00 34.41  ? 50  GLN B CB    1 
ATOM 3244  C CG    . GLN F 4 13  ? 47.684  31.689  10.064  1.00 38.27  ? 50  GLN B CG    1 
ATOM 3245  C CD    . GLN F 4 13  ? 46.168  31.787  10.059  1.00 42.17  ? 50  GLN B CD    1 
ATOM 3246  O OE1   . GLN F 4 13  ? 45.599  32.629  9.378   1.00 41.95  ? 50  GLN B OE1   1 
ATOM 3247  N NE2   . GLN F 4 13  ? 45.513  30.930  10.827  1.00 43.83  ? 50  GLN B NE2   1 
ATOM 3248  N N     . ARG F 4 14  ? 51.494  30.687  9.486   1.00 16.75  ? 51  ARG B N     1 
ATOM 3249  C CA    . ARG F 4 14  ? 52.378  30.218  10.554  1.00 14.56  ? 51  ARG B CA    1 
ATOM 3250  C C     . ARG F 4 14  ? 53.633  29.724  9.882   1.00 13.82  ? 51  ARG B C     1 
ATOM 3251  O O     . ARG F 4 14  ? 53.589  29.290  8.739   1.00 10.44  ? 51  ARG B O     1 
ATOM 3252  C CB    . ARG F 4 14  ? 51.790  29.037  11.339  1.00 10.35  ? 51  ARG B CB    1 
ATOM 3253  C CG    . ARG F 4 14  ? 50.453  29.249  12.009  1.00 10.35  ? 51  ARG B CG    1 
ATOM 3254  C CD    . ARG F 4 14  ? 50.566  29.336  13.507  1.00 10.35  ? 51  ARG B CD    1 
ATOM 3255  N NE    . ARG F 4 14  ? 49.250  29.278  14.144  1.00 15.89  ? 51  ARG B NE    1 
ATOM 3256  C CZ    . ARG F 4 14  ? 48.988  29.615  15.412  1.00 18.33  ? 51  ARG B CZ    1 
ATOM 3257  N NH1   . ARG F 4 14  ? 49.953  30.060  16.230  1.00 22.32  ? 51  ARG B NH1   1 
ATOM 3258  N NH2   . ARG F 4 14  ? 47.744  29.490  15.867  1.00 18.92  ? 51  ARG B NH2   1 
ATOM 3259  N N     . GLY F 4 15  ? 54.748  29.772  10.601  1.00 40.81  ? 52  GLY B N     1 
ATOM 3260  C CA    . GLY F 4 15  ? 56.006  29.304  10.050  1.00 44.28  ? 52  GLY B CA    1 
ATOM 3261  C C     . GLY F 4 15  ? 56.897  30.435  9.594   1.00 46.43  ? 52  GLY B C     1 
ATOM 3262  O O     . GLY F 4 15  ? 58.089  30.242  9.368   1.00 19.74  ? 52  GLY B O     1 
ATOM 3263  N N     . PHE F 4 16  ? 56.319  31.621  9.453   1.00 37.92  ? 53  PHE B N     1 
ATOM 3264  C CA    . PHE F 4 16  ? 57.091  32.772  9.021   1.00 39.18  ? 53  PHE B CA    1 
ATOM 3265  C C     . PHE F 4 16  ? 57.667  33.488  10.232  1.00 39.16  ? 53  PHE B C     1 
ATOM 3266  O O     . PHE F 4 16  ? 56.977  33.680  11.237  1.00 24.03  ? 53  PHE B O     1 
ATOM 3267  C CB    . PHE F 4 16  ? 56.223  33.737  8.221   1.00 28.41  ? 53  PHE B CB    1 
ATOM 3268  C CG    . PHE F 4 16  ? 56.999  34.860  7.591   1.00 27.22  ? 53  PHE B CG    1 
ATOM 3269  C CD1   . PHE F 4 16  ? 57.952  34.599  6.607   1.00 27.89  ? 53  PHE B CD1   1 
ATOM 3270  C CD2   . PHE F 4 16  ? 56.771  36.180  7.969   1.00 23.87  ? 53  PHE B CD2   1 
ATOM 3271  C CE1   . PHE F 4 16  ? 58.659  35.639  6.006   1.00 29.34  ? 53  PHE B CE1   1 
ATOM 3272  C CE2   . PHE F 4 16  ? 57.474  37.218  7.376   1.00 27.73  ? 53  PHE B CE2   1 
ATOM 3273  C CZ    . PHE F 4 16  ? 58.416  36.948  6.392   1.00 28.42  ? 53  PHE B CZ    1 
ATOM 3274  N N     . ARG F 4 17  ? 58.936  33.876  10.114  1.00 15.61  ? 54  ARG B N     1 
ATOM 3275  C CA    . ARG F 4 17  ? 59.644  34.574  11.171  1.00 12.99  ? 54  ARG B CA    1 
ATOM 3276  C C     . ARG F 4 17  ? 59.894  36.011  10.766  1.00 11.29  ? 54  ARG B C     1 
ATOM 3277  O O     . ARG F 4 17  ? 60.565  36.275  9.771   1.00 14.13  ? 54  ARG B O     1 
ATOM 3278  C CB    . ARG F 4 17  ? 60.992  33.905  11.458  1.00 14.25  ? 54  ARG B CB    1 
ATOM 3279  C CG    . ARG F 4 17  ? 61.579  34.314  12.803  1.00 11.75  ? 54  ARG B CG    1 
ATOM 3280  C CD    . ARG F 4 17  ? 62.941  34.986  12.722  1.00 13.51  ? 54  ARG B CD    1 
ATOM 3281  N NE    . ARG F 4 17  ? 64.014  34.017  12.563  1.00 19.11  ? 54  ARG B NE    1 
ATOM 3282  C CZ    . ARG F 4 17  ? 65.273  34.230  12.929  1.00 23.21  ? 54  ARG B CZ    1 
ATOM 3283  N NH1   . ARG F 4 17  ? 65.644  35.381  13.485  1.00 26.12  ? 54  ARG B NH1   1 
ATOM 3284  N NH2   . ARG F 4 17  ? 66.167  33.280  12.735  1.00 25.35  ? 54  ARG B NH2   1 
ATOM 3285  N N     . PHE F 4 18  ? 59.349  36.936  11.542  1.00 20.75  ? 55  PHE B N     1 
ATOM 3286  C CA    . PHE F 4 18  ? 59.520  38.348  11.275  1.00 15.99  ? 55  PHE B CA    1 
ATOM 3287  C C     . PHE F 4 18  ? 60.977  38.661  11.440  1.00 16.49  ? 55  PHE B C     1 
ATOM 3288  O O     . PHE F 4 18  ? 61.718  37.842  11.978  1.00 19.46  ? 55  PHE B O     1 
ATOM 3289  C CB    . PHE F 4 18  ? 58.713  39.156  12.267  1.00 3.12   ? 55  PHE B CB    1 
ATOM 3290  C CG    . PHE F 4 18  ? 57.242  38.917  12.176  1.00 3.12   ? 55  PHE B CG    1 
ATOM 3291  C CD1   . PHE F 4 18  ? 56.666  38.524  10.983  1.00 4.79   ? 55  PHE B CD1   1 
ATOM 3292  C CD2   . PHE F 4 18  ? 56.424  39.146  13.269  1.00 5.55   ? 55  PHE B CD2   1 
ATOM 3293  C CE1   . PHE F 4 18  ? 55.308  38.370  10.879  1.00 5.96   ? 55  PHE B CE1   1 
ATOM 3294  C CE2   . PHE F 4 18  ? 55.048  38.992  13.177  1.00 7.11   ? 55  PHE B CE2   1 
ATOM 3295  C CZ    . PHE F 4 18  ? 54.491  38.605  11.985  1.00 9.29   ? 55  PHE B CZ    1 
ATOM 3296  N N     . ARG F 4 19  ? 61.393  39.835  10.975  1.00 18.04  ? 56  ARG B N     1 
ATOM 3297  C CA    . ARG F 4 19  ? 62.794  40.234  11.099  1.00 19.48  ? 56  ARG B CA    1 
ATOM 3298  C C     . ARG F 4 19  ? 62.921  41.679  11.501  1.00 22.76  ? 56  ARG B C     1 
ATOM 3299  O O     . ARG F 4 19  ? 62.057  42.499  11.159  1.00 14.44  ? 56  ARG B O     1 
ATOM 3300  C CB    . ARG F 4 19  ? 63.533  40.031  9.790   1.00 19.50  ? 56  ARG B CB    1 
ATOM 3301  C CG    . ARG F 4 19  ? 63.602  38.582  9.384   1.00 23.31  ? 56  ARG B CG    1 
ATOM 3302  C CD    . ARG F 4 19  ? 64.806  37.845  9.943   1.00 21.31  ? 56  ARG B CD    1 
ATOM 3303  N NE    . ARG F 4 19  ? 64.754  36.449  9.528   1.00 22.01  ? 56  ARG B NE    1 
ATOM 3304  C CZ    . ARG F 4 19  ? 65.737  35.561  9.667   1.00 21.20  ? 56  ARG B CZ    1 
ATOM 3305  N NH1   . ARG F 4 19  ? 66.906  35.897  10.218  1.00 21.24  ? 56  ARG B NH1   1 
ATOM 3306  N NH2   . ARG F 4 19  ? 65.532  34.309  9.258   1.00 19.50  ? 56  ARG B NH2   1 
ATOM 3307  N N     . TYR F 4 20  ? 63.983  41.976  12.252  1.00 32.07  ? 57  TYR B N     1 
ATOM 3308  C CA    . TYR F 4 20  ? 64.262  43.341  12.680  1.00 30.08  ? 57  TYR B CA    1 
ATOM 3309  C C     . TYR F 4 20  ? 65.223  43.913  11.659  1.00 31.14  ? 57  TYR B C     1 
ATOM 3310  O O     . TYR F 4 20  ? 65.874  43.174  10.919  1.00 24.85  ? 57  TYR B O     1 
ATOM 3311  C CB    . TYR F 4 20  ? 64.926  43.388  14.057  1.00 19.91  ? 57  TYR B CB    1 
ATOM 3312  C CG    . TYR F 4 20  ? 64.072  42.910  15.216  1.00 16.92  ? 57  TYR B CG    1 
ATOM 3313  C CD1   . TYR F 4 20  ? 63.774  41.562  15.376  1.00 16.18  ? 57  TYR B CD1   1 
ATOM 3314  C CD2   . TYR F 4 20  ? 63.564  43.813  16.152  1.00 17.29  ? 57  TYR B CD2   1 
ATOM 3315  C CE1   . TYR F 4 20  ? 62.994  41.125  16.434  1.00 16.18  ? 57  TYR B CE1   1 
ATOM 3316  C CE2   . TYR F 4 20  ? 62.777  43.377  17.211  1.00 20.12  ? 57  TYR B CE2   1 
ATOM 3317  C CZ    . TYR F 4 20  ? 62.496  42.033  17.340  1.00 18.36  ? 57  TYR B CZ    1 
ATOM 3318  O OH    . TYR F 4 20  ? 61.682  41.594  18.351  1.00 22.37  ? 57  TYR B OH    1 
ATOM 3319  N N     . VAL F 4 21  ? 65.312  45.234  11.624  1.00 19.92  ? 58  VAL B N     1 
ATOM 3320  C CA    . VAL F 4 21  ? 66.182  45.900  10.673  1.00 20.75  ? 58  VAL B CA    1 
ATOM 3321  C C     . VAL F 4 21  ? 67.581  45.300  10.730  1.00 24.51  ? 58  VAL B C     1 
ATOM 3322  O O     . VAL F 4 21  ? 68.272  45.177  9.716   1.00 16.41  ? 58  VAL B O     1 
ATOM 3323  C CB    . VAL F 4 21  ? 66.237  47.397  10.967  1.00 13.86  ? 58  VAL B CB    1 
ATOM 3324  C CG1   . VAL F 4 21  ? 66.856  48.116  9.809   1.00 13.91  ? 58  VAL B CG1   1 
ATOM 3325  C CG2   . VAL F 4 21  ? 64.846  47.920  11.232  1.00 15.23  ? 58  VAL B CG2   1 
ATOM 3326  N N     . CYS F 4 22  ? 67.986  44.907  11.927  1.00 18.27  ? 59  CYS B N     1 
ATOM 3327  C CA    . CYS F 4 22  ? 69.298  44.310  12.120  1.00 22.84  ? 59  CYS B CA    1 
ATOM 3328  C C     . CYS F 4 22  ? 69.590  43.143  11.155  1.00 23.69  ? 59  CYS B C     1 
ATOM 3329  O O     . CYS F 4 22  ? 70.695  43.055  10.615  1.00 20.32  ? 59  CYS B O     1 
ATOM 3330  C CB    . CYS F 4 22  ? 69.442  43.857  13.575  1.00 24.42  ? 59  CYS B CB    1 
ATOM 3331  S SG    . CYS F 4 22  ? 67.898  43.871  14.551  1.00 37.96  ? 59  CYS B SG    1 
ATOM 3332  N N     . GLU F 4 23  ? 68.616  42.253  10.935  1.00 28.05  ? 60  GLU B N     1 
ATOM 3333  C CA    . GLU F 4 23  ? 68.810  41.117  10.021  1.00 28.33  ? 60  GLU B CA    1 
ATOM 3334  C C     . GLU F 4 23  ? 69.048  41.557  8.572   1.00 31.06  ? 60  GLU B C     1 
ATOM 3335  O O     . GLU F 4 23  ? 69.504  40.765  7.745   1.00 36.11  ? 60  GLU B O     1 
ATOM 3336  C CB    . GLU F 4 23  ? 67.615  40.175  10.052  1.00 30.55  ? 60  GLU B CB    1 
ATOM 3337  C CG    . GLU F 4 23  ? 67.526  39.285  11.274  1.00 28.89  ? 60  GLU B CG    1 
ATOM 3338  C CD    . GLU F 4 23  ? 66.806  39.938  12.425  1.00 28.02  ? 60  GLU B CD    1 
ATOM 3339  O OE1   . GLU F 4 23  ? 66.026  39.239  13.118  1.00 25.00  ? 60  GLU B OE1   1 
ATOM 3340  O OE2   . GLU F 4 23  ? 67.028  41.147  12.629  1.00 24.22  ? 60  GLU B OE2   1 
ATOM 3341  N N     . GLY F 4 24  ? 68.714  42.810  8.275   1.00 28.46  ? 61  GLY B N     1 
ATOM 3342  C CA    . GLY F 4 24  ? 68.924  43.381  6.947   1.00 35.22  ? 61  GLY B CA    1 
ATOM 3343  C C     . GLY F 4 24  ? 68.631  42.630  5.653   1.00 37.79  ? 61  GLY B C     1 
ATOM 3344  O O     . GLY F 4 24  ? 67.496  42.615  5.186   1.00 48.73  ? 61  GLY B O     1 
ATOM 3345  N N     . PRO F 4 25  ? 69.652  42.017  5.033   1.00 75.40  ? 62  PRO B N     1 
ATOM 3346  C CA    . PRO F 4 25  ? 69.516  41.267  3.780   1.00 72.87  ? 62  PRO B CA    1 
ATOM 3347  C C     . PRO F 4 25  ? 68.241  40.445  3.627   1.00 70.15  ? 62  PRO B C     1 
ATOM 3348  O O     . PRO F 4 25  ? 67.437  40.327  4.552   1.00 107.70 ? 62  PRO B O     1 
ATOM 3349  C CB    . PRO F 4 25  ? 70.767  40.391  3.773   1.00 110.75 ? 62  PRO B CB    1 
ATOM 3350  C CG    . PRO F 4 25  ? 71.781  41.294  4.373   1.00 112.76 ? 62  PRO B CG    1 
ATOM 3351  C CD    . PRO F 4 25  ? 71.029  41.911  5.546   1.00 110.08 ? 62  PRO B CD    1 
ATOM 3352  N N     . SER F 4 26  ? 68.071  39.880  2.438   1.00 35.21  ? 63  SER B N     1 
ATOM 3353  C CA    . SER F 4 26  ? 66.910  39.067  2.147   1.00 30.02  ? 63  SER B CA    1 
ATOM 3354  C C     . SER F 4 26  ? 66.916  37.895  3.108   1.00 24.88  ? 63  SER B C     1 
ATOM 3355  O O     . SER F 4 26  ? 67.972  37.404  3.498   1.00 57.74  ? 63  SER B O     1 
ATOM 3356  C CB    . SER F 4 26  ? 66.964  38.562  0.697   1.00 62.08  ? 63  SER B CB    1 
ATOM 3357  O OG    . SER F 4 26  ? 65.881  37.682  0.418   1.00 56.35  ? 63  SER B OG    1 
ATOM 3358  N N     . HIS F 4 27  ? 65.726  37.469  3.498   1.00 11.60  ? 64  HIS B N     1 
ATOM 3359  C CA    . HIS F 4 27  ? 65.578  36.351  4.414   1.00 8.67   ? 64  HIS B CA    1 
ATOM 3360  C C     . HIS F 4 27  ? 64.336  35.567  4.021   1.00 6.97   ? 64  HIS B C     1 
ATOM 3361  O O     . HIS F 4 27  ? 63.721  34.905  4.844   1.00 2.00   ? 64  HIS B O     1 
ATOM 3362  C CB    . HIS F 4 27  ? 65.482  36.850  5.875   1.00 9.64   ? 64  HIS B CB    1 
ATOM 3363  C CG    . HIS F 4 27  ? 66.814  37.081  6.531   1.00 7.75   ? 64  HIS B CG    1 
ATOM 3364  N ND1   . HIS F 4 27  ? 67.173  38.285  7.096   1.00 7.75   ? 64  HIS B ND1   1 
ATOM 3365  C CD2   . HIS F 4 27  ? 67.880  36.263  6.690   1.00 7.75   ? 64  HIS B CD2   1 
ATOM 3366  C CE1   . HIS F 4 27  ? 68.405  38.203  7.566   1.00 7.75   ? 64  HIS B CE1   1 
ATOM 3367  N NE2   . HIS F 4 27  ? 68.855  36.986  7.332   1.00 7.75   ? 64  HIS B NE2   1 
ATOM 3368  N N     . GLY F 4 28  ? 63.970  35.664  2.747   1.00 32.52  ? 65  GLY B N     1 
ATOM 3369  C CA    . GLY F 4 28  ? 62.826  34.924  2.249   1.00 31.54  ? 65  GLY B CA    1 
ATOM 3370  C C     . GLY F 4 28  ? 61.703  35.744  1.669   1.00 28.16  ? 65  GLY B C     1 
ATOM 3371  O O     . GLY F 4 28  ? 61.865  36.924  1.384   1.00 48.28  ? 65  GLY B O     1 
ATOM 3372  N N     . GLY F 4 29  ? 60.562  35.094  1.484   1.00 9.25   ? 66  GLY B N     1 
ATOM 3373  C CA    . GLY F 4 29  ? 59.398  35.764  0.957   1.00 13.57  ? 66  GLY B CA    1 
ATOM 3374  C C     . GLY F 4 29  ? 58.180  35.224  1.667   1.00 20.37  ? 66  GLY B C     1 
ATOM 3375  O O     . GLY F 4 29  ? 58.021  34.015  1.766   1.00 31.01  ? 66  GLY B O     1 
ATOM 3376  N N     . LEU F 4 30  ? 57.326  36.106  2.172   1.00 30.23  ? 67  LEU B N     1 
ATOM 3377  C CA    . LEU F 4 30  ? 56.116  35.675  2.869   1.00 30.55  ? 67  LEU B CA    1 
ATOM 3378  C C     . LEU F 4 30  ? 55.352  34.630  2.040   1.00 32.24  ? 67  LEU B C     1 
ATOM 3379  O O     . LEU F 4 30  ? 54.717  34.964  1.035   1.00 41.65  ? 67  LEU B O     1 
ATOM 3380  C CB    . LEU F 4 30  ? 55.211  36.875  3.123   1.00 36.49  ? 67  LEU B CB    1 
ATOM 3381  C CG    . LEU F 4 30  ? 54.119  36.650  4.160   1.00 34.80  ? 67  LEU B CG    1 
ATOM 3382  C CD1   . LEU F 4 30  ? 54.741  36.726  5.544   1.00 38.21  ? 67  LEU B CD1   1 
ATOM 3383  C CD2   . LEU F 4 30  ? 53.033  37.699  3.995   1.00 30.14  ? 67  LEU B CD2   1 
ATOM 3384  N N     . PRO F 4 31  ? 55.382  33.360  2.474   1.00 35.28  ? 68  PRO B N     1 
ATOM 3385  C CA    . PRO F 4 31  ? 54.731  32.211  1.827   1.00 35.84  ? 68  PRO B CA    1 
ATOM 3386  C C     . PRO F 4 31  ? 53.219  32.253  1.631   1.00 37.46  ? 68  PRO B C     1 
ATOM 3387  O O     . PRO F 4 31  ? 52.504  33.010  2.286   1.00 39.87  ? 68  PRO B O     1 
ATOM 3388  C CB    . PRO F 4 31  ? 55.142  31.044  2.711   1.00 39.62  ? 68  PRO B CB    1 
ATOM 3389  C CG    . PRO F 4 31  ? 55.218  31.680  4.071   1.00 41.76  ? 68  PRO B CG    1 
ATOM 3390  C CD    . PRO F 4 31  ? 55.960  32.963  3.770   1.00 41.06  ? 68  PRO B CD    1 
ATOM 3391  N N     . GLY F 4 32  ? 52.748  31.414  0.712   1.00 16.52  ? 69  GLY B N     1 
ATOM 3392  C CA    . GLY F 4 32  ? 51.327  31.325  0.437   1.00 19.91  ? 69  GLY B CA    1 
ATOM 3393  C C     . GLY F 4 32  ? 50.784  30.207  1.295   1.00 23.04  ? 69  GLY B C     1 
ATOM 3394  O O     . GLY F 4 32  ? 51.556  29.391  1.789   1.00 56.14  ? 69  GLY B O     1 
ATOM 3395  N N     . ALA F 4 33  ? 49.472  30.154  1.484   1.00 32.51  ? 70  ALA B N     1 
ATOM 3396  C CA    . ALA F 4 33  ? 48.874  29.105  2.306   1.00 35.04  ? 70  ALA B CA    1 
ATOM 3397  C C     . ALA F 4 33  ? 48.843  27.769  1.569   1.00 37.53  ? 70  ALA B C     1 
ATOM 3398  O O     . ALA F 4 33  ? 48.135  26.838  1.970   1.00 64.45  ? 70  ALA B O     1 
ATOM 3399  C CB    . ALA F 4 33  ? 47.463  29.509  2.723   1.00 66.14  ? 70  ALA B CB    1 
ATOM 3400  N N     . SER F 4 34  ? 49.619  27.690  0.489   1.00 33.73  ? 71  SER B N     1 
ATOM 3401  C CA    . SER F 4 34  ? 49.706  26.482  -0.327  1.00 37.52  ? 71  SER B CA    1 
ATOM 3402  C C     . SER F 4 34  ? 51.144  26.151  -0.647  1.00 39.49  ? 71  SER B C     1 
ATOM 3403  O O     . SER F 4 34  ? 51.421  25.114  -1.232  1.00 48.96  ? 71  SER B O     1 
ATOM 3404  C CB    . SER F 4 34  ? 48.919  26.642  -1.629  1.00 37.94  ? 71  SER B CB    1 
ATOM 3405  O OG    . SER F 4 34  ? 47.527  26.681  -1.371  1.00 41.19  ? 71  SER B OG    1 
ATOM 3406  N N     . SER F 4 35  ? 52.063  27.029  -0.276  1.00 67.14  ? 72  SER B N     1 
ATOM 3407  C CA    . SER F 4 35  ? 53.461  26.755  -0.545  1.00 67.41  ? 72  SER B CA    1 
ATOM 3408  C C     . SER F 4 35  ? 53.837  25.439  0.117   1.00 66.45  ? 72  SER B C     1 
ATOM 3409  O O     . SER F 4 35  ? 53.453  25.170  1.256   1.00 54.24  ? 72  SER B O     1 
ATOM 3410  C CB    . SER F 4 35  ? 54.348  27.876  -0.009  1.00 68.66  ? 72  SER B CB    1 
ATOM 3411  O OG    . SER F 4 35  ? 54.317  29.016  -0.847  1.00 68.56  ? 72  SER B OG    1 
ATOM 3412  N N     . GLU F 4 36  ? 54.583  24.620  -0.614  1.00 69.10  ? 73  GLU B N     1 
ATOM 3413  C CA    . GLU F 4 36  ? 55.029  23.323  -0.134  1.00 69.63  ? 73  GLU B CA    1 
ATOM 3414  C C     . GLU F 4 36  ? 56.376  23.026  -0.779  1.00 68.09  ? 73  GLU B C     1 
ATOM 3415  O O     . GLU F 4 36  ? 56.496  22.098  -1.570  1.00 54.81  ? 73  GLU B O     1 
ATOM 3416  C CB    . GLU F 4 36  ? 54.017  22.238  -0.525  1.00 58.80  ? 73  GLU B CB    1 
ATOM 3417  C CG    . GLU F 4 36  ? 53.266  21.558  0.628   1.00 62.21  ? 73  GLU B CG    1 
ATOM 3418  C CD    . GLU F 4 36  ? 54.068  20.450  1.324   1.00 63.12  ? 73  GLU B CD    1 
ATOM 3419  O OE1   . GLU F 4 36  ? 54.857  19.744  0.658   1.00 64.48  ? 73  GLU B OE1   1 
ATOM 3420  O OE2   . GLU F 4 36  ? 53.884  20.264  2.546   1.00 62.63  ? 73  GLU B OE2   1 
ATOM 3421  N N     . LYS F 4 37  ? 57.375  23.845  -0.472  1.00 52.74  ? 74  LYS B N     1 
ATOM 3422  C CA    . LYS F 4 37  ? 58.725  23.639  -0.991  1.00 52.19  ? 74  LYS B CA    1 
ATOM 3423  C C     . LYS F 4 37  ? 58.788  23.355  -2.489  1.00 53.12  ? 74  LYS B C     1 
ATOM 3424  O O     . LYS F 4 37  ? 59.042  24.254  -3.292  1.00 59.54  ? 74  LYS B O     1 
ATOM 3425  C CB    . LYS F 4 37  ? 59.390  22.476  -0.247  1.00 60.94  ? 74  LYS B CB    1 
ATOM 3426  C CG    . LYS F 4 37  ? 60.673  21.958  -0.898  1.00 62.20  ? 74  LYS B CG    1 
ATOM 3427  C CD    . LYS F 4 37  ? 60.918  20.479  -0.579  1.00 59.84  ? 74  LYS B CD    1 
ATOM 3428  C CE    . LYS F 4 37  ? 59.915  19.573  -1.293  1.00 60.75  ? 74  LYS B CE    1 
ATOM 3429  N NZ    . LYS F 4 37  ? 60.158  18.136  -0.988  1.00 58.92  ? 74  LYS B NZ    1 
ATOM 3430  N N     . ASN F 4 38  ? 58.583  22.091  -2.859  1.00 73.40  ? 75  ASN B N     1 
ATOM 3431  C CA    . ASN F 4 38  ? 58.625  21.701  -4.261  1.00 73.63  ? 75  ASN B CA    1 
ATOM 3432  C C     . ASN F 4 38  ? 57.429  22.297  -4.977  1.00 72.85  ? 75  ASN B C     1 
ATOM 3433  O O     . ASN F 4 38  ? 56.773  21.633  -5.766  1.00 45.02  ? 75  ASN B O     1 
ATOM 3434  C CB    . ASN F 4 38  ? 58.608  20.178  -4.402  1.00 57.70  ? 75  ASN B CB    1 
ATOM 3435  C CG    . ASN F 4 38  ? 59.665  19.671  -5.380  1.00 58.00  ? 75  ASN B CG    1 
ATOM 3436  O OD1   . ASN F 4 38  ? 59.818  20.209  -6.487  1.00 57.21  ? 75  ASN B OD1   1 
ATOM 3437  N ND2   . ASN F 4 38  ? 60.403  18.631  -4.973  1.00 57.16  ? 75  ASN B ND2   1 
ATOM 3438  N N     . LYS F 4 39  ? 57.172  23.565  -4.682  1.00 63.56  ? 76  LYS B N     1 
ATOM 3439  C CA    . LYS F 4 39  ? 56.069  24.340  -5.235  1.00 63.24  ? 76  LYS B CA    1 
ATOM 3440  C C     . LYS F 4 39  ? 55.828  25.367  -4.141  1.00 62.69  ? 76  LYS B C     1 
ATOM 3441  O O     . LYS F 4 39  ? 55.428  25.023  -3.030  1.00 59.18  ? 76  LYS B O     1 
ATOM 3442  C CB    . LYS F 4 39  ? 54.817  23.466  -5.437  1.00 57.32  ? 76  LYS B CB    1 
ATOM 3443  C CG    . LYS F 4 39  ? 53.772  24.032  -6.401  1.00 53.78  ? 76  LYS B CG    1 
ATOM 3444  C CD    . LYS F 4 39  ? 53.018  25.214  -5.810  1.00 51.90  ? 76  LYS B CD    1 
ATOM 3445  C CE    . LYS F 4 39  ? 52.075  25.822  -6.842  1.00 49.24  ? 76  LYS B CE    1 
ATOM 3446  N NZ    . LYS F 4 39  ? 51.120  24.820  -7.391  1.00 45.61  ? 76  LYS B NZ    1 
ATOM 3447  N N     . LYS F 4 40  ? 56.108  26.626  -4.443  1.00 51.43  ? 77  LYS B N     1 
ATOM 3448  C CA    . LYS F 4 40  ? 55.925  27.673  -3.456  1.00 50.61  ? 77  LYS B CA    1 
ATOM 3449  C C     . LYS F 4 40  ? 55.118  28.813  -4.063  1.00 49.24  ? 77  LYS B C     1 
ATOM 3450  O O     . LYS F 4 40  ? 55.260  29.131  -5.240  1.00 79.16  ? 77  LYS B O     1 
ATOM 3451  C CB    . LYS F 4 40  ? 57.291  28.175  -2.980  1.00 80.26  ? 77  LYS B CB    1 
ATOM 3452  C CG    . LYS F 4 40  ? 57.322  28.660  -1.534  1.00 79.89  ? 77  LYS B CG    1 
ATOM 3453  C CD    . LYS F 4 40  ? 57.324  27.506  -0.528  1.00 79.85  ? 77  LYS B CD    1 
ATOM 3454  C CE    . LYS F 4 40  ? 57.493  28.035  0.906   1.00 79.14  ? 77  LYS B CE    1 
ATOM 3455  N NZ    . LYS F 4 40  ? 57.520  26.988  1.983   1.00 74.42  ? 77  LYS B NZ    1 
ATOM 3456  N N     . SER F 4 41  ? 54.264  29.422  -3.253  1.00 87.78  ? 78  SER B N     1 
ATOM 3457  C CA    . SER F 4 41  ? 53.438  30.513  -3.726  1.00 87.72  ? 78  SER B CA    1 
ATOM 3458  C C     . SER F 4 41  ? 53.543  31.742  -2.840  1.00 86.95  ? 78  SER B C     1 
ATOM 3459  O O     . SER F 4 41  ? 54.404  31.826  -1.959  1.00 62.42  ? 78  SER B O     1 
ATOM 3460  C CB    . SER F 4 41  ? 51.982  30.067  -3.806  1.00 66.82  ? 78  SER B CB    1 
ATOM 3461  O OG    . SER F 4 41  ? 51.853  28.902  -4.598  1.00 69.12  ? 78  SER B OG    1 
ATOM 3462  N N     . TYR F 4 42  ? 52.654  32.698  -3.095  1.00 76.80  ? 79  TYR B N     1 
ATOM 3463  C CA    . TYR F 4 42  ? 52.607  33.956  -2.364  1.00 74.49  ? 79  TYR B CA    1 
ATOM 3464  C C     . TYR F 4 42  ? 51.169  34.448  -2.342  1.00 74.22  ? 79  TYR B C     1 
ATOM 3465  O O     . TYR F 4 42  ? 50.412  34.219  -3.282  1.00 59.21  ? 79  TYR B O     1 
ATOM 3466  C CB    . TYR F 4 42  ? 53.487  35.009  -3.039  1.00 76.83  ? 79  TYR B CB    1 
ATOM 3467  C CG    . TYR F 4 42  ? 54.838  34.498  -3.483  1.00 80.00  ? 79  TYR B CG    1 
ATOM 3468  C CD1   . TYR F 4 42  ? 54.977  33.790  -4.678  1.00 80.62  ? 79  TYR B CD1   1 
ATOM 3469  C CD2   . TYR F 4 42  ? 55.971  34.692  -2.696  1.00 82.23  ? 79  TYR B CD2   1 
ATOM 3470  C CE1   . TYR F 4 42  ? 56.209  33.284  -5.078  1.00 81.34  ? 79  TYR B CE1   1 
ATOM 3471  C CE2   . TYR F 4 42  ? 57.210  34.190  -3.085  1.00 82.42  ? 79  TYR B CE2   1 
ATOM 3472  C CZ    . TYR F 4 42  ? 57.322  33.484  -4.278  1.00 82.57  ? 79  TYR B CZ    1 
ATOM 3473  O OH    . TYR F 4 42  ? 58.541  32.972  -4.668  1.00 80.21  ? 79  TYR B OH    1 
ATOM 3474  N N     . PRO F 4 43  ? 50.780  35.155  -1.272  1.00 43.51  ? 80  PRO B N     1 
ATOM 3475  C CA    . PRO F 4 43  ? 49.418  35.667  -1.147  1.00 41.27  ? 80  PRO B CA    1 
ATOM 3476  C C     . PRO F 4 43  ? 48.947  36.326  -2.440  1.00 40.36  ? 80  PRO B C     1 
ATOM 3477  O O     . PRO F 4 43  ? 49.432  37.404  -2.794  1.00 78.57  ? 80  PRO B O     1 
ATOM 3478  C CB    . PRO F 4 43  ? 49.533  36.664  0.001   1.00 64.11  ? 80  PRO B CB    1 
ATOM 3479  C CG    . PRO F 4 43  ? 50.610  36.086  0.833   1.00 65.37  ? 80  PRO B CG    1 
ATOM 3480  C CD    . PRO F 4 43  ? 51.630  35.698  -0.200  1.00 65.55  ? 80  PRO B CD    1 
ATOM 3481  N N     . GLN F 4 44  ? 48.018  35.680  -3.147  1.00 19.68  ? 81  GLN B N     1 
ATOM 3482  C CA    . GLN F 4 44  ? 47.495  36.239  -4.388  1.00 17.63  ? 81  GLN B CA    1 
ATOM 3483  C C     . GLN F 4 44  ? 46.118  36.834  -4.224  1.00 17.50  ? 81  GLN B C     1 
ATOM 3484  O O     . GLN F 4 44  ? 45.266  36.276  -3.534  1.00 29.72  ? 81  GLN B O     1 
ATOM 3485  C CB    . GLN F 4 44  ? 47.447  35.186  -5.470  1.00 45.55  ? 81  GLN B CB    1 
ATOM 3486  C CG    . GLN F 4 44  ? 48.768  34.916  -6.093  1.00 46.04  ? 81  GLN B CG    1 
ATOM 3487  C CD    . GLN F 4 44  ? 48.640  33.858  -7.128  1.00 45.97  ? 81  GLN B CD    1 
ATOM 3488  O OE1   . GLN F 4 44  ? 48.448  32.682  -6.798  1.00 45.84  ? 81  GLN B OE1   1 
ATOM 3489  N NE2   . GLN F 4 44  ? 48.710  34.256  -8.400  1.00 42.43  ? 81  GLN B NE2   1 
ATOM 3490  N N     . VAL F 4 45  ? 45.908  37.976  -4.872  1.00 10.73  ? 82  VAL B N     1 
ATOM 3491  C CA    . VAL F 4 45  ? 44.617  38.656  -4.803  1.00 10.73  ? 82  VAL B CA    1 
ATOM 3492  C C     . VAL F 4 45  ? 44.037  38.682  -6.214  1.00 10.73  ? 82  VAL B C     1 
ATOM 3493  O O     . VAL F 4 45  ? 44.710  38.305  -7.166  1.00 18.61  ? 82  VAL B O     1 
ATOM 3494  C CB    . VAL F 4 45  ? 44.763  40.128  -4.321  1.00 12.20  ? 82  VAL B CB    1 
ATOM 3495  C CG1   . VAL F 4 45  ? 43.559  40.524  -3.498  1.00 11.57  ? 82  VAL B CG1   1 
ATOM 3496  C CG2   . VAL F 4 45  ? 46.044  40.308  -3.549  1.00 11.57  ? 82  VAL B CG2   1 
ATOM 3497  N N     . LYS F 4 46  ? 42.787  39.117  -6.337  1.00 24.82  ? 83  LYS B N     1 
ATOM 3498  C CA    . LYS F 4 46  ? 42.142  39.224  -7.640  1.00 25.45  ? 83  LYS B CA    1 
ATOM 3499  C C     . LYS F 4 46  ? 40.855  40.019  -7.560  1.00 27.65  ? 83  LYS B C     1 
ATOM 3500  O O     . LYS F 4 46  ? 40.184  40.034  -6.532  1.00 82.93  ? 83  LYS B O     1 
ATOM 3501  C CB    . LYS F 4 46  ? 41.854  37.843  -8.244  1.00 93.90  ? 83  LYS B CB    1 
ATOM 3502  C CG    . LYS F 4 46  ? 41.104  37.938  -9.577  1.00 93.78  ? 83  LYS B CG    1 
ATOM 3503  C CD    . LYS F 4 46  ? 41.279  36.717  -10.472 1.00 88.02  ? 83  LYS B CD    1 
ATOM 3504  C CE    . LYS F 4 46  ? 40.628  36.960  -11.840 1.00 84.79  ? 83  LYS B CE    1 
ATOM 3505  N NZ    . LYS F 4 46  ? 40.864  35.857  -12.823 1.00 78.18  ? 83  LYS B NZ    1 
ATOM 3506  N N     . ILE F 4 47  ? 40.528  40.691  -8.657  1.00 75.66  ? 84  ILE B N     1 
ATOM 3507  C CA    . ILE F 4 47  ? 39.322  41.500  -8.759  1.00 78.18  ? 84  ILE B CA    1 
ATOM 3508  C C     . ILE F 4 47  ? 38.369  40.696  -9.650  1.00 80.37  ? 84  ILE B C     1 
ATOM 3509  O O     . ILE F 4 47  ? 38.766  39.655  -10.169 1.00 53.28  ? 84  ILE B O     1 
ATOM 3510  C CB    . ILE F 4 47  ? 39.666  42.868  -9.396  1.00 51.57  ? 84  ILE B CB    1 
ATOM 3511  C CG1   . ILE F 4 47  ? 41.005  43.368  -8.843  1.00 52.59  ? 84  ILE B CG1   1 
ATOM 3512  C CG2   . ILE F 4 47  ? 38.589  43.893  -9.069  1.00 51.06  ? 84  ILE B CG2   1 
ATOM 3513  C CD1   . ILE F 4 47  ? 41.497  44.643  -9.456  1.00 49.87  ? 84  ILE B CD1   1 
ATOM 3514  N N     . CYS F 4 48  ? 37.126  41.143  -9.814  1.00 88.08  ? 85  CYS B N     1 
ATOM 3515  C CA    . CYS F 4 48  ? 36.189  40.404  -10.669 1.00 90.64  ? 85  CYS B CA    1 
ATOM 3516  C C     . CYS F 4 48  ? 35.718  41.203  -11.875 1.00 90.70  ? 85  CYS B C     1 
ATOM 3517  O O     . CYS F 4 48  ? 36.079  40.903  -13.016 1.00 85.14  ? 85  CYS B O     1 
ATOM 3518  C CB    . CYS F 4 48  ? 34.952  39.938  -9.887  1.00 90.07  ? 85  CYS B CB    1 
ATOM 3519  S SG    . CYS F 4 48  ? 33.723  38.971  -10.883 1.00 98.50  ? 85  CYS B SG    1 
ATOM 3520  N N     . ASN F 4 49  ? 34.889  42.206  -11.618 1.00 50.32  ? 86  ASN B N     1 
ATOM 3521  C CA    . ASN F 4 49  ? 34.374  43.041  -12.683 1.00 49.25  ? 86  ASN B CA    1 
ATOM 3522  C C     . ASN F 4 49  ? 35.518  43.922  -13.194 1.00 48.76  ? 86  ASN B C     1 
ATOM 3523  O O     . ASN F 4 49  ? 35.579  45.121  -12.915 1.00 54.77  ? 86  ASN B O     1 
ATOM 3524  C CB    . ASN F 4 49  ? 33.206  43.885  -12.158 1.00 51.89  ? 86  ASN B CB    1 
ATOM 3525  C CG    . ASN F 4 49  ? 32.133  43.036  -11.476 1.00 51.20  ? 86  ASN B CG    1 
ATOM 3526  O OD1   . ASN F 4 49  ? 31.187  43.556  -10.874 1.00 51.44  ? 86  ASN B OD1   1 
ATOM 3527  N ND2   . ASN F 4 49  ? 32.278  41.724  -11.575 1.00 49.33  ? 86  ASN B ND2   1 
ATOM 3528  N N     . TYR F 4 50  ? 36.426  43.293  -13.941 1.00 98.80  ? 87  TYR B N     1 
ATOM 3529  C CA    . TYR F 4 50  ? 37.596  43.947  -14.515 1.00 98.09  ? 87  TYR B CA    1 
ATOM 3530  C C     . TYR F 4 50  ? 37.439  45.442  -14.717 1.00 95.01  ? 87  TYR B C     1 
ATOM 3531  O O     . TYR F 4 50  ? 36.373  45.932  -15.092 1.00 97.63  ? 87  TYR B O     1 
ATOM 3532  C CB    . TYR F 4 50  ? 37.966  43.236  -15.823 1.00 97.82  ? 87  TYR B CB    1 
ATOM 3533  C CG    . TYR F 4 50  ? 38.570  44.075  -16.926 1.00 101.05 ? 87  TYR B CG    1 
ATOM 3534  C CD1   . TYR F 4 50  ? 37.787  44.958  -17.669 1.00 101.62 ? 87  TYR B CD1   1 
ATOM 3535  C CD2   . TYR F 4 50  ? 39.904  43.918  -17.291 1.00 101.92 ? 87  TYR B CD2   1 
ATOM 3536  C CE1   . TYR F 4 50  ? 38.315  45.658  -18.760 1.00 104.26 ? 87  TYR B CE1   1 
ATOM 3537  C CE2   . TYR F 4 50  ? 40.444  44.611  -18.378 1.00 102.75 ? 87  TYR B CE2   1 
ATOM 3538  C CZ    . TYR F 4 50  ? 39.645  45.477  -19.110 1.00 105.37 ? 87  TYR B CZ    1 
ATOM 3539  O OH    . TYR F 4 50  ? 40.173  46.148  -20.192 1.00 111.03 ? 87  TYR B OH    1 
ATOM 3540  N N     . VAL F 4 51  ? 38.517  46.164  -14.436 1.00 96.01  ? 88  VAL B N     1 
ATOM 3541  C CA    . VAL F 4 51  ? 38.543  47.615  -14.579 1.00 92.63  ? 88  VAL B CA    1 
ATOM 3542  C C     . VAL F 4 51  ? 39.827  47.960  -15.315 1.00 93.12  ? 88  VAL B C     1 
ATOM 3543  O O     . VAL F 4 51  ? 40.546  48.897  -14.957 1.00 45.12  ? 88  VAL B O     1 
ATOM 3544  C CB    . VAL F 4 51  ? 38.503  48.317  -13.194 1.00 27.53  ? 88  VAL B CB    1 
ATOM 3545  C CG1   . VAL F 4 51  ? 38.498  49.825  -13.362 1.00 29.35  ? 88  VAL B CG1   1 
ATOM 3546  C CG2   . VAL F 4 51  ? 37.259  47.874  -12.438 1.00 26.07  ? 88  VAL B CG2   1 
ATOM 3547  N N     . GLY F 4 52  ? 40.109  47.184  -16.355 1.00 34.88  ? 89  GLY B N     1 
ATOM 3548  C CA    . GLY F 4 52  ? 41.313  47.414  -17.121 1.00 29.83  ? 89  GLY B CA    1 
ATOM 3549  C C     . GLY F 4 52  ? 42.480  47.459  -16.167 1.00 26.48  ? 89  GLY B C     1 
ATOM 3550  O O     . GLY F 4 52  ? 42.826  46.440  -15.587 1.00 38.45  ? 89  GLY B O     1 
ATOM 3551  N N     . PRO F 4 53  ? 43.101  48.629  -15.982 1.00 51.09  ? 90  PRO B N     1 
ATOM 3552  C CA    . PRO F 4 53  ? 44.239  48.830  -15.092 1.00 52.15  ? 90  PRO B CA    1 
ATOM 3553  C C     . PRO F 4 53  ? 43.742  49.235  -13.716 1.00 52.71  ? 90  PRO B C     1 
ATOM 3554  O O     . PRO F 4 53  ? 42.649  49.787  -13.584 1.00 21.49  ? 90  PRO B O     1 
ATOM 3555  C CB    . PRO F 4 53  ? 44.972  49.960  -15.762 1.00 2.00   ? 90  PRO B CB    1 
ATOM 3556  C CG    . PRO F 4 53  ? 43.847  50.825  -16.160 1.00 2.00   ? 90  PRO B CG    1 
ATOM 3557  C CD    . PRO F 4 53  ? 42.867  49.844  -16.775 1.00 2.00   ? 90  PRO B CD    1 
ATOM 3558  N N     . ALA F 4 54  ? 44.549  48.973  -12.696 1.00 10.60  ? 91  ALA B N     1 
ATOM 3559  C CA    . ALA F 4 54  ? 44.168  49.323  -11.332 1.00 11.61  ? 91  ALA B CA    1 
ATOM 3560  C C     . ALA F 4 54  ? 45.349  49.212  -10.395 1.00 15.12  ? 91  ALA B C     1 
ATOM 3561  O O     . ALA F 4 54  ? 46.305  48.480  -10.663 1.00 13.75  ? 91  ALA B O     1 
ATOM 3562  C CB    . ALA F 4 54  ? 43.028  48.424  -10.852 1.00 18.78  ? 91  ALA B CB    1 
ATOM 3563  N N     . LYS F 4 55  ? 45.278  49.957  -9.298  1.00 44.28  ? 92  LYS B N     1 
ATOM 3564  C CA    . LYS F 4 55  ? 46.337  49.958  -8.293  1.00 43.50  ? 92  LYS B CA    1 
ATOM 3565  C C     . LYS F 4 55  ? 45.824  49.384  -6.981  1.00 44.24  ? 92  LYS B C     1 
ATOM 3566  O O     . LYS F 4 55  ? 44.832  49.869  -6.425  1.00 40.93  ? 92  LYS B O     1 
ATOM 3567  C CB    . LYS F 4 55  ? 46.861  51.385  -8.071  1.00 24.86  ? 92  LYS B CB    1 
ATOM 3568  C CG    . LYS F 4 55  ? 46.775  51.911  -6.635  1.00 28.54  ? 92  LYS B CG    1 
ATOM 3569  C CD    . LYS F 4 55  ? 47.283  53.351  -6.567  1.00 30.17  ? 92  LYS B CD    1 
ATOM 3570  C CE    . LYS F 4 55  ? 47.231  53.931  -5.165  1.00 29.85  ? 92  LYS B CE    1 
ATOM 3571  N NZ    . LYS F 4 55  ? 47.533  55.376  -5.193  1.00 27.63  ? 92  LYS B NZ    1 
ATOM 3572  N N     . VAL F 4 56  ? 46.507  48.349  -6.498  1.00 39.59  ? 93  VAL B N     1 
ATOM 3573  C CA    . VAL F 4 56  ? 46.147  47.693  -5.245  1.00 38.38  ? 93  VAL B CA    1 
ATOM 3574  C C     . VAL F 4 56  ? 47.230  47.878  -4.182  1.00 36.19  ? 93  VAL B C     1 
ATOM 3575  O O     . VAL F 4 56  ? 48.298  47.293  -4.290  1.00 31.81  ? 93  VAL B O     1 
ATOM 3576  C CB    . VAL F 4 56  ? 45.951  46.182  -5.458  1.00 32.99  ? 93  VAL B CB    1 
ATOM 3577  C CG1   . VAL F 4 56  ? 45.221  45.568  -4.269  1.00 36.20  ? 93  VAL B CG1   1 
ATOM 3578  C CG2   . VAL F 4 56  ? 45.191  45.943  -6.744  1.00 33.42  ? 93  VAL B CG2   1 
ATOM 3579  N N     . ILE F 4 57  ? 46.979  48.692  -3.161  1.00 37.57  ? 94  ILE B N     1 
ATOM 3580  C CA    . ILE F 4 57  ? 47.982  48.864  -2.111  1.00 34.36  ? 94  ILE B CA    1 
ATOM 3581  C C     . ILE F 4 57  ? 47.649  47.967  -0.946  1.00 32.98  ? 94  ILE B C     1 
ATOM 3582  O O     . ILE F 4 57  ? 46.485  47.750  -0.645  1.00 8.24   ? 94  ILE B O     1 
ATOM 3583  C CB    . ILE F 4 57  ? 48.087  50.336  -1.583  1.00 9.71   ? 94  ILE B CB    1 
ATOM 3584  C CG1   . ILE F 4 57  ? 46.801  50.763  -0.883  1.00 9.71   ? 94  ILE B CG1   1 
ATOM 3585  C CG2   . ILE F 4 57  ? 48.392  51.273  -2.725  1.00 9.71   ? 94  ILE B CG2   1 
ATOM 3586  C CD1   . ILE F 4 57  ? 46.655  50.263  0.505   1.00 9.71   ? 94  ILE B CD1   1 
ATOM 3587  N N     . VAL F 4 58  ? 48.682  47.438  -0.305  1.00 2.00   ? 95  VAL B N     1 
ATOM 3588  C CA    . VAL F 4 58  ? 48.524  46.585  0.873   1.00 2.00   ? 95  VAL B CA    1 
ATOM 3589  C C     . VAL F 4 58  ? 49.385  47.040  2.053   1.00 2.00   ? 95  VAL B C     1 
ATOM 3590  O O     . VAL F 4 58  ? 50.589  47.272  1.920   1.00 3.50   ? 95  VAL B O     1 
ATOM 3591  C CB    . VAL F 4 58  ? 48.896  45.120  0.595   1.00 32.86  ? 95  VAL B CB    1 
ATOM 3592  C CG1   . VAL F 4 58  ? 50.314  45.014  0.004   1.00 29.91  ? 95  VAL B CG1   1 
ATOM 3593  C CG2   . VAL F 4 58  ? 48.812  44.341  1.895   1.00 32.98  ? 95  VAL B CG2   1 
ATOM 3594  N N     . GLN F 4 59  ? 48.747  47.148  3.213   1.00 2.00   ? 96  GLN B N     1 
ATOM 3595  C CA    . GLN F 4 59  ? 49.425  47.558  4.451   1.00 2.00   ? 96  GLN B CA    1 
ATOM 3596  C C     . GLN F 4 59  ? 49.150  46.579  5.600   1.00 2.00   ? 96  GLN B C     1 
ATOM 3597  O O     . GLN F 4 59  ? 48.141  45.871  5.599   1.00 9.95   ? 96  GLN B O     1 
ATOM 3598  C CB    . GLN F 4 59  ? 48.975  48.971  4.839   1.00 31.75  ? 96  GLN B CB    1 
ATOM 3599  C CG    . GLN F 4 59  ? 47.470  49.216  4.692   1.00 30.26  ? 96  GLN B CG    1 
ATOM 3600  C CD    . GLN F 4 59  ? 47.071  50.632  5.070   1.00 34.19  ? 96  GLN B CD    1 
ATOM 3601  O OE1   . GLN F 4 59  ? 47.300  51.073  6.191   1.00 36.29  ? 96  GLN B OE1   1 
ATOM 3602  N NE2   . GLN F 4 59  ? 46.471  51.350  4.133   1.00 34.42  ? 96  GLN B NE2   1 
ATOM 3603  N N     . LEU F 4 60  ? 50.047  46.526  6.577   1.00 7.17   ? 97  LEU B N     1 
ATOM 3604  C CA    . LEU F 4 60  ? 49.840  45.614  7.704   1.00 7.17   ? 97  LEU B CA    1 
ATOM 3605  C C     . LEU F 4 60  ? 48.901  46.202  8.751   1.00 7.17   ? 97  LEU B C     1 
ATOM 3606  O O     . LEU F 4 60  ? 49.171  47.280  9.294   1.00 33.35  ? 97  LEU B O     1 
ATOM 3607  C CB    . LEU F 4 60  ? 51.174  45.266  8.361   1.00 31.55  ? 97  LEU B CB    1 
ATOM 3608  C CG    . LEU F 4 60  ? 52.118  44.335  7.589   1.00 34.15  ? 97  LEU B CG    1 
ATOM 3609  C CD1   . LEU F 4 60  ? 53.524  44.380  8.180   1.00 31.52  ? 97  LEU B CD1   1 
ATOM 3610  C CD2   . LEU F 4 60  ? 51.552  42.918  7.627   1.00 35.19  ? 97  LEU B CD2   1 
ATOM 3611  N N     . VAL F 4 61  ? 47.796  45.511  9.028   1.00 4.06   ? 98  VAL B N     1 
ATOM 3612  C CA    . VAL F 4 61  ? 46.850  45.991  10.041  1.00 5.29   ? 98  VAL B CA    1 
ATOM 3613  C C     . VAL F 4 61  ? 46.953  45.149  11.317  1.00 5.10   ? 98  VAL B C     1 
ATOM 3614  O O     . VAL F 4 61  ? 47.772  44.236  11.406  1.00 2.00   ? 98  VAL B O     1 
ATOM 3615  C CB    . VAL F 4 61  ? 45.413  45.943  9.529   1.00 12.39  ? 98  VAL B CB    1 
ATOM 3616  C CG1   . VAL F 4 61  ? 45.338  46.598  8.170   1.00 17.48  ? 98  VAL B CG1   1 
ATOM 3617  C CG2   . VAL F 4 61  ? 44.938  44.508  9.478   1.00 13.62  ? 98  VAL B CG2   1 
ATOM 3618  N N     . THR F 4 62  ? 46.112  45.438  12.299  1.00 16.50  ? 99  THR B N     1 
ATOM 3619  C CA    . THR F 4 62  ? 46.165  44.706  13.565  1.00 19.01  ? 99  THR B CA    1 
ATOM 3620  C C     . THR F 4 62  ? 45.052  43.687  13.799  1.00 19.92  ? 99  THR B C     1 
ATOM 3621  O O     . THR F 4 62  ? 43.890  43.932  13.490  1.00 32.15  ? 99  THR B O     1 
ATOM 3622  C CB    . THR F 4 62  ? 46.163  45.675  14.722  1.00 22.98  ? 99  THR B CB    1 
ATOM 3623  O OG1   . THR F 4 62  ? 44.933  46.413  14.720  1.00 21.54  ? 99  THR B OG1   1 
ATOM 3624  C CG2   . THR F 4 62  ? 47.322  46.635  14.574  1.00 22.98  ? 99  THR B CG2   1 
ATOM 3625  N N     . ASN F 4 63  ? 45.422  42.553  14.386  1.00 24.80  ? 100 ASN B N     1 
ATOM 3626  C CA    . ASN F 4 63  ? 44.490  41.460  14.654  1.00 26.08  ? 100 ASN B CA    1 
ATOM 3627  C C     . ASN F 4 63  ? 43.575  41.702  15.861  1.00 31.97  ? 100 ASN B C     1 
ATOM 3628  O O     . ASN F 4 63  ? 43.454  40.842  16.735  1.00 42.16  ? 100 ASN B O     1 
ATOM 3629  C CB    . ASN F 4 63  ? 45.282  40.166  14.851  1.00 14.43  ? 100 ASN B CB    1 
ATOM 3630  C CG    . ASN F 4 63  ? 44.409  38.933  14.833  1.00 13.82  ? 100 ASN B CG    1 
ATOM 3631  O OD1   . ASN F 4 63  ? 44.313  38.227  15.830  1.00 11.02  ? 100 ASN B OD1   1 
ATOM 3632  N ND2   . ASN F 4 63  ? 43.770  38.660  13.698  1.00 15.55  ? 100 ASN B ND2   1 
ATOM 3633  N N     . GLY F 4 64  ? 42.926  42.865  15.904  1.00 58.12  ? 101 GLY B N     1 
ATOM 3634  C CA    . GLY F 4 64  ? 42.038  43.176  17.012  1.00 62.42  ? 101 GLY B CA    1 
ATOM 3635  C C     . GLY F 4 64  ? 40.644  43.479  16.510  1.00 64.53  ? 101 GLY B C     1 
ATOM 3636  O O     . GLY F 4 64  ? 40.472  43.834  15.346  1.00 55.21  ? 101 GLY B O     1 
ATOM 3637  N N     . LYS F 4 65  ? 39.648  43.348  17.382  1.00 69.03  ? 102 LYS B N     1 
ATOM 3638  C CA    . LYS F 4 65  ? 38.255  43.592  17.004  1.00 69.97  ? 102 LYS B CA    1 
ATOM 3639  C C     . LYS F 4 65  ? 38.087  44.870  16.192  1.00 72.07  ? 102 LYS B C     1 
ATOM 3640  O O     . LYS F 4 65  ? 37.254  44.938  15.287  1.00 57.35  ? 102 LYS B O     1 
ATOM 3641  C CB    . LYS F 4 65  ? 37.370  43.651  18.257  1.00 55.37  ? 102 LYS B CB    1 
ATOM 3642  C CG    . LYS F 4 65  ? 35.877  43.677  17.957  1.00 55.33  ? 102 LYS B CG    1 
ATOM 3643  C CD    . LYS F 4 65  ? 35.082  42.867  18.994  1.00 54.68  ? 102 LYS B CD    1 
ATOM 3644  C CE    . LYS F 4 65  ? 34.802  43.644  20.275  1.00 52.65  ? 102 LYS B CE    1 
ATOM 3645  N NZ    . LYS F 4 65  ? 33.816  44.766  20.087  1.00 46.39  ? 102 LYS B NZ    1 
ATOM 3646  N N     . ASN F 4 66  ? 38.891  45.875  16.523  1.00 38.32  ? 103 ASN B N     1 
ATOM 3647  C CA    . ASN F 4 66  ? 38.851  47.158  15.837  1.00 41.75  ? 103 ASN B CA    1 
ATOM 3648  C C     . ASN F 4 66  ? 40.099  47.329  14.972  1.00 43.07  ? 103 ASN B C     1 
ATOM 3649  O O     . ASN F 4 66  ? 41.066  47.990  15.365  1.00 62.41  ? 103 ASN B O     1 
ATOM 3650  C CB    . ASN F 4 66  ? 38.732  48.291  16.866  1.00 60.23  ? 103 ASN B CB    1 
ATOM 3651  C CG    . ASN F 4 66  ? 39.588  48.052  18.109  1.00 62.66  ? 103 ASN B CG    1 
ATOM 3652  O OD1   . ASN F 4 66  ? 40.602  48.717  18.321  1.00 64.00  ? 103 ASN B OD1   1 
ATOM 3653  N ND2   . ASN F 4 66  ? 39.180  47.091  18.933  1.00 63.75  ? 103 ASN B ND2   1 
ATOM 3654  N N     . ILE F 4 67  ? 40.059  46.710  13.792  1.00 32.65  ? 104 ILE B N     1 
ATOM 3655  C CA    . ILE F 4 67  ? 41.154  46.751  12.821  1.00 31.60  ? 104 ILE B CA    1 
ATOM 3656  C C     . ILE F 4 67  ? 41.853  48.119  12.786  1.00 31.75  ? 104 ILE B C     1 
ATOM 3657  O O     . ILE F 4 67  ? 41.241  49.154  12.499  1.00 25.96  ? 104 ILE B O     1 
ATOM 3658  C CB    . ILE F 4 67  ? 40.634  46.420  11.394  1.00 17.60  ? 104 ILE B CB    1 
ATOM 3659  C CG1   . ILE F 4 67  ? 39.646  45.254  11.446  1.00 19.14  ? 104 ILE B CG1   1 
ATOM 3660  C CG2   . ILE F 4 67  ? 41.797  46.031  10.471  1.00 21.19  ? 104 ILE B CG2   1 
ATOM 3661  C CD1   . ILE F 4 67  ? 40.266  43.925  11.834  1.00 24.05  ? 104 ILE B CD1   1 
ATOM 3662  N N     . HIS F 4 68  ? 43.145  48.110  13.087  1.00 42.60  ? 105 HIS B N     1 
ATOM 3663  C CA    . HIS F 4 68  ? 43.963  49.319  13.097  1.00 41.74  ? 105 HIS B CA    1 
ATOM 3664  C C     . HIS F 4 68  ? 45.297  49.068  12.396  1.00 39.96  ? 105 HIS B C     1 
ATOM 3665  O O     . HIS F 4 68  ? 45.613  47.949  11.983  1.00 56.55  ? 105 HIS B O     1 
ATOM 3666  C CB    . HIS F 4 68  ? 44.269  49.757  14.530  1.00 52.22  ? 105 HIS B CB    1 
ATOM 3667  C CG    . HIS F 4 68  ? 43.078  50.237  15.294  1.00 51.90  ? 105 HIS B CG    1 
ATOM 3668  N ND1   . HIS F 4 68  ? 43.088  50.374  16.663  1.00 53.22  ? 105 HIS B ND1   1 
ATOM 3669  C CD2   . HIS F 4 68  ? 41.851  50.633  14.886  1.00 51.84  ? 105 HIS B CD2   1 
ATOM 3670  C CE1   . HIS F 4 68  ? 41.918  50.831  17.067  1.00 54.95  ? 105 HIS B CE1   1 
ATOM 3671  N NE2   . HIS F 4 68  ? 41.148  50.997  16.009  1.00 54.50  ? 105 HIS B NE2   1 
ATOM 3672  N N     . LEU F 4 69  ? 46.085  50.127  12.290  1.00 48.19  ? 106 LEU B N     1 
ATOM 3673  C CA    . LEU F 4 69  ? 47.391  50.055  11.667  1.00 49.65  ? 106 LEU B CA    1 
ATOM 3674  C C     . LEU F 4 69  ? 48.416  49.455  12.630  1.00 50.17  ? 106 LEU B C     1 
ATOM 3675  O O     . LEU F 4 69  ? 48.512  49.872  13.784  1.00 47.75  ? 106 LEU B O     1 
ATOM 3676  C CB    . LEU F 4 69  ? 47.833  51.458  11.254  1.00 40.00  ? 106 LEU B CB    1 
ATOM 3677  C CG    . LEU F 4 69  ? 47.383  51.945  9.878   1.00 40.36  ? 106 LEU B CG    1 
ATOM 3678  C CD1   . LEU F 4 69  ? 47.687  53.419  9.735   1.00 36.41  ? 106 LEU B CD1   1 
ATOM 3679  C CD2   . LEU F 4 69  ? 48.099  51.145  8.799   1.00 39.84  ? 106 LEU B CD2   1 
ATOM 3680  N N     . HIS F 4 70  ? 49.184  48.481  12.153  1.00 54.57  ? 107 HIS B N     1 
ATOM 3681  C CA    . HIS F 4 70  ? 50.209  47.837  12.968  1.00 49.23  ? 107 HIS B CA    1 
ATOM 3682  C C     . HIS F 4 70  ? 51.535  48.551  12.692  1.00 49.52  ? 107 HIS B C     1 
ATOM 3683  O O     . HIS F 4 70  ? 51.786  49.003  11.577  1.00 30.91  ? 107 HIS B O     1 
ATOM 3684  C CB    . HIS F 4 70  ? 50.290  46.352  12.595  1.00 23.11  ? 107 HIS B CB    1 
ATOM 3685  C CG    . HIS F 4 70  ? 51.172  45.531  13.486  1.00 21.71  ? 107 HIS B CG    1 
ATOM 3686  N ND1   . HIS F 4 70  ? 50.740  44.366  14.084  1.00 21.25  ? 107 HIS B ND1   1 
ATOM 3687  C CD2   . HIS F 4 70  ? 52.464  45.684  13.854  1.00 20.14  ? 107 HIS B CD2   1 
ATOM 3688  C CE1   . HIS F 4 70  ? 51.728  43.838  14.783  1.00 18.24  ? 107 HIS B CE1   1 
ATOM 3689  N NE2   . HIS F 4 70  ? 52.786  44.619  14.662  1.00 18.74  ? 107 HIS B NE2   1 
ATOM 3690  N N     . ALA F 4 71  ? 52.375  48.665  13.711  1.00 4.73   ? 108 ALA B N     1 
ATOM 3691  C CA    . ALA F 4 71  ? 53.659  49.332  13.571  1.00 4.73   ? 108 ALA B CA    1 
ATOM 3692  C C     . ALA F 4 71  ? 54.608  48.645  12.595  1.00 4.73   ? 108 ALA B C     1 
ATOM 3693  O O     . ALA F 4 71  ? 55.262  49.320  11.811  1.00 33.83  ? 108 ALA B O     1 
ATOM 3694  C CB    . ALA F 4 71  ? 54.318  49.458  14.921  1.00 42.74  ? 108 ALA B CB    1 
ATOM 3695  N N     . HIS F 4 72  ? 54.707  47.316  12.646  1.00 12.79  ? 109 HIS B N     1 
ATOM 3696  C CA    . HIS F 4 72  ? 55.588  46.570  11.735  1.00 10.84  ? 109 HIS B CA    1 
ATOM 3697  C C     . HIS F 4 72  ? 55.428  47.109  10.325  1.00 11.42  ? 109 HIS B C     1 
ATOM 3698  O O     . HIS F 4 72  ? 54.360  47.571  9.952   1.00 18.13  ? 109 HIS B O     1 
ATOM 3699  C CB    . HIS F 4 72  ? 55.223  45.085  11.715  1.00 20.11  ? 109 HIS B CB    1 
ATOM 3700  C CG    . HIS F 4 72  ? 55.578  44.347  12.967  1.00 16.35  ? 109 HIS B CG    1 
ATOM 3701  N ND1   . HIS F 4 72  ? 54.956  43.174  13.334  1.00 17.44  ? 109 HIS B ND1   1 
ATOM 3702  C CD2   . HIS F 4 72  ? 56.488  44.608  13.935  1.00 14.76  ? 109 HIS B CD2   1 
ATOM 3703  C CE1   . HIS F 4 72  ? 55.464  42.748  14.475  1.00 14.67  ? 109 HIS B CE1   1 
ATOM 3704  N NE2   . HIS F 4 72  ? 56.395  43.600  14.861  1.00 12.70  ? 109 HIS B NE2   1 
ATOM 3705  N N     . SER F 4 73  ? 56.486  47.031  9.535   1.00 16.17  ? 110 SER B N     1 
ATOM 3706  C CA    . SER F 4 73  ? 56.459  47.527  8.173   1.00 15.88  ? 110 SER B CA    1 
ATOM 3707  C C     . SER F 4 73  ? 56.614  46.404  7.163   1.00 16.29  ? 110 SER B C     1 
ATOM 3708  O O     . SER F 4 73  ? 57.568  45.629  7.217   1.00 33.30  ? 110 SER B O     1 
ATOM 3709  C CB    . SER F 4 73  ? 57.585  48.536  7.979   1.00 44.19  ? 110 SER B CB    1 
ATOM 3710  O OG    . SER F 4 73  ? 57.861  48.719  6.598   1.00 50.30  ? 110 SER B OG    1 
ATOM 3711  N N     . LEU F 4 74  ? 55.672  46.328  6.236   1.00 30.99  ? 111 LEU B N     1 
ATOM 3712  C CA    . LEU F 4 74  ? 55.703  45.316  5.200   1.00 30.33  ? 111 LEU B CA    1 
ATOM 3713  C C     . LEU F 4 74  ? 56.757  45.716  4.177   1.00 28.81  ? 111 LEU B C     1 
ATOM 3714  O O     . LEU F 4 74  ? 56.423  46.294  3.152   1.00 25.13  ? 111 LEU B O     1 
ATOM 3715  C CB    . LEU F 4 74  ? 54.344  45.251  4.510   1.00 7.65   ? 111 LEU B CB    1 
ATOM 3716  C CG    . LEU F 4 74  ? 54.018  43.876  3.951   1.00 7.27   ? 111 LEU B CG    1 
ATOM 3717  C CD1   . LEU F 4 74  ? 53.282  43.103  5.024   1.00 7.27   ? 111 LEU B CD1   1 
ATOM 3718  C CD2   . LEU F 4 74  ? 53.168  43.978  2.721   1.00 7.27   ? 111 LEU B CD2   1 
ATOM 3719  N N     . VAL F 4 75  ? 58.024  45.422  4.447   1.00 11.73  ? 112 VAL B N     1 
ATOM 3720  C CA    . VAL F 4 75  ? 59.098  45.767  3.508   1.00 14.59  ? 112 VAL B CA    1 
ATOM 3721  C C     . VAL F 4 75  ? 59.267  44.737  2.379   1.00 16.45  ? 112 VAL B C     1 
ATOM 3722  O O     . VAL F 4 75  ? 59.310  43.533  2.614   1.00 29.39  ? 112 VAL B O     1 
ATOM 3723  C CB    . VAL F 4 75  ? 60.453  45.922  4.240   1.00 34.75  ? 112 VAL B CB    1 
ATOM 3724  C CG1   . VAL F 4 75  ? 60.270  46.770  5.471   1.00 33.06  ? 112 VAL B CG1   1 
ATOM 3725  C CG2   . VAL F 4 75  ? 61.032  44.561  4.606   1.00 32.67  ? 112 VAL B CG2   1 
ATOM 3726  N N     . GLY F 4 76  ? 59.363  45.222  1.150   1.00 17.23  ? 113 GLY B N     1 
ATOM 3727  C CA    . GLY F 4 76  ? 59.528  44.326  0.022   1.00 20.85  ? 113 GLY B CA    1 
ATOM 3728  C C     . GLY F 4 76  ? 60.070  44.998  -1.232  1.00 23.50  ? 113 GLY B C     1 
ATOM 3729  O O     . GLY F 4 76  ? 61.144  45.601  -1.213  1.00 70.34  ? 113 GLY B O     1 
ATOM 3730  N N     . LYS F 4 77  ? 59.326  44.888  -2.327  1.00 26.32  ? 114 LYS B N     1 
ATOM 3731  C CA    . LYS F 4 77  ? 59.740  45.475  -3.596  1.00 28.73  ? 114 LYS B CA    1 
ATOM 3732  C C     . LYS F 4 77  ? 59.135  46.858  -3.732  1.00 31.05  ? 114 LYS B C     1 
ATOM 3733  O O     . LYS F 4 77  ? 59.743  47.855  -3.338  1.00 74.08  ? 114 LYS B O     1 
ATOM 3734  C CB    . LYS F 4 77  ? 59.280  44.593  -4.760  1.00 64.08  ? 114 LYS B CB    1 
ATOM 3735  C CG    . LYS F 4 77  ? 59.568  45.157  -6.151  1.00 63.27  ? 114 LYS B CG    1 
ATOM 3736  C CD    . LYS F 4 77  ? 61.057  45.299  -6.414  1.00 69.70  ? 114 LYS B CD    1 
ATOM 3737  C CE    . LYS F 4 77  ? 61.320  45.691  -7.862  1.00 70.15  ? 114 LYS B CE    1 
ATOM 3738  N NZ    . LYS F 4 77  ? 62.770  45.922  -8.136  1.00 67.77  ? 114 LYS B NZ    1 
ATOM 3739  N N     . HIS F 4 78  ? 57.930  46.910  -4.286  1.00 83.02  ? 115 HIS B N     1 
ATOM 3740  C CA    . HIS F 4 78  ? 57.230  48.169  -4.472  1.00 79.07  ? 115 HIS B CA    1 
ATOM 3741  C C     . HIS F 4 78  ? 56.902  48.840  -3.137  1.00 74.66  ? 115 HIS B C     1 
ATOM 3742  O O     . HIS F 4 78  ? 56.449  49.988  -3.102  1.00 56.09  ? 115 HIS B O     1 
ATOM 3743  C CB    . HIS F 4 78  ? 55.953  47.920  -5.264  1.00 79.76  ? 115 HIS B CB    1 
ATOM 3744  C CG    . HIS F 4 78  ? 55.945  48.571  -6.611  1.00 81.43  ? 115 HIS B CG    1 
ATOM 3745  N ND1   . HIS F 4 78  ? 55.289  49.761  -6.861  1.00 82.12  ? 115 HIS B ND1   1 
ATOM 3746  C CD2   . HIS F 4 78  ? 56.512  48.200  -7.782  1.00 81.23  ? 115 HIS B CD2   1 
ATOM 3747  C CE1   . HIS F 4 78  ? 55.451  50.090  -8.128  1.00 79.35  ? 115 HIS B CE1   1 
ATOM 3748  N NE2   . HIS F 4 78  ? 56.188  49.160  -8.712  1.00 77.15  ? 115 HIS B NE2   1 
ATOM 3749  N N     . CYS F 4 79  ? 57.142  48.118  -2.044  1.00 37.85  ? 116 CYS B N     1 
ATOM 3750  C CA    . CYS F 4 79  ? 56.876  48.627  -0.706  1.00 36.83  ? 116 CYS B CA    1 
ATOM 3751  C C     . CYS F 4 79  ? 57.757  49.819  -0.417  1.00 32.39  ? 116 CYS B C     1 
ATOM 3752  O O     . CYS F 4 79  ? 58.813  49.974  -1.017  1.00 34.22  ? 116 CYS B O     1 
ATOM 3753  C CB    . CYS F 4 79  ? 57.174  47.565  0.329   1.00 59.69  ? 116 CYS B CB    1 
ATOM 3754  S SG    . CYS F 4 79  ? 56.610  45.915  -0.153  1.00 57.22  ? 116 CYS B SG    1 
ATOM 3755  N N     . GLU F 4 80  ? 57.298  50.639  0.520   1.00 28.42  ? 117 GLU B N     1 
ATOM 3756  C CA    . GLU F 4 80  ? 57.973  51.849  0.983   1.00 28.24  ? 117 GLU B CA    1 
ATOM 3757  C C     . GLU F 4 80  ? 57.104  52.380  2.120   1.00 29.03  ? 117 GLU B C     1 
ATOM 3758  O O     . GLU F 4 80  ? 55.965  52.771  1.883   1.00 26.11  ? 117 GLU B O     1 
ATOM 3759  C CB    . GLU F 4 80  ? 58.032  52.915  -0.116  1.00 39.48  ? 117 GLU B CB    1 
ATOM 3760  C CG    . GLU F 4 80  ? 59.148  52.746  -1.157  1.00 39.26  ? 117 GLU B CG    1 
ATOM 3761  C CD    . GLU F 4 80  ? 59.183  53.893  -2.165  1.00 39.05  ? 117 GLU B CD    1 
ATOM 3762  O OE1   . GLU F 4 80  ? 59.423  55.044  -1.737  1.00 38.12  ? 117 GLU B OE1   1 
ATOM 3763  O OE2   . GLU F 4 80  ? 58.961  53.649  -3.378  1.00 37.72  ? 117 GLU B OE2   1 
ATOM 3764  N N     . ASP F 4 81  ? 57.631  52.390  3.342   1.00 16.16  ? 118 ASP B N     1 
ATOM 3765  C CA    . ASP F 4 81  ? 56.881  52.869  4.503   1.00 19.87  ? 118 ASP B CA    1 
ATOM 3766  C C     . ASP F 4 81  ? 55.773  51.891  4.835   1.00 21.13  ? 118 ASP B C     1 
ATOM 3767  O O     . ASP F 4 81  ? 54.842  52.206  5.564   1.00 45.24  ? 118 ASP B O     1 
ATOM 3768  C CB    . ASP F 4 81  ? 56.301  54.260  4.245   1.00 43.73  ? 118 ASP B CB    1 
ATOM 3769  C CG    . ASP F 4 81  ? 57.378  55.307  4.089   1.00 46.37  ? 118 ASP B CG    1 
ATOM 3770  O OD1   . ASP F 4 81  ? 57.046  56.502  3.979   1.00 44.56  ? 118 ASP B OD1   1 
ATOM 3771  O OD2   . ASP F 4 81  ? 58.567  54.932  4.076   1.00 47.39  ? 118 ASP B OD2   1 
ATOM 3772  N N     . GLY F 4 82  ? 55.890  50.694  4.278   1.00 12.49  ? 119 GLY B N     1 
ATOM 3773  C CA    . GLY F 4 82  ? 54.910  49.651  4.517   1.00 15.28  ? 119 GLY B CA    1 
ATOM 3774  C C     . GLY F 4 82  ? 53.619  49.718  3.722   1.00 16.27  ? 119 GLY B C     1 
ATOM 3775  O O     . GLY F 4 82  ? 52.567  49.383  4.257   1.00 32.62  ? 119 GLY B O     1 
ATOM 3776  N N     . VAL F 4 83  ? 53.678  50.134  2.459   1.00 36.79  ? 120 VAL B N     1 
ATOM 3777  C CA    . VAL F 4 83  ? 52.464  50.219  1.640   1.00 37.57  ? 120 VAL B CA    1 
ATOM 3778  C C     . VAL F 4 83  ? 52.689  49.684  0.231   1.00 36.48  ? 120 VAL B C     1 
ATOM 3779  O O     . VAL F 4 83  ? 52.324  50.328  -0.756  1.00 59.77  ? 120 VAL B O     1 
ATOM 3780  C CB    . VAL F 4 83  ? 51.949  51.678  1.527   1.00 56.29  ? 120 VAL B CB    1 
ATOM 3781  C CG1   . VAL F 4 83  ? 51.491  52.172  2.881   1.00 56.24  ? 120 VAL B CG1   1 
ATOM 3782  C CG2   . VAL F 4 83  ? 53.042  52.584  0.982   1.00 59.95  ? 120 VAL B CG2   1 
ATOM 3783  N N     . CYS F 4 84  ? 53.292  48.504  0.143   1.00 59.27  ? 121 CYS B N     1 
ATOM 3784  C CA    . CYS F 4 84  ? 53.577  47.888  -1.142  1.00 61.19  ? 121 CYS B CA    1 
ATOM 3785  C C     . CYS F 4 84  ? 52.460  48.213  -2.115  1.00 61.15  ? 121 CYS B C     1 
ATOM 3786  O O     . CYS F 4 84  ? 51.307  47.860  -1.885  1.00 69.87  ? 121 CYS B O     1 
ATOM 3787  C CB    . CYS F 4 84  ? 53.696  46.377  -0.986  1.00 77.79  ? 121 CYS B CB    1 
ATOM 3788  S SG    . CYS F 4 84  ? 54.672  45.856  0.462   1.00 84.44  ? 121 CYS B SG    1 
ATOM 3789  N N     . THR F 4 85  ? 52.809  48.909  -3.189  1.00 9.50   ? 122 THR B N     1 
ATOM 3790  C CA    . THR F 4 85  ? 51.841  49.284  -4.208  1.00 9.38   ? 122 THR B CA    1 
ATOM 3791  C C     . THR F 4 85  ? 52.107  48.530  -5.503  1.00 8.71   ? 122 THR B C     1 
ATOM 3792  O O     . THR F 4 85  ? 53.178  48.669  -6.088  1.00 30.41  ? 122 THR B O     1 
ATOM 3793  C CB    . THR F 4 85  ? 51.900  50.803  -4.475  1.00 44.45  ? 122 THR B CB    1 
ATOM 3794  O OG1   . THR F 4 85  ? 51.805  51.514  -3.232  1.00 45.56  ? 122 THR B OG1   1 
ATOM 3795  C CG2   . THR F 4 85  ? 50.751  51.230  -5.378  1.00 46.71  ? 122 THR B CG2   1 
ATOM 3796  N N     . VAL F 4 86  ? 51.126  47.735  -5.935  1.00 17.70  ? 123 VAL B N     1 
ATOM 3797  C CA    . VAL F 4 86  ? 51.247  46.958  -7.166  1.00 18.70  ? 123 VAL B CA    1 
ATOM 3798  C C     . VAL F 4 86  ? 50.226  47.413  -8.203  1.00 20.54  ? 123 VAL B C     1 
ATOM 3799  O O     . VAL F 4 86  ? 49.064  47.665  -7.876  1.00 23.02  ? 123 VAL B O     1 
ATOM 3800  C CB    . VAL F 4 86  ? 51.076  45.455  -6.899  1.00 29.25  ? 123 VAL B CB    1 
ATOM 3801  C CG1   . VAL F 4 86  ? 49.607  45.055  -6.977  1.00 27.46  ? 123 VAL B CG1   1 
ATOM 3802  C CG2   . VAL F 4 86  ? 51.899  44.669  -7.890  1.00 31.56  ? 123 VAL B CG2   1 
ATOM 3803  N N     . THR F 4 87  ? 50.670  47.530  -9.455  1.00 31.41  ? 124 THR B N     1 
ATOM 3804  C CA    . THR F 4 87  ? 49.800  47.983  -10.541 1.00 32.38  ? 124 THR B CA    1 
ATOM 3805  C C     . THR F 4 87  ? 49.186  46.825  -11.285 1.00 31.35  ? 124 THR B C     1 
ATOM 3806  O O     . THR F 4 87  ? 49.760  46.306  -12.240 1.00 72.68  ? 124 THR B O     1 
ATOM 3807  C CB    . THR F 4 87  ? 50.568  48.863  -11.543 1.00 75.93  ? 124 THR B CB    1 
ATOM 3808  O OG1   . THR F 4 87  ? 51.807  48.228  -11.885 1.00 75.94  ? 124 THR B OG1   1 
ATOM 3809  C CG2   . THR F 4 87  ? 50.837  50.233  -10.948 1.00 77.89  ? 124 THR B CG2   1 
ATOM 3810  N N     . ALA F 4 88  ? 48.008  46.426  -10.832 1.00 28.36  ? 125 ALA B N     1 
ATOM 3811  C CA    . ALA F 4 88  ? 47.298  45.308  -11.435 1.00 30.10  ? 125 ALA B CA    1 
ATOM 3812  C C     . ALA F 4 88  ? 47.231  45.487  -12.945 1.00 30.22  ? 125 ALA B C     1 
ATOM 3813  O O     . ALA F 4 88  ? 46.534  46.383  -13.451 1.00 47.05  ? 125 ALA B O     1 
ATOM 3814  C CB    . ALA F 4 88  ? 45.893  45.197  -10.855 1.00 37.95  ? 125 ALA B CB    1 
ATOM 3815  N N     . GLY F 4 89  ? 47.983  44.638  -13.647 1.00 90.81  ? 126 GLY B N     1 
ATOM 3816  C CA    . GLY F 4 89  ? 48.037  44.683  -15.098 1.00 89.39  ? 126 GLY B CA    1 
ATOM 3817  C C     . GLY F 4 89  ? 46.652  44.663  -15.720 1.00 90.53  ? 126 GLY B C     1 
ATOM 3818  O O     . GLY F 4 89  ? 45.685  44.268  -15.061 1.00 80.81  ? 126 GLY B O     1 
ATOM 3819  N N     . PRO F 4 90  ? 46.520  45.087  -16.988 1.00 42.88  ? 127 PRO B N     1 
ATOM 3820  C CA    . PRO F 4 90  ? 45.241  45.119  -17.704 1.00 43.44  ? 127 PRO B CA    1 
ATOM 3821  C C     . PRO F 4 90  ? 44.797  43.728  -18.150 1.00 44.94  ? 127 PRO B C     1 
ATOM 3822  O O     . PRO F 4 90  ? 45.631  42.850  -18.407 1.00 51.34  ? 127 PRO B O     1 
ATOM 3823  C CB    . PRO F 4 90  ? 45.537  46.044  -18.873 1.00 43.18  ? 127 PRO B CB    1 
ATOM 3824  C CG    . PRO F 4 90  ? 46.950  45.685  -19.204 1.00 42.61  ? 127 PRO B CG    1 
ATOM 3825  C CD    . PRO F 4 90  ? 47.610  45.604  -17.838 1.00 41.91  ? 127 PRO B CD    1 
ATOM 3826  N N     . LYS F 4 91  ? 43.483  43.542  -18.247 1.00 28.28  ? 128 LYS B N     1 
ATOM 3827  C CA    . LYS F 4 91  ? 42.892  42.255  -18.643 1.00 27.69  ? 128 LYS B CA    1 
ATOM 3828  C C     . LYS F 4 91  ? 43.114  41.169  -17.588 1.00 25.64  ? 128 LYS B C     1 
ATOM 3829  O O     . LYS F 4 91  ? 42.180  40.448  -17.225 1.00 69.82  ? 128 LYS B O     1 
ATOM 3830  C CB    . LYS F 4 91  ? 43.445  41.792  -20.001 1.00 78.22  ? 128 LYS B CB    1 
ATOM 3831  C CG    . LYS F 4 91  ? 43.128  42.741  -21.171 1.00 83.35  ? 128 LYS B CG    1 
ATOM 3832  C CD    . LYS F 4 91  ? 41.622  42.959  -21.355 1.00 83.54  ? 128 LYS B CD    1 
ATOM 3833  C CE    . LYS F 4 91  ? 41.329  44.013  -22.422 1.00 82.88  ? 128 LYS B CE    1 
ATOM 3834  N NZ    . LYS F 4 91  ? 39.875  44.363  -22.525 1.00 85.61  ? 128 LYS B NZ    1 
ATOM 3835  N N     . ASP F 4 92  ? 44.350  41.058  -17.102 1.00 48.17  ? 129 ASP B N     1 
ATOM 3836  C CA    . ASP F 4 92  ? 44.688  40.085  -16.070 1.00 48.50  ? 129 ASP B CA    1 
ATOM 3837  C C     . ASP F 4 92  ? 44.444  40.715  -14.700 1.00 45.57  ? 129 ASP B C     1 
ATOM 3838  O O     . ASP F 4 92  ? 45.304  41.398  -14.162 1.00 36.18  ? 129 ASP B O     1 
ATOM 3839  C CB    . ASP F 4 92  ? 46.155  39.683  -16.177 1.00 44.73  ? 129 ASP B CB    1 
ATOM 3840  C CG    . ASP F 4 92  ? 46.557  38.654  -15.115 1.00 46.26  ? 129 ASP B CG    1 
ATOM 3841  O OD1   . ASP F 4 92  ? 46.090  38.766  -13.958 1.00 45.74  ? 129 ASP B OD1   1 
ATOM 3842  O OD2   . ASP F 4 92  ? 47.354  37.744  -15.438 1.00 44.46  ? 129 ASP B OD2   1 
ATOM 3843  N N     . MET F 4 93  ? 43.275  40.476  -14.126 1.00 37.70  ? 130 MET B N     1 
ATOM 3844  C CA    . MET F 4 93  ? 42.968  41.060  -12.831 1.00 38.92  ? 130 MET B CA    1 
ATOM 3845  C C     . MET F 4 93  ? 43.506  40.248  -11.664 1.00 39.87  ? 130 MET B C     1 
ATOM 3846  O O     . MET F 4 93  ? 42.936  40.266  -10.574 1.00 44.35  ? 130 MET B O     1 
ATOM 3847  C CB    . MET F 4 93  ? 41.451  41.264  -12.690 1.00 36.36  ? 130 MET B CB    1 
ATOM 3848  C CG    . MET F 4 93  ? 40.891  42.274  -13.690 1.00 35.12  ? 130 MET B CG    1 
ATOM 3849  S SD    . MET F 4 93  ? 41.910  43.788  -13.845 1.00 30.67  ? 130 MET B SD    1 
ATOM 3850  C CE    . MET F 4 93  ? 41.099  44.834  -12.651 1.00 28.89  ? 130 MET B CE    1 
ATOM 3851  N N     . VAL F 4 94  ? 44.614  39.550  -11.886 1.00 29.78  ? 131 VAL B N     1 
ATOM 3852  C CA    . VAL F 4 94  ? 45.209  38.751  -10.828 1.00 31.37  ? 131 VAL B CA    1 
ATOM 3853  C C     . VAL F 4 94  ? 46.714  38.985  -10.683 1.00 32.92  ? 131 VAL B C     1 
ATOM 3854  O O     . VAL F 4 94  ? 47.525  38.378  -11.387 1.00 39.40  ? 131 VAL B O     1 
ATOM 3855  C CB    . VAL F 4 94  ? 44.912  37.238  -11.041 1.00 49.49  ? 131 VAL B CB    1 
ATOM 3856  C CG1   . VAL F 4 94  ? 45.356  36.799  -12.429 1.00 53.05  ? 131 VAL B CG1   1 
ATOM 3857  C CG2   . VAL F 4 94  ? 45.605  36.412  -9.981  1.00 50.91  ? 131 VAL B CG2   1 
ATOM 3858  N N     . VAL F 4 95  ? 47.073  39.887  -9.771  1.00 59.60  ? 132 VAL B N     1 
ATOM 3859  C CA    . VAL F 4 95  ? 48.471  40.206  -9.494  1.00 60.05  ? 132 VAL B CA    1 
ATOM 3860  C C     . VAL F 4 95  ? 48.846  39.718  -8.095  1.00 59.69  ? 132 VAL B C     1 
ATOM 3861  O O     . VAL F 4 95  ? 48.263  40.153  -7.100  1.00 44.32  ? 132 VAL B O     1 
ATOM 3862  C CB    . VAL F 4 95  ? 48.743  41.733  -9.574  1.00 51.16  ? 132 VAL B CB    1 
ATOM 3863  C CG1   . VAL F 4 95  ? 48.568  42.222  -11.016 1.00 52.07  ? 132 VAL B CG1   1 
ATOM 3864  C CG2   . VAL F 4 95  ? 47.811  42.484  -8.616  1.00 48.75  ? 132 VAL B CG2   1 
ATOM 3865  N N     . GLY F 4 96  ? 49.812  38.806  -8.030  1.00 51.44  ? 133 GLY B N     1 
ATOM 3866  C CA    . GLY F 4 96  ? 50.256  38.273  -6.754  1.00 53.22  ? 133 GLY B CA    1 
ATOM 3867  C C     . GLY F 4 96  ? 51.376  39.090  -6.136  1.00 53.12  ? 133 GLY B C     1 
ATOM 3868  O O     . GLY F 4 96  ? 51.974  39.946  -6.783  1.00 60.45  ? 133 GLY B O     1 
ATOM 3869  N N     . PHE F 4 97  ? 51.666  38.817  -4.872  1.00 60.33  ? 134 PHE B N     1 
ATOM 3870  C CA    . PHE F 4 97  ? 52.711  39.533  -4.162  1.00 57.30  ? 134 PHE B CA    1 
ATOM 3871  C C     . PHE F 4 97  ? 53.837  38.586  -3.808  1.00 57.73  ? 134 PHE B C     1 
ATOM 3872  O O     . PHE F 4 97  ? 53.716  37.803  -2.874  1.00 39.03  ? 134 PHE B O     1 
ATOM 3873  C CB    . PHE F 4 97  ? 52.117  40.148  -2.911  1.00 13.35  ? 134 PHE B CB    1 
ATOM 3874  C CG    . PHE F 4 97  ? 51.051  41.173  -3.199  1.00 9.53   ? 134 PHE B CG    1 
ATOM 3875  C CD1   . PHE F 4 97  ? 51.401  42.511  -3.441  1.00 7.29   ? 134 PHE B CD1   1 
ATOM 3876  C CD2   . PHE F 4 97  ? 49.701  40.819  -3.178  1.00 8.20   ? 134 PHE B CD2   1 
ATOM 3877  C CE1   . PHE F 4 97  ? 50.427  43.484  -3.653  1.00 4.53   ? 134 PHE B CE1   1 
ATOM 3878  C CE2   . PHE F 4 97  ? 48.715  41.777  -3.389  1.00 6.47   ? 134 PHE B CE2   1 
ATOM 3879  C CZ    . PHE F 4 97  ? 49.074  43.121  -3.622  1.00 4.71   ? 134 PHE B CZ    1 
ATOM 3880  N N     . ALA F 4 98  ? 54.920  38.668  -4.578  1.00 48.50  ? 135 ALA B N     1 
ATOM 3881  C CA    . ALA F 4 98  ? 56.098  37.828  -4.406  1.00 47.40  ? 135 ALA B CA    1 
ATOM 3882  C C     . ALA F 4 98  ? 56.683  37.882  -3.010  1.00 46.96  ? 135 ALA B C     1 
ATOM 3883  O O     . ALA F 4 98  ? 55.969  38.034  -2.022  1.00 66.99  ? 135 ALA B O     1 
ATOM 3884  C CB    . ALA F 4 98  ? 57.164  38.231  -5.415  1.00 70.72  ? 135 ALA B CB    1 
ATOM 3885  N N     . ASN F 4 99  ? 58.002  37.751  -2.938  1.00 40.78  ? 136 ASN B N     1 
ATOM 3886  C CA    . ASN F 4 99  ? 58.708  37.779  -1.662  1.00 39.66  ? 136 ASN B CA    1 
ATOM 3887  C C     . ASN F 4 99  ? 58.523  39.122  -0.965  1.00 38.61  ? 136 ASN B C     1 
ATOM 3888  O O     . ASN F 4 99  ? 59.230  40.092  -1.245  1.00 65.79  ? 136 ASN B O     1 
ATOM 3889  C CB    . ASN F 4 99  ? 60.190  37.472  -1.880  1.00 66.02  ? 136 ASN B CB    1 
ATOM 3890  C CG    . ASN F 4 99  ? 60.744  38.156  -3.104  1.00 71.36  ? 136 ASN B CG    1 
ATOM 3891  O OD1   . ASN F 4 99  ? 60.845  39.378  -3.144  1.00 75.35  ? 136 ASN B OD1   1 
ATOM 3892  N ND2   . ASN F 4 99  ? 61.095  37.372  -4.118  1.00 70.64  ? 136 ASN B ND2   1 
ATOM 3893  N N     . LEU F 4 100 ? 57.550  39.155  -0.056  1.00 31.93  ? 137 LEU B N     1 
ATOM 3894  C CA    . LEU F 4 100 ? 57.222  40.349  0.705   1.00 28.67  ? 137 LEU B CA    1 
ATOM 3895  C C     . LEU F 4 100 ? 58.175  40.594  1.874   1.00 29.33  ? 137 LEU B C     1 
ATOM 3896  O O     . LEU F 4 100 ? 59.036  41.472  1.794   1.00 29.50  ? 137 LEU B O     1 
ATOM 3897  C CB    . LEU F 4 100 ? 55.786  40.258  1.222   1.00 4.78   ? 137 LEU B CB    1 
ATOM 3898  C CG    . LEU F 4 100 ? 54.735  41.074  0.460   1.00 4.06   ? 137 LEU B CG    1 
ATOM 3899  C CD1   . LEU F 4 100 ? 53.338  40.875  1.057   1.00 4.23   ? 137 LEU B CD1   1 
ATOM 3900  C CD2   . LEU F 4 100 ? 55.121  42.534  0.508   1.00 4.06   ? 137 LEU B CD2   1 
ATOM 3901  N N     . GLY F 4 101 ? 58.014  39.821  2.949   1.00 11.71  ? 138 GLY B N     1 
ATOM 3902  C CA    . GLY F 4 101 ? 58.864  39.978  4.119   1.00 11.71  ? 138 GLY B CA    1 
ATOM 3903  C C     . GLY F 4 101 ? 58.300  40.998  5.092   1.00 11.71  ? 138 GLY B C     1 
ATOM 3904  O O     . GLY F 4 101 ? 58.004  42.123  4.690   1.00 11.71  ? 138 GLY B O     1 
ATOM 3905  N N     . ILE F 4 102 ? 58.152  40.606  6.362   1.00 8.16   ? 139 ILE B N     1 
ATOM 3906  C CA    . ILE F 4 102 ? 57.605  41.459  7.427   1.00 8.16   ? 139 ILE B CA    1 
ATOM 3907  C C     . ILE F 4 102 ? 58.732  42.065  8.225   1.00 8.16   ? 139 ILE B C     1 
ATOM 3908  O O     . ILE F 4 102 ? 59.689  41.378  8.568   1.00 20.33  ? 139 ILE B O     1 
ATOM 3909  C CB    . ILE F 4 102 ? 56.774  40.661  8.441   1.00 11.96  ? 139 ILE B CB    1 
ATOM 3910  C CG1   . ILE F 4 102 ? 55.677  39.846  7.753   1.00 14.52  ? 139 ILE B CG1   1 
ATOM 3911  C CG2   . ILE F 4 102 ? 56.144  41.598  9.413   1.00 14.90  ? 139 ILE B CG2   1 
ATOM 3912  C CD1   . ILE F 4 102 ? 54.522  40.655  7.248   1.00 9.54   ? 139 ILE B CD1   1 
ATOM 3913  N N     . LEU F 4 103 ? 58.626  43.349  8.532   1.00 11.80  ? 140 LEU B N     1 
ATOM 3914  C CA    . LEU F 4 103 ? 59.658  43.997  9.316   1.00 9.43   ? 140 LEU B CA    1 
ATOM 3915  C C     . LEU F 4 103 ? 59.107  44.222  10.709  1.00 9.48   ? 140 LEU B C     1 
ATOM 3916  O O     . LEU F 4 103 ? 58.022  44.778  10.872  1.00 14.94  ? 140 LEU B O     1 
ATOM 3917  C CB    . LEU F 4 103 ? 60.070  45.320  8.680   1.00 35.48  ? 140 LEU B CB    1 
ATOM 3918  C CG    . LEU F 4 103 ? 61.410  45.850  9.186   1.00 35.07  ? 140 LEU B CG    1 
ATOM 3919  C CD1   . LEU F 4 103 ? 62.428  44.737  9.179   1.00 33.62  ? 140 LEU B CD1   1 
ATOM 3920  C CD2   . LEU F 4 103 ? 61.875  46.995  8.314   1.00 30.55  ? 140 LEU B CD2   1 
ATOM 3921  N N     . HIS F 4 104 ? 59.879  43.777  11.700  1.00 18.02  ? 141 HIS B N     1 
ATOM 3922  C CA    . HIS F 4 104 ? 59.531  43.824  13.126  1.00 19.24  ? 141 HIS B CA    1 
ATOM 3923  C C     . HIS F 4 104 ? 60.001  45.078  13.821  1.00 17.44  ? 141 HIS B C     1 
ATOM 3924  O O     . HIS F 4 104 ? 61.190  45.312  13.965  1.00 20.71  ? 141 HIS B O     1 
ATOM 3925  C CB    . HIS F 4 104 ? 60.168  42.624  13.821  1.00 19.42  ? 141 HIS B CB    1 
ATOM 3926  C CG    . HIS F 4 104 ? 59.538  42.257  15.123  1.00 17.83  ? 141 HIS B CG    1 
ATOM 3927  N ND1   . HIS F 4 104 ? 58.826  41.090  15.301  1.00 18.60  ? 141 HIS B ND1   1 
ATOM 3928  C CD2   . HIS F 4 104 ? 59.520  42.893  16.316  1.00 16.90  ? 141 HIS B CD2   1 
ATOM 3929  C CE1   . HIS F 4 104 ? 58.393  41.022  16.545  1.00 20.52  ? 141 HIS B CE1   1 
ATOM 3930  N NE2   . HIS F 4 104 ? 58.800  42.106  17.183  1.00 18.92  ? 141 HIS B NE2   1 
ATOM 3931  N N     . VAL F 4 105 ? 59.054  45.875  14.266  1.00 4.01   ? 142 VAL B N     1 
ATOM 3932  C CA    . VAL F 4 105 ? 59.379  47.102  14.962  1.00 4.01   ? 142 VAL B CA    1 
ATOM 3933  C C     . VAL F 4 105 ? 59.691  46.708  16.391  1.00 6.60   ? 142 VAL B C     1 
ATOM 3934  O O     . VAL F 4 105 ? 59.310  45.625  16.834  1.00 23.06  ? 142 VAL B O     1 
ATOM 3935  C CB    . VAL F 4 105 ? 58.164  48.075  14.959  1.00 16.66  ? 142 VAL B CB    1 
ATOM 3936  C CG1   . VAL F 4 105 ? 56.976  47.417  15.629  1.00 14.90  ? 142 VAL B CG1   1 
ATOM 3937  C CG2   . VAL F 4 105 ? 58.514  49.382  15.658  1.00 17.62  ? 142 VAL B CG2   1 
ATOM 3938  N N     . THR F 4 106 ? 60.396  47.563  17.119  1.00 23.57  ? 143 THR B N     1 
ATOM 3939  C CA    . THR F 4 106 ? 60.682  47.235  18.506  1.00 27.15  ? 143 THR B CA    1 
ATOM 3940  C C     . THR F 4 106 ? 59.526  47.702  19.374  1.00 27.21  ? 143 THR B C     1 
ATOM 3941  O O     . THR F 4 106 ? 58.599  48.366  18.898  1.00 23.98  ? 143 THR B O     1 
ATOM 3942  C CB    . THR F 4 106 ? 61.977  47.883  19.028  1.00 34.50  ? 143 THR B CB    1 
ATOM 3943  O OG1   . THR F 4 106 ? 62.090  47.623  20.433  1.00 38.32  ? 143 THR B OG1   1 
ATOM 3944  C CG2   . THR F 4 106 ? 61.967  49.379  18.810  1.00 39.17  ? 143 THR B CG2   1 
ATOM 3945  N N     . LYS F 4 107 ? 59.583  47.351  20.651  1.00 21.32  ? 144 LYS B N     1 
ATOM 3946  C CA    . LYS F 4 107 ? 58.524  47.721  21.568  1.00 23.08  ? 144 LYS B CA    1 
ATOM 3947  C C     . LYS F 4 107 ? 58.670  49.183  21.933  1.00 20.70  ? 144 LYS B C     1 
ATOM 3948  O O     . LYS F 4 107 ? 57.725  49.803  22.450  1.00 24.87  ? 144 LYS B O     1 
ATOM 3949  C CB    . LYS F 4 107 ? 58.596  46.859  22.819  1.00 34.44  ? 144 LYS B CB    1 
ATOM 3950  C CG    . LYS F 4 107 ? 57.278  46.703  23.541  1.00 39.36  ? 144 LYS B CG    1 
ATOM 3951  C CD    . LYS F 4 107 ? 57.403  45.626  24.606  1.00 41.58  ? 144 LYS B CD    1 
ATOM 3952  C CE    . LYS F 4 107 ? 57.909  44.284  24.032  1.00 40.10  ? 144 LYS B CE    1 
ATOM 3953  N NZ    . LYS F 4 107 ? 56.900  43.582  23.167  1.00 38.17  ? 144 LYS B NZ    1 
ATOM 3954  N N     . LYS F 4 108 ? 59.869  49.710  21.661  1.00 57.11  ? 145 LYS B N     1 
ATOM 3955  C CA    . LYS F 4 108 ? 60.219  51.103  21.931  1.00 56.31  ? 145 LYS B CA    1 
ATOM 3956  C C     . LYS F 4 108 ? 59.923  51.968  20.719  1.00 55.60  ? 145 LYS B C     1 
ATOM 3957  O O     . LYS F 4 108 ? 59.590  53.145  20.858  1.00 42.28  ? 145 LYS B O     1 
ATOM 3958  C CB    . LYS F 4 108 ? 61.703  51.228  22.307  1.00 44.54  ? 145 LYS B CB    1 
ATOM 3959  C CG    . LYS F 4 108 ? 62.045  50.916  23.785  1.00 41.67  ? 145 LYS B CG    1 
ATOM 3960  C CD    . LYS F 4 108 ? 61.850  49.438  24.151  1.00 41.66  ? 145 LYS B CD    1 
ATOM 3961  C CE    . LYS F 4 108 ? 62.301  49.137  25.587  1.00 43.50  ? 145 LYS B CE    1 
ATOM 3962  N NZ    . LYS F 4 108 ? 62.115  47.696  25.959  1.00 38.62  ? 145 LYS B NZ    1 
ATOM 3963  N N     . LYS F 4 109 ? 60.041  51.387  19.528  1.00 36.83  ? 146 LYS B N     1 
ATOM 3964  C CA    . LYS F 4 109 ? 59.756  52.139  18.308  1.00 35.59  ? 146 LYS B CA    1 
ATOM 3965  C C     . LYS F 4 109 ? 58.300  51.976  17.833  1.00 36.36  ? 146 LYS B C     1 
ATOM 3966  O O     . LYS F 4 109 ? 57.985  52.308  16.688  1.00 46.08  ? 146 LYS B O     1 
ATOM 3967  C CB    . LYS F 4 109 ? 60.726  51.756  17.169  1.00 26.91  ? 146 LYS B CB    1 
ATOM 3968  C CG    . LYS F 4 109 ? 62.160  52.299  17.332  1.00 24.81  ? 146 LYS B CG    1 
ATOM 3969  C CD    . LYS F 4 109 ? 62.979  52.332  16.009  1.00 23.54  ? 146 LYS B CD    1 
ATOM 3970  C CE    . LYS F 4 109 ? 63.815  51.056  15.735  1.00 26.97  ? 146 LYS B CE    1 
ATOM 3971  N NZ    . LYS F 4 109 ? 63.056  49.819  15.330  1.00 20.44  ? 146 LYS B NZ    1 
ATOM 3972  N N     . VAL F 4 110 ? 57.410  51.487  18.701  1.00 36.99  ? 147 VAL B N     1 
ATOM 3973  C CA    . VAL F 4 110 ? 56.012  51.311  18.302  1.00 36.24  ? 147 VAL B CA    1 
ATOM 3974  C C     . VAL F 4 110 ? 55.243  52.620  18.075  1.00 37.46  ? 147 VAL B C     1 
ATOM 3975  O O     . VAL F 4 110 ? 54.725  52.824  16.977  1.00 44.40  ? 147 VAL B O     1 
ATOM 3976  C CB    . VAL F 4 110 ? 55.231  50.392  19.291  1.00 34.65  ? 147 VAL B CB    1 
ATOM 3977  C CG1   . VAL F 4 110 ? 55.582  48.926  19.021  1.00 29.92  ? 147 VAL B CG1   1 
ATOM 3978  C CG2   . VAL F 4 110 ? 55.554  50.765  20.732  1.00 38.36  ? 147 VAL B CG2   1 
ATOM 3979  N N     . PHE F 4 111 ? 55.161  53.500  19.080  1.00 30.31  ? 148 PHE B N     1 
ATOM 3980  C CA    . PHE F 4 111 ? 54.461  54.794  18.910  1.00 28.76  ? 148 PHE B CA    1 
ATOM 3981  C C     . PHE F 4 111 ? 55.279  55.681  17.968  1.00 26.18  ? 148 PHE B C     1 
ATOM 3982  O O     . PHE F 4 111 ? 54.735  56.398  17.128  1.00 24.81  ? 148 PHE B O     1 
ATOM 3983  C CB    . PHE F 4 111 ? 54.263  55.509  20.263  1.00 33.81  ? 148 PHE B CB    1 
ATOM 3984  C CG    . PHE F 4 111 ? 53.845  56.968  20.145  1.00 33.68  ? 148 PHE B CG    1 
ATOM 3985  C CD1   . PHE F 4 111 ? 54.759  57.945  19.743  1.00 33.75  ? 148 PHE B CD1   1 
ATOM 3986  C CD2   . PHE F 4 111 ? 52.534  57.362  20.422  1.00 33.22  ? 148 PHE B CD2   1 
ATOM 3987  C CE1   . PHE F 4 111 ? 54.373  59.295  19.616  1.00 34.63  ? 148 PHE B CE1   1 
ATOM 3988  C CE2   . PHE F 4 111 ? 52.142  58.709  20.298  1.00 31.13  ? 148 PHE B CE2   1 
ATOM 3989  C CZ    . PHE F 4 111 ? 53.067  59.671  19.892  1.00 33.21  ? 148 PHE B CZ    1 
ATOM 3990  N N     . GLU F 4 112 ? 56.593  55.617  18.120  1.00 28.78  ? 149 GLU B N     1 
ATOM 3991  C CA    . GLU F 4 112 ? 57.494  56.380  17.282  1.00 31.27  ? 149 GLU B CA    1 
ATOM 3992  C C     . GLU F 4 112 ? 57.229  56.024  15.803  1.00 32.20  ? 149 GLU B C     1 
ATOM 3993  O O     . GLU F 4 112 ? 56.943  56.909  14.996  1.00 54.96  ? 149 GLU B O     1 
ATOM 3994  C CB    . GLU F 4 112 ? 58.941  56.058  17.676  1.00 59.47  ? 149 GLU B CB    1 
ATOM 3995  C CG    . GLU F 4 112 ? 59.965  57.021  17.113  1.00 59.89  ? 149 GLU B CG    1 
ATOM 3996  C CD    . GLU F 4 112 ? 59.874  57.135  15.608  1.00 63.69  ? 149 GLU B CD    1 
ATOM 3997  O OE1   . GLU F 4 112 ? 60.226  56.163  14.905  1.00 64.00  ? 149 GLU B OE1   1 
ATOM 3998  O OE2   . GLU F 4 112 ? 59.433  58.199  15.131  1.00 65.83  ? 149 GLU B OE2   1 
ATOM 3999  N N     . THR F 4 113 ? 57.314  54.736  15.454  1.00 31.38  ? 150 THR B N     1 
ATOM 4000  C CA    . THR F 4 113 ? 57.076  54.290  14.073  1.00 31.08  ? 150 THR B CA    1 
ATOM 4001  C C     . THR F 4 113 ? 55.614  54.428  13.706  1.00 31.83  ? 150 THR B C     1 
ATOM 4002  O O     . THR F 4 113 ? 55.273  54.679  12.548  1.00 36.59  ? 150 THR B O     1 
ATOM 4003  C CB    . THR F 4 113 ? 57.424  52.794  13.833  1.00 23.35  ? 150 THR B CB    1 
ATOM 4004  O OG1   . THR F 4 113 ? 58.805  52.540  14.129  1.00 20.20  ? 150 THR B OG1   1 
ATOM 4005  C CG2   . THR F 4 113 ? 57.167  52.443  12.379  1.00 22.90  ? 150 THR B CG2   1 
ATOM 4006  N N     . LEU F 4 114 ? 54.739  54.263  14.688  1.00 57.34  ? 151 LEU B N     1 
ATOM 4007  C CA    . LEU F 4 114 ? 53.323  54.351  14.387  1.00 58.65  ? 151 LEU B CA    1 
ATOM 4008  C C     . LEU F 4 114 ? 52.887  55.750  13.922  1.00 64.01  ? 151 LEU B C     1 
ATOM 4009  O O     . LEU F 4 114 ? 52.076  55.844  12.996  1.00 33.97  ? 151 LEU B O     1 
ATOM 4010  C CB    . LEU F 4 114 ? 52.481  53.828  15.573  1.00 3.55   ? 151 LEU B CB    1 
ATOM 4011  C CG    . LEU F 4 114 ? 50.973  53.627  15.328  1.00 3.31   ? 151 LEU B CG    1 
ATOM 4012  C CD1   . LEU F 4 114 ? 50.756  53.337  13.851  1.00 3.31   ? 151 LEU B CD1   1 
ATOM 4013  C CD2   . LEU F 4 114 ? 50.402  52.506  16.210  1.00 3.31   ? 151 LEU B CD2   1 
ATOM 4014  N N     . GLU F 4 115 ? 53.433  56.821  14.514  1.00 41.85  ? 152 GLU B N     1 
ATOM 4015  C CA    . GLU F 4 115 ? 53.066  58.180  14.099  1.00 44.67  ? 152 GLU B CA    1 
ATOM 4016  C C     . GLU F 4 115 ? 53.083  58.286  12.584  1.00 45.14  ? 152 GLU B C     1 
ATOM 4017  O O     . GLU F 4 115 ? 52.084  58.655  11.974  1.00 69.17  ? 152 GLU B O     1 
ATOM 4018  C CB    . GLU F 4 115 ? 54.038  59.229  14.662  1.00 83.63  ? 152 GLU B CB    1 
ATOM 4019  C CG    . GLU F 4 115 ? 53.679  60.713  14.324  1.00 84.40  ? 152 GLU B CG    1 
ATOM 4020  C CD    . GLU F 4 115 ? 54.446  61.322  13.121  1.00 84.10  ? 152 GLU B CD    1 
ATOM 4021  O OE1   . GLU F 4 115 ? 54.287  60.841  11.977  1.00 79.25  ? 152 GLU B OE1   1 
ATOM 4022  O OE2   . GLU F 4 115 ? 55.207  62.300  13.317  1.00 83.36  ? 152 GLU B OE2   1 
ATOM 4023  N N     . ALA F 4 116 ? 54.225  57.955  11.988  1.00 50.67  ? 153 ALA B N     1 
ATOM 4024  C CA    . ALA F 4 116 ? 54.408  58.032  10.541  1.00 52.99  ? 153 ALA B CA    1 
ATOM 4025  C C     . ALA F 4 116 ? 53.327  57.303  9.761   1.00 54.11  ? 153 ALA B C     1 
ATOM 4026  O O     . ALA F 4 116 ? 52.748  57.842  8.819   1.00 52.30  ? 153 ALA B O     1 
ATOM 4027  C CB    . ALA F 4 116 ? 55.768  57.485  10.168  1.00 54.10  ? 153 ALA B CB    1 
ATOM 4028  N N     . ARG F 4 117 ? 53.061  56.067  10.152  1.00 68.38  ? 154 ARG B N     1 
ATOM 4029  C CA    . ARG F 4 117 ? 52.050  55.281  9.475   1.00 66.56  ? 154 ARG B CA    1 
ATOM 4030  C C     . ARG F 4 117 ? 50.701  55.986  9.407   1.00 66.06  ? 154 ARG B C     1 
ATOM 4031  O O     . ARG F 4 117 ? 50.044  55.969  8.374   1.00 46.92  ? 154 ARG B O     1 
ATOM 4032  C CB    . ARG F 4 117 ? 51.897  53.929  10.160  1.00 45.82  ? 154 ARG B CB    1 
ATOM 4033  C CG    . ARG F 4 117 ? 52.938  52.938  9.730   1.00 45.30  ? 154 ARG B CG    1 
ATOM 4034  C CD    . ARG F 4 117 ? 54.294  53.302  10.237  1.00 45.27  ? 154 ARG B CD    1 
ATOM 4035  N NE    . ARG F 4 117 ? 55.292  52.431  9.641   1.00 48.04  ? 154 ARG B NE    1 
ATOM 4036  C CZ    . ARG F 4 117 ? 55.588  52.447  8.350   1.00 48.26  ? 154 ARG B CZ    1 
ATOM 4037  N NH1   . ARG F 4 117 ? 54.957  53.295  7.551   1.00 45.56  ? 154 ARG B NH1   1 
ATOM 4038  N NH2   . ARG F 4 117 ? 56.506  51.626  7.859   1.00 46.07  ? 154 ARG B NH2   1 
ATOM 4039  N N     . MET F 4 118 ? 50.289  56.607  10.503  1.00 47.41  ? 155 MET B N     1 
ATOM 4040  C CA    . MET F 4 118 ? 49.014  57.306  10.535  1.00 49.85  ? 155 MET B CA    1 
ATOM 4041  C C     . MET F 4 118 ? 49.159  58.632  9.818   1.00 52.14  ? 155 MET B C     1 
ATOM 4042  O O     . MET F 4 118 ? 48.278  59.051  9.076   1.00 34.34  ? 155 MET B O     1 
ATOM 4043  C CB    . MET F 4 118 ? 48.584  57.525  11.974  1.00 20.10  ? 155 MET B CB    1 
ATOM 4044  C CG    . MET F 4 118 ? 48.596  56.257  12.768  1.00 15.88  ? 155 MET B CG    1 
ATOM 4045  S SD    . MET F 4 118 ? 47.948  56.552  14.395  1.00 12.92  ? 155 MET B SD    1 
ATOM 4046  C CE    . MET F 4 118 ? 46.598  55.380  14.508  1.00 18.84  ? 155 MET B CE    1 
ATOM 4047  N N     . THR F 4 119 ? 50.277  59.297  10.058  1.00 33.10  ? 156 THR B N     1 
ATOM 4048  C CA    . THR F 4 119 ? 50.557  60.557  9.401   1.00 36.00  ? 156 THR B CA    1 
ATOM 4049  C C     . THR F 4 119 ? 50.344  60.254  7.934   1.00 37.46  ? 156 THR B C     1 
ATOM 4050  O O     . THR F 4 119 ? 49.458  60.817  7.290   1.00 87.80  ? 156 THR B O     1 
ATOM 4051  C CB    . THR F 4 119 ? 52.018  60.967  9.628   1.00 77.57  ? 156 THR B CB    1 
ATOM 4052  O OG1   . THR F 4 119 ? 52.143  61.567  10.921  1.00 81.19  ? 156 THR B OG1   1 
ATOM 4053  C CG2   . THR F 4 119 ? 52.483  61.932  8.552   1.00 78.87  ? 156 THR B CG2   1 
ATOM 4054  N N     . GLU F 4 120 ? 51.162  59.342  7.419   1.00 58.67  ? 157 GLU B N     1 
ATOM 4055  C CA    . GLU F 4 120 ? 51.063  58.926  6.026   1.00 58.77  ? 157 GLU B CA    1 
ATOM 4056  C C     . GLU F 4 120 ? 49.690  58.294  5.838   1.00 57.56  ? 157 GLU B C     1 
ATOM 4057  O O     . GLU F 4 120 ? 48.949  58.141  6.811   1.00 54.87  ? 157 GLU B O     1 
ATOM 4058  C CB    . GLU F 4 120 ? 52.180  57.937  5.681   1.00 60.75  ? 157 GLU B CB    1 
ATOM 4059  C CG    . GLU F 4 120 ? 53.491  58.609  5.291   1.00 64.80  ? 157 GLU B CG    1 
ATOM 4060  C CD    . GLU F 4 120 ? 53.705  58.628  3.785   1.00 65.41  ? 157 GLU B CD    1 
ATOM 4061  O OE1   . GLU F 4 120 ? 52.709  58.772  3.047   1.00 62.84  ? 157 GLU B OE1   1 
ATOM 4062  O OE2   . GLU F 4 120 ? 54.869  58.507  3.337   1.00 67.71  ? 157 GLU B OE2   1 
ATOM 4063  N N     . ALA F 4 121 ? 49.348  57.932  4.605   1.00 86.94  ? 158 ALA B N     1 
ATOM 4064  C CA    . ALA F 4 121 ? 48.034  57.360  4.323   1.00 85.08  ? 158 ALA B CA    1 
ATOM 4065  C C     . ALA F 4 121 ? 47.037  58.518  4.409   1.00 84.98  ? 158 ALA B C     1 
ATOM 4066  O O     . ALA F 4 121 ? 46.279  58.788  3.478   1.00 61.82  ? 158 ALA B O     1 
ATOM 4067  C CB    . ALA F 4 121 ? 47.691  56.285  5.347   1.00 54.76  ? 158 ALA B CB    1 
ATOM 4068  N N     . CYS F 4 122 ? 47.047  59.201  5.544   1.00 50.41  ? 159 CYS B N     1 
ATOM 4069  C CA    . CYS F 4 122 ? 46.184  60.348  5.736   1.00 45.63  ? 159 CYS B CA    1 
ATOM 4070  C C     . CYS F 4 122 ? 46.612  61.347  4.671   1.00 45.92  ? 159 CYS B C     1 
ATOM 4071  O O     . CYS F 4 122 ? 45.862  62.231  4.288   1.00 60.90  ? 159 CYS B O     1 
ATOM 4072  C CB    . CYS F 4 122 ? 46.387  60.924  7.141   1.00 38.24  ? 159 CYS B CB    1 
ATOM 4073  S SG    . CYS F 4 122 ? 45.734  59.865  8.451   1.00 28.36  ? 159 CYS B SG    1 
ATOM 4074  N N     . ILE F 4 123 ? 47.830  61.167  4.182   1.00 11.38  ? 160 ILE B N     1 
ATOM 4075  C CA    . ILE F 4 123 ? 48.405  62.021  3.161   1.00 13.96  ? 160 ILE B CA    1 
ATOM 4076  C C     . ILE F 4 123 ? 48.244  61.349  1.806   1.00 15.23  ? 160 ILE B C     1 
ATOM 4077  O O     . ILE F 4 123 ? 47.555  61.867  0.924   1.00 63.02  ? 160 ILE B O     1 
ATOM 4078  C CB    . ILE F 4 123 ? 49.911  62.227  3.415   1.00 58.63  ? 160 ILE B CB    1 
ATOM 4079  C CG1   . ILE F 4 123 ? 50.122  62.845  4.799   1.00 57.32  ? 160 ILE B CG1   1 
ATOM 4080  C CG2   . ILE F 4 123 ? 50.516  63.080  2.311   1.00 61.26  ? 160 ILE B CG2   1 
ATOM 4081  C CD1   . ILE F 4 123 ? 51.574  62.992  5.199   1.00 56.54  ? 160 ILE B CD1   1 
ATOM 4082  N N     . ARG F 4 124 ? 48.889  60.188  1.655   1.00 49.44  ? 161 ARG B N     1 
ATOM 4083  C CA    . ARG F 4 124 ? 48.858  59.420  0.409   1.00 49.61  ? 161 ARG B CA    1 
ATOM 4084  C C     . ARG F 4 124 ? 47.467  58.923  0.016   1.00 51.36  ? 161 ARG B C     1 
ATOM 4085  O O     . ARG F 4 124 ? 47.306  58.291  -1.024  1.00 66.38  ? 161 ARG B O     1 
ATOM 4086  C CB    . ARG F 4 124 ? 49.807  58.216  0.489   1.00 62.74  ? 161 ARG B CB    1 
ATOM 4087  C CG    . ARG F 4 124 ? 51.290  58.499  0.227   1.00 65.59  ? 161 ARG B CG    1 
ATOM 4088  C CD    . ARG F 4 124 ? 52.058  57.176  -0.032  1.00 67.27  ? 161 ARG B CD    1 
ATOM 4089  N NE    . ARG F 4 124 ? 53.489  57.344  -0.322  1.00 67.09  ? 161 ARG B NE    1 
ATOM 4090  C CZ    . ARG F 4 124 ? 54.293  56.363  -0.745  1.00 67.60  ? 161 ARG B CZ    1 
ATOM 4091  N NH1   . ARG F 4 124 ? 53.814  55.137  -0.936  1.00 67.64  ? 161 ARG B NH1   1 
ATOM 4092  N NH2   . ARG F 4 124 ? 55.584  56.597  -0.964  1.00 67.39  ? 161 ARG B NH2   1 
ATOM 4093  N N     . GLY F 4 125 ? 46.461  59.213  0.831   1.00 61.77  ? 162 GLY B N     1 
ATOM 4094  C CA    . GLY F 4 125 ? 45.118  58.759  0.507   1.00 64.12  ? 162 GLY B CA    1 
ATOM 4095  C C     . GLY F 4 125 ? 45.029  57.251  0.625   1.00 65.74  ? 162 GLY B C     1 
ATOM 4096  O O     . GLY F 4 125 ? 44.795  56.550  -0.355  1.00 70.84  ? 162 GLY B O     1 
ATOM 4097  N N     . TYR F 4 126 ? 45.196  56.748  1.839   1.00 46.50  ? 163 TYR B N     1 
ATOM 4098  C CA    . TYR F 4 126 ? 45.180  55.317  2.063   1.00 48.43  ? 163 TYR B CA    1 
ATOM 4099  C C     . TYR F 4 126 ? 44.273  54.864  3.188   1.00 48.67  ? 163 TYR B C     1 
ATOM 4100  O O     . TYR F 4 126 ? 44.594  55.021  4.366   1.00 51.00  ? 163 TYR B O     1 
ATOM 4101  C CB    . TYR F 4 126 ? 46.600  54.831  2.349   1.00 73.95  ? 163 TYR B CB    1 
ATOM 4102  C CG    . TYR F 4 126 ? 47.477  54.635  1.129   1.00 76.50  ? 163 TYR B CG    1 
ATOM 4103  C CD1   . TYR F 4 126 ? 48.866  54.585  1.256   1.00 77.45  ? 163 TYR B CD1   1 
ATOM 4104  C CD2   . TYR F 4 126 ? 46.922  54.436  -0.135  1.00 77.02  ? 163 TYR B CD2   1 
ATOM 4105  C CE1   . TYR F 4 126 ? 49.683  54.335  0.160   1.00 79.84  ? 163 TYR B CE1   1 
ATOM 4106  C CE2   . TYR F 4 126 ? 47.729  54.183  -1.241  1.00 77.64  ? 163 TYR B CE2   1 
ATOM 4107  C CZ    . TYR F 4 126 ? 49.111  54.135  -1.087  1.00 79.66  ? 163 TYR B CZ    1 
ATOM 4108  O OH    . TYR F 4 126 ? 49.925  53.883  -2.177  1.00 81.20  ? 163 TYR B OH    1 
ATOM 4109  N N     . ASN F 4 127 ? 43.138  54.290  2.813   1.00 70.35  ? 164 ASN B N     1 
ATOM 4110  C CA    . ASN F 4 127 ? 42.199  53.789  3.792   1.00 69.54  ? 164 ASN B CA    1 
ATOM 4111  C C     . ASN F 4 127 ? 41.702  54.918  4.694   1.00 71.54  ? 164 ASN B C     1 
ATOM 4112  O O     . ASN F 4 127 ? 42.462  55.493  5.480   1.00 64.33  ? 164 ASN B O     1 
ATOM 4113  C CB    . ASN F 4 127 ? 42.881  52.701  4.605   1.00 76.92  ? 164 ASN B CB    1 
ATOM 4114  C CG    . ASN F 4 127 ? 41.965  52.076  5.605   1.00 76.08  ? 164 ASN B CG    1 
ATOM 4115  O OD1   . ASN F 4 127 ? 41.587  52.707  6.594   1.00 74.51  ? 164 ASN B OD1   1 
ATOM 4116  N ND2   . ASN F 4 127 ? 41.590  50.826  5.359   1.00 74.23  ? 164 ASN B ND2   1 
ATOM 4117  N N     . PRO F 4 128 ? 40.399  55.235  4.598   1.00 91.38  ? 165 PRO B N     1 
ATOM 4118  C CA    . PRO F 4 128 ? 39.702  56.284  5.351   1.00 91.35  ? 165 PRO B CA    1 
ATOM 4119  C C     . PRO F 4 128 ? 39.502  56.044  6.846   1.00 90.99  ? 165 PRO B C     1 
ATOM 4120  O O     . PRO F 4 128 ? 38.494  55.468  7.237   1.00 73.24  ? 165 PRO B O     1 
ATOM 4121  C CB    . PRO F 4 128 ? 38.367  56.388  4.618   1.00 71.27  ? 165 PRO B CB    1 
ATOM 4122  C CG    . PRO F 4 128 ? 38.093  54.963  4.277   1.00 71.36  ? 165 PRO B CG    1 
ATOM 4123  C CD    . PRO F 4 128 ? 39.444  54.501  3.741   1.00 73.17  ? 165 PRO B CD    1 
ATOM 4124  N N     . GLY F 4 129 ? 40.442  56.497  7.675   1.00 36.36  ? 166 GLY B N     1 
ATOM 4125  C CA    . GLY F 4 129 ? 40.297  56.324  9.109   1.00 35.54  ? 166 GLY B CA    1 
ATOM 4126  C C     . GLY F 4 129 ? 39.482  55.094  9.443   1.00 35.32  ? 166 GLY B C     1 
ATOM 4127  O O     . GLY F 4 129 ? 38.553  55.130  10.251  1.00 55.39  ? 166 GLY B O     1 
ATOM 4128  N N     . LEU F 4 130 ? 39.829  54.001  8.777   1.00 64.72  ? 167 LEU B N     1 
ATOM 4129  C CA    . LEU F 4 130 ? 39.179  52.713  8.969   1.00 63.96  ? 167 LEU B CA    1 
ATOM 4130  C C     . LEU F 4 130 ? 40.167  51.972  9.865   1.00 62.33  ? 167 LEU B C     1 
ATOM 4131  O O     . LEU F 4 130 ? 39.906  50.879  10.381  1.00 49.00  ? 167 LEU B O     1 
ATOM 4132  C CB    . LEU F 4 130 ? 39.048  51.995  7.623   1.00 32.70  ? 167 LEU B CB    1 
ATOM 4133  C CG    . LEU F 4 130 ? 37.919  50.992  7.386   1.00 33.83  ? 167 LEU B CG    1 
ATOM 4134  C CD1   . LEU F 4 130 ? 38.103  50.311  6.015   1.00 35.50  ? 167 LEU B CD1   1 
ATOM 4135  C CD2   . LEU F 4 130 ? 37.904  49.974  8.506   1.00 35.49  ? 167 LEU B CD2   1 
ATOM 4136  N N     . LEU F 4 131 ? 41.323  52.596  10.041  1.00 62.00  ? 168 LEU B N     1 
ATOM 4137  C CA    . LEU F 4 131 ? 42.368  52.033  10.860  1.00 57.92  ? 168 LEU B CA    1 
ATOM 4138  C C     . LEU F 4 131 ? 42.785  53.054  11.914  1.00 56.68  ? 168 LEU B C     1 
ATOM 4139  O O     . LEU F 4 131 ? 43.064  52.697  13.055  1.00 65.00  ? 168 LEU B O     1 
ATOM 4140  C CB    . LEU F 4 131 ? 43.562  51.662  9.976   1.00 33.22  ? 168 LEU B CB    1 
ATOM 4141  C CG    . LEU F 4 131 ? 43.316  50.633  8.878   1.00 30.49  ? 168 LEU B CG    1 
ATOM 4142  C CD1   . LEU F 4 131 ? 44.577  50.462  8.084   1.00 28.69  ? 168 LEU B CD1   1 
ATOM 4143  C CD2   . LEU F 4 131 ? 42.891  49.312  9.473   1.00 24.58  ? 168 LEU B CD2   1 
ATOM 4144  N N     . VAL F 4 132 ? 42.805  54.325  11.526  1.00 33.95  ? 169 VAL B N     1 
ATOM 4145  C CA    . VAL F 4 132 ? 43.207  55.407  12.422  1.00 33.18  ? 169 VAL B CA    1 
ATOM 4146  C C     . VAL F 4 132 ? 42.116  55.821  13.409  1.00 34.76  ? 169 VAL B C     1 
ATOM 4147  O O     . VAL F 4 132 ? 42.268  55.663  14.619  1.00 32.30  ? 169 VAL B O     1 
ATOM 4148  C CB    . VAL F 4 132 ? 43.632  56.650  11.615  1.00 21.33  ? 169 VAL B CB    1 
ATOM 4149  C CG1   . VAL F 4 132 ? 44.114  57.732  12.550  1.00 17.70  ? 169 VAL B CG1   1 
ATOM 4150  C CG2   . VAL F 4 132 ? 44.718  56.283  10.627  1.00 19.93  ? 169 VAL B CG2   1 
ATOM 4151  N N     . HIS F 4 133 ? 41.024  56.364  12.879  1.00 54.65  ? 170 HIS B N     1 
ATOM 4152  C CA    . HIS F 4 133 ? 39.897  56.809  13.694  1.00 57.50  ? 170 HIS B CA    1 
ATOM 4153  C C     . HIS F 4 133 ? 38.690  57.069  12.794  1.00 58.61  ? 170 HIS B C     1 
ATOM 4154  O O     . HIS F 4 133 ? 38.815  57.133  11.572  1.00 65.86  ? 170 HIS B O     1 
ATOM 4155  C CB    . HIS F 4 133 ? 40.270  58.085  14.454  1.00 76.93  ? 170 HIS B CB    1 
ATOM 4156  C CG    . HIS F 4 133 ? 40.554  59.252  13.561  1.00 79.87  ? 170 HIS B CG    1 
ATOM 4157  N ND1   . HIS F 4 133 ? 41.286  59.138  12.399  1.00 79.23  ? 170 HIS B ND1   1 
ATOM 4158  C CD2   . HIS F 4 133 ? 40.215  60.559  13.664  1.00 79.79  ? 170 HIS B CD2   1 
ATOM 4159  C CE1   . HIS F 4 133 ? 41.386  60.323  11.824  1.00 79.51  ? 170 HIS B CE1   1 
ATOM 4160  N NE2   . HIS F 4 133 ? 40.745  61.202  12.571  1.00 79.56  ? 170 HIS B NE2   1 
ATOM 4161  N N     . SER F 4 134 ? 37.527  57.229  13.409  1.00 64.79  ? 171 SER B N     1 
ATOM 4162  C CA    . SER F 4 134 ? 36.293  57.459  12.669  1.00 67.90  ? 171 SER B CA    1 
ATOM 4163  C C     . SER F 4 134 ? 35.947  58.938  12.476  1.00 71.55  ? 171 SER B C     1 
ATOM 4164  O O     . SER F 4 134 ? 34.789  59.287  12.239  1.00 90.15  ? 171 SER B O     1 
ATOM 4165  C CB    . SER F 4 134 ? 35.141  56.746  13.380  1.00 89.97  ? 171 SER B CB    1 
ATOM 4166  O OG    . SER F 4 134 ? 33.902  57.000  12.742  1.00 85.68  ? 171 SER B OG    1 
ATOM 4167  N N     . ASP F 4 135 ? 36.947  59.808  12.567  1.00 58.55  ? 172 ASP B N     1 
ATOM 4168  C CA    . ASP F 4 135 ? 36.706  61.236  12.404  1.00 60.33  ? 172 ASP B CA    1 
ATOM 4169  C C     . ASP F 4 135 ? 37.267  61.747  11.088  1.00 59.69  ? 172 ASP B C     1 
ATOM 4170  O O     . ASP F 4 135 ? 37.072  62.910  10.733  1.00 79.81  ? 172 ASP B O     1 
ATOM 4171  C CB    . ASP F 4 135 ? 37.334  62.022  13.559  1.00 83.65  ? 172 ASP B CB    1 
ATOM 4172  C CG    . ASP F 4 135 ? 36.759  61.642  14.911  1.00 86.75  ? 172 ASP B CG    1 
ATOM 4173  O OD1   . ASP F 4 135 ? 36.931  60.475  15.334  1.00 88.13  ? 172 ASP B OD1   1 
ATOM 4174  O OD2   . ASP F 4 135 ? 36.133  62.513  15.552  1.00 84.20  ? 172 ASP B OD2   1 
ATOM 4175  N N     . LEU F 4 136 ? 37.957  60.875  10.360  1.00 48.89  ? 173 LEU B N     1 
ATOM 4176  C CA    . LEU F 4 136 ? 38.553  61.276  9.089   1.00 48.38  ? 173 LEU B CA    1 
ATOM 4177  C C     . LEU F 4 136 ? 37.746  60.820  7.874   1.00 48.74  ? 173 LEU B C     1 
ATOM 4178  O O     . LEU F 4 136 ? 36.904  61.558  7.372   1.00 63.06  ? 173 LEU B O     1 
ATOM 4179  C CB    . LEU F 4 136 ? 39.996  60.764  8.996   1.00 53.61  ? 173 LEU B CB    1 
ATOM 4180  C CG    . LEU F 4 136 ? 40.858  61.565  8.020   1.00 51.74  ? 173 LEU B CG    1 
ATOM 4181  C CD1   . LEU F 4 136 ? 42.336  61.376  8.322   1.00 46.64  ? 173 LEU B CD1   1 
ATOM 4182  C CD2   . LEU F 4 136 ? 40.508  61.146  6.611   1.00 48.75  ? 173 LEU B CD2   1 
ATOM 4183  N N     . ALA F 4 137 ? 38.004  59.615  7.391   1.00 79.03  ? 174 ALA B N     1 
ATOM 4184  C CA    . ALA F 4 137 ? 37.261  59.105  6.249   1.00 80.09  ? 174 ALA B CA    1 
ATOM 4185  C C     . ALA F 4 137 ? 37.525  59.889  4.971   1.00 80.17  ? 174 ALA B C     1 
ATOM 4186  O O     . ALA F 4 137 ? 37.242  59.400  3.874   1.00 43.53  ? 174 ALA B O     1 
ATOM 4187  C CB    . ALA F 4 137 ? 35.774  59.110  6.560   1.00 42.43  ? 174 ALA B CB    1 
ATOM 4188  N N     . TYR F 4 138 ? 38.044  61.107  5.102   1.00 65.12  ? 175 TYR B N     1 
ATOM 4189  C CA    . TYR F 4 138 ? 38.345  61.897  3.918   1.00 63.99  ? 175 TYR B CA    1 
ATOM 4190  C C     . TYR F 4 138 ? 39.852  61.991  3.698   1.00 62.56  ? 175 TYR B C     1 
ATOM 4191  O O     . TYR F 4 138 ? 40.427  63.073  3.626   1.00 62.00  ? 175 TYR B O     1 
ATOM 4192  C CB    . TYR F 4 138 ? 37.700  63.295  3.992   1.00 60.62  ? 175 TYR B CB    1 
ATOM 4193  C CG    . TYR F 4 138 ? 38.169  64.182  5.119   1.00 62.58  ? 175 TYR B CG    1 
ATOM 4194  C CD1   . TYR F 4 138 ? 37.883  63.866  6.443   1.00 64.21  ? 175 TYR B CD1   1 
ATOM 4195  C CD2   . TYR F 4 138 ? 38.929  65.326  4.859   1.00 61.22  ? 175 TYR B CD2   1 
ATOM 4196  C CE1   . TYR F 4 138 ? 38.345  64.652  7.486   1.00 62.25  ? 175 TYR B CE1   1 
ATOM 4197  C CE2   . TYR F 4 138 ? 39.400  66.121  5.892   1.00 61.48  ? 175 TYR B CE2   1 
ATOM 4198  C CZ    . TYR F 4 138 ? 39.107  65.775  7.207   1.00 61.19  ? 175 TYR B CZ    1 
ATOM 4199  O OH    . TYR F 4 138 ? 39.610  66.524  8.244   1.00 57.21  ? 175 TYR B OH    1 
ATOM 4200  N N     . LEU F 4 139 ? 40.490  60.828  3.612   1.00 75.53  ? 176 LEU B N     1 
ATOM 4201  C CA    . LEU F 4 139 ? 41.927  60.749  3.378   1.00 76.98  ? 176 LEU B CA    1 
ATOM 4202  C C     . LEU F 4 139 ? 42.107  60.036  2.042   1.00 77.84  ? 176 LEU B C     1 
ATOM 4203  O O     . LEU F 4 139 ? 42.968  59.167  1.899   1.00 56.59  ? 176 LEU B O     1 
ATOM 4204  C CB    . LEU F 4 139 ? 42.633  59.973  4.518   1.00 41.65  ? 176 LEU B CB    1 
ATOM 4205  C CG    . LEU F 4 139 ? 42.465  58.466  4.787   1.00 41.57  ? 176 LEU B CG    1 
ATOM 4206  C CD1   . LEU F 4 139 ? 43.577  57.721  4.081   1.00 42.67  ? 176 LEU B CD1   1 
ATOM 4207  C CD2   . LEU F 4 139 ? 42.546  58.166  6.281   1.00 40.18  ? 176 LEU B CD2   1 
ATOM 4208  N N     . GLN F 4 140 ? 41.284  60.416  1.064   1.00 77.21  ? 177 GLN B N     1 
ATOM 4209  C CA    . GLN F 4 140 ? 41.321  59.805  -0.262  1.00 76.80  ? 177 GLN B CA    1 
ATOM 4210  C C     . GLN F 4 140 ? 42.075  60.593  -1.331  1.00 75.94  ? 177 GLN B C     1 
ATOM 4211  O O     . GLN F 4 140 ? 43.093  60.128  -1.858  1.00 65.62  ? 177 GLN B O     1 
ATOM 4212  C CB    . GLN F 4 140 ? 39.894  59.534  -0.749  1.00 74.59  ? 177 GLN B CB    1 
ATOM 4213  C CG    . GLN F 4 140 ? 38.929  60.693  -0.563  1.00 75.11  ? 177 GLN B CG    1 
ATOM 4214  C CD    . GLN F 4 140 ? 38.387  60.785  0.852   1.00 73.60  ? 177 GLN B CD    1 
ATOM 4215  O OE1   . GLN F 4 140 ? 37.577  61.661  1.162   1.00 71.73  ? 177 GLN B OE1   1 
ATOM 4216  N NE2   . GLN F 4 140 ? 38.827  59.876  1.717   1.00 71.68  ? 177 GLN B NE2   1 
ATOM 4217  N N     . ALA F 4 141 ? 41.561  61.773  -1.664  1.00 98.43  ? 178 ALA B N     1 
ATOM 4218  C CA    . ALA F 4 141 ? 42.186  62.617  -2.673  1.00 98.87  ? 178 ALA B CA    1 
ATOM 4219  C C     . ALA F 4 141 ? 41.768  64.076  -2.519  1.00 100.19 ? 178 ALA B C     1 
ATOM 4220  O O     . ALA F 4 141 ? 42.562  64.986  -2.781  1.00 92.82  ? 178 ALA B O     1 
ATOM 4221  C CB    . ALA F 4 141 ? 41.826  62.120  -4.066  1.00 81.80  ? 178 ALA B CB    1 
ATOM 4222  N N     . GLU F 4 142 ? 40.525  64.293  -2.090  1.00 88.61  ? 179 GLU B N     1 
ATOM 4223  C CA    . GLU F 4 142 ? 39.978  65.640  -1.903  1.00 89.74  ? 179 GLU B CA    1 
ATOM 4224  C C     . GLU F 4 142 ? 39.853  66.338  -3.258  1.00 92.12  ? 179 GLU B C     1 
ATOM 4225  O O     . GLU F 4 142 ? 38.799  66.867  -3.608  1.00 90.45  ? 179 GLU B O     1 
ATOM 4226  C CB    . GLU F 4 142 ? 40.887  66.468  -0.982  1.00 75.68  ? 179 GLU B CB    1 
ATOM 4227  C CG    . GLU F 4 142 ? 41.415  65.708  0.232   1.00 76.35  ? 179 GLU B CG    1 
ATOM 4228  C CD    . GLU F 4 142 ? 40.339  65.381  1.244   1.00 76.61  ? 179 GLU B CD    1 
ATOM 4229  O OE1   . GLU F 4 142 ? 40.061  66.235  2.112   1.00 78.81  ? 179 GLU B OE1   1 
ATOM 4230  O OE2   . GLU F 4 142 ? 39.767  64.271  1.167   1.00 75.28  ? 179 GLU B OE2   1 
ATOM 4231  N N     . GLY F 4 143 ? 40.941  66.324  -4.018  1.00 66.87  ? 180 GLY B N     1 
ATOM 4232  C CA    . GLY F 4 143 ? 40.955  66.955  -5.319  1.00 67.32  ? 180 GLY B CA    1 
ATOM 4233  C C     . GLY F 4 143 ? 42.386  67.210  -5.750  1.00 68.13  ? 180 GLY B C     1 
ATOM 4234  O O     . GLY F 4 143 ? 42.874  66.588  -6.692  1.00 89.31  ? 180 GLY B O     1 
ATOM 4235  N N     . GLY F 4 144 ? 43.064  68.120  -5.053  1.00 107.61 ? 181 GLY B N     1 
ATOM 4236  C CA    . GLY F 4 144 ? 44.442  68.436  -5.388  1.00 104.95 ? 181 GLY B CA    1 
ATOM 4237  C C     . GLY F 4 144 ? 45.178  69.173  -4.282  1.00 103.68 ? 181 GLY B C     1 
ATOM 4238  O O     . GLY F 4 144 ? 44.589  69.973  -3.552  1.00 97.28  ? 181 GLY B O     1 
ATOM 4239  N N     . GLY F 4 145 ? 46.474  68.903  -4.155  1.00 74.05  ? 182 GLY B N     1 
ATOM 4240  C CA    . GLY F 4 145 ? 47.266  69.557  -3.128  1.00 73.09  ? 182 GLY B CA    1 
ATOM 4241  C C     . GLY F 4 145 ? 48.297  68.638  -2.493  1.00 72.47  ? 182 GLY B C     1 
ATOM 4242  O O     . GLY F 4 145 ? 49.049  67.953  -3.192  1.00 73.34  ? 182 GLY B O     1 
ATOM 4243  N N     . ASP F 4 146 ? 48.343  68.631  -1.162  1.00 57.38  ? 183 ASP B N     1 
ATOM 4244  C CA    . ASP F 4 146 ? 49.282  67.786  -0.431  1.00 58.68  ? 183 ASP B CA    1 
ATOM 4245  C C     . ASP F 4 146 ? 48.609  67.169  0.793   1.00 60.01  ? 183 ASP B C     1 
ATOM 4246  O O     . ASP F 4 146 ? 49.150  66.258  1.412   1.00 65.44  ? 183 ASP B O     1 
ATOM 4247  C CB    . ASP F 4 146 ? 50.529  68.597  -0.020  1.00 71.11  ? 183 ASP B CB    1 
ATOM 4248  C CG    . ASP F 4 146 ? 50.186  69.870  0.757   1.00 71.27  ? 183 ASP B CG    1 
ATOM 4249  O OD1   . ASP F 4 146 ? 50.059  69.809  2.003   1.00 69.65  ? 183 ASP B OD1   1 
ATOM 4250  O OD2   . ASP F 4 146 ? 50.039  70.933  0.112   1.00 69.55  ? 183 ASP B OD2   1 
ATOM 4251  N N     . ARG F 4 147 ? 47.421  67.672  1.121   1.00 88.95  ? 184 ARG B N     1 
ATOM 4252  C CA    . ARG F 4 147 ? 46.631  67.191  2.255   1.00 89.72  ? 184 ARG B CA    1 
ATOM 4253  C C     . ARG F 4 147 ? 47.317  67.307  3.626   1.00 91.09  ? 184 ARG B C     1 
ATOM 4254  O O     . ARG F 4 147 ? 47.319  66.348  4.401   1.00 78.93  ? 184 ARG B O     1 
ATOM 4255  C CB    . ARG F 4 147 ? 46.196  65.730  2.017   1.00 74.63  ? 184 ARG B CB    1 
ATOM 4256  C CG    . ARG F 4 147 ? 45.201  65.539  0.865   1.00 71.83  ? 184 ARG B CG    1 
ATOM 4257  C CD    . ARG F 4 147 ? 44.547  64.144  0.859   1.00 70.09  ? 184 ARG B CD    1 
ATOM 4258  N NE    . ARG F 4 147 ? 45.355  63.109  0.208   1.00 70.04  ? 184 ARG B NE    1 
ATOM 4259  C CZ    . ARG F 4 147 ? 45.613  63.059  -1.100  1.00 69.62  ? 184 ARG B CZ    1 
ATOM 4260  N NH1   . ARG F 4 147 ? 45.132  63.990  -1.913  1.00 68.80  ? 184 ARG B NH1   1 
ATOM 4261  N NH2   . ARG F 4 147 ? 46.343  62.072  -1.601  1.00 70.86  ? 184 ARG B NH2   1 
ATOM 4262  N N     . GLN F 4 148 ? 47.876  68.474  3.945   1.00 71.16  ? 185 GLN B N     1 
ATOM 4263  C CA    . GLN F 4 148 ? 48.545  68.639  5.234   1.00 72.42  ? 185 GLN B CA    1 
ATOM 4264  C C     . GLN F 4 148 ? 47.587  68.606  6.418   1.00 73.04  ? 185 GLN B C     1 
ATOM 4265  O O     . GLN F 4 148 ? 47.994  68.809  7.561   1.00 85.66  ? 185 GLN B O     1 
ATOM 4266  C CB    . GLN F 4 148 ? 49.373  69.930  5.252   1.00 92.59  ? 185 GLN B CB    1 
ATOM 4267  C CG    . GLN F 4 148 ? 48.740  71.120  4.559   1.00 94.50  ? 185 GLN B CG    1 
ATOM 4268  C CD    . GLN F 4 148 ? 49.724  72.262  4.378   1.00 95.00  ? 185 GLN B CD    1 
ATOM 4269  O OE1   . GLN F 4 148 ? 50.183  72.859  5.351   1.00 95.19  ? 185 GLN B OE1   1 
ATOM 4270  N NE2   . GLN F 4 148 ? 50.062  72.563  3.129   1.00 94.26  ? 185 GLN B NE2   1 
ATOM 4271  N N     . LEU F 4 149 ? 46.314  68.341  6.128   1.00 108.03 ? 186 LEU B N     1 
ATOM 4272  C CA    . LEU F 4 149 ? 45.263  68.245  7.140   1.00 107.96 ? 186 LEU B CA    1 
ATOM 4273  C C     . LEU F 4 149 ? 45.398  69.249  8.277   1.00 107.33 ? 186 LEU B C     1 
ATOM 4274  O O     . LEU F 4 149 ? 44.819  69.061  9.347   1.00 80.15  ? 186 LEU B O     1 
ATOM 4275  C CB    . LEU F 4 149 ? 45.243  66.830  7.722   1.00 67.20  ? 186 LEU B CB    1 
ATOM 4276  C CG    . LEU F 4 149 ? 46.571  66.306  8.290   1.00 67.67  ? 186 LEU B CG    1 
ATOM 4277  C CD1   . LEU F 4 149 ? 46.868  66.925  9.646   1.00 65.05  ? 186 LEU B CD1   1 
ATOM 4278  C CD2   . LEU F 4 149 ? 46.492  64.800  8.420   1.00 68.33  ? 186 LEU B CD2   1 
ATOM 4279  N N     . THR F 4 150 ? 46.161  70.311  8.044   1.00 70.38  ? 187 THR B N     1 
ATOM 4280  C CA    . THR F 4 150 ? 46.380  71.343  9.052   1.00 69.94  ? 187 THR B CA    1 
ATOM 4281  C C     . THR F 4 150 ? 47.077  70.803  10.296  1.00 69.54  ? 187 THR B C     1 
ATOM 4282  O O     . THR F 4 150 ? 47.042  69.603  10.587  1.00 115.68 ? 187 THR B O     1 
ATOM 4283  C CB    . THR F 4 150 ? 45.049  72.021  9.474   1.00 119.77 ? 187 THR B CB    1 
ATOM 4284  O OG1   . THR F 4 150 ? 44.423  72.599  8.319   1.00 119.77 ? 187 THR B OG1   1 
ATOM 4285  C CG2   . THR F 4 150 ? 45.306  73.126  10.508  1.00 119.77 ? 187 THR B CG2   1 
ATOM 4286  N N     . ASP F 4 151 ? 47.710  71.720  11.023  1.00 90.04  ? 188 ASP B N     1 
ATOM 4287  C CA    . ASP F 4 151 ? 48.447  71.407  12.241  1.00 89.79  ? 188 ASP B CA    1 
ATOM 4288  C C     . ASP F 4 151 ? 47.503  71.010  13.380  1.00 88.83  ? 188 ASP B C     1 
ATOM 4289  O O     . ASP F 4 151 ? 47.936  70.541  14.433  1.00 109.10 ? 188 ASP B O     1 
ATOM 4290  C CB    . ASP F 4 151 ? 49.294  72.623  12.639  1.00 101.73 ? 188 ASP B CB    1 
ATOM 4291  C CG    . ASP F 4 151 ? 50.177  73.125  11.495  1.00 100.48 ? 188 ASP B CG    1 
ATOM 4292  O OD1   . ASP F 4 151 ? 51.136  72.417  11.108  1.00 102.30 ? 188 ASP B OD1   1 
ATOM 4293  O OD2   . ASP F 4 151 ? 49.905  74.229  10.974  1.00 100.42 ? 188 ASP B OD2   1 
ATOM 4294  N N     . ARG F 4 152 ? 46.207  71.195  13.158  1.00 50.13  ? 189 ARG B N     1 
ATOM 4295  C CA    . ARG F 4 152 ? 45.200  70.849  14.151  1.00 48.47  ? 189 ARG B CA    1 
ATOM 4296  C C     . ARG F 4 152 ? 45.002  69.349  14.228  1.00 47.55  ? 189 ARG B C     1 
ATOM 4297  O O     . ARG F 4 152 ? 45.392  68.690  15.190  1.00 91.82  ? 189 ARG B O     1 
ATOM 4298  C CB    . ARG F 4 152 ? 43.855  71.498  13.793  1.00 107.83 ? 189 ARG B CB    1 
ATOM 4299  C CG    . ARG F 4 152 ? 42.623  70.769  14.357  1.00 105.01 ? 189 ARG B CG    1 
ATOM 4300  C CD    . ARG F 4 152 ? 42.630  70.744  15.881  1.00 100.34 ? 189 ARG B CD    1 
ATOM 4301  N NE    . ARG F 4 152 ? 41.653  69.808  16.435  1.00 96.75  ? 189 ARG B NE    1 
ATOM 4302  C CZ    . ARG F 4 152 ? 41.769  68.485  16.378  1.00 95.45  ? 189 ARG B CZ    1 
ATOM 4303  N NH1   . ARG F 4 152 ? 42.825  67.936  15.790  1.00 95.54  ? 189 ARG B NH1   1 
ATOM 4304  N NH2   . ARG F 4 152 ? 40.835  67.712  16.916  1.00 94.62  ? 189 ARG B NH2   1 
ATOM 4305  N N     . GLU F 4 153 ? 44.372  68.831  13.186  1.00 64.72  ? 190 GLU B N     1 
ATOM 4306  C CA    . GLU F 4 153 ? 44.057  67.425  13.082  1.00 64.17  ? 190 GLU B CA    1 
ATOM 4307  C C     . GLU F 4 153 ? 45.174  66.524  13.605  1.00 62.92  ? 190 GLU B C     1 
ATOM 4308  O O     . GLU F 4 153 ? 44.914  65.407  14.057  1.00 87.72  ? 190 GLU B O     1 
ATOM 4309  C CB    . GLU F 4 153 ? 43.683  67.114  11.626  1.00 90.30  ? 190 GLU B CB    1 
ATOM 4310  C CG    . GLU F 4 153 ? 42.676  68.150  11.075  1.00 88.49  ? 190 GLU B CG    1 
ATOM 4311  C CD    . GLU F 4 153 ? 41.810  67.641  9.933   1.00 89.82  ? 190 GLU B CD    1 
ATOM 4312  O OE1   . GLU F 4 153 ? 42.340  67.410  8.822   1.00 88.89  ? 190 GLU B OE1   1 
ATOM 4313  O OE2   . GLU F 4 153 ? 40.589  67.477  10.156  1.00 89.26  ? 190 GLU B OE2   1 
ATOM 4314  N N     . LYS F 4 154 ? 46.407  67.024  13.579  1.00 75.67  ? 191 LYS B N     1 
ATOM 4315  C CA    . LYS F 4 154 ? 47.552  66.253  14.069  1.00 72.82  ? 191 LYS B CA    1 
ATOM 4316  C C     . LYS F 4 154 ? 47.315  65.657  15.459  1.00 72.94  ? 191 LYS B C     1 
ATOM 4317  O O     . LYS F 4 154 ? 47.842  64.593  15.774  1.00 58.36  ? 191 LYS B O     1 
ATOM 4318  C CB    . LYS F 4 154 ? 48.820  67.123  14.128  1.00 46.80  ? 191 LYS B CB    1 
ATOM 4319  C CG    . LYS F 4 154 ? 49.837  66.900  13.006  1.00 41.85  ? 191 LYS B CG    1 
ATOM 4320  C CD    . LYS F 4 154 ? 49.392  67.536  11.695  1.00 40.27  ? 191 LYS B CD    1 
ATOM 4321  C CE    . LYS F 4 154 ? 50.514  67.540  10.638  1.00 36.42  ? 191 LYS B CE    1 
ATOM 4322  N NZ    . LYS F 4 154 ? 51.644  68.479  10.936  1.00 30.40  ? 191 LYS B NZ    1 
ATOM 4323  N N     . GLU F 4 155 ? 46.522  66.335  16.283  1.00 52.65  ? 192 GLU B N     1 
ATOM 4324  C CA    . GLU F 4 155 ? 46.258  65.876  17.649  1.00 53.11  ? 192 GLU B CA    1 
ATOM 4325  C C     . GLU F 4 155 ? 45.493  64.567  17.799  1.00 53.31  ? 192 GLU B C     1 
ATOM 4326  O O     . GLU F 4 155 ? 45.647  63.867  18.805  1.00 70.42  ? 192 GLU B O     1 
ATOM 4327  C CB    . GLU F 4 155 ? 45.537  66.973  18.440  1.00 78.96  ? 192 GLU B CB    1 
ATOM 4328  C CG    . GLU F 4 155 ? 46.467  68.060  18.972  1.00 74.85  ? 192 GLU B CG    1 
ATOM 4329  C CD    . GLU F 4 155 ? 47.220  67.635  20.226  1.00 73.33  ? 192 GLU B CD    1 
ATOM 4330  O OE1   . GLU F 4 155 ? 46.607  67.637  21.317  1.00 72.40  ? 192 GLU B OE1   1 
ATOM 4331  O OE2   . GLU F 4 155 ? 48.418  67.296  20.119  1.00 70.22  ? 192 GLU B OE2   1 
ATOM 4332  N N     . ILE F 4 156 ? 44.655  64.240  16.820  1.00 92.08  ? 193 ILE B N     1 
ATOM 4333  C CA    . ILE F 4 156 ? 43.895  62.995  16.884  1.00 93.28  ? 193 ILE B CA    1 
ATOM 4334  C C     . ILE F 4 156 ? 44.829  61.853  16.490  1.00 93.77  ? 193 ILE B C     1 
ATOM 4335  O O     . ILE F 4 156 ? 44.914  60.847  17.191  1.00 102.80 ? 193 ILE B O     1 
ATOM 4336  C CB    . ILE F 4 156 ? 42.694  62.996  15.916  1.00 89.07  ? 193 ILE B CB    1 
ATOM 4337  C CG1   . ILE F 4 156 ? 41.919  64.306  16.030  1.00 91.13  ? 193 ILE B CG1   1 
ATOM 4338  C CG2   . ILE F 4 156 ? 41.770  61.845  16.257  1.00 86.64  ? 193 ILE B CG2   1 
ATOM 4339  C CD1   . ILE F 4 156 ? 40.741  64.397  15.083  1.00 90.27  ? 193 ILE B CD1   1 
ATOM 4340  N N     . ILE F 4 157 ? 45.522  62.021  15.363  1.00 74.87  ? 194 ILE B N     1 
ATOM 4341  C CA    . ILE F 4 157 ? 46.476  61.024  14.867  1.00 72.09  ? 194 ILE B CA    1 
ATOM 4342  C C     . ILE F 4 157 ? 47.449  60.637  15.975  1.00 69.49  ? 194 ILE B C     1 
ATOM 4343  O O     . ILE F 4 157 ? 47.468  59.492  16.437  1.00 38.80  ? 194 ILE B O     1 
ATOM 4344  C CB    . ILE F 4 157 ? 47.328  61.571  13.662  1.00 34.46  ? 194 ILE B CB    1 
ATOM 4345  C CG1   . ILE F 4 157 ? 46.550  61.432  12.351  1.00 34.25  ? 194 ILE B CG1   1 
ATOM 4346  C CG2   . ILE F 4 157 ? 48.672  60.828  13.568  1.00 34.32  ? 194 ILE B CG2   1 
ATOM 4347  C CD1   . ILE F 4 157 ? 47.312  61.941  11.154  1.00 32.57  ? 194 ILE B CD1   1 
ATOM 4348  N N     . ARG F 4 158 ? 48.260  61.606  16.393  1.00 70.22  ? 195 ARG B N     1 
ATOM 4349  C CA    . ARG F 4 158 ? 49.250  61.376  17.430  1.00 68.71  ? 195 ARG B CA    1 
ATOM 4350  C C     . ARG F 4 158 ? 48.641  60.750  18.679  1.00 67.08  ? 195 ARG B C     1 
ATOM 4351  O O     . ARG F 4 158 ? 49.218  59.826  19.248  1.00 93.03  ? 195 ARG B O     1 
ATOM 4352  C CB    . ARG F 4 158 ? 49.969  62.684  17.791  1.00 81.12  ? 195 ARG B CB    1 
ATOM 4353  C CG    . ARG F 4 158 ? 49.070  63.781  18.345  1.00 84.51  ? 195 ARG B CG    1 
ATOM 4354  C CD    . ARG F 4 158 ? 49.868  65.038  18.726  1.00 89.20  ? 195 ARG B CD    1 
ATOM 4355  N NE    . ARG F 4 158 ? 50.601  65.615  17.597  1.00 92.72  ? 195 ARG B NE    1 
ATOM 4356  C CZ    . ARG F 4 158 ? 51.281  66.758  17.645  1.00 95.10  ? 195 ARG B CZ    1 
ATOM 4357  N NH1   . ARG F 4 158 ? 51.327  67.459  18.767  1.00 95.07  ? 195 ARG B NH1   1 
ATOM 4358  N NH2   . ARG F 4 158 ? 51.913  67.205  16.567  1.00 93.87  ? 195 ARG B NH2   1 
ATOM 4359  N N     . GLN F 4 159 ? 47.482  61.234  19.114  1.00 17.78  ? 196 GLN B N     1 
ATOM 4360  C CA    . GLN F 4 159 ? 46.864  60.659  20.305  1.00 15.06  ? 196 GLN B CA    1 
ATOM 4361  C C     . GLN F 4 159 ? 46.248  59.289  20.030  1.00 15.41  ? 196 GLN B C     1 
ATOM 4362  O O     . GLN F 4 159 ? 45.988  58.516  20.948  1.00 32.75  ? 196 GLN B O     1 
ATOM 4363  C CB    . GLN F 4 159 ? 45.833  61.624  20.876  1.00 51.67  ? 196 GLN B CB    1 
ATOM 4364  C CG    . GLN F 4 159 ? 46.474  62.731  21.704  1.00 52.18  ? 196 GLN B CG    1 
ATOM 4365  C CD    . GLN F 4 159 ? 45.481  63.791  22.145  1.00 51.35  ? 196 GLN B CD    1 
ATOM 4366  O OE1   . GLN F 4 159 ? 45.112  64.675  21.358  1.00 50.91  ? 196 GLN B OE1   1 
ATOM 4367  N NE2   . GLN F 4 159 ? 45.032  63.706  23.403  1.00 49.84  ? 196 GLN B NE2   1 
ATOM 4368  N N     . ALA F 4 160 ? 46.034  58.998  18.748  1.00 44.35  ? 197 ALA B N     1 
ATOM 4369  C CA    . ALA F 4 160 ? 45.470  57.728  18.314  1.00 45.21  ? 197 ALA B CA    1 
ATOM 4370  C C     . ALA F 4 160 ? 46.635  56.770  18.327  1.00 45.59  ? 197 ALA B C     1 
ATOM 4371  O O     . ALA F 4 160 ? 46.470  55.562  18.485  1.00 67.89  ? 197 ALA B O     1 
ATOM 4372  C CB    . ALA F 4 160 ? 44.914  57.849  16.907  1.00 54.63  ? 197 ALA B CB    1 
ATOM 4373  N N     . ALA F 4 161 ? 47.826  57.325  18.159  1.00 46.98  ? 198 ALA B N     1 
ATOM 4374  C CA    . ALA F 4 161 ? 49.036  56.522  18.185  1.00 47.93  ? 198 ALA B CA    1 
ATOM 4375  C C     . ALA F 4 161 ? 49.432  56.257  19.643  1.00 49.32  ? 198 ALA B C     1 
ATOM 4376  O O     . ALA F 4 161 ? 50.420  55.572  19.901  1.00 34.88  ? 198 ALA B O     1 
ATOM 4377  C CB    . ALA F 4 161 ? 50.174  57.252  17.449  1.00 22.02  ? 198 ALA B CB    1 
ATOM 4378  N N     . VAL F 4 162 ? 48.647  56.793  20.585  1.00 69.85  ? 199 VAL B N     1 
ATOM 4379  C CA    . VAL F 4 162 ? 48.913  56.641  22.024  1.00 68.97  ? 199 VAL B CA    1 
ATOM 4380  C C     . VAL F 4 162 ? 48.098  55.548  22.707  1.00 67.71  ? 199 VAL B C     1 
ATOM 4381  O O     . VAL F 4 162 ? 48.558  54.950  23.680  1.00 59.38  ? 199 VAL B O     1 
ATOM 4382  C CB    . VAL F 4 162 ? 48.647  57.963  22.810  1.00 53.95  ? 199 VAL B CB    1 
ATOM 4383  C CG1   . VAL F 4 162 ? 48.940  57.759  24.295  1.00 50.38  ? 199 VAL B CG1   1 
ATOM 4384  C CG2   . VAL F 4 162 ? 49.521  59.085  22.267  1.00 55.89  ? 199 VAL B CG2   1 
ATOM 4385  N N     . GLN F 4 163 ? 46.886  55.299  22.222  1.00 64.80  ? 200 GLN B N     1 
ATOM 4386  C CA    . GLN F 4 163 ? 46.056  54.263  22.825  1.00 65.37  ? 200 GLN B CA    1 
ATOM 4387  C C     . GLN F 4 163 ? 46.121  52.948  22.071  1.00 64.05  ? 200 GLN B C     1 
ATOM 4388  O O     . GLN F 4 163 ? 45.705  51.909  22.588  1.00 54.25  ? 200 GLN B O     1 
ATOM 4389  C CB    . GLN F 4 163 ? 44.600  54.715  22.931  1.00 60.73  ? 200 GLN B CB    1 
ATOM 4390  C CG    . GLN F 4 163 ? 44.328  55.693  24.070  1.00 67.04  ? 200 GLN B CG    1 
ATOM 4391  C CD    . GLN F 4 163 ? 44.774  55.179  25.444  1.00 71.15  ? 200 GLN B CD    1 
ATOM 4392  O OE1   . GLN F 4 163 ? 45.968  55.108  25.734  1.00 73.69  ? 200 GLN B OE1   1 
ATOM 4393  N NE2   . GLN F 4 163 ? 43.811  54.822  26.290  1.00 70.02  ? 200 GLN B NE2   1 
ATOM 4394  N N     . GLN F 4 164 ? 46.641  52.990  20.849  1.00 53.03  ? 201 GLN B N     1 
ATOM 4395  C CA    . GLN F 4 164 ? 46.752  51.781  20.046  1.00 49.34  ? 201 GLN B CA    1 
ATOM 4396  C C     . GLN F 4 164 ? 48.103  51.133  20.352  1.00 45.31  ? 201 GLN B C     1 
ATOM 4397  O O     . GLN F 4 164 ? 48.234  49.907  20.431  1.00 48.10  ? 201 GLN B O     1 
ATOM 4398  C CB    . GLN F 4 164 ? 46.665  52.128  18.553  1.00 59.10  ? 201 GLN B CB    1 
ATOM 4399  C CG    . GLN F 4 164 ? 45.408  52.896  18.122  1.00 58.54  ? 201 GLN B CG    1 
ATOM 4400  C CD    . GLN F 4 164 ? 45.355  53.161  16.606  1.00 60.04  ? 201 GLN B CD    1 
ATOM 4401  O OE1   . GLN F 4 164 ? 44.516  53.929  16.120  1.00 55.58  ? 201 GLN B OE1   1 
ATOM 4402  N NE2   . GLN F 4 164 ? 46.245  52.516  15.860  1.00 62.05  ? 201 GLN B NE2   1 
ATOM 4403  N N     . THR F 4 165 ? 49.108  51.977  20.536  1.00 23.27  ? 202 THR B N     1 
ATOM 4404  C CA    . THR F 4 165 ? 50.451  51.503  20.825  1.00 22.13  ? 202 THR B CA    1 
ATOM 4405  C C     . THR F 4 165 ? 50.507  50.819  22.192  1.00 22.02  ? 202 THR B C     1 
ATOM 4406  O O     . THR F 4 165 ? 51.480  50.151  22.535  1.00 28.17  ? 202 THR B O     1 
ATOM 4407  C CB    . THR F 4 165 ? 51.449  52.682  20.792  1.00 34.47  ? 202 THR B CB    1 
ATOM 4408  O OG1   . THR F 4 165 ? 52.783  52.187  20.660  1.00 34.17  ? 202 THR B OG1   1 
ATOM 4409  C CG2   . THR F 4 165 ? 51.356  53.495  22.063  1.00 30.47  ? 202 THR B CG2   1 
ATOM 4410  N N     . LYS F 4 166 ? 49.448  50.982  22.970  1.00 25.93  ? 203 LYS B N     1 
ATOM 4411  C CA    . LYS F 4 166 ? 49.388  50.403  24.300  1.00 27.30  ? 203 LYS B CA    1 
ATOM 4412  C C     . LYS F 4 166 ? 48.888  48.976  24.270  1.00 29.32  ? 203 LYS B C     1 
ATOM 4413  O O     . LYS F 4 166 ? 49.275  48.156  25.102  1.00 59.94  ? 203 LYS B O     1 
ATOM 4414  C CB    . LYS F 4 166 ? 48.484  51.262  25.192  1.00 54.99  ? 203 LYS B CB    1 
ATOM 4415  C CG    . LYS F 4 166 ? 49.209  52.349  25.979  1.00 59.61  ? 203 LYS B CG    1 
ATOM 4416  C CD    . LYS F 4 166 ? 50.094  53.222  25.102  1.00 63.53  ? 203 LYS B CD    1 
ATOM 4417  C CE    . LYS F 4 166 ? 50.971  54.152  25.952  1.00 63.44  ? 203 LYS B CE    1 
ATOM 4418  N NZ    . LYS F 4 166 ? 51.914  55.015  25.163  1.00 63.10  ? 203 LYS B NZ    1 
ATOM 4419  N N     . GLU F 4 167 ? 48.016  48.675  23.319  1.00 35.30  ? 204 GLU B N     1 
ATOM 4420  C CA    . GLU F 4 167 ? 47.492  47.322  23.230  1.00 36.87  ? 204 GLU B CA    1 
ATOM 4421  C C     . GLU F 4 167 ? 48.103  46.545  22.082  1.00 34.11  ? 204 GLU B C     1 
ATOM 4422  O O     . GLU F 4 167 ? 48.034  45.317  22.046  1.00 66.95  ? 204 GLU B O     1 
ATOM 4423  C CB    . GLU F 4 167 ? 45.960  47.334  23.118  1.00 77.95  ? 204 GLU B CB    1 
ATOM 4424  C CG    . GLU F 4 167 ? 45.247  47.329  24.480  1.00 84.38  ? 204 GLU B CG    1 
ATOM 4425  C CD    . GLU F 4 167 ? 43.739  47.193  24.360  1.00 87.57  ? 204 GLU B CD    1 
ATOM 4426  O OE1   . GLU F 4 167 ? 43.285  46.308  23.608  1.00 88.68  ? 204 GLU B OE1   1 
ATOM 4427  O OE2   . GLU F 4 167 ? 43.012  47.964  25.024  1.00 89.29  ? 204 GLU B OE2   1 
ATOM 4428  N N     . MET F 4 168 ? 48.722  47.264  21.156  1.00 50.40  ? 205 MET B N     1 
ATOM 4429  C CA    . MET F 4 168 ? 49.353  46.626  20.017  1.00 47.15  ? 205 MET B CA    1 
ATOM 4430  C C     . MET F 4 168 ? 50.107  45.353  20.385  1.00 47.15  ? 205 MET B C     1 
ATOM 4431  O O     . MET F 4 168 ? 50.799  45.294  21.407  1.00 30.33  ? 205 MET B O     1 
ATOM 4432  C CB    . MET F 4 168 ? 50.318  47.589  19.339  1.00 2.00   ? 205 MET B CB    1 
ATOM 4433  C CG    . MET F 4 168 ? 49.761  48.261  18.103  1.00 2.00   ? 205 MET B CG    1 
ATOM 4434  S SD    . MET F 4 168 ? 51.072  48.693  16.968  1.00 2.00   ? 205 MET B SD    1 
ATOM 4435  C CE    . MET F 4 168 ? 51.654  47.093  16.635  1.00 2.00   ? 205 MET B CE    1 
ATOM 4436  N N     . ASP F 4 169 ? 49.955  44.329  19.553  1.00 41.19  ? 206 ASP B N     1 
ATOM 4437  C CA    . ASP F 4 169 ? 50.649  43.066  19.756  1.00 35.91  ? 206 ASP B CA    1 
ATOM 4438  C C     . ASP F 4 169 ? 51.652  42.955  18.623  1.00 34.35  ? 206 ASP B C     1 
ATOM 4439  O O     . ASP F 4 169 ? 51.264  42.919  17.456  1.00 34.34  ? 206 ASP B O     1 
ATOM 4440  C CB    . ASP F 4 169 ? 49.670  41.899  19.714  1.00 8.46   ? 206 ASP B CB    1 
ATOM 4441  C CG    . ASP F 4 169 ? 50.372  40.545  19.639  1.00 10.31  ? 206 ASP B CG    1 
ATOM 4442  O OD1   . ASP F 4 169 ? 49.715  39.517  19.951  1.00 6.41   ? 206 ASP B OD1   1 
ATOM 4443  O OD2   . ASP F 4 169 ? 51.564  40.508  19.254  1.00 12.40  ? 206 ASP B OD2   1 
ATOM 4444  N N     . LEU F 4 170 ? 52.938  42.901  18.955  1.00 16.03  ? 207 LEU B N     1 
ATOM 4445  C CA    . LEU F 4 170 ? 53.947  42.837  17.907  1.00 18.20  ? 207 LEU B CA    1 
ATOM 4446  C C     . LEU F 4 170 ? 54.202  41.433  17.373  1.00 18.24  ? 207 LEU B C     1 
ATOM 4447  O O     . LEU F 4 170 ? 55.134  41.235  16.587  1.00 31.07  ? 207 LEU B O     1 
ATOM 4448  C CB    . LEU F 4 170 ? 55.277  43.409  18.395  1.00 14.72  ? 207 LEU B CB    1 
ATOM 4449  C CG    . LEU F 4 170 ? 55.328  44.683  19.230  1.00 11.38  ? 207 LEU B CG    1 
ATOM 4450  C CD1   . LEU F 4 170 ? 54.620  45.812  18.510  1.00 11.56  ? 207 LEU B CD1   1 
ATOM 4451  C CD2   . LEU F 4 170 ? 54.715  44.401  20.604  1.00 14.08  ? 207 LEU B CD2   1 
ATOM 4452  N N     . SER F 4 171 ? 53.382  40.465  17.776  1.00 12.79  ? 208 SER B N     1 
ATOM 4453  C CA    . SER F 4 171 ? 53.588  39.080  17.347  1.00 14.11  ? 208 SER B CA    1 
ATOM 4454  C C     . SER F 4 171 ? 52.749  38.596  16.172  1.00 14.59  ? 208 SER B C     1 
ATOM 4455  O O     . SER F 4 171 ? 53.058  37.569  15.559  1.00 6.53   ? 208 SER B O     1 
ATOM 4456  C CB    . SER F 4 171 ? 53.346  38.143  18.524  1.00 9.03   ? 208 SER B CB    1 
ATOM 4457  O OG    . SER F 4 171 ? 52.006  38.245  18.986  1.00 9.03   ? 208 SER B OG    1 
ATOM 4458  N N     . VAL F 4 172 ? 51.680  39.320  15.868  1.00 20.82  ? 209 VAL B N     1 
ATOM 4459  C CA    . VAL F 4 172 ? 50.804  38.925  14.780  1.00 17.89  ? 209 VAL B CA    1 
ATOM 4460  C C     . VAL F 4 172 ? 50.321  40.102  13.960  1.00 16.36  ? 209 VAL B C     1 
ATOM 4461  O O     . VAL F 4 172 ? 50.098  41.195  14.478  1.00 7.73   ? 209 VAL B O     1 
ATOM 4462  C CB    . VAL F 4 172 ? 49.587  38.186  15.302  1.00 14.56  ? 209 VAL B CB    1 
ATOM 4463  C CG1   . VAL F 4 172 ? 48.817  39.079  16.264  1.00 15.57  ? 209 VAL B CG1   1 
ATOM 4464  C CG2   . VAL F 4 172 ? 48.708  37.781  14.149  1.00 10.99  ? 209 VAL B CG2   1 
ATOM 4465  N N     . VAL F 4 173 ? 50.140  39.867  12.671  1.00 21.45  ? 210 VAL B N     1 
ATOM 4466  C CA    . VAL F 4 173 ? 49.692  40.911  11.765  1.00 24.31  ? 210 VAL B CA    1 
ATOM 4467  C C     . VAL F 4 173 ? 48.645  40.380  10.789  1.00 26.73  ? 210 VAL B C     1 
ATOM 4468  O O     . VAL F 4 173 ? 48.277  39.201  10.821  1.00 15.90  ? 210 VAL B O     1 
ATOM 4469  C CB    . VAL F 4 173 ? 50.867  41.455  10.944  1.00 12.78  ? 210 VAL B CB    1 
ATOM 4470  C CG1   . VAL F 4 173 ? 51.861  42.137  11.843  1.00 15.08  ? 210 VAL B CG1   1 
ATOM 4471  C CG2   . VAL F 4 173 ? 51.537  40.334  10.213  1.00 14.90  ? 210 VAL B CG2   1 
ATOM 4472  N N     . ARG F 4 174 ? 48.171  41.258  9.914   1.00 19.17  ? 211 ARG B N     1 
ATOM 4473  C CA    . ARG F 4 174 ? 47.180  40.888  8.912   1.00 20.06  ? 211 ARG B CA    1 
ATOM 4474  C C     . ARG F 4 174 ? 47.324  41.837  7.752   1.00 20.76  ? 211 ARG B C     1 
ATOM 4475  O O     . ARG F 4 174 ? 47.466  43.048  7.958   1.00 22.88  ? 211 ARG B O     1 
ATOM 4476  C CB    . ARG F 4 174 ? 45.772  41.034  9.460   1.00 16.53  ? 211 ARG B CB    1 
ATOM 4477  C CG    . ARG F 4 174 ? 45.536  40.416  10.805  1.00 12.01  ? 211 ARG B CG    1 
ATOM 4478  C CD    . ARG F 4 174 ? 44.107  40.679  11.196  1.00 14.08  ? 211 ARG B CD    1 
ATOM 4479  N NE    . ARG F 4 174 ? 43.188  39.902  10.368  1.00 22.15  ? 211 ARG B NE    1 
ATOM 4480  C CZ    . ARG F 4 174 ? 41.868  40.068  10.347  1.00 24.55  ? 211 ARG B CZ    1 
ATOM 4481  N NH1   . ARG F 4 174 ? 41.296  40.996  11.105  1.00 27.73  ? 211 ARG B NH1   1 
ATOM 4482  N NH2   . ARG F 4 174 ? 41.115  39.286  9.585   1.00 21.51  ? 211 ARG B NH2   1 
ATOM 4483  N N     . LEU F 4 175 ? 47.282  41.287  6.540   1.00 5.51   ? 212 LEU B N     1 
ATOM 4484  C CA    . LEU F 4 175 ? 47.388  42.068  5.315   1.00 5.51   ? 212 LEU B CA    1 
ATOM 4485  C C     . LEU F 4 175 ? 46.103  42.855  5.087   1.00 5.51   ? 212 LEU B C     1 
ATOM 4486  O O     . LEU F 4 175 ? 45.039  42.447  5.537   1.00 15.43  ? 212 LEU B O     1 
ATOM 4487  C CB    . LEU F 4 175 ? 47.632  41.126  4.150   1.00 2.00   ? 212 LEU B CB    1 
ATOM 4488  C CG    . LEU F 4 175 ? 49.087  40.784  3.844   1.00 2.00   ? 212 LEU B CG    1 
ATOM 4489  C CD1   . LEU F 4 175 ? 49.961  41.159  5.000   1.00 2.00   ? 212 LEU B CD1   1 
ATOM 4490  C CD2   . LEU F 4 175 ? 49.219  39.315  3.513   1.00 2.00   ? 212 LEU B CD2   1 
ATOM 4491  N N     . MET F 4 176 ? 46.175  43.994  4.415   1.00 16.08  ? 213 MET B N     1 
ATOM 4492  C CA    . MET F 4 176 ? 44.951  44.761  4.164   1.00 16.08  ? 213 MET B CA    1 
ATOM 4493  C C     . MET F 4 176 ? 44.935  45.209  2.721   1.00 16.08  ? 213 MET B C     1 
ATOM 4494  O O     . MET F 4 176 ? 45.382  46.312  2.391   1.00 30.11  ? 213 MET B O     1 
ATOM 4495  C CB    . MET F 4 176 ? 44.870  45.981  5.070   1.00 19.38  ? 213 MET B CB    1 
ATOM 4496  C CG    . MET F 4 176 ? 43.747  46.928  4.720   1.00 24.85  ? 213 MET B CG    1 
ATOM 4497  S SD    . MET F 4 176 ? 42.171  46.332  5.263   1.00 31.52  ? 213 MET B SD    1 
ATOM 4498  C CE    . MET F 4 176 ? 41.624  47.721  6.271   1.00 33.15  ? 213 MET B CE    1 
ATOM 4499  N N     . PHE F 4 177 ? 44.411  44.338  1.865   1.00 14.96  ? 214 PHE B N     1 
ATOM 4500  C CA    . PHE F 4 177 ? 44.354  44.604  0.438   1.00 13.87  ? 214 PHE B CA    1 
ATOM 4501  C C     . PHE F 4 177 ? 43.296  45.597  0.066   1.00 13.64  ? 214 PHE B C     1 
ATOM 4502  O O     . PHE F 4 177 ? 42.115  45.391  0.333   1.00 16.96  ? 214 PHE B O     1 
ATOM 4503  C CB    . PHE F 4 177 ? 44.137  43.303  -0.309  1.00 8.34   ? 214 PHE B CB    1 
ATOM 4504  C CG    . PHE F 4 177 ? 45.206  42.274  -0.047  1.00 4.75   ? 214 PHE B CG    1 
ATOM 4505  C CD1   . PHE F 4 177 ? 46.550  42.565  -0.314  1.00 4.75   ? 214 PHE B CD1   1 
ATOM 4506  C CD2   . PHE F 4 177 ? 44.878  41.028  0.467   1.00 4.75   ? 214 PHE B CD2   1 
ATOM 4507  C CE1   . PHE F 4 177 ? 47.550  41.633  -0.072  1.00 4.75   ? 214 PHE B CE1   1 
ATOM 4508  C CE2   . PHE F 4 177 ? 45.860  40.090  0.712   1.00 4.75   ? 214 PHE B CE2   1 
ATOM 4509  C CZ    . PHE F 4 177 ? 47.208  40.386  0.444   1.00 4.75   ? 214 PHE B CZ    1 
ATOM 4510  N N     . THR F 4 178 ? 43.744  46.691  -0.542  1.00 22.18  ? 215 THR B N     1 
ATOM 4511  C CA    . THR F 4 178 ? 42.862  47.767  -0.983  1.00 22.18  ? 215 THR B CA    1 
ATOM 4512  C C     . THR F 4 178 ? 43.081  48.048  -2.470  1.00 22.18  ? 215 THR B C     1 
ATOM 4513  O O     . THR F 4 178 ? 44.221  48.219  -2.901  1.00 38.20  ? 215 THR B O     1 
ATOM 4514  C CB    . THR F 4 178 ? 43.131  49.057  -0.222  1.00 31.54  ? 215 THR B CB    1 
ATOM 4515  O OG1   . THR F 4 178 ? 43.151  48.795  1.185   1.00 37.17  ? 215 THR B OG1   1 
ATOM 4516  C CG2   . THR F 4 178 ? 42.041  50.069  -0.540  1.00 28.82  ? 215 THR B CG2   1 
ATOM 4517  N N     . ALA F 4 179 ? 41.993  48.108  -3.238  1.00 37.02  ? 216 ALA B N     1 
ATOM 4518  C CA    . ALA F 4 179 ? 42.070  48.352  -4.677  1.00 38.33  ? 216 ALA B CA    1 
ATOM 4519  C C     . ALA F 4 179 ? 41.597  49.739  -5.102  1.00 39.09  ? 216 ALA B C     1 
ATOM 4520  O O     . ALA F 4 179 ? 40.583  50.243  -4.612  1.00 38.89  ? 216 ALA B O     1 
ATOM 4521  C CB    . ALA F 4 179 ? 41.260  47.302  -5.406  1.00 34.44  ? 216 ALA B CB    1 
ATOM 4522  N N     . PHE F 4 180 ? 42.331  50.346  -6.032  1.00 5.01   ? 217 PHE B N     1 
ATOM 4523  C CA    . PHE F 4 180 ? 41.981  51.672  -6.539  1.00 5.01   ? 217 PHE B CA    1 
ATOM 4524  C C     . PHE F 4 180 ? 41.843  51.636  -8.045  1.00 6.60   ? 217 PHE B C     1 
ATOM 4525  O O     . PHE F 4 180 ? 42.802  51.318  -8.757  1.00 10.32  ? 217 PHE B O     1 
ATOM 4526  C CB    . PHE F 4 180 ? 43.045  52.686  -6.122  1.00 11.79  ? 217 PHE B CB    1 
ATOM 4527  C CG    . PHE F 4 180 ? 43.014  52.989  -4.665  1.00 12.49  ? 217 PHE B CG    1 
ATOM 4528  C CD1   . PHE F 4 180 ? 42.122  53.916  -4.161  1.00 12.75  ? 217 PHE B CD1   1 
ATOM 4529  C CD2   . PHE F 4 180 ? 43.830  52.303  -3.782  1.00 11.43  ? 217 PHE B CD2   1 
ATOM 4530  C CE1   . PHE F 4 180 ? 42.026  54.152  -2.800  1.00 11.58  ? 217 PHE B CE1   1 
ATOM 4531  C CE2   . PHE F 4 180 ? 43.738  52.533  -2.414  1.00 10.99  ? 217 PHE B CE2   1 
ATOM 4532  C CZ    . PHE F 4 180 ? 42.838  53.464  -1.923  1.00 11.85  ? 217 PHE B CZ    1 
ATOM 4533  N N     . LEU F 4 181 ? 40.635  51.945  -8.517  1.00 34.93  ? 218 LEU B N     1 
ATOM 4534  C CA    . LEU F 4 181 ? 40.323  51.971  -9.947  1.00 32.89  ? 218 LEU B CA    1 
ATOM 4535  C C     . LEU F 4 181 ? 40.427  53.392  -10.471 1.00 36.00  ? 218 LEU B C     1 
ATOM 4536  O O     . LEU F 4 181 ? 40.063  54.343  -9.782  1.00 48.08  ? 218 LEU B O     1 
ATOM 4537  C CB    . LEU F 4 181 ? 38.914  51.425  -10.189 1.00 25.66  ? 218 LEU B CB    1 
ATOM 4538  C CG    . LEU F 4 181 ? 38.736  49.906  -10.077 1.00 20.67  ? 218 LEU B CG    1 
ATOM 4539  C CD1   . LEU F 4 181 ? 39.743  49.315  -9.097  1.00 17.00  ? 218 LEU B CD1   1 
ATOM 4540  C CD2   . LEU F 4 181 ? 37.315  49.598  -9.656  1.00 19.73  ? 218 LEU B CD2   1 
ATOM 4541  N N     . PRO F 4 182 ? 40.915  53.551  -11.705 1.00 49.53  ? 219 PRO B N     1 
ATOM 4542  C CA    . PRO F 4 182 ? 41.076  54.872  -12.331 1.00 55.29  ? 219 PRO B CA    1 
ATOM 4543  C C     . PRO F 4 182 ? 39.803  55.721  -12.246 1.00 59.52  ? 219 PRO B C     1 
ATOM 4544  O O     . PRO F 4 182 ? 38.729  55.205  -11.947 1.00 47.64  ? 219 PRO B O     1 
ATOM 4545  C CB    . PRO F 4 182 ? 41.458  54.525  -13.769 1.00 42.78  ? 219 PRO B CB    1 
ATOM 4546  C CG    . PRO F 4 182 ? 40.682  53.243  -14.004 1.00 44.41  ? 219 PRO B CG    1 
ATOM 4547  C CD    . PRO F 4 182 ? 40.940  52.480  -12.719 1.00 39.62  ? 219 PRO B CD    1 
ATOM 4548  N N     . ASP F 4 183 ? 39.927  57.021  -12.494 1.00 63.66  ? 220 ASP B N     1 
ATOM 4549  C CA    . ASP F 4 183 ? 38.772  57.914  -12.445 1.00 67.17  ? 220 ASP B CA    1 
ATOM 4550  C C     . ASP F 4 183 ? 38.717  58.775  -13.711 1.00 67.14  ? 220 ASP B C     1 
ATOM 4551  O O     . ASP F 4 183 ? 39.310  58.421  -14.734 1.00 35.32  ? 220 ASP B O     1 
ATOM 4552  C CB    . ASP F 4 183 ? 38.830  58.805  -11.196 1.00 25.59  ? 220 ASP B CB    1 
ATOM 4553  C CG    . ASP F 4 183 ? 39.935  59.843  -11.268 1.00 30.09  ? 220 ASP B CG    1 
ATOM 4554  O OD1   . ASP F 4 183 ? 41.074  59.482  -11.608 1.00 32.35  ? 220 ASP B OD1   1 
ATOM 4555  O OD2   . ASP F 4 183 ? 39.673  61.023  -10.977 1.00 29.21  ? 220 ASP B OD2   1 
ATOM 4556  N N     . SER F 4 184 ? 38.010  59.902  -13.645 1.00 81.43  ? 221 SER B N     1 
ATOM 4557  C CA    . SER F 4 184 ? 37.883  60.789  -14.806 1.00 81.54  ? 221 SER B CA    1 
ATOM 4558  C C     . SER F 4 184 ? 39.240  61.352  -15.194 1.00 82.12  ? 221 SER B C     1 
ATOM 4559  O O     . SER F 4 184 ? 39.587  61.420  -16.376 1.00 81.05  ? 221 SER B O     1 
ATOM 4560  C CB    . SER F 4 184 ? 36.940  61.955  -14.499 1.00 66.86  ? 221 SER B CB    1 
ATOM 4561  O OG    . SER F 4 184 ? 37.587  62.920  -13.690 1.00 65.41  ? 221 SER B OG    1 
ATOM 4562  N N     . THR F 4 185 ? 39.998  61.750  -14.177 1.00 81.65  ? 222 THR B N     1 
ATOM 4563  C CA    . THR F 4 185 ? 41.325  62.326  -14.349 1.00 83.87  ? 222 THR B CA    1 
ATOM 4564  C C     . THR F 4 185 ? 42.317  61.272  -14.801 1.00 85.74  ? 222 THR B C     1 
ATOM 4565  O O     . THR F 4 185 ? 43.463  61.584  -15.100 1.00 61.85  ? 222 THR B O     1 
ATOM 4566  C CB    . THR F 4 185 ? 41.854  62.895  -13.022 1.00 56.82  ? 222 THR B CB    1 
ATOM 4567  O OG1   . THR F 4 185 ? 40.786  63.537  -12.317 1.00 54.98  ? 222 THR B OG1   1 
ATOM 4568  C CG2   . THR F 4 185 ? 42.969  63.900  -13.279 1.00 55.31  ? 222 THR B CG2   1 
ATOM 4569  N N     . GLY F 4 186 ? 41.875  60.020  -14.841 1.00 76.57  ? 223 GLY B N     1 
ATOM 4570  C CA    . GLY F 4 186 ? 42.765  58.938  -15.228 1.00 78.91  ? 223 GLY B CA    1 
ATOM 4571  C C     . GLY F 4 186 ? 43.525  58.425  -14.013 1.00 81.25  ? 223 GLY B C     1 
ATOM 4572  O O     . GLY F 4 186 ? 44.217  57.405  -14.073 1.00 74.38  ? 223 GLY B O     1 
ATOM 4573  N N     . SER F 4 187 ? 43.396  59.148  -12.904 1.00 66.73  ? 224 SER B N     1 
ATOM 4574  C CA    . SER F 4 187 ? 44.052  58.784  -11.656 1.00 66.76  ? 224 SER B CA    1 
ATOM 4575  C C     . SER F 4 187 ? 43.258  57.684  -10.950 1.00 65.10  ? 224 SER B C     1 
ATOM 4576  O O     . SER F 4 187 ? 42.164  57.336  -11.387 1.00 87.49  ? 224 SER B O     1 
ATOM 4577  C CB    . SER F 4 187 ? 44.186  60.021  -10.765 1.00 96.99  ? 224 SER B CB    1 
ATOM 4578  O OG    . SER F 4 187 ? 43.035  60.850  -10.852 1.00 99.82  ? 224 SER B OG    1 
ATOM 4579  N N     . PHE F 4 188 ? 43.804  57.138  -9.866  1.00 55.99  ? 225 PHE B N     1 
ATOM 4580  C CA    . PHE F 4 188 ? 43.145  56.052  -9.133  1.00 53.03  ? 225 PHE B CA    1 
ATOM 4581  C C     . PHE F 4 188 ? 42.573  56.507  -7.798  1.00 54.13  ? 225 PHE B C     1 
ATOM 4582  O O     . PHE F 4 188 ? 43.220  56.350  -6.768  1.00 33.75  ? 225 PHE B O     1 
ATOM 4583  C CB    . PHE F 4 188 ? 44.155  54.937  -8.896  1.00 25.65  ? 225 PHE B CB    1 
ATOM 4584  C CG    . PHE F 4 188 ? 44.816  54.458  -10.147 1.00 21.11  ? 225 PHE B CG    1 
ATOM 4585  C CD1   . PHE F 4 188 ? 44.233  53.456  -10.918 1.00 20.64  ? 225 PHE B CD1   1 
ATOM 4586  C CD2   . PHE F 4 188 ? 45.983  55.040  -10.591 1.00 17.80  ? 225 PHE B CD2   1 
ATOM 4587  C CE1   . PHE F 4 188 ? 44.810  53.037  -12.135 1.00 16.60  ? 225 PHE B CE1   1 
ATOM 4588  C CE2   . PHE F 4 188 ? 46.561  54.633  -11.795 1.00 14.44  ? 225 PHE B CE2   1 
ATOM 4589  C CZ    . PHE F 4 188 ? 45.973  53.625  -12.570 1.00 13.17  ? 225 PHE B CZ    1 
ATOM 4590  N N     . THR F 4 189 ? 41.348  57.025  -7.817  1.00 74.82  ? 226 THR B N     1 
ATOM 4591  C CA    . THR F 4 189 ? 40.709  57.558  -6.614  1.00 75.74  ? 226 THR B CA    1 
ATOM 4592  C C     . THR F 4 189 ? 39.576  56.740  -6.013  1.00 74.65  ? 226 THR B C     1 
ATOM 4593  O O     . THR F 4 189 ? 39.120  57.030  -4.904  1.00 82.81  ? 226 THR B O     1 
ATOM 4594  C CB    . THR F 4 189 ? 40.121  58.944  -6.897  1.00 96.98  ? 226 THR B CB    1 
ATOM 4595  O OG1   . THR F 4 189 ? 41.005  59.675  -7.759  1.00 98.78  ? 226 THR B OG1   1 
ATOM 4596  C CG2   . THR F 4 189 ? 39.912  59.709  -5.589  1.00 96.66  ? 226 THR B CG2   1 
ATOM 4597  N N     . ARG F 4 190 ? 39.111  55.733  -6.741  1.00 47.52  ? 227 ARG B N     1 
ATOM 4598  C CA    . ARG F 4 190 ? 38.000  54.917  -6.268  1.00 45.71  ? 227 ARG B CA    1 
ATOM 4599  C C     . ARG F 4 190 ? 38.418  53.813  -5.289  1.00 41.07  ? 227 ARG B C     1 
ATOM 4600  O O     . ARG F 4 190 ? 38.985  52.791  -5.691  1.00 70.40  ? 227 ARG B O     1 
ATOM 4601  C CB    . ARG F 4 190 ? 37.278  54.336  -7.483  1.00 85.31  ? 227 ARG B CB    1 
ATOM 4602  C CG    . ARG F 4 190 ? 36.880  55.399  -8.517  1.00 88.07  ? 227 ARG B CG    1 
ATOM 4603  C CD    . ARG F 4 190 ? 35.814  56.389  -7.985  1.00 92.46  ? 227 ARG B CD    1 
ATOM 4604  N NE    . ARG F 4 190 ? 36.316  57.307  -6.956  1.00 94.61  ? 227 ARG B NE    1 
ATOM 4605  C CZ    . ARG F 4 190 ? 35.574  58.212  -6.315  1.00 94.72  ? 227 ARG B CZ    1 
ATOM 4606  N NH1   . ARG F 4 190 ? 34.279  58.339  -6.582  1.00 93.68  ? 227 ARG B NH1   1 
ATOM 4607  N NH2   . ARG F 4 190 ? 36.132  58.997  -5.402  1.00 94.07  ? 227 ARG B NH2   1 
ATOM 4608  N N     . ARG F 4 191 ? 38.131  54.035  -4.002  1.00 50.28  ? 228 ARG B N     1 
ATOM 4609  C CA    . ARG F 4 191 ? 38.466  53.091  -2.925  1.00 46.03  ? 228 ARG B CA    1 
ATOM 4610  C C     . ARG F 4 191 ? 37.547  51.872  -2.900  1.00 43.43  ? 228 ARG B C     1 
ATOM 4611  O O     . ARG F 4 191 ? 36.362  51.983  -2.579  1.00 63.68  ? 228 ARG B O     1 
ATOM 4612  C CB    . ARG F 4 191 ? 38.376  53.771  -1.547  1.00 65.56  ? 228 ARG B CB    1 
ATOM 4613  C CG    . ARG F 4 191 ? 39.278  54.985  -1.336  1.00 66.45  ? 228 ARG B CG    1 
ATOM 4614  C CD    . ARG F 4 191 ? 38.860  56.209  -2.172  1.00 66.99  ? 228 ARG B CD    1 
ATOM 4615  N NE    . ARG F 4 191 ? 37.497  56.678  -1.896  1.00 71.55  ? 228 ARG B NE    1 
ATOM 4616  C CZ    . ARG F 4 191 ? 37.092  57.198  -0.739  1.00 72.85  ? 228 ARG B CZ    1 
ATOM 4617  N NH1   . ARG F 4 191 ? 37.934  57.328  0.277   1.00 74.69  ? 228 ARG B NH1   1 
ATOM 4618  N NH2   . ARG F 4 191 ? 35.835  57.586  -0.597  1.00 72.92  ? 228 ARG B NH2   1 
ATOM 4619  N N     . LEU F 4 192 ? 38.099  50.711  -3.226  1.00 31.21  ? 229 LEU B N     1 
ATOM 4620  C CA    . LEU F 4 192 ? 37.327  49.479  -3.201  1.00 29.90  ? 229 LEU B CA    1 
ATOM 4621  C C     . LEU F 4 192 ? 37.468  48.830  -1.829  1.00 30.77  ? 229 LEU B C     1 
ATOM 4622  O O     . LEU F 4 192 ? 38.586  48.535  -1.390  1.00 41.63  ? 229 LEU B O     1 
ATOM 4623  C CB    . LEU F 4 192 ? 37.825  48.530  -4.281  1.00 39.87  ? 229 LEU B CB    1 
ATOM 4624  C CG    . LEU F 4 192 ? 37.287  48.801  -5.676  1.00 34.66  ? 229 LEU B CG    1 
ATOM 4625  C CD1   . LEU F 4 192 ? 38.054  47.978  -6.692  1.00 31.55  ? 229 LEU B CD1   1 
ATOM 4626  C CD2   . LEU F 4 192 ? 35.806  48.449  -5.689  1.00 36.47  ? 229 LEU B CD2   1 
ATOM 4627  N N     . GLU F 4 193 ? 36.327  48.614  -1.169  1.00 67.28  ? 230 GLU B N     1 
ATOM 4628  C CA    . GLU F 4 193 ? 36.288  48.021  0.166   1.00 66.82  ? 230 GLU B CA    1 
ATOM 4629  C C     . GLU F 4 193 ? 37.474  47.117  0.415   1.00 66.36  ? 230 GLU B C     1 
ATOM 4630  O O     . GLU F 4 193 ? 37.668  46.124  -0.283  1.00 47.80  ? 230 GLU B O     1 
ATOM 4631  C CB    . GLU F 4 193 ? 34.998  47.227  0.378   1.00 51.97  ? 230 GLU B CB    1 
ATOM 4632  C CG    . GLU F 4 193 ? 33.744  48.081  0.551   1.00 53.74  ? 230 GLU B CG    1 
ATOM 4633  C CD    . GLU F 4 193 ? 33.827  49.040  1.739   1.00 54.71  ? 230 GLU B CD    1 
ATOM 4634  O OE1   . GLU F 4 193 ? 34.476  50.110  1.630   1.00 54.42  ? 230 GLU B OE1   1 
ATOM 4635  O OE2   . GLU F 4 193 ? 33.241  48.714  2.790   1.00 53.93  ? 230 GLU B OE2   1 
ATOM 4636  N N     . PRO F 4 194 ? 38.304  47.468  1.403   1.00 42.36  ? 231 PRO B N     1 
ATOM 4637  C CA    . PRO F 4 194 ? 39.482  46.667  1.735   1.00 38.29  ? 231 PRO B CA    1 
ATOM 4638  C C     . PRO F 4 194 ? 39.111  45.260  2.202   1.00 36.19  ? 231 PRO B C     1 
ATOM 4639  O O     . PRO F 4 194 ? 38.011  45.035  2.701   1.00 34.70  ? 231 PRO B O     1 
ATOM 4640  C CB    . PRO F 4 194 ? 40.166  47.507  2.819   1.00 23.79  ? 231 PRO B CB    1 
ATOM 4641  C CG    . PRO F 4 194 ? 39.032  48.277  3.434   1.00 28.10  ? 231 PRO B CG    1 
ATOM 4642  C CD    . PRO F 4 194 ? 38.240  48.681  2.237   1.00 29.01  ? 231 PRO B CD    1 
ATOM 4643  N N     . VAL F 4 195 ? 40.026  44.319  2.020   1.00 34.90  ? 232 VAL B N     1 
ATOM 4644  C CA    . VAL F 4 195 ? 39.811  42.943  2.442   1.00 33.36  ? 232 VAL B CA    1 
ATOM 4645  C C     . VAL F 4 195 ? 41.010  42.455  3.279   1.00 32.78  ? 232 VAL B C     1 
ATOM 4646  O O     . VAL F 4 195 ? 42.068  42.152  2.725   1.00 43.03  ? 232 VAL B O     1 
ATOM 4647  C CB    . VAL F 4 195 ? 39.606  42.020  1.200   1.00 21.10  ? 232 VAL B CB    1 
ATOM 4648  C CG1   . VAL F 4 195 ? 40.413  42.532  0.036   1.00 21.53  ? 232 VAL B CG1   1 
ATOM 4649  C CG2   . VAL F 4 195 ? 40.045  40.600  1.519   1.00 23.39  ? 232 VAL B CG2   1 
ATOM 4650  N N     . VAL F 4 196 ? 40.868  42.384  4.602   1.00 33.17  ? 233 VAL B N     1 
ATOM 4651  C CA    . VAL F 4 196 ? 42.002  41.918  5.402   1.00 32.70  ? 233 VAL B CA    1 
ATOM 4652  C C     . VAL F 4 196 ? 42.277  40.430  5.232   1.00 33.58  ? 233 VAL B C     1 
ATOM 4653  O O     . VAL F 4 196 ? 41.376  39.629  4.974   1.00 27.88  ? 233 VAL B O     1 
ATOM 4654  C CB    . VAL F 4 196 ? 41.840  42.200  6.904   1.00 8.39   ? 233 VAL B CB    1 
ATOM 4655  C CG1   . VAL F 4 196 ? 41.619  43.666  7.118   1.00 3.16   ? 233 VAL B CG1   1 
ATOM 4656  C CG2   . VAL F 4 196 ? 40.715  41.391  7.471   1.00 7.17   ? 233 VAL B CG2   1 
ATOM 4657  N N     . SER F 4 197 ? 43.546  40.072  5.369   1.00 30.42  ? 234 SER B N     1 
ATOM 4658  C CA    . SER F 4 197 ? 43.966  38.691  5.226   1.00 30.39  ? 234 SER B CA    1 
ATOM 4659  C C     . SER F 4 197 ? 43.539  37.935  6.462   1.00 30.51  ? 234 SER B C     1 
ATOM 4660  O O     . SER F 4 197 ? 42.840  38.471  7.318   1.00 52.12  ? 234 SER B O     1 
ATOM 4661  C CB    . SER F 4 197 ? 45.483  38.619  5.072   1.00 49.70  ? 234 SER B CB    1 
ATOM 4662  O OG    . SER F 4 197 ? 45.882  37.325  4.664   1.00 51.55  ? 234 SER B OG    1 
ATOM 4663  N N     . ASP F 4 198 ? 43.969  36.688  6.546   1.00 67.57  ? 235 ASP B N     1 
ATOM 4664  C CA    . ASP F 4 198 ? 43.659  35.829  7.673   1.00 68.28  ? 235 ASP B CA    1 
ATOM 4665  C C     . ASP F 4 198 ? 44.279  36.342  8.968   1.00 66.24  ? 235 ASP B C     1 
ATOM 4666  O O     . ASP F 4 198 ? 43.620  36.994  9.783   1.00 48.77  ? 235 ASP B O     1 
ATOM 4667  C CB    . ASP F 4 198 ? 44.196  34.436  7.394   1.00 27.78  ? 235 ASP B CB    1 
ATOM 4668  C CG    . ASP F 4 198 ? 43.135  33.500  6.944   1.00 28.71  ? 235 ASP B CG    1 
ATOM 4669  O OD1   . ASP F 4 198 ? 43.383  32.754  5.974   1.00 29.82  ? 235 ASP B OD1   1 
ATOM 4670  O OD2   . ASP F 4 198 ? 42.061  33.509  7.575   1.00 25.90  ? 235 ASP B OD2   1 
ATOM 4671  N N     . ALA F 4 199 ? 45.555  36.022  9.148   1.00 16.09  ? 236 ALA B N     1 
ATOM 4672  C CA    . ALA F 4 199 ? 46.303  36.417  10.329  1.00 13.78  ? 236 ALA B CA    1 
ATOM 4673  C C     . ALA F 4 199 ? 47.617  35.660  10.303  1.00 13.80  ? 236 ALA B C     1 
ATOM 4674  O O     . ALA F 4 199 ? 47.650  34.427  10.312  1.00 13.52  ? 236 ALA B O     1 
ATOM 4675  C CB    . ALA F 4 199 ? 45.539  36.082  11.581  1.00 14.20  ? 236 ALA B CB    1 
ATOM 4676  N N     . ILE F 4 200 ? 48.705  36.413  10.265  1.00 36.93  ? 237 ILE B N     1 
ATOM 4677  C CA    . ILE F 4 200 ? 50.034  35.834  10.221  1.00 38.60  ? 237 ILE B CA    1 
ATOM 4678  C C     . ILE F 4 200 ? 50.722  35.936  11.582  1.00 39.81  ? 237 ILE B C     1 
ATOM 4679  O O     . ILE F 4 200 ? 50.797  37.011  12.196  1.00 20.03  ? 237 ILE B O     1 
ATOM 4680  C CB    . ILE F 4 200 ? 50.875  36.539  9.146   1.00 18.32  ? 237 ILE B CB    1 
ATOM 4681  C CG1   . ILE F 4 200 ? 50.044  36.664  7.867   1.00 16.43  ? 237 ILE B CG1   1 
ATOM 4682  C CG2   . ILE F 4 200 ? 52.153  35.763  8.881   1.00 14.71  ? 237 ILE B CG2   1 
ATOM 4683  C CD1   . ILE F 4 200 ? 50.801  37.241  6.689   1.00 13.79  ? 237 ILE B CD1   1 
ATOM 4684  N N     . TYR F 4 201 ? 51.231  34.796  12.035  1.00 20.07  ? 238 TYR B N     1 
ATOM 4685  C CA    . TYR F 4 201 ? 51.898  34.695  13.316  1.00 18.52  ? 238 TYR B CA    1 
ATOM 4686  C C     . TYR F 4 201 ? 53.421  34.605  13.209  1.00 18.52  ? 238 TYR B C     1 
ATOM 4687  O O     . TYR F 4 201 ? 53.970  33.767  12.500  1.00 29.98  ? 238 TYR B O     1 
ATOM 4688  C CB    . TYR F 4 201 ? 51.325  33.487  14.053  1.00 2.00   ? 238 TYR B CB    1 
ATOM 4689  C CG    . TYR F 4 201 ? 49.825  33.594  14.323  1.00 2.00   ? 238 TYR B CG    1 
ATOM 4690  C CD1   . TYR F 4 201 ? 49.334  34.447  15.317  1.00 2.20   ? 238 TYR B CD1   1 
ATOM 4691  C CD2   . TYR F 4 201 ? 48.902  32.797  13.645  1.00 2.00   ? 238 TYR B CD2   1 
ATOM 4692  C CE1   . TYR F 4 201 ? 47.964  34.493  15.648  1.00 2.00   ? 238 TYR B CE1   1 
ATOM 4693  C CE2   . TYR F 4 201 ? 47.520  32.837  13.970  1.00 2.00   ? 238 TYR B CE2   1 
ATOM 4694  C CZ    . TYR F 4 201 ? 47.069  33.685  14.982  1.00 2.00   ? 238 TYR B CZ    1 
ATOM 4695  O OH    . TYR F 4 201 ? 45.753  33.684  15.378  1.00 2.00   ? 238 TYR B OH    1 
ATOM 4696  N N     . ASP F 4 202 ? 54.093  35.514  13.898  1.00 13.65  ? 239 ASP B N     1 
ATOM 4697  C CA    . ASP F 4 202 ? 55.541  35.539  13.922  1.00 15.60  ? 239 ASP B CA    1 
ATOM 4698  C C     . ASP F 4 202 ? 55.950  34.137  14.357  1.00 13.67  ? 239 ASP B C     1 
ATOM 4699  O O     . ASP F 4 202 ? 55.299  33.550  15.210  1.00 22.01  ? 239 ASP B O     1 
ATOM 4700  C CB    . ASP F 4 202 ? 56.002  36.554  14.964  1.00 23.02  ? 239 ASP B CB    1 
ATOM 4701  C CG    . ASP F 4 202 ? 57.499  36.782  14.949  1.00 23.47  ? 239 ASP B CG    1 
ATOM 4702  O OD1   . ASP F 4 202 ? 58.230  35.930  14.413  1.00 22.47  ? 239 ASP B OD1   1 
ATOM 4703  O OD2   . ASP F 4 202 ? 57.947  37.817  15.499  1.00 25.60  ? 239 ASP B OD2   1 
ATOM 4704  N N     . SER F 4 203 ? 57.004  33.588  13.771  1.00 16.99  ? 240 SER B N     1 
ATOM 4705  C CA    . SER F 4 203 ? 57.453  32.267  14.151  1.00 20.44  ? 240 SER B CA    1 
ATOM 4706  C C     . SER F 4 203 ? 58.454  32.471  15.270  1.00 19.78  ? 240 SER B C     1 
ATOM 4707  O O     . SER F 4 203 ? 58.641  31.587  16.111  1.00 27.54  ? 240 SER B O     1 
ATOM 4708  C CB    . SER F 4 203 ? 58.152  31.580  13.001  1.00 24.01  ? 240 SER B CB    1 
ATOM 4709  O OG    . SER F 4 203 ? 59.514  31.957  12.982  1.00 35.14  ? 240 SER B OG    1 
ATOM 4710  N N     . LYS F 4 204 ? 59.110  33.632  15.280  1.00 2.19   ? 241 LYS B N     1 
ATOM 4711  C CA    . LYS F 4 204 ? 60.084  33.942  16.327  1.00 2.19   ? 241 LYS B CA    1 
ATOM 4712  C C     . LYS F 4 204 ? 59.443  33.803  17.730  1.00 2.19   ? 241 LYS B C     1 
ATOM 4713  O O     . LYS F 4 204 ? 60.113  33.449  18.700  1.00 15.15  ? 241 LYS B O     1 
ATOM 4714  C CB    . LYS F 4 204 ? 60.630  35.357  16.108  1.00 41.09  ? 241 LYS B CB    1 
ATOM 4715  C CG    . LYS F 4 204 ? 61.923  35.707  16.874  1.00 42.36  ? 241 LYS B CG    1 
ATOM 4716  C CD    . LYS F 4 204 ? 61.639  36.335  18.256  1.00 39.84  ? 241 LYS B CD    1 
ATOM 4717  C CE    . LYS F 4 204 ? 62.797  37.217  18.732  1.00 36.42  ? 241 LYS B CE    1 
ATOM 4718  N NZ    . LYS F 4 204 ? 64.120  36.508  18.740  1.00 29.20  ? 241 LYS B NZ    1 
ATOM 4719  N N     . ALA F 4 205 ? 58.142  34.071  17.821  1.00 2.00   ? 242 ALA B N     1 
ATOM 4720  C CA    . ALA F 4 205 ? 57.405  33.959  19.075  1.00 2.00   ? 242 ALA B CA    1 
ATOM 4721  C C     . ALA F 4 205 ? 57.388  32.514  19.539  1.00 2.00   ? 242 ALA B C     1 
ATOM 4722  O O     . ALA F 4 205 ? 57.071  31.619  18.775  1.00 2.00   ? 242 ALA B O     1 
ATOM 4723  C CB    . ALA F 4 205 ? 55.984  34.469  18.893  1.00 12.92  ? 242 ALA B CB    1 
ATOM 4724  N N     . PRO F 4 206 ? 57.711  32.275  20.818  1.00 23.91  ? 243 PRO B N     1 
ATOM 4725  C CA    . PRO F 4 206 ? 57.766  30.960  21.459  1.00 22.98  ? 243 PRO B CA    1 
ATOM 4726  C C     . PRO F 4 206 ? 56.524  30.091  21.383  1.00 23.30  ? 243 PRO B C     1 
ATOM 4727  O O     . PRO F 4 206 ? 56.558  28.940  21.815  1.00 31.28  ? 243 PRO B O     1 
ATOM 4728  C CB    . PRO F 4 206 ? 58.112  31.302  22.900  1.00 10.31  ? 243 PRO B CB    1 
ATOM 4729  C CG    . PRO F 4 206 ? 58.976  32.466  22.754  1.00 7.41   ? 243 PRO B CG    1 
ATOM 4730  C CD    . PRO F 4 206 ? 58.173  33.297  21.767  1.00 10.54  ? 243 PRO B CD    1 
ATOM 4731  N N     . ASN F 4 207 ? 55.430  30.624  20.845  1.00 11.69  ? 244 ASN B N     1 
ATOM 4732  C CA    . ASN F 4 207 ? 54.198  29.845  20.765  1.00 11.69  ? 244 ASN B CA    1 
ATOM 4733  C C     . ASN F 4 207 ? 53.473  29.998  19.448  1.00 11.69  ? 244 ASN B C     1 
ATOM 4734  O O     . ASN F 4 207 ? 52.247  29.899  19.389  1.00 11.69  ? 244 ASN B O     1 
ATOM 4735  C CB    . ASN F 4 207 ? 53.250  30.245  21.876  1.00 8.53   ? 244 ASN B CB    1 
ATOM 4736  C CG    . ASN F 4 207 ? 52.496  31.521  21.568  1.00 8.53   ? 244 ASN B CG    1 
ATOM 4737  O OD1   . ASN F 4 207 ? 51.577  31.852  22.290  1.00 9.86   ? 244 ASN B OD1   1 
ATOM 4738  N ND2   . ASN F 4 207 ? 52.871  32.241  20.512  1.00 8.53   ? 244 ASN B ND2   1 
ATOM 4739  N N     . ALA F 4 208 ? 54.227  30.262  18.396  1.00 7.04   ? 245 ALA B N     1 
ATOM 4740  C CA    . ALA F 4 208 ? 53.637  30.416  17.087  1.00 7.47   ? 245 ALA B CA    1 
ATOM 4741  C C     . ALA F 4 208 ? 54.582  29.724  16.120  1.00 10.13  ? 245 ALA B C     1 
ATOM 4742  O O     . ALA F 4 208 ? 54.349  29.685  14.901  1.00 38.09  ? 245 ALA B O     1 
ATOM 4743  C CB    . ALA F 4 208 ? 53.517  31.883  16.755  1.00 39.68  ? 245 ALA B CB    1 
ATOM 4744  N N     . SER F 4 209 ? 55.666  29.182  16.679  1.00 21.34  ? 246 SER B N     1 
ATOM 4745  C CA    . SER F 4 209 ? 56.665  28.494  15.876  1.00 19.15  ? 246 SER B CA    1 
ATOM 4746  C C     . SER F 4 209 ? 56.150  27.122  15.464  1.00 17.98  ? 246 SER B C     1 
ATOM 4747  O O     . SER F 4 209 ? 55.164  26.612  15.998  1.00 24.98  ? 246 SER B O     1 
ATOM 4748  C CB    . SER F 4 209 ? 57.982  28.377  16.651  1.00 31.54  ? 246 SER B CB    1 
ATOM 4749  O OG    . SER F 4 209 ? 57.811  27.647  17.850  1.00 37.14  ? 246 SER B OG    1 
ATOM 4750  N N     . ASN F 4 210 ? 56.809  26.527  14.488  1.00 19.16  ? 247 ASN B N     1 
ATOM 4751  C CA    . ASN F 4 210 ? 56.375  25.232  14.044  1.00 22.59  ? 247 ASN B CA    1 
ATOM 4752  C C     . ASN F 4 210 ? 56.949  24.170  14.953  1.00 21.81  ? 247 ASN B C     1 
ATOM 4753  O O     . ASN F 4 210 ? 58.142  24.182  15.267  1.00 21.69  ? 247 ASN B O     1 
ATOM 4754  C CB    . ASN F 4 210 ? 56.773  25.006  12.576  1.00 36.96  ? 247 ASN B CB    1 
ATOM 4755  C CG    . ASN F 4 210 ? 55.572  25.080  11.636  1.00 41.24  ? 247 ASN B CG    1 
ATOM 4756  O OD1   . ASN F 4 210 ? 55.724  25.095  10.414  1.00 39.95  ? 247 ASN B OD1   1 
ATOM 4757  N ND2   . ASN F 4 210 ? 54.365  25.111  12.210  1.00 43.46  ? 247 ASN B ND2   1 
ATOM 4758  N N     . LEU F 4 211 ? 56.061  23.286  15.407  1.00 2.00   ? 248 LEU B N     1 
ATOM 4759  C CA    . LEU F 4 211 ? 56.420  22.171  16.266  1.00 2.00   ? 248 LEU B CA    1 
ATOM 4760  C C     . LEU F 4 211 ? 57.100  21.080  15.427  1.00 2.00   ? 248 LEU B C     1 
ATOM 4761  O O     . LEU F 4 211 ? 56.733  20.823  14.279  1.00 2.00   ? 248 LEU B O     1 
ATOM 4762  C CB    . LEU F 4 211 ? 55.171  21.597  16.955  1.00 2.00   ? 248 LEU B CB    1 
ATOM 4763  C CG    . LEU F 4 211 ? 54.248  22.407  17.889  1.00 2.00   ? 248 LEU B CG    1 
ATOM 4764  C CD1   . LEU F 4 211 ? 55.034  23.406  18.740  1.00 2.00   ? 248 LEU B CD1   1 
ATOM 4765  C CD2   . LEU F 4 211 ? 53.220  23.117  17.060  1.00 2.00   ? 248 LEU B CD2   1 
ATOM 4766  N N     . LYS F 4 212 ? 58.100  20.437  16.012  1.00 21.25  ? 249 LYS B N     1 
ATOM 4767  C CA    . LYS F 4 212 ? 58.828  19.388  15.314  1.00 21.59  ? 249 LYS B CA    1 
ATOM 4768  C C     . LYS F 4 212 ? 59.474  18.455  16.348  1.00 23.62  ? 249 LYS B C     1 
ATOM 4769  O O     . LYS F 4 212 ? 60.014  18.920  17.358  1.00 17.29  ? 249 LYS B O     1 
ATOM 4770  C CB    . LYS F 4 212 ? 59.906  20.036  14.432  1.00 21.75  ? 249 LYS B CB    1 
ATOM 4771  C CG    . LYS F 4 212 ? 60.628  19.116  13.462  1.00 21.75  ? 249 LYS B CG    1 
ATOM 4772  C CD    . LYS F 4 212 ? 61.975  19.727  13.046  1.00 21.75  ? 249 LYS B CD    1 
ATOM 4773  C CE    . LYS F 4 212 ? 62.255  19.603  11.546  1.00 21.75  ? 249 LYS B CE    1 
ATOM 4774  N NZ    . LYS F 4 212 ? 61.451  20.569  10.702  1.00 22.08  ? 249 LYS B NZ    1 
ATOM 4775  N N     . ILE F 4 213 ? 59.381  17.147  16.119  1.00 15.06  ? 250 ILE B N     1 
ATOM 4776  C CA    . ILE F 4 213 ? 60.019  16.189  17.018  1.00 16.24  ? 250 ILE B CA    1 
ATOM 4777  C C     . ILE F 4 213 ? 61.312  15.858  16.301  1.00 15.52  ? 250 ILE B C     1 
ATOM 4778  O O     . ILE F 4 213 ? 61.292  15.256  15.233  1.00 12.19  ? 250 ILE B O     1 
ATOM 4779  C CB    . ILE F 4 213 ? 59.187  14.897  17.209  1.00 13.33  ? 250 ILE B CB    1 
ATOM 4780  C CG1   . ILE F 4 213 ? 57.914  15.203  17.986  1.00 9.85   ? 250 ILE B CG1   1 
ATOM 4781  C CG2   . ILE F 4 213 ? 59.979  13.867  17.970  1.00 14.03  ? 250 ILE B CG2   1 
ATOM 4782  C CD1   . ILE F 4 213 ? 57.094  13.986  18.253  1.00 7.14   ? 250 ILE B CD1   1 
ATOM 4783  N N     . VAL F 4 214 ? 62.433  16.279  16.880  1.00 35.60  ? 251 VAL B N     1 
ATOM 4784  C CA    . VAL F 4 214 ? 63.742  16.045  16.279  1.00 33.65  ? 251 VAL B CA    1 
ATOM 4785  C C     . VAL F 4 214 ? 64.331  14.697  16.616  1.00 34.91  ? 251 VAL B C     1 
ATOM 4786  O O     . VAL F 4 214 ? 64.868  14.014  15.745  1.00 15.55  ? 251 VAL B O     1 
ATOM 4787  C CB    . VAL F 4 214 ? 64.770  17.089  16.739  1.00 2.00   ? 251 VAL B CB    1 
ATOM 4788  C CG1   . VAL F 4 214 ? 66.032  16.994  15.883  1.00 2.00   ? 251 VAL B CG1   1 
ATOM 4789  C CG2   . VAL F 4 214 ? 64.151  18.474  16.692  1.00 3.29   ? 251 VAL B CG2   1 
ATOM 4790  N N     . ARG F 4 215 ? 64.230  14.314  17.883  1.00 2.00   ? 252 ARG B N     1 
ATOM 4791  C CA    . ARG F 4 215 ? 64.807  13.061  18.324  1.00 2.00   ? 252 ARG B CA    1 
ATOM 4792  C C     . ARG F 4 215 ? 64.073  12.420  19.478  1.00 2.00   ? 252 ARG B C     1 
ATOM 4793  O O     . ARG F 4 215 ? 63.498  13.109  20.322  1.00 13.31  ? 252 ARG B O     1 
ATOM 4794  C CB    . ARG F 4 215 ? 66.251  13.305  18.752  1.00 18.13  ? 252 ARG B CB    1 
ATOM 4795  C CG    . ARG F 4 215 ? 67.283  12.610  17.913  1.00 15.29  ? 252 ARG B CG    1 
ATOM 4796  C CD    . ARG F 4 215 ? 68.183  11.835  18.820  1.00 11.38  ? 252 ARG B CD    1 
ATOM 4797  N NE    . ARG F 4 215 ? 69.219  11.117  18.090  1.00 13.25  ? 252 ARG B NE    1 
ATOM 4798  C CZ    . ARG F 4 215 ? 70.370  11.649  17.694  1.00 20.38  ? 252 ARG B CZ    1 
ATOM 4799  N NH1   . ARG F 4 215 ? 70.643  12.923  17.964  1.00 19.48  ? 252 ARG B NH1   1 
ATOM 4800  N NH2   . ARG F 4 215 ? 71.244  10.907  17.020  1.00 23.21  ? 252 ARG B NH2   1 
ATOM 4801  N N     . MET F 4 216 ? 64.130  11.090  19.517  1.00 14.75  ? 253 MET B N     1 
ATOM 4802  C CA    . MET F 4 216 ? 63.512  10.284  20.569  1.00 14.14  ? 253 MET B CA    1 
ATOM 4803  C C     . MET F 4 216 ? 64.499  9.167   20.811  1.00 13.99  ? 253 MET B C     1 
ATOM 4804  O O     . MET F 4 216 ? 64.871  8.490   19.852  1.00 18.23  ? 253 MET B O     1 
ATOM 4805  C CB    . MET F 4 216 ? 62.190  9.694   20.086  1.00 11.77  ? 253 MET B CB    1 
ATOM 4806  C CG    . MET F 4 216 ? 61.066  10.686  20.048  1.00 12.75  ? 253 MET B CG    1 
ATOM 4807  S SD    . MET F 4 216 ? 59.519  9.853   19.735  1.00 16.36  ? 253 MET B SD    1 
ATOM 4808  C CE    . MET F 4 216 ? 59.296  10.233  17.987  1.00 9.59   ? 253 MET B CE    1 
ATOM 4809  N N     . ASP F 4 217 ? 64.939  8.961   22.053  1.00 20.49  ? 254 ASP B N     1 
ATOM 4810  C CA    . ASP F 4 217 ? 65.924  7.901   22.299  1.00 19.39  ? 254 ASP B CA    1 
ATOM 4811  C C     . ASP F 4 217 ? 65.397  6.504   22.001  1.00 19.68  ? 254 ASP B C     1 
ATOM 4812  O O     . ASP F 4 217 ? 66.165  5.550   21.778  1.00 27.26  ? 254 ASP B O     1 
ATOM 4813  C CB    . ASP F 4 217 ? 66.439  7.954   23.729  1.00 15.48  ? 254 ASP B CB    1 
ATOM 4814  C CG    . ASP F 4 217 ? 65.354  7.877   24.719  1.00 14.61  ? 254 ASP B CG    1 
ATOM 4815  O OD1   . ASP F 4 217 ? 65.671  7.667   25.910  1.00 16.78  ? 254 ASP B OD1   1 
ATOM 4816  O OD2   . ASP F 4 217 ? 64.190  8.043   24.298  1.00 18.33  ? 254 ASP B OD2   1 
ATOM 4817  N N     . ARG F 4 218 ? 64.077  6.397   21.995  1.00 25.79  ? 255 ARG B N     1 
ATOM 4818  C CA    . ARG F 4 218 ? 63.410  5.143   21.702  1.00 28.69  ? 255 ARG B CA    1 
ATOM 4819  C C     . ARG F 4 218 ? 62.041  5.437   21.116  1.00 30.48  ? 255 ARG B C     1 
ATOM 4820  O O     . ARG F 4 218 ? 61.360  6.383   21.531  1.00 37.84  ? 255 ARG B O     1 
ATOM 4821  C CB    . ARG F 4 218 ? 63.269  4.261   22.956  1.00 54.04  ? 255 ARG B CB    1 
ATOM 4822  C CG    . ARG F 4 218 ? 62.537  2.939   22.677  1.00 54.20  ? 255 ARG B CG    1 
ATOM 4823  C CD    . ARG F 4 218 ? 62.793  1.862   23.733  1.00 58.74  ? 255 ARG B CD    1 
ATOM 4824  N NE    . ARG F 4 218 ? 62.099  2.101   24.999  1.00 64.43  ? 255 ARG B NE    1 
ATOM 4825  C CZ    . ARG F 4 218 ? 62.239  1.340   26.084  1.00 64.66  ? 255 ARG B CZ    1 
ATOM 4826  N NH1   . ARG F 4 218 ? 63.046  0.289   26.067  1.00 64.50  ? 255 ARG B NH1   1 
ATOM 4827  N NH2   . ARG F 4 218 ? 61.577  1.636   27.193  1.00 62.54  ? 255 ARG B NH2   1 
ATOM 4828  N N     . THR F 4 219 ? 61.645  4.634   20.136  1.00 41.54  ? 256 THR B N     1 
ATOM 4829  C CA    . THR F 4 219 ? 60.350  4.828   19.512  1.00 40.87  ? 256 THR B CA    1 
ATOM 4830  C C     . THR F 4 219 ? 59.501  3.575   19.587  1.00 42.91  ? 256 THR B C     1 
ATOM 4831  O O     . THR F 4 219 ? 58.749  3.257   18.657  1.00 44.73  ? 256 THR B O     1 
ATOM 4832  C CB    . THR F 4 219 ? 60.469  5.306   18.042  1.00 44.96  ? 256 THR B CB    1 
ATOM 4833  O OG1   . THR F 4 219 ? 60.958  4.244   17.214  1.00 32.75  ? 256 THR B OG1   1 
ATOM 4834  C CG2   . THR F 4 219 ? 61.408  6.492   17.953  1.00 45.22  ? 256 THR B CG2   1 
ATOM 4835  N N     . ALA F 4 220 ? 59.623  2.874   20.718  1.00 45.04  ? 257 ALA B N     1 
ATOM 4836  C CA    . ALA F 4 220 ? 58.851  1.657   20.994  1.00 45.83  ? 257 ALA B CA    1 
ATOM 4837  C C     . ALA F 4 220 ? 58.803  1.395   22.493  1.00 45.19  ? 257 ALA B C     1 
ATOM 4838  O O     . ALA F 4 220 ? 59.793  1.593   23.213  1.00 26.46  ? 257 ALA B O     1 
ATOM 4839  C CB    . ALA F 4 220 ? 59.445  0.449   20.277  1.00 2.00   ? 257 ALA B CB    1 
ATOM 4840  N N     . GLY F 4 221 ? 57.635  0.954   22.952  1.00 41.89  ? 258 GLY B N     1 
ATOM 4841  C CA    . GLY F 4 221 ? 57.443  0.659   24.359  1.00 41.15  ? 258 GLY B CA    1 
ATOM 4842  C C     . GLY F 4 221 ? 56.380  -0.401  24.574  1.00 42.12  ? 258 GLY B C     1 
ATOM 4843  O O     . GLY F 4 221 ? 55.652  -0.772  23.647  1.00 18.45  ? 258 GLY B O     1 
ATOM 4844  N N     . CYS F 4 222 ? 56.280  -0.883  25.810  1.00 25.37  ? 259 CYS B N     1 
ATOM 4845  C CA    . CYS F 4 222 ? 55.313  -1.922  26.155  1.00 26.02  ? 259 CYS B CA    1 
ATOM 4846  C C     . CYS F 4 222 ? 53.930  -1.331  26.290  1.00 27.72  ? 259 CYS B C     1 
ATOM 4847  O O     . CYS F 4 222 ? 53.769  -0.209  26.765  1.00 36.78  ? 259 CYS B O     1 
ATOM 4848  C CB    . CYS F 4 222 ? 55.679  -2.619  27.468  1.00 12.86  ? 259 CYS B CB    1 
ATOM 4849  S SG    . CYS F 4 222 ? 54.648  -4.065  27.779  1.00 16.02  ? 259 CYS B SG    1 
ATOM 4850  N N     . VAL F 4 223 ? 52.934  -2.100  25.870  1.00 25.56  ? 260 VAL B N     1 
ATOM 4851  C CA    . VAL F 4 223 ? 51.549  -1.662  25.931  1.00 22.04  ? 260 VAL B CA    1 
ATOM 4852  C C     . VAL F 4 223 ? 51.148  -1.228  27.338  1.00 19.82  ? 260 VAL B C     1 
ATOM 4853  O O     . VAL F 4 223 ? 50.190  -0.472  27.527  1.00 5.60   ? 260 VAL B O     1 
ATOM 4854  C CB    . VAL F 4 223 ? 50.646  -2.787  25.449  1.00 22.45  ? 260 VAL B CB    1 
ATOM 4855  C CG1   . VAL F 4 223 ? 51.020  -3.130  24.024  1.00 25.02  ? 260 VAL B CG1   1 
ATOM 4856  C CG2   . VAL F 4 223 ? 50.838  -4.007  26.297  1.00 22.46  ? 260 VAL B CG2   1 
ATOM 4857  N N     . THR F 4 224 ? 51.888  -1.715  28.326  1.00 25.49  ? 261 THR B N     1 
ATOM 4858  C CA    . THR F 4 224 ? 51.609  -1.360  29.704  1.00 26.94  ? 261 THR B CA    1 
ATOM 4859  C C     . THR F 4 224 ? 51.845  0.117   29.845  1.00 29.05  ? 261 THR B C     1 
ATOM 4860  O O     . THR F 4 224 ? 51.125  0.794   30.561  1.00 23.58  ? 261 THR B O     1 
ATOM 4861  C CB    . THR F 4 224 ? 52.550  -2.054  30.704  1.00 35.23  ? 261 THR B CB    1 
ATOM 4862  O OG1   . THR F 4 224 ? 52.323  -3.462  30.692  1.00 35.97  ? 261 THR B OG1   1 
ATOM 4863  C CG2   . THR F 4 224 ? 52.302  -1.527  32.111  1.00 30.19  ? 261 THR B CG2   1 
ATOM 4864  N N     . GLY F 4 225 ? 52.873  0.607   29.161  1.00 57.26  ? 262 GLY B N     1 
ATOM 4865  C CA    . GLY F 4 225 ? 53.210  2.017   29.240  1.00 57.13  ? 262 GLY B CA    1 
ATOM 4866  C C     . GLY F 4 225 ? 54.028  2.302   30.486  1.00 54.85  ? 262 GLY B C     1 
ATOM 4867  O O     . GLY F 4 225 ? 54.426  1.374   31.203  1.00 73.10  ? 262 GLY B O     1 
ATOM 4868  N N     . GLY F 4 226 ? 54.277  3.580   30.755  1.00 32.32  ? 263 GLY B N     1 
ATOM 4869  C CA    . GLY F 4 226 ? 55.049  3.943   31.931  1.00 32.38  ? 263 GLY B CA    1 
ATOM 4870  C C     . GLY F 4 226 ? 56.526  3.649   31.736  1.00 31.96  ? 263 GLY B C     1 
ATOM 4871  O O     . GLY F 4 226 ? 57.250  3.329   32.682  1.00 26.12  ? 263 GLY B O     1 
ATOM 4872  N N     . GLU F 4 227 ? 56.968  3.738   30.487  1.00 38.41  ? 264 GLU B N     1 
ATOM 4873  C CA    . GLU F 4 227 ? 58.354  3.509   30.154  1.00 35.88  ? 264 GLU B CA    1 
ATOM 4874  C C     . GLU F 4 227 ? 58.909  4.880   29.757  1.00 35.50  ? 264 GLU B C     1 
ATOM 4875  O O     . GLU F 4 227 ? 58.428  5.490   28.803  1.00 29.07  ? 264 GLU B O     1 
ATOM 4876  C CB    . GLU F 4 227 ? 58.445  2.505   29.004  1.00 18.98  ? 264 GLU B CB    1 
ATOM 4877  C CG    . GLU F 4 227 ? 58.302  1.032   29.424  1.00 21.90  ? 264 GLU B CG    1 
ATOM 4878  C CD    . GLU F 4 227 ? 58.524  0.040   28.257  1.00 24.15  ? 264 GLU B CD    1 
ATOM 4879  O OE1   . GLU F 4 227 ? 58.024  0.321   27.140  1.00 21.96  ? 264 GLU B OE1   1 
ATOM 4880  O OE2   . GLU F 4 227 ? 59.176  -1.017  28.458  1.00 22.35  ? 264 GLU B OE2   1 
ATOM 4881  N N     . GLU F 4 228 ? 59.908  5.366   30.497  1.00 23.72  ? 265 GLU B N     1 
ATOM 4882  C CA    . GLU F 4 228 ? 60.502  6.687   30.258  1.00 22.57  ? 265 GLU B CA    1 
ATOM 4883  C C     . GLU F 4 228 ? 61.029  6.838   28.842  1.00 23.04  ? 265 GLU B C     1 
ATOM 4884  O O     . GLU F 4 228 ? 61.494  5.877   28.248  1.00 14.34  ? 265 GLU B O     1 
ATOM 4885  C CB    . GLU F 4 228 ? 61.649  6.928   31.256  1.00 17.88  ? 265 GLU B CB    1 
ATOM 4886  C CG    . GLU F 4 228 ? 61.830  8.375   31.757  1.00 23.49  ? 265 GLU B CG    1 
ATOM 4887  C CD    . GLU F 4 228 ? 63.223  8.627   32.372  1.00 25.41  ? 265 GLU B CD    1 
ATOM 4888  O OE1   . GLU F 4 228 ? 63.304  9.243   33.455  1.00 24.96  ? 265 GLU B OE1   1 
ATOM 4889  O OE2   . GLU F 4 228 ? 64.245  8.217   31.773  1.00 23.92  ? 265 GLU B OE2   1 
ATOM 4890  N N     . ILE F 4 229 ? 60.942  8.049   28.302  1.00 8.25   ? 266 ILE B N     1 
ATOM 4891  C CA    . ILE F 4 229 ? 61.451  8.349   26.959  1.00 8.23   ? 266 ILE B CA    1 
ATOM 4892  C C     . ILE F 4 229 ? 61.959  9.789   26.892  1.00 10.05  ? 266 ILE B C     1 
ATOM 4893  O O     . ILE F 4 229 ? 61.452  10.672  27.606  1.00 4.29   ? 266 ILE B O     1 
ATOM 4894  C CB    . ILE F 4 229 ? 60.379  8.211   25.861  1.00 2.00   ? 266 ILE B CB    1 
ATOM 4895  C CG1   . ILE F 4 229 ? 59.799  6.803   25.829  1.00 2.00   ? 266 ILE B CG1   1 
ATOM 4896  C CG2   . ILE F 4 229 ? 61.015  8.452   24.520  1.00 2.00   ? 266 ILE B CG2   1 
ATOM 4897  C CD1   . ILE F 4 229 ? 60.657  5.822   25.056  1.00 2.00   ? 266 ILE B CD1   1 
ATOM 4898  N N     . TYR F 4 230 ? 62.963  10.015  26.039  1.00 11.68  ? 267 TYR B N     1 
ATOM 4899  C CA    . TYR F 4 230 ? 63.545  11.348  25.832  1.00 11.68  ? 267 TYR B CA    1 
ATOM 4900  C C     . TYR F 4 230 ? 63.193  11.849  24.434  1.00 11.68  ? 267 TYR B C     1 
ATOM 4901  O O     . TYR F 4 230 ? 63.459  11.180  23.430  1.00 18.87  ? 267 TYR B O     1 
ATOM 4902  C CB    . TYR F 4 230 ? 65.060  11.305  26.001  1.00 12.92  ? 267 TYR B CB    1 
ATOM 4903  C CG    . TYR F 4 230 ? 65.511  11.355  27.432  1.00 13.83  ? 267 TYR B CG    1 
ATOM 4904  C CD1   . TYR F 4 230 ? 64.903  10.560  28.394  1.00 15.29  ? 267 TYR B CD1   1 
ATOM 4905  C CD2   . TYR F 4 230 ? 66.576  12.164  27.826  1.00 14.40  ? 267 TYR B CD2   1 
ATOM 4906  C CE1   . TYR F 4 230 ? 65.346  10.560  29.723  1.00 16.76  ? 267 TYR B CE1   1 
ATOM 4907  C CE2   . TYR F 4 230 ? 67.028  12.172  29.143  1.00 17.20  ? 267 TYR B CE2   1 
ATOM 4908  C CZ    . TYR F 4 230 ? 66.411  11.364  30.091  1.00 18.25  ? 267 TYR B CZ    1 
ATOM 4909  O OH    . TYR F 4 230 ? 66.856  11.323  31.403  1.00 15.90  ? 267 TYR B OH    1 
ATOM 4910  N N     . LEU F 4 231 ? 62.587  13.025  24.373  1.00 21.09  ? 268 LEU B N     1 
ATOM 4911  C CA    . LEU F 4 231 ? 62.203  13.584  23.097  1.00 21.96  ? 268 LEU B CA    1 
ATOM 4912  C C     . LEU F 4 231 ? 62.875  14.939  22.950  1.00 23.40  ? 268 LEU B C     1 
ATOM 4913  O O     . LEU F 4 231 ? 62.593  15.855  23.721  1.00 22.03  ? 268 LEU B O     1 
ATOM 4914  C CB    . LEU F 4 231 ? 60.667  13.717  23.030  1.00 2.00   ? 268 LEU B CB    1 
ATOM 4915  C CG    . LEU F 4 231 ? 59.962  13.982  21.695  1.00 2.11   ? 268 LEU B CG    1 
ATOM 4916  C CD1   . LEU F 4 231 ? 58.509  13.603  21.777  1.00 2.00   ? 268 LEU B CD1   1 
ATOM 4917  C CD2   . LEU F 4 231 ? 60.110  15.430  21.330  1.00 2.06   ? 268 LEU B CD2   1 
ATOM 4918  N N     . LEU F 4 232 ? 63.784  15.052  21.983  1.00 14.88  ? 269 LEU B N     1 
ATOM 4919  C CA    . LEU F 4 232 ? 64.466  16.311  21.710  1.00 14.46  ? 269 LEU B CA    1 
ATOM 4920  C C     . LEU F 4 232 ? 63.612  17.089  20.701  1.00 16.60  ? 269 LEU B C     1 
ATOM 4921  O O     . LEU F 4 232 ? 63.288  16.579  19.628  1.00 13.47  ? 269 LEU B O     1 
ATOM 4922  C CB    . LEU F 4 232 ? 65.844  16.049  21.116  1.00 2.84   ? 269 LEU B CB    1 
ATOM 4923  C CG    . LEU F 4 232 ? 66.838  15.293  21.990  1.00 2.84   ? 269 LEU B CG    1 
ATOM 4924  C CD1   . LEU F 4 232 ? 68.224  15.749  21.648  1.00 2.84   ? 269 LEU B CD1   1 
ATOM 4925  C CD2   . LEU F 4 232 ? 66.566  15.569  23.450  1.00 2.84   ? 269 LEU B CD2   1 
ATOM 4926  N N     . CYS F 4 233 ? 63.281  18.334  21.022  1.00 2.00   ? 270 CYS B N     1 
ATOM 4927  C CA    . CYS F 4 233 ? 62.414  19.113  20.158  1.00 2.00   ? 270 CYS B CA    1 
ATOM 4928  C C     . CYS F 4 233 ? 62.847  20.540  19.839  1.00 2.00   ? 270 CYS B C     1 
ATOM 4929  O O     . CYS F 4 233 ? 63.903  20.988  20.254  1.00 2.00   ? 270 CYS B O     1 
ATOM 4930  C CB    . CYS F 4 233 ? 61.018  19.128  20.783  1.00 10.18  ? 270 CYS B CB    1 
ATOM 4931  S SG    . CYS F 4 233 ? 60.963  19.706  22.520  1.00 10.18  ? 270 CYS B SG    1 
ATOM 4932  N N     . ASP F 4 234 ? 62.004  21.228  19.072  1.00 2.00   ? 271 ASP B N     1 
ATOM 4933  C CA    . ASP F 4 234 ? 62.209  22.612  18.663  1.00 2.00   ? 271 ASP B CA    1 
ATOM 4934  C C     . ASP F 4 234 ? 61.616  23.407  19.790  1.00 2.00   ? 271 ASP B C     1 
ATOM 4935  O O     . ASP F 4 234 ? 60.672  22.951  20.415  1.00 2.00   ? 271 ASP B O     1 
ATOM 4936  C CB    . ASP F 4 234 ? 61.399  22.929  17.398  1.00 8.69   ? 271 ASP B CB    1 
ATOM 4937  C CG    . ASP F 4 234 ? 62.243  22.983  16.144  1.00 9.80   ? 271 ASP B CG    1 
ATOM 4938  O OD1   . ASP F 4 234 ? 63.438  22.651  16.206  1.00 7.90   ? 271 ASP B OD1   1 
ATOM 4939  O OD2   . ASP F 4 234 ? 61.699  23.360  15.088  1.00 10.64  ? 271 ASP B OD2   1 
ATOM 4940  N N     . LYS F 4 235 ? 62.138  24.602  20.029  1.00 15.67  ? 272 LYS B N     1 
ATOM 4941  C CA    . LYS F 4 235 ? 61.621  25.432  21.103  1.00 17.44  ? 272 LYS B CA    1 
ATOM 4942  C C     . LYS F 4 235 ? 60.125  25.218  21.327  1.00 15.76  ? 272 LYS B C     1 
ATOM 4943  O O     . LYS F 4 235 ? 59.310  25.457  20.437  1.00 21.43  ? 272 LYS B O     1 
ATOM 4944  C CB    . LYS F 4 235 ? 61.896  26.914  20.823  1.00 10.40  ? 272 LYS B CB    1 
ATOM 4945  C CG    . LYS F 4 235 ? 61.123  27.842  21.740  1.00 5.14   ? 272 LYS B CG    1 
ATOM 4946  C CD    . LYS F 4 235 ? 61.424  29.284  21.471  1.00 5.14   ? 272 LYS B CD    1 
ATOM 4947  C CE    . LYS F 4 235 ? 62.706  29.711  22.163  1.00 5.18   ? 272 LYS B CE    1 
ATOM 4948  N NZ    . LYS F 4 235 ? 62.573  31.095  22.728  1.00 5.14   ? 272 LYS B NZ    1 
ATOM 4949  N N     . VAL F 4 236 ? 59.768  24.732  22.508  1.00 13.51  ? 273 VAL B N     1 
ATOM 4950  C CA    . VAL F 4 236 ? 58.361  24.528  22.844  1.00 15.64  ? 273 VAL B CA    1 
ATOM 4951  C C     . VAL F 4 236 ? 58.105  25.242  24.173  1.00 17.65  ? 273 VAL B C     1 
ATOM 4952  O O     . VAL F 4 236 ? 58.997  25.292  25.030  1.00 18.74  ? 273 VAL B O     1 
ATOM 4953  C CB    . VAL F 4 236 ? 58.001  23.009  22.961  1.00 25.03  ? 273 VAL B CB    1 
ATOM 4954  C CG1   . VAL F 4 236 ? 58.103  22.348  21.594  1.00 25.35  ? 273 VAL B CG1   1 
ATOM 4955  C CG2   . VAL F 4 236 ? 58.927  22.299  23.968  1.00 20.73  ? 273 VAL B CG2   1 
ATOM 4956  N N     . GLN F 4 237 ? 56.912  25.806  24.341  1.00 8.81   ? 274 GLN B N     1 
ATOM 4957  C CA    . GLN F 4 237 ? 56.591  26.529  25.566  1.00 13.59  ? 274 GLN B CA    1 
ATOM 4958  C C     . GLN F 4 237 ? 56.305  25.576  26.734  1.00 15.33  ? 274 GLN B C     1 
ATOM 4959  O O     . GLN F 4 237 ? 55.283  24.888  26.783  1.00 26.74  ? 274 GLN B O     1 
ATOM 4960  C CB    . GLN F 4 237 ? 55.421  27.478  25.312  1.00 21.99  ? 274 GLN B CB    1 
ATOM 4961  C CG    . GLN F 4 237 ? 55.469  28.758  26.126  1.00 22.49  ? 274 GLN B CG    1 
ATOM 4962  C CD    . GLN F 4 237 ? 54.818  29.913  25.405  1.00 24.85  ? 274 GLN B CD    1 
ATOM 4963  O OE1   . GLN F 4 237 ? 55.168  30.207  24.270  1.00 26.13  ? 274 GLN B OE1   1 
ATOM 4964  N NE2   . GLN F 4 237 ? 53.867  30.572  26.056  1.00 27.24  ? 274 GLN B NE2   1 
ATOM 4965  N N     . LYS F 4 238 ? 57.240  25.557  27.676  1.00 25.68  ? 275 LYS B N     1 
ATOM 4966  C CA    . LYS F 4 238 ? 57.189  24.691  28.850  1.00 27.12  ? 275 LYS B CA    1 
ATOM 4967  C C     . LYS F 4 238 ? 55.823  24.197  29.335  1.00 29.01  ? 275 LYS B C     1 
ATOM 4968  O O     . LYS F 4 238 ? 55.622  22.999  29.482  1.00 38.41  ? 275 LYS B O     1 
ATOM 4969  C CB    . LYS F 4 238 ? 57.913  25.366  30.016  1.00 25.70  ? 275 LYS B CB    1 
ATOM 4970  C CG    . LYS F 4 238 ? 58.564  24.398  30.976  1.00 20.45  ? 275 LYS B CG    1 
ATOM 4971  C CD    . LYS F 4 238 ? 58.701  25.021  32.331  1.00 19.44  ? 275 LYS B CD    1 
ATOM 4972  C CE    . LYS F 4 238 ? 59.318  26.401  32.266  1.00 20.02  ? 275 LYS B CE    1 
ATOM 4973  N NZ    . LYS F 4 238 ? 59.184  27.128  33.570  1.00 17.42  ? 275 LYS B NZ    1 
ATOM 4974  N N     . ASP F 4 239 ? 54.894  25.117  29.578  1.00 29.90  ? 276 ASP B N     1 
ATOM 4975  C CA    . ASP F 4 239 ? 53.569  24.778  30.093  1.00 28.51  ? 276 ASP B CA    1 
ATOM 4976  C C     . ASP F 4 239 ? 52.457  24.830  29.078  1.00 27.06  ? 276 ASP B C     1 
ATOM 4977  O O     . ASP F 4 239 ? 51.335  25.176  29.423  1.00 32.04  ? 276 ASP B O     1 
ATOM 4978  C CB    . ASP F 4 239 ? 53.190  25.766  31.190  1.00 56.98  ? 276 ASP B CB    1 
ATOM 4979  C CG    . ASP F 4 239 ? 53.839  25.450  32.507  1.00 65.02  ? 276 ASP B CG    1 
ATOM 4980  O OD1   . ASP F 4 239 ? 53.170  24.844  33.382  1.00 68.11  ? 276 ASP B OD1   1 
ATOM 4981  O OD2   . ASP F 4 239 ? 55.030  25.803  32.659  1.00 67.29  ? 276 ASP B OD2   1 
ATOM 4982  N N     . ASP F 4 240 ? 52.737  24.488  27.833  1.00 36.54  ? 277 ASP B N     1 
ATOM 4983  C CA    . ASP F 4 240 ? 51.715  24.587  26.804  1.00 33.78  ? 277 ASP B CA    1 
ATOM 4984  C C     . ASP F 4 240 ? 51.988  23.562  25.717  1.00 31.27  ? 277 ASP B C     1 
ATOM 4985  O O     . ASP F 4 240 ? 51.611  23.742  24.565  1.00 29.23  ? 277 ASP B O     1 
ATOM 4986  C CB    . ASP F 4 240 ? 51.778  25.999  26.225  1.00 7.07   ? 277 ASP B CB    1 
ATOM 4987  C CG    . ASP F 4 240 ? 50.830  26.204  25.103  1.00 11.53  ? 277 ASP B CG    1 
ATOM 4988  O OD1   . ASP F 4 240 ? 51.273  26.687  24.038  1.00 17.93  ? 277 ASP B OD1   1 
ATOM 4989  O OD2   . ASP F 4 240 ? 49.642  25.876  25.282  1.00 15.96  ? 277 ASP B OD2   1 
ATOM 4990  N N     . ILE F 4 241 ? 52.658  22.481  26.082  1.00 21.21  ? 278 ILE B N     1 
ATOM 4991  C CA    . ILE F 4 241 ? 52.992  21.467  25.105  1.00 20.26  ? 278 ILE B CA    1 
ATOM 4992  C C     . ILE F 4 241 ? 52.643  20.126  25.659  1.00 21.92  ? 278 ILE B C     1 
ATOM 4993  O O     . ILE F 4 241 ? 52.718  19.910  26.866  1.00 34.75  ? 278 ILE B O     1 
ATOM 4994  C CB    . ILE F 4 241 ? 54.481  21.425  24.826  1.00 7.43   ? 278 ILE B CB    1 
ATOM 4995  C CG1   . ILE F 4 241 ? 54.738  20.845  23.442  1.00 6.56   ? 278 ILE B CG1   1 
ATOM 4996  C CG2   . ILE F 4 241 ? 55.159  20.561  25.847  1.00 6.56   ? 278 ILE B CG2   1 
ATOM 4997  C CD1   . ILE F 4 241 ? 54.121  21.703  22.332  1.00 6.56   ? 278 ILE B CD1   1 
ATOM 4998  N N     . GLN F 4 242 ? 52.287  19.211  24.776  1.00 30.82  ? 279 GLN B N     1 
ATOM 4999  C CA    . GLN F 4 242 ? 51.948  17.885  25.215  1.00 27.52  ? 279 GLN B CA    1 
ATOM 5000  C C     . GLN F 4 242 ? 52.290  16.881  24.136  1.00 28.93  ? 279 GLN B C     1 
ATOM 5001  O O     . GLN F 4 242 ? 52.362  17.223  22.948  1.00 15.89  ? 279 GLN B O     1 
ATOM 5002  C CB    . GLN F 4 242 ? 50.472  17.837  25.574  1.00 12.39  ? 279 GLN B CB    1 
ATOM 5003  C CG    . GLN F 4 242 ? 49.542  18.394  24.508  1.00 12.39  ? 279 GLN B CG    1 
ATOM 5004  C CD    . GLN F 4 242 ? 48.089  18.299  24.930  1.00 12.39  ? 279 GLN B CD    1 
ATOM 5005  O OE1   . GLN F 4 242 ? 47.199  18.246  24.096  1.00 12.39  ? 279 GLN B OE1   1 
ATOM 5006  N NE2   . GLN F 4 242 ? 47.848  18.279  26.245  1.00 12.39  ? 279 GLN B NE2   1 
ATOM 5007  N N     . ILE F 4 243 ? 52.530  15.647  24.568  1.00 21.88  ? 280 ILE B N     1 
ATOM 5008  C CA    . ILE F 4 243 ? 52.883  14.555  23.670  1.00 21.85  ? 280 ILE B CA    1 
ATOM 5009  C C     . ILE F 4 243 ? 51.608  13.742  23.440  1.00 23.20  ? 280 ILE B C     1 
ATOM 5010  O O     . ILE F 4 243 ? 50.999  13.245  24.383  1.00 15.91  ? 280 ILE B O     1 
ATOM 5011  C CB    . ILE F 4 243 ? 53.942  13.637  24.320  1.00 6.16   ? 280 ILE B CB    1 
ATOM 5012  C CG1   . ILE F 4 243 ? 55.040  14.451  24.998  1.00 9.09   ? 280 ILE B CG1   1 
ATOM 5013  C CG2   . ILE F 4 243 ? 54.572  12.778  23.293  1.00 6.16   ? 280 ILE B CG2   1 
ATOM 5014  C CD1   . ILE F 4 243 ? 56.171  14.835  24.116  1.00 9.64   ? 280 ILE B CD1   1 
ATOM 5015  N N     . ARG F 4 244 ? 51.185  13.606  22.194  1.00 16.83  ? 281 ARG B N     1 
ATOM 5016  C CA    . ARG F 4 244 ? 49.969  12.842  21.922  1.00 15.40  ? 281 ARG B CA    1 
ATOM 5017  C C     . ARG F 4 244 ? 50.251  11.588  21.140  1.00 15.79  ? 281 ARG B C     1 
ATOM 5018  O O     . ARG F 4 244 ? 50.957  11.623  20.129  1.00 20.48  ? 281 ARG B O     1 
ATOM 5019  C CB    . ARG F 4 244 ? 48.953  13.680  21.130  1.00 10.24  ? 281 ARG B CB    1 
ATOM 5020  C CG    . ARG F 4 244 ? 47.628  12.977  20.781  1.00 7.96   ? 281 ARG B CG    1 
ATOM 5021  C CD    . ARG F 4 244 ? 46.533  14.021  20.519  1.00 6.32   ? 281 ARG B CD    1 
ATOM 5022  N NE    . ARG F 4 244 ? 45.245  13.490  20.055  1.00 6.32   ? 281 ARG B NE    1 
ATOM 5023  C CZ    . ARG F 4 244 ? 45.059  12.875  18.887  1.00 6.32   ? 281 ARG B CZ    1 
ATOM 5024  N NH1   . ARG F 4 244 ? 46.072  12.686  18.050  1.00 6.32   ? 281 ARG B NH1   1 
ATOM 5025  N NH2   . ARG F 4 244 ? 43.853  12.493  18.522  1.00 6.80   ? 281 ARG B NH2   1 
ATOM 5026  N N     . PHE F 4 245 ? 49.692  10.482  21.624  1.00 2.00   ? 282 PHE B N     1 
ATOM 5027  C CA    . PHE F 4 245 ? 49.831  9.194   20.960  1.00 2.00   ? 282 PHE B CA    1 
ATOM 5028  C C     . PHE F 4 245 ? 48.439  8.938   20.436  1.00 2.00   ? 282 PHE B C     1 
ATOM 5029  O O     . PHE F 4 245 ? 47.473  9.077   21.168  1.00 2.48   ? 282 PHE B O     1 
ATOM 5030  C CB    . PHE F 4 245 ? 50.227  8.088   21.949  1.00 21.29  ? 282 PHE B CB    1 
ATOM 5031  C CG    . PHE F 4 245 ? 51.609  8.239   22.517  1.00 21.08  ? 282 PHE B CG    1 
ATOM 5032  C CD1   . PHE F 4 245 ? 51.864  9.162   23.525  1.00 22.98  ? 282 PHE B CD1   1 
ATOM 5033  C CD2   . PHE F 4 245 ? 52.668  7.489   22.006  1.00 21.67  ? 282 PHE B CD2   1 
ATOM 5034  C CE1   . PHE F 4 245 ? 53.154  9.339   24.014  1.00 23.25  ? 282 PHE B CE1   1 
ATOM 5035  C CE2   . PHE F 4 245 ? 53.973  7.655   22.487  1.00 20.83  ? 282 PHE B CE2   1 
ATOM 5036  C CZ    . PHE F 4 245 ? 54.216  8.581   23.490  1.00 20.43  ? 282 PHE B CZ    1 
ATOM 5037  N N     . TYR F 4 246 ? 48.313  8.582   19.169  1.00 14.02  ? 283 TYR B N     1 
ATOM 5038  C CA    . TYR F 4 246 ? 46.981  8.354   18.638  1.00 18.55  ? 283 TYR B CA    1 
ATOM 5039  C C     . TYR F 4 246 ? 46.961  7.204   17.641  1.00 22.77  ? 283 TYR B C     1 
ATOM 5040  O O     . TYR F 4 246 ? 48.015  6.754   17.184  1.00 27.99  ? 283 TYR B O     1 
ATOM 5041  C CB    . TYR F 4 246 ? 46.465  9.639   17.968  1.00 32.89  ? 283 TYR B CB    1 
ATOM 5042  C CG    . TYR F 4 246 ? 47.139  9.957   16.655  1.00 31.58  ? 283 TYR B CG    1 
ATOM 5043  C CD1   . TYR F 4 246 ? 48.359  10.609  16.606  1.00 31.32  ? 283 TYR B CD1   1 
ATOM 5044  C CD2   . TYR F 4 246 ? 46.565  9.562   15.448  1.00 29.96  ? 283 TYR B CD2   1 
ATOM 5045  C CE1   . TYR F 4 246 ? 48.994  10.859  15.375  1.00 32.52  ? 283 TYR B CE1   1 
ATOM 5046  C CE2   . TYR F 4 246 ? 47.189  9.801   14.219  1.00 31.10  ? 283 TYR B CE2   1 
ATOM 5047  C CZ    . TYR F 4 246 ? 48.401  10.447  14.186  1.00 31.64  ? 283 TYR B CZ    1 
ATOM 5048  O OH    . TYR F 4 246 ? 49.015  10.671  12.969  1.00 32.45  ? 283 TYR B OH    1 
ATOM 5049  N N     . GLU F 4 247 ? 45.760  6.719   17.318  1.00 24.22  ? 284 GLU B N     1 
ATOM 5050  C CA    . GLU F 4 247 ? 45.616  5.642   16.340  1.00 25.28  ? 284 GLU B CA    1 
ATOM 5051  C C     . GLU F 4 247 ? 44.376  5.756   15.457  1.00 28.91  ? 284 GLU B C     1 
ATOM 5052  O O     . GLU F 4 247 ? 43.315  6.204   15.879  1.00 45.19  ? 284 GLU B O     1 
ATOM 5053  C CB    . GLU F 4 247 ? 45.601  4.273   17.021  1.00 26.26  ? 284 GLU B CB    1 
ATOM 5054  C CG    . GLU F 4 247 ? 45.511  3.118   16.016  1.00 18.35  ? 284 GLU B CG    1 
ATOM 5055  C CD    . GLU F 4 247 ? 45.783  1.766   16.639  1.00 16.19  ? 284 GLU B CD    1 
ATOM 5056  O OE1   . GLU F 4 247 ? 45.013  1.383   17.554  1.00 12.80  ? 284 GLU B OE1   1 
ATOM 5057  O OE2   . GLU F 4 247 ? 46.766  1.105   16.212  1.00 15.35  ? 284 GLU B OE2   1 
ATOM 5058  N N     . GLU F 4 248 ? 44.541  5.330   14.215  1.00 31.19  ? 285 GLU B N     1 
ATOM 5059  C CA    . GLU F 4 248 ? 43.479  5.342   13.227  1.00 35.55  ? 285 GLU B CA    1 
ATOM 5060  C C     . GLU F 4 248 ? 42.639  4.086   13.444  1.00 38.55  ? 285 GLU B C     1 
ATOM 5061  O O     . GLU F 4 248 ? 42.881  3.050   12.825  1.00 107.17 ? 285 GLU B O     1 
ATOM 5062  C CB    . GLU F 4 248 ? 44.121  5.367   11.827  1.00 104.61 ? 285 GLU B CB    1 
ATOM 5063  C CG    . GLU F 4 248 ? 43.270  4.867   10.654  1.00 104.85 ? 285 GLU B CG    1 
ATOM 5064  C CD    . GLU F 4 248 ? 43.468  3.383   10.369  1.00 105.03 ? 285 GLU B CD    1 
ATOM 5065  O OE1   . GLU F 4 248 ? 44.631  2.920   10.395  1.00 103.52 ? 285 GLU B OE1   1 
ATOM 5066  O OE2   . GLU F 4 248 ? 42.463  2.684   10.114  1.00 107.39 ? 285 GLU B OE2   1 
ATOM 5067  N N     . GLU F 4 249 ? 41.663  4.163   14.341  1.00 99.67  ? 286 GLU B N     1 
ATOM 5068  C CA    . GLU F 4 249 ? 40.821  3.003   14.617  1.00 102.57 ? 286 GLU B CA    1 
ATOM 5069  C C     . GLU F 4 249 ? 39.743  2.865   13.526  1.00 105.35 ? 286 GLU B C     1 
ATOM 5070  O O     . GLU F 4 249 ? 39.031  3.829   13.221  1.00 71.36  ? 286 GLU B O     1 
ATOM 5071  C CB    . GLU F 4 249 ? 40.197  3.144   16.017  1.00 61.69  ? 286 GLU B CB    1 
ATOM 5072  C CG    . GLU F 4 249 ? 39.840  1.818   16.683  1.00 58.22  ? 286 GLU B CG    1 
ATOM 5073  C CD    . GLU F 4 249 ? 39.407  1.980   18.136  1.00 56.19  ? 286 GLU B CD    1 
ATOM 5074  O OE1   . GLU F 4 249 ? 38.853  1.014   18.710  1.00 56.85  ? 286 GLU B OE1   1 
ATOM 5075  O OE2   . GLU F 4 249 ? 39.623  3.068   18.704  1.00 49.47  ? 286 GLU B OE2   1 
ATOM 5076  N N     . GLU F 4 250 ? 39.641  1.670   12.935  1.00 84.28  ? 287 GLU B N     1 
ATOM 5077  C CA    . GLU F 4 250 ? 38.677  1.400   11.857  1.00 84.17  ? 287 GLU B CA    1 
ATOM 5078  C C     . GLU F 4 250 ? 37.244  1.806   12.191  1.00 85.95  ? 287 GLU B C     1 
ATOM 5079  O O     . GLU F 4 250 ? 36.580  2.493   11.409  1.00 51.94  ? 287 GLU B O     1 
ATOM 5080  C CB    . GLU F 4 250 ? 38.711  -0.087  11.469  1.00 60.09  ? 287 GLU B CB    1 
ATOM 5081  C CG    . GLU F 4 250 ? 37.803  -0.439  10.290  1.00 57.53  ? 287 GLU B CG    1 
ATOM 5082  C CD    . GLU F 4 250 ? 37.958  -1.879  9.810   1.00 54.79  ? 287 GLU B CD    1 
ATOM 5083  O OE1   . GLU F 4 250 ? 39.083  -2.261  9.429   1.00 52.78  ? 287 GLU B OE1   1 
ATOM 5084  O OE2   . GLU F 4 250 ? 36.956  -2.627  9.803   1.00 53.59  ? 287 GLU B OE2   1 
ATOM 5085  N N     . ASN F 4 251 ? 36.769  1.360   13.349  1.00 73.73  ? 288 ASN B N     1 
ATOM 5086  C CA    . ASN F 4 251 ? 35.424  1.684   13.800  1.00 76.24  ? 288 ASN B CA    1 
ATOM 5087  C C     . ASN F 4 251 ? 35.388  3.164   14.149  1.00 77.87  ? 288 ASN B C     1 
ATOM 5088  O O     . ASN F 4 251 ? 35.145  3.549   15.295  1.00 112.02 ? 288 ASN B O     1 
ATOM 5089  C CB    . ASN F 4 251 ? 35.045  0.828   15.016  1.00 110.51 ? 288 ASN B CB    1 
ATOM 5090  C CG    . ASN F 4 251 ? 36.044  0.943   16.153  1.00 113.90 ? 288 ASN B CG    1 
ATOM 5091  O OD1   . ASN F 4 251 ? 36.203  2.007   16.754  1.00 115.25 ? 288 ASN B OD1   1 
ATOM 5092  N ND2   . ASN F 4 251 ? 36.723  -0.160  16.455  1.00 114.35 ? 288 ASN B ND2   1 
ATOM 5093  N N     . GLY F 4 252 ? 35.640  3.992   13.138  1.00 103.82 ? 289 GLY B N     1 
ATOM 5094  C CA    . GLY F 4 252 ? 35.647  5.429   13.329  1.00 102.38 ? 289 GLY B CA    1 
ATOM 5095  C C     . GLY F 4 252 ? 37.057  5.970   13.239  1.00 100.74 ? 289 GLY B C     1 
ATOM 5096  O O     . GLY F 4 252 ? 37.564  6.228   12.150  1.00 72.16  ? 289 GLY B O     1 
ATOM 5097  N N     . GLY F 4 253 ? 37.696  6.133   14.388  1.00 50.56  ? 290 GLY B N     1 
ATOM 5098  C CA    . GLY F 4 253 ? 39.050  6.642   14.402  1.00 49.63  ? 290 GLY B CA    1 
ATOM 5099  C C     . GLY F 4 253 ? 39.309  7.444   15.653  1.00 47.88  ? 290 GLY B C     1 
ATOM 5100  O O     . GLY F 4 253 ? 39.670  8.620   15.584  1.00 53.31  ? 290 GLY B O     1 
ATOM 5101  N N     . VAL F 4 254 ? 39.134  6.803   16.804  1.00 47.57  ? 291 VAL B N     1 
ATOM 5102  C CA    . VAL F 4 254 ? 39.345  7.474   18.079  1.00 45.44  ? 291 VAL B CA    1 
ATOM 5103  C C     . VAL F 4 254 ? 40.707  7.146   18.722  1.00 43.51  ? 291 VAL B C     1 
ATOM 5104  O O     . VAL F 4 254 ? 41.749  7.208   18.069  1.00 60.70  ? 291 VAL B O     1 
ATOM 5105  C CB    . VAL F 4 254 ? 38.190  7.132   19.074  1.00 64.26  ? 291 VAL B CB    1 
ATOM 5106  C CG1   . VAL F 4 254 ? 38.119  8.166   20.189  1.00 66.22  ? 291 VAL B CG1   1 
ATOM 5107  C CG2   . VAL F 4 254 ? 36.869  7.062   18.328  1.00 68.50  ? 291 VAL B CG2   1 
ATOM 5108  N N     . TRP F 4 255 ? 40.673  6.780   20.002  1.00 99.00  ? 292 TRP B N     1 
ATOM 5109  C CA    . TRP F 4 255 ? 41.851  6.470   20.824  1.00 94.90  ? 292 TRP B CA    1 
ATOM 5110  C C     . TRP F 4 255 ? 43.067  7.356   20.663  1.00 92.33  ? 292 TRP B C     1 
ATOM 5111  O O     . TRP F 4 255 ? 43.740  7.383   19.618  1.00 46.91  ? 292 TRP B O     1 
ATOM 5112  C CB    . TRP F 4 255 ? 42.339  5.027   20.681  1.00 51.12  ? 292 TRP B CB    1 
ATOM 5113  C CG    . TRP F 4 255 ? 43.255  4.685   21.836  1.00 48.33  ? 292 TRP B CG    1 
ATOM 5114  C CD1   . TRP F 4 255 ? 42.875  4.250   23.070  1.00 47.19  ? 292 TRP B CD1   1 
ATOM 5115  C CD2   . TRP F 4 255 ? 44.673  4.885   21.904  1.00 49.27  ? 292 TRP B CD2   1 
ATOM 5116  N NE1   . TRP F 4 255 ? 43.961  4.172   23.905  1.00 46.21  ? 292 TRP B NE1   1 
ATOM 5117  C CE2   . TRP F 4 255 ? 45.078  4.557   23.216  1.00 47.80  ? 292 TRP B CE2   1 
ATOM 5118  C CE3   . TRP F 4 255 ? 45.640  5.317   20.986  1.00 50.58  ? 292 TRP B CE3   1 
ATOM 5119  C CZ2   . TRP F 4 255 ? 46.410  4.646   23.635  1.00 50.39  ? 292 TRP B CZ2   1 
ATOM 5120  C CZ3   . TRP F 4 255 ? 46.967  5.405   21.406  1.00 51.61  ? 292 TRP B CZ3   1 
ATOM 5121  C CH2   . TRP F 4 255 ? 47.336  5.070   22.720  1.00 51.50  ? 292 TRP B CH2   1 
ATOM 5122  N N     . GLU F 4 256 ? 43.358  8.052   21.749  1.00 23.21  ? 293 GLU B N     1 
ATOM 5123  C CA    . GLU F 4 256 ? 44.487  8.931   21.806  1.00 19.22  ? 293 GLU B CA    1 
ATOM 5124  C C     . GLU F 4 256 ? 45.026  8.856   23.224  1.00 16.23  ? 293 GLU B C     1 
ATOM 5125  O O     . GLU F 4 256 ? 44.265  8.728   24.190  1.00 19.12  ? 293 GLU B O     1 
ATOM 5126  C CB    . GLU F 4 256 ? 44.061  10.350  21.441  1.00 27.79  ? 293 GLU B CB    1 
ATOM 5127  C CG    . GLU F 4 256 ? 43.087  10.979  22.394  1.00 27.71  ? 293 GLU B CG    1 
ATOM 5128  C CD    . GLU F 4 256 ? 42.512  12.272  21.851  1.00 26.61  ? 293 GLU B CD    1 
ATOM 5129  O OE1   . GLU F 4 256 ? 41.759  12.943  22.582  1.00 27.13  ? 293 GLU B OE1   1 
ATOM 5130  O OE2   . GLU F 4 256 ? 42.803  12.628  20.691  1.00 27.08  ? 293 GLU B OE2   1 
ATOM 5131  N N     . GLY F 4 257 ? 46.351  8.901   23.326  1.00 48.56  ? 294 GLY B N     1 
ATOM 5132  C CA    . GLY F 4 257 ? 47.025  8.843   24.607  1.00 47.20  ? 294 GLY B CA    1 
ATOM 5133  C C     . GLY F 4 257 ? 47.995  9.997   24.761  1.00 45.99  ? 294 GLY B C     1 
ATOM 5134  O O     . GLY F 4 257 ? 48.436  10.618  23.778  1.00 16.41  ? 294 GLY B O     1 
ATOM 5135  N N     . PHE F 4 258 ? 48.343  10.290  26.004  1.00 20.69  ? 295 PHE B N     1 
ATOM 5136  C CA    . PHE F 4 258 ? 49.246  11.389  26.260  1.00 19.62  ? 295 PHE B CA    1 
ATOM 5137  C C     . PHE F 4 258 ? 50.382  10.971  27.164  1.00 19.50  ? 295 PHE B C     1 
ATOM 5138  O O     . PHE F 4 258 ? 50.175  10.255  28.138  1.00 33.05  ? 295 PHE B O     1 
ATOM 5139  C CB    . PHE F 4 258 ? 48.471  12.555  26.871  1.00 19.55  ? 295 PHE B CB    1 
ATOM 5140  C CG    . PHE F 4 258 ? 47.448  13.156  25.937  1.00 16.53  ? 295 PHE B CG    1 
ATOM 5141  C CD1   . PHE F 4 258 ? 47.827  13.676  24.701  1.00 13.99  ? 295 PHE B CD1   1 
ATOM 5142  C CD2   . PHE F 4 258 ? 46.107  13.214  26.293  1.00 13.85  ? 295 PHE B CD2   1 
ATOM 5143  C CE1   . PHE F 4 258 ? 46.888  14.245  23.837  1.00 9.75   ? 295 PHE B CE1   1 
ATOM 5144  C CE2   . PHE F 4 258 ? 45.158  13.786  25.420  1.00 11.40  ? 295 PHE B CE2   1 
ATOM 5145  C CZ    . PHE F 4 258 ? 45.563  14.300  24.192  1.00 9.17   ? 295 PHE B CZ    1 
ATOM 5146  N N     . GLY F 4 259 ? 51.590  11.406  26.818  1.00 11.84  ? 296 GLY B N     1 
ATOM 5147  C CA    . GLY F 4 259 ? 52.756  11.077  27.609  1.00 11.84  ? 296 GLY B CA    1 
ATOM 5148  C C     . GLY F 4 259 ? 52.502  11.678  28.969  1.00 11.84  ? 296 GLY B C     1 
ATOM 5149  O O     . GLY F 4 259 ? 51.690  12.597  29.110  1.00 25.54  ? 296 GLY B O     1 
ATOM 5150  N N     . ASP F 4 260 ? 53.163  11.158  29.987  1.00 26.80  ? 297 ASP B N     1 
ATOM 5151  C CA    . ASP F 4 260 ? 52.955  11.712  31.295  1.00 30.48  ? 297 ASP B CA    1 
ATOM 5152  C C     . ASP F 4 260 ? 54.220  12.411  31.751  1.00 30.95  ? 297 ASP B C     1 
ATOM 5153  O O     . ASP F 4 260 ? 55.204  11.766  32.114  1.00 49.91  ? 297 ASP B O     1 
ATOM 5154  C CB    . ASP F 4 260 ? 52.590  10.629  32.292  1.00 44.75  ? 297 ASP B CB    1 
ATOM 5155  C CG    . ASP F 4 260 ? 52.097  11.208  33.593  1.00 49.36  ? 297 ASP B CG    1 
ATOM 5156  O OD1   . ASP F 4 260 ? 52.304  10.566  34.642  1.00 53.45  ? 297 ASP B OD1   1 
ATOM 5157  O OD2   . ASP F 4 260 ? 51.498  12.310  33.564  1.00 47.06  ? 297 ASP B OD2   1 
ATOM 5158  N N     . PHE F 4 261 ? 54.186  13.736  31.732  1.00 37.26  ? 298 PHE B N     1 
ATOM 5159  C CA    . PHE F 4 261 ? 55.324  14.525  32.167  1.00 33.92  ? 298 PHE B CA    1 
ATOM 5160  C C     . PHE F 4 261 ? 54.841  15.847  32.732  1.00 35.07  ? 298 PHE B C     1 
ATOM 5161  O O     . PHE F 4 261 ? 53.647  16.160  32.710  1.00 12.37  ? 298 PHE B O     1 
ATOM 5162  C CB    . PHE F 4 261 ? 56.287  14.766  31.000  1.00 3.15   ? 298 PHE B CB    1 
ATOM 5163  C CG    . PHE F 4 261 ? 55.723  15.649  29.904  1.00 2.00   ? 298 PHE B CG    1 
ATOM 5164  C CD1   . PHE F 4 261 ? 55.844  17.025  29.968  1.00 2.00   ? 298 PHE B CD1   1 
ATOM 5165  C CD2   . PHE F 4 261 ? 55.062  15.095  28.822  1.00 2.00   ? 298 PHE B CD2   1 
ATOM 5166  C CE1   . PHE F 4 261 ? 55.321  17.821  28.985  1.00 2.00   ? 298 PHE B CE1   1 
ATOM 5167  C CE2   . PHE F 4 261 ? 54.531  15.900  27.829  1.00 2.00   ? 298 PHE B CE2   1 
ATOM 5168  C CZ    . PHE F 4 261 ? 54.659  17.255  27.910  1.00 2.00   ? 298 PHE B CZ    1 
ATOM 5169  N N     . SER F 4 262 ? 55.773  16.619  33.257  1.00 22.44  ? 299 SER B N     1 
ATOM 5170  C CA    . SER F 4 262 ? 55.407  17.899  33.815  1.00 26.70  ? 299 SER B CA    1 
ATOM 5171  C C     . SER F 4 262 ? 56.286  18.968  33.213  1.00 28.47  ? 299 SER B C     1 
ATOM 5172  O O     . SER F 4 262 ? 57.316  18.664  32.600  1.00 39.28  ? 299 SER B O     1 
ATOM 5173  C CB    . SER F 4 262 ? 55.561  17.888  35.334  1.00 36.27  ? 299 SER B CB    1 
ATOM 5174  O OG    . SER F 4 262 ? 54.408  17.344  35.929  1.00 38.06  ? 299 SER B OG    1 
ATOM 5175  N N     . PRO F 4 263 ? 55.891  20.237  33.376  1.00 43.44  ? 300 PRO B N     1 
ATOM 5176  C CA    . PRO F 4 263 ? 56.666  21.356  32.841  1.00 44.40  ? 300 PRO B CA    1 
ATOM 5177  C C     . PRO F 4 263 ? 58.076  21.226  33.398  1.00 43.97  ? 300 PRO B C     1 
ATOM 5178  O O     . PRO F 4 263 ? 59.071  21.585  32.760  1.00 38.72  ? 300 PRO B O     1 
ATOM 5179  C CB    . PRO F 4 263 ? 55.930  22.563  33.392  1.00 34.75  ? 300 PRO B CB    1 
ATOM 5180  C CG    . PRO F 4 263 ? 55.457  22.048  34.720  1.00 38.13  ? 300 PRO B CG    1 
ATOM 5181  C CD    . PRO F 4 263 ? 54.895  20.713  34.348  1.00 35.65  ? 300 PRO B CD    1 
ATOM 5182  N N     . THR F 4 264 ? 58.143  20.683  34.604  1.00 23.35  ? 301 THR B N     1 
ATOM 5183  C CA    . THR F 4 264 ? 59.418  20.477  35.250  1.00 20.36  ? 301 THR B CA    1 
ATOM 5184  C C     . THR F 4 264 ? 60.202  19.366  34.533  1.00 18.62  ? 301 THR B C     1 
ATOM 5185  O O     . THR F 4 264 ? 61.335  19.070  34.910  1.00 44.27  ? 301 THR B O     1 
ATOM 5186  C CB    . THR F 4 264 ? 59.214  20.101  36.710  1.00 34.83  ? 301 THR B CB    1 
ATOM 5187  O OG1   . THR F 4 264 ? 58.285  21.016  37.304  1.00 37.86  ? 301 THR B OG1   1 
ATOM 5188  C CG2   . THR F 4 264 ? 60.524  20.169  37.458  1.00 38.56  ? 301 THR B CG2   1 
ATOM 5189  N N     . ASP F 4 265 ? 59.612  18.758  33.501  1.00 9.32   ? 302 ASP B N     1 
ATOM 5190  C CA    . ASP F 4 265 ? 60.289  17.696  32.759  1.00 9.85   ? 302 ASP B CA    1 
ATOM 5191  C C     . ASP F 4 265 ? 60.652  18.105  31.332  1.00 8.42   ? 302 ASP B C     1 
ATOM 5192  O O     . ASP F 4 265 ? 61.129  17.285  30.529  1.00 12.39  ? 302 ASP B O     1 
ATOM 5193  C CB    . ASP F 4 265 ? 59.427  16.445  32.731  1.00 27.60  ? 302 ASP B CB    1 
ATOM 5194  C CG    . ASP F 4 265 ? 59.143  15.908  34.112  1.00 30.93  ? 302 ASP B CG    1 
ATOM 5195  O OD1   . ASP F 4 265 ? 60.086  15.419  34.797  1.00 26.26  ? 302 ASP B OD1   1 
ATOM 5196  O OD2   . ASP F 4 265 ? 57.958  15.990  34.500  1.00 34.25  ? 302 ASP B OD2   1 
ATOM 5197  N N     . VAL F 4 266 ? 60.417  19.375  31.020  1.00 4.97   ? 303 VAL B N     1 
ATOM 5198  C CA    . VAL F 4 266 ? 60.765  19.900  29.716  1.00 4.97   ? 303 VAL B CA    1 
ATOM 5199  C C     . VAL F 4 266 ? 62.105  20.611  29.908  1.00 4.97   ? 303 VAL B C     1 
ATOM 5200  O O     . VAL F 4 266 ? 62.165  21.690  30.471  1.00 9.70   ? 303 VAL B O     1 
ATOM 5201  C CB    . VAL F 4 266 ? 59.760  20.913  29.256  1.00 2.00   ? 303 VAL B CB    1 
ATOM 5202  C CG1   . VAL F 4 266 ? 59.549  20.776  27.813  1.00 2.00   ? 303 VAL B CG1   1 
ATOM 5203  C CG2   . VAL F 4 266 ? 58.482  20.723  29.975  1.00 2.00   ? 303 VAL B CG2   1 
ATOM 5204  N N     . HIS F 4 267 ? 63.190  20.004  29.466  1.00 13.42  ? 304 HIS B N     1 
ATOM 5205  C CA    . HIS F 4 267 ? 64.493  20.614  29.610  1.00 9.69   ? 304 HIS B CA    1 
ATOM 5206  C C     . HIS F 4 267 ? 64.688  21.799  28.649  1.00 7.23   ? 304 HIS B C     1 
ATOM 5207  O O     . HIS F 4 267 ? 64.546  21.674  27.425  1.00 7.23   ? 304 HIS B O     1 
ATOM 5208  C CB    . HIS F 4 267 ? 65.537  19.545  29.380  1.00 14.02  ? 304 HIS B CB    1 
ATOM 5209  C CG    . HIS F 4 267 ? 66.930  20.059  29.395  1.00 14.02  ? 304 HIS B CG    1 
ATOM 5210  N ND1   . HIS F 4 267 ? 67.351  21.033  30.272  1.00 14.02  ? 304 HIS B ND1   1 
ATOM 5211  C CD2   . HIS F 4 267 ? 68.015  19.710  28.667  1.00 14.02  ? 304 HIS B CD2   1 
ATOM 5212  C CE1   . HIS F 4 267 ? 68.637  21.262  30.085  1.00 14.02  ? 304 HIS B CE1   1 
ATOM 5213  N NE2   . HIS F 4 267 ? 69.065  20.471  29.116  1.00 14.02  ? 304 HIS B NE2   1 
ATOM 5214  N N     . ARG F 4 268 ? 64.997  22.954  29.229  1.00 17.19  ? 305 ARG B N     1 
ATOM 5215  C CA    . ARG F 4 268 ? 65.211  24.211  28.521  1.00 18.81  ? 305 ARG B CA    1 
ATOM 5216  C C     . ARG F 4 268 ? 64.594  24.403  27.125  1.00 21.34  ? 305 ARG B C     1 
ATOM 5217  O O     . ARG F 4 268 ? 65.272  24.701  26.153  1.00 10.30  ? 305 ARG B O     1 
ATOM 5218  C CB    . ARG F 4 268 ? 66.699  24.501  28.558  1.00 2.00   ? 305 ARG B CB    1 
ATOM 5219  C CG    . ARG F 4 268 ? 67.140  24.477  30.003  1.00 2.00   ? 305 ARG B CG    1 
ATOM 5220  C CD    . ARG F 4 268 ? 68.591  24.737  30.236  1.00 2.00   ? 305 ARG B CD    1 
ATOM 5221  N NE    . ARG F 4 268 ? 68.830  24.660  31.676  1.00 2.78   ? 305 ARG B NE    1 
ATOM 5222  C CZ    . ARG F 4 268 ? 68.459  25.594  32.545  1.00 7.99   ? 305 ARG B CZ    1 
ATOM 5223  N NH1   . ARG F 4 268 ? 67.843  26.676  32.108  1.00 7.93   ? 305 ARG B NH1   1 
ATOM 5224  N NH2   . ARG F 4 268 ? 68.685  25.437  33.839  1.00 10.40  ? 305 ARG B NH2   1 
ATOM 5225  N N     . GLN F 4 269 ? 63.273  24.245  27.077  1.00 8.81   ? 306 GLN B N     1 
ATOM 5226  C CA    . GLN F 4 269 ? 62.450  24.426  25.884  1.00 8.75   ? 306 GLN B CA    1 
ATOM 5227  C C     . GLN F 4 269 ? 62.849  23.638  24.657  1.00 10.69  ? 306 GLN B C     1 
ATOM 5228  O O     . GLN F 4 269 ? 62.357  23.920  23.568  1.00 17.43  ? 306 GLN B O     1 
ATOM 5229  C CB    . GLN F 4 269 ? 62.378  25.913  25.528  1.00 2.00   ? 306 GLN B CB    1 
ATOM 5230  C CG    . GLN F 4 269 ? 61.519  26.729  26.467  1.00 2.00   ? 306 GLN B CG    1 
ATOM 5231  C CD    . GLN F 4 269 ? 61.662  28.241  26.276  1.00 2.00   ? 306 GLN B CD    1 
ATOM 5232  O OE1   . GLN F 4 269 ? 62.674  28.834  26.651  1.00 2.00   ? 306 GLN B OE1   1 
ATOM 5233  N NE2   . GLN F 4 269 ? 60.643  28.865  25.703  1.00 2.00   ? 306 GLN B NE2   1 
ATOM 5234  N N     . PHE F 4 270 ? 63.712  22.643  24.823  1.00 28.66  ? 307 PHE B N     1 
ATOM 5235  C CA    . PHE F 4 270 ? 64.152  21.861  23.680  1.00 28.22  ? 307 PHE B CA    1 
ATOM 5236  C C     . PHE F 4 270 ? 64.126  20.359  23.877  1.00 26.60  ? 307 PHE B C     1 
ATOM 5237  O O     . PHE F 4 270 ? 64.392  19.599  22.940  1.00 10.97  ? 307 PHE B O     1 
ATOM 5238  C CB    . PHE F 4 270 ? 65.559  22.294  23.278  1.00 2.00   ? 307 PHE B CB    1 
ATOM 5239  C CG    . PHE F 4 270 ? 65.627  23.695  22.785  1.00 2.00   ? 307 PHE B CG    1 
ATOM 5240  C CD1   . PHE F 4 270 ? 66.357  24.655  23.466  1.00 2.00   ? 307 PHE B CD1   1 
ATOM 5241  C CD2   . PHE F 4 270 ? 64.940  24.069  21.651  1.00 2.00   ? 307 PHE B CD2   1 
ATOM 5242  C CE1   . PHE F 4 270 ? 66.397  25.975  23.020  1.00 2.00   ? 307 PHE B CE1   1 
ATOM 5243  C CE2   . PHE F 4 270 ? 64.977  25.367  21.206  1.00 2.00   ? 307 PHE B CE2   1 
ATOM 5244  C CZ    . PHE F 4 270 ? 65.709  26.327  21.894  1.00 2.00   ? 307 PHE B CZ    1 
ATOM 5245  N N     . ALA F 4 271 ? 63.827  19.931  25.096  1.00 6.65   ? 308 ALA B N     1 
ATOM 5246  C CA    . ALA F 4 271 ? 63.772  18.513  25.392  1.00 6.65   ? 308 ALA B CA    1 
ATOM 5247  C C     . ALA F 4 271 ? 62.609  18.210  26.309  1.00 6.65   ? 308 ALA B C     1 
ATOM 5248  O O     . ALA F 4 271 ? 62.166  19.057  27.084  1.00 37.90  ? 308 ALA B O     1 
ATOM 5249  C CB    . ALA F 4 271 ? 65.065  18.060  26.027  1.00 41.70  ? 308 ALA B CB    1 
ATOM 5250  N N     . ILE F 4 272 ? 62.103  16.995  26.199  1.00 2.00   ? 309 ILE B N     1 
ATOM 5251  C CA    . ILE F 4 272 ? 61.006  16.564  27.033  1.00 2.00   ? 309 ILE B CA    1 
ATOM 5252  C C     . ILE F 4 272 ? 61.240  15.128  27.437  1.00 2.00   ? 309 ILE B C     1 
ATOM 5253  O O     . ILE F 4 272 ? 61.458  14.269  26.589  1.00 9.00   ? 309 ILE B O     1 
ATOM 5254  C CB    . ILE F 4 272 ? 59.683  16.641  26.289  1.00 26.55  ? 309 ILE B CB    1 
ATOM 5255  C CG1   . ILE F 4 272 ? 58.986  17.948  26.606  1.00 26.35  ? 309 ILE B CG1   1 
ATOM 5256  C CG2   . ILE F 4 272 ? 58.794  15.488  26.691  1.00 26.95  ? 309 ILE B CG2   1 
ATOM 5257  C CD1   . ILE F 4 272 ? 57.659  18.042  25.961  1.00 26.79  ? 309 ILE B CD1   1 
ATOM 5258  N N     . VAL F 4 273 ? 61.214  14.882  28.738  1.00 37.75  ? 310 VAL B N     1 
ATOM 5259  C CA    . VAL F 4 273 ? 61.391  13.544  29.276  1.00 37.35  ? 310 VAL B CA    1 
ATOM 5260  C C     . VAL F 4 273 ? 60.023  13.134  29.778  1.00 38.33  ? 310 VAL B C     1 
ATOM 5261  O O     . VAL F 4 273 ? 59.473  13.781  30.667  1.00 31.14  ? 310 VAL B O     1 
ATOM 5262  C CB    . VAL F 4 273 ? 62.376  13.542  30.456  1.00 45.77  ? 310 VAL B CB    1 
ATOM 5263  C CG1   . VAL F 4 273 ? 62.185  12.281  31.304  1.00 48.16  ? 310 VAL B CG1   1 
ATOM 5264  C CG2   . VAL F 4 273 ? 63.806  13.627  29.928  1.00 47.84  ? 310 VAL B CG2   1 
ATOM 5265  N N     . PHE F 4 274 ? 59.460  12.076  29.214  1.00 52.05  ? 311 PHE B N     1 
ATOM 5266  C CA    . PHE F 4 274 ? 58.151  11.662  29.667  1.00 51.27  ? 311 PHE B CA    1 
ATOM 5267  C C     . PHE F 4 274 ? 57.980  10.150  29.757  1.00 51.58  ? 311 PHE B C     1 
ATOM 5268  O O     . PHE F 4 274 ? 58.830  9.374   29.311  1.00 38.34  ? 311 PHE B O     1 
ATOM 5269  C CB    . PHE F 4 274 ? 57.078  12.262  28.764  1.00 28.57  ? 311 PHE B CB    1 
ATOM 5270  C CG    . PHE F 4 274 ? 57.109  11.726  27.377  1.00 25.61  ? 311 PHE B CG    1 
ATOM 5271  C CD1   . PHE F 4 274 ? 57.893  12.323  26.402  1.00 24.13  ? 311 PHE B CD1   1 
ATOM 5272  C CD2   . PHE F 4 274 ? 56.382  10.587  27.046  1.00 25.15  ? 311 PHE B CD2   1 
ATOM 5273  C CE1   . PHE F 4 274 ? 57.953  11.792  25.114  1.00 28.58  ? 311 PHE B CE1   1 
ATOM 5274  C CE2   . PHE F 4 274 ? 56.439  10.053  25.767  1.00 26.10  ? 311 PHE B CE2   1 
ATOM 5275  C CZ    . PHE F 4 274 ? 57.225  10.657  24.801  1.00 28.20  ? 311 PHE B CZ    1 
ATOM 5276  N N     . LYS F 4 275 ? 56.869  9.749   30.363  1.00 21.42  ? 312 LYS B N     1 
ATOM 5277  C CA    . LYS F 4 275 ? 56.518  8.349   30.537  1.00 23.21  ? 312 LYS B CA    1 
ATOM 5278  C C     . LYS F 4 275 ? 55.458  8.020   29.485  1.00 21.15  ? 312 LYS B C     1 
ATOM 5279  O O     . LYS F 4 275 ? 54.606  8.863   29.187  1.00 19.62  ? 312 LYS B O     1 
ATOM 5280  C CB    . LYS F 4 275 ? 55.889  8.135   31.910  1.00 28.69  ? 312 LYS B CB    1 
ATOM 5281  C CG    . LYS F 4 275 ? 56.721  8.556   33.088  1.00 31.09  ? 312 LYS B CG    1 
ATOM 5282  C CD    . LYS F 4 275 ? 57.612  7.430   33.520  1.00 31.53  ? 312 LYS B CD    1 
ATOM 5283  C CE    . LYS F 4 275 ? 58.162  7.673   34.912  1.00 29.07  ? 312 LYS B CE    1 
ATOM 5284  N NZ    . LYS F 4 275 ? 59.145  6.609   35.267  1.00 28.21  ? 312 LYS B NZ    1 
ATOM 5285  N N     . THR F 4 276 ? 55.491  6.799   28.942  1.00 15.51  ? 313 THR B N     1 
ATOM 5286  C CA    . THR F 4 276 ? 54.507  6.398   27.945  1.00 16.67  ? 313 THR B CA    1 
ATOM 5287  C C     . THR F 4 276 ? 53.192  5.934   28.555  1.00 19.41  ? 313 THR B C     1 
ATOM 5288  O O     . THR F 4 276 ? 53.163  5.285   29.606  1.00 11.32  ? 313 THR B O     1 
ATOM 5289  C CB    . THR F 4 276 ? 54.995  5.252   27.043  1.00 5.31   ? 313 THR B CB    1 
ATOM 5290  O OG1   . THR F 4 276 ? 55.318  4.109   27.842  1.00 7.41   ? 313 THR B OG1   1 
ATOM 5291  C CG2   . THR F 4 276 ? 56.198  5.670   26.244  1.00 7.37   ? 313 THR B CG2   1 
ATOM 5292  N N     . PRO F 4 277 ? 52.080  6.261   27.881  1.00 37.43  ? 314 PRO B N     1 
ATOM 5293  C CA    . PRO F 4 277 ? 50.698  5.930   28.250  1.00 36.94  ? 314 PRO B CA    1 
ATOM 5294  C C     . PRO F 4 277 ? 50.336  4.480   27.911  1.00 37.72  ? 314 PRO B C     1 
ATOM 5295  O O     . PRO F 4 277 ? 50.950  3.870   27.030  1.00 16.14  ? 314 PRO B O     1 
ATOM 5296  C CB    . PRO F 4 277 ? 49.888  6.909   27.422  1.00 14.85  ? 314 PRO B CB    1 
ATOM 5297  C CG    . PRO F 4 277 ? 50.714  7.007   26.155  1.00 14.85  ? 314 PRO B CG    1 
ATOM 5298  C CD    . PRO F 4 277 ? 52.110  7.151   26.703  1.00 14.85  ? 314 PRO B CD    1 
ATOM 5299  N N     . LYS F 4 278 ? 49.340  3.932   28.608  1.00 13.14  ? 315 LYS B N     1 
ATOM 5300  C CA    . LYS F 4 278 ? 48.906  2.563   28.343  1.00 13.14  ? 315 LYS B CA    1 
ATOM 5301  C C     . LYS F 4 278 ? 48.272  2.567   26.961  1.00 13.14  ? 315 LYS B C     1 
ATOM 5302  O O     . LYS F 4 278 ? 47.598  3.526   26.590  1.00 43.58  ? 315 LYS B O     1 
ATOM 5303  C CB    . LYS F 4 278 ? 47.860  2.090   29.359  1.00 30.09  ? 315 LYS B CB    1 
ATOM 5304  C CG    . LYS F 4 278 ? 48.423  1.678   30.698  1.00 31.83  ? 315 LYS B CG    1 
ATOM 5305  C CD    . LYS F 4 278 ? 47.444  0.817   31.501  1.00 32.54  ? 315 LYS B CD    1 
ATOM 5306  C CE    . LYS F 4 278 ? 46.261  1.617   32.024  1.00 32.93  ? 315 LYS B CE    1 
ATOM 5307  N NZ    . LYS F 4 278 ? 45.458  0.837   33.011  1.00 31.69  ? 315 LYS B NZ    1 
ATOM 5308  N N     . TYR F 4 279 ? 48.506  1.512   26.186  1.00 58.34  ? 316 TYR B N     1 
ATOM 5309  C CA    . TYR F 4 279 ? 47.910  1.425   24.857  1.00 60.81  ? 316 TYR B CA    1 
ATOM 5310  C C     . TYR F 4 279 ? 46.524  0.825   25.031  1.00 63.26  ? 316 TYR B C     1 
ATOM 5311  O O     . TYR F 4 279 ? 46.244  0.217   26.066  1.00 62.79  ? 316 TYR B O     1 
ATOM 5312  C CB    . TYR F 4 279 ? 48.744  0.545   23.932  1.00 31.96  ? 316 TYR B CB    1 
ATOM 5313  C CG    . TYR F 4 279 ? 48.119  0.384   22.563  1.00 31.08  ? 316 TYR B CG    1 
ATOM 5314  C CD1   . TYR F 4 279 ? 47.722  1.501   21.818  1.00 30.10  ? 316 TYR B CD1   1 
ATOM 5315  C CD2   . TYR F 4 279 ? 47.930  -0.882  22.008  1.00 29.45  ? 316 TYR B CD2   1 
ATOM 5316  C CE1   . TYR F 4 279 ? 47.151  1.356   20.559  1.00 28.66  ? 316 TYR B CE1   1 
ATOM 5317  C CE2   . TYR F 4 279 ? 47.366  -1.039  20.754  1.00 23.77  ? 316 TYR B CE2   1 
ATOM 5318  C CZ    . TYR F 4 279 ? 46.980  0.080   20.032  1.00 24.11  ? 316 TYR B CZ    1 
ATOM 5319  O OH    . TYR F 4 279 ? 46.440  -0.084  18.775  1.00 19.04  ? 316 TYR B OH    1 
ATOM 5320  N N     . LYS F 4 280 ? 45.652  0.976   24.042  1.00 43.83  ? 317 LYS B N     1 
ATOM 5321  C CA    . LYS F 4 280 ? 44.314  0.438   24.212  1.00 40.19  ? 317 LYS B CA    1 
ATOM 5322  C C     . LYS F 4 280 ? 44.287  -1.068  24.497  1.00 40.29  ? 317 LYS B C     1 
ATOM 5323  O O     . LYS F 4 280 ? 43.946  -1.469  25.601  1.00 41.42  ? 317 LYS B O     1 
ATOM 5324  C CB    . LYS F 4 280 ? 43.419  0.799   23.023  1.00 40.55  ? 317 LYS B CB    1 
ATOM 5325  C CG    . LYS F 4 280 ? 43.969  0.445   21.657  1.00 40.56  ? 317 LYS B CG    1 
ATOM 5326  C CD    . LYS F 4 280 ? 42.926  0.699   20.585  1.00 40.54  ? 317 LYS B CD    1 
ATOM 5327  C CE    . LYS F 4 280 ? 43.278  -0.021  19.307  1.00 40.92  ? 317 LYS B CE    1 
ATOM 5328  N NZ    . LYS F 4 280 ? 42.126  -0.040  18.367  1.00 37.29  ? 317 LYS B NZ    1 
ATOM 5329  N N     . ASP F 4 281 ? 44.683  -1.901  23.544  1.00 34.84  ? 318 ASP B N     1 
ATOM 5330  C CA    . ASP F 4 281 ? 44.649  -3.351  23.745  1.00 33.03  ? 318 ASP B CA    1 
ATOM 5331  C C     . ASP F 4 281 ? 45.906  -3.954  24.369  1.00 32.81  ? 318 ASP B C     1 
ATOM 5332  O O     . ASP F 4 281 ? 46.789  -4.424  23.645  1.00 42.81  ? 318 ASP B O     1 
ATOM 5333  C CB    . ASP F 4 281 ? 44.397  -4.043  22.401  1.00 61.07  ? 318 ASP B CB    1 
ATOM 5334  C CG    . ASP F 4 281 ? 43.232  -5.028  22.443  1.00 62.93  ? 318 ASP B CG    1 
ATOM 5335  O OD1   . ASP F 4 281 ? 43.292  -6.019  23.213  1.00 62.25  ? 318 ASP B OD1   1 
ATOM 5336  O OD2   . ASP F 4 281 ? 42.253  -4.810  21.692  1.00 64.20  ? 318 ASP B OD2   1 
ATOM 5337  N N     . VAL F 4 282 ? 45.979  -3.970  25.698  1.00 2.00   ? 319 VAL B N     1 
ATOM 5338  C CA    . VAL F 4 282 ? 47.137  -4.550  26.373  1.00 2.00   ? 319 VAL B CA    1 
ATOM 5339  C C     . VAL F 4 282 ? 47.071  -6.075  26.287  1.00 2.23   ? 319 VAL B C     1 
ATOM 5340  O O     . VAL F 4 282 ? 47.910  -6.789  26.845  1.00 5.09   ? 319 VAL B O     1 
ATOM 5341  C CB    . VAL F 4 282 ? 47.230  -4.122  27.872  1.00 8.17   ? 319 VAL B CB    1 
ATOM 5342  C CG1   . VAL F 4 282 ? 47.020  -2.627  28.004  1.00 7.13   ? 319 VAL B CG1   1 
ATOM 5343  C CG2   . VAL F 4 282 ? 46.238  -4.868  28.711  1.00 10.71  ? 319 VAL B CG2   1 
ATOM 5344  N N     . ASN F 4 283 ? 46.070  -6.558  25.564  1.00 51.92  ? 320 ASN B N     1 
ATOM 5345  C CA    . ASN F 4 283 ? 45.840  -7.988  25.368  1.00 57.83  ? 320 ASN B CA    1 
ATOM 5346  C C     . ASN F 4 283 ? 46.428  -8.404  24.022  1.00 58.23  ? 320 ASN B C     1 
ATOM 5347  O O     . ASN F 4 283 ? 46.264  -9.542  23.573  1.00 37.68  ? 320 ASN B O     1 
ATOM 5348  C CB    . ASN F 4 283 ? 44.334  -8.272  25.365  1.00 45.67  ? 320 ASN B CB    1 
ATOM 5349  C CG    . ASN F 4 283 ? 43.645  -7.792  26.627  1.00 48.45  ? 320 ASN B CG    1 
ATOM 5350  O OD1   . ASN F 4 283 ? 42.443  -7.514  26.627  1.00 50.42  ? 320 ASN B OD1   1 
ATOM 5351  N ND2   . ASN F 4 283 ? 44.400  -7.702  27.718  1.00 49.57  ? 320 ASN B ND2   1 
ATOM 5352  N N     . ILE F 4 284 ? 47.123  -7.468  23.391  1.00 26.83  ? 321 ILE B N     1 
ATOM 5353  C CA    . ILE F 4 284 ? 47.703  -7.709  22.086  1.00 25.99  ? 321 ILE B CA    1 
ATOM 5354  C C     . ILE F 4 284 ? 48.813  -8.773  22.135  1.00 26.11  ? 321 ILE B C     1 
ATOM 5355  O O     . ILE F 4 284 ? 49.513  -8.910  23.135  1.00 64.78  ? 321 ILE B O     1 
ATOM 5356  C CB    . ILE F 4 284 ? 48.190  -6.346  21.492  1.00 52.76  ? 321 ILE B CB    1 
ATOM 5357  C CG1   . ILE F 4 284 ? 48.415  -6.463  19.990  1.00 53.08  ? 321 ILE B CG1   1 
ATOM 5358  C CG2   . ILE F 4 284 ? 49.435  -5.886  22.185  1.00 50.47  ? 321 ILE B CG2   1 
ATOM 5359  C CD1   . ILE F 4 284 ? 47.164  -6.763  19.204  1.00 50.05  ? 321 ILE B CD1   1 
ATOM 5360  N N     . THR F 4 285 ? 48.940  -9.551  21.065  1.00 24.08  ? 322 THR B N     1 
ATOM 5361  C CA    . THR F 4 285 ? 49.978  -10.577 20.998  1.00 23.58  ? 322 THR B CA    1 
ATOM 5362  C C     . THR F 4 285 ? 50.950  -10.189 19.896  1.00 22.13  ? 322 THR B C     1 
ATOM 5363  O O     . THR F 4 285 ? 52.108  -10.593 19.902  1.00 59.53  ? 322 THR B O     1 
ATOM 5364  C CB    . THR F 4 285 ? 49.397  -11.990 20.726  1.00 68.66  ? 322 THR B CB    1 
ATOM 5365  O OG1   . THR F 4 285 ? 48.774  -12.023 19.435  1.00 70.19  ? 322 THR B OG1   1 
ATOM 5366  C CG2   . THR F 4 285 ? 48.376  -12.356 21.799  1.00 69.44  ? 322 THR B CG2   1 
ATOM 5367  N N     . LYS F 4 286 ? 50.475  -9.408  18.937  1.00 15.76  ? 323 LYS B N     1 
ATOM 5368  C CA    . LYS F 4 286 ? 51.357  -8.933  17.897  1.00 18.97  ? 323 LYS B CA    1 
ATOM 5369  C C     . LYS F 4 286 ? 51.424  -7.430  18.105  1.00 19.62  ? 323 LYS B C     1 
ATOM 5370  O O     . LYS F 4 286 ? 50.406  -6.774  18.299  1.00 43.74  ? 323 LYS B O     1 
ATOM 5371  C CB    . LYS F 4 286 ? 50.828  -9.294  16.512  1.00 52.90  ? 323 LYS B CB    1 
ATOM 5372  C CG    . LYS F 4 286 ? 51.000  -10.777 16.178  1.00 57.28  ? 323 LYS B CG    1 
ATOM 5373  C CD    . LYS F 4 286 ? 50.869  -11.053 14.681  1.00 60.29  ? 323 LYS B CD    1 
ATOM 5374  C CE    . LYS F 4 286 ? 51.958  -10.335 13.888  1.00 62.38  ? 323 LYS B CE    1 
ATOM 5375  N NZ    . LYS F 4 286 ? 51.937  -10.675 12.432  1.00 59.87  ? 323 LYS B NZ    1 
ATOM 5376  N N     . PRO F 4 287 ? 52.631  -6.861  18.106  1.00 50.47  ? 324 PRO B N     1 
ATOM 5377  C CA    . PRO F 4 287 ? 52.768  -5.417  18.304  1.00 50.72  ? 324 PRO B CA    1 
ATOM 5378  C C     . PRO F 4 287 ? 52.002  -4.584  17.287  1.00 49.85  ? 324 PRO B C     1 
ATOM 5379  O O     . PRO F 4 287 ? 51.795  -5.011  16.150  1.00 29.78  ? 324 PRO B O     1 
ATOM 5380  C CB    . PRO F 4 287 ? 54.276  -5.199  18.211  1.00 47.13  ? 324 PRO B CB    1 
ATOM 5381  C CG    . PRO F 4 287 ? 54.712  -6.269  17.278  1.00 45.78  ? 324 PRO B CG    1 
ATOM 5382  C CD    . PRO F 4 287 ? 53.934  -7.465  17.795  1.00 47.13  ? 324 PRO B CD    1 
ATOM 5383  N N     . ALA F 4 288 ? 51.601  -3.389  17.703  1.00 34.00  ? 325 ALA B N     1 
ATOM 5384  C CA    . ALA F 4 288 ? 50.852  -2.489  16.842  1.00 32.99  ? 325 ALA B CA    1 
ATOM 5385  C C     . ALA F 4 288 ? 51.531  -1.128  16.672  1.00 30.20  ? 325 ALA B C     1 
ATOM 5386  O O     . ALA F 4 288 ? 52.049  -0.547  17.641  1.00 16.35  ? 325 ALA B O     1 
ATOM 5387  C CB    . ALA F 4 288 ? 49.465  -2.318  17.391  1.00 22.18  ? 325 ALA B CB    1 
ATOM 5388  N N     . SER F 4 289 ? 51.509  -0.626  15.432  1.00 13.57  ? 326 SER B N     1 
ATOM 5389  C CA    . SER F 4 289 ? 52.126  0.660   15.089  1.00 14.18  ? 326 SER B CA    1 
ATOM 5390  C C     . SER F 4 289 ? 51.175  1.817   15.306  1.00 13.14  ? 326 SER B C     1 
ATOM 5391  O O     . SER F 4 289 ? 50.164  1.918   14.634  1.00 29.10  ? 326 SER B O     1 
ATOM 5392  C CB    . SER F 4 289 ? 52.580  0.670   13.623  1.00 36.69  ? 326 SER B CB    1 
ATOM 5393  O OG    . SER F 4 289 ? 53.387  -0.456  13.311  1.00 36.23  ? 326 SER B OG    1 
ATOM 5394  N N     . VAL F 4 290 ? 51.497  2.684   16.257  1.00 18.01  ? 327 VAL B N     1 
ATOM 5395  C CA    . VAL F 4 290 ? 50.669  3.851   16.530  1.00 14.63  ? 327 VAL B CA    1 
ATOM 5396  C C     . VAL F 4 290 ? 51.510  5.097   16.306  1.00 14.27  ? 327 VAL B C     1 
ATOM 5397  O O     . VAL F 4 290 ? 52.664  5.010   15.900  1.00 2.00   ? 327 VAL B O     1 
ATOM 5398  C CB    . VAL F 4 290 ? 50.113  3.852   17.966  1.00 10.19  ? 327 VAL B CB    1 
ATOM 5399  C CG1   . VAL F 4 290 ? 49.229  2.623   18.175  1.00 10.19  ? 327 VAL B CG1   1 
ATOM 5400  C CG2   . VAL F 4 290 ? 51.263  3.892   18.974  1.00 10.19  ? 327 VAL B CG2   1 
ATOM 5401  N N     . PHE F 4 291 ? 50.940  6.261   16.568  1.00 19.64  ? 328 PHE B N     1 
ATOM 5402  C CA    . PHE F 4 291 ? 51.680  7.492   16.340  1.00 21.13  ? 328 PHE B CA    1 
ATOM 5403  C C     . PHE F 4 291 ? 51.939  8.373   17.541  1.00 23.72  ? 328 PHE B C     1 
ATOM 5404  O O     . PHE F 4 291 ? 51.279  8.261   18.580  1.00 29.67  ? 328 PHE B O     1 
ATOM 5405  C CB    . PHE F 4 291 ? 50.982  8.327   15.276  1.00 34.78  ? 328 PHE B CB    1 
ATOM 5406  C CG    . PHE F 4 291 ? 51.357  7.960   13.885  1.00 31.78  ? 328 PHE B CG    1 
ATOM 5407  C CD1   . PHE F 4 291 ? 52.704  7.829   13.528  1.00 32.64  ? 328 PHE B CD1   1 
ATOM 5408  C CD2   . PHE F 4 291 ? 50.379  7.769   12.921  1.00 32.89  ? 328 PHE B CD2   1 
ATOM 5409  C CE1   . PHE F 4 291 ? 53.073  7.522   12.221  1.00 36.29  ? 328 PHE B CE1   1 
ATOM 5410  C CE2   . PHE F 4 291 ? 50.731  7.460   11.603  1.00 34.61  ? 328 PHE B CE2   1 
ATOM 5411  C CZ    . PHE F 4 291 ? 52.079  7.331   11.249  1.00 34.32  ? 328 PHE B CZ    1 
ATOM 5412  N N     . VAL F 4 292 ? 52.924  9.249   17.380  1.00 18.10  ? 329 VAL B N     1 
ATOM 5413  C CA    . VAL F 4 292 ? 53.281  10.200  18.415  1.00 16.68  ? 329 VAL B CA    1 
ATOM 5414  C C     . VAL F 4 292 ? 53.219  11.546  17.737  1.00 16.54  ? 329 VAL B C     1 
ATOM 5415  O O     . VAL F 4 292 ? 53.456  11.663  16.533  1.00 13.87  ? 329 VAL B O     1 
ATOM 5416  C CB    . VAL F 4 292 ? 54.696  10.007  18.948  1.00 30.19  ? 329 VAL B CB    1 
ATOM 5417  C CG1   . VAL F 4 292 ? 54.876  10.867  20.197  1.00 24.84  ? 329 VAL B CG1   1 
ATOM 5418  C CG2   . VAL F 4 292 ? 54.954  8.534   19.234  1.00 29.99  ? 329 VAL B CG2   1 
ATOM 5419  N N     . GLN F 4 293 ? 52.926  12.578  18.509  1.00 26.46  ? 330 GLN B N     1 
ATOM 5420  C CA    . GLN F 4 293 ? 52.800  13.881  17.899  1.00 26.50  ? 330 GLN B CA    1 
ATOM 5421  C C     . GLN F 4 293 ? 52.922  14.968  18.948  1.00 24.91  ? 330 GLN B C     1 
ATOM 5422  O O     . GLN F 4 293 ? 52.385  14.835  20.039  1.00 13.98  ? 330 GLN B O     1 
ATOM 5423  C CB    . GLN F 4 293 ? 51.431  13.934  17.236  1.00 24.94  ? 330 GLN B CB    1 
ATOM 5424  C CG    . GLN F 4 293 ? 51.262  14.933  16.145  1.00 30.75  ? 330 GLN B CG    1 
ATOM 5425  C CD    . GLN F 4 293 ? 49.831  14.960  15.670  1.00 32.68  ? 330 GLN B CD    1 
ATOM 5426  O OE1   . GLN F 4 293 ? 48.911  15.107  16.479  1.00 30.71  ? 330 GLN B OE1   1 
ATOM 5427  N NE2   . GLN F 4 293 ? 49.628  14.811  14.360  1.00 33.18  ? 330 GLN B NE2   1 
ATOM 5428  N N     . LEU F 4 294 ? 53.652  16.025  18.620  1.00 2.00   ? 331 LEU B N     1 
ATOM 5429  C CA    . LEU F 4 294 ? 53.812  17.147  19.523  1.00 2.00   ? 331 LEU B CA    1 
ATOM 5430  C C     . LEU F 4 294 ? 52.567  17.986  19.293  1.00 2.00   ? 331 LEU B C     1 
ATOM 5431  O O     . LEU F 4 294 ? 52.177  18.205  18.150  1.00 2.00   ? 331 LEU B O     1 
ATOM 5432  C CB    . LEU F 4 294 ? 55.058  17.936  19.137  1.00 5.01   ? 331 LEU B CB    1 
ATOM 5433  C CG    . LEU F 4 294 ? 56.156  18.177  20.171  1.00 5.70   ? 331 LEU B CG    1 
ATOM 5434  C CD1   . LEU F 4 294 ? 56.099  17.188  21.332  1.00 7.38   ? 331 LEU B CD1   1 
ATOM 5435  C CD2   . LEU F 4 294 ? 57.479  18.069  19.444  1.00 3.61   ? 331 LEU B CD2   1 
ATOM 5436  N N     . ARG F 4 295 ? 51.920  18.440  20.358  1.00 4.58   ? 332 ARG B N     1 
ATOM 5437  C CA    . ARG F 4 295 ? 50.715  19.251  20.190  1.00 4.58   ? 332 ARG B CA    1 
ATOM 5438  C C     . ARG F 4 295 ? 50.699  20.387  21.202  1.00 4.58   ? 332 ARG B C     1 
ATOM 5439  O O     . ARG F 4 295 ? 51.051  20.199  22.373  1.00 4.58   ? 332 ARG B O     1 
ATOM 5440  C CB    . ARG F 4 295 ? 49.457  18.381  20.342  1.00 22.33  ? 332 ARG B CB    1 
ATOM 5441  C CG    . ARG F 4 295 ? 48.153  19.115  20.137  1.00 25.27  ? 332 ARG B CG    1 
ATOM 5442  C CD    . ARG F 4 295 ? 47.212  18.773  21.260  1.00 27.87  ? 332 ARG B CD    1 
ATOM 5443  N NE    . ARG F 4 295 ? 45.986  18.115  20.809  1.00 27.63  ? 332 ARG B NE    1 
ATOM 5444  C CZ    . ARG F 4 295 ? 45.182  17.396  21.596  1.00 29.53  ? 332 ARG B CZ    1 
ATOM 5445  N NH1   . ARG F 4 295 ? 45.460  17.229  22.890  1.00 24.55  ? 332 ARG B NH1   1 
ATOM 5446  N NH2   . ARG F 4 295 ? 44.100  16.827  21.081  1.00 28.93  ? 332 ARG B NH2   1 
ATOM 5447  N N     . ARG F 4 296 ? 50.298  21.567  20.738  1.00 4.86   ? 333 ARG B N     1 
ATOM 5448  C CA    . ARG F 4 296 ? 50.254  22.752  21.585  1.00 4.86   ? 333 ARG B CA    1 
ATOM 5449  C C     . ARG F 4 296 ? 48.908  22.857  22.241  1.00 4.86   ? 333 ARG B C     1 
ATOM 5450  O O     . ARG F 4 296 ? 47.904  23.051  21.555  1.00 7.78   ? 333 ARG B O     1 
ATOM 5451  C CB    . ARG F 4 296 ? 50.493  24.026  20.757  1.00 11.38  ? 333 ARG B CB    1 
ATOM 5452  C CG    . ARG F 4 296 ? 50.500  25.334  21.582  1.00 11.38  ? 333 ARG B CG    1 
ATOM 5453  C CD    . ARG F 4 296 ? 50.905  26.513  20.736  1.00 11.38  ? 333 ARG B CD    1 
ATOM 5454  N NE    . ARG F 4 296 ? 52.286  26.410  20.277  1.00 11.38  ? 333 ARG B NE    1 
ATOM 5455  C CZ    . ARG F 4 296 ? 52.690  26.559  19.012  1.00 11.38  ? 333 ARG B CZ    1 
ATOM 5456  N NH1   . ARG F 4 296 ? 51.814  26.814  18.042  1.00 11.38  ? 333 ARG B NH1   1 
ATOM 5457  N NH2   . ARG F 4 296 ? 53.990  26.472  18.725  1.00 11.38  ? 333 ARG B NH2   1 
ATOM 5458  N N     . LYS F 4 297 ? 48.874  22.755  23.562  1.00 17.75  ? 334 LYS B N     1 
ATOM 5459  C CA    . LYS F 4 297 ? 47.606  22.823  24.262  1.00 22.72  ? 334 LYS B CA    1 
ATOM 5460  C C     . LYS F 4 297 ? 46.780  24.037  23.833  1.00 27.33  ? 334 LYS B C     1 
ATOM 5461  O O     . LYS F 4 297 ? 45.544  23.968  23.776  1.00 38.70  ? 334 LYS B O     1 
ATOM 5462  C CB    . LYS F 4 297 ? 47.843  22.794  25.775  1.00 33.28  ? 334 LYS B CB    1 
ATOM 5463  C CG    . LYS F 4 297 ? 48.147  21.382  26.274  1.00 35.35  ? 334 LYS B CG    1 
ATOM 5464  C CD    . LYS F 4 297 ? 48.547  21.326  27.748  1.00 38.28  ? 334 LYS B CD    1 
ATOM 5465  C CE    . LYS F 4 297 ? 47.391  21.658  28.692  1.00 38.43  ? 334 LYS B CE    1 
ATOM 5466  N NZ    . LYS F 4 297 ? 47.762  21.474  30.132  1.00 41.59  ? 334 LYS B NZ    1 
ATOM 5467  N N     . SER F 4 298 ? 47.460  25.133  23.508  1.00 13.49  ? 335 SER B N     1 
ATOM 5468  C CA    . SER F 4 298 ? 46.788  26.346  23.054  1.00 11.15  ? 335 SER B CA    1 
ATOM 5469  C C     . SER F 4 298 ? 45.971  26.081  21.784  1.00 11.75  ? 335 SER B C     1 
ATOM 5470  O O     . SER F 4 298 ? 44.904  25.472  21.804  1.00 32.84  ? 335 SER B O     1 
ATOM 5471  C CB    . SER F 4 298 ? 47.821  27.420  22.735  1.00 34.49  ? 335 SER B CB    1 
ATOM 5472  O OG    . SER F 4 298 ? 48.641  27.671  23.850  1.00 35.67  ? 335 SER B OG    1 
ATOM 5473  N N     . ASP F 4 299 ? 46.517  26.561  20.679  1.00 17.68  ? 336 ASP B N     1 
ATOM 5474  C CA    . ASP F 4 299 ? 45.932  26.442  19.362  1.00 19.19  ? 336 ASP B CA    1 
ATOM 5475  C C     . ASP F 4 299 ? 45.747  25.003  18.890  1.00 20.90  ? 336 ASP B C     1 
ATOM 5476  O O     . ASP F 4 299 ? 45.083  24.742  17.879  1.00 24.86  ? 336 ASP B O     1 
ATOM 5477  C CB    . ASP F 4 299 ? 46.854  27.163  18.412  1.00 29.16  ? 336 ASP B CB    1 
ATOM 5478  C CG    . ASP F 4 299 ? 48.291  26.809  18.660  1.00 33.38  ? 336 ASP B CG    1 
ATOM 5479  O OD1   . ASP F 4 299 ? 49.167  27.425  18.017  1.00 35.42  ? 336 ASP B OD1   1 
ATOM 5480  O OD2   . ASP F 4 299 ? 48.535  25.911  19.500  1.00 38.86  ? 336 ASP B OD2   1 
ATOM 5481  N N     . LEU F 4 300 ? 46.343  24.067  19.615  1.00 37.74  ? 337 LEU B N     1 
ATOM 5482  C CA    . LEU F 4 300 ? 46.257  22.664  19.241  1.00 37.67  ? 337 LEU B CA    1 
ATOM 5483  C C     . LEU F 4 300 ? 47.008  22.364  17.943  1.00 38.22  ? 337 LEU B C     1 
ATOM 5484  O O     . LEU F 4 300 ? 46.682  21.417  17.233  1.00 30.31  ? 337 LEU B O     1 
ATOM 5485  C CB    . LEU F 4 300 ? 44.797  22.227  19.101  1.00 23.61  ? 337 LEU B CB    1 
ATOM 5486  C CG    . LEU F 4 300 ? 44.192  21.546  20.340  1.00 22.86  ? 337 LEU B CG    1 
ATOM 5487  C CD1   . LEU F 4 300 ? 44.453  22.394  21.586  1.00 18.65  ? 337 LEU B CD1   1 
ATOM 5488  C CD2   . LEU F 4 300 ? 42.694  21.331  20.127  1.00 23.31  ? 337 LEU B CD2   1 
ATOM 5489  N N     . GLU F 4 301 ? 48.005  23.176  17.615  1.00 30.29  ? 338 GLU B N     1 
ATOM 5490  C CA    . GLU F 4 301 ? 48.785  22.907  16.420  1.00 30.07  ? 338 GLU B CA    1 
ATOM 5491  C C     . GLU F 4 301 ? 49.558  21.620  16.716  1.00 29.55  ? 338 GLU B C     1 
ATOM 5492  O O     . GLU F 4 301 ? 49.828  21.307  17.881  1.00 29.82  ? 338 GLU B O     1 
ATOM 5493  C CB    . GLU F 4 301 ? 49.761  24.054  16.130  1.00 29.06  ? 338 GLU B CB    1 
ATOM 5494  C CG    . GLU F 4 301 ? 49.154  25.276  15.449  1.00 28.82  ? 338 GLU B CG    1 
ATOM 5495  C CD    . GLU F 4 301 ? 48.334  24.916  14.226  1.00 28.37  ? 338 GLU B CD    1 
ATOM 5496  O OE1   . GLU F 4 301 ? 47.086  24.984  14.310  1.00 24.36  ? 338 GLU B OE1   1 
ATOM 5497  O OE2   . GLU F 4 301 ? 48.937  24.555  13.190  1.00 26.44  ? 338 GLU B OE2   1 
ATOM 5498  N N     . THR F 4 302 ? 49.936  20.889  15.673  1.00 15.25  ? 339 THR B N     1 
ATOM 5499  C CA    . THR F 4 302 ? 50.634  19.633  15.870  1.00 12.76  ? 339 THR B CA    1 
ATOM 5500  C C     . THR F 4 302 ? 51.779  19.423  14.911  1.00 12.50  ? 339 THR B C     1 
ATOM 5501  O O     . THR F 4 302 ? 51.755  19.903  13.777  1.00 35.01  ? 339 THR B O     1 
ATOM 5502  C CB    . THR F 4 302 ? 49.675  18.484  15.684  1.00 31.74  ? 339 THR B CB    1 
ATOM 5503  O OG1   . THR F 4 302 ? 49.213  18.487  14.330  1.00 25.91  ? 339 THR B OG1   1 
ATOM 5504  C CG2   . THR F 4 302 ? 48.488  18.637  16.608  1.00 30.46  ? 339 THR B CG2   1 
ATOM 5505  N N     . SER F 4 303 ? 52.765  18.665  15.377  1.00 12.99  ? 340 SER B N     1 
ATOM 5506  C CA    . SER F 4 303 ? 53.955  18.330  14.609  1.00 12.80  ? 340 SER B CA    1 
ATOM 5507  C C     . SER F 4 303 ? 53.621  17.243  13.595  1.00 13.60  ? 340 SER B C     1 
ATOM 5508  O O     . SER F 4 303 ? 52.544  16.649  13.645  1.00 32.69  ? 340 SER B O     1 
ATOM 5509  C CB    . SER F 4 303 ? 55.012  17.750  15.540  1.00 41.14  ? 340 SER B CB    1 
ATOM 5510  O OG    . SER F 4 303 ? 54.652  16.424  15.921  1.00 40.43  ? 340 SER B OG    1 
ATOM 5511  N N     . GLU F 4 304 ? 54.547  16.990  12.670  1.00 23.25  ? 341 GLU B N     1 
ATOM 5512  C CA    . GLU F 4 304 ? 54.348  15.905  11.732  1.00 25.25  ? 341 GLU B CA    1 
ATOM 5513  C C     . GLU F 4 304 ? 54.399  14.732  12.706  1.00 27.23  ? 341 GLU B C     1 
ATOM 5514  O O     . GLU F 4 304 ? 55.260  14.696  13.585  1.00 52.55  ? 341 GLU B O     1 
ATOM 5515  C CB    . GLU F 4 304 ? 55.516  15.807  10.758  1.00 46.70  ? 341 GLU B CB    1 
ATOM 5516  C CG    . GLU F 4 304 ? 55.406  16.716  9.551   1.00 50.32  ? 341 GLU B CG    1 
ATOM 5517  C CD    . GLU F 4 304 ? 54.259  16.341  8.618   1.00 54.63  ? 341 GLU B CD    1 
ATOM 5518  O OE1   . GLU F 4 304 ? 54.211  15.179  8.148   1.00 56.46  ? 341 GLU B OE1   1 
ATOM 5519  O OE2   . GLU F 4 304 ? 53.410  17.217  8.347   1.00 53.59  ? 341 GLU B OE2   1 
ATOM 5520  N N     . PRO F 4 305 ? 53.469  13.772  12.587  1.00 15.38  ? 342 PRO B N     1 
ATOM 5521  C CA    . PRO F 4 305 ? 53.476  12.630  13.502  1.00 16.34  ? 342 PRO B CA    1 
ATOM 5522  C C     . PRO F 4 305 ? 54.631  11.673  13.224  1.00 16.68  ? 342 PRO B C     1 
ATOM 5523  O O     . PRO F 4 305 ? 55.000  11.458  12.082  1.00 8.22   ? 342 PRO B O     1 
ATOM 5524  C CB    . PRO F 4 305 ? 52.107  12.003  13.262  1.00 37.05  ? 342 PRO B CB    1 
ATOM 5525  C CG    . PRO F 4 305 ? 51.866  12.285  11.815  1.00 34.04  ? 342 PRO B CG    1 
ATOM 5526  C CD    . PRO F 4 305 ? 52.340  13.698  11.643  1.00 33.29  ? 342 PRO B CD    1 
ATOM 5527  N N     . LYS F 4 306 ? 55.200  11.117  14.287  1.00 58.27  ? 343 LYS B N     1 
ATOM 5528  C CA    . LYS F 4 306 ? 56.313  10.183  14.182  1.00 58.02  ? 343 LYS B CA    1 
ATOM 5529  C C     . LYS F 4 306 ? 55.830  8.823   14.665  1.00 55.99  ? 343 LYS B C     1 
ATOM 5530  O O     . LYS F 4 306 ? 55.113  8.741   15.665  1.00 31.94  ? 343 LYS B O     1 
ATOM 5531  C CB    . LYS F 4 306 ? 57.452  10.641  15.077  1.00 22.28  ? 343 LYS B CB    1 
ATOM 5532  C CG    . LYS F 4 306 ? 58.832  10.388  14.530  1.00 29.43  ? 343 LYS B CG    1 
ATOM 5533  C CD    . LYS F 4 306 ? 59.305  11.568  13.683  1.00 33.34  ? 343 LYS B CD    1 
ATOM 5534  C CE    . LYS F 4 306 ? 60.825  11.587  13.577  1.00 34.33  ? 343 LYS B CE    1 
ATOM 5535  N NZ    . LYS F 4 306 ? 61.302  12.832  12.937  1.00 31.75  ? 343 LYS B NZ    1 
ATOM 5536  N N     . PRO F 4 307 ? 56.212  7.743   13.962  1.00 36.50  ? 344 PRO B N     1 
ATOM 5537  C CA    . PRO F 4 307 ? 55.825  6.370   14.308  1.00 36.41  ? 344 PRO B CA    1 
ATOM 5538  C C     . PRO F 4 307 ? 56.294  5.908   15.696  1.00 35.01  ? 344 PRO B C     1 
ATOM 5539  O O     . PRO F 4 307 ? 57.331  6.354   16.198  1.00 36.84  ? 344 PRO B O     1 
ATOM 5540  C CB    . PRO F 4 307 ? 56.474  5.548   13.196  1.00 20.00  ? 344 PRO B CB    1 
ATOM 5541  C CG    . PRO F 4 307 ? 56.458  6.481   12.034  1.00 22.18  ? 344 PRO B CG    1 
ATOM 5542  C CD    . PRO F 4 307 ? 56.919  7.763   12.669  1.00 22.65  ? 344 PRO B CD    1 
ATOM 5543  N N     . PHE F 4 308 ? 55.526  5.005   16.303  1.00 6.85   ? 345 PHE B N     1 
ATOM 5544  C CA    . PHE F 4 308 ? 55.838  4.455   17.622  1.00 6.85   ? 345 PHE B CA    1 
ATOM 5545  C C     . PHE F 4 308 ? 55.272  3.048   17.634  1.00 6.85   ? 345 PHE B C     1 
ATOM 5546  O O     . PHE F 4 308 ? 54.129  2.852   17.256  1.00 16.61  ? 345 PHE B O     1 
ATOM 5547  C CB    . PHE F 4 308 ? 55.176  5.286   18.710  1.00 19.08  ? 345 PHE B CB    1 
ATOM 5548  C CG    . PHE F 4 308 ? 55.698  5.011   20.083  1.00 16.15  ? 345 PHE B CG    1 
ATOM 5549  C CD1   . PHE F 4 308 ? 57.057  4.944   20.319  1.00 14.66  ? 345 PHE B CD1   1 
ATOM 5550  C CD2   . PHE F 4 308 ? 54.838  4.826   21.143  1.00 17.58  ? 345 PHE B CD2   1 
ATOM 5551  C CE1   . PHE F 4 308 ? 57.547  4.693   21.596  1.00 15.31  ? 345 PHE B CE1   1 
ATOM 5552  C CE2   . PHE F 4 308 ? 55.319  4.578   22.417  1.00 18.76  ? 345 PHE B CE2   1 
ATOM 5553  C CZ    . PHE F 4 308 ? 56.671  4.507   22.643  1.00 15.75  ? 345 PHE B CZ    1 
ATOM 5554  N N     . LEU F 4 309 ? 56.067  2.067   18.042  1.00 18.89  ? 346 LEU B N     1 
ATOM 5555  C CA    . LEU F 4 309 ? 55.589  0.689   18.051  1.00 18.89  ? 346 LEU B CA    1 
ATOM 5556  C C     . LEU F 4 309 ? 55.436  0.078   19.435  1.00 18.89  ? 346 LEU B C     1 
ATOM 5557  O O     . LEU F 4 309 ? 56.397  -0.038  20.193  1.00 41.93  ? 346 LEU B O     1 
ATOM 5558  C CB    . LEU F 4 309 ? 56.502  -0.209  17.219  1.00 37.03  ? 346 LEU B CB    1 
ATOM 5559  C CG    . LEU F 4 309 ? 56.106  -1.691  17.232  1.00 43.00  ? 346 LEU B CG    1 
ATOM 5560  C CD1   . LEU F 4 309 ? 54.700  -1.846  16.687  1.00 44.60  ? 346 LEU B CD1   1 
ATOM 5561  C CD2   . LEU F 4 309 ? 57.074  -2.507  16.398  1.00 46.87  ? 346 LEU B CD2   1 
ATOM 5562  N N     . TYR F 4 310 ? 54.212  -0.324  19.743  1.00 10.95  ? 347 TYR B N     1 
ATOM 5563  C CA    . TYR F 4 310 ? 53.897  -0.938  21.016  1.00 13.45  ? 347 TYR B CA    1 
ATOM 5564  C C     . TYR F 4 310 ? 53.970  -2.442  20.874  1.00 13.17  ? 347 TYR B C     1 
ATOM 5565  O O     . TYR F 4 310 ? 53.407  -3.007  19.940  1.00 14.20  ? 347 TYR B O     1 
ATOM 5566  C CB    . TYR F 4 310 ? 52.479  -0.597  21.421  1.00 11.43  ? 347 TYR B CB    1 
ATOM 5567  C CG    . TYR F 4 310 ? 52.266  0.737   22.060  1.00 12.09  ? 347 TYR B CG    1 
ATOM 5568  C CD1   . TYR F 4 310 ? 52.901  1.054   23.242  1.00 15.42  ? 347 TYR B CD1   1 
ATOM 5569  C CD2   . TYR F 4 310 ? 51.288  1.618   21.574  1.00 15.05  ? 347 TYR B CD2   1 
ATOM 5570  C CE1   . TYR F 4 310 ? 52.556  2.198   23.940  1.00 18.37  ? 347 TYR B CE1   1 
ATOM 5571  C CE2   . TYR F 4 310 ? 50.942  2.759   22.268  1.00 13.48  ? 347 TYR B CE2   1 
ATOM 5572  C CZ    . TYR F 4 310 ? 51.576  3.032   23.454  1.00 16.87  ? 347 TYR B CZ    1 
ATOM 5573  O OH    . TYR F 4 310 ? 51.198  4.092   24.218  1.00 17.11  ? 347 TYR B OH    1 
ATOM 5574  N N     . TYR F 4 311 ? 54.657  -3.083  21.812  1.00 46.81  ? 348 TYR B N     1 
ATOM 5575  C CA    . TYR F 4 311 ? 54.793  -4.537  21.831  1.00 45.92  ? 348 TYR B CA    1 
ATOM 5576  C C     . TYR F 4 311 ? 54.247  -5.020  23.179  1.00 42.66  ? 348 TYR B C     1 
ATOM 5577  O O     . TYR F 4 311 ? 54.313  -4.297  24.191  1.00 35.79  ? 348 TYR B O     1 
ATOM 5578  C CB    . TYR F 4 311 ? 56.262  -4.955  21.620  1.00 36.62  ? 348 TYR B CB    1 
ATOM 5579  C CG    . TYR F 4 311 ? 57.238  -4.240  22.513  1.00 37.22  ? 348 TYR B CG    1 
ATOM 5580  C CD1   . TYR F 4 311 ? 57.282  -4.505  23.883  1.00 38.03  ? 348 TYR B CD1   1 
ATOM 5581  C CD2   . TYR F 4 311 ? 58.069  -3.247  22.008  1.00 36.10  ? 348 TYR B CD2   1 
ATOM 5582  C CE1   . TYR F 4 311 ? 58.120  -3.794  24.717  1.00 38.03  ? 348 TYR B CE1   1 
ATOM 5583  C CE2   . TYR F 4 311 ? 58.908  -2.531  22.840  1.00 34.37  ? 348 TYR B CE2   1 
ATOM 5584  C CZ    . TYR F 4 311 ? 58.924  -2.806  24.190  1.00 36.65  ? 348 TYR B CZ    1 
ATOM 5585  O OH    . TYR F 4 311 ? 59.727  -2.082  25.033  1.00 40.00  ? 348 TYR B OH    1 
ATOM 5586  N N     . PRO F 4 312 ? 53.659  -6.234  23.195  1.00 3.99   ? 349 PRO B N     1 
ATOM 5587  C CA    . PRO F 4 312 ? 53.074  -6.835  24.399  1.00 2.34   ? 349 PRO B CA    1 
ATOM 5588  C C     . PRO F 4 312 ? 54.008  -7.077  25.568  1.00 2.26   ? 349 PRO B C     1 
ATOM 5589  O O     . PRO F 4 312 ? 55.216  -7.071  25.406  1.00 2.00   ? 349 PRO B O     1 
ATOM 5590  C CB    . PRO F 4 312 ? 52.414  -8.112  23.868  1.00 9.79   ? 349 PRO B CB    1 
ATOM 5591  C CG    . PRO F 4 312 ? 53.190  -8.422  22.629  1.00 9.79   ? 349 PRO B CG    1 
ATOM 5592  C CD    . PRO F 4 312 ? 53.414  -7.079  22.013  1.00 9.79   ? 349 PRO B CD    1 
ATOM 5593  N N     . GLU F 4 313 ? 53.399  -7.280  26.733  1.00 13.38  ? 350 GLU B N     1 
ATOM 5594  C CA    . GLU F 4 313 ? 54.060  -7.511  28.014  1.00 14.21  ? 350 GLU B CA    1 
ATOM 5595  C C     . GLU F 4 313 ? 54.547  -8.969  28.246  1.00 16.05  ? 350 GLU B C     1 
ATOM 5596  O O     . GLU F 4 313 ? 54.309  -9.537  29.334  1.00 32.59  ? 350 GLU B O     1 
ATOM 5597  C CB    . GLU F 4 313 ? 53.090  -7.088  29.121  1.00 44.50  ? 350 GLU B CB    1 
ATOM 5598  C CG    . GLU F 4 313 ? 53.632  -7.115  30.531  1.00 49.07  ? 350 GLU B CG    1 
ATOM 5599  C CD    . GLU F 4 313 ? 52.564  -6.748  31.554  1.00 51.77  ? 350 GLU B CD    1 
ATOM 5600  O OE1   . GLU F 4 313 ? 51.475  -7.360  31.525  1.00 50.20  ? 350 GLU B OE1   1 
ATOM 5601  O OE2   . GLU F 4 313 ? 52.811  -5.856  32.394  1.00 53.56  ? 350 GLU B OE2   1 
ATOM 5602  O OXT   . GLU F 4 313 ? 55.197  -9.536  27.339  1.00 47.04  ? 350 GLU B OXT   1 
ATOM 5603  N N     . ALA G 3 2   ? 99.195  -0.135  46.361  1.00 79.34  ? 19  ALA E N     1 
ATOM 5604  C CA    . ALA G 3 2   ? 99.054  0.815   45.216  1.00 78.55  ? 19  ALA E CA    1 
ATOM 5605  C C     . ALA G 3 2   ? 99.003  2.272   45.688  1.00 78.49  ? 19  ALA E C     1 
ATOM 5606  O O     . ALA G 3 2   ? 98.016  2.713   46.295  1.00 55.19  ? 19  ALA E O     1 
ATOM 5607  C CB    . ALA G 3 2   ? 97.802  0.474   44.409  1.00 52.83  ? 19  ALA E CB    1 
ATOM 5608  N N     . TYR G 3 3   ? 100.078 3.009   45.408  1.00 74.73  ? 20  TYR E N     1 
ATOM 5609  C CA    . TYR G 3 3   ? 100.185 4.419   45.791  1.00 71.94  ? 20  TYR E CA    1 
ATOM 5610  C C     . TYR G 3 3   ? 101.495 5.054   45.313  1.00 69.46  ? 20  TYR E C     1 
ATOM 5611  O O     . TYR G 3 3   ? 102.580 4.758   45.826  1.00 69.55  ? 20  TYR E O     1 
ATOM 5612  C CB    . TYR G 3 3   ? 100.051 4.555   47.315  1.00 78.50  ? 20  TYR E CB    1 
ATOM 5613  C CG    . TYR G 3 3   ? 100.265 5.956   47.891  1.00 76.35  ? 20  TYR E CG    1 
ATOM 5614  C CD1   . TYR G 3 3   ? 101.542 6.527   47.961  1.00 73.36  ? 20  TYR E CD1   1 
ATOM 5615  C CD2   . TYR G 3 3   ? 99.201  6.673   48.446  1.00 75.58  ? 20  TYR E CD2   1 
ATOM 5616  C CE1   . TYR G 3 3   ? 101.748 7.757   48.573  1.00 73.30  ? 20  TYR E CE1   1 
ATOM 5617  C CE2   . TYR G 3 3   ? 99.404  7.906   49.063  1.00 73.30  ? 20  TYR E CE2   1 
ATOM 5618  C CZ    . TYR G 3 3   ? 100.677 8.435   49.123  1.00 73.47  ? 20  TYR E CZ    1 
ATOM 5619  O OH    . TYR G 3 3   ? 100.883 9.632   49.762  1.00 72.08  ? 20  TYR E OH    1 
ATOM 5620  N N     . VAL G 3 4   ? 101.379 5.931   44.322  1.00 76.58  ? 21  VAL E N     1 
ATOM 5621  C CA    . VAL G 3 4   ? 102.531 6.629   43.767  1.00 73.70  ? 21  VAL E CA    1 
ATOM 5622  C C     . VAL G 3 4   ? 102.474 8.053   44.329  1.00 71.91  ? 21  VAL E C     1 
ATOM 5623  O O     . VAL G 3 4   ? 101.738 8.310   45.287  1.00 58.01  ? 21  VAL E O     1 
ATOM 5624  C CB    . VAL G 3 4   ? 102.465 6.651   42.204  1.00 52.65  ? 21  VAL E CB    1 
ATOM 5625  C CG1   . VAL G 3 4   ? 103.790 7.100   41.621  1.00 54.44  ? 21  VAL E CG1   1 
ATOM 5626  C CG2   . VAL G 3 4   ? 102.115 5.264   41.671  1.00 49.80  ? 21  VAL E CG2   1 
ATOM 5627  N N     . GLU G 3 5   ? 103.253 8.959   43.743  1.00 68.26  ? 22  GLU E N     1 
ATOM 5628  C CA    . GLU G 3 5   ? 103.310 10.366  44.149  1.00 70.24  ? 22  GLU E CA    1 
ATOM 5629  C C     . GLU G 3 5   ? 104.686 10.956  43.867  1.00 72.87  ? 22  GLU E C     1 
ATOM 5630  O O     . GLU G 3 5   ? 105.539 11.038  44.756  1.00 65.16  ? 22  GLU E O     1 
ATOM 5631  C CB    . GLU G 3 5   ? 102.995 10.544  45.635  1.00 56.74  ? 22  GLU E CB    1 
ATOM 5632  C CG    . GLU G 3 5   ? 103.030 11.995  46.078  1.00 50.39  ? 22  GLU E CG    1 
ATOM 5633  C CD    . GLU G 3 5   ? 102.716 12.157  47.540  1.00 47.59  ? 22  GLU E CD    1 
ATOM 5634  O OE1   . GLU G 3 5   ? 102.765 13.299  48.043  1.00 42.57  ? 22  GLU E OE1   1 
ATOM 5635  O OE2   . GLU G 3 5   ? 102.418 11.133  48.190  1.00 44.81  ? 22  GLU E OE2   1 
ATOM 5636  N N     . ILE G 3 6   ? 104.891 11.373  42.623  1.00 83.03  ? 23  ILE E N     1 
ATOM 5637  C CA    . ILE G 3 6   ? 106.157 11.956  42.202  1.00 84.40  ? 23  ILE E CA    1 
ATOM 5638  C C     . ILE G 3 6   ? 106.603 13.091  43.132  1.00 86.35  ? 23  ILE E C     1 
ATOM 5639  O O     . ILE G 3 6   ? 105.926 14.115  43.266  1.00 48.76  ? 23  ILE E O     1 
ATOM 5640  C CB    . ILE G 3 6   ? 106.049 12.489  40.771  1.00 34.49  ? 23  ILE E CB    1 
ATOM 5641  C CG1   . ILE G 3 6   ? 105.218 11.529  39.928  1.00 33.89  ? 23  ILE E CG1   1 
ATOM 5642  C CG2   . ILE G 3 6   ? 107.421 12.623  40.165  1.00 31.70  ? 23  ILE E CG2   1 
ATOM 5643  C CD1   . ILE G 3 6   ? 104.803 12.098  38.584  1.00 32.61  ? 23  ILE E CD1   1 
ATOM 5644  N N     . ILE G 3 7   ? 107.752 12.890  43.770  1.00 80.67  ? 24  ILE E N     1 
ATOM 5645  C CA    . ILE G 3 7   ? 108.326 13.864  44.695  1.00 84.06  ? 24  ILE E CA    1 
ATOM 5646  C C     . ILE G 3 7   ? 109.419 14.727  44.044  1.00 85.04  ? 24  ILE E C     1 
ATOM 5647  O O     . ILE G 3 7   ? 109.869 15.723  44.620  1.00 58.12  ? 24  ILE E O     1 
ATOM 5648  C CB    . ILE G 3 7   ? 108.892 13.141  45.930  1.00 57.01  ? 24  ILE E CB    1 
ATOM 5649  C CG1   . ILE G 3 7   ? 109.430 11.765  45.519  1.00 58.20  ? 24  ILE E CG1   1 
ATOM 5650  C CG2   . ILE G 3 7   ? 107.806 12.990  46.979  1.00 56.98  ? 24  ILE E CG2   1 
ATOM 5651  C CD1   . ILE G 3 7   ? 110.289 11.092  46.562  1.00 62.67  ? 24  ILE E CD1   1 
ATOM 5652  N N     . GLU G 3 8   ? 109.837 14.328  42.844  1.00 65.79  ? 25  GLU E N     1 
ATOM 5653  C CA    . GLU G 3 8   ? 110.848 15.044  42.066  1.00 64.75  ? 25  GLU E CA    1 
ATOM 5654  C C     . GLU G 3 8   ? 110.305 15.406  40.681  1.00 63.36  ? 25  GLU E C     1 
ATOM 5655  O O     . GLU G 3 8   ? 110.718 14.801  39.685  1.00 82.07  ? 25  GLU E O     1 
ATOM 5656  C CB    . GLU G 3 8   ? 112.106 14.193  41.864  1.00 92.17  ? 25  GLU E CB    1 
ATOM 5657  C CG    . GLU G 3 8   ? 113.083 14.193  43.017  1.00 93.62  ? 25  GLU E CG    1 
ATOM 5658  C CD    . GLU G 3 8   ? 112.600 13.368  44.182  1.00 94.09  ? 25  GLU E CD    1 
ATOM 5659  O OE1   . GLU G 3 8   ? 113.344 13.246  45.181  1.00 92.41  ? 25  GLU E OE1   1 
ATOM 5660  O OE2   . GLU G 3 8   ? 111.477 12.837  44.094  1.00 95.46  ? 25  GLU E OE2   1 
ATOM 5661  N N     . GLN G 3 9   ? 109.391 16.379  40.619  1.00 50.61  ? 26  GLN E N     1 
ATOM 5662  C CA    . GLN G 3 9   ? 108.808 16.817  39.349  1.00 49.53  ? 26  GLN E CA    1 
ATOM 5663  C C     . GLN G 3 9   ? 109.904 17.460  38.498  1.00 51.10  ? 26  GLN E C     1 
ATOM 5664  O O     . GLN G 3 9   ? 110.743 18.206  39.010  1.00 75.91  ? 26  GLN E O     1 
ATOM 5665  C CB    . GLN G 3 9   ? 107.671 17.818  39.600  1.00 84.43  ? 26  GLN E CB    1 
ATOM 5666  C CG    . GLN G 3 9   ? 106.698 17.373  40.703  1.00 80.76  ? 26  GLN E CG    1 
ATOM 5667  C CD    . GLN G 3 9   ? 105.353 18.103  40.680  1.00 78.88  ? 26  GLN E CD    1 
ATOM 5668  O OE1   . GLN G 3 9   ? 104.576 17.959  39.734  1.00 77.28  ? 26  GLN E OE1   1 
ATOM 5669  N NE2   . GLN G 3 9   ? 105.071 18.878  41.730  1.00 76.30  ? 26  GLN E NE2   1 
ATOM 5670  N N     . PRO G 3 10  ? 109.920 17.170  37.182  1.00 81.41  ? 27  PRO E N     1 
ATOM 5671  C CA    . PRO G 3 10  ? 110.947 17.745  36.301  1.00 81.98  ? 27  PRO E CA    1 
ATOM 5672  C C     . PRO G 3 10  ? 110.766 19.253  36.159  1.00 83.70  ? 27  PRO E C     1 
ATOM 5673  O O     . PRO G 3 10  ? 109.731 19.790  36.552  1.00 84.84  ? 27  PRO E O     1 
ATOM 5674  C CB    . PRO G 3 10  ? 110.728 16.993  34.990  1.00 65.29  ? 27  PRO E CB    1 
ATOM 5675  C CG    . PRO G 3 10  ? 109.237 16.789  34.977  1.00 66.46  ? 27  PRO E CG    1 
ATOM 5676  C CD    . PRO G 3 10  ? 108.938 16.382  36.408  1.00 65.69  ? 27  PRO E CD    1 
ATOM 5677  N N     . LYS G 3 11  ? 111.761 19.946  35.616  1.00 57.23  ? 28  LYS E N     1 
ATOM 5678  C CA    . LYS G 3 11  ? 111.619 21.389  35.460  1.00 54.48  ? 28  LYS E CA    1 
ATOM 5679  C C     . LYS G 3 11  ? 110.542 21.656  34.397  1.00 51.94  ? 28  LYS E C     1 
ATOM 5680  O O     . LYS G 3 11  ? 110.689 21.234  33.252  1.00 74.59  ? 28  LYS E O     1 
ATOM 5681  C CB    . LYS G 3 11  ? 112.958 22.021  35.045  1.00 85.53  ? 28  LYS E CB    1 
ATOM 5682  C CG    . LYS G 3 11  ? 113.060 23.525  35.354  1.00 83.17  ? 28  LYS E CG    1 
ATOM 5683  C CD    . LYS G 3 11  ? 114.385 24.131  34.869  1.00 80.11  ? 28  LYS E CD    1 
ATOM 5684  C CE    . LYS G 3 11  ? 114.505 25.618  35.239  1.00 75.42  ? 28  LYS E CE    1 
ATOM 5685  N NZ    . LYS G 3 11  ? 115.767 26.230  34.720  1.00 77.23  ? 28  LYS E NZ    1 
ATOM 5686  N N     . GLN G 3 12  ? 109.466 22.346  34.773  1.00 41.74  ? 29  GLN E N     1 
ATOM 5687  C CA    . GLN G 3 12  ? 108.389 22.620  33.825  1.00 40.59  ? 29  GLN E CA    1 
ATOM 5688  C C     . GLN G 3 12  ? 108.909 23.136  32.482  1.00 37.97  ? 29  GLN E C     1 
ATOM 5689  O O     . GLN G 3 12  ? 109.048 22.375  31.514  1.00 54.79  ? 29  GLN E O     1 
ATOM 5690  C CB    . GLN G 3 12  ? 107.386 23.622  34.417  1.00 58.87  ? 29  GLN E CB    1 
ATOM 5691  C CG    . GLN G 3 12  ? 106.154 22.980  35.060  1.00 59.17  ? 29  GLN E CG    1 
ATOM 5692  C CD    . GLN G 3 12  ? 105.084 23.996  35.452  1.00 58.96  ? 29  GLN E CD    1 
ATOM 5693  O OE1   . GLN G 3 12  ? 104.052 23.643  36.032  1.00 62.42  ? 29  GLN E OE1   1 
ATOM 5694  N NE2   . GLN G 3 12  ? 105.325 25.263  35.133  1.00 56.66  ? 29  GLN E NE2   1 
ATOM 5695  N N     . ARG G 3 13  ? 109.176 24.436  32.422  1.00 99.05  ? 30  ARG E N     1 
ATOM 5696  C CA    . ARG G 3 13  ? 109.696 25.041  31.208  1.00 98.59  ? 30  ARG E CA    1 
ATOM 5697  C C     . ARG G 3 13  ? 111.182 25.315  31.421  1.00 98.17  ? 30  ARG E C     1 
ATOM 5698  O O     . ARG G 3 13  ? 111.572 25.981  32.384  1.00 51.11  ? 30  ARG E O     1 
ATOM 5699  C CB    . ARG G 3 13  ? 108.925 26.335  30.873  1.00 44.94  ? 30  ARG E CB    1 
ATOM 5700  C CG    . ARG G 3 13  ? 107.573 26.097  30.148  1.00 37.89  ? 30  ARG E CG    1 
ATOM 5701  C CD    . ARG G 3 13  ? 106.665 27.322  30.194  1.00 33.98  ? 30  ARG E CD    1 
ATOM 5702  N NE    . ARG G 3 13  ? 106.699 27.937  31.520  1.00 34.62  ? 30  ARG E NE    1 
ATOM 5703  C CZ    . ARG G 3 13  ? 106.235 27.376  32.636  1.00 34.13  ? 30  ARG E CZ    1 
ATOM 5704  N NH1   . ARG G 3 13  ? 105.676 26.177  32.605  1.00 34.15  ? 30  ARG E NH1   1 
ATOM 5705  N NH2   . ARG G 3 13  ? 106.362 28.001  33.796  1.00 32.08  ? 30  ARG E NH2   1 
ATOM 5706  N N     . GLY G 3 14  ? 112.006 24.762  30.532  1.00 63.73  ? 31  GLY E N     1 
ATOM 5707  C CA    . GLY G 3 14  ? 113.444 24.946  30.624  1.00 64.52  ? 31  GLY E CA    1 
ATOM 5708  C C     . GLY G 3 14  ? 114.218 23.686  30.276  1.00 64.41  ? 31  GLY E C     1 
ATOM 5709  O O     . GLY G 3 14  ? 115.168 23.322  30.975  1.00 72.45  ? 31  GLY E O     1 
ATOM 5710  N N     . MET G 3 15  ? 113.825 23.028  29.187  1.00 69.53  ? 32  MET E N     1 
ATOM 5711  C CA    . MET G 3 15  ? 114.474 21.792  28.766  1.00 69.93  ? 32  MET E CA    1 
ATOM 5712  C C     . MET G 3 15  ? 114.149 21.478  27.300  1.00 70.81  ? 32  MET E C     1 
ATOM 5713  O O     . MET G 3 15  ? 112.989 21.299  26.938  1.00 75.23  ? 32  MET E O     1 
ATOM 5714  C CB    . MET G 3 15  ? 114.000 20.653  29.676  1.00 69.36  ? 32  MET E CB    1 
ATOM 5715  C CG    . MET G 3 15  ? 114.943 19.467  29.773  1.00 73.68  ? 32  MET E CG    1 
ATOM 5716  S SD    . MET G 3 15  ? 114.917 18.358  28.352  1.00 79.33  ? 32  MET E SD    1 
ATOM 5717  C CE    . MET G 3 15  ? 113.911 17.048  28.999  1.00 78.42  ? 32  MET E CE    1 
ATOM 5718  N N     . ARG G 3 16  ? 115.172 21.423  26.456  1.00 39.83  ? 33  ARG E N     1 
ATOM 5719  C CA    . ARG G 3 16  ? 114.967 21.121  25.042  1.00 41.68  ? 33  ARG E CA    1 
ATOM 5720  C C     . ARG G 3 16  ? 114.967 19.610  24.813  1.00 43.08  ? 33  ARG E C     1 
ATOM 5721  O O     . ARG G 3 16  ? 115.688 18.869  25.486  1.00 55.47  ? 33  ARG E O     1 
ATOM 5722  C CB    . ARG G 3 16  ? 116.059 21.773  24.184  1.00 37.03  ? 33  ARG E CB    1 
ATOM 5723  C CG    . ARG G 3 16  ? 117.347 22.094  24.949  1.00 31.18  ? 33  ARG E CG    1 
ATOM 5724  C CD    . ARG G 3 16  ? 118.601 21.455  24.343  1.00 27.38  ? 33  ARG E CD    1 
ATOM 5725  N NE    . ARG G 3 16  ? 119.089 22.069  23.098  1.00 22.65  ? 33  ARG E NE    1 
ATOM 5726  C CZ    . ARG G 3 16  ? 118.624 21.783  21.883  1.00 25.27  ? 33  ARG E CZ    1 
ATOM 5727  N NH1   . ARG G 3 16  ? 117.642 20.890  21.735  1.00 23.93  ? 33  ARG E NH1   1 
ATOM 5728  N NH2   . ARG G 3 16  ? 119.169 22.367  20.817  1.00 22.97  ? 33  ARG E NH2   1 
ATOM 5729  N N     . PHE G 3 17  ? 114.154 19.165  23.855  1.00 90.90  ? 34  PHE E N     1 
ATOM 5730  C CA    . PHE G 3 17  ? 114.035 17.749  23.517  1.00 91.23  ? 34  PHE E CA    1 
ATOM 5731  C C     . PHE G 3 17  ? 115.291 17.199  22.846  1.00 91.31  ? 34  PHE E C     1 
ATOM 5732  O O     . PHE G 3 17  ? 116.407 17.393  23.337  1.00 69.02  ? 34  PHE E O     1 
ATOM 5733  C CB    . PHE G 3 17  ? 112.828 17.519  22.596  1.00 61.93  ? 34  PHE E CB    1 
ATOM 5734  C CG    . PHE G 3 17  ? 111.490 17.659  23.283  1.00 61.46  ? 34  PHE E CG    1 
ATOM 5735  C CD1   . PHE G 3 17  ? 110.308 17.516  22.556  1.00 59.59  ? 34  PHE E CD1   1 
ATOM 5736  C CD2   . PHE G 3 17  ? 111.406 17.910  24.654  1.00 62.88  ? 34  PHE E CD2   1 
ATOM 5737  C CE1   . PHE G 3 17  ? 109.061 17.609  23.182  1.00 58.06  ? 34  PHE E CE1   1 
ATOM 5738  C CE2   . PHE G 3 17  ? 110.161 18.004  25.292  1.00 63.19  ? 34  PHE E CE2   1 
ATOM 5739  C CZ    . PHE G 3 17  ? 108.987 17.856  24.551  1.00 60.22  ? 34  PHE E CZ    1 
ATOM 5740  N N     . ARG G 3 18  ? 115.098 16.517  21.718  1.00 37.47  ? 35  ARG E N     1 
ATOM 5741  C CA    . ARG G 3 18  ? 116.211 15.913  20.980  1.00 39.00  ? 35  ARG E CA    1 
ATOM 5742  C C     . ARG G 3 18  ? 115.674 15.251  19.705  1.00 41.13  ? 35  ARG E C     1 
ATOM 5743  O O     . ARG G 3 18  ? 114.462 15.145  19.530  1.00 71.04  ? 35  ARG E O     1 
ATOM 5744  C CB    . ARG G 3 18  ? 116.893 14.874  21.871  1.00 61.54  ? 35  ARG E CB    1 
ATOM 5745  C CG    . ARG G 3 18  ? 118.296 14.493  21.465  1.00 54.98  ? 35  ARG E CG    1 
ATOM 5746  C CD    . ARG G 3 18  ? 119.321 15.497  21.949  1.00 50.07  ? 35  ARG E CD    1 
ATOM 5747  N NE    . ARG G 3 18  ? 119.285 16.729  21.178  1.00 44.03  ? 35  ARG E NE    1 
ATOM 5748  C CZ    . ARG G 3 18  ? 120.049 17.791  21.423  1.00 42.34  ? 35  ARG E CZ    1 
ATOM 5749  N NH1   . ARG G 3 18  ? 120.921 17.778  22.426  1.00 37.86  ? 35  ARG E NH1   1 
ATOM 5750  N NH2   . ARG G 3 18  ? 119.933 18.874  20.667  1.00 38.07  ? 35  ARG E NH2   1 
ATOM 5751  N N     . TYR G 3 19  ? 116.567 14.827  18.815  1.00 28.74  ? 36  TYR E N     1 
ATOM 5752  C CA    . TYR G 3 19  ? 116.167 14.179  17.560  1.00 32.87  ? 36  TYR E CA    1 
ATOM 5753  C C     . TYR G 3 19  ? 116.958 12.894  17.340  1.00 32.78  ? 36  TYR E C     1 
ATOM 5754  O O     . TYR G 3 19  ? 118.004 12.690  17.951  1.00 67.79  ? 36  TYR E O     1 
ATOM 5755  C CB    . TYR G 3 19  ? 116.374 15.119  16.356  1.00 64.73  ? 36  TYR E CB    1 
ATOM 5756  C CG    . TYR G 3 19  ? 115.176 15.995  16.025  1.00 69.69  ? 36  TYR E CG    1 
ATOM 5757  C CD1   . TYR G 3 19  ? 114.649 16.879  16.966  1.00 70.24  ? 36  TYR E CD1   1 
ATOM 5758  C CD2   . TYR G 3 19  ? 114.574 15.947  14.762  1.00 73.00  ? 36  TYR E CD2   1 
ATOM 5759  C CE1   . TYR G 3 19  ? 113.564 17.688  16.665  1.00 70.79  ? 36  TYR E CE1   1 
ATOM 5760  C CE2   . TYR G 3 19  ? 113.480 16.756  14.453  1.00 72.90  ? 36  TYR E CE2   1 
ATOM 5761  C CZ    . TYR G 3 19  ? 112.987 17.624  15.410  1.00 72.03  ? 36  TYR E CZ    1 
ATOM 5762  O OH    . TYR G 3 19  ? 111.920 18.441  15.122  1.00 70.28  ? 36  TYR E OH    1 
ATOM 5763  N N     . LYS G 3 20  ? 116.460 12.027  16.466  1.00 68.83  ? 37  LYS E N     1 
ATOM 5764  C CA    . LYS G 3 20  ? 117.155 10.774  16.209  1.00 68.45  ? 37  LYS E CA    1 
ATOM 5765  C C     . LYS G 3 20  ? 118.571 11.101  15.761  1.00 69.21  ? 37  LYS E C     1 
ATOM 5766  O O     . LYS G 3 20  ? 119.532 10.885  16.502  1.00 73.91  ? 37  LYS E O     1 
ATOM 5767  C CB    . LYS G 3 20  ? 116.440 9.962   15.124  1.00 69.76  ? 37  LYS E CB    1 
ATOM 5768  C CG    . LYS G 3 20  ? 116.785 8.473   15.129  1.00 67.99  ? 37  LYS E CG    1 
ATOM 5769  C CD    . LYS G 3 20  ? 116.239 7.767   16.386  1.00 67.67  ? 37  LYS E CD    1 
ATOM 5770  C CE    . LYS G 3 20  ? 116.506 6.248   16.403  1.00 66.52  ? 37  LYS E CE    1 
ATOM 5771  N NZ    . LYS G 3 20  ? 115.877 5.548   17.577  1.00 64.83  ? 37  LYS E NZ    1 
ATOM 5772  N N     . CYS G 3 21  ? 118.687 11.643  14.551  1.00 88.37  ? 38  CYS E N     1 
ATOM 5773  C CA    . CYS G 3 21  ? 119.977 12.008  13.965  1.00 89.15  ? 38  CYS E CA    1 
ATOM 5774  C C     . CYS G 3 21  ? 120.901 12.761  14.915  1.00 88.90  ? 38  CYS E C     1 
ATOM 5775  O O     . CYS G 3 21  ? 122.072 12.979  14.595  1.00 81.43  ? 38  CYS E O     1 
ATOM 5776  C CB    . CYS G 3 21  ? 119.759 12.874  12.724  1.00 83.42  ? 38  CYS E CB    1 
ATOM 5777  S SG    . CYS G 3 21  ? 118.948 14.454  13.078  1.00 83.29  ? 38  CYS E SG    1 
ATOM 5778  N N     . GLU G 3 22  ? 120.372 13.153  16.074  1.00 92.49  ? 39  GLU E N     1 
ATOM 5779  C CA    . GLU G 3 22  ? 121.135 13.910  17.065  1.00 92.33  ? 39  GLU E CA    1 
ATOM 5780  C C     . GLU G 3 22  ? 121.824 13.120  18.181  1.00 92.89  ? 39  GLU E C     1 
ATOM 5781  O O     . GLU G 3 22  ? 121.539 11.941  18.417  1.00 65.66  ? 39  GLU E O     1 
ATOM 5782  C CB    . GLU G 3 22  ? 120.241 14.985  17.696  1.00 59.67  ? 39  GLU E CB    1 
ATOM 5783  C CG    . GLU G 3 22  ? 119.881 16.122  16.755  1.00 62.53  ? 39  GLU E CG    1 
ATOM 5784  C CD    . GLU G 3 22  ? 118.972 17.138  17.406  1.00 62.91  ? 39  GLU E CD    1 
ATOM 5785  O OE1   . GLU G 3 22  ? 118.668 18.172  16.779  1.00 64.72  ? 39  GLU E OE1   1 
ATOM 5786  O OE2   . GLU G 3 22  ? 118.559 16.898  18.555  1.00 61.02  ? 39  GLU E OE2   1 
ATOM 5787  N N     . GLY G 3 23  ? 122.732 13.813  18.866  1.00 103.36 ? 40  GLY E N     1 
ATOM 5788  C CA    . GLY G 3 23  ? 123.493 13.230  19.954  1.00 100.56 ? 40  GLY E CA    1 
ATOM 5789  C C     . GLY G 3 23  ? 122.706 12.454  20.992  1.00 99.63  ? 40  GLY E C     1 
ATOM 5790  O O     . GLY G 3 23  ? 122.090 13.020  21.899  1.00 38.32  ? 40  GLY E O     1 
ATOM 5791  N N     . ARG G 3 24  ? 122.741 11.136  20.859  1.00 93.75  ? 41  ARG E N     1 
ATOM 5792  C CA    . ARG G 3 24  ? 122.051 10.263  21.786  1.00 92.94  ? 41  ARG E CA    1 
ATOM 5793  C C     . ARG G 3 24  ? 122.907 10.182  23.062  1.00 93.48  ? 41  ARG E C     1 
ATOM 5794  O O     . ARG G 3 24  ? 123.868 10.947  23.221  1.00 63.35  ? 41  ARG E O     1 
ATOM 5795  C CB    . ARG G 3 24  ? 121.874 8.879   21.142  1.00 57.12  ? 41  ARG E CB    1 
ATOM 5796  C CG    . ARG G 3 24  ? 120.780 8.039   21.774  1.00 56.60  ? 41  ARG E CG    1 
ATOM 5797  C CD    . ARG G 3 24  ? 120.729 6.637   21.195  1.00 58.31  ? 41  ARG E CD    1 
ATOM 5798  N NE    . ARG G 3 24  ? 119.878 5.762   21.995  1.00 57.11  ? 41  ARG E NE    1 
ATOM 5799  C CZ    . ARG G 3 24  ? 120.032 5.569   23.304  1.00 53.42  ? 41  ARG E CZ    1 
ATOM 5800  N NH1   . ARG G 3 24  ? 119.212 4.756   23.957  1.00 50.56  ? 41  ARG E NH1   1 
ATOM 5801  N NH2   . ARG G 3 24  ? 121.004 6.192   23.965  1.00 51.09  ? 41  ARG E NH2   1 
ATOM 5802  N N     . SER G 3 25  ? 122.556 9.265   23.962  1.00 79.82  ? 42  SER E N     1 
ATOM 5803  C CA    . SER G 3 25  ? 123.284 9.081   25.217  1.00 80.65  ? 42  SER E CA    1 
ATOM 5804  C C     . SER G 3 25  ? 123.289 10.341  26.075  1.00 80.58  ? 42  SER E C     1 
ATOM 5805  O O     . SER G 3 25  ? 123.051 10.277  27.281  1.00 86.83  ? 42  SER E O     1 
ATOM 5806  C CB    . SER G 3 25  ? 124.725 8.638   24.943  1.00 76.47  ? 42  SER E CB    1 
ATOM 5807  O OG    . SER G 3 25  ? 124.774 7.298   24.480  1.00 76.55  ? 42  SER E OG    1 
ATOM 5808  N N     . ALA G 3 26  ? 123.560 11.485  25.452  1.00 66.16  ? 43  ALA E N     1 
ATOM 5809  C CA    . ALA G 3 26  ? 123.588 12.757  26.163  1.00 64.16  ? 43  ALA E CA    1 
ATOM 5810  C C     . ALA G 3 26  ? 122.186 13.172  26.611  1.00 62.67  ? 43  ALA E C     1 
ATOM 5811  O O     . ALA G 3 26  ? 121.180 12.739  26.041  1.00 71.12  ? 43  ALA E O     1 
ATOM 5812  C CB    . ALA G 3 26  ? 124.188 13.835  25.270  1.00 72.79  ? 43  ALA E CB    1 
ATOM 5813  N N     . GLY G 3 27  ? 122.128 14.004  27.647  1.00 68.39  ? 44  GLY E N     1 
ATOM 5814  C CA    . GLY G 3 27  ? 120.847 14.478  28.141  1.00 67.05  ? 44  GLY E CA    1 
ATOM 5815  C C     . GLY G 3 27  ? 120.381 13.847  29.438  1.00 64.95  ? 44  GLY E C     1 
ATOM 5816  O O     . GLY G 3 27  ? 121.030 12.944  29.969  1.00 68.56  ? 44  GLY E O     1 
ATOM 5817  N N     . SER G 3 28  ? 119.247 14.328  29.941  1.00 67.05  ? 45  SER E N     1 
ATOM 5818  C CA    . SER G 3 28  ? 118.667 13.825  31.175  1.00 66.92  ? 45  SER E CA    1 
ATOM 5819  C C     . SER G 3 28  ? 117.566 14.752  31.660  1.00 67.15  ? 45  SER E C     1 
ATOM 5820  O O     . SER G 3 28  ? 117.841 15.890  32.034  1.00 55.79  ? 45  SER E O     1 
ATOM 5821  C CB    . SER G 3 28  ? 119.738 13.716  32.263  1.00 46.69  ? 45  SER E CB    1 
ATOM 5822  O OG    . SER G 3 28  ? 119.266 14.220  33.507  1.00 47.33  ? 45  SER E OG    1 
ATOM 5823  N N     . ILE G 3 29  ? 116.322 14.276  31.651  1.00 72.40  ? 46  ILE E N     1 
ATOM 5824  C CA    . ILE G 3 29  ? 115.208 15.092  32.135  1.00 72.58  ? 46  ILE E CA    1 
ATOM 5825  C C     . ILE G 3 29  ? 115.475 15.365  33.608  1.00 73.32  ? 46  ILE E C     1 
ATOM 5826  O O     . ILE G 3 29  ? 115.258 14.509  34.461  1.00 65.92  ? 46  ILE E O     1 
ATOM 5827  C CB    . ILE G 3 29  ? 113.856 14.360  31.994  1.00 70.57  ? 46  ILE E CB    1 
ATOM 5828  C CG1   . ILE G 3 29  ? 113.574 14.076  30.512  1.00 68.84  ? 46  ILE E CG1   1 
ATOM 5829  C CG2   . ILE G 3 29  ? 112.741 15.197  32.622  1.00 69.27  ? 46  ILE E CG2   1 
ATOM 5830  C CD1   . ILE G 3 29  ? 112.260 13.371  30.241  1.00 67.10  ? 46  ILE E CD1   1 
ATOM 5831  N N     . PRO G 3 30  ? 115.958 16.571  33.918  1.00 28.46  ? 47  PRO E N     1 
ATOM 5832  C CA    . PRO G 3 30  ? 116.282 17.004  35.286  1.00 27.14  ? 47  PRO E CA    1 
ATOM 5833  C C     . PRO G 3 30  ? 115.146 17.129  36.321  1.00 27.14  ? 47  PRO E C     1 
ATOM 5834  O O     . PRO G 3 30  ? 113.974 16.875  36.030  1.00 52.96  ? 47  PRO E O     1 
ATOM 5835  C CB    . PRO G 3 30  ? 117.006 18.334  35.056  1.00 45.55  ? 47  PRO E CB    1 
ATOM 5836  C CG    . PRO G 3 30  ? 116.314 18.872  33.858  1.00 44.56  ? 47  PRO E CG    1 
ATOM 5837  C CD    . PRO G 3 30  ? 116.189 17.665  32.958  1.00 43.82  ? 47  PRO E CD    1 
ATOM 5838  N N     . GLY G 3 31  ? 115.528 17.543  37.530  1.00 52.93  ? 48  GLY E N     1 
ATOM 5839  C CA    . GLY G 3 31  ? 114.586 17.686  38.627  1.00 54.10  ? 48  GLY E CA    1 
ATOM 5840  C C     . GLY G 3 31  ? 113.829 18.996  38.744  1.00 53.32  ? 48  GLY E C     1 
ATOM 5841  O O     . GLY G 3 31  ? 113.401 19.561  37.737  1.00 77.57  ? 48  GLY E O     1 
ATOM 5842  N N     . GLU G 3 32  ? 113.667 19.479  39.977  1.00 30.14  ? 49  GLU E N     1 
ATOM 5843  C CA    . GLU G 3 32  ? 112.927 20.717  40.235  1.00 27.20  ? 49  GLU E CA    1 
ATOM 5844  C C     . GLU G 3 32  ? 113.773 21.872  40.743  1.00 25.70  ? 49  GLU E C     1 
ATOM 5845  O O     . GLU G 3 32  ? 113.747 22.945  40.155  1.00 63.45  ? 49  GLU E O     1 
ATOM 5846  C CB    . GLU G 3 32  ? 111.773 20.462  41.216  1.00 71.30  ? 49  GLU E CB    1 
ATOM 5847  C CG    . GLU G 3 32  ? 112.185 20.020  42.640  1.00 69.41  ? 49  GLU E CG    1 
ATOM 5848  C CD    . GLU G 3 32  ? 112.291 21.176  43.647  1.00 69.45  ? 49  GLU E CD    1 
ATOM 5849  O OE1   . GLU G 3 32  ? 112.162 20.917  44.871  1.00 72.41  ? 49  GLU E OE1   1 
ATOM 5850  O OE2   . GLU G 3 32  ? 112.506 22.334  43.217  1.00 64.98  ? 49  GLU E OE2   1 
ATOM 5851  N N     . ARG G 3 33  ? 114.514 21.675  41.828  1.00 35.72  ? 50  ARG E N     1 
ATOM 5852  C CA    . ARG G 3 33  ? 115.349 22.757  42.347  1.00 36.01  ? 50  ARG E CA    1 
ATOM 5853  C C     . ARG G 3 33  ? 116.762 22.584  41.840  1.00 36.24  ? 50  ARG E C     1 
ATOM 5854  O O     . ARG G 3 33  ? 117.733 22.817  42.561  1.00 33.63  ? 50  ARG E O     1 
ATOM 5855  C CB    . ARG G 3 33  ? 115.364 22.778  43.874  1.00 56.72  ? 50  ARG E CB    1 
ATOM 5856  C CG    . ARG G 3 33  ? 115.909 24.086  44.443  1.00 57.15  ? 50  ARG E CG    1 
ATOM 5857  C CD    . ARG G 3 33  ? 115.837 24.118  45.963  1.00 55.16  ? 50  ARG E CD    1 
ATOM 5858  N NE    . ARG G 3 33  ? 117.088 23.697  46.590  1.00 50.75  ? 50  ARG E NE    1 
ATOM 5859  C CZ    . ARG G 3 33  ? 117.249 23.562  47.903  1.00 50.63  ? 50  ARG E CZ    1 
ATOM 5860  N NH1   . ARG G 3 33  ? 116.228 23.811  48.716  1.00 46.29  ? 50  ARG E NH1   1 
ATOM 5861  N NH2   . ARG G 3 33  ? 118.425 23.203  48.405  1.00 47.98  ? 50  ARG E NH2   1 
ATOM 5862  N N     . SER G 3 34  ? 116.854 22.155  40.589  1.00 82.67  ? 51  SER E N     1 
ATOM 5863  C CA    . SER G 3 34  ? 118.131 21.941  39.937  1.00 84.13  ? 51  SER E CA    1 
ATOM 5864  C C     . SER G 3 34  ? 118.805 23.294  39.748  1.00 83.90  ? 51  SER E C     1 
ATOM 5865  O O     . SER G 3 34  ? 118.137 24.320  39.556  1.00 54.89  ? 51  SER E O     1 
ATOM 5866  C CB    . SER G 3 34  ? 117.921 21.252  38.577  1.00 59.33  ? 51  SER E CB    1 
ATOM 5867  O OG    . SER G 3 34  ? 119.146 20.913  37.942  1.00 58.70  ? 51  SER E OG    1 
ATOM 5868  N N     . THR G 3 35  ? 120.133 23.273  39.830  1.00 77.31  ? 52  THR E N     1 
ATOM 5869  C CA    . THR G 3 35  ? 120.984 24.449  39.663  1.00 80.25  ? 52  THR E CA    1 
ATOM 5870  C C     . THR G 3 35  ? 122.124 24.006  38.736  1.00 83.74  ? 52  THR E C     1 
ATOM 5871  O O     . THR G 3 35  ? 121.870 23.494  37.644  1.00 107.17 ? 52  THR E O     1 
ATOM 5872  C CB    . THR G 3 35  ? 121.552 24.926  41.035  1.00 97.59  ? 52  THR E CB    1 
ATOM 5873  O OG1   . THR G 3 35  ? 122.031 23.797  41.781  1.00 97.00  ? 52  THR E OG1   1 
ATOM 5874  C CG2   . THR G 3 35  ? 120.472 25.636  41.848  1.00 95.87  ? 52  THR E CG2   1 
ATOM 5875  N N     . ASP G 3 36  ? 123.368 24.198  39.162  1.00 80.88  ? 53  ASP E N     1 
ATOM 5876  C CA    . ASP G 3 36  ? 124.515 23.774  38.362  1.00 84.93  ? 53  ASP E CA    1 
ATOM 5877  C C     . ASP G 3 36  ? 125.626 23.210  39.246  1.00 86.95  ? 53  ASP E C     1 
ATOM 5878  O O     . ASP G 3 36  ? 126.810 23.295  38.909  1.00 61.29  ? 53  ASP E O     1 
ATOM 5879  C CB    . ASP G 3 36  ? 125.038 24.931  37.503  1.00 53.19  ? 53  ASP E CB    1 
ATOM 5880  C CG    . ASP G 3 36  ? 124.373 24.990  36.126  1.00 54.37  ? 53  ASP E CG    1 
ATOM 5881  O OD1   . ASP G 3 36  ? 124.636 24.101  35.284  1.00 55.99  ? 53  ASP E OD1   1 
ATOM 5882  O OD2   . ASP G 3 36  ? 123.580 25.926  35.890  1.00 53.57  ? 53  ASP E OD2   1 
ATOM 5883  N N     . THR G 3 37  ? 125.218 22.620  40.371  1.00 90.53  ? 54  THR E N     1 
ATOM 5884  C CA    . THR G 3 37  ? 126.128 22.011  41.338  1.00 91.59  ? 54  THR E CA    1 
ATOM 5885  C C     . THR G 3 37  ? 125.526 20.702  41.880  1.00 92.62  ? 54  THR E C     1 
ATOM 5886  O O     . THR G 3 37  ? 126.251 19.800  42.307  1.00 81.65  ? 54  THR E O     1 
ATOM 5887  C CB    . THR G 3 37  ? 126.386 22.948  42.535  1.00 78.56  ? 54  THR E CB    1 
ATOM 5888  O OG1   . THR G 3 37  ? 126.359 24.312  42.098  1.00 78.25  ? 54  THR E OG1   1 
ATOM 5889  C CG2   . THR G 3 37  ? 127.750 22.647  43.150  1.00 78.41  ? 54  THR E CG2   1 
ATOM 5890  N N     . THR G 3 38  ? 124.196 20.617  41.868  1.00 67.26  ? 55  THR E N     1 
ATOM 5891  C CA    . THR G 3 38  ? 123.467 19.439  42.345  1.00 70.63  ? 55  THR E CA    1 
ATOM 5892  C C     . THR G 3 38  ? 122.046 19.476  41.778  1.00 69.99  ? 55  THR E C     1 
ATOM 5893  O O     . THR G 3 38  ? 121.127 20.018  42.399  1.00 82.82  ? 55  THR E O     1 
ATOM 5894  C CB    . THR G 3 38  ? 123.400 19.406  43.892  1.00 87.33  ? 55  THR E CB    1 
ATOM 5895  O OG1   . THR G 3 38  ? 124.728 19.321  44.424  1.00 90.15  ? 55  THR E OG1   1 
ATOM 5896  C CG2   . THR G 3 38  ? 122.587 18.201  44.373  1.00 90.01  ? 55  THR E CG2   1 
ATOM 5897  N N     . LYS G 3 39  ? 121.882 18.887  40.598  1.00 85.07  ? 56  LYS E N     1 
ATOM 5898  C CA    . LYS G 3 39  ? 120.605 18.860  39.889  1.00 81.84  ? 56  LYS E CA    1 
ATOM 5899  C C     . LYS G 3 39  ? 119.423 18.177  40.582  1.00 81.11  ? 56  LYS E C     1 
ATOM 5900  O O     . LYS G 3 39  ? 118.371 18.788  40.776  1.00 98.23  ? 56  LYS E O     1 
ATOM 5901  C CB    . LYS G 3 39  ? 120.793 18.221  38.508  1.00 89.24  ? 56  LYS E CB    1 
ATOM 5902  C CG    . LYS G 3 39  ? 121.776 18.946  37.607  1.00 85.97  ? 56  LYS E CG    1 
ATOM 5903  C CD    . LYS G 3 39  ? 123.218 18.740  38.047  1.00 85.27  ? 56  LYS E CD    1 
ATOM 5904  C CE    . LYS G 3 39  ? 123.650 17.304  37.858  1.00 84.50  ? 56  LYS E CE    1 
ATOM 5905  N NZ    . LYS G 3 39  ? 125.096 17.142  38.126  1.00 82.85  ? 56  LYS E NZ    1 
ATOM 5906  N N     . THR G 3 40  ? 119.605 16.905  40.927  1.00 111.55 ? 57  THR E N     1 
ATOM 5907  C CA    . THR G 3 40  ? 118.572 16.084  41.559  1.00 109.70 ? 57  THR E CA    1 
ATOM 5908  C C     . THR G 3 40  ? 117.767 15.439  40.445  1.00 108.72 ? 57  THR E C     1 
ATOM 5909  O O     . THR G 3 40  ? 117.025 16.121  39.734  1.00 106.18 ? 57  THR E O     1 
ATOM 5910  C CB    . THR G 3 40  ? 117.600 16.906  42.414  1.00 103.65 ? 57  THR E CB    1 
ATOM 5911  O OG1   . THR G 3 40  ? 118.339 17.748  43.304  1.00 104.62 ? 57  THR E OG1   1 
ATOM 5912  C CG2   . THR G 3 40  ? 116.699 15.981  43.220  1.00 102.03 ? 57  THR E CG2   1 
ATOM 5913  N N     . HIS G 3 41  ? 117.922 14.131  40.286  1.00 105.97 ? 58  HIS E N     1 
ATOM 5914  C CA    . HIS G 3 41  ? 117.203 13.403  39.246  1.00 106.13 ? 58  HIS E CA    1 
ATOM 5915  C C     . HIS G 3 41  ? 115.804 13.028  39.715  1.00 105.74 ? 58  HIS E C     1 
ATOM 5916  O O     . HIS G 3 41  ? 115.570 12.848  40.912  1.00 84.95  ? 58  HIS E O     1 
ATOM 5917  C CB    . HIS G 3 41  ? 117.986 12.151  38.862  1.00 67.38  ? 58  HIS E CB    1 
ATOM 5918  C CG    . HIS G 3 41  ? 119.355 12.450  38.351  1.00 68.03  ? 58  HIS E CG    1 
ATOM 5919  N ND1   . HIS G 3 41  ? 119.593 12.829  37.048  1.00 69.87  ? 58  HIS E ND1   1 
ATOM 5920  C CD2   . HIS G 3 41  ? 120.551 12.494  38.984  1.00 67.70  ? 58  HIS E CD2   1 
ATOM 5921  C CE1   . HIS G 3 41  ? 120.878 13.094  36.900  1.00 70.31  ? 58  HIS E CE1   1 
ATOM 5922  N NE2   . HIS G 3 41  ? 121.482 12.900  38.059  1.00 70.47  ? 58  HIS E NE2   1 
ATOM 5923  N N     . PRO G 3 42  ? 114.851 12.912  38.776  1.00 111.78 ? 59  PRO E N     1 
ATOM 5924  C CA    . PRO G 3 42  ? 113.475 12.555  39.134  1.00 110.63 ? 59  PRO E CA    1 
ATOM 5925  C C     . PRO G 3 42  ? 113.398 11.233  39.912  1.00 109.07 ? 59  PRO E C     1 
ATOM 5926  O O     . PRO G 3 42  ? 113.968 10.216  39.500  1.00 78.85  ? 59  PRO E O     1 
ATOM 5927  C CB    . PRO G 3 42  ? 112.776 12.472  37.777  1.00 66.45  ? 59  PRO E CB    1 
ATOM 5928  C CG    . PRO G 3 42  ? 113.558 13.427  36.925  1.00 67.90  ? 59  PRO E CG    1 
ATOM 5929  C CD    . PRO G 3 42  ? 114.978 13.112  37.322  1.00 68.78  ? 59  PRO E CD    1 
ATOM 5930  N N     . THR G 3 43  ? 112.707 11.257  41.046  1.00 39.08  ? 60  THR E N     1 
ATOM 5931  C CA    . THR G 3 43  ? 112.546 10.057  41.847  1.00 38.82  ? 60  THR E CA    1 
ATOM 5932  C C     . THR G 3 43  ? 111.064 9.955   42.178  1.00 37.51  ? 60  THR E C     1 
ATOM 5933  O O     . THR G 3 43  ? 110.402 10.964  42.434  1.00 71.53  ? 60  THR E O     1 
ATOM 5934  C CB    . THR G 3 43  ? 113.400 10.120  43.144  1.00 72.49  ? 60  THR E CB    1 
ATOM 5935  O OG1   . THR G 3 43  ? 112.567 10.393  44.277  1.00 69.96  ? 60  THR E OG1   1 
ATOM 5936  C CG2   . THR G 3 43  ? 114.442 11.212  43.024  1.00 72.67  ? 60  THR E CG2   1 
ATOM 5937  N N     . ILE G 3 44  ? 110.540 8.739   42.142  1.00 82.52  ? 61  ILE E N     1 
ATOM 5938  C CA    . ILE G 3 44  ? 109.135 8.524   42.434  1.00 82.40  ? 61  ILE E CA    1 
ATOM 5939  C C     . ILE G 3 44  ? 109.021 8.046   43.882  1.00 82.53  ? 61  ILE E C     1 
ATOM 5940  O O     . ILE G 3 44  ? 109.862 7.274   44.353  1.00 84.99  ? 61  ILE E O     1 
ATOM 5941  C CB    . ILE G 3 44  ? 108.531 7.477   41.452  1.00 72.01  ? 61  ILE E CB    1 
ATOM 5942  C CG1   . ILE G 3 44  ? 107.005 7.508   41.518  1.00 69.43  ? 61  ILE E CG1   1 
ATOM 5943  C CG2   . ILE G 3 44  ? 109.058 6.091   41.765  1.00 72.36  ? 61  ILE E CG2   1 
ATOM 5944  C CD1   . ILE G 3 44  ? 106.408 8.795   40.996  1.00 69.11  ? 61  ILE E CD1   1 
ATOM 5945  N N     . LYS G 3 45  ? 108.002 8.526   44.594  1.00 66.73  ? 62  LYS E N     1 
ATOM 5946  C CA    . LYS G 3 45  ? 107.790 8.143   45.990  1.00 65.91  ? 62  LYS E CA    1 
ATOM 5947  C C     . LYS G 3 45  ? 106.608 7.200   46.145  1.00 63.08  ? 62  LYS E C     1 
ATOM 5948  O O     . LYS G 3 45  ? 105.491 7.524   45.750  1.00 72.45  ? 62  LYS E O     1 
ATOM 5949  C CB    . LYS G 3 45  ? 107.554 9.385   46.854  1.00 79.76  ? 62  LYS E CB    1 
ATOM 5950  C CG    . LYS G 3 45  ? 107.061 9.091   48.269  1.00 81.55  ? 62  LYS E CG    1 
ATOM 5951  C CD    . LYS G 3 45  ? 106.681 10.377  49.005  1.00 82.25  ? 62  LYS E CD    1 
ATOM 5952  C CE    . LYS G 3 45  ? 107.895 11.116  49.551  1.00 83.76  ? 62  LYS E CE    1 
ATOM 5953  N NZ    . LYS G 3 45  ? 108.462 10.446  50.753  1.00 84.46  ? 62  LYS E NZ    1 
ATOM 5954  N N     . ILE G 3 46  ? 106.849 6.029   46.722  1.00 64.73  ? 63  ILE E N     1 
ATOM 5955  C CA    . ILE G 3 46  ? 105.773 5.068   46.923  1.00 64.83  ? 63  ILE E CA    1 
ATOM 5956  C C     . ILE G 3 46  ? 105.701 4.761   48.419  1.00 65.91  ? 63  ILE E C     1 
ATOM 5957  O O     . ILE G 3 46  ? 106.466 3.940   48.929  1.00 70.62  ? 63  ILE E O     1 
ATOM 5958  C CB    . ILE G 3 46  ? 106.034 3.755   46.136  1.00 64.11  ? 63  ILE E CB    1 
ATOM 5959  C CG1   . ILE G 3 46  ? 106.773 4.059   44.828  1.00 64.49  ? 63  ILE E CG1   1 
ATOM 5960  C CG2   . ILE G 3 46  ? 104.717 3.067   45.811  1.00 62.56  ? 63  ILE E CG2   1 
ATOM 5961  C CD1   . ILE G 3 46  ? 106.024 4.977   43.896  1.00 59.04  ? 63  ILE E CD1   1 
ATOM 5962  N N     . ASN G 3 47  ? 104.791 5.438   49.118  1.00 68.77  ? 64  ASN E N     1 
ATOM 5963  C CA    . ASN G 3 47  ? 104.622 5.241   50.556  1.00 71.13  ? 64  ASN E CA    1 
ATOM 5964  C C     . ASN G 3 47  ? 104.220 3.796   50.886  1.00 71.91  ? 64  ASN E C     1 
ATOM 5965  O O     . ASN G 3 47  ? 103.491 3.158   50.119  1.00 115.88 ? 64  ASN E O     1 
ATOM 5966  C CB    . ASN G 3 47  ? 103.550 6.199   51.094  1.00 111.60 ? 64  ASN E CB    1 
ATOM 5967  C CG    . ASN G 3 47  ? 103.922 7.663   50.924  1.00 111.87 ? 64  ASN E CG    1 
ATOM 5968  O OD1   . ASN G 3 47  ? 104.283 8.104   49.829  1.00 110.38 ? 64  ASN E OD1   1 
ATOM 5969  N ND2   . ASN G 3 47  ? 103.820 8.427   52.008  1.00 108.99 ? 64  ASN E ND2   1 
ATOM 5970  N N     . GLY G 3 48  ? 104.699 3.284   52.023  1.00 112.48 ? 65  GLY E N     1 
ATOM 5971  C CA    . GLY G 3 48  ? 104.365 1.928   52.441  1.00 111.92 ? 65  GLY E CA    1 
ATOM 5972  C C     . GLY G 3 48  ? 105.070 0.780   51.727  1.00 113.19 ? 65  GLY E C     1 
ATOM 5973  O O     . GLY G 3 48  ? 106.102 0.284   52.212  1.00 64.13  ? 65  GLY E O     1 
ATOM 5974  N N     . TYR G 3 49  ? 104.520 0.352   50.584  1.00 52.38  ? 66  TYR E N     1 
ATOM 5975  C CA    . TYR G 3 49  ? 105.093 -0.754  49.812  1.00 51.57  ? 66  TYR E CA    1 
ATOM 5976  C C     . TYR G 3 49  ? 106.570 -0.591  49.470  1.00 51.57  ? 66  TYR E C     1 
ATOM 5977  O O     . TYR G 3 49  ? 106.985 0.351   48.783  1.00 62.69  ? 66  TYR E O     1 
ATOM 5978  C CB    . TYR G 3 49  ? 104.300 -1.000  48.512  1.00 61.85  ? 66  TYR E CB    1 
ATOM 5979  C CG    . TYR G 3 49  ? 104.878 -2.117  47.649  1.00 60.73  ? 66  TYR E CG    1 
ATOM 5980  C CD1   . TYR G 3 49  ? 106.106 -1.960  46.988  1.00 58.48  ? 66  TYR E CD1   1 
ATOM 5981  C CD2   . TYR G 3 49  ? 104.230 -3.351  47.541  1.00 59.32  ? 66  TYR E CD2   1 
ATOM 5982  C CE1   . TYR G 3 49  ? 106.679 -3.004  46.246  1.00 57.79  ? 66  TYR E CE1   1 
ATOM 5983  C CE2   . TYR G 3 49  ? 104.795 -4.407  46.799  1.00 57.39  ? 66  TYR E CE2   1 
ATOM 5984  C CZ    . TYR G 3 49  ? 106.022 -4.225  46.156  1.00 57.52  ? 66  TYR E CZ    1 
ATOM 5985  O OH    . TYR G 3 49  ? 106.593 -5.257  45.439  1.00 54.16  ? 66  TYR E OH    1 
ATOM 5986  N N     . THR G 3 50  ? 107.344 -1.553  49.956  1.00 41.64  ? 67  THR E N     1 
ATOM 5987  C CA    . THR G 3 50  ? 108.778 -1.617  49.735  1.00 41.96  ? 67  THR E CA    1 
ATOM 5988  C C     . THR G 3 50  ? 109.100 -3.046  49.275  1.00 40.98  ? 67  THR E C     1 
ATOM 5989  O O     . THR G 3 50  ? 108.708 -4.027  49.919  1.00 55.88  ? 67  THR E O     1 
ATOM 5990  C CB    . THR G 3 50  ? 109.560 -1.279  51.035  1.00 59.63  ? 67  THR E CB    1 
ATOM 5991  O OG1   . THR G 3 50  ? 108.953 -1.935  52.157  1.00 61.75  ? 67  THR E OG1   1 
ATOM 5992  C CG2   . THR G 3 50  ? 109.561 0.216   51.277  1.00 59.95  ? 67  THR E CG2   1 
ATOM 5993  N N     . GLY G 3 51  ? 109.800 -3.161  48.150  1.00 73.75  ? 68  GLY E N     1 
ATOM 5994  C CA    . GLY G 3 51  ? 110.148 -4.470  47.628  1.00 72.85  ? 68  GLY E CA    1 
ATOM 5995  C C     . GLY G 3 51  ? 110.433 -4.417  46.141  1.00 71.73  ? 68  GLY E C     1 
ATOM 5996  O O     . GLY G 3 51  ? 110.350 -3.346  45.539  1.00 19.35  ? 68  GLY E O     1 
ATOM 5997  N N     . PRO G 3 52  ? 110.765 -5.560  45.517  1.00 75.24  ? 69  PRO E N     1 
ATOM 5998  C CA    . PRO G 3 52  ? 111.073 -5.663  44.083  1.00 77.43  ? 69  PRO E CA    1 
ATOM 5999  C C     . PRO G 3 52  ? 109.872 -5.329  43.212  1.00 78.96  ? 69  PRO E C     1 
ATOM 6000  O O     . PRO G 3 52  ? 108.757 -5.208  43.721  1.00 79.99  ? 69  PRO E O     1 
ATOM 6001  C CB    . PRO G 3 52  ? 111.499 -7.118  43.934  1.00 62.65  ? 69  PRO E CB    1 
ATOM 6002  C CG    . PRO G 3 52  ? 110.618 -7.800  44.925  1.00 61.75  ? 69  PRO E CG    1 
ATOM 6003  C CD    . PRO G 3 52  ? 110.735 -6.898  46.131  1.00 60.96  ? 69  PRO E CD    1 
ATOM 6004  N N     . GLY G 3 53  ? 110.095 -5.182  41.906  1.00 56.60  ? 70  GLY E N     1 
ATOM 6005  C CA    . GLY G 3 53  ? 108.992 -4.873  41.011  1.00 55.19  ? 70  GLY E CA    1 
ATOM 6006  C C     . GLY G 3 53  ? 109.333 -4.580  39.559  1.00 55.57  ? 70  GLY E C     1 
ATOM 6007  O O     . GLY G 3 53  ? 110.003 -5.370  38.884  1.00 78.22  ? 70  GLY E O     1 
ATOM 6008  N N     . THR G 3 54  ? 108.851 -3.435  39.080  1.00 67.14  ? 71  THR E N     1 
ATOM 6009  C CA    . THR G 3 54  ? 109.062 -2.993  37.702  1.00 66.00  ? 71  THR E CA    1 
ATOM 6010  C C     . THR G 3 54  ? 108.596 -1.546  37.558  1.00 64.50  ? 71  THR E C     1 
ATOM 6011  O O     . THR G 3 54  ? 107.521 -1.200  38.017  1.00 27.13  ? 71  THR E O     1 
ATOM 6012  C CB    . THR G 3 54  ? 108.290 -3.914  36.718  1.00 34.37  ? 71  THR E CB    1 
ATOM 6013  O OG1   . THR G 3 54  ? 109.050 -5.112  36.505  1.00 36.39  ? 71  THR E OG1   1 
ATOM 6014  C CG2   . THR G 3 54  ? 108.032 -3.218  35.384  1.00 32.54  ? 71  THR E CG2   1 
ATOM 6015  N N     . VAL G 3 55  ? 109.411 -0.702  36.929  1.00 58.86  ? 72  VAL E N     1 
ATOM 6016  C CA    . VAL G 3 55  ? 109.063 0.711   36.751  1.00 59.23  ? 72  VAL E CA    1 
ATOM 6017  C C     . VAL G 3 55  ? 109.050 1.192   35.293  1.00 60.34  ? 72  VAL E C     1 
ATOM 6018  O O     . VAL G 3 55  ? 109.974 1.876   34.856  1.00 52.04  ? 72  VAL E O     1 
ATOM 6019  C CB    . VAL G 3 55  ? 110.034 1.623   37.547  1.00 45.93  ? 72  VAL E CB    1 
ATOM 6020  C CG1   . VAL G 3 55  ? 109.693 3.075   37.304  1.00 43.13  ? 72  VAL E CG1   1 
ATOM 6021  C CG2   . VAL G 3 55  ? 109.961 1.304   39.028  1.00 47.37  ? 72  VAL E CG2   1 
ATOM 6022  N N     . ARG G 3 56  ? 107.990 0.850   34.557  1.00 106.08 ? 73  ARG E N     1 
ATOM 6023  C CA    . ARG G 3 56  ? 107.834 1.239   33.146  1.00 109.00 ? 73  ARG E CA    1 
ATOM 6024  C C     . ARG G 3 56  ? 107.519 2.740   33.058  1.00 108.96 ? 73  ARG E C     1 
ATOM 6025  O O     . ARG G 3 56  ? 106.709 3.251   33.831  1.00 99.74  ? 73  ARG E O     1 
ATOM 6026  C CB    . ARG G 3 56  ? 106.701 0.410   32.507  1.00 93.60  ? 73  ARG E CB    1 
ATOM 6027  C CG    . ARG G 3 56  ? 106.712 0.279   30.967  1.00 92.03  ? 73  ARG E CG    1 
ATOM 6028  C CD    . ARG G 3 56  ? 105.617 -0.719  30.506  1.00 93.56  ? 73  ARG E CD    1 
ATOM 6029  N NE    . ARG G 3 56  ? 105.521 -0.903  29.052  1.00 97.10  ? 73  ARG E NE    1 
ATOM 6030  C CZ    . ARG G 3 56  ? 104.600 -1.654  28.441  1.00 97.35  ? 73  ARG E CZ    1 
ATOM 6031  N NH1   . ARG G 3 56  ? 103.684 -2.301  29.149  1.00 98.63  ? 73  ARG E NH1   1 
ATOM 6032  N NH2   . ARG G 3 56  ? 104.587 -1.758  27.118  1.00 97.06  ? 73  ARG E NH2   1 
ATOM 6033  N N     . ILE G 3 57  ? 108.162 3.445   32.127  1.00 82.25  ? 74  ILE E N     1 
ATOM 6034  C CA    . ILE G 3 57  ? 107.947 4.890   31.964  1.00 79.67  ? 74  ILE E CA    1 
ATOM 6035  C C     . ILE G 3 57  ? 107.670 5.308   30.519  1.00 76.40  ? 74  ILE E C     1 
ATOM 6036  O O     . ILE G 3 57  ? 108.589 5.373   29.698  1.00 42.04  ? 74  ILE E O     1 
ATOM 6037  C CB    . ILE G 3 57  ? 109.168 5.694   32.477  1.00 59.48  ? 74  ILE E CB    1 
ATOM 6038  C CG1   . ILE G 3 57  ? 109.301 5.528   33.992  1.00 61.18  ? 74  ILE E CG1   1 
ATOM 6039  C CG2   . ILE G 3 57  ? 109.024 7.168   32.105  1.00 60.34  ? 74  ILE E CG2   1 
ATOM 6040  C CD1   . ILE G 3 57  ? 108.037 5.871   34.735  1.00 62.32  ? 74  ILE E CD1   1 
ATOM 6041  N N     . SER G 3 58  ? 106.408 5.627   30.230  1.00 25.02  ? 75  SER E N     1 
ATOM 6042  C CA    . SER G 3 58  ? 105.994 6.017   28.879  1.00 22.01  ? 75  SER E CA    1 
ATOM 6043  C C     . SER G 3 58  ? 105.742 7.511   28.684  1.00 20.20  ? 75  SER E C     1 
ATOM 6044  O O     . SER G 3 58  ? 105.638 8.278   29.648  1.00 67.40  ? 75  SER E O     1 
ATOM 6045  C CB    . SER G 3 58  ? 104.725 5.249   28.465  1.00 72.23  ? 75  SER E CB    1 
ATOM 6046  O OG    . SER G 3 58  ? 104.936 3.846   28.403  1.00 70.79  ? 75  SER E OG    1 
ATOM 6047  N N     . LEU G 3 59  ? 105.633 7.908   27.416  1.00 44.33  ? 76  LEU E N     1 
ATOM 6048  C CA    . LEU G 3 59  ? 105.376 9.299   27.048  1.00 44.29  ? 76  LEU E CA    1 
ATOM 6049  C C     . LEU G 3 59  ? 103.898 9.504   26.736  1.00 42.95  ? 76  LEU E C     1 
ATOM 6050  O O     . LEU G 3 59  ? 103.342 8.843   25.862  1.00 77.96  ? 76  LEU E O     1 
ATOM 6051  C CB    . LEU G 3 59  ? 106.214 9.702   25.829  1.00 74.34  ? 76  LEU E CB    1 
ATOM 6052  C CG    . LEU G 3 59  ? 107.729 9.635   26.026  1.00 72.30  ? 76  LEU E CG    1 
ATOM 6053  C CD1   . LEU G 3 59  ? 108.209 8.241   25.661  1.00 69.14  ? 76  LEU E CD1   1 
ATOM 6054  C CD2   . LEU G 3 59  ? 108.424 10.678  25.165  1.00 64.32  ? 76  LEU E CD2   1 
ATOM 6055  N N     . VAL G 3 60  ? 103.267 10.420  27.459  1.00 56.80  ? 77  VAL E N     1 
ATOM 6056  C CA    . VAL G 3 60  ? 101.854 10.697  27.249  1.00 57.42  ? 77  VAL E CA    1 
ATOM 6057  C C     . VAL G 3 60  ? 101.624 12.116  26.737  1.00 56.26  ? 77  VAL E C     1 
ATOM 6058  O O     . VAL G 3 60  ? 102.499 12.699  26.087  1.00 36.66  ? 77  VAL E O     1 
ATOM 6059  C CB    . VAL G 3 60  ? 101.052 10.506  28.551  1.00 41.51  ? 77  VAL E CB    1 
ATOM 6060  C CG1   . VAL G 3 60  ? 101.121 9.052   28.986  1.00 40.83  ? 77  VAL E CG1   1 
ATOM 6061  C CG2   . VAL G 3 60  ? 101.587 11.434  29.636  1.00 42.52  ? 77  VAL E CG2   1 
ATOM 6062  N N     . THR G 3 61  ? 100.442 12.662  27.026  1.00 41.51  ? 78  THR E N     1 
ATOM 6063  C CA    . THR G 3 61  ? 100.092 14.012  26.595  1.00 37.23  ? 78  THR E CA    1 
ATOM 6064  C C     . THR G 3 61  ? 99.731  14.894  27.793  1.00 36.13  ? 78  THR E C     1 
ATOM 6065  O O     . THR G 3 61  ? 99.653  14.418  28.934  1.00 41.31  ? 78  THR E O     1 
ATOM 6066  C CB    . THR G 3 61  ? 98.914  13.987  25.613  1.00 44.25  ? 78  THR E CB    1 
ATOM 6067  O OG1   . THR G 3 61  ? 99.155  13.000  24.601  1.00 37.85  ? 78  THR E OG1   1 
ATOM 6068  C CG2   . THR G 3 61  ? 98.760  15.347  24.943  1.00 47.67  ? 78  THR E CG2   1 
ATOM 6069  N N     . LYS G 3 62  ? 99.520  16.182  27.527  1.00 23.27  ? 79  LYS E N     1 
ATOM 6070  C CA    . LYS G 3 62  ? 99.185  17.143  28.579  1.00 25.74  ? 79  LYS E CA    1 
ATOM 6071  C C     . LYS G 3 62  ? 97.696  17.164  28.924  1.00 29.56  ? 79  LYS E C     1 
ATOM 6072  O O     . LYS G 3 62  ? 97.306  17.294  30.094  1.00 49.56  ? 79  LYS E O     1 
ATOM 6073  C CB    . LYS G 3 62  ? 99.616  18.560  28.160  1.00 38.59  ? 79  LYS E CB    1 
ATOM 6074  C CG    . LYS G 3 62  ? 99.246  19.652  29.181  1.00 33.76  ? 79  LYS E CG    1 
ATOM 6075  C CD    . LYS G 3 62  ? 99.600  21.074  28.730  1.00 30.73  ? 79  LYS E CD    1 
ATOM 6076  C CE    . LYS G 3 62  ? 98.757  21.540  27.549  1.00 31.11  ? 79  LYS E CE    1 
ATOM 6077  N NZ    . LYS G 3 62  ? 99.014  20.743  26.307  1.00 32.05  ? 79  LYS E NZ    1 
ATOM 6078  N N     . ASP G 3 63  ? 96.869  17.036  27.892  1.00 94.51  ? 80  ASP E N     1 
ATOM 6079  C CA    . ASP G 3 63  ? 95.424  17.079  28.056  1.00 98.28  ? 80  ASP E CA    1 
ATOM 6080  C C     . ASP G 3 63  ? 94.765  15.710  28.340  1.00 100.79 ? 80  ASP E C     1 
ATOM 6081  O O     . ASP G 3 63  ? 95.050  14.716  27.664  1.00 48.74  ? 80  ASP E O     1 
ATOM 6082  C CB    . ASP G 3 63  ? 94.816  17.758  26.816  1.00 38.59  ? 80  ASP E CB    1 
ATOM 6083  C CG    . ASP G 3 63  ? 95.370  19.175  26.584  1.00 39.12  ? 80  ASP E CG    1 
ATOM 6084  O OD1   . ASP G 3 63  ? 95.973  19.766  27.508  1.00 39.67  ? 80  ASP E OD1   1 
ATOM 6085  O OD2   . ASP G 3 63  ? 95.181  19.702  25.470  1.00 38.97  ? 80  ASP E OD2   1 
ATOM 6086  N N     . PRO G 3 64  ? 93.860  15.664  29.348  1.00 23.09  ? 81  PRO E N     1 
ATOM 6087  C CA    . PRO G 3 64  ? 93.071  14.550  29.887  1.00 25.37  ? 81  PRO E CA    1 
ATOM 6088  C C     . PRO G 3 64  ? 92.978  13.236  29.131  1.00 28.98  ? 81  PRO E C     1 
ATOM 6089  O O     . PRO G 3 64  ? 93.208  12.175  29.709  1.00 58.35  ? 81  PRO E O     1 
ATOM 6090  C CB    . PRO G 3 64  ? 91.735  15.203  30.149  1.00 62.00  ? 81  PRO E CB    1 
ATOM 6091  C CG    . PRO G 3 64  ? 92.205  16.461  30.827  1.00 62.92  ? 81  PRO E CG    1 
ATOM 6092  C CD    . PRO G 3 64  ? 93.362  16.926  29.923  1.00 60.56  ? 81  PRO E CD    1 
ATOM 6093  N N     . PRO G 3 65  ? 92.606  13.264  27.851  1.00 54.78  ? 82  PRO E N     1 
ATOM 6094  C CA    . PRO G 3 65  ? 92.563  11.959  27.185  1.00 54.85  ? 82  PRO E CA    1 
ATOM 6095  C C     . PRO G 3 65  ? 94.033  11.602  26.916  1.00 54.52  ? 82  PRO E C     1 
ATOM 6096  O O     . PRO G 3 65  ? 94.449  11.416  25.774  1.00 44.74  ? 82  PRO E O     1 
ATOM 6097  C CB    . PRO G 3 65  ? 91.783  12.254  25.914  1.00 63.49  ? 82  PRO E CB    1 
ATOM 6098  C CG    . PRO G 3 65  ? 92.215  13.683  25.604  1.00 62.24  ? 82  PRO E CG    1 
ATOM 6099  C CD    . PRO G 3 65  ? 92.151  14.346  26.961  1.00 61.68  ? 82  PRO E CD    1 
ATOM 6100  N N     . HIS G 3 66  ? 94.793  11.536  28.011  1.00 39.54  ? 83  HIS E N     1 
ATOM 6101  C CA    . HIS G 3 66  ? 96.230  11.251  28.069  1.00 35.97  ? 83  HIS E CA    1 
ATOM 6102  C C     . HIS G 3 66  ? 96.813  10.139  27.211  1.00 33.59  ? 83  HIS E C     1 
ATOM 6103  O O     . HIS G 3 66  ? 97.469  9.236   27.731  1.00 37.59  ? 83  HIS E O     1 
ATOM 6104  C CB    . HIS G 3 66  ? 96.615  10.985  29.518  1.00 39.15  ? 83  HIS E CB    1 
ATOM 6105  C CG    . HIS G 3 66  ? 96.157  12.047  30.461  1.00 38.59  ? 83  HIS E CG    1 
ATOM 6106  N ND1   . HIS G 3 66  ? 95.349  11.782  31.548  1.00 39.79  ? 83  HIS E ND1   1 
ATOM 6107  C CD2   . HIS G 3 66  ? 96.415  13.376  30.503  1.00 37.71  ? 83  HIS E CD2   1 
ATOM 6108  C CE1   . HIS G 3 66  ? 95.134  12.899  32.220  1.00 39.90  ? 83  HIS E CE1   1 
ATOM 6109  N NE2   . HIS G 3 66  ? 95.771  13.881  31.608  1.00 40.48  ? 83  HIS E NE2   1 
ATOM 6110  N N     . ARG G 3 67  ? 96.606  10.228  25.903  1.00 56.85  ? 84  ARG E N     1 
ATOM 6111  C CA    . ARG G 3 67  ? 97.119  9.232   24.969  1.00 54.79  ? 84  ARG E CA    1 
ATOM 6112  C C     . ARG G 3 67  ? 98.650  9.165   24.975  1.00 53.34  ? 84  ARG E C     1 
ATOM 6113  O O     . ARG G 3 67  ? 99.328  10.102  25.401  1.00 61.82  ? 84  ARG E O     1 
ATOM 6114  C CB    . ARG G 3 67  ? 96.602  9.525   23.547  1.00 54.72  ? 84  ARG E CB    1 
ATOM 6115  C CG    . ARG G 3 67  ? 96.836  10.951  23.054  1.00 57.10  ? 84  ARG E CG    1 
ATOM 6116  C CD    . ARG G 3 67  ? 95.538  11.639  22.646  1.00 59.50  ? 84  ARG E CD    1 
ATOM 6117  N NE    . ARG G 3 67  ? 95.103  12.606  23.651  1.00 65.22  ? 84  ARG E NE    1 
ATOM 6118  C CZ    . ARG G 3 67  ? 95.646  13.809  23.826  1.00 70.01  ? 84  ARG E CZ    1 
ATOM 6119  N NH1   . ARG G 3 67  ? 96.651  14.206  23.052  1.00 72.25  ? 84  ARG E NH1   1 
ATOM 6120  N NH2   . ARG G 3 67  ? 95.193  14.612  24.786  1.00 69.31  ? 84  ARG E NH2   1 
ATOM 6121  N N     . PRO G 3 68  ? 99.211  8.038   24.521  1.00 85.51  ? 85  PRO E N     1 
ATOM 6122  C CA    . PRO G 3 68  ? 100.661 7.827   24.464  1.00 85.65  ? 85  PRO E CA    1 
ATOM 6123  C C     . PRO G 3 68  ? 101.351 8.722   23.426  1.00 86.60  ? 85  PRO E C     1 
ATOM 6124  O O     . PRO G 3 68  ? 101.099 8.597   22.222  1.00 50.64  ? 85  PRO E O     1 
ATOM 6125  C CB    . PRO G 3 68  ? 100.769 6.349   24.113  1.00 41.59  ? 85  PRO E CB    1 
ATOM 6126  C CG    . PRO G 3 68  ? 99.508  5.772   24.712  1.00 43.32  ? 85  PRO E CG    1 
ATOM 6127  C CD    . PRO G 3 68  ? 98.495  6.773   24.291  1.00 40.90  ? 85  PRO E CD    1 
ATOM 6128  N N     . HIS G 3 69  ? 102.222 9.611   23.903  1.00 46.74  ? 86  HIS E N     1 
ATOM 6129  C CA    . HIS G 3 69  ? 102.959 10.541  23.051  1.00 49.21  ? 86  HIS E CA    1 
ATOM 6130  C C     . HIS G 3 69  ? 103.889 9.779   22.116  1.00 50.65  ? 86  HIS E C     1 
ATOM 6131  O O     . HIS G 3 69  ? 104.649 8.919   22.560  1.00 46.43  ? 86  HIS E O     1 
ATOM 6132  C CB    . HIS G 3 69  ? 103.777 11.495  23.924  1.00 52.25  ? 86  HIS E CB    1 
ATOM 6133  C CG    . HIS G 3 69  ? 104.074 12.812  23.273  1.00 55.23  ? 86  HIS E CG    1 
ATOM 6134  N ND1   . HIS G 3 69  ? 103.765 14.017  23.869  1.00 56.55  ? 86  HIS E ND1   1 
ATOM 6135  C CD2   . HIS G 3 69  ? 104.632 13.113  22.077  1.00 56.27  ? 86  HIS E CD2   1 
ATOM 6136  C CE1   . HIS G 3 69  ? 104.116 15.004  23.064  1.00 55.53  ? 86  HIS E CE1   1 
ATOM 6137  N NE2   . HIS G 3 69  ? 104.644 14.484  21.970  1.00 54.74  ? 86  HIS E NE2   1 
ATOM 6138  N N     . PRO G 3 70  ? 103.854 10.097  20.808  1.00 88.18  ? 87  PRO E N     1 
ATOM 6139  C CA    . PRO G 3 70  ? 104.691 9.441   19.801  1.00 89.54  ? 87  PRO E CA    1 
ATOM 6140  C C     . PRO G 3 70  ? 106.193 9.699   19.919  1.00 90.60  ? 87  PRO E C     1 
ATOM 6141  O O     . PRO G 3 70  ? 106.964 9.254   19.070  1.00 57.88  ? 87  PRO E O     1 
ATOM 6142  C CB    . PRO G 3 70  ? 104.114 9.961   18.486  1.00 43.32  ? 87  PRO E CB    1 
ATOM 6143  C CG    . PRO G 3 70  ? 103.705 11.323  18.836  1.00 40.72  ? 87  PRO E CG    1 
ATOM 6144  C CD    . PRO G 3 70  ? 103.008 11.117  20.167  1.00 40.10  ? 87  PRO E CD    1 
ATOM 6145  N N     . HIS G 3 71  ? 106.604 10.423  20.957  1.00 98.93  ? 88  HIS E N     1 
ATOM 6146  C CA    . HIS G 3 71  ? 108.022 10.704  21.177  1.00 99.50  ? 88  HIS E CA    1 
ATOM 6147  C C     . HIS G 3 71  ? 108.626 9.566   21.992  1.00 100.34 ? 88  HIS E C     1 
ATOM 6148  O O     . HIS G 3 71  ? 108.017 9.097   22.953  1.00 47.73  ? 88  HIS E O     1 
ATOM 6149  C CB    . HIS G 3 71  ? 108.190 12.020  21.938  1.00 49.54  ? 88  HIS E CB    1 
ATOM 6150  C CG    . HIS G 3 71  ? 108.139 13.233  21.066  1.00 46.56  ? 88  HIS E CG    1 
ATOM 6151  N ND1   . HIS G 3 71  ? 107.931 14.500  21.569  1.00 44.93  ? 88  HIS E ND1   1 
ATOM 6152  C CD2   . HIS G 3 71  ? 108.285 13.375  19.727  1.00 47.16  ? 88  HIS E CD2   1 
ATOM 6153  C CE1   . HIS G 3 71  ? 107.951 15.370  20.574  1.00 47.00  ? 88  HIS E CE1   1 
ATOM 6154  N NE2   . HIS G 3 71  ? 108.164 14.714  19.446  1.00 47.44  ? 88  HIS E NE2   1 
ATOM 6155  N N     . GLU G 3 72  ? 109.819 9.118   21.615  1.00 56.78  ? 89  GLU E N     1 
ATOM 6156  C CA    . GLU G 3 72  ? 110.459 8.028   22.346  1.00 55.99  ? 89  GLU E CA    1 
ATOM 6157  C C     . GLU G 3 72  ? 111.373 8.538   23.441  1.00 55.70  ? 89  GLU E C     1 
ATOM 6158  O O     . GLU G 3 72  ? 112.213 9.417   23.222  1.00 65.89  ? 89  GLU E O     1 
ATOM 6159  C CB    . GLU G 3 72  ? 111.265 7.136   21.405  1.00 56.10  ? 89  GLU E CB    1 
ATOM 6160  C CG    . GLU G 3 72  ? 110.462 6.611   20.247  1.00 54.95  ? 89  GLU E CG    1 
ATOM 6161  C CD    . GLU G 3 72  ? 111.249 5.659   19.393  1.00 54.23  ? 89  GLU E CD    1 
ATOM 6162  O OE1   . GLU G 3 72  ? 111.593 4.570   19.897  1.00 53.00  ? 89  GLU E OE1   1 
ATOM 6163  O OE2   . GLU G 3 72  ? 111.529 5.997   18.224  1.00 52.38  ? 89  GLU E OE2   1 
ATOM 6164  N N     . LEU G 3 73  ? 111.188 7.987   24.632  1.00 71.89  ? 90  LEU E N     1 
ATOM 6165  C CA    . LEU G 3 73  ? 112.008 8.341   25.776  1.00 69.20  ? 90  LEU E CA    1 
ATOM 6166  C C     . LEU G 3 73  ? 113.259 7.475   25.539  1.00 69.25  ? 90  LEU E C     1 
ATOM 6167  O O     . LEU G 3 73  ? 113.497 6.485   26.226  1.00 45.58  ? 90  LEU E O     1 
ATOM 6168  C CB    . LEU G 3 73  ? 111.250 7.960   27.058  1.00 3.04   ? 90  LEU E CB    1 
ATOM 6169  C CG    . LEU G 3 73  ? 111.549 8.573   28.429  1.00 2.00   ? 90  LEU E CG    1 
ATOM 6170  C CD1   . LEU G 3 73  ? 110.344 8.386   29.305  1.00 2.00   ? 90  LEU E CD1   1 
ATOM 6171  C CD2   . LEU G 3 73  ? 112.752 7.896   29.095  1.00 2.00   ? 90  LEU E CD2   1 
ATOM 6172  N N     . VAL G 3 74  ? 114.033 7.859   24.523  1.00 77.42  ? 91  VAL E N     1 
ATOM 6173  C CA    . VAL G 3 74  ? 115.246 7.155   24.104  1.00 79.45  ? 91  VAL E CA    1 
ATOM 6174  C C     . VAL G 3 74  ? 116.477 7.330   24.993  1.00 80.32  ? 91  VAL E C     1 
ATOM 6175  O O     . VAL G 3 74  ? 117.250 8.261   24.806  1.00 45.88  ? 91  VAL E O     1 
ATOM 6176  C CB    . VAL G 3 74  ? 115.644 7.580   22.665  1.00 50.21  ? 91  VAL E CB    1 
ATOM 6177  C CG1   . VAL G 3 74  ? 114.617 7.069   21.670  1.00 50.27  ? 91  VAL E CG1   1 
ATOM 6178  C CG2   . VAL G 3 74  ? 115.737 9.097   22.565  1.00 51.75  ? 91  VAL E CG2   1 
ATOM 6179  N N     . GLY G 3 75  ? 116.680 6.417   25.936  1.00 80.08  ? 92  GLY E N     1 
ATOM 6180  C CA    . GLY G 3 75  ? 117.833 6.526   26.815  1.00 82.99  ? 92  GLY E CA    1 
ATOM 6181  C C     . GLY G 3 75  ? 118.223 5.204   27.446  1.00 85.02  ? 92  GLY E C     1 
ATOM 6182  O O     . GLY G 3 75  ? 118.032 4.147   26.845  1.00 71.27  ? 92  GLY E O     1 
ATOM 6183  N N     . LYS G 3 76  ? 118.774 5.265   28.658  1.00 45.26  ? 93  LYS E N     1 
ATOM 6184  C CA    . LYS G 3 76  ? 119.184 4.063   29.381  1.00 46.30  ? 93  LYS E CA    1 
ATOM 6185  C C     . LYS G 3 76  ? 117.990 3.166   29.664  1.00 45.95  ? 93  LYS E C     1 
ATOM 6186  O O     . LYS G 3 76  ? 116.899 3.655   29.934  1.00 68.30  ? 93  LYS E O     1 
ATOM 6187  C CB    . LYS G 3 76  ? 119.880 4.437   30.698  1.00 71.39  ? 93  LYS E CB    1 
ATOM 6188  C CG    . LYS G 3 76  ? 119.138 5.423   31.605  1.00 74.37  ? 93  LYS E CG    1 
ATOM 6189  C CD    . LYS G 3 76  ? 117.895 4.835   32.251  1.00 77.53  ? 93  LYS E CD    1 
ATOM 6190  C CE    . LYS G 3 76  ? 117.427 5.674   33.440  1.00 78.56  ? 93  LYS E CE    1 
ATOM 6191  N NZ    . LYS G 3 76  ? 116.996 7.052   33.077  1.00 79.30  ? 93  LYS E NZ    1 
ATOM 6192  N N     . ASP G 3 77  ? 118.204 1.856   29.599  1.00 88.80  ? 94  ASP E N     1 
ATOM 6193  C CA    . ASP G 3 77  ? 117.131 0.901   29.834  1.00 89.71  ? 94  ASP E CA    1 
ATOM 6194  C C     . ASP G 3 77  ? 115.867 1.377   29.123  1.00 89.64  ? 94  ASP E C     1 
ATOM 6195  O O     . ASP G 3 77  ? 114.754 1.017   29.515  1.00 97.40  ? 94  ASP E O     1 
ATOM 6196  C CB    . ASP G 3 77  ? 116.833 0.767   31.334  1.00 98.24  ? 94  ASP E CB    1 
ATOM 6197  C CG    . ASP G 3 77  ? 117.987 0.170   32.119  1.00 100.16 ? 94  ASP E CG    1 
ATOM 6198  O OD1   . ASP G 3 77  ? 118.480 -0.914  31.737  1.00 102.31 ? 94  ASP E OD1   1 
ATOM 6199  O OD2   . ASP G 3 77  ? 118.391 0.783   33.129  1.00 98.16  ? 94  ASP E OD2   1 
ATOM 6200  N N     . CYS G 3 78  ? 116.036 2.194   28.087  1.00 67.84  ? 95  CYS E N     1 
ATOM 6201  C CA    . CYS G 3 78  ? 114.891 2.718   27.346  1.00 66.94  ? 95  CYS E CA    1 
ATOM 6202  C C     . CYS G 3 78  ? 114.761 2.106   25.951  1.00 67.40  ? 95  CYS E C     1 
ATOM 6203  O O     . CYS G 3 78  ? 115.356 2.600   24.989  1.00 93.18  ? 95  CYS E O     1 
ATOM 6204  C CB    . CYS G 3 78  ? 114.983 4.246   27.234  1.00 85.50  ? 95  CYS E CB    1 
ATOM 6205  S SG    . CYS G 3 78  ? 114.493 5.169   28.728  1.00 81.25  ? 95  CYS E SG    1 
ATOM 6206  N N     . ARG G 3 79  ? 113.971 1.038   25.849  1.00 66.32  ? 96  ARG E N     1 
ATOM 6207  C CA    . ARG G 3 79  ? 113.754 0.353   24.581  1.00 65.73  ? 96  ARG E CA    1 
ATOM 6208  C C     . ARG G 3 79  ? 112.291 0.314   24.204  1.00 66.49  ? 96  ARG E C     1 
ATOM 6209  O O     . ARG G 3 79  ? 111.434 0.010   25.030  1.00 56.37  ? 96  ARG E O     1 
ATOM 6210  C CB    . ARG G 3 79  ? 114.323 -1.063  24.639  1.00 54.45  ? 96  ARG E CB    1 
ATOM 6211  C CG    . ARG G 3 79  ? 115.803 -1.081  24.289  1.00 52.88  ? 96  ARG E CG    1 
ATOM 6212  C CD    . ARG G 3 79  ? 116.503 -2.348  24.722  1.00 50.12  ? 96  ARG E CD    1 
ATOM 6213  N NE    . ARG G 3 79  ? 116.369 -2.566  26.155  1.00 46.89  ? 96  ARG E NE    1 
ATOM 6214  C CZ    . ARG G 3 79  ? 117.243 -3.260  26.877  1.00 43.93  ? 96  ARG E CZ    1 
ATOM 6215  N NH1   . ARG G 3 79  ? 118.311 -3.793  26.282  1.00 39.56  ? 96  ARG E NH1   1 
ATOM 6216  N NH2   . ARG G 3 79  ? 117.053 -3.424  28.186  1.00 39.96  ? 96  ARG E NH2   1 
ATOM 6217  N N     . ASP G 3 80  ? 112.027 0.632   22.940  1.00 81.05  ? 97  ASP E N     1 
ATOM 6218  C CA    . ASP G 3 80  ? 110.678 0.681   22.381  1.00 82.69  ? 97  ASP E CA    1 
ATOM 6219  C C     . ASP G 3 80  ? 109.975 1.992   22.736  1.00 81.97  ? 97  ASP E C     1 
ATOM 6220  O O     . ASP G 3 80  ? 108.748 2.092   22.665  1.00 75.19  ? 97  ASP E O     1 
ATOM 6221  C CB    . ASP G 3 80  ? 109.848 -0.532  22.828  1.00 74.10  ? 97  ASP E CB    1 
ATOM 6222  C CG    . ASP G 3 80  ? 109.995 -1.724  21.885  1.00 76.24  ? 97  ASP E CG    1 
ATOM 6223  O OD1   . ASP G 3 80  ? 109.554 -2.834  22.248  1.00 76.62  ? 97  ASP E OD1   1 
ATOM 6224  O OD2   . ASP G 3 80  ? 110.543 -1.551  20.775  1.00 78.80  ? 97  ASP E OD2   1 
ATOM 6225  N N     . GLY G 3 81  ? 110.773 2.991   23.119  1.00 54.01  ? 98  GLY E N     1 
ATOM 6226  C CA    . GLY G 3 81  ? 110.242 4.306   23.432  1.00 51.16  ? 98  GLY E CA    1 
ATOM 6227  C C     . GLY G 3 81  ? 110.063 4.704   24.878  1.00 50.47  ? 98  GLY E C     1 
ATOM 6228  O O     . GLY G 3 81  ? 110.261 5.863   25.223  1.00 42.20  ? 98  GLY E O     1 
ATOM 6229  N N     . TYR G 3 82  ? 109.679 3.754   25.721  1.00 49.57  ? 99  TYR E N     1 
ATOM 6230  C CA    . TYR G 3 82  ? 109.453 4.020   27.141  1.00 48.79  ? 99  TYR E CA    1 
ATOM 6231  C C     . TYR G 3 82  ? 110.656 3.602   27.954  1.00 50.14  ? 99  TYR E C     1 
ATOM 6232  O O     . TYR G 3 82  ? 111.765 3.523   27.443  1.00 53.53  ? 99  TYR E O     1 
ATOM 6233  C CB    . TYR G 3 82  ? 108.240 3.231   27.634  1.00 43.32  ? 99  TYR E CB    1 
ATOM 6234  C CG    . TYR G 3 82  ? 108.391 1.743   27.436  1.00 40.31  ? 99  TYR E CG    1 
ATOM 6235  C CD1   . TYR G 3 82  ? 108.014 1.135   26.244  1.00 37.96  ? 99  TYR E CD1   1 
ATOM 6236  C CD2   . TYR G 3 82  ? 108.978 0.950   28.416  1.00 41.45  ? 99  TYR E CD2   1 
ATOM 6237  C CE1   . TYR G 3 82  ? 108.223 -0.227  26.034  1.00 38.11  ? 99  TYR E CE1   1 
ATOM 6238  C CE2   . TYR G 3 82  ? 109.192 -0.409  28.213  1.00 39.74  ? 99  TYR E CE2   1 
ATOM 6239  C CZ    . TYR G 3 82  ? 108.815 -0.989  27.023  1.00 37.55  ? 99  TYR E CZ    1 
ATOM 6240  O OH    . TYR G 3 82  ? 109.044 -2.325  26.825  1.00 35.92  ? 99  TYR E OH    1 
ATOM 6241  N N     . TYR G 3 83  ? 110.418 3.331   29.231  1.00 48.21  ? 100 TYR E N     1 
ATOM 6242  C CA    . TYR G 3 83  ? 111.463 2.879   30.144  1.00 50.20  ? 100 TYR E CA    1 
ATOM 6243  C C     . TYR G 3 83  ? 110.898 1.736   30.962  1.00 51.35  ? 100 TYR E C     1 
ATOM 6244  O O     . TYR G 3 83  ? 109.704 1.703   31.230  1.00 81.61  ? 100 TYR E O     1 
ATOM 6245  C CB    . TYR G 3 83  ? 111.908 4.026   31.060  1.00 87.62  ? 100 TYR E CB    1 
ATOM 6246  C CG    . TYR G 3 83  ? 112.616 3.593   32.330  1.00 89.57  ? 100 TYR E CG    1 
ATOM 6247  C CD1   . TYR G 3 83  ? 111.891 3.299   33.487  1.00 90.93  ? 100 TYR E CD1   1 
ATOM 6248  C CD2   . TYR G 3 83  ? 114.008 3.488   32.382  1.00 89.78  ? 100 TYR E CD2   1 
ATOM 6249  C CE1   . TYR G 3 83  ? 112.534 2.911   34.670  1.00 91.38  ? 100 TYR E CE1   1 
ATOM 6250  C CE2   . TYR G 3 83  ? 114.662 3.099   33.560  1.00 90.79  ? 100 TYR E CE2   1 
ATOM 6251  C CZ    . TYR G 3 83  ? 113.917 2.815   34.700  1.00 91.70  ? 100 TYR E CZ    1 
ATOM 6252  O OH    . TYR G 3 83  ? 114.550 2.449   35.870  1.00 92.59  ? 100 TYR E OH    1 
ATOM 6253  N N     . GLU G 3 84  ? 111.742 0.787   31.341  1.00 42.95  ? 101 GLU E N     1 
ATOM 6254  C CA    . GLU G 3 84  ? 111.275 -0.343  32.134  1.00 45.75  ? 101 GLU E CA    1 
ATOM 6255  C C     . GLU G 3 84  ? 112.440 -1.001  32.864  1.00 46.36  ? 101 GLU E C     1 
ATOM 6256  O O     . GLU G 3 84  ? 113.274 -1.659  32.244  1.00 90.40  ? 101 GLU E O     1 
ATOM 6257  C CB    . GLU G 3 84  ? 110.577 -1.354  31.226  1.00 96.59  ? 101 GLU E CB    1 
ATOM 6258  C CG    . GLU G 3 84  ? 109.747 -2.391  31.952  1.00 101.74 ? 101 GLU E CG    1 
ATOM 6259  C CD    . GLU G 3 84  ? 108.852 -3.168  31.003  1.00 104.72 ? 101 GLU E CD    1 
ATOM 6260  O OE1   . GLU G 3 84  ? 108.025 -2.532  30.315  1.00 108.24 ? 101 GLU E OE1   1 
ATOM 6261  O OE2   . GLU G 3 84  ? 108.970 -4.412  30.940  1.00 103.92 ? 101 GLU E OE2   1 
ATOM 6262  N N     . ALA G 3 85  ? 112.495 -0.820  34.180  1.00 53.54  ? 102 ALA E N     1 
ATOM 6263  C CA    . ALA G 3 85  ? 113.568 -1.390  34.978  1.00 55.08  ? 102 ALA E CA    1 
ATOM 6264  C C     . ALA G 3 85  ? 113.115 -1.648  36.412  1.00 55.45  ? 102 ALA E C     1 
ATOM 6265  O O     . ALA G 3 85  ? 112.518 -0.774  37.048  1.00 93.02  ? 102 ALA E O     1 
ATOM 6266  C CB    . ALA G 3 85  ? 114.766 -0.451  34.969  1.00 95.53  ? 102 ALA E CB    1 
ATOM 6267  N N     . ASP G 3 86  ? 113.406 -2.843  36.922  1.00 86.88  ? 103 ASP E N     1 
ATOM 6268  C CA    . ASP G 3 86  ? 113.019 -3.208  38.282  1.00 86.83  ? 103 ASP E CA    1 
ATOM 6269  C C     . ASP G 3 86  ? 113.473 -2.151  39.276  1.00 86.51  ? 103 ASP E C     1 
ATOM 6270  O O     . ASP G 3 86  ? 114.632 -1.737  39.257  1.00 91.48  ? 103 ASP E O     1 
ATOM 6271  C CB    . ASP G 3 86  ? 113.614 -4.564  38.673  1.00 88.35  ? 103 ASP E CB    1 
ATOM 6272  C CG    . ASP G 3 86  ? 113.181 -5.010  40.060  1.00 89.40  ? 103 ASP E CG    1 
ATOM 6273  O OD1   . ASP G 3 86  ? 113.596 -4.374  41.049  1.00 88.56  ? 103 ASP E OD1   1 
ATOM 6274  O OD2   . ASP G 3 86  ? 112.415 -5.991  40.161  1.00 89.30  ? 103 ASP E OD2   1 
ATOM 6275  N N     . LEU G 3 87  ? 112.554 -1.723  40.141  1.00 56.85  ? 104 LEU E N     1 
ATOM 6276  C CA    . LEU G 3 87  ? 112.851 -0.708  41.148  1.00 56.72  ? 104 LEU E CA    1 
ATOM 6277  C C     . LEU G 3 87  ? 113.571 -1.275  42.374  1.00 55.21  ? 104 LEU E C     1 
ATOM 6278  O O     . LEU G 3 87  ? 113.399 -2.449  42.707  1.00 82.61  ? 104 LEU E O     1 
ATOM 6279  C CB    . LEU G 3 87  ? 111.563 0.000   41.581  1.00 83.11  ? 104 LEU E CB    1 
ATOM 6280  C CG    . LEU G 3 87  ? 110.451 -0.809  42.245  1.00 83.67  ? 104 LEU E CG    1 
ATOM 6281  C CD1   . LEU G 3 87  ? 109.303 0.124   42.589  1.00 83.79  ? 104 LEU E CD1   1 
ATOM 6282  C CD2   . LEU G 3 87  ? 109.976 -1.909  41.324  1.00 85.43  ? 104 LEU E CD2   1 
ATOM 6283  N N     . CYS G 3 88  ? 114.378 -0.437  43.031  1.00 91.30  ? 105 CYS E N     1 
ATOM 6284  C CA    . CYS G 3 88  ? 115.133 -0.848  44.218  1.00 88.33  ? 105 CYS E CA    1 
ATOM 6285  C C     . CYS G 3 88  ? 114.378 -1.899  45.020  1.00 87.18  ? 105 CYS E C     1 
ATOM 6286  O O     . CYS G 3 88  ? 113.359 -1.600  45.651  1.00 87.77  ? 105 CYS E O     1 
ATOM 6287  C CB    . CYS G 3 88  ? 115.435 0.355   45.127  1.00 88.80  ? 105 CYS E CB    1 
ATOM 6288  S SG    . CYS G 3 88  ? 116.846 1.397   44.637  1.00 84.16  ? 105 CYS E SG    1 
ATOM 6289  N N     . PRO G 3 89  ? 114.864 -3.152  44.996  1.00 66.32  ? 106 PRO E N     1 
ATOM 6290  C CA    . PRO G 3 89  ? 114.231 -4.255  45.727  1.00 65.63  ? 106 PRO E CA    1 
ATOM 6291  C C     . PRO G 3 89  ? 114.216 -4.036  47.241  1.00 65.87  ? 106 PRO E C     1 
ATOM 6292  O O     . PRO G 3 89  ? 113.408 -4.630  47.956  1.00 54.87  ? 106 PRO E O     1 
ATOM 6293  C CB    . PRO G 3 89  ? 115.079 -5.463  45.332  1.00 53.34  ? 106 PRO E CB    1 
ATOM 6294  C CG    . PRO G 3 89  ? 115.555 -5.108  43.953  1.00 52.75  ? 106 PRO E CG    1 
ATOM 6295  C CD    . PRO G 3 89  ? 115.944 -3.659  44.129  1.00 54.50  ? 106 PRO E CD    1 
ATOM 6296  N N     . ASP G 3 90  ? 115.106 -3.170  47.721  1.00 71.78  ? 107 ASP E N     1 
ATOM 6297  C CA    . ASP G 3 90  ? 115.208 -2.888  49.150  1.00 71.09  ? 107 ASP E CA    1 
ATOM 6298  C C     . ASP G 3 90  ? 114.597 -1.541  49.555  1.00 71.28  ? 107 ASP E C     1 
ATOM 6299  O O     . ASP G 3 90  ? 113.931 -1.441  50.587  1.00 89.90  ? 107 ASP E O     1 
ATOM 6300  C CB    . ASP G 3 90  ? 116.682 -2.935  49.584  1.00 86.22  ? 107 ASP E CB    1 
ATOM 6301  C CG    . ASP G 3 90  ? 117.362 -4.259  49.235  1.00 87.83  ? 107 ASP E CG    1 
ATOM 6302  O OD1   . ASP G 3 90  ? 117.839 -4.418  48.086  1.00 86.41  ? 107 ASP E OD1   1 
ATOM 6303  O OD2   . ASP G 3 90  ? 117.413 -5.145  50.114  1.00 86.45  ? 107 ASP E OD2   1 
ATOM 6304  N N     . ARG G 3 91  ? 114.829 -0.514  48.739  1.00 92.11  ? 108 ARG E N     1 
ATOM 6305  C CA    . ARG G 3 91  ? 114.315 0.832   49.008  1.00 91.49  ? 108 ARG E CA    1 
ATOM 6306  C C     . ARG G 3 91  ? 112.990 1.124   48.285  1.00 91.62  ? 108 ARG E C     1 
ATOM 6307  O O     . ARG G 3 91  ? 112.633 0.448   47.313  1.00 82.05  ? 108 ARG E O     1 
ATOM 6308  C CB    . ARG G 3 91  ? 115.358 1.885   48.596  1.00 77.89  ? 108 ARG E CB    1 
ATOM 6309  C CG    . ARG G 3 91  ? 116.699 1.792   49.319  1.00 75.59  ? 108 ARG E CG    1 
ATOM 6310  C CD    . ARG G 3 91  ? 116.543 1.966   50.822  1.00 72.13  ? 108 ARG E CD    1 
ATOM 6311  N NE    . ARG G 3 91  ? 117.821 1.876   51.529  1.00 68.61  ? 108 ARG E NE    1 
ATOM 6312  C CZ    . ARG G 3 91  ? 118.704 2.866   51.652  1.00 66.97  ? 108 ARG E CZ    1 
ATOM 6313  N NH1   . ARG G 3 91  ? 118.463 4.053   51.114  1.00 67.03  ? 108 ARG E NH1   1 
ATOM 6314  N NH2   . ARG G 3 91  ? 119.837 2.662   52.317  1.00 66.39  ? 108 ARG E NH2   1 
ATOM 6315  N N     . SER G 3 92  ? 112.266 2.133   48.771  1.00 80.46  ? 109 SER E N     1 
ATOM 6316  C CA    . SER G 3 92  ? 110.993 2.528   48.169  1.00 81.42  ? 109 SER E CA    1 
ATOM 6317  C C     . SER G 3 92  ? 111.246 3.633   47.152  1.00 80.07  ? 109 SER E C     1 
ATOM 6318  O O     . SER G 3 92  ? 111.182 3.385   45.947  1.00 86.69  ? 109 SER E O     1 
ATOM 6319  C CB    . SER G 3 92  ? 110.005 3.023   49.236  1.00 85.17  ? 109 SER E CB    1 
ATOM 6320  O OG    . SER G 3 92  ? 110.371 4.292   49.755  1.00 82.89  ? 109 SER E OG    1 
ATOM 6321  N N     . ILE G 3 93  ? 111.543 4.844   47.631  1.00 39.25  ? 110 ILE E N     1 
ATOM 6322  C CA    . ILE G 3 93  ? 111.813 5.981   46.747  1.00 37.32  ? 110 ILE E CA    1 
ATOM 6323  C C     . ILE G 3 93  ? 112.980 5.716   45.779  1.00 35.69  ? 110 ILE E C     1 
ATOM 6324  O O     . ILE G 3 93  ? 114.155 5.837   46.146  1.00 68.36  ? 110 ILE E O     1 
ATOM 6325  C CB    . ILE G 3 93  ? 112.116 7.256   47.555  1.00 63.16  ? 110 ILE E CB    1 
ATOM 6326  C CG1   . ILE G 3 93  ? 110.886 7.657   48.366  1.00 64.32  ? 110 ILE E CG1   1 
ATOM 6327  C CG2   . ILE G 3 93  ? 112.498 8.387   46.617  1.00 62.71  ? 110 ILE E CG2   1 
ATOM 6328  C CD1   . ILE G 3 93  ? 111.056 8.955   49.115  1.00 67.69  ? 110 ILE E CD1   1 
ATOM 6329  N N     . HIS G 3 94  ? 112.631 5.375   44.537  1.00 46.33  ? 111 HIS E N     1 
ATOM 6330  C CA    . HIS G 3 94  ? 113.604 5.070   43.484  1.00 47.15  ? 111 HIS E CA    1 
ATOM 6331  C C     . HIS G 3 94  ? 113.755 6.192   42.430  1.00 50.43  ? 111 HIS E C     1 
ATOM 6332  O O     . HIS G 3 94  ? 112.830 6.459   41.661  1.00 70.03  ? 111 HIS E O     1 
ATOM 6333  C CB    . HIS G 3 94  ? 113.190 3.751   42.822  1.00 68.54  ? 111 HIS E CB    1 
ATOM 6334  C CG    . HIS G 3 94  ? 114.004 3.388   41.623  1.00 64.69  ? 111 HIS E CG    1 
ATOM 6335  N ND1   . HIS G 3 94  ? 113.864 4.026   40.409  1.00 60.85  ? 111 HIS E ND1   1 
ATOM 6336  C CD2   . HIS G 3 94  ? 114.964 2.450   41.449  1.00 62.24  ? 111 HIS E CD2   1 
ATOM 6337  C CE1   . HIS G 3 94  ? 114.703 3.495   39.537  1.00 61.71  ? 111 HIS E CE1   1 
ATOM 6338  N NE2   . HIS G 3 94  ? 115.382 2.537   40.142  1.00 63.43  ? 111 HIS E NE2   1 
ATOM 6339  N N     . SER G 3 95  ? 114.932 6.827   42.402  1.00 89.64  ? 112 SER E N     1 
ATOM 6340  C CA    . SER G 3 95  ? 115.239 7.937   41.482  1.00 92.70  ? 112 SER E CA    1 
ATOM 6341  C C     . SER G 3 95  ? 115.680 7.508   40.077  1.00 92.95  ? 112 SER E C     1 
ATOM 6342  O O     . SER G 3 95  ? 116.206 6.410   39.890  1.00 108.33 ? 112 SER E O     1 
ATOM 6343  C CB    . SER G 3 95  ? 116.330 8.814   42.090  1.00 99.52  ? 112 SER E CB    1 
ATOM 6344  O OG    . SER G 3 95  ? 116.086 9.022   43.468  1.00 99.68  ? 112 SER E OG    1 
ATOM 6345  N N     . PHE G 3 96  ? 115.493 8.392   39.097  1.00 77.59  ? 113 PHE E N     1 
ATOM 6346  C CA    . PHE G 3 96  ? 115.852 8.089   37.705  1.00 78.74  ? 113 PHE E CA    1 
ATOM 6347  C C     . PHE G 3 96  ? 116.810 9.107   37.058  1.00 79.65  ? 113 PHE E C     1 
ATOM 6348  O O     . PHE G 3 96  ? 116.486 10.290  36.913  1.00 89.11  ? 113 PHE E O     1 
ATOM 6349  C CB    . PHE G 3 96  ? 114.571 7.961   36.869  1.00 81.92  ? 113 PHE E CB    1 
ATOM 6350  C CG    . PHE G 3 96  ? 113.555 7.003   37.454  1.00 80.63  ? 113 PHE E CG    1 
ATOM 6351  C CD1   . PHE G 3 96  ? 112.762 7.381   38.535  1.00 80.14  ? 113 PHE E CD1   1 
ATOM 6352  C CD2   . PHE G 3 96  ? 113.405 5.716   36.934  1.00 78.41  ? 113 PHE E CD2   1 
ATOM 6353  C CE1   . PHE G 3 96  ? 111.839 6.494   39.085  1.00 78.92  ? 113 PHE E CE1   1 
ATOM 6354  C CE2   . PHE G 3 96  ? 112.483 4.824   37.482  1.00 77.68  ? 113 PHE E CE2   1 
ATOM 6355  C CZ    . PHE G 3 96  ? 111.701 5.217   38.558  1.00 78.92  ? 113 PHE E CZ    1 
ATOM 6356  N N     . GLN G 3 97  ? 117.984 8.632   36.651  1.00 52.17  ? 114 GLN E N     1 
ATOM 6357  C CA    . GLN G 3 97  ? 118.990 9.504   36.056  1.00 51.86  ? 114 GLN E CA    1 
ATOM 6358  C C     . GLN G 3 97  ? 119.438 8.982   34.701  1.00 50.44  ? 114 GLN E C     1 
ATOM 6359  O O     . GLN G 3 97  ? 119.939 7.864   34.601  1.00 48.39  ? 114 GLN E O     1 
ATOM 6360  C CB    . GLN G 3 97  ? 120.223 9.601   36.959  1.00 58.60  ? 114 GLN E CB    1 
ATOM 6361  C CG    . GLN G 3 97  ? 119.993 9.294   38.438  1.00 63.29  ? 114 GLN E CG    1 
ATOM 6362  C CD    . GLN G 3 97  ? 121.267 9.415   39.271  1.00 65.02  ? 114 GLN E CD    1 
ATOM 6363  O OE1   . GLN G 3 97  ? 121.317 8.964   40.412  1.00 68.20  ? 114 GLN E OE1   1 
ATOM 6364  N NE2   . GLN G 3 97  ? 122.294 10.034  38.702  1.00 64.42  ? 114 GLN E NE2   1 
ATOM 6365  N N     . ASN G 3 98  ? 119.281 9.819   33.678  1.00 69.74  ? 115 ASN E N     1 
ATOM 6366  C CA    . ASN G 3 98  ? 119.638 9.509   32.292  1.00 65.96  ? 115 ASN E CA    1 
ATOM 6367  C C     . ASN G 3 98  ? 118.389 9.046   31.560  1.00 62.61  ? 115 ASN E C     1 
ATOM 6368  O O     . ASN G 3 98  ? 118.265 7.893   31.166  1.00 72.84  ? 115 ASN E O     1 
ATOM 6369  C CB    . ASN G 3 98  ? 120.729 8.428   32.206  1.00 83.77  ? 115 ASN E CB    1 
ATOM 6370  C CG    . ASN G 3 98  ? 121.204 8.178   30.772  1.00 84.85  ? 115 ASN E CG    1 
ATOM 6371  O OD1   . ASN G 3 98  ? 120.478 7.617   29.949  1.00 84.74  ? 115 ASN E OD1   1 
ATOM 6372  N ND2   . ASN G 3 98  ? 122.429 8.604   30.472  1.00 84.15  ? 115 ASN E ND2   1 
ATOM 6373  N N     . LEU G 3 99  ? 117.453 9.966   31.393  1.00 74.77  ? 116 LEU E N     1 
ATOM 6374  C CA    . LEU G 3 99  ? 116.211 9.668   30.702  1.00 71.96  ? 116 LEU E CA    1 
ATOM 6375  C C     . LEU G 3 99  ? 116.358 10.054  29.234  1.00 71.46  ? 116 LEU E C     1 
ATOM 6376  O O     . LEU G 3 99  ? 116.902 9.292   28.419  1.00 55.35  ? 116 LEU E O     1 
ATOM 6377  C CB    . LEU G 3 99  ? 115.061 10.451  31.346  1.00 27.28  ? 116 LEU E CB    1 
ATOM 6378  C CG    . LEU G 3 99  ? 114.986 10.204  32.863  1.00 24.67  ? 116 LEU E CG    1 
ATOM 6379  C CD1   . LEU G 3 99  ? 115.697 11.346  33.650  1.00 23.85  ? 116 LEU E CD1   1 
ATOM 6380  C CD2   . LEU G 3 99  ? 113.513 10.050  33.268  1.00 22.07  ? 116 LEU E CD2   1 
ATOM 6381  N N     . GLY G 3 100 ? 115.891 11.253  28.906  1.00 43.43  ? 117 GLY E N     1 
ATOM 6382  C CA    . GLY G 3 100 ? 115.980 11.705  27.534  1.00 43.23  ? 117 GLY E CA    1 
ATOM 6383  C C     . GLY G 3 100 ? 114.619 11.751  26.868  1.00 43.36  ? 117 GLY E C     1 
ATOM 6384  O O     . GLY G 3 100 ? 113.628 11.209  27.370  1.00 57.13  ? 117 GLY E O     1 
ATOM 6385  N N     . ILE G 3 101 ? 114.564 12.426  25.732  1.00 39.16  ? 118 ILE E N     1 
ATOM 6386  C CA    . ILE G 3 101 ? 113.326 12.535  24.992  1.00 34.92  ? 118 ILE E CA    1 
ATOM 6387  C C     . ILE G 3 101 ? 113.689 12.680  23.530  1.00 34.94  ? 118 ILE E C     1 
ATOM 6388  O O     . ILE G 3 101 ? 114.707 13.276  23.176  1.00 19.63  ? 118 ILE E O     1 
ATOM 6389  C CB    . ILE G 3 101 ? 112.491 13.747  25.434  1.00 31.44  ? 118 ILE E CB    1 
ATOM 6390  C CG1   . ILE G 3 101 ? 112.288 13.739  26.958  1.00 31.71  ? 118 ILE E CG1   1 
ATOM 6391  C CG2   . ILE G 3 101 ? 111.147 13.717  24.709  1.00 30.72  ? 118 ILE E CG2   1 
ATOM 6392  C CD1   . ILE G 3 101 ? 111.531 14.952  27.477  1.00 27.69  ? 118 ILE E CD1   1 
ATOM 6393  N N     . GLN G 3 102 ? 112.853 12.119  22.686  1.00 9.08   ? 119 GLN E N     1 
ATOM 6394  C CA    . GLN G 3 102 ? 113.112 12.131  21.254  1.00 9.08   ? 119 GLN E CA    1 
ATOM 6395  C C     . GLN G 3 102 ? 111.938 12.699  20.465  1.00 9.08   ? 119 GLN E C     1 
ATOM 6396  O O     . GLN G 3 102 ? 110.829 12.167  20.513  1.00 24.48  ? 119 GLN E O     1 
ATOM 6397  C CB    . GLN G 3 102 ? 113.432 10.720  20.764  1.00 42.65  ? 119 GLN E CB    1 
ATOM 6398  C CG    . GLN G 3 102 ? 114.683 10.626  19.909  1.00 45.47  ? 119 GLN E CG    1 
ATOM 6399  C CD    . GLN G 3 102 ? 114.682 9.401   19.018  1.00 20.00  ? 119 GLN E CD    1 
ATOM 6400  O OE1   . GLN G 3 102 ? 115.138 8.330   19.419  1.00 20.00  ? 119 GLN E OE1   1 
ATOM 6401  N NE2   . GLN G 3 102 ? 114.219 9.331   17.776  1.00 20.00  ? 119 GLN E NE2   1 
ATOM 6402  N N     . CYS G 3 103 ? 112.158 13.814  19.769  1.00 74.67  ? 120 CYS E N     1 
ATOM 6403  C CA    . CYS G 3 103 ? 111.144 14.432  18.923  1.00 75.17  ? 120 CYS E CA    1 
ATOM 6404  C C     . CYS G 3 103 ? 111.067 13.633  17.628  1.00 73.77  ? 120 CYS E C     1 
ATOM 6405  O O     . CYS G 3 103 ? 112.091 13.280  17.055  1.00 61.87  ? 120 CYS E O     1 
ATOM 6406  C CB    . CYS G 3 103 ? 111.529 15.880  18.601  1.00 60.64  ? 120 CYS E CB    1 
ATOM 6407  S SG    . CYS G 3 103 ? 110.596 16.626  17.224  1.00 65.44  ? 120 CYS E SG    1 
ATOM 6408  N N     . VAL G 3 104 ? 109.862 13.328  17.170  1.00 35.03  ? 121 VAL E N     1 
ATOM 6409  C CA    . VAL G 3 104 ? 109.713 12.589  15.928  1.00 35.73  ? 121 VAL E CA    1 
ATOM 6410  C C     . VAL G 3 104 ? 109.526 13.624  14.841  1.00 35.52  ? 121 VAL E C     1 
ATOM 6411  O O     . VAL G 3 104 ? 109.325 14.798  15.136  1.00 22.27  ? 121 VAL E O     1 
ATOM 6412  C CB    . VAL G 3 104 ? 108.474 11.719  15.945  1.00 14.61  ? 121 VAL E CB    1 
ATOM 6413  C CG1   . VAL G 3 104 ? 108.411 10.957  17.249  1.00 16.16  ? 121 VAL E CG1   1 
ATOM 6414  C CG2   . VAL G 3 104 ? 107.245 12.570  15.745  1.00 14.96  ? 121 VAL E CG2   1 
ATOM 6415  N N     . LYS G 3 105 ? 109.598 13.209  13.583  1.00 42.53  ? 122 LYS E N     1 
ATOM 6416  C CA    . LYS G 3 105 ? 109.396 14.153  12.493  1.00 40.83  ? 122 LYS E CA    1 
ATOM 6417  C C     . LYS G 3 105 ? 107.887 14.169  12.279  1.00 41.74  ? 122 LYS E C     1 
ATOM 6418  O O     . LYS G 3 105 ? 107.158 13.388  12.907  1.00 43.71  ? 122 LYS E O     1 
ATOM 6419  C CB    . LYS G 3 105 ? 110.121 13.686  11.220  1.00 46.46  ? 122 LYS E CB    1 
ATOM 6420  C CG    . LYS G 3 105 ? 111.643 13.482  11.382  1.00 44.53  ? 122 LYS E CG    1 
ATOM 6421  C CD    . LYS G 3 105 ? 112.409 13.459  10.031  1.00 41.84  ? 122 LYS E CD    1 
ATOM 6422  C CE    . LYS G 3 105 ? 112.598 12.042  9.446   1.00 42.18  ? 122 LYS E CE    1 
ATOM 6423  N NZ    . LYS G 3 105 ? 113.252 12.041  8.096   1.00 40.12  ? 122 LYS E NZ    1 
ATOM 6424  N N     . LYS G 3 106 ? 107.407 15.068  11.425  1.00 89.64  ? 123 LYS E N     1 
ATOM 6425  C CA    . LYS G 3 106 ? 105.977 15.130  11.144  1.00 91.26  ? 123 LYS E CA    1 
ATOM 6426  C C     . LYS G 3 106 ? 105.674 13.948  10.223  1.00 92.84  ? 123 LYS E C     1 
ATOM 6427  O O     . LYS G 3 106 ? 104.580 13.392  10.249  1.00 81.49  ? 123 LYS E O     1 
ATOM 6428  C CB    . LYS G 3 106 ? 105.616 16.460  10.469  1.00 70.15  ? 123 LYS E CB    1 
ATOM 6429  C CG    . LYS G 3 106 ? 104.118 16.677  10.208  1.00 66.74  ? 123 LYS E CG    1 
ATOM 6430  C CD    . LYS G 3 106 ? 103.289 16.814  11.487  1.00 62.16  ? 123 LYS E CD    1 
ATOM 6431  C CE    . LYS G 3 106 ? 101.817 17.108  11.156  1.00 67.11  ? 123 LYS E CE    1 
ATOM 6432  N NZ    . LYS G 3 106 ? 100.940 17.211  12.364  1.00 69.75  ? 123 LYS E NZ    1 
ATOM 6433  N N     . ARG G 3 107 ? 106.655 13.564  9.411   1.00 52.70  ? 124 ARG E N     1 
ATOM 6434  C CA    . ARG G 3 107 ? 106.489 12.425  8.524   1.00 55.20  ? 124 ARG E CA    1 
ATOM 6435  C C     . ARG G 3 107 ? 106.455 11.197  9.406   1.00 56.31  ? 124 ARG E C     1 
ATOM 6436  O O     . ARG G 3 107 ? 105.603 10.325  9.254   1.00 66.74  ? 124 ARG E O     1 
ATOM 6437  C CB    . ARG G 3 107 ? 107.673 12.282  7.572   1.00 77.49  ? 124 ARG E CB    1 
ATOM 6438  C CG    . ARG G 3 107 ? 107.613 10.997  6.732   1.00 78.09  ? 124 ARG E CG    1 
ATOM 6439  C CD    . ARG G 3 107 ? 108.964 10.582  6.151   1.00 80.60  ? 124 ARG E CD    1 
ATOM 6440  N NE    . ARG G 3 107 ? 109.661 11.679  5.488   1.00 81.51  ? 124 ARG E NE    1 
ATOM 6441  C CZ    . ARG G 3 107 ? 110.356 12.620  6.125   1.00 80.31  ? 124 ARG E CZ    1 
ATOM 6442  N NH1   . ARG G 3 107 ? 110.453 12.601  7.449   1.00 79.52  ? 124 ARG E NH1   1 
ATOM 6443  N NH2   . ARG G 3 107 ? 110.953 13.582  5.438   1.00 79.42  ? 124 ARG E NH2   1 
ATOM 6444  N N     . ASP G 3 108 ? 107.414 11.151  10.325  1.00 31.00  ? 125 ASP E N     1 
ATOM 6445  C CA    . ASP G 3 108 ? 107.576 10.048  11.267  1.00 32.45  ? 125 ASP E CA    1 
ATOM 6446  C C     . ASP G 3 108 ? 106.618 10.180  12.448  1.00 31.79  ? 125 ASP E C     1 
ATOM 6447  O O     . ASP G 3 108 ? 106.942 9.805   13.577  1.00 38.58  ? 125 ASP E O     1 
ATOM 6448  C CB    . ASP G 3 108 ? 109.026 10.003  11.771  1.00 48.82  ? 125 ASP E CB    1 
ATOM 6449  C CG    . ASP G 3 108 ? 110.037 9.847   10.641  1.00 52.72  ? 125 ASP E CG    1 
ATOM 6450  O OD1   . ASP G 3 108 ? 109.922 10.571  9.627   1.00 54.17  ? 125 ASP E OD1   1 
ATOM 6451  O OD2   . ASP G 3 108 ? 110.955 9.011   10.765  1.00 54.87  ? 125 ASP E OD2   1 
ATOM 6452  N N     . LEU G 3 109 ? 105.437 10.724  12.171  1.00 59.59  ? 126 LEU E N     1 
ATOM 6453  C CA    . LEU G 3 109 ? 104.411 10.905  13.184  1.00 61.15  ? 126 LEU E CA    1 
ATOM 6454  C C     . LEU G 3 109 ? 103.512 9.675   13.219  1.00 63.21  ? 126 LEU E C     1 
ATOM 6455  O O     . LEU G 3 109 ? 103.448 8.979   14.232  1.00 65.18  ? 126 LEU E O     1 
ATOM 6456  C CB    . LEU G 3 109 ? 103.573 12.158  12.883  1.00 64.38  ? 126 LEU E CB    1 
ATOM 6457  C CG    . LEU G 3 109 ? 102.384 12.451  13.811  1.00 63.84  ? 126 LEU E CG    1 
ATOM 6458  C CD1   . LEU G 3 109 ? 102.875 12.545  15.247  1.00 62.44  ? 126 LEU E CD1   1 
ATOM 6459  C CD2   . LEU G 3 109 ? 101.686 13.745  13.402  1.00 60.84  ? 126 LEU E CD2   1 
ATOM 6460  N N     . GLU G 3 110 ? 102.831 9.405   12.105  1.00 124.32 ? 127 GLU E N     1 
ATOM 6461  C CA    . GLU G 3 110 ? 101.928 8.258   12.022  1.00 125.04 ? 127 GLU E CA    1 
ATOM 6462  C C     . GLU G 3 110 ? 102.601 6.910   12.265  1.00 125.04 ? 127 GLU E C     1 
ATOM 6463  O O     . GLU G 3 110 ? 101.931 5.953   12.654  1.00 77.57  ? 127 GLU E O     1 
ATOM 6464  C CB    . GLU G 3 110 ? 101.174 8.242   10.679  1.00 66.20  ? 127 GLU E CB    1 
ATOM 6465  C CG    . GLU G 3 110 ? 100.040 9.266   10.608  1.00 68.87  ? 127 GLU E CG    1 
ATOM 6466  C CD    . GLU G 3 110 ? 99.053  9.146   11.775  1.00 69.92  ? 127 GLU E CD    1 
ATOM 6467  O OE1   . GLU G 3 110 ? 98.196  10.046  11.926  1.00 70.40  ? 127 GLU E OE1   1 
ATOM 6468  O OE2   . GLU G 3 110 ? 99.127  8.154   12.535  1.00 71.88  ? 127 GLU E OE2   1 
ATOM 6469  N N     . GLN G 3 111 ? 103.911 6.823   12.031  1.00 61.32  ? 128 GLN E N     1 
ATOM 6470  C CA    . GLN G 3 111 ? 104.627 5.575   12.288  1.00 60.07  ? 128 GLN E CA    1 
ATOM 6471  C C     . GLN G 3 111 ? 104.954 5.585   13.779  1.00 61.04  ? 128 GLN E C     1 
ATOM 6472  O O     . GLN G 3 111 ? 104.659 4.638   14.501  1.00 65.87  ? 128 GLN E O     1 
ATOM 6473  C CB    . GLN G 3 111 ? 105.922 5.490   11.474  1.00 70.04  ? 128 GLN E CB    1 
ATOM 6474  C CG    . GLN G 3 111 ? 106.701 4.205   11.721  1.00 67.82  ? 128 GLN E CG    1 
ATOM 6475  C CD    . GLN G 3 111 ? 108.030 4.169   10.989  1.00 67.83  ? 128 GLN E CD    1 
ATOM 6476  O OE1   . GLN G 3 111 ? 108.073 4.309   9.766   1.00 67.81  ? 128 GLN E OE1   1 
ATOM 6477  N NE2   . GLN G 3 111 ? 109.129 3.976   11.735  1.00 67.49  ? 128 GLN E NE2   1 
ATOM 6478  N N     . ALA G 3 112 ? 105.545 6.682   14.236  1.00 68.55  ? 129 ALA E N     1 
ATOM 6479  C CA    . ALA G 3 112 ? 105.892 6.821   15.641  1.00 69.89  ? 129 ALA E CA    1 
ATOM 6480  C C     . ALA G 3 112 ? 104.737 6.345   16.516  1.00 69.55  ? 129 ALA E C     1 
ATOM 6481  O O     . ALA G 3 112 ? 104.939 5.567   17.444  1.00 32.57  ? 129 ALA E O     1 
ATOM 6482  C CB    . ALA G 3 112 ? 106.220 8.277   15.958  1.00 37.06  ? 129 ALA E CB    1 
ATOM 6483  N N     . ILE G 3 113 ? 103.526 6.804   16.214  1.00 76.42  ? 130 ILE E N     1 
ATOM 6484  C CA    . ILE G 3 113 ? 102.364 6.414   17.006  1.00 76.16  ? 130 ILE E CA    1 
ATOM 6485  C C     . ILE G 3 113 ? 101.929 4.990   16.682  1.00 76.10  ? 130 ILE E C     1 
ATOM 6486  O O     . ILE G 3 113 ? 101.519 4.241   17.573  1.00 58.51  ? 130 ILE E O     1 
ATOM 6487  C CB    . ILE G 3 113 ? 101.150 7.389   16.805  1.00 63.06  ? 130 ILE E CB    1 
ATOM 6488  C CG1   . ILE G 3 113 ? 100.236 6.898   15.676  1.00 63.33  ? 130 ILE E CG1   1 
ATOM 6489  C CG2   . ILE G 3 113 ? 101.657 8.801   16.508  1.00 63.04  ? 130 ILE E CG2   1 
ATOM 6490  C CD1   . ILE G 3 113 ? 98.841  7.514   15.698  1.00 63.50  ? 130 ILE E CD1   1 
ATOM 6491  N N     . SER G 3 114 ? 102.018 4.616   15.408  1.00 87.98  ? 131 SER E N     1 
ATOM 6492  C CA    . SER G 3 114 ? 101.640 3.269   14.998  1.00 85.87  ? 131 SER E CA    1 
ATOM 6493  C C     . SER G 3 114 ? 102.476 2.317   15.821  1.00 83.23  ? 131 SER E C     1 
ATOM 6494  O O     . SER G 3 114 ? 102.084 1.184   16.062  1.00 56.20  ? 131 SER E O     1 
ATOM 6495  C CB    . SER G 3 114 ? 101.934 3.034   13.515  1.00 69.50  ? 131 SER E CB    1 
ATOM 6496  O OG    . SER G 3 114 ? 101.099 3.826   12.689  1.00 71.14  ? 131 SER E OG    1 
ATOM 6497  N N     . GLN G 3 115 ? 103.636 2.803   16.250  1.00 79.35  ? 132 GLN E N     1 
ATOM 6498  C CA    . GLN G 3 115 ? 104.560 2.019   17.054  1.00 78.45  ? 132 GLN E CA    1 
ATOM 6499  C C     . GLN G 3 115 ? 103.982 1.786   18.444  1.00 76.60  ? 132 GLN E C     1 
ATOM 6500  O O     . GLN G 3 115 ? 104.145 0.701   19.002  1.00 97.32  ? 132 GLN E O     1 
ATOM 6501  C CB    . GLN G 3 115 ? 105.925 2.724   17.124  1.00 100.85 ? 132 GLN E CB    1 
ATOM 6502  C CG    . GLN G 3 115 ? 106.528 2.978   15.730  1.00 103.68 ? 132 GLN E CG    1 
ATOM 6503  C CD    . GLN G 3 115 ? 107.907 3.624   15.749  1.00 105.34 ? 132 GLN E CD    1 
ATOM 6504  O OE1   . GLN G 3 115 ? 108.143 4.602   16.461  1.00 103.99 ? 132 GLN E OE1   1 
ATOM 6505  N NE2   . GLN G 3 115 ? 108.818 3.087   14.945  1.00 105.76 ? 132 GLN E NE2   1 
ATOM 6506  N N     . ARG G 3 116 ? 103.308 2.792   19.006  1.00 35.24  ? 133 ARG E N     1 
ATOM 6507  C CA    . ARG G 3 116 ? 102.690 2.617   20.316  1.00 31.40  ? 133 ARG E CA    1 
ATOM 6508  C C     . ARG G 3 116 ? 101.875 1.344   20.186  1.00 31.73  ? 133 ARG E C     1 
ATOM 6509  O O     . ARG G 3 116 ? 101.935 0.462   21.035  1.00 49.07  ? 133 ARG E O     1 
ATOM 6510  C CB    . ARG G 3 116 ? 101.737 3.766   20.651  1.00 45.73  ? 133 ARG E CB    1 
ATOM 6511  C CG    . ARG G 3 116 ? 102.379 5.010   21.227  1.00 40.84  ? 133 ARG E CG    1 
ATOM 6512  C CD    . ARG G 3 116 ? 103.067 5.834   20.160  1.00 34.72  ? 133 ARG E CD    1 
ATOM 6513  N NE    . ARG G 3 116 ? 104.313 5.236   19.692  1.00 32.89  ? 133 ARG E NE    1 
ATOM 6514  C CZ    . ARG G 3 116 ? 105.483 5.336   20.320  1.00 29.25  ? 133 ARG E CZ    1 
ATOM 6515  N NH1   . ARG G 3 116 ? 105.588 6.015   21.457  1.00 26.67  ? 133 ARG E NH1   1 
ATOM 6516  N NH2   . ARG G 3 116 ? 106.557 4.758   19.798  1.00 30.18  ? 133 ARG E NH2   1 
ATOM 6517  N N     . ILE G 3 117 ? 101.135 1.274   19.082  1.00 63.05  ? 134 ILE E N     1 
ATOM 6518  C CA    . ILE G 3 117 ? 100.248 0.163   18.726  1.00 61.97  ? 134 ILE E CA    1 
ATOM 6519  C C     . ILE G 3 117 ? 100.953 -1.205  18.631  1.00 62.67  ? 134 ILE E C     1 
ATOM 6520  O O     . ILE G 3 117 ? 100.781 -2.066  19.501  1.00 26.78  ? 134 ILE E O     1 
ATOM 6521  C CB    . ILE G 3 117 ? 99.528  0.491   17.361  1.00 39.68  ? 134 ILE E CB    1 
ATOM 6522  C CG1   . ILE G 3 117 ? 98.736  1.798   17.489  1.00 35.23  ? 134 ILE E CG1   1 
ATOM 6523  C CG2   . ILE G 3 117 ? 98.589  -0.630  16.948  1.00 35.85  ? 134 ILE E CG2   1 
ATOM 6524  C CD1   . ILE G 3 117 ? 98.144  2.298   16.183  1.00 32.42  ? 134 ILE E CD1   1 
ATOM 6525  N N     . GLN G 3 118 ? 101.741 -1.392  17.572  1.00 39.63  ? 135 GLN E N     1 
ATOM 6526  C CA    . GLN G 3 118 ? 102.462 -2.641  17.338  1.00 42.93  ? 135 GLN E CA    1 
ATOM 6527  C C     . GLN G 3 118 ? 103.484 -2.950  18.426  1.00 45.17  ? 135 GLN E C     1 
ATOM 6528  O O     . GLN G 3 118 ? 104.446 -3.675  18.183  1.00 74.63  ? 135 GLN E O     1 
ATOM 6529  C CB    . GLN G 3 118 ? 103.181 -2.615  15.974  1.00 60.03  ? 135 GLN E CB    1 
ATOM 6530  C CG    . GLN G 3 118 ? 104.409 -1.695  15.889  1.00 61.04  ? 135 GLN E CG    1 
ATOM 6531  C CD    . GLN G 3 118 ? 105.248 -1.918  14.621  1.00 61.92  ? 135 GLN E CD    1 
ATOM 6532  O OE1   . GLN G 3 118 ? 104.729 -1.910  13.509  1.00 64.06  ? 135 GLN E OE1   1 
ATOM 6533  N NE2   . GLN G 3 118 ? 106.549 -2.110  14.796  1.00 62.46  ? 135 GLN E NE2   1 
ATOM 6534  N N     . THR G 3 119 ? 103.282 -2.403  19.621  1.00 43.10  ? 136 THR E N     1 
ATOM 6535  C CA    . THR G 3 119 ? 104.220 -2.647  20.706  1.00 43.89  ? 136 THR E CA    1 
ATOM 6536  C C     . THR G 3 119 ? 103.549 -2.604  22.074  1.00 44.40  ? 136 THR E C     1 
ATOM 6537  O O     . THR G 3 119 ? 104.215 -2.507  23.102  1.00 50.37  ? 136 THR E O     1 
ATOM 6538  C CB    . THR G 3 119 ? 105.393 -1.636  20.681  1.00 54.78  ? 136 THR E CB    1 
ATOM 6539  O OG1   . THR G 3 119 ? 105.797 -1.387  19.326  1.00 54.15  ? 136 THR E OG1   1 
ATOM 6540  C CG2   . THR G 3 119 ? 106.584 -2.212  21.431  1.00 55.36  ? 136 THR E CG2   1 
ATOM 6541  N N     . ASN G 3 120 ? 102.223 -2.670  22.075  1.00 73.18  ? 137 ASN E N     1 
ATOM 6542  C CA    . ASN G 3 120 ? 101.450 -2.681  23.316  1.00 69.76  ? 137 ASN E CA    1 
ATOM 6543  C C     . ASN G 3 120 ? 101.886 -1.578  24.287  1.00 66.01  ? 137 ASN E C     1 
ATOM 6544  O O     . ASN G 3 120 ? 102.452 -1.852  25.345  1.00 109.14 ? 137 ASN E O     1 
ATOM 6545  C CB    . ASN G 3 120 ? 101.607 -4.055  23.979  1.00 113.74 ? 137 ASN E CB    1 
ATOM 6546  C CG    . ASN G 3 120 ? 101.371 -5.211  23.005  1.00 115.39 ? 137 ASN E CG    1 
ATOM 6547  O OD1   . ASN G 3 120 ? 101.903 -5.223  21.888  1.00 113.87 ? 137 ASN E OD1   1 
ATOM 6548  N ND2   . ASN G 3 120 ? 100.579 -6.193  23.432  1.00 114.14 ? 137 ASN E ND2   1 
ATOM 6549  N N     . ASN G 3 121 ? 101.619 -0.329  23.921  1.00 65.14  ? 138 ASN E N     1 
ATOM 6550  C CA    . ASN G 3 121 ? 102.004 0.807   24.751  1.00 63.87  ? 138 ASN E CA    1 
ATOM 6551  C C     . ASN G 3 121 ? 100.854 1.799   24.855  1.00 64.12  ? 138 ASN E C     1 
ATOM 6552  O O     . ASN G 3 121 ? 100.438 2.381   23.855  1.00 49.19  ? 138 ASN E O     1 
ATOM 6553  C CB    . ASN G 3 121 ? 103.245 1.484   24.156  1.00 42.98  ? 138 ASN E CB    1 
ATOM 6554  C CG    . ASN G 3 121 ? 103.832 2.542   25.078  1.00 44.68  ? 138 ASN E CG    1 
ATOM 6555  O OD1   . ASN G 3 121 ? 103.709 2.453   26.309  1.00 47.02  ? 138 ASN E OD1   1 
ATOM 6556  N ND2   . ASN G 3 121 ? 104.493 3.541   24.490  1.00 44.47  ? 138 ASN E ND2   1 
ATOM 6557  N N     . ASN G 3 122 ? 100.345 1.979   26.074  1.00 74.92  ? 139 ASN E N     1 
ATOM 6558  C CA    . ASN G 3 122 ? 99.215  2.876   26.342  1.00 73.21  ? 139 ASN E CA    1 
ATOM 6559  C C     . ASN G 3 122 ? 98.705  2.691   27.788  1.00 71.32  ? 139 ASN E C     1 
ATOM 6560  O O     . ASN G 3 122 ? 97.603  2.187   28.011  1.00 34.14  ? 139 ASN E O     1 
ATOM 6561  C CB    . ASN G 3 122 ? 98.083  2.578   25.357  1.00 40.13  ? 139 ASN E CB    1 
ATOM 6562  C CG    . ASN G 3 122 ? 96.940  3.539   25.490  1.00 40.00  ? 139 ASN E CG    1 
ATOM 6563  O OD1   . ASN G 3 122 ? 95.941  3.420   24.787  1.00 39.03  ? 139 ASN E OD1   1 
ATOM 6564  N ND2   . ASN G 3 122 ? 97.076  4.508   26.401  1.00 42.21  ? 139 ASN E ND2   1 
ATOM 6565  N N     . PRO G 3 123 ? 99.489  3.151   28.777  1.00 7.10   ? 140 PRO E N     1 
ATOM 6566  C CA    . PRO G 3 123 ? 99.292  3.110   30.232  1.00 7.10   ? 140 PRO E CA    1 
ATOM 6567  C C     . PRO G 3 123 ? 97.966  3.604   30.773  1.00 7.10   ? 140 PRO E C     1 
ATOM 6568  O O     . PRO G 3 123 ? 97.665  3.418   31.956  1.00 38.73  ? 140 PRO E O     1 
ATOM 6569  C CB    . PRO G 3 123 ? 100.454 3.947   30.751  1.00 50.35  ? 140 PRO E CB    1 
ATOM 6570  C CG    . PRO G 3 123 ? 100.568 4.995   29.708  1.00 49.82  ? 140 PRO E CG    1 
ATOM 6571  C CD    . PRO G 3 123 ? 100.482 4.189   28.431  1.00 48.48  ? 140 PRO E CD    1 
ATOM 6572  N N     . PHE G 3 124 ? 97.187  4.249   29.908  1.00 69.73  ? 141 PHE E N     1 
ATOM 6573  C CA    . PHE G 3 124 ? 95.879  4.783   30.283  1.00 70.87  ? 141 PHE E CA    1 
ATOM 6574  C C     . PHE G 3 124 ? 94.792  4.144   29.429  1.00 71.43  ? 141 PHE E C     1 
ATOM 6575  O O     . PHE G 3 124 ? 93.593  4.327   29.666  1.00 45.51  ? 141 PHE E O     1 
ATOM 6576  C CB    . PHE G 3 124 ? 95.856  6.308   30.104  1.00 37.94  ? 141 PHE E CB    1 
ATOM 6577  C CG    . PHE G 3 124 ? 96.016  7.067   31.385  1.00 36.20  ? 141 PHE E CG    1 
ATOM 6578  C CD1   . PHE G 3 124 ? 96.992  8.046   31.511  1.00 34.57  ? 141 PHE E CD1   1 
ATOM 6579  C CD2   . PHE G 3 124 ? 95.204  6.777   32.478  1.00 36.60  ? 141 PHE E CD2   1 
ATOM 6580  C CE1   . PHE G 3 124 ? 97.156  8.725   32.722  1.00 34.06  ? 141 PHE E CE1   1 
ATOM 6581  C CE2   . PHE G 3 124 ? 95.353  7.441   33.685  1.00 36.92  ? 141 PHE E CE2   1 
ATOM 6582  C CZ    . PHE G 3 124 ? 96.329  8.417   33.815  1.00 34.37  ? 141 PHE E CZ    1 
ATOM 6583  N N     . HIS G 3 125 ? 95.238  3.385   28.437  1.00 57.16  ? 142 HIS E N     1 
ATOM 6584  C CA    . HIS G 3 125 ? 94.349  2.698   27.519  1.00 56.74  ? 142 HIS E CA    1 
ATOM 6585  C C     . HIS G 3 125 ? 93.279  3.627   26.964  1.00 53.51  ? 142 HIS E C     1 
ATOM 6586  O O     . HIS G 3 125 ? 92.248  3.914   27.585  1.00 57.49  ? 142 HIS E O     1 
ATOM 6587  C CB    . HIS G 3 125 ? 93.723  1.472   28.195  1.00 65.33  ? 142 HIS E CB    1 
ATOM 6588  C CG    . HIS G 3 125 ? 94.731  0.466   28.663  1.00 64.52  ? 142 HIS E CG    1 
ATOM 6589  N ND1   . HIS G 3 125 ? 95.022  0.266   29.996  1.00 62.94  ? 142 HIS E ND1   1 
ATOM 6590  C CD2   . HIS G 3 125 ? 95.550  -0.363  27.971  1.00 64.38  ? 142 HIS E CD2   1 
ATOM 6591  C CE1   . HIS G 3 125 ? 95.978  -0.639  30.104  1.00 63.41  ? 142 HIS E CE1   1 
ATOM 6592  N NE2   . HIS G 3 125 ? 96.316  -1.037  28.890  1.00 64.10  ? 142 HIS E NE2   1 
ATOM 6593  N N     . VAL G 3 126 ? 93.582  4.113   25.773  1.00 31.52  ? 143 VAL E N     1 
ATOM 6594  C CA    . VAL G 3 126 ? 92.712  5.007   25.043  1.00 32.92  ? 143 VAL E CA    1 
ATOM 6595  C C     . VAL G 3 126 ? 92.417  4.346   23.702  1.00 31.59  ? 143 VAL E C     1 
ATOM 6596  O O     . VAL G 3 126 ? 93.310  3.837   23.028  1.00 71.70  ? 143 VAL E O     1 
ATOM 6597  C CB    . VAL G 3 126 ? 93.387  6.389   24.846  1.00 71.28  ? 143 VAL E CB    1 
ATOM 6598  C CG1   . VAL G 3 126 ? 92.546  7.276   23.932  1.00 72.06  ? 143 VAL E CG1   1 
ATOM 6599  C CG2   . VAL G 3 126 ? 93.567  7.058   26.205  1.00 68.54  ? 143 VAL E CG2   1 
ATOM 6600  N N     . PRO G 3 127 ? 91.149  4.331   23.311  1.00 2.00   ? 144 PRO E N     1 
ATOM 6601  C CA    . PRO G 3 127 ? 90.759  3.723   22.053  1.00 2.00   ? 144 PRO E CA    1 
ATOM 6602  C C     . PRO G 3 127 ? 91.683  4.034   20.913  1.00 2.00   ? 144 PRO E C     1 
ATOM 6603  O O     . PRO G 3 127 ? 91.969  5.187   20.644  1.00 4.79   ? 144 PRO E O     1 
ATOM 6604  C CB    . PRO G 3 127 ? 89.358  4.263   21.835  1.00 27.65  ? 144 PRO E CB    1 
ATOM 6605  C CG    . PRO G 3 127 ? 88.822  4.246   23.227  1.00 28.43  ? 144 PRO E CG    1 
ATOM 6606  C CD    . PRO G 3 127 ? 89.968  4.849   24.028  1.00 28.68  ? 144 PRO E CD    1 
ATOM 6607  N N     . ILE G 3 128 ? 92.141  2.968   20.257  1.00 35.77  ? 145 ILE E N     1 
ATOM 6608  C CA    . ILE G 3 128 ? 93.011  3.045   19.087  1.00 38.91  ? 145 ILE E CA    1 
ATOM 6609  C C     . ILE G 3 128 ? 92.448  4.124   18.160  1.00 41.04  ? 145 ILE E C     1 
ATOM 6610  O O     . ILE G 3 128 ? 93.166  4.688   17.334  1.00 52.98  ? 145 ILE E O     1 
ATOM 6611  C CB    . ILE G 3 128 ? 93.018  1.679   18.317  1.00 42.49  ? 145 ILE E CB    1 
ATOM 6612  C CG1   . ILE G 3 128 ? 93.689  0.591   19.171  1.00 42.60  ? 145 ILE E CG1   1 
ATOM 6613  C CG2   . ILE G 3 128 ? 93.679  1.841   16.938  1.00 43.55  ? 145 ILE E CG2   1 
ATOM 6614  C CD1   . ILE G 3 128 ? 95.211  0.658   19.223  1.00 41.43  ? 145 ILE E CD1   1 
ATOM 6615  N N     . GLU G 3 129 ? 91.154  4.394   18.307  1.00 65.44  ? 146 GLU E N     1 
ATOM 6616  C CA    . GLU G 3 129 ? 90.458  5.392   17.504  1.00 64.17  ? 146 GLU E CA    1 
ATOM 6617  C C     . GLU G 3 129 ? 90.546  6.773   18.140  1.00 61.96  ? 146 GLU E C     1 
ATOM 6618  O O     . GLU G 3 129 ? 90.345  7.786   17.466  1.00 61.75  ? 146 GLU E O     1 
ATOM 6619  C CB    . GLU G 3 129 ? 88.991  5.000   17.335  1.00 62.88  ? 146 GLU E CB    1 
ATOM 6620  C CG    . GLU G 3 129 ? 88.584  3.725   18.059  1.00 61.02  ? 146 GLU E CG    1 
ATOM 6621  C CD    . GLU G 3 129 ? 89.263  2.480   17.516  1.00 62.07  ? 146 GLU E CD    1 
ATOM 6622  O OE1   . GLU G 3 129 ? 88.897  1.369   17.963  1.00 61.73  ? 146 GLU E OE1   1 
ATOM 6623  O OE2   . GLU G 3 129 ? 90.160  2.606   16.650  1.00 63.15  ? 146 GLU E OE2   1 
ATOM 6624  N N     . GLU G 3 130 ? 90.823  6.798   19.443  1.00 66.04  ? 147 GLU E N     1 
ATOM 6625  C CA    . GLU G 3 130 ? 90.978  8.037   20.198  1.00 65.21  ? 147 GLU E CA    1 
ATOM 6626  C C     . GLU G 3 130 ? 92.495  8.252   20.332  1.00 65.70  ? 147 GLU E C     1 
ATOM 6627  O O     . GLU G 3 130 ? 92.984  8.780   21.338  1.00 30.94  ? 147 GLU E O     1 
ATOM 6628  C CB    . GLU G 3 130 ? 90.339  7.900   21.591  1.00 28.29  ? 147 GLU E CB    1 
ATOM 6629  C CG    . GLU G 3 130 ? 89.993  9.237   22.260  1.00 33.97  ? 147 GLU E CG    1 
ATOM 6630  C CD    . GLU G 3 130 ? 89.589  9.133   23.737  1.00 35.74  ? 147 GLU E CD    1 
ATOM 6631  O OE1   . GLU G 3 130 ? 88.592  8.451   24.070  1.00 39.79  ? 147 GLU E OE1   1 
ATOM 6632  O OE2   . GLU G 3 130 ? 90.273  9.763   24.573  1.00 37.17  ? 147 GLU E OE2   1 
ATOM 6633  N N     . GLN G 3 131 ? 93.237  7.822   19.311  1.00 20.32  ? 148 GLN E N     1 
ATOM 6634  C CA    . GLN G 3 131 ? 94.698  7.942   19.298  1.00 21.35  ? 148 GLN E CA    1 
ATOM 6635  C C     . GLN G 3 131 ? 95.231  8.297   17.937  1.00 21.96  ? 148 GLN E C     1 
ATOM 6636  O O     . GLN G 3 131 ? 96.194  7.694   17.458  1.00 48.70  ? 148 GLN E O     1 
ATOM 6637  C CB    . GLN G 3 131 ? 95.368  6.648   19.744  1.00 60.91  ? 148 GLN E CB    1 
ATOM 6638  C CG    . GLN G 3 131 ? 95.389  6.433   21.231  1.00 63.24  ? 148 GLN E CG    1 
ATOM 6639  C CD    . GLN G 3 131 ? 96.141  5.168   21.603  1.00 63.97  ? 148 GLN E CD    1 
ATOM 6640  O OE1   . GLN G 3 131 ? 96.103  4.725   22.751  1.00 61.62  ? 148 GLN E OE1   1 
ATOM 6641  N NE2   . GLN G 3 131 ? 96.834  4.579   20.629  1.00 65.91  ? 148 GLN E NE2   1 
ATOM 6642  N N     . ARG G 3 132 ? 94.597  9.286   17.321  1.00 93.73  ? 149 ARG E N     1 
ATOM 6643  C CA    . ARG G 3 132 ? 95.006  9.763   16.013  1.00 95.46  ? 149 ARG E CA    1 
ATOM 6644  C C     . ARG G 3 132 ? 94.519  11.199  15.822  1.00 95.81  ? 149 ARG E C     1 
ATOM 6645  O O     . ARG G 3 132 ? 93.566  11.637  16.466  1.00 81.34  ? 149 ARG E O     1 
ATOM 6646  C CB    . ARG G 3 132 ? 94.452  8.850   14.920  1.00 75.37  ? 149 ARG E CB    1 
ATOM 6647  C CG    . ARG G 3 132 ? 95.150  9.011   13.587  1.00 80.50  ? 149 ARG E CG    1 
ATOM 6648  C CD    . ARG G 3 132 ? 95.454  7.659   12.945  1.00 84.41  ? 149 ARG E CD    1 
ATOM 6649  N NE    . ARG G 3 132 ? 96.444  6.890   13.700  1.00 86.33  ? 149 ARG E NE    1 
ATOM 6650  C CZ    . ARG G 3 132 ? 96.994  5.758   13.269  1.00 87.44  ? 149 ARG E CZ    1 
ATOM 6651  N NH1   . ARG G 3 132 ? 96.650  5.265   12.088  1.00 86.97  ? 149 ARG E NH1   1 
ATOM 6652  N NH2   . ARG G 3 132 ? 97.887  5.119   14.015  1.00 88.48  ? 149 ARG E NH2   1 
ATOM 6653  N N     . GLY G 3 133 ? 95.194  11.931  14.948  1.00 72.68  ? 150 GLY E N     1 
ATOM 6654  C CA    . GLY G 3 133 ? 94.824  13.308  14.702  1.00 71.62  ? 150 GLY E CA    1 
ATOM 6655  C C     . GLY G 3 133 ? 96.047  14.195  14.777  1.00 71.71  ? 150 GLY E C     1 
ATOM 6656  O O     . GLY G 3 133 ? 96.886  14.181  13.873  1.00 58.67  ? 150 GLY E O     1 
ATOM 6657  N N     . ASP G 3 134 ? 96.147  14.964  15.858  1.00 46.31  ? 151 ASP E N     1 
ATOM 6658  C CA    . ASP G 3 134 ? 97.276  15.863  16.071  1.00 47.64  ? 151 ASP E CA    1 
ATOM 6659  C C     . ASP G 3 134 ? 97.793  15.743  17.502  1.00 48.12  ? 151 ASP E C     1 
ATOM 6660  O O     . ASP G 3 134 ? 97.048  15.376  18.418  1.00 55.64  ? 151 ASP E O     1 
ATOM 6661  C CB    . ASP G 3 134 ? 96.860  17.314  15.790  1.00 66.06  ? 151 ASP E CB    1 
ATOM 6662  C CG    . ASP G 3 134 ? 96.928  17.675  14.313  1.00 68.56  ? 151 ASP E CG    1 
ATOM 6663  O OD1   . ASP G 3 134 ? 98.051  17.850  13.788  1.00 70.48  ? 151 ASP E OD1   1 
ATOM 6664  O OD2   . ASP G 3 134 ? 95.859  17.781  13.677  1.00 72.06  ? 151 ASP E OD2   1 
ATOM 6665  N N     . TYR G 3 135 ? 99.073  16.052  17.690  1.00 50.16  ? 152 TYR E N     1 
ATOM 6666  C CA    . TYR G 3 135 ? 99.679  15.982  19.014  1.00 50.37  ? 152 TYR E CA    1 
ATOM 6667  C C     . TYR G 3 135 ? 100.534 17.194  19.377  1.00 51.16  ? 152 TYR E C     1 
ATOM 6668  O O     . TYR G 3 135 ? 101.357 17.658  18.586  1.00 53.76  ? 152 TYR E O     1 
ATOM 6669  C CB    . TYR G 3 135 ? 100.557 14.742  19.144  1.00 51.27  ? 152 TYR E CB    1 
ATOM 6670  C CG    . TYR G 3 135 ? 99.888  13.484  19.664  1.00 46.83  ? 152 TYR E CG    1 
ATOM 6671  C CD1   . TYR G 3 135 ? 99.043  12.721  18.842  1.00 48.25  ? 152 TYR E CD1   1 
ATOM 6672  C CD2   . TYR G 3 135 ? 100.198 12.990  20.945  1.00 42.23  ? 152 TYR E CD2   1 
ATOM 6673  C CE1   . TYR G 3 135 ? 98.537  11.494  19.276  1.00 46.29  ? 152 TYR E CE1   1 
ATOM 6674  C CE2   . TYR G 3 135 ? 99.704  11.775  21.383  1.00 44.95  ? 152 TYR E CE2   1 
ATOM 6675  C CZ    . TYR G 3 135 ? 98.878  11.024  20.545  1.00 45.85  ? 152 TYR E CZ    1 
ATOM 6676  O OH    . TYR G 3 135 ? 98.424  9.788   20.965  1.00 47.00  ? 152 TYR E OH    1 
ATOM 6677  N N     . ASP G 3 136 ? 100.324 17.686  20.593  1.00 29.55  ? 153 ASP E N     1 
ATOM 6678  C CA    . ASP G 3 136 ? 101.063 18.804  21.146  1.00 29.93  ? 153 ASP E CA    1 
ATOM 6679  C C     . ASP G 3 136 ? 102.429 18.166  21.310  1.00 29.31  ? 153 ASP E C     1 
ATOM 6680  O O     . ASP G 3 136 ? 102.653 17.402  22.255  1.00 47.73  ? 153 ASP E O     1 
ATOM 6681  C CB    . ASP G 3 136 ? 100.458 19.162  22.507  1.00 53.47  ? 153 ASP E CB    1 
ATOM 6682  C CG    . ASP G 3 136 ? 101.065 20.397  23.122  1.00 55.13  ? 153 ASP E CG    1 
ATOM 6683  O OD1   . ASP G 3 136 ? 100.508 20.885  24.135  1.00 55.82  ? 153 ASP E OD1   1 
ATOM 6684  O OD2   . ASP G 3 136 ? 102.093 20.873  22.600  1.00 55.87  ? 153 ASP E OD2   1 
ATOM 6685  N N     . LEU G 3 137 ? 103.328 18.444  20.369  1.00 66.73  ? 154 LEU E N     1 
ATOM 6686  C CA    . LEU G 3 137 ? 104.673 17.866  20.391  1.00 65.79  ? 154 LEU E CA    1 
ATOM 6687  C C     . LEU G 3 137 ? 105.680 18.627  21.254  1.00 65.52  ? 154 LEU E C     1 
ATOM 6688  O O     . LEU G 3 137 ? 106.844 18.226  21.346  1.00 66.12  ? 154 LEU E O     1 
ATOM 6689  C CB    . LEU G 3 137 ? 105.232 17.795  18.970  1.00 57.64  ? 154 LEU E CB    1 
ATOM 6690  C CG    . LEU G 3 137 ? 104.300 17.319  17.862  1.00 58.22  ? 154 LEU E CG    1 
ATOM 6691  C CD1   . LEU G 3 137 ? 105.058 17.293  16.543  1.00 55.66  ? 154 LEU E CD1   1 
ATOM 6692  C CD2   . LEU G 3 137 ? 103.768 15.947  18.198  1.00 57.86  ? 154 LEU E CD2   1 
ATOM 6693  N N     . ASN G 3 138 ? 105.232 19.707  21.891  1.00 26.12  ? 155 ASN E N     1 
ATOM 6694  C CA    . ASN G 3 138 ? 106.125 20.534  22.681  1.00 27.09  ? 155 ASN E CA    1 
ATOM 6695  C C     . ASN G 3 138 ? 105.900 20.434  24.188  1.00 28.71  ? 155 ASN E C     1 
ATOM 6696  O O     . ASN G 3 138 ? 106.565 21.118  24.964  1.00 52.90  ? 155 ASN E O     1 
ATOM 6697  C CB    . ASN G 3 138 ? 106.002 21.998  22.211  1.00 44.48  ? 155 ASN E CB    1 
ATOM 6698  C CG    . ASN G 3 138 ? 106.099 22.148  20.677  1.00 47.34  ? 155 ASN E CG    1 
ATOM 6699  O OD1   . ASN G 3 138 ? 107.022 21.633  20.034  1.00 45.36  ? 155 ASN E OD1   1 
ATOM 6700  N ND2   . ASN G 3 138 ? 105.144 22.869  20.094  1.00 48.05  ? 155 ASN E ND2   1 
ATOM 6701  N N     . ALA G 3 139 ? 104.976 19.579  24.603  1.00 66.17  ? 156 ALA E N     1 
ATOM 6702  C CA    . ALA G 3 139 ? 104.674 19.416  26.024  1.00 65.25  ? 156 ALA E CA    1 
ATOM 6703  C C     . ALA G 3 139 ? 104.242 17.979  26.285  1.00 63.23  ? 156 ALA E C     1 
ATOM 6704  O O     . ALA G 3 139 ? 103.466 17.424  25.505  1.00 58.30  ? 156 ALA E O     1 
ATOM 6705  C CB    . ALA G 3 139 ? 103.566 20.371  26.423  1.00 55.11  ? 156 ALA E CB    1 
ATOM 6706  N N     . VAL G 3 140 ? 104.735 17.371  27.367  1.00 46.35  ? 157 VAL E N     1 
ATOM 6707  C CA    . VAL G 3 140 ? 104.371 15.982  27.658  1.00 44.77  ? 157 VAL E CA    1 
ATOM 6708  C C     . VAL G 3 140 ? 104.682 15.463  29.046  1.00 48.65  ? 157 VAL E C     1 
ATOM 6709  O O     . VAL G 3 140 ? 105.845 15.322  29.415  1.00 37.37  ? 157 VAL E O     1 
ATOM 6710  C CB    . VAL G 3 140 ? 105.015 14.987  26.632  1.00 19.68  ? 157 VAL E CB    1 
ATOM 6711  C CG1   . VAL G 3 140 ? 106.512 15.258  26.463  1.00 13.25  ? 157 VAL E CG1   1 
ATOM 6712  C CG2   . VAL G 3 140 ? 104.769 13.542  27.087  1.00 13.63  ? 157 VAL E CG2   1 
ATOM 6713  N N     . ARG G 3 141 ? 103.626 15.154  29.793  1.00 46.48  ? 158 ARG E N     1 
ATOM 6714  C CA    . ARG G 3 141 ? 103.739 14.618  31.150  1.00 50.59  ? 158 ARG E CA    1 
ATOM 6715  C C     . ARG G 3 141 ? 104.419 13.251  31.056  1.00 52.97  ? 158 ARG E C     1 
ATOM 6716  O O     . ARG G 3 141 ? 104.444 12.641  29.986  1.00 86.02  ? 158 ARG E O     1 
ATOM 6717  C CB    . ARG G 3 141 ? 102.342 14.449  31.747  1.00 82.81  ? 158 ARG E CB    1 
ATOM 6718  C CG    . ARG G 3 141 ? 101.446 15.675  31.596  1.00 86.11  ? 158 ARG E CG    1 
ATOM 6719  C CD    . ARG G 3 141 ? 99.970  15.339  31.801  1.00 88.54  ? 158 ARG E CD    1 
ATOM 6720  N NE    . ARG G 3 141 ? 99.111  16.524  31.823  1.00 89.24  ? 158 ARG E NE    1 
ATOM 6721  C CZ    . ARG G 3 141 ? 99.062  17.408  32.820  1.00 90.97  ? 158 ARG E CZ    1 
ATOM 6722  N NH1   . ARG G 3 141 ? 99.821  17.260  33.897  1.00 89.65  ? 158 ARG E NH1   1 
ATOM 6723  N NH2   . ARG G 3 141 ? 98.243  18.445  32.741  1.00 90.91  ? 158 ARG E NH2   1 
ATOM 6724  N N     . LEU G 3 142 ? 104.961 12.765  32.170  1.00 59.49  ? 159 LEU E N     1 
ATOM 6725  C CA    . LEU G 3 142 ? 105.634 11.465  32.188  1.00 56.49  ? 159 LEU E CA    1 
ATOM 6726  C C     . LEU G 3 142 ? 104.772 10.406  32.849  1.00 57.87  ? 159 LEU E C     1 
ATOM 6727  O O     . LEU G 3 142 ? 104.250 10.622  33.939  1.00 53.39  ? 159 LEU E O     1 
ATOM 6728  C CB    . LEU G 3 142 ? 106.963 11.582  32.923  1.00 44.87  ? 159 LEU E CB    1 
ATOM 6729  C CG    . LEU G 3 142 ? 107.920 12.461  32.132  1.00 40.08  ? 159 LEU E CG    1 
ATOM 6730  C CD1   . LEU G 3 142 ? 109.137 12.826  32.958  1.00 36.82  ? 159 LEU E CD1   1 
ATOM 6731  C CD2   . LEU G 3 142 ? 108.298 11.709  30.866  1.00 43.84  ? 159 LEU E CD2   1 
ATOM 6732  N N     . CYS G 3 143 ? 104.633 9.255   32.198  1.00 56.20  ? 160 CYS E N     1 
ATOM 6733  C CA    . CYS G 3 143 ? 103.794 8.194   32.741  1.00 59.61  ? 160 CYS E CA    1 
ATOM 6734  C C     . CYS G 3 143 ? 104.504 7.181   33.625  1.00 60.52  ? 160 CYS E C     1 
ATOM 6735  O O     . CYS G 3 143 ? 105.524 6.601   33.251  1.00 44.87  ? 160 CYS E O     1 
ATOM 6736  C CB    . CYS G 3 143 ? 103.072 7.462   31.612  1.00 45.38  ? 160 CYS E CB    1 
ATOM 6737  S SG    . CYS G 3 143 ? 101.514 6.704   32.139  1.00 43.55  ? 160 CYS E SG    1 
ATOM 6738  N N     . PHE G 3 144 ? 103.931 6.965   34.801  1.00 55.57  ? 161 PHE E N     1 
ATOM 6739  C CA    . PHE G 3 144 ? 104.476 6.035   35.767  1.00 54.29  ? 161 PHE E CA    1 
ATOM 6740  C C     . PHE G 3 144 ? 103.632 4.775   35.948  1.00 53.55  ? 161 PHE E C     1 
ATOM 6741  O O     . PHE G 3 144 ? 103.160 4.482   37.058  1.00 70.38  ? 161 PHE E O     1 
ATOM 6742  C CB    . PHE G 3 144 ? 104.662 6.741   37.111  1.00 62.65  ? 161 PHE E CB    1 
ATOM 6743  C CG    . PHE G 3 144 ? 105.871 7.629   37.157  1.00 63.42  ? 161 PHE E CG    1 
ATOM 6744  C CD1   . PHE G 3 144 ? 107.134 7.095   37.398  1.00 63.05  ? 161 PHE E CD1   1 
ATOM 6745  C CD2   . PHE G 3 144 ? 105.761 8.987   36.903  1.00 62.96  ? 161 PHE E CD2   1 
ATOM 6746  C CE1   . PHE G 3 144 ? 108.268 7.903   37.381  1.00 62.31  ? 161 PHE E CE1   1 
ATOM 6747  C CE2   . PHE G 3 144 ? 106.892 9.796   36.885  1.00 60.86  ? 161 PHE E CE2   1 
ATOM 6748  C CZ    . PHE G 3 144 ? 108.145 9.251   37.123  1.00 61.68  ? 161 PHE E CZ    1 
ATOM 6749  N N     . GLN G 3 145 ? 103.433 4.030   34.858  1.00 44.04  ? 162 GLN E N     1 
ATOM 6750  C CA    . GLN G 3 145 ? 102.689 2.780   34.954  1.00 42.11  ? 162 GLN E CA    1 
ATOM 6751  C C     . GLN G 3 145 ? 103.672 1.733   35.508  1.00 41.27  ? 162 GLN E C     1 
ATOM 6752  O O     . GLN G 3 145 ? 104.421 1.093   34.761  1.00 46.76  ? 162 GLN E O     1 
ATOM 6753  C CB    . GLN G 3 145 ? 102.139 2.345   33.586  1.00 57.87  ? 162 GLN E CB    1 
ATOM 6754  C CG    . GLN G 3 145 ? 101.097 1.219   33.712  1.00 56.70  ? 162 GLN E CG    1 
ATOM 6755  C CD    . GLN G 3 145 ? 100.266 0.980   32.451  1.00 57.61  ? 162 GLN E CD    1 
ATOM 6756  O OE1   . GLN G 3 145 ? 100.780 0.540   31.420  1.00 54.78  ? 162 GLN E OE1   1 
ATOM 6757  N NE2   . GLN G 3 145 ? 98.966  1.265   32.537  1.00 58.30  ? 162 GLN E NE2   1 
ATOM 6758  N N     . VAL G 3 146 ? 103.669 1.586   36.832  1.00 54.85  ? 163 VAL E N     1 
ATOM 6759  C CA    . VAL G 3 146 ? 104.553 0.649   37.516  1.00 54.80  ? 163 VAL E CA    1 
ATOM 6760  C C     . VAL G 3 146 ? 103.855 -0.576  38.152  1.00 56.11  ? 163 VAL E C     1 
ATOM 6761  O O     . VAL G 3 146 ? 102.653 -0.550  38.436  1.00 42.10  ? 163 VAL E O     1 
ATOM 6762  C CB    . VAL G 3 146 ? 105.379 1.390   38.590  1.00 38.42  ? 163 VAL E CB    1 
ATOM 6763  C CG1   . VAL G 3 146 ? 106.422 2.261   37.920  1.00 36.15  ? 163 VAL E CG1   1 
ATOM 6764  C CG2   . VAL G 3 146 ? 104.462 2.257   39.455  1.00 37.69  ? 163 VAL E CG2   1 
ATOM 6765  N N     . THR G 3 147 ? 104.633 -1.642  38.355  1.00 26.02  ? 164 THR E N     1 
ATOM 6766  C CA    . THR G 3 147 ? 104.171 -2.905  38.935  1.00 27.39  ? 164 THR E CA    1 
ATOM 6767  C C     . THR G 3 147 ? 104.869 -3.131  40.284  1.00 26.99  ? 164 THR E C     1 
ATOM 6768  O O     . THR G 3 147 ? 105.944 -2.575  40.543  1.00 81.72  ? 164 THR E O     1 
ATOM 6769  C CB    . THR G 3 147 ? 104.520 -4.108  38.013  1.00 81.69  ? 164 THR E CB    1 
ATOM 6770  O OG1   . THR G 3 147 ? 103.945 -3.911  36.717  1.00 84.81  ? 164 THR E OG1   1 
ATOM 6771  C CG2   . THR G 3 147 ? 103.997 -5.409  38.599  1.00 82.19  ? 164 THR E CG2   1 
ATOM 6772  N N     . VAL G 3 148 ? 104.254 -3.951  41.136  1.00 43.81  ? 165 VAL E N     1 
ATOM 6773  C CA    . VAL G 3 148 ? 104.803 -4.280  42.455  1.00 43.13  ? 165 VAL E CA    1 
ATOM 6774  C C     . VAL G 3 148 ? 104.433 -5.703  42.844  1.00 41.74  ? 165 VAL E C     1 
ATOM 6775  O O     . VAL G 3 148 ? 104.747 -6.653  42.133  1.00 72.34  ? 165 VAL E O     1 
ATOM 6776  C CB    . VAL G 3 148 ? 104.271 -3.330  43.547  1.00 62.56  ? 165 VAL E CB    1 
ATOM 6777  C CG1   . VAL G 3 148 ? 104.972 -1.991  43.455  1.00 61.54  ? 165 VAL E CG1   1 
ATOM 6778  C CG2   . VAL G 3 148 ? 102.767 -3.158  43.398  1.00 61.97  ? 165 VAL E CG2   1 
ATOM 6779  N N     . ARG G 3 149 ? 103.759 -5.837  43.978  1.00 39.63  ? 166 ARG E N     1 
ATOM 6780  C CA    . ARG G 3 149 ? 103.328 -7.137  44.477  1.00 39.74  ? 166 ARG E CA    1 
ATOM 6781  C C     . ARG G 3 149 ? 102.230 -7.009  45.541  1.00 40.39  ? 166 ARG E C     1 
ATOM 6782  O O     . ARG G 3 149 ? 102.258 -6.112  46.388  1.00 53.29  ? 166 ARG E O     1 
ATOM 6783  C CB    . ARG G 3 149 ? 104.530 -7.905  45.044  1.00 40.98  ? 166 ARG E CB    1 
ATOM 6784  C CG    . ARG G 3 149 ? 105.294 -8.691  43.995  1.00 35.42  ? 166 ARG E CG    1 
ATOM 6785  C CD    . ARG G 3 149 ? 106.761 -8.340  43.958  1.00 37.50  ? 166 ARG E CD    1 
ATOM 6786  N NE    . ARG G 3 149 ? 107.171 -7.871  42.635  1.00 39.90  ? 166 ARG E NE    1 
ATOM 6787  C CZ    . ARG G 3 149 ? 107.011 -8.552  41.499  1.00 39.98  ? 166 ARG E CZ    1 
ATOM 6788  N NH1   . ARG G 3 149 ? 106.443 -9.752  41.502  1.00 38.47  ? 166 ARG E NH1   1 
ATOM 6789  N NH2   . ARG G 3 149 ? 107.419 -8.029  40.350  1.00 38.24  ? 166 ARG E NH2   1 
ATOM 6790  N N     . ASP G 3 150 ? 101.258 -7.912  45.485  1.00 29.57  ? 167 ASP E N     1 
ATOM 6791  C CA    . ASP G 3 150 ? 100.150 -7.913  46.437  1.00 32.22  ? 167 ASP E CA    1 
ATOM 6792  C C     . ASP G 3 150 ? 100.652 -8.304  47.828  1.00 33.29  ? 167 ASP E C     1 
ATOM 6793  O O     . ASP G 3 150 ? 101.842 -8.544  48.015  1.00 90.81  ? 167 ASP E O     1 
ATOM 6794  C CB    . ASP G 3 150 ? 99.097  -8.911  45.972  1.00 84.46  ? 167 ASP E CB    1 
ATOM 6795  C CG    . ASP G 3 150 ? 99.673  -10.289 45.763  1.00 84.06  ? 167 ASP E CG    1 
ATOM 6796  O OD1   . ASP G 3 150 ? 98.913  -11.202 45.377  1.00 80.13  ? 167 ASP E OD1   1 
ATOM 6797  O OD2   . ASP G 3 150 ? 100.893 -10.457 45.988  1.00 83.56  ? 167 ASP E OD2   1 
ATOM 6798  N N     . PRO G 3 151 ? 99.749  -8.378  48.820  1.00 46.42  ? 168 PRO E N     1 
ATOM 6799  C CA    . PRO G 3 151 ? 100.169 -8.751  50.173  1.00 46.59  ? 168 PRO E CA    1 
ATOM 6800  C C     . PRO G 3 151 ? 100.655 -10.201 50.258  1.00 47.46  ? 168 PRO E C     1 
ATOM 6801  O O     . PRO G 3 151 ? 100.780 -10.766 51.360  1.00 64.41  ? 168 PRO E O     1 
ATOM 6802  C CB    . PRO G 3 151 ? 98.910  -8.510  51.000  1.00 45.64  ? 168 PRO E CB    1 
ATOM 6803  C CG    . PRO G 3 151 ? 98.225  -7.408  50.261  1.00 49.57  ? 168 PRO E CG    1 
ATOM 6804  C CD    . PRO G 3 151 ? 98.369  -7.868  48.837  1.00 47.64  ? 168 PRO E CD    1 
ATOM 6805  N N     . ALA G 3 152 ? 100.937 -10.790 49.095  1.00 93.30  ? 169 ALA E N     1 
ATOM 6806  C CA    . ALA G 3 152 ? 101.405 -12.167 49.014  1.00 92.67  ? 169 ALA E CA    1 
ATOM 6807  C C     . ALA G 3 152 ? 102.588 -12.346 48.046  1.00 92.78  ? 169 ALA E C     1 
ATOM 6808  O O     . ALA G 3 152 ? 103.747 -12.221 48.442  1.00 28.64  ? 169 ALA E O     1 
ATOM 6809  C CB    . ALA G 3 152 ? 100.254 -13.068 48.616  1.00 13.16  ? 169 ALA E CB    1 
ATOM 6810  N N     . GLY G 3 153 ? 102.311 -12.647 46.780  1.00 42.70  ? 170 GLY E N     1 
ATOM 6811  C CA    . GLY G 3 153 ? 103.402 -12.826 45.837  1.00 43.60  ? 170 GLY E CA    1 
ATOM 6812  C C     . GLY G 3 153 ? 103.070 -12.487 44.398  1.00 43.15  ? 170 GLY E C     1 
ATOM 6813  O O     . GLY G 3 153 ? 103.898 -12.658 43.510  1.00 53.02  ? 170 GLY E O     1 
ATOM 6814  N N     . ARG G 3 154 ? 101.859 -11.990 44.170  1.00 64.28  ? 171 ARG E N     1 
ATOM 6815  C CA    . ARG G 3 154 ? 101.395 -11.640 42.828  1.00 65.60  ? 171 ARG E CA    1 
ATOM 6816  C C     . ARG G 3 154 ? 101.728 -10.211 42.403  1.00 64.31  ? 171 ARG E C     1 
ATOM 6817  O O     . ARG G 3 154 ? 101.704 -9.288  43.220  1.00 74.75  ? 171 ARG E O     1 
ATOM 6818  C CB    . ARG G 3 154 ? 99.882  -11.848 42.734  1.00 88.55  ? 171 ARG E CB    1 
ATOM 6819  C CG    . ARG G 3 154 ? 99.419  -13.272 43.036  1.00 90.20  ? 171 ARG E CG    1 
ATOM 6820  C CD    . ARG G 3 154 ? 100.021 -14.275 42.056  1.00 91.67  ? 171 ARG E CD    1 
ATOM 6821  N NE    . ARG G 3 154 ? 99.349  -15.569 42.113  1.00 94.28  ? 171 ARG E NE    1 
ATOM 6822  C CZ    . ARG G 3 154 ? 99.402  -16.406 43.142  1.00 96.06  ? 171 ARG E CZ    1 
ATOM 6823  N NH1   . ARG G 3 154 ? 100.107 -16.105 44.226  1.00 96.40  ? 171 ARG E NH1   1 
ATOM 6824  N NH2   . ARG G 3 154 ? 98.727  -17.541 43.087  1.00 96.06  ? 171 ARG E NH2   1 
ATOM 6825  N N     . PRO G 3 155 ? 102.043 -10.016 41.107  1.00 37.77  ? 172 PRO E N     1 
ATOM 6826  C CA    . PRO G 3 155 ? 102.383 -8.693  40.569  1.00 37.79  ? 172 PRO E CA    1 
ATOM 6827  C C     . PRO G 3 155 ? 101.200 -7.757  40.662  1.00 37.70  ? 172 PRO E C     1 
ATOM 6828  O O     . PRO G 3 155 ? 100.071 -8.168  40.416  1.00 63.08  ? 172 PRO E O     1 
ATOM 6829  C CB    . PRO G 3 155 ? 102.771 -8.997  39.123  1.00 52.89  ? 172 PRO E CB    1 
ATOM 6830  C CG    . PRO G 3 155 ? 103.348 -10.377 39.221  1.00 52.24  ? 172 PRO E CG    1 
ATOM 6831  C CD    . PRO G 3 155 ? 102.337 -11.066 40.114  1.00 51.69  ? 172 PRO E CD    1 
ATOM 6832  N N     . LEU G 3 156 ? 101.463 -6.503  41.018  1.00 68.25  ? 173 LEU E N     1 
ATOM 6833  C CA    . LEU G 3 156 ? 100.392 -5.526  41.140  1.00 67.95  ? 173 LEU E CA    1 
ATOM 6834  C C     . LEU G 3 156 ? 100.580 -4.335  40.210  1.00 66.22  ? 173 LEU E C     1 
ATOM 6835  O O     . LEU G 3 156 ? 101.537 -3.577  40.336  1.00 44.05  ? 173 LEU E O     1 
ATOM 6836  C CB    . LEU G 3 156 ? 100.270 -5.043  42.591  1.00 62.44  ? 173 LEU E CB    1 
ATOM 6837  C CG    . LEU G 3 156 ? 99.051  -4.171  42.936  1.00 60.91  ? 173 LEU E CG    1 
ATOM 6838  C CD1   . LEU G 3 156 ? 97.748  -4.905  42.594  1.00 57.00  ? 173 LEU E CD1   1 
ATOM 6839  C CD2   . LEU G 3 156 ? 99.097  -3.809  44.419  1.00 64.58  ? 173 LEU E CD2   1 
ATOM 6840  N N     . LEU G 3 157 ? 99.640  -4.204  39.276  1.00 73.32  ? 174 LEU E N     1 
ATOM 6841  C CA    . LEU G 3 157 ? 99.583  -3.140  38.270  1.00 73.82  ? 174 LEU E CA    1 
ATOM 6842  C C     . LEU G 3 157 ? 99.051  -1.857  38.921  1.00 74.36  ? 174 LEU E C     1 
ATOM 6843  O O     . LEU G 3 157 ? 97.844  -1.641  39.004  1.00 50.61  ? 174 LEU E O     1 
ATOM 6844  C CB    . LEU G 3 157 ? 98.651  -3.582  37.124  1.00 65.82  ? 174 LEU E CB    1 
ATOM 6845  C CG    . LEU G 3 157 ? 97.741  -4.809  37.399  1.00 67.64  ? 174 LEU E CG    1 
ATOM 6846  C CD1   . LEU G 3 157 ? 96.585  -4.878  36.412  1.00 65.72  ? 174 LEU E CD1   1 
ATOM 6847  C CD2   . LEU G 3 157 ? 98.573  -6.087  37.328  1.00 67.91  ? 174 LEU E CD2   1 
ATOM 6848  N N     . LEU G 3 158 ? 99.962  -1.007  39.379  1.00 69.20  ? 175 LEU E N     1 
ATOM 6849  C CA    . LEU G 3 158 ? 99.592  0.234   40.046  1.00 71.11  ? 175 LEU E CA    1 
ATOM 6850  C C     . LEU G 3 158 ? 99.091  1.334   39.108  1.00 73.06  ? 175 LEU E C     1 
ATOM 6851  O O     . LEU G 3 158 ? 99.143  1.197   37.885  1.00 67.31  ? 175 LEU E O     1 
ATOM 6852  C CB    . LEU G 3 158 ? 100.788 0.744   40.850  1.00 64.72  ? 175 LEU E CB    1 
ATOM 6853  C CG    . LEU G 3 158 ? 101.433 -0.305  41.761  1.00 66.69  ? 175 LEU E CG    1 
ATOM 6854  C CD1   . LEU G 3 158 ? 102.613 0.302   42.513  1.00 67.94  ? 175 LEU E CD1   1 
ATOM 6855  C CD2   . LEU G 3 158 ? 100.393 -0.844  42.734  1.00 64.19  ? 175 LEU E CD2   1 
ATOM 6856  N N     . THR G 3 159 ? 98.606  2.425   39.695  1.00 73.83  ? 176 THR E N     1 
ATOM 6857  C CA    . THR G 3 159 ? 98.088  3.559   38.932  1.00 71.87  ? 176 THR E CA    1 
ATOM 6858  C C     . THR G 3 159 ? 99.146  4.239   38.056  1.00 69.65  ? 176 THR E C     1 
ATOM 6859  O O     . THR G 3 159 ? 100.297 4.390   38.463  1.00 62.14  ? 176 THR E O     1 
ATOM 6860  C CB    . THR G 3 159 ? 97.462  4.628   39.884  1.00 64.10  ? 176 THR E CB    1 
ATOM 6861  O OG1   . THR G 3 159 ? 96.134  4.225   40.249  1.00 61.59  ? 176 THR E OG1   1 
ATOM 6862  C CG2   . THR G 3 159 ? 97.413  6.006   39.217  1.00 63.86  ? 176 THR E CG2   1 
ATOM 6863  N N     . PRO G 3 160 ? 98.771  4.620   36.821  1.00 77.20  ? 177 PRO E N     1 
ATOM 6864  C CA    . PRO G 3 160 ? 99.681  5.289   35.882  1.00 77.78  ? 177 PRO E CA    1 
ATOM 6865  C C     . PRO G 3 160 ? 99.757  6.801   36.160  1.00 76.55  ? 177 PRO E C     1 
ATOM 6866  O O     . PRO G 3 160 ? 99.214  7.602   35.403  1.00 83.32  ? 177 PRO E O     1 
ATOM 6867  C CB    . PRO G 3 160 ? 99.057  4.989   34.510  1.00 73.81  ? 177 PRO E CB    1 
ATOM 6868  C CG    . PRO G 3 160 ? 98.263  3.734   34.743  1.00 74.19  ? 177 PRO E CG    1 
ATOM 6869  C CD    . PRO G 3 160 ? 97.643  4.017   36.085  1.00 73.76  ? 177 PRO E CD    1 
ATOM 6870  N N     . VAL G 3 161 ? 100.430 7.181   37.242  1.00 28.29  ? 178 VAL E N     1 
ATOM 6871  C CA    . VAL G 3 161 ? 100.568 8.585   37.624  1.00 23.83  ? 178 VAL E CA    1 
ATOM 6872  C C     . VAL G 3 161 ? 101.305 9.425   36.573  1.00 23.69  ? 178 VAL E C     1 
ATOM 6873  O O     . VAL G 3 161 ? 102.217 8.942   35.901  1.00 50.91  ? 178 VAL E O     1 
ATOM 6874  C CB    . VAL G 3 161 ? 101.305 8.731   38.989  1.00 56.40  ? 178 VAL E CB    1 
ATOM 6875  C CG1   . VAL G 3 161 ? 102.819 8.874   38.768  1.00 52.67  ? 178 VAL E CG1   1 
ATOM 6876  C CG2   . VAL G 3 161 ? 100.733 9.922   39.770  1.00 52.92  ? 178 VAL E CG2   1 
ATOM 6877  N N     . LEU G 3 162 ? 100.901 10.692  36.467  1.00 97.67  ? 179 LEU E N     1 
ATOM 6878  C CA    . LEU G 3 162 ? 101.464 11.649  35.513  1.00 97.55  ? 179 LEU E CA    1 
ATOM 6879  C C     . LEU G 3 162 ? 102.368 12.696  36.170  1.00 97.03  ? 179 LEU E C     1 
ATOM 6880  O O     . LEU G 3 162 ? 102.106 13.158  37.282  1.00 33.29  ? 179 LEU E O     1 
ATOM 6881  C CB    . LEU G 3 162 ? 100.322 12.355  34.758  1.00 9.34   ? 179 LEU E CB    1 
ATOM 6882  C CG    . LEU G 3 162 ? 99.550  11.515  33.724  1.00 8.62   ? 179 LEU E CG    1 
ATOM 6883  C CD1   . LEU G 3 162 ? 98.276  12.200  33.347  1.00 9.40   ? 179 LEU E CD1   1 
ATOM 6884  C CD2   . LEU G 3 162 ? 100.409 11.277  32.490  1.00 7.78   ? 179 LEU E CD2   1 
ATOM 6885  N N     . SER G 3 163 ? 103.443 13.061  35.479  1.00 57.64  ? 180 SER E N     1 
ATOM 6886  C CA    . SER G 3 163 ? 104.362 14.066  35.997  1.00 57.52  ? 180 SER E CA    1 
ATOM 6887  C C     . SER G 3 163 ? 103.910 15.439  35.514  1.00 58.89  ? 180 SER E C     1 
ATOM 6888  O O     . SER G 3 163 ? 103.198 15.535  34.505  1.00 63.26  ? 180 SER E O     1 
ATOM 6889  C CB    . SER G 3 163 ? 105.786 13.794  35.512  1.00 50.88  ? 180 SER E CB    1 
ATOM 6890  O OG    . SER G 3 163 ? 106.407 12.784  36.281  1.00 49.80  ? 180 SER E OG    1 
ATOM 6891  N N     . HIS G 3 164 ? 104.309 16.490  36.235  1.00 82.98  ? 181 HIS E N     1 
ATOM 6892  C CA    . HIS G 3 164 ? 103.945 17.849  35.845  1.00 83.46  ? 181 HIS E CA    1 
ATOM 6893  C C     . HIS G 3 164 ? 104.295 18.054  34.397  1.00 80.96  ? 181 HIS E C     1 
ATOM 6894  O O     . HIS G 3 164 ? 105.135 17.350  33.830  1.00 48.21  ? 181 HIS E O     1 
ATOM 6895  C CB    . HIS G 3 164 ? 104.681 18.900  36.662  1.00 47.11  ? 181 HIS E CB    1 
ATOM 6896  C CG    . HIS G 3 164 ? 103.809 19.624  37.636  1.00 48.76  ? 181 HIS E CG    1 
ATOM 6897  N ND1   . HIS G 3 164 ? 104.282 20.624  38.458  1.00 49.75  ? 181 HIS E ND1   1 
ATOM 6898  C CD2   . HIS G 3 164 ? 102.496 19.485  37.932  1.00 47.36  ? 181 HIS E CD2   1 
ATOM 6899  C CE1   . HIS G 3 164 ? 103.299 21.071  39.219  1.00 49.54  ? 181 HIS E CE1   1 
ATOM 6900  N NE2   . HIS G 3 164 ? 102.205 20.395  38.919  1.00 50.32  ? 181 HIS E NE2   1 
ATOM 6901  N N     . PRO G 3 165 ? 103.677 19.048  33.777  1.00 18.60  ? 182 PRO E N     1 
ATOM 6902  C CA    . PRO G 3 165 ? 103.955 19.301  32.368  1.00 15.49  ? 182 PRO E CA    1 
ATOM 6903  C C     . PRO G 3 165 ? 105.444 19.507  32.072  1.00 15.00  ? 182 PRO E C     1 
ATOM 6904  O O     . PRO G 3 165 ? 106.150 20.179  32.818  1.00 26.80  ? 182 PRO E O     1 
ATOM 6905  C CB    . PRO G 3 165 ? 103.105 20.537  32.076  1.00 30.97  ? 182 PRO E CB    1 
ATOM 6906  C CG    . PRO G 3 165 ? 101.972 20.410  33.049  1.00 30.83  ? 182 PRO E CG    1 
ATOM 6907  C CD    . PRO G 3 165 ? 102.690 19.999  34.300  1.00 30.21  ? 182 PRO E CD    1 
ATOM 6908  N N     . ILE G 3 166 ? 105.910 18.901  30.991  1.00 15.36  ? 183 ILE E N     1 
ATOM 6909  C CA    . ILE G 3 166 ? 107.292 19.025  30.580  1.00 14.73  ? 183 ILE E CA    1 
ATOM 6910  C C     . ILE G 3 166 ? 107.254 19.715  29.242  1.00 15.19  ? 183 ILE E C     1 
ATOM 6911  O O     . ILE G 3 166 ? 106.730 19.163  28.264  1.00 41.63  ? 183 ILE E O     1 
ATOM 6912  C CB    . ILE G 3 166 ? 107.971 17.646  30.411  1.00 58.33  ? 183 ILE E CB    1 
ATOM 6913  C CG1   . ILE G 3 166 ? 108.706 17.267  31.695  1.00 60.83  ? 183 ILE E CG1   1 
ATOM 6914  C CG2   . ILE G 3 166 ? 108.958 17.671  29.235  1.00 53.54  ? 183 ILE E CG2   1 
ATOM 6915  C CD1   . ILE G 3 166 ? 110.041 17.955  31.852  1.00 58.92  ? 183 ILE E CD1   1 
ATOM 6916  N N     . PHE G 3 167 ? 107.827 20.918  29.196  1.00 22.18  ? 184 PHE E N     1 
ATOM 6917  C CA    . PHE G 3 167 ? 107.833 21.687  27.964  1.00 19.15  ? 184 PHE E CA    1 
ATOM 6918  C C     . PHE G 3 167 ? 109.169 21.788  27.287  1.00 21.01  ? 184 PHE E C     1 
ATOM 6919  O O     . PHE G 3 167 ? 110.159 22.164  27.892  1.00 28.46  ? 184 PHE E O     1 
ATOM 6920  C CB    . PHE G 3 167 ? 107.303 23.078  28.232  1.00 7.10   ? 184 PHE E CB    1 
ATOM 6921  C CG    . PHE G 3 167 ? 105.977 23.089  28.915  1.00 2.00   ? 184 PHE E CG    1 
ATOM 6922  C CD1   . PHE G 3 167 ? 105.897 23.214  30.292  1.00 2.00   ? 184 PHE E CD1   1 
ATOM 6923  C CD2   . PHE G 3 167 ? 104.804 22.973  28.183  1.00 2.00   ? 184 PHE E CD2   1 
ATOM 6924  C CE1   . PHE G 3 167 ? 104.651 23.229  30.943  1.00 2.00   ? 184 PHE E CE1   1 
ATOM 6925  C CE2   . PHE G 3 167 ? 103.560 22.984  28.821  1.00 2.00   ? 184 PHE E CE2   1 
ATOM 6926  C CZ    . PHE G 3 167 ? 103.479 23.114  30.200  1.00 2.00   ? 184 PHE E CZ    1 
ATOM 6927  N N     . ASP G 3 168 ? 109.171 21.461  26.010  1.00 57.74  ? 185 ASP E N     1 
ATOM 6928  C CA    . ASP G 3 168 ? 110.360 21.520  25.183  1.00 57.81  ? 185 ASP E CA    1 
ATOM 6929  C C     . ASP G 3 168 ? 110.802 22.980  24.997  1.00 59.47  ? 185 ASP E C     1 
ATOM 6930  O O     . ASP G 3 168 ? 109.996 23.836  24.631  1.00 36.02  ? 185 ASP E O     1 
ATOM 6931  C CB    . ASP G 3 168 ? 110.029 20.912  23.827  1.00 15.97  ? 185 ASP E CB    1 
ATOM 6932  C CG    . ASP G 3 168 ? 111.142 21.069  22.831  1.00 22.22  ? 185 ASP E CG    1 
ATOM 6933  O OD1   . ASP G 3 168 ? 110.911 20.811  21.623  1.00 26.14  ? 185 ASP E OD1   1 
ATOM 6934  O OD2   . ASP G 3 168 ? 112.255 21.448  23.256  1.00 24.54  ? 185 ASP E OD2   1 
ATOM 6935  N N     . ASN G 3 169 ? 112.071 23.286  25.244  1.00 28.62  ? 186 ASN E N     1 
ATOM 6936  C CA    . ASN G 3 169 ? 112.507 24.658  25.033  1.00 26.49  ? 186 ASN E CA    1 
ATOM 6937  C C     . ASN G 3 169 ? 112.741 24.887  23.563  1.00 25.59  ? 186 ASN E C     1 
ATOM 6938  O O     . ASN G 3 169 ? 112.447 25.967  23.051  1.00 42.47  ? 186 ASN E O     1 
ATOM 6939  C CB    . ASN G 3 169 ? 113.768 24.981  25.825  1.00 36.94  ? 186 ASN E CB    1 
ATOM 6940  C CG    . ASN G 3 169 ? 113.446 25.403  27.238  1.00 37.08  ? 186 ASN E CG    1 
ATOM 6941  O OD1   . ASN G 3 169 ? 112.302 25.268  27.700  1.00 36.59  ? 186 ASN E OD1   1 
ATOM 6942  N ND2   . ASN G 3 169 ? 114.443 25.905  27.940  1.00 34.43  ? 186 ASN E ND2   1 
ATOM 6943  N N     . ARG G 3 170 ? 113.240 23.867  22.874  1.00 12.47  ? 187 ARG E N     1 
ATOM 6944  C CA    . ARG G 3 170 ? 113.494 24.009  21.451  1.00 15.81  ? 187 ARG E CA    1 
ATOM 6945  C C     . ARG G 3 170 ? 112.216 24.533  20.838  1.00 15.76  ? 187 ARG E C     1 
ATOM 6946  O O     . ARG G 3 170 ? 112.208 25.033  19.719  1.00 21.56  ? 187 ARG E O     1 
ATOM 6947  C CB    . ARG G 3 170 ? 113.876 22.667  20.836  1.00 47.77  ? 187 ARG E CB    1 
ATOM 6948  C CG    . ARG G 3 170 ? 114.690 22.794  19.561  1.00 50.55  ? 187 ARG E CG    1 
ATOM 6949  C CD    . ARG G 3 170 ? 115.485 21.523  19.337  1.00 55.08  ? 187 ARG E CD    1 
ATOM 6950  N NE    . ARG G 3 170 ? 116.493 21.674  18.292  1.00 56.95  ? 187 ARG E NE    1 
ATOM 6951  C CZ    . ARG G 3 170 ? 117.590 20.927  18.197  1.00 56.73  ? 187 ARG E CZ    1 
ATOM 6952  N NH1   . ARG G 3 170 ? 117.828 19.972  19.090  1.00 57.15  ? 187 ARG E NH1   1 
ATOM 6953  N NH2   . ARG G 3 170 ? 118.451 21.135  17.208  1.00 56.81  ? 187 ARG E NH2   1 
ATOM 6954  N N     . ALA G 3 171 ? 111.129 24.404  21.592  1.00 47.69  ? 188 ALA E N     1 
ATOM 6955  C CA    . ALA G 3 171 ? 109.821 24.892  21.178  1.00 49.89  ? 188 ALA E CA    1 
ATOM 6956  C C     . ALA G 3 171 ? 109.679 26.328  21.690  1.00 53.63  ? 188 ALA E C     1 
ATOM 6957  O O     . ALA G 3 171 ? 109.562 26.559  22.897  1.00 42.77  ? 188 ALA E O     1 
ATOM 6958  C CB    . ALA G 3 171 ? 108.729 24.019  21.768  1.00 35.36  ? 188 ALA E CB    1 
ATOM 6959  N N     . PRO G 3 172 ? 109.674 27.306  20.770  1.00 39.07  ? 189 PRO E N     1 
ATOM 6960  C CA    . PRO G 3 172 ? 109.553 28.731  21.097  1.00 38.52  ? 189 PRO E CA    1 
ATOM 6961  C C     . PRO G 3 172 ? 108.294 29.107  21.860  1.00 37.45  ? 189 PRO E C     1 
ATOM 6962  O O     . PRO G 3 172 ? 108.339 29.941  22.750  1.00 21.70  ? 189 PRO E O     1 
ATOM 6963  C CB    . PRO G 3 172 ? 109.634 29.403  19.729  1.00 47.01  ? 189 PRO E CB    1 
ATOM 6964  C CG    . PRO G 3 172 ? 109.053 28.366  18.802  1.00 50.31  ? 189 PRO E CG    1 
ATOM 6965  C CD    . PRO G 3 172 ? 109.683 27.096  19.309  1.00 49.67  ? 189 PRO E CD    1 
ATOM 6966  N N     . ASN G 3 173 ? 107.178 28.485  21.498  1.00 29.00  ? 190 ASN E N     1 
ATOM 6967  C CA    . ASN G 3 173 ? 105.884 28.734  22.138  1.00 25.99  ? 190 ASN E CA    1 
ATOM 6968  C C     . ASN G 3 173 ? 105.965 28.459  23.617  1.00 24.32  ? 190 ASN E C     1 
ATOM 6969  O O     . ASN G 3 173 ? 105.123 28.924  24.370  1.00 29.69  ? 190 ASN E O     1 
ATOM 6970  C CB    . ASN G 3 173 ? 104.793 27.821  21.570  1.00 33.79  ? 190 ASN E CB    1 
ATOM 6971  C CG    . ASN G 3 173 ? 105.051 27.438  20.137  1.00 31.31  ? 190 ASN E CG    1 
ATOM 6972  O OD1   . ASN G 3 173 ? 105.962 26.661  19.847  1.00 30.71  ? 190 ASN E OD1   1 
ATOM 6973  N ND2   . ASN G 3 173 ? 104.269 27.994  19.225  1.00 31.24  ? 190 ASN E ND2   1 
ATOM 6974  N N     . THR G 3 174 ? 106.956 27.677  24.033  1.00 51.08  ? 191 THR E N     1 
ATOM 6975  C CA    . THR G 3 174 ? 107.090 27.360  25.449  1.00 53.46  ? 191 THR E CA    1 
ATOM 6976  C C     . THR G 3 174 ? 108.505 27.283  25.955  1.00 54.63  ? 191 THR E C     1 
ATOM 6977  O O     . THR G 3 174 ? 108.736 26.784  27.050  1.00 27.95  ? 191 THR E O     1 
ATOM 6978  C CB    . THR G 3 174 ? 106.439 26.026  25.818  1.00 33.18  ? 191 THR E CB    1 
ATOM 6979  O OG1   . THR G 3 174 ? 106.479 25.868  27.243  1.00 33.19  ? 191 THR E OG1   1 
ATOM 6980  C CG2   . THR G 3 174 ? 107.183 24.874  25.173  1.00 26.57  ? 191 THR E CG2   1 
ATOM 6981  N N     . ALA G 3 175 ? 109.459 27.742  25.160  1.00 37.61  ? 192 ALA E N     1 
ATOM 6982  C CA    . ALA G 3 175 ? 110.846 27.730  25.607  1.00 37.65  ? 192 ALA E CA    1 
ATOM 6983  C C     . ALA G 3 175 ? 110.836 28.642  26.828  1.00 36.79  ? 192 ALA E C     1 
ATOM 6984  O O     . ALA G 3 175 ? 109.921 29.458  26.982  1.00 32.34  ? 192 ALA E O     1 
ATOM 6985  C CB    . ALA G 3 175 ? 111.761 28.294  24.521  1.00 30.22  ? 192 ALA E CB    1 
ATOM 6986  N N     . GLU G 3 176 ? 111.819 28.495  27.711  1.00 23.76  ? 193 GLU E N     1 
ATOM 6987  C CA    . GLU G 3 176 ? 111.856 29.346  28.889  1.00 23.73  ? 193 GLU E CA    1 
ATOM 6988  C C     . GLU G 3 176 ? 112.098 30.795  28.476  1.00 23.24  ? 193 GLU E C     1 
ATOM 6989  O O     . GLU G 3 176 ? 112.781 31.066  27.491  1.00 35.94  ? 193 GLU E O     1 
ATOM 6990  C CB    . GLU G 3 176 ? 112.944 28.890  29.855  1.00 33.32  ? 193 GLU E CB    1 
ATOM 6991  C CG    . GLU G 3 176 ? 113.087 29.823  31.048  1.00 29.35  ? 193 GLU E CG    1 
ATOM 6992  C CD    . GLU G 3 176 ? 113.864 29.203  32.190  1.00 30.26  ? 193 GLU E CD    1 
ATOM 6993  O OE1   . GLU G 3 176 ? 115.008 28.744  31.955  1.00 33.28  ? 193 GLU E OE1   1 
ATOM 6994  O OE2   . GLU G 3 176 ? 113.321 29.179  33.319  1.00 23.26  ? 193 GLU E OE2   1 
ATOM 6995  N N     . LEU G 3 177 ? 111.508 31.724  29.218  1.00 52.27  ? 194 LEU E N     1 
ATOM 6996  C CA    . LEU G 3 177 ? 111.667 33.142  28.934  1.00 48.60  ? 194 LEU E CA    1 
ATOM 6997  C C     . LEU G 3 177 ? 112.970 33.541  29.586  1.00 49.48  ? 194 LEU E C     1 
ATOM 6998  O O     . LEU G 3 177 ? 113.168 33.248  30.753  1.00 19.44  ? 194 LEU E O     1 
ATOM 6999  C CB    . LEU G 3 177 ? 110.513 33.956  29.554  1.00 13.90  ? 194 LEU E CB    1 
ATOM 7000  C CG    . LEU G 3 177 ? 109.097 33.561  29.096  1.00 14.12  ? 194 LEU E CG    1 
ATOM 7001  C CD1   . LEU G 3 177 ? 108.000 34.315  29.861  1.00 6.90   ? 194 LEU E CD1   1 
ATOM 7002  C CD2   . LEU G 3 177 ? 109.003 33.813  27.599  1.00 10.90  ? 194 LEU E CD2   1 
ATOM 7003  N N     . LYS G 3 178 ? 113.869 34.175  28.841  1.00 59.19  ? 195 LYS E N     1 
ATOM 7004  C CA    . LYS G 3 178 ? 115.133 34.620  29.426  1.00 59.00  ? 195 LYS E CA    1 
ATOM 7005  C C     . LYS G 3 178 ? 115.551 36.004  28.972  1.00 59.04  ? 195 LYS E C     1 
ATOM 7006  O O     . LYS G 3 178 ? 115.437 36.360  27.791  1.00 41.58  ? 195 LYS E O     1 
ATOM 7007  C CB    . LYS G 3 178 ? 116.276 33.639  29.137  1.00 23.35  ? 195 LYS E CB    1 
ATOM 7008  C CG    . LYS G 3 178 ? 116.350 32.494  30.114  1.00 23.53  ? 195 LYS E CG    1 
ATOM 7009  C CD    . LYS G 3 178 ? 117.739 31.903  30.243  1.00 24.14  ? 195 LYS E CD    1 
ATOM 7010  C CE    . LYS G 3 178 ? 118.252 31.346  28.937  1.00 19.73  ? 195 LYS E CE    1 
ATOM 7011  N NZ    . LYS G 3 178 ? 118.586 32.429  27.984  1.00 18.70  ? 195 LYS E NZ    1 
ATOM 7012  N N     . ILE G 3 179 ? 116.030 36.784  29.932  1.00 12.32  ? 196 ILE E N     1 
ATOM 7013  C CA    . ILE G 3 179 ? 116.491 38.135  29.655  1.00 9.46   ? 196 ILE E CA    1 
ATOM 7014  C C     . ILE G 3 179 ? 117.995 38.067  29.781  1.00 10.33  ? 196 ILE E C     1 
ATOM 7015  O O     . ILE G 3 179 ? 118.539 38.131  30.879  1.00 29.33  ? 196 ILE E O     1 
ATOM 7016  C CB    . ILE G 3 179 ? 116.012 39.152  30.690  1.00 16.57  ? 196 ILE E CB    1 
ATOM 7017  C CG1   . ILE G 3 179 ? 114.518 39.005  30.928  1.00 17.30  ? 196 ILE E CG1   1 
ATOM 7018  C CG2   . ILE G 3 179 ? 116.334 40.553  30.215  1.00 13.30  ? 196 ILE E CG2   1 
ATOM 7019  C CD1   . ILE G 3 179 ? 113.975 40.059  31.862  1.00 16.88  ? 196 ILE E CD1   1 
ATOM 7020  N N     . CYS G 3 180 ? 118.671 37.945  28.653  1.00 26.54  ? 197 CYS E N     1 
ATOM 7021  C CA    . CYS G 3 180 ? 120.116 37.834  28.646  1.00 26.42  ? 197 CYS E CA    1 
ATOM 7022  C C     . CYS G 3 180 ? 120.911 39.099  28.987  1.00 25.73  ? 197 CYS E C     1 
ATOM 7023  O O     . CYS G 3 180 ? 121.972 39.016  29.591  1.00 22.73  ? 197 CYS E O     1 
ATOM 7024  C CB    . CYS G 3 180 ? 120.555 37.273  27.291  1.00 20.48  ? 197 CYS E CB    1 
ATOM 7025  S SG    . CYS G 3 180 ? 119.994 35.550  27.005  1.00 22.87  ? 197 CYS E SG    1 
ATOM 7026  N N     . ARG G 3 181 ? 120.407 40.270  28.626  1.00 35.63  ? 198 ARG E N     1 
ATOM 7027  C CA    . ARG G 3 181 ? 121.138 41.498  28.908  1.00 34.74  ? 198 ARG E CA    1 
ATOM 7028  C C     . ARG G 3 181 ? 120.441 42.707  28.281  1.00 37.02  ? 198 ARG E C     1 
ATOM 7029  O O     . ARG G 3 181 ? 119.837 42.594  27.210  1.00 29.06  ? 198 ARG E O     1 
ATOM 7030  C CB    . ARG G 3 181 ? 122.567 41.359  28.370  1.00 9.58   ? 198 ARG E CB    1 
ATOM 7031  C CG    . ARG G 3 181 ? 123.256 42.673  28.132  1.00 10.77  ? 198 ARG E CG    1 
ATOM 7032  C CD    . ARG G 3 181 ? 124.780 42.571  28.156  1.00 8.19   ? 198 ARG E CD    1 
ATOM 7033  N NE    . ARG G 3 181 ? 125.374 42.041  26.930  1.00 7.21   ? 198 ARG E NE    1 
ATOM 7034  C CZ    . ARG G 3 181 ? 126.685 42.034  26.682  1.00 3.38   ? 198 ARG E CZ    1 
ATOM 7035  N NH1   . ARG G 3 181 ? 127.143 41.531  25.542  1.00 3.38   ? 198 ARG E NH1   1 
ATOM 7036  N NH2   . ARG G 3 181 ? 127.542 42.526  27.572  1.00 3.38   ? 198 ARG E NH2   1 
ATOM 7037  N N     . VAL G 3 182 ? 120.519 43.856  28.953  1.00 17.21  ? 199 VAL E N     1 
ATOM 7038  C CA    . VAL G 3 182 ? 119.910 45.074  28.447  1.00 16.26  ? 199 VAL E CA    1 
ATOM 7039  C C     . VAL G 3 182 ? 120.905 46.216  28.593  1.00 17.87  ? 199 VAL E C     1 
ATOM 7040  O O     . VAL G 3 182 ? 121.782 46.158  29.434  1.00 28.66  ? 199 VAL E O     1 
ATOM 7041  C CB    . VAL G 3 182 ? 118.609 45.374  29.199  1.00 27.36  ? 199 VAL E CB    1 
ATOM 7042  C CG1   . VAL G 3 182 ? 117.710 44.161  29.177  1.00 34.82  ? 199 VAL E CG1   1 
ATOM 7043  C CG2   . VAL G 3 182 ? 118.907 45.739  30.617  1.00 32.03  ? 199 VAL E CG2   1 
ATOM 7044  N N     . ASN G 3 183 ? 120.786 47.240  27.758  1.00 19.37  ? 200 ASN E N     1 
ATOM 7045  C CA    . ASN G 3 183 ? 121.698 48.375  27.806  1.00 17.19  ? 200 ASN E CA    1 
ATOM 7046  C C     . ASN G 3 183 ? 121.380 49.279  28.980  1.00 15.82  ? 200 ASN E C     1 
ATOM 7047  O O     . ASN G 3 183 ? 122.136 49.353  29.934  1.00 25.89  ? 200 ASN E O     1 
ATOM 7048  C CB    . ASN G 3 183 ? 121.639 49.147  26.490  1.00 12.61  ? 200 ASN E CB    1 
ATOM 7049  C CG    . ASN G 3 183 ? 120.221 49.378  26.013  1.00 17.42  ? 200 ASN E CG    1 
ATOM 7050  O OD1   . ASN G 3 183 ? 120.003 50.035  25.000  1.00 24.63  ? 200 ASN E OD1   1 
ATOM 7051  N ND2   . ASN G 3 183 ? 119.252 48.835  26.734  1.00 15.06  ? 200 ASN E ND2   1 
ATOM 7052  N N     . ARG G 3 184 ? 120.258 49.971  28.920  1.00 5.57   ? 201 ARG E N     1 
ATOM 7053  C CA    . ARG G 3 184 ? 119.868 50.839  30.017  1.00 6.02   ? 201 ARG E CA    1 
ATOM 7054  C C     . ARG G 3 184 ? 119.491 49.968  31.226  1.00 8.48   ? 201 ARG E C     1 
ATOM 7055  O O     . ARG G 3 184 ? 119.124 48.804  31.074  1.00 27.72  ? 201 ARG E O     1 
ATOM 7056  C CB    . ARG G 3 184 ? 118.677 51.685  29.590  1.00 20.66  ? 201 ARG E CB    1 
ATOM 7057  C CG    . ARG G 3 184 ? 118.076 52.442  30.717  1.00 25.42  ? 201 ARG E CG    1 
ATOM 7058  C CD    . ARG G 3 184 ? 118.965 53.574  31.134  1.00 27.91  ? 201 ARG E CD    1 
ATOM 7059  N NE    . ARG G 3 184 ? 118.390 54.819  30.657  1.00 30.98  ? 201 ARG E NE    1 
ATOM 7060  C CZ    . ARG G 3 184 ? 118.317 55.161  29.381  1.00 31.83  ? 201 ARG E CZ    1 
ATOM 7061  N NH1   . ARG G 3 184 ? 117.756 56.313  29.055  1.00 31.40  ? 201 ARG E NH1   1 
ATOM 7062  N NH2   . ARG G 3 184 ? 118.818 54.366  28.444  1.00 35.14  ? 201 ARG E NH2   1 
ATOM 7063  N N     . ASN G 3 185 ? 119.568 50.538  32.425  1.00 34.99  ? 202 ASN E N     1 
ATOM 7064  C CA    . ASN G 3 185 ? 119.251 49.805  33.654  1.00 38.75  ? 202 ASN E CA    1 
ATOM 7065  C C     . ASN G 3 185 ? 118.399 50.709  34.536  1.00 41.41  ? 202 ASN E C     1 
ATOM 7066  O O     . ASN G 3 185 ? 117.872 50.283  35.563  1.00 47.70  ? 202 ASN E O     1 
ATOM 7067  C CB    . ASN G 3 185 ? 120.560 49.450  34.380  1.00 30.67  ? 202 ASN E CB    1 
ATOM 7068  C CG    . ASN G 3 185 ? 120.513 48.106  35.052  1.00 35.55  ? 202 ASN E CG    1 
ATOM 7069  O OD1   . ASN G 3 185 ? 119.904 47.953  36.102  1.00 39.77  ? 202 ASN E OD1   1 
ATOM 7070  N ND2   . ASN G 3 185 ? 121.154 47.110  34.440  1.00 33.94  ? 202 ASN E ND2   1 
ATOM 7071  N N     . SER G 3 186 ? 118.258 51.958  34.110  1.00 38.90  ? 203 SER E N     1 
ATOM 7072  C CA    . SER G 3 186 ? 117.514 52.948  34.873  1.00 38.87  ? 203 SER E CA    1 
ATOM 7073  C C     . SER G 3 186 ? 116.731 53.905  33.980  1.00 38.42  ? 203 SER E C     1 
ATOM 7074  O O     . SER G 3 186 ? 116.833 53.844  32.765  1.00 17.44  ? 203 SER E O     1 
ATOM 7075  C CB    . SER G 3 186 ? 118.502 53.742  35.716  1.00 29.46  ? 203 SER E CB    1 
ATOM 7076  O OG    . SER G 3 186 ? 119.574 54.189  34.899  1.00 33.21  ? 203 SER E OG    1 
ATOM 7077  N N     . GLY G 3 187 ? 115.955 54.797  34.591  1.00 10.18  ? 204 GLY E N     1 
ATOM 7078  C CA    . GLY G 3 187 ? 115.181 55.740  33.815  1.00 14.30  ? 204 GLY E CA    1 
ATOM 7079  C C     . GLY G 3 187 ? 114.371 56.696  34.664  1.00 16.04  ? 204 GLY E C     1 
ATOM 7080  O O     . GLY G 3 187 ? 114.271 56.540  35.885  1.00 30.18  ? 204 GLY E O     1 
ATOM 7081  N N     . SER G 3 188 ? 113.778 57.689  34.005  1.00 14.04  ? 205 SER E N     1 
ATOM 7082  C CA    . SER G 3 188 ? 112.963 58.695  34.679  1.00 15.13  ? 205 SER E CA    1 
ATOM 7083  C C     . SER G 3 188 ? 111.531 58.229  34.925  1.00 15.15  ? 205 SER E C     1 
ATOM 7084  O O     . SER G 3 188 ? 110.929 57.553  34.087  1.00 51.02  ? 205 SER E O     1 
ATOM 7085  C CB    . SER G 3 188 ? 112.959 59.984  33.857  1.00 66.65  ? 205 SER E CB    1 
ATOM 7086  O OG    . SER G 3 188 ? 112.914 59.699  32.466  1.00 69.25  ? 205 SER E OG    1 
ATOM 7087  N N     . CYS G 3 189 ? 110.989 58.599  36.083  1.00 56.37  ? 206 CYS E N     1 
ATOM 7088  C CA    . CYS G 3 189 ? 109.623 58.219  36.429  1.00 53.36  ? 206 CYS E CA    1 
ATOM 7089  C C     . CYS G 3 189 ? 108.642 58.647  35.345  1.00 50.75  ? 206 CYS E C     1 
ATOM 7090  O O     . CYS G 3 189 ? 107.539 58.115  35.246  1.00 52.53  ? 206 CYS E O     1 
ATOM 7091  C CB    . CYS G 3 189 ? 109.211 58.798  37.797  1.00 46.35  ? 206 CYS E CB    1 
ATOM 7092  S SG    . CYS G 3 189 ? 109.930 60.384  38.272  1.00 40.36  ? 206 CYS E SG    1 
ATOM 7093  N N     . LEU G 3 190 ? 109.054 59.595  34.516  1.00 18.41  ? 207 LEU E N     1 
ATOM 7094  C CA    . LEU G 3 190 ? 108.199 60.063  33.432  1.00 18.22  ? 207 LEU E CA    1 
ATOM 7095  C C     . LEU G 3 190 ? 108.048 58.998  32.343  1.00 17.73  ? 207 LEU E C     1 
ATOM 7096  O O     . LEU G 3 190 ? 107.097 59.026  31.554  1.00 22.25  ? 207 LEU E O     1 
ATOM 7097  C CB    . LEU G 3 190 ? 108.765 61.355  32.848  1.00 33.27  ? 207 LEU E CB    1 
ATOM 7098  C CG    . LEU G 3 190 ? 108.657 62.495  33.863  1.00 28.42  ? 207 LEU E CG    1 
ATOM 7099  C CD1   . LEU G 3 190 ? 109.456 63.711  33.408  1.00 26.91  ? 207 LEU E CD1   1 
ATOM 7100  C CD2   . LEU G 3 190 ? 107.182 62.834  34.051  1.00 25.68  ? 207 LEU E CD2   1 
ATOM 7101  N N     . GLY G 3 191 ? 108.992 58.058  32.323  1.00 30.88  ? 208 GLY E N     1 
ATOM 7102  C CA    . GLY G 3 191 ? 108.972 56.974  31.356  1.00 33.78  ? 208 GLY E CA    1 
ATOM 7103  C C     . GLY G 3 191 ? 109.235 57.387  29.924  1.00 33.15  ? 208 GLY E C     1 
ATOM 7104  O O     . GLY G 3 191 ? 108.986 58.528  29.548  1.00 32.42  ? 208 GLY E O     1 
ATOM 7105  N N     . GLY G 3 192 ? 109.745 56.460  29.119  1.00 2.00   ? 209 GLY E N     1 
ATOM 7106  C CA    . GLY G 3 192 ? 110.003 56.773  27.727  1.00 2.00   ? 209 GLY E CA    1 
ATOM 7107  C C     . GLY G 3 192 ? 111.444 56.550  27.318  1.00 2.00   ? 209 GLY E C     1 
ATOM 7108  O O     . GLY G 3 192 ? 111.851 56.824  26.177  1.00 2.00   ? 209 GLY E O     1 
ATOM 7109  N N     . ASP G 3 193 ? 112.233 56.058  28.256  1.00 10.21  ? 210 ASP E N     1 
ATOM 7110  C CA    . ASP G 3 193 ? 113.620 55.803  27.955  1.00 9.54   ? 210 ASP E CA    1 
ATOM 7111  C C     . ASP G 3 193 ? 113.732 54.551  27.093  1.00 10.69  ? 210 ASP E C     1 
ATOM 7112  O O     . ASP G 3 193 ? 113.480 53.440  27.570  1.00 23.52  ? 210 ASP E O     1 
ATOM 7113  C CB    . ASP G 3 193 ? 114.402 55.617  29.248  1.00 36.77  ? 210 ASP E CB    1 
ATOM 7114  C CG    . ASP G 3 193 ? 114.267 56.799  30.174  1.00 40.90  ? 210 ASP E CG    1 
ATOM 7115  O OD1   . ASP G 3 193 ? 114.788 57.869  29.813  1.00 38.61  ? 210 ASP E OD1   1 
ATOM 7116  O OD2   . ASP G 3 193 ? 113.636 56.667  31.246  1.00 40.22  ? 210 ASP E OD2   1 
ATOM 7117  N N     . GLU G 3 194 ? 114.089 54.728  25.823  1.00 3.54   ? 211 GLU E N     1 
ATOM 7118  C CA    . GLU G 3 194 ? 114.258 53.594  24.928  1.00 3.34   ? 211 GLU E CA    1 
ATOM 7119  C C     . GLU G 3 194 ? 115.275 52.593  25.504  1.00 3.34   ? 211 GLU E C     1 
ATOM 7120  O O     . GLU G 3 194 ? 116.334 52.966  26.028  1.00 10.27  ? 211 GLU E O     1 
ATOM 7121  C CB    . GLU G 3 194 ? 114.727 54.072  23.565  1.00 8.39   ? 211 GLU E CB    1 
ATOM 7122  C CG    . GLU G 3 194 ? 115.428 53.013  22.738  1.00 11.61  ? 211 GLU E CG    1 
ATOM 7123  C CD    . GLU G 3 194 ? 114.996 53.059  21.300  1.00 13.20  ? 211 GLU E CD    1 
ATOM 7124  O OE1   . GLU G 3 194 ? 113.804 52.806  21.066  1.00 16.46  ? 211 GLU E OE1   1 
ATOM 7125  O OE2   . GLU G 3 194 ? 115.815 53.351  20.404  1.00 12.57  ? 211 GLU E OE2   1 
ATOM 7126  N N     . ILE G 3 195 ? 114.945 51.312  25.407  1.00 12.76  ? 212 ILE E N     1 
ATOM 7127  C CA    . ILE G 3 195 ? 115.814 50.263  25.915  1.00 13.55  ? 212 ILE E CA    1 
ATOM 7128  C C     . ILE G 3 195 ? 116.029 49.167  24.875  1.00 17.00  ? 212 ILE E C     1 
ATOM 7129  O O     . ILE G 3 195 ? 115.148 48.872  24.059  1.00 11.68  ? 212 ILE E O     1 
ATOM 7130  C CB    . ILE G 3 195 ? 115.205 49.587  27.180  1.00 10.55  ? 212 ILE E CB    1 
ATOM 7131  C CG1   . ILE G 3 195 ? 115.178 50.577  28.338  1.00 10.55  ? 212 ILE E CG1   1 
ATOM 7132  C CG2   . ILE G 3 195 ? 116.010 48.339  27.586  1.00 10.55  ? 212 ILE E CG2   1 
ATOM 7133  C CD1   . ILE G 3 195 ? 114.797 49.926  29.664  1.00 10.55  ? 212 ILE E CD1   1 
ATOM 7134  N N     . PHE G 3 196 ? 117.219 48.581  24.904  1.00 25.72  ? 213 PHE E N     1 
ATOM 7135  C CA    . PHE G 3 196 ? 117.552 47.475  24.031  1.00 23.43  ? 213 PHE E CA    1 
ATOM 7136  C C     . PHE G 3 196 ? 117.612 46.303  24.971  1.00 23.79  ? 213 PHE E C     1 
ATOM 7137  O O     . PHE G 3 196 ? 118.392 46.308  25.913  1.00 7.96   ? 213 PHE E O     1 
ATOM 7138  C CB    . PHE G 3 196 ? 118.927 47.645  23.404  1.00 3.12   ? 213 PHE E CB    1 
ATOM 7139  C CG    . PHE G 3 196 ? 118.905 48.386  22.115  1.00 3.12   ? 213 PHE E CG    1 
ATOM 7140  C CD1   . PHE G 3 196 ? 118.298 49.631  22.029  1.00 3.12   ? 213 PHE E CD1   1 
ATOM 7141  C CD2   . PHE G 3 196 ? 119.465 47.835  20.974  1.00 3.12   ? 213 PHE E CD2   1 
ATOM 7142  C CE1   . PHE G 3 196 ? 118.245 50.319  20.832  1.00 3.12   ? 213 PHE E CE1   1 
ATOM 7143  C CE2   . PHE G 3 196 ? 119.414 48.533  19.777  1.00 3.12   ? 213 PHE E CE2   1 
ATOM 7144  C CZ    . PHE G 3 196 ? 118.797 49.776  19.717  1.00 3.12   ? 213 PHE E CZ    1 
ATOM 7145  N N     . LEU G 3 197 ? 116.768 45.313  24.729  1.00 24.83  ? 214 LEU E N     1 
ATOM 7146  C CA    . LEU G 3 197 ? 116.748 44.134  25.561  1.00 25.38  ? 214 LEU E CA    1 
ATOM 7147  C C     . LEU G 3 197 ? 117.107 42.946  24.703  1.00 25.72  ? 214 LEU E C     1 
ATOM 7148  O O     . LEU G 3 197 ? 116.394 42.618  23.758  1.00 16.41  ? 214 LEU E O     1 
ATOM 7149  C CB    . LEU G 3 197 ? 115.366 43.954  26.182  1.00 2.00   ? 214 LEU E CB    1 
ATOM 7150  C CG    . LEU G 3 197 ? 115.104 42.746  27.086  1.00 2.00   ? 214 LEU E CG    1 
ATOM 7151  C CD1   . LEU G 3 197 ? 114.051 43.107  28.126  1.00 2.00   ? 214 LEU E CD1   1 
ATOM 7152  C CD2   . LEU G 3 197 ? 114.666 41.561  26.267  1.00 2.00   ? 214 LEU E CD2   1 
ATOM 7153  N N     . LEU G 3 198 ? 118.247 42.332  24.999  1.00 20.19  ? 215 LEU E N     1 
ATOM 7154  C CA    . LEU G 3 198 ? 118.665 41.162  24.248  1.00 21.72  ? 215 LEU E CA    1 
ATOM 7155  C C     . LEU G 3 198 ? 118.078 40.024  25.029  1.00 23.63  ? 215 LEU E C     1 
ATOM 7156  O O     . LEU G 3 198 ? 118.201 39.993  26.259  1.00 19.20  ? 215 LEU E O     1 
ATOM 7157  C CB    . LEU G 3 198 ? 120.184 41.021  24.203  1.00 9.03   ? 215 LEU E CB    1 
ATOM 7158  C CG    . LEU G 3 198 ? 120.998 42.053  23.423  1.00 7.21   ? 215 LEU E CG    1 
ATOM 7159  C CD1   . LEU G 3 198 ? 122.340 41.439  23.091  1.00 5.91   ? 215 LEU E CD1   1 
ATOM 7160  C CD2   . LEU G 3 198 ? 120.283 42.468  22.137  1.00 6.44   ? 215 LEU E CD2   1 
ATOM 7161  N N     . CYS G 3 199 ? 117.423 39.100  24.330  1.00 10.12  ? 216 CYS E N     1 
ATOM 7162  C CA    . CYS G 3 199 ? 116.802 37.975  25.006  1.00 9.32   ? 216 CYS E CA    1 
ATOM 7163  C C     . CYS G 3 199 ? 116.801 36.719  24.172  1.00 9.63   ? 216 CYS E C     1 
ATOM 7164  O O     . CYS G 3 199 ? 117.151 36.736  23.002  1.00 5.29   ? 216 CYS E O     1 
ATOM 7165  C CB    . CYS G 3 199 ? 115.357 38.300  25.375  1.00 19.03  ? 216 CYS E CB    1 
ATOM 7166  S SG    . CYS G 3 199 ? 114.291 38.449  23.931  1.00 27.15  ? 216 CYS E SG    1 
ATOM 7167  N N     . ASP G 3 200 ? 116.382 35.631  24.806  1.00 27.93  ? 217 ASP E N     1 
ATOM 7168  C CA    . ASP G 3 200 ? 116.291 34.329  24.177  1.00 26.60  ? 217 ASP E CA    1 
ATOM 7169  C C     . ASP G 3 200 ? 115.185 34.333  23.137  1.00 25.53  ? 217 ASP E C     1 
ATOM 7170  O O     . ASP G 3 200 ? 114.274 35.158  23.201  1.00 41.90  ? 217 ASP E O     1 
ATOM 7171  C CB    . ASP G 3 200 ? 115.956 33.280  25.236  1.00 39.35  ? 217 ASP E CB    1 
ATOM 7172  C CG    . ASP G 3 200 ? 117.160 32.482  25.670  1.00 43.14  ? 217 ASP E CG    1 
ATOM 7173  O OD1   . ASP G 3 200 ? 116.981 31.542  26.474  1.00 41.64  ? 217 ASP E OD1   1 
ATOM 7174  O OD2   . ASP G 3 200 ? 118.277 32.789  25.205  1.00 42.41  ? 217 ASP E OD2   1 
ATOM 7175  N N     . LYS G 3 201 ? 115.256 33.388  22.204  1.00 12.95  ? 218 LYS E N     1 
ATOM 7176  C CA    . LYS G 3 201 ? 114.252 33.260  21.159  1.00 12.01  ? 218 LYS E CA    1 
ATOM 7177  C C     . LYS G 3 201 ? 112.898 33.586  21.769  1.00 12.78  ? 218 LYS E C     1 
ATOM 7178  O O     . LYS G 3 201 ? 112.562 33.068  22.844  1.00 15.98  ? 218 LYS E O     1 
ATOM 7179  C CB    . LYS G 3 201 ? 114.227 31.836  20.649  1.00 26.31  ? 218 LYS E CB    1 
ATOM 7180  C CG    . LYS G 3 201 ? 114.024 31.718  19.171  1.00 28.43  ? 218 LYS E CG    1 
ATOM 7181  C CD    . LYS G 3 201 ? 115.324 31.980  18.414  1.00 33.31  ? 218 LYS E CD    1 
ATOM 7182  C CE    . LYS G 3 201 ? 116.358 30.838  18.516  1.00 36.02  ? 218 LYS E CE    1 
ATOM 7183  N NZ    . LYS G 3 201 ? 117.082 30.727  19.826  1.00 37.85  ? 218 LYS E NZ    1 
ATOM 7184  N N     . VAL G 3 202 ? 112.138 34.450  21.094  1.00 36.45  ? 219 VAL E N     1 
ATOM 7185  C CA    . VAL G 3 202 ? 110.811 34.870  21.541  1.00 37.28  ? 219 VAL E CA    1 
ATOM 7186  C C     . VAL G 3 202 ? 109.918 35.029  20.327  1.00 38.63  ? 219 VAL E C     1 
ATOM 7187  O O     . VAL G 3 202 ? 110.414 35.279  19.240  1.00 34.41  ? 219 VAL E O     1 
ATOM 7188  C CB    . VAL G 3 202 ? 110.877 36.224  22.221  1.00 24.07  ? 219 VAL E CB    1 
ATOM 7189  C CG1   . VAL G 3 202 ? 111.057 36.053  23.711  1.00 24.45  ? 219 VAL E CG1   1 
ATOM 7190  C CG2   . VAL G 3 202 ? 112.027 37.006  21.629  1.00 27.83  ? 219 VAL E CG2   1 
ATOM 7191  N N     . GLN G 3 203 ? 108.605 34.898  20.499  1.00 5.83   ? 220 GLN E N     1 
ATOM 7192  C CA    . GLN G 3 203 ? 107.704 35.063  19.359  1.00 4.85   ? 220 GLN E CA    1 
ATOM 7193  C C     . GLN G 3 203 ? 107.037 36.444  19.445  1.00 3.31   ? 220 GLN E C     1 
ATOM 7194  O O     . GLN G 3 203 ? 106.203 36.704  20.319  1.00 2.00   ? 220 GLN E O     1 
ATOM 7195  C CB    . GLN G 3 203 ? 106.658 33.923  19.305  1.00 17.08  ? 220 GLN E CB    1 
ATOM 7196  C CG    . GLN G 3 203 ? 107.250 32.530  18.931  1.00 20.91  ? 220 GLN E CG    1 
ATOM 7197  C CD    . GLN G 3 203 ? 106.207 31.425  18.655  1.00 20.38  ? 220 GLN E CD    1 
ATOM 7198  O OE1   . GLN G 3 203 ? 105.539 30.919  19.566  1.00 17.44  ? 220 GLN E OE1   1 
ATOM 7199  N NE2   . GLN G 3 203 ? 106.077 31.051  17.387  1.00 25.00  ? 220 GLN E NE2   1 
ATOM 7200  N N     . LYS G 3 204 ? 107.450 37.334  18.541  1.00 44.69  ? 221 LYS E N     1 
ATOM 7201  C CA    . LYS G 3 204 ? 106.942 38.700  18.491  1.00 45.63  ? 221 LYS E CA    1 
ATOM 7202  C C     . LYS G 3 204 ? 105.441 38.808  18.646  1.00 47.10  ? 221 LYS E C     1 
ATOM 7203  O O     . LYS G 3 204 ? 104.955 39.642  19.408  1.00 27.41  ? 221 LYS E O     1 
ATOM 7204  C CB    . LYS G 3 204 ? 107.377 39.377  17.191  1.00 25.75  ? 221 LYS E CB    1 
ATOM 7205  C CG    . LYS G 3 204 ? 107.214 38.523  15.946  1.00 27.08  ? 221 LYS E CG    1 
ATOM 7206  C CD    . LYS G 3 204 ? 107.573 39.305  14.687  1.00 25.97  ? 221 LYS E CD    1 
ATOM 7207  C CE    . LYS G 3 204 ? 107.795 38.374  13.500  1.00 29.29  ? 221 LYS E CE    1 
ATOM 7208  N NZ    . LYS G 3 204 ? 106.632 37.485  13.203  1.00 28.13  ? 221 LYS E NZ    1 
ATOM 7209  N N     . GLU G 3 205 ? 104.696 37.974  17.933  1.00 6.93   ? 222 GLU E N     1 
ATOM 7210  C CA    . GLU G 3 205 ? 103.245 38.037  18.047  1.00 7.86   ? 222 GLU E CA    1 
ATOM 7211  C C     . GLU G 3 205 ? 102.800 37.755  19.484  1.00 6.60   ? 222 GLU E C     1 
ATOM 7212  O O     . GLU G 3 205 ? 101.750 38.222  19.909  1.00 15.86  ? 222 GLU E O     1 
ATOM 7213  C CB    . GLU G 3 205 ? 102.601 37.017  17.127  1.00 22.30  ? 222 GLU E CB    1 
ATOM 7214  C CG    . GLU G 3 205 ? 103.288 36.879  15.790  1.00 33.42  ? 222 GLU E CG    1 
ATOM 7215  C CD    . GLU G 3 205 ? 104.542 36.017  15.852  1.00 38.89  ? 222 GLU E CD    1 
ATOM 7216  O OE1   . GLU G 3 205 ? 105.142 35.757  14.781  1.00 43.56  ? 222 GLU E OE1   1 
ATOM 7217  O OE2   . GLU G 3 205 ? 104.925 35.597  16.966  1.00 40.31  ? 222 GLU E OE2   1 
ATOM 7218  N N     . ASP G 3 206 ? 103.637 37.044  20.240  1.00 21.14  ? 223 ASP E N     1 
ATOM 7219  C CA    . ASP G 3 206 ? 103.309 36.617  21.597  1.00 20.76  ? 223 ASP E CA    1 
ATOM 7220  C C     . ASP G 3 206 ? 104.421 36.881  22.643  1.00 22.36  ? 223 ASP E C     1 
ATOM 7221  O O     . ASP G 3 206 ? 105.079 35.944  23.108  1.00 40.31  ? 223 ASP E O     1 
ATOM 7222  C CB    . ASP G 3 206 ? 102.995 35.117  21.511  1.00 32.66  ? 223 ASP E CB    1 
ATOM 7223  C CG    . ASP G 3 206 ? 102.360 34.565  22.754  1.00 37.56  ? 223 ASP E CG    1 
ATOM 7224  O OD1   . ASP G 3 206 ? 102.970 34.654  23.840  1.00 37.20  ? 223 ASP E OD1   1 
ATOM 7225  O OD2   . ASP G 3 206 ? 101.239 34.023  22.632  1.00 42.72  ? 223 ASP E OD2   1 
ATOM 7226  N N     . ILE G 3 207 ? 104.636 38.140  23.019  1.00 2.00   ? 224 ILE E N     1 
ATOM 7227  C CA    . ILE G 3 207 ? 105.659 38.456  24.013  1.00 2.00   ? 224 ILE E CA    1 
ATOM 7228  C C     . ILE G 3 207 ? 105.430 39.846  24.528  1.00 2.00   ? 224 ILE E C     1 
ATOM 7229  O O     . ILE G 3 207 ? 104.983 40.705  23.775  1.00 2.00   ? 224 ILE E O     1 
ATOM 7230  C CB    . ILE G 3 207 ? 107.066 38.397  23.408  1.00 2.27   ? 224 ILE E CB    1 
ATOM 7231  C CG1   . ILE G 3 207 ? 108.130 38.556  24.486  1.00 4.16   ? 224 ILE E CG1   1 
ATOM 7232  C CG2   . ILE G 3 207 ? 107.250 39.515  22.442  1.00 2.00   ? 224 ILE E CG2   1 
ATOM 7233  C CD1   . ILE G 3 207 ? 107.923 37.701  25.737  1.00 3.78   ? 224 ILE E CD1   1 
ATOM 7234  N N     . GLU G 3 208 ? 105.731 40.052  25.813  1.00 8.47   ? 225 GLU E N     1 
ATOM 7235  C CA    . GLU G 3 208 ? 105.596 41.353  26.484  1.00 8.47   ? 225 GLU E CA    1 
ATOM 7236  C C     . GLU G 3 208 ? 106.755 41.635  27.449  1.00 9.51   ? 225 GLU E C     1 
ATOM 7237  O O     . GLU G 3 208 ? 107.430 40.718  27.904  1.00 12.84  ? 225 GLU E O     1 
ATOM 7238  C CB    . GLU G 3 208 ? 104.301 41.423  27.307  1.00 9.06   ? 225 GLU E CB    1 
ATOM 7239  C CG    . GLU G 3 208 ? 103.032 41.137  26.541  1.00 9.46   ? 225 GLU E CG    1 
ATOM 7240  C CD    . GLU G 3 208 ? 101.780 41.410  27.358  1.00 11.37  ? 225 GLU E CD    1 
ATOM 7241  O OE1   . GLU G 3 208 ? 101.122 42.438  27.107  1.00 14.40  ? 225 GLU E OE1   1 
ATOM 7242  O OE2   . GLU G 3 208 ? 101.451 40.603  28.253  1.00 14.33  ? 225 GLU E OE2   1 
ATOM 7243  N N     . VAL G 3 209 ? 106.977 42.911  27.755  1.00 2.00   ? 226 VAL E N     1 
ATOM 7244  C CA    . VAL G 3 209 ? 108.011 43.313  28.711  1.00 2.00   ? 226 VAL E CA    1 
ATOM 7245  C C     . VAL G 3 209 ? 107.238 43.840  29.912  1.00 2.00   ? 226 VAL E C     1 
ATOM 7246  O O     . VAL G 3 209 ? 106.710 44.951  29.892  1.00 2.00   ? 226 VAL E O     1 
ATOM 7247  C CB    . VAL G 3 209 ? 108.898 44.422  28.144  1.00 15.06  ? 226 VAL E CB    1 
ATOM 7248  C CG1   . VAL G 3 209 ? 109.878 44.892  29.199  1.00 17.11  ? 226 VAL E CG1   1 
ATOM 7249  C CG2   . VAL G 3 209 ? 109.657 43.911  26.923  1.00 15.06  ? 226 VAL E CG2   1 
ATOM 7250  N N     . TYR G 3 210 ? 107.183 43.036  30.963  1.00 22.81  ? 227 TYR E N     1 
ATOM 7251  C CA    . TYR G 3 210 ? 106.402 43.358  32.150  1.00 26.94  ? 227 TYR E CA    1 
ATOM 7252  C C     . TYR G 3 210 ? 107.162 44.006  33.311  1.00 28.92  ? 227 TYR E C     1 
ATOM 7253  O O     . TYR G 3 210 ? 108.158 43.468  33.816  1.00 27.68  ? 227 TYR E O     1 
ATOM 7254  C CB    . TYR G 3 210 ? 105.694 42.057  32.580  1.00 9.44   ? 227 TYR E CB    1 
ATOM 7255  C CG    . TYR G 3 210 ? 104.695 42.130  33.702  1.00 11.41  ? 227 TYR E CG    1 
ATOM 7256  C CD1   . TYR G 3 210 ? 103.716 43.112  33.740  1.00 12.29  ? 227 TYR E CD1   1 
ATOM 7257  C CD2   . TYR G 3 210 ? 104.710 41.181  34.723  1.00 13.03  ? 227 TYR E CD2   1 
ATOM 7258  C CE1   . TYR G 3 210 ? 102.769 43.154  34.781  1.00 14.09  ? 227 TYR E CE1   1 
ATOM 7259  C CE2   . TYR G 3 210 ? 103.769 41.211  35.768  1.00 14.40  ? 227 TYR E CE2   1 
ATOM 7260  C CZ    . TYR G 3 210 ? 102.804 42.200  35.789  1.00 12.85  ? 227 TYR E CZ    1 
ATOM 7261  O OH    . TYR G 3 210 ? 101.888 42.238  36.811  1.00 8.65   ? 227 TYR E OH    1 
ATOM 7262  N N     . PHE G 3 211 ? 106.674 45.177  33.716  1.00 10.45  ? 228 PHE E N     1 
ATOM 7263  C CA    . PHE G 3 211 ? 107.242 45.924  34.822  1.00 10.45  ? 228 PHE E CA    1 
ATOM 7264  C C     . PHE G 3 211 ? 106.367 45.762  36.052  1.00 10.45  ? 228 PHE E C     1 
ATOM 7265  O O     . PHE G 3 211 ? 105.261 46.299  36.110  1.00 27.64  ? 228 PHE E O     1 
ATOM 7266  C CB    . PHE G 3 211 ? 107.324 47.399  34.482  1.00 2.00   ? 228 PHE E CB    1 
ATOM 7267  C CG    . PHE G 3 211 ? 108.301 47.720  33.410  1.00 2.00   ? 228 PHE E CG    1 
ATOM 7268  C CD1   . PHE G 3 211 ? 108.036 47.403  32.097  1.00 2.00   ? 228 PHE E CD1   1 
ATOM 7269  C CD2   . PHE G 3 211 ? 109.510 48.317  33.724  1.00 2.00   ? 228 PHE E CD2   1 
ATOM 7270  C CE1   . PHE G 3 211 ? 108.971 47.689  31.108  1.00 2.00   ? 228 PHE E CE1   1 
ATOM 7271  C CE2   . PHE G 3 211 ? 110.450 48.603  32.748  1.00 2.00   ? 228 PHE E CE2   1 
ATOM 7272  C CZ    . PHE G 3 211 ? 110.189 48.289  31.448  1.00 2.00   ? 228 PHE E CZ    1 
ATOM 7273  N N     . THR G 3 212 ? 106.863 45.023  37.038  1.00 23.63  ? 229 THR E N     1 
ATOM 7274  C CA    . THR G 3 212 ? 106.121 44.791  38.278  1.00 24.69  ? 229 THR E CA    1 
ATOM 7275  C C     . THR G 3 212 ? 106.247 45.944  39.281  1.00 25.96  ? 229 THR E C     1 
ATOM 7276  O O     . THR G 3 212 ? 106.050 47.111  38.937  1.00 73.69  ? 229 THR E O     1 
ATOM 7277  C CB    . THR G 3 212 ? 106.610 43.515  38.975  1.00 63.96  ? 229 THR E CB    1 
ATOM 7278  O OG1   . THR G 3 212 ? 108.030 43.593  39.160  1.00 59.90  ? 229 THR E OG1   1 
ATOM 7279  C CG2   . THR G 3 212 ? 106.253 42.290  38.149  1.00 65.41  ? 229 THR E CG2   1 
ATOM 7280  N N     . GLY G 3 213 ? 106.565 45.603  40.527  1.00 43.61  ? 230 GLY E N     1 
ATOM 7281  C CA    . GLY G 3 213 ? 106.710 46.617  41.554  1.00 43.10  ? 230 GLY E CA    1 
ATOM 7282  C C     . GLY G 3 213 ? 105.435 46.900  42.336  1.00 43.10  ? 230 GLY E C     1 
ATOM 7283  O O     . GLY G 3 213 ? 104.407 47.255  41.753  1.00 39.46  ? 230 GLY E O     1 
ATOM 7284  N N     . PRO G 3 214 ? 105.497 46.802  43.675  1.00 60.58  ? 231 PRO E N     1 
ATOM 7285  C CA    . PRO G 3 214 ? 104.398 47.021  44.622  1.00 59.77  ? 231 PRO E CA    1 
ATOM 7286  C C     . PRO G 3 214 ? 103.434 48.127  44.255  1.00 58.15  ? 231 PRO E C     1 
ATOM 7287  O O     . PRO G 3 214 ? 103.813 49.294  44.191  1.00 58.60  ? 231 PRO E O     1 
ATOM 7288  C CB    . PRO G 3 214 ? 105.122 47.315  45.931  1.00 69.32  ? 231 PRO E CB    1 
ATOM 7289  C CG    . PRO G 3 214 ? 106.363 47.974  45.473  1.00 69.94  ? 231 PRO E CG    1 
ATOM 7290  C CD    . PRO G 3 214 ? 106.778 47.025  44.363  1.00 70.74  ? 231 PRO E CD    1 
ATOM 7291  N N     . GLY G 3 215 ? 102.184 47.750  44.024  1.00 56.28  ? 232 GLY E N     1 
ATOM 7292  C CA    . GLY G 3 215 ? 101.175 48.731  43.687  1.00 54.97  ? 232 GLY E CA    1 
ATOM 7293  C C     . GLY G 3 215 ? 101.285 49.339  42.301  1.00 54.70  ? 232 GLY E C     1 
ATOM 7294  O O     . GLY G 3 215 ? 100.509 50.234  41.942  1.00 59.53  ? 232 GLY E O     1 
ATOM 7295  N N     . TRP G 3 216 ? 102.242 48.866  41.514  1.00 30.89  ? 233 TRP E N     1 
ATOM 7296  C CA    . TRP G 3 216 ? 102.394 49.382  40.166  1.00 27.27  ? 233 TRP E CA    1 
ATOM 7297  C C     . TRP G 3 216 ? 102.522 48.251  39.170  1.00 28.06  ? 233 TRP E C     1 
ATOM 7298  O O     . TRP G 3 216 ? 103.230 47.261  39.414  1.00 20.21  ? 233 TRP E O     1 
ATOM 7299  C CB    . TRP G 3 216 ? 103.618 50.273  40.059  1.00 16.86  ? 233 TRP E CB    1 
ATOM 7300  C CG    . TRP G 3 216 ? 103.776 50.918  38.719  1.00 10.78  ? 233 TRP E CG    1 
ATOM 7301  C CD1   . TRP G 3 216 ? 102.906 51.788  38.118  1.00 10.78  ? 233 TRP E CD1   1 
ATOM 7302  C CD2   . TRP G 3 216 ? 104.866 50.745  37.809  1.00 10.78  ? 233 TRP E CD2   1 
ATOM 7303  N NE1   . TRP G 3 216 ? 103.390 52.169  36.883  1.00 10.78  ? 233 TRP E NE1   1 
ATOM 7304  C CE2   . TRP G 3 216 ? 104.593 51.545  36.668  1.00 10.78  ? 233 TRP E CE2   1 
ATOM 7305  C CE3   . TRP G 3 216 ? 106.049 49.998  37.842  1.00 10.78  ? 233 TRP E CE3   1 
ATOM 7306  C CZ2   . TRP G 3 216 ? 105.463 51.611  35.562  1.00 10.78  ? 233 TRP E CZ2   1 
ATOM 7307  C CZ3   . TRP G 3 216 ? 106.915 50.063  36.739  1.00 10.78  ? 233 TRP E CZ3   1 
ATOM 7308  C CH2   . TRP G 3 216 ? 106.614 50.868  35.618  1.00 10.78  ? 233 TRP E CH2   1 
ATOM 7309  N N     . GLU G 3 217 ? 101.825 48.405  38.048  1.00 26.10  ? 234 GLU E N     1 
ATOM 7310  C CA    . GLU G 3 217 ? 101.847 47.417  36.969  1.00 21.54  ? 234 GLU E CA    1 
ATOM 7311  C C     . GLU G 3 217 ? 101.776 48.102  35.622  1.00 18.63  ? 234 GLU E C     1 
ATOM 7312  O O     . GLU G 3 217 ? 100.881 48.899  35.371  1.00 10.18  ? 234 GLU E O     1 
ATOM 7313  C CB    . GLU G 3 217 ? 100.670 46.457  37.073  1.00 11.66  ? 234 GLU E CB    1 
ATOM 7314  C CG    . GLU G 3 217 ? 100.517 45.835  38.429  1.00 11.83  ? 234 GLU E CG    1 
ATOM 7315  C CD    . GLU G 3 217 ? 100.151 44.370  38.359  1.00 14.24  ? 234 GLU E CD    1 
ATOM 7316  O OE1   . GLU G 3 217 ? 99.280  44.016  37.547  1.00 16.14  ? 234 GLU E OE1   1 
ATOM 7317  O OE2   . GLU G 3 217 ? 100.729 43.572  39.127  1.00 14.10  ? 234 GLU E OE2   1 
ATOM 7318  N N     . ALA G 3 218 ? 102.720 47.788  34.750  1.00 2.00   ? 235 ALA E N     1 
ATOM 7319  C CA    . ALA G 3 218 ? 102.744 48.383  33.422  1.00 2.00   ? 235 ALA E CA    1 
ATOM 7320  C C     . ALA G 3 218 ? 103.671 47.618  32.511  1.00 2.00   ? 235 ALA E C     1 
ATOM 7321  O O     . ALA G 3 218 ? 104.519 46.856  32.975  1.00 2.00   ? 235 ALA E O     1 
ATOM 7322  C CB    . ALA G 3 218 ? 103.206 49.807  33.496  1.00 13.06  ? 235 ALA E CB    1 
ATOM 7323  N N     . ARG G 3 219 ? 103.506 47.836  31.206  1.00 7.93   ? 236 ARG E N     1 
ATOM 7324  C CA    . ARG G 3 219 ? 104.339 47.181  30.209  1.00 7.93   ? 236 ARG E CA    1 
ATOM 7325  C C     . ARG G 3 219 ? 104.988 48.218  29.311  1.00 7.93   ? 236 ARG E C     1 
ATOM 7326  O O     . ARG G 3 219 ? 104.405 49.263  29.029  1.00 20.91  ? 236 ARG E O     1 
ATOM 7327  C CB    . ARG G 3 219 ? 103.518 46.221  29.352  1.00 21.52  ? 236 ARG E CB    1 
ATOM 7328  C CG    . ARG G 3 219 ? 102.077 46.013  29.775  1.00 24.40  ? 236 ARG E CG    1 
ATOM 7329  C CD    . ARG G 3 219 ? 101.325 45.322  28.629  1.00 25.91  ? 236 ARG E CD    1 
ATOM 7330  N NE    . ARG G 3 219 ? 99.873  45.504  28.656  1.00 28.12  ? 236 ARG E NE    1 
ATOM 7331  C CZ    . ARG G 3 219 ? 99.084  45.275  27.613  1.00 28.78  ? 236 ARG E CZ    1 
ATOM 7332  N NH1   . ARG G 3 219 ? 97.780  45.457  27.712  1.00 32.92  ? 236 ARG E NH1   1 
ATOM 7333  N NH2   . ARG G 3 219 ? 99.606  44.876  26.464  1.00 31.36  ? 236 ARG E NH2   1 
ATOM 7334  N N     . GLY G 3 220 ? 106.213 47.925  28.889  1.00 3.61   ? 237 GLY E N     1 
ATOM 7335  C CA    . GLY G 3 220 ? 106.941 48.817  28.011  1.00 3.61   ? 237 GLY E CA    1 
ATOM 7336  C C     . GLY G 3 220 ? 106.223 48.798  26.689  1.00 3.61   ? 237 GLY E C     1 
ATOM 7337  O O     . GLY G 3 220 ? 105.567 47.817  26.342  1.00 21.30  ? 237 GLY E O     1 
ATOM 7338  N N     . SER G 3 221 ? 106.334 49.894  25.958  1.00 11.21  ? 238 SER E N     1 
ATOM 7339  C CA    . SER G 3 221 ? 105.692 50.053  24.669  1.00 11.21  ? 238 SER E CA    1 
ATOM 7340  C C     . SER G 3 221 ? 106.627 49.728  23.512  1.00 13.21  ? 238 SER E C     1 
ATOM 7341  O O     . SER G 3 221 ? 107.730 50.257  23.440  1.00 30.00  ? 238 SER E O     1 
ATOM 7342  C CB    . SER G 3 221 ? 105.222 51.486  24.549  1.00 19.60  ? 238 SER E CB    1 
ATOM 7343  O OG    . SER G 3 221 ? 105.202 51.895  23.202  1.00 23.96  ? 238 SER E OG    1 
ATOM 7344  N N     . PHE G 3 222 ? 106.194 48.854  22.610  1.00 8.74   ? 239 PHE E N     1 
ATOM 7345  C CA    . PHE G 3 222 ? 107.000 48.488  21.450  1.00 8.74   ? 239 PHE E CA    1 
ATOM 7346  C C     . PHE G 3 222 ? 106.113 47.784  20.455  1.00 8.74   ? 239 PHE E C     1 
ATOM 7347  O O     . PHE G 3 222 ? 105.208 47.046  20.834  1.00 18.24  ? 239 PHE E O     1 
ATOM 7348  C CB    . PHE G 3 222 ? 108.180 47.573  21.819  1.00 2.00   ? 239 PHE E CB    1 
ATOM 7349  C CG    . PHE G 3 222 ? 107.780 46.198  22.266  1.00 2.00   ? 239 PHE E CG    1 
ATOM 7350  C CD1   . PHE G 3 222 ? 107.600 45.911  23.615  1.00 2.00   ? 239 PHE E CD1   1 
ATOM 7351  C CD2   . PHE G 3 222 ? 107.615 45.171  21.334  1.00 2.00   ? 239 PHE E CD2   1 
ATOM 7352  C CE1   . PHE G 3 222 ? 107.266 44.619  24.045  1.00 2.00   ? 239 PHE E CE1   1 
ATOM 7353  C CE2   . PHE G 3 222 ? 107.280 43.875  21.754  1.00 2.00   ? 239 PHE E CE2   1 
ATOM 7354  C CZ    . PHE G 3 222 ? 107.108 43.603  23.120  1.00 2.00   ? 239 PHE E CZ    1 
ATOM 7355  N N     . SER G 3 223 ? 106.374 48.041  19.180  1.00 17.98  ? 240 SER E N     1 
ATOM 7356  C CA    . SER G 3 223 ? 105.615 47.472  18.085  1.00 18.70  ? 240 SER E CA    1 
ATOM 7357  C C     . SER G 3 223 ? 106.270 46.177  17.724  1.00 18.91  ? 240 SER E C     1 
ATOM 7358  O O     . SER G 3 223 ? 107.441 45.984  18.004  1.00 33.77  ? 240 SER E O     1 
ATOM 7359  C CB    . SER G 3 223 ? 105.655 48.417  16.900  1.00 18.58  ? 240 SER E CB    1 
ATOM 7360  O OG    . SER G 3 223 ? 106.984 48.821  16.658  1.00 14.18  ? 240 SER E OG    1 
ATOM 7361  N N     . GLN G 3 224 ? 105.520 45.279  17.106  1.00 15.78  ? 241 GLN E N     1 
ATOM 7362  C CA    . GLN G 3 224 ? 106.105 44.004  16.749  1.00 14.92  ? 241 GLN E CA    1 
ATOM 7363  C C     . GLN G 3 224 ? 107.329 44.219  15.875  1.00 14.07  ? 241 GLN E C     1 
ATOM 7364  O O     . GLN G 3 224 ? 108.310 43.489  15.981  1.00 18.79  ? 241 GLN E O     1 
ATOM 7365  C CB    . GLN G 3 224 ? 105.079 43.110  16.049  1.00 11.60  ? 241 GLN E CB    1 
ATOM 7366  C CG    . GLN G 3 224 ? 104.243 42.249  16.999  1.00 12.46  ? 241 GLN E CG    1 
ATOM 7367  C CD    . GLN G 3 224 ? 103.288 41.318  16.253  1.00 15.16  ? 241 GLN E CD    1 
ATOM 7368  O OE1   . GLN G 3 224 ? 103.702 40.443  15.495  1.00 14.13  ? 241 GLN E OE1   1 
ATOM 7369  N NE2   . GLN G 3 224 ? 102.005 41.514  16.463  1.00 19.08  ? 241 GLN E NE2   1 
ATOM 7370  N N     . ALA G 3 225 ? 107.297 45.244  15.036  1.00 19.37  ? 242 ALA E N     1 
ATOM 7371  C CA    . ALA G 3 225 ? 108.440 45.498  14.166  1.00 19.37  ? 242 ALA E CA    1 
ATOM 7372  C C     . ALA G 3 225 ? 109.665 45.993  14.952  1.00 19.37  ? 242 ALA E C     1 
ATOM 7373  O O     . ALA G 3 225 ? 110.657 46.421  14.363  1.00 19.37  ? 242 ALA E O     1 
ATOM 7374  C CB    . ALA G 3 225 ? 108.063 46.490  13.084  1.00 5.91   ? 242 ALA E CB    1 
ATOM 7375  N N     . ASP G 3 226 ? 109.591 45.932  16.279  1.00 6.07   ? 243 ASP E N     1 
ATOM 7376  C CA    . ASP G 3 226 ? 110.708 46.347  17.116  1.00 6.07   ? 243 ASP E CA    1 
ATOM 7377  C C     . ASP G 3 226 ? 111.329 45.079  17.691  1.00 6.07   ? 243 ASP E C     1 
ATOM 7378  O O     . ASP G 3 226 ? 112.219 45.144  18.537  1.00 22.40  ? 243 ASP E O     1 
ATOM 7379  C CB    . ASP G 3 226 ? 110.254 47.286  18.264  1.00 17.40  ? 243 ASP E CB    1 
ATOM 7380  C CG    . ASP G 3 226 ? 109.857 48.693  17.777  1.00 16.81  ? 243 ASP E CG    1 
ATOM 7381  O OD1   . ASP G 3 226 ? 110.612 49.286  16.990  1.00 19.82  ? 243 ASP E OD1   1 
ATOM 7382  O OD2   . ASP G 3 226 ? 108.801 49.226  18.190  1.00 15.34  ? 243 ASP E OD2   1 
ATOM 7383  N N     . VAL G 3 227 ? 110.854 43.921  17.242  1.00 2.00   ? 244 VAL E N     1 
ATOM 7384  C CA    . VAL G 3 227 ? 111.423 42.666  17.723  1.00 2.00   ? 244 VAL E CA    1 
ATOM 7385  C C     . VAL G 3 227 ? 112.333 42.130  16.629  1.00 3.10   ? 244 VAL E C     1 
ATOM 7386  O O     . VAL G 3 227 ? 111.853 41.656  15.601  1.00 2.00   ? 244 VAL E O     1 
ATOM 7387  C CB    . VAL G 3 227 ? 110.337 41.631  18.024  1.00 5.76   ? 244 VAL E CB    1 
ATOM 7388  C CG1   . VAL G 3 227 ? 110.858 40.583  19.013  1.00 5.76   ? 244 VAL E CG1   1 
ATOM 7389  C CG2   . VAL G 3 227 ? 109.137 42.322  18.589  1.00 5.76   ? 244 VAL E CG2   1 
ATOM 7390  N N     . HIS G 3 228 ? 113.640 42.196  16.865  1.00 13.56  ? 245 HIS E N     1 
ATOM 7391  C CA    . HIS G 3 228 ? 114.649 41.764  15.902  1.00 15.52  ? 245 HIS E CA    1 
ATOM 7392  C C     . HIS G 3 228 ? 114.997 40.270  15.946  1.00 15.00  ? 245 HIS E C     1 
ATOM 7393  O O     . HIS G 3 228 ? 115.487 39.764  16.959  1.00 2.00   ? 245 HIS E O     1 
ATOM 7394  C CB    . HIS G 3 228 ? 115.908 42.583  16.129  1.00 9.66   ? 245 HIS E CB    1 
ATOM 7395  C CG    . HIS G 3 228 ? 116.924 42.462  15.037  1.00 9.66   ? 245 HIS E CG    1 
ATOM 7396  N ND1   . HIS G 3 228 ? 117.183 41.272  14.390  1.00 10.41  ? 245 HIS E ND1   1 
ATOM 7397  C CD2   . HIS G 3 228 ? 117.826 43.352  14.560  1.00 10.90  ? 245 HIS E CD2   1 
ATOM 7398  C CE1   . HIS G 3 228 ? 118.208 41.433  13.572  1.00 13.44  ? 245 HIS E CE1   1 
ATOM 7399  N NE2   . HIS G 3 228 ? 118.618 42.685  13.657  1.00 10.38  ? 245 HIS E NE2   1 
ATOM 7400  N N     . ARG G 3 229 ? 114.774 39.589  14.819  1.00 2.00   ? 246 ARG E N     1 
ATOM 7401  C CA    . ARG G 3 229 ? 115.014 38.166  14.678  1.00 2.00   ? 246 ARG E CA    1 
ATOM 7402  C C     . ARG G 3 229 ? 114.762 37.440  15.978  1.00 2.00   ? 246 ARG E C     1 
ATOM 7403  O O     . ARG G 3 229 ? 115.540 36.580  16.409  1.00 5.50   ? 246 ARG E O     1 
ATOM 7404  C CB    . ARG G 3 229 ? 116.420 37.909  14.180  1.00 18.81  ? 246 ARG E CB    1 
ATOM 7405  C CG    . ARG G 3 229 ? 116.645 38.565  12.846  1.00 25.71  ? 246 ARG E CG    1 
ATOM 7406  C CD    . ARG G 3 229 ? 115.596 38.156  11.805  1.00 28.86  ? 246 ARG E CD    1 
ATOM 7407  N NE    . ARG G 3 229 ? 116.079 37.085  10.940  1.00 30.91  ? 246 ARG E NE    1 
ATOM 7408  C CZ    . ARG G 3 229 ? 115.810 35.797  11.113  1.00 31.71  ? 246 ARG E CZ    1 
ATOM 7409  N NH1   . ARG G 3 229 ? 115.046 35.402  12.120  1.00 26.24  ? 246 ARG E NH1   1 
ATOM 7410  N NH2   . ARG G 3 229 ? 116.311 34.902  10.280  1.00 33.16  ? 246 ARG E NH2   1 
ATOM 7411  N N     . GLN G 3 230 ? 113.638 37.807  16.583  1.00 18.22  ? 247 GLN E N     1 
ATOM 7412  C CA    . GLN G 3 230 ? 113.162 37.244  17.840  1.00 18.22  ? 247 GLN E CA    1 
ATOM 7413  C C     . GLN G 3 230 ? 114.171 37.010  18.956  1.00 18.91  ? 247 GLN E C     1 
ATOM 7414  O O     . GLN G 3 230 ? 113.996 36.105  19.776  1.00 18.22  ? 247 GLN E O     1 
ATOM 7415  C CB    . GLN G 3 230 ? 112.375 35.952  17.569  1.00 2.67   ? 247 GLN E CB    1 
ATOM 7416  C CG    . GLN G 3 230 ? 113.079 34.861  16.812  1.00 2.67   ? 247 GLN E CG    1 
ATOM 7417  C CD    . GLN G 3 230 ? 112.185 33.649  16.657  1.00 2.67   ? 247 GLN E CD    1 
ATOM 7418  O OE1   . GLN G 3 230 ? 111.278 33.438  17.447  1.00 2.67   ? 247 GLN E OE1   1 
ATOM 7419  N NE2   . GLN G 3 230 ? 112.446 32.838  15.645  1.00 2.67   ? 247 GLN E NE2   1 
ATOM 7420  N N     . VAL G 3 231 ? 115.218 37.824  18.995  1.00 2.00   ? 248 VAL E N     1 
ATOM 7421  C CA    . VAL G 3 231 ? 116.207 37.695  20.050  1.00 2.00   ? 248 VAL E CA    1 
ATOM 7422  C C     . VAL G 3 231 ? 116.657 39.059  20.566  1.00 2.00   ? 248 VAL E C     1 
ATOM 7423  O O     . VAL G 3 231 ? 117.741 39.216  21.149  1.00 2.00   ? 248 VAL E O     1 
ATOM 7424  C CB    . VAL G 3 231 ? 117.411 36.903  19.583  1.00 13.30  ? 248 VAL E CB    1 
ATOM 7425  C CG1   . VAL G 3 231 ? 117.015 35.462  19.374  1.00 12.27  ? 248 VAL E CG1   1 
ATOM 7426  C CG2   . VAL G 3 231 ? 117.949 37.510  18.320  1.00 12.31  ? 248 VAL E CG2   1 
ATOM 7427  N N     . ALA G 3 232 ? 115.790 40.042  20.365  1.00 12.80  ? 249 ALA E N     1 
ATOM 7428  C CA    . ALA G 3 232 ? 116.069 41.398  20.793  1.00 11.81  ? 249 ALA E CA    1 
ATOM 7429  C C     . ALA G 3 232 ? 114.824 42.256  20.661  1.00 11.32  ? 249 ALA E C     1 
ATOM 7430  O O     . ALA G 3 232 ? 114.095 42.181  19.674  1.00 9.91   ? 249 ALA E O     1 
ATOM 7431  C CB    . ALA G 3 232 ? 117.185 41.977  19.955  1.00 21.22  ? 249 ALA E CB    1 
ATOM 7432  N N     . ILE G 3 233 ? 114.584 43.074  21.667  1.00 16.10  ? 250 ILE E N     1 
ATOM 7433  C CA    . ILE G 3 233 ? 113.433 43.940  21.637  1.00 15.17  ? 250 ILE E CA    1 
ATOM 7434  C C     . ILE G 3 233 ? 113.893 45.347  21.956  1.00 17.28  ? 250 ILE E C     1 
ATOM 7435  O O     . ILE G 3 233 ? 114.820 45.543  22.733  1.00 14.23  ? 250 ILE E O     1 
ATOM 7436  C CB    . ILE G 3 233 ? 112.380 43.505  22.653  1.00 5.48   ? 250 ILE E CB    1 
ATOM 7437  C CG1   . ILE G 3 233 ? 112.129 41.998  22.538  1.00 7.55   ? 250 ILE E CG1   1 
ATOM 7438  C CG2   . ILE G 3 233 ? 111.105 44.267  22.400  1.00 5.18   ? 250 ILE E CG2   1 
ATOM 7439  C CD1   . ILE G 3 233 ? 110.874 41.509  23.258  1.00 7.07   ? 250 ILE E CD1   1 
ATOM 7440  N N     . VAL G 3 234 ? 113.249 46.325  21.335  1.00 18.13  ? 251 VAL E N     1 
ATOM 7441  C CA    . VAL G 3 234 ? 113.591 47.720  21.528  1.00 17.96  ? 251 VAL E CA    1 
ATOM 7442  C C     . VAL G 3 234 ? 112.328 48.406  21.983  1.00 21.78  ? 251 VAL E C     1 
ATOM 7443  O O     . VAL G 3 234 ? 111.569 48.902  21.167  1.00 21.20  ? 251 VAL E O     1 
ATOM 7444  C CB    . VAL G 3 234 ? 114.028 48.324  20.218  1.00 3.44   ? 251 VAL E CB    1 
ATOM 7445  C CG1   . VAL G 3 234 ? 114.833 49.573  20.470  1.00 3.44   ? 251 VAL E CG1   1 
ATOM 7446  C CG2   . VAL G 3 234 ? 114.814 47.287  19.423  1.00 3.44   ? 251 VAL E CG2   1 
ATOM 7447  N N     . PHE G 3 235 ? 112.097 48.423  23.285  1.00 2.00   ? 252 PHE E N     1 
ATOM 7448  C CA    . PHE G 3 235 ? 110.894 49.024  23.812  1.00 2.00   ? 252 PHE E CA    1 
ATOM 7449  C C     . PHE G 3 235 ? 111.172 50.337  24.528  1.00 2.00   ? 252 PHE E C     1 
ATOM 7450  O O     . PHE G 3 235 ? 112.321 50.673  24.797  1.00 2.00   ? 252 PHE E O     1 
ATOM 7451  C CB    . PHE G 3 235 ? 110.224 48.025  24.761  1.00 2.00   ? 252 PHE E CB    1 
ATOM 7452  C CG    . PHE G 3 235 ? 111.008 47.741  26.029  1.00 2.00   ? 252 PHE E CG    1 
ATOM 7453  C CD1   . PHE G 3 235 ? 110.613 48.295  27.252  1.00 2.00   ? 252 PHE E CD1   1 
ATOM 7454  C CD2   . PHE G 3 235 ? 112.112 46.910  26.008  1.00 2.00   ? 252 PHE E CD2   1 
ATOM 7455  C CE1   . PHE G 3 235 ? 111.300 48.015  28.421  1.00 2.00   ? 252 PHE E CE1   1 
ATOM 7456  C CE2   . PHE G 3 235 ? 112.793 46.639  27.182  1.00 2.00   ? 252 PHE E CE2   1 
ATOM 7457  C CZ    . PHE G 3 235 ? 112.379 47.194  28.383  1.00 2.00   ? 252 PHE E CZ    1 
ATOM 7458  N N     . ARG G 3 236 ? 110.109 51.076  24.827  1.00 2.00   ? 253 ARG E N     1 
ATOM 7459  C CA    . ARG G 3 236 ? 110.183 52.346  25.535  1.00 2.00   ? 253 ARG E CA    1 
ATOM 7460  C C     . ARG G 3 236 ? 109.686 52.121  26.956  1.00 2.00   ? 253 ARG E C     1 
ATOM 7461  O O     . ARG G 3 236 ? 108.623 51.571  27.165  1.00 2.00   ? 253 ARG E O     1 
ATOM 7462  C CB    . ARG G 3 236 ? 109.285 53.388  24.868  1.00 35.82  ? 253 ARG E CB    1 
ATOM 7463  C CG    . ARG G 3 236 ? 109.771 53.897  23.535  1.00 41.00  ? 253 ARG E CG    1 
ATOM 7464  C CD    . ARG G 3 236 ? 110.838 54.976  23.685  1.00 43.74  ? 253 ARG E CD    1 
ATOM 7465  N NE    . ARG G 3 236 ? 111.133 55.612  22.398  1.00 50.14  ? 253 ARG E NE    1 
ATOM 7466  C CZ    . ARG G 3 236 ? 112.018 56.592  22.214  1.00 50.32  ? 253 ARG E CZ    1 
ATOM 7467  N NH1   . ARG G 3 236 ? 112.201 57.087  20.998  1.00 48.59  ? 253 ARG E NH1   1 
ATOM 7468  N NH2   . ARG G 3 236 ? 112.720 57.078  23.235  1.00 53.00  ? 253 ARG E NH2   1 
ATOM 7469  N N     . THR G 3 237 ? 110.461 52.575  27.928  1.00 14.79  ? 254 THR E N     1 
ATOM 7470  C CA    . THR G 3 237 ? 110.135 52.430  29.336  1.00 14.46  ? 254 THR E CA    1 
ATOM 7471  C C     . THR G 3 237 ? 108.803 53.084  29.674  1.00 14.93  ? 254 THR E C     1 
ATOM 7472  O O     . THR G 3 237 ? 108.517 54.182  29.220  1.00 3.67   ? 254 THR E O     1 
ATOM 7473  C CB    . THR G 3 237 ? 111.297 53.033  30.181  1.00 4.82   ? 254 THR E CB    1 
ATOM 7474  O OG1   . THR G 3 237 ? 111.706 52.091  31.182  1.00 3.05   ? 254 THR E OG1   1 
ATOM 7475  C CG2   . THR G 3 237 ? 110.903 54.359  30.819  1.00 6.34   ? 254 THR E CG2   1 
ATOM 7476  N N     . PRO G 3 238 ? 107.950 52.393  30.456  1.00 28.45  ? 255 PRO E N     1 
ATOM 7477  C CA    . PRO G 3 238 ? 106.626 52.874  30.883  1.00 29.84  ? 255 PRO E CA    1 
ATOM 7478  C C     . PRO G 3 238 ? 106.642 53.855  32.072  1.00 29.60  ? 255 PRO E C     1 
ATOM 7479  O O     . PRO G 3 238 ? 107.396 53.686  33.040  1.00 41.03  ? 255 PRO E O     1 
ATOM 7480  C CB    . PRO G 3 238 ? 105.882 51.581  31.211  1.00 43.45  ? 255 PRO E CB    1 
ATOM 7481  C CG    . PRO G 3 238 ? 106.961 50.716  31.738  1.00 46.56  ? 255 PRO E CG    1 
ATOM 7482  C CD    . PRO G 3 238 ? 108.080 50.952  30.738  1.00 46.30  ? 255 PRO E CD    1 
ATOM 7483  N N     . PRO G 3 239 ? 105.783 54.886  32.015  1.00 5.80   ? 256 PRO E N     1 
ATOM 7484  C CA    . PRO G 3 239 ? 105.692 55.904  33.072  1.00 5.80   ? 256 PRO E CA    1 
ATOM 7485  C C     . PRO G 3 239 ? 105.398 55.318  34.441  1.00 8.25   ? 256 PRO E C     1 
ATOM 7486  O O     . PRO G 3 239 ? 104.433 54.575  34.623  1.00 24.71  ? 256 PRO E O     1 
ATOM 7487  C CB    . PRO G 3 239 ? 104.588 56.827  32.564  1.00 29.38  ? 256 PRO E CB    1 
ATOM 7488  C CG    . PRO G 3 239 ? 103.739 55.922  31.699  1.00 24.05  ? 256 PRO E CG    1 
ATOM 7489  C CD    . PRO G 3 239 ? 104.748 55.085  30.980  1.00 27.23  ? 256 PRO E CD    1 
ATOM 7490  N N     . TYR G 3 240 ? 106.248 55.641  35.402  1.00 3.81   ? 257 TYR E N     1 
ATOM 7491  C CA    . TYR G 3 240 ? 106.071 55.139  36.750  1.00 5.82   ? 257 TYR E CA    1 
ATOM 7492  C C     . TYR G 3 240 ? 104.865 55.826  37.380  1.00 12.58  ? 257 TYR E C     1 
ATOM 7493  O O     . TYR G 3 240 ? 104.431 56.877  36.906  1.00 34.56  ? 257 TYR E O     1 
ATOM 7494  C CB    . TYR G 3 240 ? 107.332 55.389  37.570  1.00 33.09  ? 257 TYR E CB    1 
ATOM 7495  C CG    . TYR G 3 240 ? 107.301 54.734  38.932  1.00 31.69  ? 257 TYR E CG    1 
ATOM 7496  C CD1   . TYR G 3 240 ? 106.835 55.426  40.053  1.00 28.85  ? 257 TYR E CD1   1 
ATOM 7497  C CD2   . TYR G 3 240 ? 107.690 53.398  39.098  1.00 35.06  ? 257 TYR E CD2   1 
ATOM 7498  C CE1   . TYR G 3 240 ? 106.753 54.802  41.307  1.00 29.35  ? 257 TYR E CE1   1 
ATOM 7499  C CE2   . TYR G 3 240 ? 107.610 52.768  40.348  1.00 31.97  ? 257 TYR E CE2   1 
ATOM 7500  C CZ    . TYR G 3 240 ? 107.138 53.480  41.443  1.00 30.77  ? 257 TYR E CZ    1 
ATOM 7501  O OH    . TYR G 3 240 ? 107.034 52.877  42.670  1.00 25.65  ? 257 TYR E OH    1 
ATOM 7502  N N     . ALA G 3 241 ? 104.319 55.229  38.436  1.00 28.68  ? 258 ALA E N     1 
ATOM 7503  C CA    . ALA G 3 241 ? 103.147 55.770  39.128  1.00 30.85  ? 258 ALA E CA    1 
ATOM 7504  C C     . ALA G 3 241 ? 103.303 57.196  39.654  1.00 32.18  ? 258 ALA E C     1 
ATOM 7505  O O     . ALA G 3 241 ? 102.345 57.967  39.656  1.00 55.10  ? 258 ALA E O     1 
ATOM 7506  C CB    . ALA G 3 241 ? 102.769 54.848  40.278  1.00 51.92  ? 258 ALA E CB    1 
ATOM 7507  N N     . ASP G 3 242 ? 104.520 57.529  40.084  1.00 22.55  ? 259 ASP E N     1 
ATOM 7508  C CA    . ASP G 3 242 ? 104.866 58.831  40.664  1.00 20.22  ? 259 ASP E CA    1 
ATOM 7509  C C     . ASP G 3 242 ? 105.530 59.814  39.675  1.00 20.61  ? 259 ASP E C     1 
ATOM 7510  O O     . ASP G 3 242 ? 106.739 59.779  39.496  1.00 42.74  ? 259 ASP E O     1 
ATOM 7511  C CB    . ASP G 3 242 ? 105.818 58.563  41.838  1.00 31.61  ? 259 ASP E CB    1 
ATOM 7512  C CG    . ASP G 3 242 ? 105.858 59.689  42.832  1.00 29.88  ? 259 ASP E CG    1 
ATOM 7513  O OD1   . ASP G 3 242 ? 106.150 60.834  42.425  1.00 24.80  ? 259 ASP E OD1   1 
ATOM 7514  O OD2   . ASP G 3 242 ? 105.595 59.422  44.027  1.00 32.17  ? 259 ASP E OD2   1 
ATOM 7515  N N     . PRO G 3 243 ? 104.755 60.712  39.041  1.00 48.85  ? 260 PRO E N     1 
ATOM 7516  C CA    . PRO G 3 243 ? 105.316 61.674  38.086  1.00 51.78  ? 260 PRO E CA    1 
ATOM 7517  C C     . PRO G 3 243 ? 106.282 62.695  38.690  1.00 54.79  ? 260 PRO E C     1 
ATOM 7518  O O     . PRO G 3 243 ? 106.780 63.586  37.994  1.00 70.30  ? 260 PRO E O     1 
ATOM 7519  C CB    . PRO G 3 243 ? 104.074 62.323  37.479  1.00 70.55  ? 260 PRO E CB    1 
ATOM 7520  C CG    . PRO G 3 243 ? 103.095 62.270  38.596  1.00 69.77  ? 260 PRO E CG    1 
ATOM 7521  C CD    . PRO G 3 243 ? 103.295 60.875  39.137  1.00 67.69  ? 260 PRO E CD    1 
ATOM 7522  N N     . SER G 3 244 ? 106.545 62.564  39.987  1.00 48.18  ? 261 SER E N     1 
ATOM 7523  C CA    . SER G 3 244 ? 107.465 63.464  40.676  1.00 48.11  ? 261 SER E CA    1 
ATOM 7524  C C     . SER G 3 244 ? 108.163 62.693  41.788  1.00 49.85  ? 261 SER E C     1 
ATOM 7525  O O     . SER G 3 244 ? 108.075 63.046  42.964  1.00 76.06  ? 261 SER E O     1 
ATOM 7526  C CB    . SER G 3 244 ? 106.716 64.661  41.266  1.00 59.57  ? 261 SER E CB    1 
ATOM 7527  O OG    . SER G 3 244 ? 105.905 64.264  42.357  1.00 55.04  ? 261 SER E OG    1 
ATOM 7528  N N     . LEU G 3 245 ? 108.831 61.614  41.396  1.00 91.30  ? 262 LEU E N     1 
ATOM 7529  C CA    . LEU G 3 245 ? 109.574 60.757  42.311  1.00 92.73  ? 262 LEU E CA    1 
ATOM 7530  C C     . LEU G 3 245 ? 110.675 61.603  42.957  1.00 94.21  ? 262 LEU E C     1 
ATOM 7531  O O     . LEU G 3 245 ? 110.890 62.752  42.555  1.00 44.67  ? 262 LEU E O     1 
ATOM 7532  C CB    . LEU G 3 245 ? 110.157 59.579  41.509  1.00 32.62  ? 262 LEU E CB    1 
ATOM 7533  C CG    . LEU G 3 245 ? 111.143 58.583  42.111  1.00 34.65  ? 262 LEU E CG    1 
ATOM 7534  C CD1   . LEU G 3 245 ? 110.588 58.032  43.386  1.00 33.84  ? 262 LEU E CD1   1 
ATOM 7535  C CD2   . LEU G 3 245 ? 111.400 57.463  41.138  1.00 36.86  ? 262 LEU E CD2   1 
ATOM 7536  N N     . GLN G 3 246 ? 111.367 61.042  43.946  1.00 73.85  ? 263 GLN E N     1 
ATOM 7537  C CA    . GLN G 3 246 ? 112.434 61.763  44.646  1.00 72.57  ? 263 GLN E CA    1 
ATOM 7538  C C     . GLN G 3 246 ? 113.627 60.898  45.094  1.00 70.41  ? 263 GLN E C     1 
ATOM 7539  O O     . GLN G 3 246 ? 114.479 61.350  45.869  1.00 45.19  ? 263 GLN E O     1 
ATOM 7540  C CB    . GLN G 3 246 ? 111.847 62.480  45.867  1.00 55.75  ? 263 GLN E CB    1 
ATOM 7541  C CG    . GLN G 3 246 ? 110.805 61.645  46.621  1.00 59.53  ? 263 GLN E CG    1 
ATOM 7542  C CD    . GLN G 3 246 ? 111.273 60.226  46.949  1.00 61.20  ? 263 GLN E CD    1 
ATOM 7543  O OE1   . GLN G 3 246 ? 112.275 60.031  47.629  1.00 59.84  ? 263 GLN E OE1   1 
ATOM 7544  N NE2   . GLN G 3 246 ? 110.536 59.233  46.467  1.00 60.41  ? 263 GLN E NE2   1 
ATOM 7545  N N     . ALA G 3 247 ? 113.689 59.662  44.607  1.00 72.18  ? 264 ALA E N     1 
ATOM 7546  C CA    . ALA G 3 247 ? 114.773 58.760  44.969  1.00 71.42  ? 264 ALA E CA    1 
ATOM 7547  C C     . ALA G 3 247 ? 114.659 57.441  44.226  1.00 70.35  ? 264 ALA E C     1 
ATOM 7548  O O     . ALA G 3 247 ? 113.598 57.093  43.715  1.00 56.22  ? 264 ALA E O     1 
ATOM 7549  C CB    . ALA G 3 247 ? 114.765 58.505  46.464  1.00 55.42  ? 264 ALA E CB    1 
ATOM 7550  N N     . PRO G 3 248 ? 115.761 56.686  44.158  1.00 50.24  ? 265 PRO E N     1 
ATOM 7551  C CA    . PRO G 3 248 ? 115.748 55.399  43.462  1.00 50.47  ? 265 PRO E CA    1 
ATOM 7552  C C     . PRO G 3 248 ? 114.703 54.426  43.991  1.00 51.81  ? 265 PRO E C     1 
ATOM 7553  O O     . PRO G 3 248 ? 114.706 54.082  45.177  1.00 62.94  ? 265 PRO E O     1 
ATOM 7554  C CB    . PRO G 3 248 ? 117.170 54.891  43.662  1.00 56.33  ? 265 PRO E CB    1 
ATOM 7555  C CG    . PRO G 3 248 ? 117.953 56.148  43.604  1.00 56.75  ? 265 PRO E CG    1 
ATOM 7556  C CD    . PRO G 3 248 ? 117.142 57.076  44.485  1.00 57.00  ? 265 PRO E CD    1 
ATOM 7557  N N     . VAL G 3 249 ? 113.806 54.002  43.100  1.00 57.14  ? 266 VAL E N     1 
ATOM 7558  C CA    . VAL G 3 249 ? 112.760 53.044  43.440  1.00 56.44  ? 266 VAL E CA    1 
ATOM 7559  C C     . VAL G 3 249 ? 112.962 51.813  42.563  1.00 54.75  ? 266 VAL E C     1 
ATOM 7560  O O     . VAL G 3 249 ? 112.203 51.574  41.630  1.00 83.45  ? 266 VAL E O     1 
ATOM 7561  C CB    . VAL G 3 249 ? 111.361 53.613  43.163  1.00 77.48  ? 266 VAL E CB    1 
ATOM 7562  C CG1   . VAL G 3 249 ? 110.298 52.630  43.637  1.00 77.54  ? 266 VAL E CG1   1 
ATOM 7563  C CG2   . VAL G 3 249 ? 111.203 54.957  43.846  1.00 79.83  ? 266 VAL E CG2   1 
ATOM 7564  N N     . ARG G 3 250 ? 113.999 51.042  42.860  1.00 40.21  ? 267 ARG E N     1 
ATOM 7565  C CA    . ARG G 3 250 ? 114.307 49.851  42.088  1.00 39.62  ? 267 ARG E CA    1 
ATOM 7566  C C     . ARG G 3 250 ? 113.116 48.899  41.964  1.00 39.06  ? 267 ARG E C     1 
ATOM 7567  O O     . ARG G 3 250 ? 112.765 48.200  42.908  1.00 71.81  ? 267 ARG E O     1 
ATOM 7568  C CB    . ARG G 3 250 ? 115.509 49.127  42.705  1.00 67.49  ? 267 ARG E CB    1 
ATOM 7569  C CG    . ARG G 3 250 ? 115.407 48.954  44.200  1.00 67.36  ? 267 ARG E CG    1 
ATOM 7570  C CD    . ARG G 3 250 ? 116.591 48.195  44.772  1.00 69.16  ? 267 ARG E CD    1 
ATOM 7571  N NE    . ARG G 3 250 ? 117.852 48.921  44.625  1.00 72.35  ? 267 ARG E NE    1 
ATOM 7572  C CZ    . ARG G 3 250 ? 119.018 48.486  45.094  1.00 71.53  ? 267 ARG E CZ    1 
ATOM 7573  N NH1   . ARG G 3 250 ? 120.120 49.205  44.916  1.00 70.95  ? 267 ARG E NH1   1 
ATOM 7574  N NH2   . ARG G 3 250 ? 119.084 47.330  45.740  1.00 70.05  ? 267 ARG E NH2   1 
ATOM 7575  N N     . VAL G 3 251 ? 112.498 48.888  40.784  1.00 43.59  ? 268 VAL E N     1 
ATOM 7576  C CA    . VAL G 3 251 ? 111.366 48.023  40.497  1.00 39.23  ? 268 VAL E CA    1 
ATOM 7577  C C     . VAL G 3 251 ? 111.864 46.802  39.731  1.00 37.25  ? 268 VAL E C     1 
ATOM 7578  O O     . VAL G 3 251 ? 113.074 46.583  39.619  1.00 32.98  ? 268 VAL E O     1 
ATOM 7579  C CB    . VAL G 3 251 ? 110.317 48.766  39.667  1.00 26.12  ? 268 VAL E CB    1 
ATOM 7580  C CG1   . VAL G 3 251 ? 109.494 49.640  40.567  1.00 23.82  ? 268 VAL E CG1   1 
ATOM 7581  C CG2   . VAL G 3 251 ? 110.989 49.639  38.627  1.00 23.98  ? 268 VAL E CG2   1 
ATOM 7582  N N     . SER G 3 252 ? 110.948 46.003  39.193  1.00 33.00  ? 269 SER E N     1 
ATOM 7583  C CA    . SER G 3 252 ? 111.358 44.807  38.467  1.00 31.41  ? 269 SER E CA    1 
ATOM 7584  C C     . SER G 3 252 ? 110.842 44.723  37.047  1.00 31.47  ? 269 SER E C     1 
ATOM 7585  O O     . SER G 3 252 ? 109.691 45.043  36.753  1.00 38.49  ? 269 SER E O     1 
ATOM 7586  C CB    . SER G 3 252 ? 110.930 43.553  39.215  1.00 51.83  ? 269 SER E CB    1 
ATOM 7587  O OG    . SER G 3 252 ? 111.160 42.414  38.411  1.00 51.82  ? 269 SER E OG    1 
ATOM 7588  N N     . MET G 3 253 ? 111.717 44.247  36.177  1.00 22.69  ? 270 MET E N     1 
ATOM 7589  C CA    . MET G 3 253 ? 111.430 44.116  34.768  1.00 22.69  ? 270 MET E CA    1 
ATOM 7590  C C     . MET G 3 253 ? 111.562 42.678  34.305  1.00 22.69  ? 270 MET E C     1 
ATOM 7591  O O     . MET G 3 253 ? 112.576 42.031  34.559  1.00 28.84  ? 270 MET E O     1 
ATOM 7592  C CB    . MET G 3 253 ? 112.397 45.006  34.009  1.00 19.78  ? 270 MET E CB    1 
ATOM 7593  C CG    . MET G 3 253 ? 112.768 44.564  32.637  1.00 19.18  ? 270 MET E CG    1 
ATOM 7594  S SD    . MET G 3 253 ? 113.467 46.000  31.860  1.00 20.18  ? 270 MET E SD    1 
ATOM 7595  C CE    . MET G 3 253 ? 115.046 46.068  32.639  1.00 20.92  ? 270 MET E CE    1 
ATOM 7596  N N     . GLN G 3 254 ? 110.540 42.183  33.616  1.00 3.74   ? 271 GLN E N     1 
ATOM 7597  C CA    . GLN G 3 254 ? 110.577 40.817  33.147  1.00 3.74   ? 271 GLN E CA    1 
ATOM 7598  C C     . GLN G 3 254 ? 109.784 40.609  31.879  1.00 3.74   ? 271 GLN E C     1 
ATOM 7599  O O     . GLN G 3 254 ? 108.785 41.283  31.626  1.00 14.64  ? 271 GLN E O     1 
ATOM 7600  C CB    . GLN G 3 254 ? 110.047 39.892  34.238  1.00 24.54  ? 271 GLN E CB    1 
ATOM 7601  C CG    . GLN G 3 254 ? 108.735 40.366  34.820  1.00 24.65  ? 271 GLN E CG    1 
ATOM 7602  C CD    . GLN G 3 254 ? 108.483 39.834  36.221  1.00 22.73  ? 271 GLN E CD    1 
ATOM 7603  O OE1   . GLN G 3 254 ? 108.478 38.617  36.444  1.00 16.46  ? 271 GLN E OE1   1 
ATOM 7604  N NE2   . GLN G 3 254 ? 108.260 40.746  37.176  1.00 16.46  ? 271 GLN E NE2   1 
ATOM 7605  N N     . LEU G 3 255 ? 110.254 39.667  31.077  1.00 8.81   ? 272 LEU E N     1 
ATOM 7606  C CA    . LEU G 3 255 ? 109.603 39.320  29.836  1.00 8.48   ? 272 LEU E CA    1 
ATOM 7607  C C     . LEU G 3 255 ? 108.375 38.488  30.184  1.00 10.69  ? 272 LEU E C     1 
ATOM 7608  O O     . LEU G 3 255 ? 108.456 37.618  31.037  1.00 11.73  ? 272 LEU E O     1 
ATOM 7609  C CB    . LEU G 3 255 ? 110.544 38.484  28.985  1.00 2.00   ? 272 LEU E CB    1 
ATOM 7610  C CG    . LEU G 3 255 ? 111.540 39.157  28.067  1.00 2.00   ? 272 LEU E CG    1 
ATOM 7611  C CD1   . LEU G 3 255 ? 112.497 38.097  27.513  1.00 2.00   ? 272 LEU E CD1   1 
ATOM 7612  C CD2   . LEU G 3 255 ? 110.782 39.843  26.952  1.00 2.00   ? 272 LEU E CD2   1 
ATOM 7613  N N     . ARG G 3 256 ? 107.243 38.757  29.535  1.00 3.35   ? 273 ARG E N     1 
ATOM 7614  C CA    . ARG G 3 256 ? 106.028 37.986  29.776  1.00 2.00   ? 273 ARG E CA    1 
ATOM 7615  C C     . ARG G 3 256 ? 105.429 37.495  28.469  1.00 2.36   ? 273 ARG E C     1 
ATOM 7616  O O     . ARG G 3 256 ? 105.487 38.173  27.453  1.00 3.04   ? 273 ARG E O     1 
ATOM 7617  C CB    . ARG G 3 256 ? 104.981 38.794  30.534  1.00 5.49   ? 273 ARG E CB    1 
ATOM 7618  C CG    . ARG G 3 256 ? 103.715 37.984  30.763  1.00 8.38   ? 273 ARG E CG    1 
ATOM 7619  C CD    . ARG G 3 256 ? 102.669 38.673  31.639  1.00 7.96   ? 273 ARG E CD    1 
ATOM 7620  N NE    . ARG G 3 256 ? 101.621 39.318  30.851  1.00 9.69   ? 273 ARG E NE    1 
ATOM 7621  C CZ    . ARG G 3 256 ? 100.504 38.725  30.432  1.00 7.55   ? 273 ARG E CZ    1 
ATOM 7622  N NH1   . ARG G 3 256 ? 99.618  39.419  29.719  1.00 5.49   ? 273 ARG E NH1   1 
ATOM 7623  N NH2   . ARG G 3 256 ? 100.259 37.457  30.728  1.00 5.49   ? 273 ARG E NH2   1 
ATOM 7624  N N     . ARG G 3 257 ? 104.845 36.306  28.521  1.00 36.59  ? 274 ARG E N     1 
ATOM 7625  C CA    . ARG G 3 257 ? 104.242 35.677  27.357  1.00 34.64  ? 274 ARG E CA    1 
ATOM 7626  C C     . ARG G 3 257 ? 102.738 35.515  27.553  1.00 33.24  ? 274 ARG E C     1 
ATOM 7627  O O     . ARG G 3 257 ? 102.294 34.636  28.278  1.00 11.70  ? 274 ARG E O     1 
ATOM 7628  C CB    . ARG G 3 257 ? 104.907 34.320  27.144  1.00 5.22   ? 274 ARG E CB    1 
ATOM 7629  C CG    . ARG G 3 257 ? 104.524 33.565  25.892  1.00 5.22   ? 274 ARG E CG    1 
ATOM 7630  C CD    . ARG G 3 257 ? 105.564 32.448  25.620  1.00 5.22   ? 274 ARG E CD    1 
ATOM 7631  N NE    . ARG G 3 257 ? 105.771 31.585  26.788  1.00 5.22   ? 274 ARG E NE    1 
ATOM 7632  C CZ    . ARG G 3 257 ? 106.704 30.642  26.871  1.00 5.22   ? 274 ARG E CZ    1 
ATOM 7633  N NH1   . ARG G 3 257 ? 106.805 29.914  27.974  1.00 5.22   ? 274 ARG E NH1   1 
ATOM 7634  N NH2   . ARG G 3 257 ? 107.543 30.431  25.865  1.00 5.22   ? 274 ARG E NH2   1 
ATOM 7635  N N     . PRO G 3 258 ? 101.938 36.367  26.900  1.00 28.62  ? 275 PRO E N     1 
ATOM 7636  C CA    . PRO G 3 258 ? 100.473 36.372  26.963  1.00 33.66  ? 275 PRO E CA    1 
ATOM 7637  C C     . PRO G 3 258 ? 99.858  34.986  27.022  1.00 37.82  ? 275 PRO E C     1 
ATOM 7638  O O     . PRO G 3 258 ? 99.284  34.582  28.037  1.00 20.41  ? 275 PRO E O     1 
ATOM 7639  C CB    . PRO G 3 258 ? 100.092 37.076  25.684  1.00 13.79  ? 275 PRO E CB    1 
ATOM 7640  C CG    . PRO G 3 258 ? 101.175 38.081  25.546  1.00 13.79  ? 275 PRO E CG    1 
ATOM 7641  C CD    . PRO G 3 258 ? 102.412 37.289  25.856  1.00 13.79  ? 275 PRO E CD    1 
ATOM 7642  N N     . SER G 3 259 ? 99.962  34.280  25.900  1.00 9.63   ? 276 SER E N     1 
ATOM 7643  C CA    . SER G 3 259 ? 99.447  32.919  25.763  1.00 7.24   ? 276 SER E CA    1 
ATOM 7644  C C     . SER G 3 259 ? 99.713  32.096  27.017  1.00 6.43   ? 276 SER E C     1 
ATOM 7645  O O     . SER G 3 259 ? 98.836  31.924  27.851  1.00 4.43   ? 276 SER E O     1 
ATOM 7646  C CB    . SER G 3 259 ? 100.127 32.244  24.581  1.00 15.34  ? 276 SER E CB    1 
ATOM 7647  O OG    . SER G 3 259 ? 101.535 32.264  24.752  1.00 14.16  ? 276 SER E OG    1 
ATOM 7648  N N     . ASP G 3 260 ? 100.939 31.592  27.134  1.00 2.00   ? 277 ASP E N     1 
ATOM 7649  C CA    . ASP G 3 260 ? 101.368 30.785  28.274  1.00 2.00   ? 277 ASP E CA    1 
ATOM 7650  C C     . ASP G 3 260 ? 101.111 31.449  29.606  1.00 2.00   ? 277 ASP E C     1 
ATOM 7651  O O     . ASP G 3 260 ? 100.972 30.773  30.615  1.00 2.00   ? 277 ASP E O     1 
ATOM 7652  C CB    . ASP G 3 260 ? 102.870 30.492  28.185  1.00 49.51  ? 277 ASP E CB    1 
ATOM 7653  C CG    . ASP G 3 260 ? 103.230 29.648  26.978  1.00 60.91  ? 277 ASP E CG    1 
ATOM 7654  O OD1   . ASP G 3 260 ? 103.369 28.406  27.121  1.00 65.70  ? 277 ASP E OD1   1 
ATOM 7655  O OD2   . ASP G 3 260 ? 103.358 30.226  25.877  1.00 65.14  ? 277 ASP E OD2   1 
ATOM 7656  N N     . ARG G 3 261 ? 101.067 32.777  29.600  1.00 14.04  ? 278 ARG E N     1 
ATOM 7657  C CA    . ARG G 3 261 ? 100.872 33.555  30.816  1.00 15.00  ? 278 ARG E CA    1 
ATOM 7658  C C     . ARG G 3 261 ? 102.130 33.349  31.680  1.00 17.12  ? 278 ARG E C     1 
ATOM 7659  O O     . ARG G 3 261 ? 102.105 33.426  32.908  1.00 26.65  ? 278 ARG E O     1 
ATOM 7660  C CB    . ARG G 3 261 ? 99.585  33.091  31.497  1.00 54.21  ? 278 ARG E CB    1 
ATOM 7661  C CG    . ARG G 3 261 ? 98.457  32.871  30.460  1.00 61.53  ? 278 ARG E CG    1 
ATOM 7662  C CD    . ARG G 3 261 ? 97.014  32.952  30.989  1.00 62.79  ? 278 ARG E CD    1 
ATOM 7663  N NE    . ARG G 3 261 ? 96.790  32.076  32.129  1.00 62.86  ? 278 ARG E NE    1 
ATOM 7664  C CZ    . ARG G 3 261 ? 97.172  32.367  33.369  1.00 64.13  ? 278 ARG E CZ    1 
ATOM 7665  N NH1   . ARG G 3 261 ? 96.940  31.510  34.354  1.00 64.69  ? 278 ARG E NH1   1 
ATOM 7666  N NH2   . ARG G 3 261 ? 97.770  33.528  33.629  1.00 65.33  ? 278 ARG E NH2   1 
ATOM 7667  N N     . GLU G 3 262 ? 103.238 33.102  30.984  1.00 33.13  ? 279 GLU E N     1 
ATOM 7668  C CA    . GLU G 3 262 ? 104.545 32.857  31.582  1.00 38.21  ? 279 GLU E CA    1 
ATOM 7669  C C     . GLU G 3 262 ? 105.347 34.133  31.777  1.00 41.14  ? 279 GLU E C     1 
ATOM 7670  O O     . GLU G 3 262 ? 105.289 35.030  30.942  1.00 68.07  ? 279 GLU E O     1 
ATOM 7671  C CB    . GLU G 3 262 ? 105.344 31.898  30.694  1.00 52.64  ? 279 GLU E CB    1 
ATOM 7672  C CG    . GLU G 3 262 ? 105.620 30.550  31.328  1.00 55.37  ? 279 GLU E CG    1 
ATOM 7673  C CD    . GLU G 3 262 ? 106.440 30.657  32.611  1.00 59.38  ? 279 GLU E CD    1 
ATOM 7674  O OE1   . GLU G 3 262 ? 105.906 31.086  33.659  1.00 61.20  ? 279 GLU E OE1   1 
ATOM 7675  O OE2   . GLU G 3 262 ? 107.636 30.314  32.568  1.00 62.76  ? 279 GLU E OE2   1 
ATOM 7676  N N     . LEU G 3 263 ? 106.110 34.197  32.870  1.00 68.07  ? 280 LEU E N     1 
ATOM 7677  C CA    . LEU G 3 263 ? 106.925 35.370  33.177  1.00 68.14  ? 280 LEU E CA    1 
ATOM 7678  C C     . LEU G 3 263 ? 108.393 35.050  33.351  1.00 67.68  ? 280 LEU E C     1 
ATOM 7679  O O     . LEU G 3 263 ? 108.749 34.229  34.176  1.00 28.91  ? 280 LEU E O     1 
ATOM 7680  C CB    . LEU G 3 263 ? 106.459 36.040  34.460  1.00 29.66  ? 280 LEU E CB    1 
ATOM 7681  C CG    . LEU G 3 263 ? 105.006 36.453  34.570  1.00 32.85  ? 280 LEU E CG    1 
ATOM 7682  C CD1   . LEU G 3 263 ? 104.186 35.291  35.113  1.00 36.62  ? 280 LEU E CD1   1 
ATOM 7683  C CD2   . LEU G 3 263 ? 104.926 37.649  35.488  1.00 32.57  ? 280 LEU E CD2   1 
ATOM 7684  N N     . SER G 3 264 ? 109.243 35.734  32.594  1.00 16.15  ? 281 SER E N     1 
ATOM 7685  C CA    . SER G 3 264 ? 110.687 35.544  32.665  1.00 13.52  ? 281 SER E CA    1 
ATOM 7686  C C     . SER G 3 264 ? 111.184 35.898  34.048  1.00 13.21  ? 281 SER E C     1 
ATOM 7687  O O     . SER G 3 264 ? 110.486 36.528  34.840  1.00 27.09  ? 281 SER E O     1 
ATOM 7688  C CB    . SER G 3 264 ? 111.388 36.470  31.703  1.00 21.18  ? 281 SER E CB    1 
ATOM 7689  O OG    . SER G 3 264 ? 111.280 37.794  32.180  1.00 20.24  ? 281 SER E OG    1 
ATOM 7690  N N     . GLU G 3 265 ? 112.414 35.504  34.327  1.00 39.48  ? 282 GLU E N     1 
ATOM 7691  C CA    . GLU G 3 265 ? 113.021 35.804  35.607  1.00 40.81  ? 282 GLU E CA    1 
ATOM 7692  C C     . GLU G 3 265 ? 112.949 37.312  35.795  1.00 40.22  ? 282 GLU E C     1 
ATOM 7693  O O     . GLU G 3 265 ? 112.655 38.044  34.858  1.00 49.33  ? 282 GLU E O     1 
ATOM 7694  C CB    . GLU G 3 265 ? 114.482 35.308  35.612  1.00 61.42  ? 282 GLU E CB    1 
ATOM 7695  C CG    . GLU G 3 265 ? 115.189 35.317  34.230  1.00 58.58  ? 282 GLU E CG    1 
ATOM 7696  C CD    . GLU G 3 265 ? 115.579 36.715  33.727  1.00 59.81  ? 282 GLU E CD    1 
ATOM 7697  O OE1   . GLU G 3 265 ? 115.954 36.830  32.537  1.00 57.69  ? 282 GLU E OE1   1 
ATOM 7698  O OE2   . GLU G 3 265 ? 115.518 37.689  34.516  1.00 61.35  ? 282 GLU E OE2   1 
ATOM 7699  N N     . PRO G 3 266 ? 113.178 37.795  37.019  1.00 33.23  ? 283 PRO E N     1 
ATOM 7700  C CA    . PRO G 3 266 ? 113.118 39.243  37.208  1.00 33.06  ? 283 PRO E CA    1 
ATOM 7701  C C     . PRO G 3 266 ? 114.466 39.923  37.016  1.00 33.31  ? 283 PRO E C     1 
ATOM 7702  O O     . PRO G 3 266 ? 115.510 39.324  37.260  1.00 53.15  ? 283 PRO E O     1 
ATOM 7703  C CB    . PRO G 3 266 ? 112.605 39.381  38.642  1.00 42.44  ? 283 PRO E CB    1 
ATOM 7704  C CG    . PRO G 3 266 ? 113.238 38.235  39.311  1.00 44.67  ? 283 PRO E CG    1 
ATOM 7705  C CD    . PRO G 3 266 ? 113.044 37.103  38.312  1.00 43.86  ? 283 PRO E CD    1 
ATOM 7706  N N     . MET G 3 267 ? 114.424 41.170  36.554  1.00 44.92  ? 284 MET E N     1 
ATOM 7707  C CA    . MET G 3 267 ? 115.617 41.988  36.359  1.00 43.66  ? 284 MET E CA    1 
ATOM 7708  C C     . MET G 3 267 ? 115.237 43.366  36.892  1.00 45.51  ? 284 MET E C     1 
ATOM 7709  O O     . MET G 3 267 ? 114.132 43.852  36.657  1.00 40.14  ? 284 MET E O     1 
ATOM 7710  C CB    . MET G 3 267 ? 116.026 42.059  34.878  1.00 33.18  ? 284 MET E CB    1 
ATOM 7711  C CG    . MET G 3 267 ? 117.332 42.815  34.655  1.00 28.22  ? 284 MET E CG    1 
ATOM 7712  S SD    . MET G 3 267 ? 118.482 42.212  33.336  1.00 25.02  ? 284 MET E SD    1 
ATOM 7713  C CE    . MET G 3 267 ? 119.369 43.716  32.986  1.00 18.68  ? 284 MET E CE    1 
ATOM 7714  N N     . GLU G 3 268 ? 116.144 43.978  37.641  1.00 42.50  ? 285 GLU E N     1 
ATOM 7715  C CA    . GLU G 3 268 ? 115.891 45.286  38.237  1.00 40.33  ? 285 GLU E CA    1 
ATOM 7716  C C     . GLU G 3 268 ? 116.074 46.455  37.290  1.00 36.04  ? 285 GLU E C     1 
ATOM 7717  O O     . GLU G 3 268 ? 116.973 46.469  36.448  1.00 53.24  ? 285 GLU E O     1 
ATOM 7718  C CB    . GLU G 3 268 ? 116.799 45.490  39.452  1.00 59.75  ? 285 GLU E CB    1 
ATOM 7719  C CG    . GLU G 3 268 ? 116.587 44.479  40.563  1.00 63.19  ? 285 GLU E CG    1 
ATOM 7720  C CD    . GLU G 3 268 ? 117.412 44.779  41.795  1.00 66.27  ? 285 GLU E CD    1 
ATOM 7721  O OE1   . GLU G 3 268 ? 117.248 45.875  42.374  1.00 69.95  ? 285 GLU E OE1   1 
ATOM 7722  O OE2   . GLU G 3 268 ? 118.224 43.916  42.182  1.00 65.75  ? 285 GLU E OE2   1 
ATOM 7723  N N     . PHE G 3 269 ? 115.215 47.448  37.467  1.00 35.12  ? 286 PHE E N     1 
ATOM 7724  C CA    . PHE G 3 269 ? 115.245 48.646  36.658  1.00 34.07  ? 286 PHE E CA    1 
ATOM 7725  C C     . PHE G 3 269 ? 115.002 49.817  37.581  1.00 35.30  ? 286 PHE E C     1 
ATOM 7726  O O     . PHE G 3 269 ? 113.861 50.110  37.931  1.00 30.82  ? 286 PHE E O     1 
ATOM 7727  C CB    . PHE G 3 269 ? 114.144 48.586  35.619  1.00 12.92  ? 286 PHE E CB    1 
ATOM 7728  C CG    . PHE G 3 269 ? 114.137 49.751  34.706  1.00 10.46  ? 286 PHE E CG    1 
ATOM 7729  C CD1   . PHE G 3 269 ? 113.408 50.886  35.015  1.00 11.51  ? 286 PHE E CD1   1 
ATOM 7730  C CD2   . PHE G 3 269 ? 114.911 49.735  33.547  1.00 8.68   ? 286 PHE E CD2   1 
ATOM 7731  C CE1   . PHE G 3 269 ? 113.450 51.999  34.177  1.00 10.48  ? 286 PHE E CE1   1 
ATOM 7732  C CE2   . PHE G 3 269 ? 114.965 50.828  32.707  1.00 8.68   ? 286 PHE E CE2   1 
ATOM 7733  C CZ    . PHE G 3 269 ? 114.235 51.970  33.014  1.00 8.68   ? 286 PHE E CZ    1 
ATOM 7734  N N     . GLN G 3 270 ? 116.069 50.499  37.966  1.00 28.32  ? 287 GLN E N     1 
ATOM 7735  C CA    . GLN G 3 270 ? 115.945 51.614  38.890  1.00 29.27  ? 287 GLN E CA    1 
ATOM 7736  C C     . GLN G 3 270 ? 115.310 52.869  38.312  1.00 30.09  ? 287 GLN E C     1 
ATOM 7737  O O     . GLN G 3 270 ? 115.821 53.460  37.366  1.00 51.18  ? 287 GLN E O     1 
ATOM 7738  C CB    . GLN G 3 270 ? 117.317 51.937  39.462  1.00 56.13  ? 287 GLN E CB    1 
ATOM 7739  C CG    . GLN G 3 270 ? 117.278 52.951  40.557  1.00 52.49  ? 287 GLN E CG    1 
ATOM 7740  C CD    . GLN G 3 270 ? 118.519 52.889  41.379  1.00 50.68  ? 287 GLN E CD    1 
ATOM 7741  O OE1   . GLN G 3 270 ? 118.707 51.964  42.169  1.00 47.15  ? 287 GLN E OE1   1 
ATOM 7742  N NE2   . GLN G 3 270 ? 119.399 53.861  41.185  1.00 45.92  ? 287 GLN E NE2   1 
ATOM 7743  N N     . TYR G 3 271 ? 114.185 53.268  38.895  1.00 24.15  ? 288 TYR E N     1 
ATOM 7744  C CA    . TYR G 3 271 ? 113.496 54.467  38.457  1.00 26.67  ? 288 TYR E CA    1 
ATOM 7745  C C     . TYR G 3 271 ? 113.967 55.675  39.246  1.00 25.47  ? 288 TYR E C     1 
ATOM 7746  O O     . TYR G 3 271 ? 113.677 55.812  40.438  1.00 23.09  ? 288 TYR E O     1 
ATOM 7747  C CB    . TYR G 3 271 ? 111.991 54.313  38.617  1.00 36.15  ? 288 TYR E CB    1 
ATOM 7748  C CG    . TYR G 3 271 ? 111.309 54.008  37.313  1.00 37.53  ? 288 TYR E CG    1 
ATOM 7749  C CD1   . TYR G 3 271 ? 110.899 52.709  37.006  1.00 37.79  ? 288 TYR E CD1   1 
ATOM 7750  C CD2   . TYR G 3 271 ? 111.128 55.010  36.355  1.00 36.37  ? 288 TYR E CD2   1 
ATOM 7751  C CE1   . TYR G 3 271 ? 110.333 52.420  35.787  1.00 38.37  ? 288 TYR E CE1   1 
ATOM 7752  C CE2   . TYR G 3 271 ? 110.565 54.724  35.131  1.00 36.31  ? 288 TYR E CE2   1 
ATOM 7753  C CZ    . TYR G 3 271 ? 110.172 53.428  34.854  1.00 37.10  ? 288 TYR E CZ    1 
ATOM 7754  O OH    . TYR G 3 271 ? 109.637 53.133  33.631  1.00 34.96  ? 288 TYR E OH    1 
ATOM 7755  N N     . LEU G 3 272 ? 114.704 56.549  38.574  1.00 39.85  ? 289 LEU E N     1 
ATOM 7756  C CA    . LEU G 3 272 ? 115.224 57.752  39.209  1.00 39.52  ? 289 LEU E CA    1 
ATOM 7757  C C     . LEU G 3 272 ? 114.241 58.893  39.090  1.00 41.31  ? 289 LEU E C     1 
ATOM 7758  O O     . LEU G 3 272 ? 113.272 58.806  38.337  1.00 32.63  ? 289 LEU E O     1 
ATOM 7759  C CB    . LEU G 3 272 ? 116.546 58.189  38.580  1.00 23.08  ? 289 LEU E CB    1 
ATOM 7760  C CG    . LEU G 3 272 ? 117.726 57.220  38.645  1.00 21.83  ? 289 LEU E CG    1 
ATOM 7761  C CD1   . LEU G 3 272 ? 117.606 56.327  39.887  1.00 22.39  ? 289 LEU E CD1   1 
ATOM 7762  C CD2   . LEU G 3 272 ? 117.752 56.385  37.375  1.00 19.36  ? 289 LEU E CD2   1 
ATOM 7763  N N     . PRO G 3 273 ? 114.481 59.982  39.843  1.00 35.45  ? 290 PRO E N     1 
ATOM 7764  C CA    . PRO G 3 273 ? 113.641 61.186  39.865  1.00 33.52  ? 290 PRO E CA    1 
ATOM 7765  C C     . PRO G 3 273 ? 113.735 62.092  38.642  1.00 31.83  ? 290 PRO E C     1 
ATOM 7766  O O     . PRO G 3 273 ? 114.790 62.652  38.363  1.00 27.84  ? 290 PRO E O     1 
ATOM 7767  C CB    . PRO G 3 273 ? 114.096 61.894  41.143  1.00 25.98  ? 290 PRO E CB    1 
ATOM 7768  C CG    . PRO G 3 273 ? 114.542 60.748  42.032  1.00 27.93  ? 290 PRO E CG    1 
ATOM 7769  C CD    . PRO G 3 273 ? 115.338 59.943  41.044  1.00 30.21  ? 290 PRO E CD    1 
ATOM 7770  N N     . ASP G 3 274 ? 112.611 62.225  37.939  1.00 62.27  ? 291 ASP E N     1 
ATOM 7771  C CA    . ASP G 3 274 ? 112.464 63.056  36.736  1.00 64.76  ? 291 ASP E CA    1 
ATOM 7772  C C     . ASP G 3 274 ? 113.608 62.946  35.732  1.00 65.28  ? 291 ASP E C     1 
ATOM 7773  O O     . ASP G 3 274 ? 114.493 62.090  35.937  1.00 74.10  ? 291 ASP E O     1 
ATOM 7774  C CB    . ASP G 3 274 ? 112.266 64.528  37.126  1.00 81.59  ? 291 ASP E CB    1 
ATOM 7775  C CG    . ASP G 3 274 ? 111.357 65.282  36.151  1.00 84.46  ? 291 ASP E CG    1 
ATOM 7776  O OD1   . ASP G 3 274 ? 111.674 65.325  34.939  1.00 82.55  ? 291 ASP E OD1   1 
ATOM 7777  O OD2   . ASP G 3 274 ? 110.322 65.830  36.599  1.00 84.86  ? 291 ASP E OD2   1 
ATOM 7778  O OXT   . ASP G 3 274 ? 113.597 63.710  34.739  1.00 79.36  ? 291 ASP E OXT   1 
ATOM 7779  N N     . GLY H 4 2   ? 134.931 27.726  -33.668 1.00 67.79  ? 39  GLY F N     1 
ATOM 7780  C CA    . GLY H 4 2   ? 136.136 28.605  -33.574 1.00 69.33  ? 39  GLY F CA    1 
ATOM 7781  C C     . GLY H 4 2   ? 135.854 29.790  -32.674 1.00 69.14  ? 39  GLY F C     1 
ATOM 7782  O O     . GLY H 4 2   ? 136.581 30.026  -31.704 1.00 89.62  ? 39  GLY F O     1 
ATOM 7783  N N     . PRO H 4 3   ? 134.801 30.565  -32.985 1.00 95.44  ? 40  PRO F N     1 
ATOM 7784  C CA    . PRO H 4 3   ? 134.351 31.753  -32.245 1.00 94.62  ? 40  PRO F CA    1 
ATOM 7785  C C     . PRO H 4 3   ? 133.534 31.411  -30.980 1.00 93.14  ? 40  PRO F C     1 
ATOM 7786  O O     . PRO H 4 3   ? 132.307 31.250  -31.046 1.00 68.48  ? 40  PRO F O     1 
ATOM 7787  C CB    . PRO H 4 3   ? 133.528 32.501  -33.288 1.00 55.30  ? 40  PRO F CB    1 
ATOM 7788  C CG    . PRO H 4 3   ? 132.945 31.382  -34.102 1.00 55.40  ? 40  PRO F CG    1 
ATOM 7789  C CD    . PRO H 4 3   ? 134.121 30.474  -34.289 1.00 55.46  ? 40  PRO F CD    1 
ATOM 7790  N N     . TYR H 4 4   ? 134.227 31.331  -29.840 1.00 73.33  ? 41  TYR F N     1 
ATOM 7791  C CA    . TYR H 4 4   ? 133.640 30.980  -28.535 1.00 71.69  ? 41  TYR F CA    1 
ATOM 7792  C C     . TYR H 4 4   ? 132.653 31.978  -27.924 1.00 70.99  ? 41  TYR F C     1 
ATOM 7793  O O     . TYR H 4 4   ? 132.384 33.042  -28.487 1.00 108.09 ? 41  TYR F O     1 
ATOM 7794  C CB    . TYR H 4 4   ? 134.766 30.710  -27.530 1.00 113.25 ? 41  TYR F CB    1 
ATOM 7795  C CG    . TYR H 4 4   ? 135.775 29.680  -27.997 1.00 113.44 ? 41  TYR F CG    1 
ATOM 7796  C CD1   . TYR H 4 4   ? 136.943 29.448  -27.277 1.00 111.91 ? 41  TYR F CD1   1 
ATOM 7797  C CD2   . TYR H 4 4   ? 135.557 28.924  -29.150 1.00 113.42 ? 41  TYR F CD2   1 
ATOM 7798  C CE1   . TYR H 4 4   ? 137.870 28.485  -27.695 1.00 113.48 ? 41  TYR F CE1   1 
ATOM 7799  C CE2   . TYR H 4 4   ? 136.469 27.959  -29.572 1.00 115.80 ? 41  TYR F CE2   1 
ATOM 7800  C CZ    . TYR H 4 4   ? 137.623 27.744  -28.840 1.00 114.65 ? 41  TYR F CZ    1 
ATOM 7801  O OH    . TYR H 4 4   ? 138.521 26.780  -29.241 1.00 114.97 ? 41  TYR F OH    1 
ATOM 7802  N N     . LEU H 4 5   ? 132.123 31.622  -26.756 1.00 56.52  ? 42  LEU F N     1 
ATOM 7803  C CA    . LEU H 4 5   ? 131.153 32.465  -26.060 1.00 57.34  ? 42  LEU F CA    1 
ATOM 7804  C C     . LEU H 4 5   ? 131.757 33.240  -24.883 1.00 57.36  ? 42  LEU F C     1 
ATOM 7805  O O     . LEU H 4 5   ? 132.979 33.326  -24.749 1.00 96.59  ? 42  LEU F O     1 
ATOM 7806  C CB    . LEU H 4 5   ? 129.974 31.610  -25.572 1.00 105.10 ? 42  LEU F CB    1 
ATOM 7807  C CG    . LEU H 4 5   ? 130.225 30.524  -24.515 1.00 107.25 ? 42  LEU F CG    1 
ATOM 7808  C CD1   . LEU H 4 5   ? 128.896 29.883  -24.125 1.00 106.73 ? 42  LEU F CD1   1 
ATOM 7809  C CD2   . LEU H 4 5   ? 131.194 29.473  -25.053 1.00 108.40 ? 42  LEU F CD2   1 
ATOM 7810  N N     . GLN H 4 6   ? 130.895 33.794  -24.029 1.00 92.76  ? 43  GLN F N     1 
ATOM 7811  C CA    . GLN H 4 6   ? 131.360 34.574  -22.886 1.00 93.74  ? 43  GLN F CA    1 
ATOM 7812  C C     . GLN H 4 6   ? 130.454 34.555  -21.635 1.00 94.35  ? 43  GLN F C     1 
ATOM 7813  O O     . GLN H 4 6   ? 130.051 33.493  -21.153 1.00 90.45  ? 43  GLN F O     1 
ATOM 7814  C CB    . GLN H 4 6   ? 131.596 36.022  -23.340 1.00 85.83  ? 43  GLN F CB    1 
ATOM 7815  C CG    . GLN H 4 6   ? 132.679 36.758  -22.563 1.00 83.12  ? 43  GLN F CG    1 
ATOM 7816  C CD    . GLN H 4 6   ? 132.923 38.164  -23.083 1.00 84.42  ? 43  GLN F CD    1 
ATOM 7817  O OE1   . GLN H 4 6   ? 132.035 39.017  -23.034 1.00 84.62  ? 43  GLN F OE1   1 
ATOM 7818  N NE2   . GLN H 4 6   ? 134.133 38.413  -23.584 1.00 82.41  ? 43  GLN F NE2   1 
ATOM 7819  N N     . ILE H 4 7   ? 130.153 35.747  -21.123 1.00 48.50  ? 44  ILE F N     1 
ATOM 7820  C CA    . ILE H 4 7   ? 129.339 35.954  -19.919 1.00 51.46  ? 44  ILE F CA    1 
ATOM 7821  C C     . ILE H 4 7   ? 129.321 37.478  -19.720 1.00 53.49  ? 44  ILE F C     1 
ATOM 7822  O O     . ILE H 4 7   ? 129.465 37.986  -18.603 1.00 62.68  ? 44  ILE F O     1 
ATOM 7823  C CB    . ILE H 4 7   ? 129.988 35.259  -18.652 1.00 53.83  ? 44  ILE F CB    1 
ATOM 7824  C CG1   . ILE H 4 7   ? 129.125 35.508  -17.401 1.00 54.19  ? 44  ILE F CG1   1 
ATOM 7825  C CG2   . ILE H 4 7   ? 131.412 35.779  -18.422 1.00 52.67  ? 44  ILE F CG2   1 
ATOM 7826  C CD1   . ILE H 4 7   ? 129.732 35.010  -16.089 1.00 56.28  ? 44  ILE F CD1   1 
ATOM 7827  N N     . LEU H 4 8   ? 129.144 38.193  -20.831 1.00 84.11  ? 45  LEU F N     1 
ATOM 7828  C CA    . LEU H 4 8   ? 129.137 39.659  -20.856 1.00 84.08  ? 45  LEU F CA    1 
ATOM 7829  C C     . LEU H 4 8   ? 128.559 40.402  -19.651 1.00 83.28  ? 45  LEU F C     1 
ATOM 7830  O O     . LEU H 4 8   ? 128.920 41.556  -19.405 1.00 96.22  ? 45  LEU F O     1 
ATOM 7831  C CB    . LEU H 4 8   ? 128.445 40.167  -22.124 1.00 97.18  ? 45  LEU F CB    1 
ATOM 7832  C CG    . LEU H 4 8   ? 128.526 41.690  -22.280 1.00 97.96  ? 45  LEU F CG    1 
ATOM 7833  C CD1   . LEU H 4 8   ? 129.988 42.128  -22.340 1.00 95.96  ? 45  LEU F CD1   1 
ATOM 7834  C CD2   . LEU H 4 8   ? 127.783 42.119  -23.530 1.00 98.78  ? 45  LEU F CD2   1 
ATOM 7835  N N     . GLU H 4 9   ? 127.652 39.776  -18.912 1.00 96.21  ? 46  GLU F N     1 
ATOM 7836  C CA    . GLU H 4 9   ? 127.099 40.442  -17.740 1.00 96.30  ? 46  GLU F CA    1 
ATOM 7837  C C     . GLU H 4 9   ? 127.016 39.495  -16.554 1.00 95.72  ? 46  GLU F C     1 
ATOM 7838  O O     . GLU H 4 9   ? 126.041 38.756  -16.401 1.00 73.80  ? 46  GLU F O     1 
ATOM 7839  C CB    . GLU H 4 9   ? 125.711 41.024  -18.033 1.00 78.71  ? 46  GLU F CB    1 
ATOM 7840  C CG    . GLU H 4 9   ? 125.440 42.284  -17.223 1.00 76.98  ? 46  GLU F CG    1 
ATOM 7841  C CD    . GLU H 4 9   ? 125.908 42.147  -15.781 1.00 77.51  ? 46  GLU F CD    1 
ATOM 7842  O OE1   . GLU H 4 9   ? 125.202 41.475  -14.998 1.00 74.76  ? 46  GLU F OE1   1 
ATOM 7843  O OE2   . GLU H 4 9   ? 126.987 42.694  -15.441 1.00 78.82  ? 46  GLU F OE2   1 
ATOM 7844  N N     . GLN H 4 10  ? 128.051 39.535  -15.717 1.00 81.58  ? 47  GLN F N     1 
ATOM 7845  C CA    . GLN H 4 10  ? 128.128 38.688  -14.535 1.00 79.01  ? 47  GLN F CA    1 
ATOM 7846  C C     . GLN H 4 10  ? 126.918 38.892  -13.614 1.00 78.67  ? 47  GLN F C     1 
ATOM 7847  O O     . GLN H 4 10  ? 126.412 40.004  -13.477 1.00 51.93  ? 47  GLN F O     1 
ATOM 7848  C CB    . GLN H 4 10  ? 129.435 38.962  -13.787 1.00 60.50  ? 47  GLN F CB    1 
ATOM 7849  C CG    . GLN H 4 10  ? 129.644 40.405  -13.383 1.00 59.59  ? 47  GLN F CG    1 
ATOM 7850  C CD    . GLN H 4 10  ? 130.950 40.606  -12.636 1.00 59.76  ? 47  GLN F CD    1 
ATOM 7851  O OE1   . GLN H 4 10  ? 131.230 41.700  -12.140 1.00 60.55  ? 47  GLN F OE1   1 
ATOM 7852  N NE2   . GLN H 4 10  ? 131.759 39.550  -12.554 1.00 57.56  ? 47  GLN F NE2   1 
ATOM 7853  N N     . PRO H 4 11  ? 126.447 37.810  -12.967 1.00 86.48  ? 48  PRO F N     1 
ATOM 7854  C CA    . PRO H 4 11  ? 125.300 37.772  -12.049 1.00 87.29  ? 48  PRO F CA    1 
ATOM 7855  C C     . PRO H 4 11  ? 125.314 38.851  -10.969 1.00 87.81  ? 48  PRO F C     1 
ATOM 7856  O O     . PRO H 4 11  ? 125.714 39.988  -11.204 1.00 90.88  ? 48  PRO F O     1 
ATOM 7857  C CB    . PRO H 4 11  ? 125.391 36.375  -11.433 1.00 92.16  ? 48  PRO F CB    1 
ATOM 7858  C CG    . PRO H 4 11  ? 126.092 35.576  -12.469 1.00 91.59  ? 48  PRO F CG    1 
ATOM 7859  C CD    . PRO H 4 11  ? 127.159 36.518  -12.949 1.00 92.43  ? 48  PRO F CD    1 
ATOM 7860  N N     . LYS H 4 12  ? 124.852 38.469  -9.782  1.00 96.38  ? 49  LYS F N     1 
ATOM 7861  C CA    . LYS H 4 12  ? 124.819 39.352  -8.621  1.00 96.71  ? 49  LYS F CA    1 
ATOM 7862  C C     . LYS H 4 12  ? 125.820 38.769  -7.617  1.00 96.17  ? 49  LYS F C     1 
ATOM 7863  O O     . LYS H 4 12  ? 126.451 39.506  -6.865  1.00 55.72  ? 49  LYS F O     1 
ATOM 7864  C CB    . LYS H 4 12  ? 123.407 39.389  -8.017  1.00 56.76  ? 49  LYS F CB    1 
ATOM 7865  C CG    . LYS H 4 12  ? 123.224 40.325  -6.814  1.00 55.56  ? 49  LYS F CG    1 
ATOM 7866  C CD    . LYS H 4 12  ? 123.053 41.780  -7.221  1.00 55.40  ? 49  LYS F CD    1 
ATOM 7867  C CE    . LYS H 4 12  ? 124.376 42.442  -7.539  1.00 53.29  ? 49  LYS F CE    1 
ATOM 7868  N NZ    . LYS H 4 12  ? 125.126 42.728  -6.287  1.00 51.63  ? 49  LYS F NZ    1 
ATOM 7869  N N     . GLN H 4 13  ? 125.964 37.442  -7.623  1.00 103.85 ? 50  GLN F N     1 
ATOM 7870  C CA    . GLN H 4 13  ? 126.903 36.753  -6.735  1.00 105.38 ? 50  GLN F CA    1 
ATOM 7871  C C     . GLN H 4 13  ? 126.466 36.776  -5.269  1.00 105.45 ? 50  GLN F C     1 
ATOM 7872  O O     . GLN H 4 13  ? 126.586 35.772  -4.553  1.00 62.39  ? 50  GLN F O     1 
ATOM 7873  C CB    . GLN H 4 13  ? 128.296 37.383  -6.881  1.00 66.11  ? 50  GLN F CB    1 
ATOM 7874  C CG    . GLN H 4 13  ? 129.390 36.781  -6.006  1.00 65.30  ? 50  GLN F CG    1 
ATOM 7875  C CD    . GLN H 4 13  ? 130.782 37.162  -6.492  1.00 64.78  ? 50  GLN F CD    1 
ATOM 7876  O OE1   . GLN H 4 13  ? 131.060 37.131  -7.693  1.00 64.30  ? 50  GLN F OE1   1 
ATOM 7877  N NE2   . GLN H 4 13  ? 131.665 37.514  -5.561  1.00 63.60  ? 50  GLN F NE2   1 
ATOM 7878  N N     . ARG H 4 14  ? 125.955 37.925  -4.834  1.00 95.23  ? 51  ARG F N     1 
ATOM 7879  C CA    . ARG H 4 14  ? 125.496 38.111  -3.461  1.00 93.52  ? 51  ARG F CA    1 
ATOM 7880  C C     . ARG H 4 14  ? 124.073 38.665  -3.464  1.00 94.13  ? 51  ARG F C     1 
ATOM 7881  O O     . ARG H 4 14  ? 123.766 39.595  -4.209  1.00 84.32  ? 51  ARG F O     1 
ATOM 7882  C CB    . ARG H 4 14  ? 126.393 39.115  -2.738  1.00 69.37  ? 51  ARG F CB    1 
ATOM 7883  C CG    . ARG H 4 14  ? 127.855 39.036  -3.099  1.00 64.19  ? 51  ARG F CG    1 
ATOM 7884  C CD    . ARG H 4 14  ? 128.661 38.229  -2.096  1.00 61.37  ? 51  ARG F CD    1 
ATOM 7885  N NE    . ARG H 4 14  ? 130.092 38.388  -2.352  1.00 55.84  ? 51  ARG F NE    1 
ATOM 7886  C CZ    . ARG H 4 14  ? 131.061 37.866  -1.608  1.00 52.06  ? 51  ARG F CZ    1 
ATOM 7887  N NH1   . ARG H 4 14  ? 130.757 37.140  -0.540  1.00 52.54  ? 51  ARG F NH1   1 
ATOM 7888  N NH2   . ARG H 4 14  ? 132.330 38.073  -1.940  1.00 48.63  ? 51  ARG F NH2   1 
ATOM 7889  N N     . GLY H 4 15  ? 123.205 38.111  -2.627  1.00 91.73  ? 52  GLY F N     1 
ATOM 7890  C CA    . GLY H 4 15  ? 121.849 38.618  -2.572  1.00 90.34  ? 52  GLY F CA    1 
ATOM 7891  C C     . GLY H 4 15  ? 120.773 37.583  -2.795  1.00 90.42  ? 52  GLY F C     1 
ATOM 7892  O O     . GLY H 4 15  ? 119.619 37.811  -2.433  1.00 73.92  ? 52  GLY F O     1 
ATOM 7893  N N     . PHE H 4 16  ? 121.133 36.454  -3.395  1.00 70.26  ? 53  PHE F N     1 
ATOM 7894  C CA    . PHE H 4 16  ? 120.152 35.405  -3.638  1.00 71.07  ? 53  PHE F CA    1 
ATOM 7895  C C     . PHE H 4 16  ? 120.288 34.210  -2.709  1.00 71.30  ? 53  PHE F C     1 
ATOM 7896  O O     . PHE H 4 16  ? 121.390 33.832  -2.309  1.00 101.88 ? 53  PHE F O     1 
ATOM 7897  C CB    . PHE H 4 16  ? 120.218 34.889  -5.071  1.00 104.94 ? 53  PHE F CB    1 
ATOM 7898  C CG    . PHE H 4 16  ? 119.363 33.675  -5.299  1.00 103.07 ? 53  PHE F CG    1 
ATOM 7899  C CD1   . PHE H 4 16  ? 117.974 33.771  -5.250  1.00 103.55 ? 53  PHE F CD1   1 
ATOM 7900  C CD2   . PHE H 4 16  ? 119.943 32.429  -5.504  1.00 102.03 ? 53  PHE F CD2   1 
ATOM 7901  C CE1   . PHE H 4 16  ? 117.174 32.644  -5.401  1.00 104.11 ? 53  PHE F CE1   1 
ATOM 7902  C CE2   . PHE H 4 16  ? 119.152 31.293  -5.656  1.00 101.56 ? 53  PHE F CE2   1 
ATOM 7903  C CZ    . PHE H 4 16  ? 117.763 31.401  -5.605  1.00 102.55 ? 53  PHE F CZ    1 
ATOM 7904  N N     . ARG H 4 17  ? 119.141 33.611  -2.395  1.00 78.66  ? 54  ARG F N     1 
ATOM 7905  C CA    . ARG H 4 17  ? 119.067 32.454  -1.521  1.00 79.94  ? 54  ARG F CA    1 
ATOM 7906  C C     . ARG H 4 17  ? 118.800 31.195  -2.334  1.00 81.10  ? 54  ARG F C     1 
ATOM 7907  O O     . ARG H 4 17  ? 117.708 31.024  -2.877  1.00 77.25  ? 54  ARG F O     1 
ATOM 7908  C CB    . ARG H 4 17  ? 117.949 32.652  -0.496  1.00 78.60  ? 54  ARG F CB    1 
ATOM 7909  C CG    . ARG H 4 17  ? 117.667 31.430  0.361   1.00 75.73  ? 54  ARG F CG    1 
ATOM 7910  C CD    . ARG H 4 17  ? 116.614 31.738  1.400   1.00 72.16  ? 54  ARG F CD    1 
ATOM 7911  N NE    . ARG H 4 17  ? 115.462 30.852  1.303   1.00 70.93  ? 54  ARG F NE    1 
ATOM 7912  C CZ    . ARG H 4 17  ? 114.376 30.966  2.064   1.00 70.94  ? 54  ARG F CZ    1 
ATOM 7913  N NH1   . ARG H 4 17  ? 114.299 31.929  2.977   1.00 68.82  ? 54  ARG F NH1   1 
ATOM 7914  N NH2   . ARG H 4 17  ? 113.366 30.122  1.911   1.00 69.62  ? 54  ARG F NH2   1 
ATOM 7915  N N     . PHE H 4 18  ? 119.799 30.319  -2.410  1.00 97.49  ? 55  PHE F N     1 
ATOM 7916  C CA    . PHE H 4 18  ? 119.689 29.066  -3.155  1.00 96.86  ? 55  PHE F CA    1 
ATOM 7917  C C     . PHE H 4 18  ? 118.502 28.218  -2.695  1.00 97.66  ? 55  PHE F C     1 
ATOM 7918  O O     . PHE H 4 18  ? 118.619 27.418  -1.761  1.00 111.99 ? 55  PHE F O     1 
ATOM 7919  C CB    . PHE H 4 18  ? 120.980 28.252  -3.014  1.00 107.46 ? 55  PHE F CB    1 
ATOM 7920  C CG    . PHE H 4 18  ? 122.190 28.916  -3.613  1.00 104.18 ? 55  PHE F CG    1 
ATOM 7921  C CD1   . PHE H 4 18  ? 123.423 28.266  -3.609  1.00 101.55 ? 55  PHE F CD1   1 
ATOM 7922  C CD2   . PHE H 4 18  ? 122.103 30.186  -4.188  1.00 103.83 ? 55  PHE F CD2   1 
ATOM 7923  C CE1   . PHE H 4 18  ? 124.552 28.868  -4.165  1.00 99.01  ? 55  PHE F CE1   1 
ATOM 7924  C CE2   . PHE H 4 18  ? 123.224 30.800  -4.749  1.00 101.70 ? 55  PHE F CE2   1 
ATOM 7925  C CZ    . PHE H 4 18  ? 124.452 30.138  -4.739  1.00 99.31  ? 55  PHE F CZ    1 
ATOM 7926  N N     . ARG H 4 19  ? 117.368 28.391  -3.371  1.00 79.67  ? 56  ARG F N     1 
ATOM 7927  C CA    . ARG H 4 19  ? 116.145 27.667  -3.049  1.00 76.31  ? 56  ARG F CA    1 
ATOM 7928  C C     . ARG H 4 19  ? 116.222 26.166  -3.335  1.00 76.94  ? 56  ARG F C     1 
ATOM 7929  O O     . ARG H 4 19  ? 117.050 25.705  -4.127  1.00 73.61  ? 56  ARG F O     1 
ATOM 7930  C CB    . ARG H 4 19  ? 114.965 28.267  -3.816  1.00 72.72  ? 56  ARG F CB    1 
ATOM 7931  C CG    . ARG H 4 19  ? 114.822 29.780  -3.685  1.00 68.55  ? 56  ARG F CG    1 
ATOM 7932  C CD    . ARG H 4 19  ? 114.610 30.241  -2.246  1.00 65.15  ? 56  ARG F CD    1 
ATOM 7933  N NE    . ARG H 4 19  ? 113.480 29.579  -1.595  1.00 62.65  ? 56  ARG F NE    1 
ATOM 7934  C CZ    . ARG H 4 19  ? 113.564 28.450  -0.893  1.00 60.74  ? 56  ARG F CZ    1 
ATOM 7935  N NH1   . ARG H 4 19  ? 114.726 27.837  -0.731  1.00 61.10  ? 56  ARG F NH1   1 
ATOM 7936  N NH2   . ARG H 4 19  ? 112.475 27.928  -0.349  1.00 59.89  ? 56  ARG F NH2   1 
ATOM 7937  N N     . TYR H 4 20  ? 115.343 25.412  -2.682  1.00 66.63  ? 57  TYR F N     1 
ATOM 7938  C CA    . TYR H 4 20  ? 115.280 23.965  -2.844  1.00 66.81  ? 57  TYR F CA    1 
ATOM 7939  C C     . TYR H 4 20  ? 114.083 23.577  -3.697  1.00 67.50  ? 57  TYR F C     1 
ATOM 7940  O O     . TYR H 4 20  ? 113.218 24.403  -3.981  1.00 100.21 ? 57  TYR F O     1 
ATOM 7941  C CB    . TYR H 4 20  ? 115.168 23.297  -1.479  1.00 102.12 ? 57  TYR F CB    1 
ATOM 7942  C CG    . TYR H 4 20  ? 116.369 23.549  -0.612  1.00 105.07 ? 57  TYR F CG    1 
ATOM 7943  C CD1   . TYR H 4 20  ? 117.445 22.660  -0.600  1.00 107.57 ? 57  TYR F CD1   1 
ATOM 7944  C CD2   . TYR H 4 20  ? 116.457 24.705  0.156   1.00 105.84 ? 57  TYR F CD2   1 
ATOM 7945  C CE1   . TYR H 4 20  ? 118.581 22.922  0.156   1.00 108.50 ? 57  TYR F CE1   1 
ATOM 7946  C CE2   . TYR H 4 20  ? 117.585 24.978  0.908   1.00 106.73 ? 57  TYR F CE2   1 
ATOM 7947  C CZ    . TYR H 4 20  ? 118.642 24.085  0.903   1.00 107.81 ? 57  TYR F CZ    1 
ATOM 7948  O OH    . TYR H 4 20  ? 119.763 24.376  1.635   1.00 108.22 ? 57  TYR F OH    1 
ATOM 7949  N N     . VAL H 4 21  ? 114.032 22.317  -4.105  1.00 99.91  ? 58  VAL F N     1 
ATOM 7950  C CA    . VAL H 4 21  ? 112.923 21.840  -4.915  1.00 98.87  ? 58  VAL F CA    1 
ATOM 7951  C C     . VAL H 4 21  ? 111.681 21.669  -4.044  1.00 99.57  ? 58  VAL F C     1 
ATOM 7952  O O     . VAL H 4 21  ? 110.560 21.916  -4.492  1.00 115.19 ? 58  VAL F O     1 
ATOM 7953  C CB    . VAL H 4 21  ? 113.260 20.489  -5.577  1.00 113.17 ? 58  VAL F CB    1 
ATOM 7954  C CG1   . VAL H 4 21  ? 113.575 19.446  -4.506  1.00 113.55 ? 58  VAL F CG1   1 
ATOM 7955  C CG2   . VAL H 4 21  ? 112.095 20.036  -6.453  1.00 110.23 ? 58  VAL F CG2   1 
ATOM 7956  N N     . CYS H 4 22  ? 111.896 21.254  -2.798  1.00 80.27  ? 59  CYS F N     1 
ATOM 7957  C CA    . CYS H 4 22  ? 110.811 21.037  -1.846  1.00 81.11  ? 59  CYS F CA    1 
ATOM 7958  C C     . CYS H 4 22  ? 110.221 22.369  -1.394  1.00 81.20  ? 59  CYS F C     1 
ATOM 7959  O O     . CYS H 4 22  ? 109.661 22.469  -0.298  1.00 81.90  ? 59  CYS F O     1 
ATOM 7960  C CB    . CYS H 4 22  ? 111.329 20.310  -0.622  1.00 83.98  ? 59  CYS F CB    1 
ATOM 7961  S SG    . CYS H 4 22  ? 112.287 21.423  0.401   1.00 87.59  ? 59  CYS F SG    1 
ATOM 7962  N N     . GLU H 4 23  ? 110.368 23.386  -2.239  1.00 104.53 ? 60  GLU F N     1 
ATOM 7963  C CA    . GLU H 4 23  ? 109.845 24.725  -1.973  1.00 105.68 ? 60  GLU F CA    1 
ATOM 7964  C C     . GLU H 4 23  ? 109.145 25.172  -3.266  1.00 108.49 ? 60  GLU F C     1 
ATOM 7965  O O     . GLU H 4 23  ? 108.941 26.364  -3.504  1.00 62.07  ? 60  GLU F O     1 
ATOM 7966  C CB    . GLU H 4 23  ? 110.988 25.698  -1.637  1.00 57.08  ? 60  GLU F CB    1 
ATOM 7967  C CG    . GLU H 4 23  ? 112.200 25.105  -0.876  1.00 57.36  ? 60  GLU F CG    1 
ATOM 7968  C CD    . GLU H 4 23  ? 111.865 24.611  0.520   1.00 56.15  ? 60  GLU F CD    1 
ATOM 7969  O OE1   . GLU H 4 23  ? 112.777 24.630  1.385   1.00 54.24  ? 60  GLU F OE1   1 
ATOM 7970  O OE2   . GLU H 4 23  ? 110.703 24.201  0.749   1.00 55.16  ? 60  GLU F OE2   1 
ATOM 7971  N N     . GLY H 4 24  ? 108.811 24.179  -4.092  1.00 108.75 ? 61  GLY F N     1 
ATOM 7972  C CA    . GLY H 4 24  ? 108.138 24.362  -5.372  1.00 110.38 ? 61  GLY F CA    1 
ATOM 7973  C C     . GLY H 4 24  ? 107.916 25.731  -5.999  1.00 111.76 ? 61  GLY F C     1 
ATOM 7974  O O     . GLY H 4 24  ? 108.603 26.082  -6.959  1.00 92.26  ? 61  GLY F O     1 
ATOM 7975  N N     . PRO H 4 25  ? 106.946 26.517  -5.494  1.00 101.36 ? 62  PRO F N     1 
ATOM 7976  C CA    . PRO H 4 25  ? 106.576 27.858  -5.964  1.00 100.64 ? 62  PRO F CA    1 
ATOM 7977  C C     . PRO H 4 25  ? 107.604 28.691  -6.737  1.00 99.95  ? 62  PRO F C     1 
ATOM 7978  O O     . PRO H 4 25  ? 108.814 28.533  -6.576  1.00 113.60 ? 62  PRO F O     1 
ATOM 7979  C CB    . PRO H 4 25  ? 106.082 28.559  -4.686  1.00 111.69 ? 62  PRO F CB    1 
ATOM 7980  C CG    . PRO H 4 25  ? 106.222 27.505  -3.563  1.00 112.68 ? 62  PRO F CG    1 
ATOM 7981  C CD    . PRO H 4 25  ? 106.191 26.195  -4.274  1.00 112.60 ? 62  PRO F CD    1 
ATOM 7982  N N     . SER H 4 26  ? 107.081 29.580  -7.582  1.00 97.17  ? 63  SER F N     1 
ATOM 7983  C CA    . SER H 4 26  ? 107.872 30.477  -8.426  1.00 96.52  ? 63  SER F CA    1 
ATOM 7984  C C     . SER H 4 26  ? 108.687 31.475  -7.597  1.00 95.85  ? 63  SER F C     1 
ATOM 7985  O O     . SER H 4 26  ? 108.200 32.555  -7.262  1.00 65.83  ? 63  SER F O     1 
ATOM 7986  C CB    . SER H 4 26  ? 106.946 31.256  -9.382  1.00 61.81  ? 63  SER F CB    1 
ATOM 7987  O OG    . SER H 4 26  ? 106.118 30.403  -10.161 1.00 61.17  ? 63  SER F OG    1 
ATOM 7988  N N     . HIS H 4 27  ? 109.928 31.120  -7.282  1.00 87.40  ? 64  HIS F N     1 
ATOM 7989  C CA    . HIS H 4 27  ? 110.793 31.990  -6.488  1.00 87.30  ? 64  HIS F CA    1 
ATOM 7990  C C     . HIS H 4 27  ? 111.799 32.775  -7.331  1.00 87.10  ? 64  HIS F C     1 
ATOM 7991  O O     . HIS H 4 27  ? 113.009 32.668  -7.119  1.00 115.02 ? 64  HIS F O     1 
ATOM 7992  C CB    . HIS H 4 27  ? 111.553 31.168  -5.440  1.00 117.19 ? 64  HIS F CB    1 
ATOM 7993  C CG    . HIS H 4 27  ? 110.695 30.670  -4.317  1.00 117.19 ? 64  HIS F CG    1 
ATOM 7994  N ND1   . HIS H 4 27  ? 109.620 29.830  -4.512  1.00 117.19 ? 64  HIS F ND1   1 
ATOM 7995  C CD2   . HIS H 4 27  ? 110.764 30.887  -2.981  1.00 117.19 ? 64  HIS F CD2   1 
ATOM 7996  C CE1   . HIS H 4 27  ? 109.065 29.549  -3.347  1.00 117.19 ? 64  HIS F CE1   1 
ATOM 7997  N NE2   . HIS H 4 27  ? 109.740 30.178  -2.401  1.00 117.09 ? 64  HIS F NE2   1 
ATOM 7998  N N     . GLY H 4 28  ? 111.295 33.565  -8.276  1.00 96.99  ? 65  GLY F N     1 
ATOM 7999  C CA    . GLY H 4 28  ? 112.161 34.362  -9.131  1.00 96.06  ? 65  GLY F CA    1 
ATOM 8000  C C     . GLY H 4 28  ? 113.477 33.688  -9.475  1.00 94.87  ? 65  GLY F C     1 
ATOM 8001  O O     . GLY H 4 28  ? 113.502 32.525  -9.890  1.00 65.28  ? 65  GLY F O     1 
ATOM 8002  N N     . GLY H 4 29  ? 114.575 34.419  -9.299  1.00 122.22 ? 66  GLY F N     1 
ATOM 8003  C CA    . GLY H 4 29  ? 115.882 33.862  -9.602  1.00 121.39 ? 66  GLY F CA    1 
ATOM 8004  C C     . GLY H 4 29  ? 117.079 34.732  -9.248  1.00 118.98 ? 66  GLY F C     1 
ATOM 8005  O O     . GLY H 4 29  ? 117.050 35.532  -8.303  1.00 93.97  ? 66  GLY F O     1 
ATOM 8006  N N     . LEU H 4 30  ? 118.141 34.563  -10.031 1.00 90.36  ? 67  LEU F N     1 
ATOM 8007  C CA    . LEU H 4 30  ? 119.396 35.285  -9.851  1.00 88.92  ? 67  LEU F CA    1 
ATOM 8008  C C     . LEU H 4 30  ? 119.568 36.426  -10.857 1.00 87.91  ? 67  LEU F C     1 
ATOM 8009  O O     . LEU H 4 30  ? 119.813 36.195  -12.046 1.00 87.23  ? 67  LEU F O     1 
ATOM 8010  C CB    . LEU H 4 30  ? 120.567 34.305  -9.975  1.00 85.91  ? 67  LEU F CB    1 
ATOM 8011  C CG    . LEU H 4 30  ? 120.751 33.540  -11.293 1.00 85.67  ? 67  LEU F CG    1 
ATOM 8012  C CD1   . LEU H 4 30  ? 121.870 32.531  -11.104 1.00 85.73  ? 67  LEU F CD1   1 
ATOM 8013  C CD2   . LEU H 4 30  ? 119.470 32.829  -11.706 1.00 87.34  ? 67  LEU F CD2   1 
ATOM 8014  N N     . PRO H 4 31  ? 119.449 37.677  -10.386 1.00 56.83  ? 68  PRO F N     1 
ATOM 8015  C CA    . PRO H 4 31  ? 119.598 38.831  -11.277 1.00 58.02  ? 68  PRO F CA    1 
ATOM 8016  C C     . PRO H 4 31  ? 121.036 38.996  -11.769 1.00 59.54  ? 68  PRO F C     1 
ATOM 8017  O O     . PRO H 4 31  ? 121.751 38.010  -11.963 1.00 111.75 ? 68  PRO F O     1 
ATOM 8018  C CB    . PRO H 4 31  ? 119.135 39.993  -10.404 1.00 102.19 ? 68  PRO F CB    1 
ATOM 8019  C CG    . PRO H 4 31  ? 119.583 39.569  -9.041  1.00 104.12 ? 68  PRO F CG    1 
ATOM 8020  C CD    . PRO H 4 31  ? 119.175 38.112  -9.004  1.00 102.13 ? 68  PRO F CD    1 
ATOM 8021  N N     . GLY H 4 32  ? 121.451 40.244  -11.970 1.00 74.91  ? 69  GLY F N     1 
ATOM 8022  C CA    . GLY H 4 32  ? 122.802 40.520  -12.427 1.00 77.50  ? 69  GLY F CA    1 
ATOM 8023  C C     . GLY H 4 32  ? 123.476 41.548  -11.537 1.00 79.17  ? 69  GLY F C     1 
ATOM 8024  O O     . GLY H 4 32  ? 123.091 41.723  -10.382 1.00 74.67  ? 69  GLY F O     1 
ATOM 8025  N N     . ALA H 4 33  ? 124.482 42.231  -12.074 1.00 95.50  ? 70  ALA F N     1 
ATOM 8026  C CA    . ALA H 4 33  ? 125.210 43.245  -11.320 1.00 95.92  ? 70  ALA F CA    1 
ATOM 8027  C C     . ALA H 4 33  ? 124.641 44.632  -11.579 1.00 96.52  ? 70  ALA F C     1 
ATOM 8028  O O     . ALA H 4 33  ? 125.282 45.632  -11.272 1.00 72.08  ? 70  ALA F O     1 
ATOM 8029  C CB    . ALA H 4 33  ? 126.686 43.217  -11.700 1.00 72.31  ? 70  ALA F CB    1 
ATOM 8030  N N     . SER H 4 34  ? 123.435 44.698  -12.139 1.00 77.66  ? 71  SER F N     1 
ATOM 8031  C CA    . SER H 4 34  ? 122.821 45.985  -12.445 1.00 77.63  ? 71  SER F CA    1 
ATOM 8032  C C     . SER H 4 34  ? 121.448 46.140  -11.802 1.00 76.29  ? 71  SER F C     1 
ATOM 8033  O O     . SER H 4 34  ? 121.054 47.243  -11.422 1.00 78.90  ? 71  SER F O     1 
ATOM 8034  C CB    . SER H 4 34  ? 122.706 46.157  -13.965 1.00 77.48  ? 71  SER F CB    1 
ATOM 8035  O OG    . SER H 4 34  ? 122.511 47.515  -14.313 1.00 76.64  ? 71  SER F OG    1 
ATOM 8036  N N     . SER H 4 35  ? 120.728 45.027  -11.682 1.00 93.41  ? 72  SER F N     1 
ATOM 8037  C CA    . SER H 4 35  ? 119.390 45.012  -11.087 1.00 92.30  ? 72  SER F CA    1 
ATOM 8038  C C     . SER H 4 35  ? 119.314 45.711  -9.723  1.00 92.00  ? 72  SER F C     1 
ATOM 8039  O O     . SER H 4 35  ? 119.502 45.079  -8.680  1.00 94.22  ? 72  SER F O     1 
ATOM 8040  C CB    . SER H 4 35  ? 118.913 43.567  -10.945 1.00 95.59  ? 72  SER F CB    1 
ATOM 8041  O OG    . SER H 4 35  ? 119.875 42.797  -10.243 1.00 94.09  ? 72  SER F OG    1 
ATOM 8042  N N     . GLU H 4 36  ? 119.009 47.008  -9.741  1.00 72.24  ? 73  GLU F N     1 
ATOM 8043  C CA    . GLU H 4 36  ? 118.923 47.830  -8.526  1.00 70.40  ? 73  GLU F CA    1 
ATOM 8044  C C     . GLU H 4 36  ? 117.491 48.160  -8.086  1.00 70.09  ? 73  GLU F C     1 
ATOM 8045  O O     . GLU H 4 36  ? 117.127 49.333  -7.985  1.00 82.34  ? 73  GLU F O     1 
ATOM 8046  C CB    . GLU H 4 36  ? 119.698 49.133  -8.757  1.00 80.28  ? 73  GLU F CB    1 
ATOM 8047  C CG    . GLU H 4 36  ? 119.359 49.819  -10.085 1.00 75.84  ? 73  GLU F CG    1 
ATOM 8048  C CD    . GLU H 4 36  ? 120.218 51.039  -10.366 1.00 73.03  ? 73  GLU F CD    1 
ATOM 8049  O OE1   . GLU H 4 36  ? 121.451 50.880  -10.511 1.00 68.67  ? 73  GLU F OE1   1 
ATOM 8050  O OE2   . GLU H 4 36  ? 119.655 52.155  -10.444 1.00 73.01  ? 73  GLU F OE2   1 
ATOM 8051  N N     . LYS H 4 37  ? 116.695 47.128  -7.812  1.00 93.99  ? 74  LYS F N     1 
ATOM 8052  C CA    . LYS H 4 37  ? 115.297 47.295  -7.401  1.00 93.46  ? 74  LYS F CA    1 
ATOM 8053  C C     . LYS H 4 37  ? 114.439 47.846  -8.539  1.00 93.84  ? 74  LYS F C     1 
ATOM 8054  O O     . LYS H 4 37  ? 113.508 47.185  -9.004  1.00 95.77  ? 74  LYS F O     1 
ATOM 8055  C CB    . LYS H 4 37  ? 115.186 48.221  -6.182  1.00 88.06  ? 74  LYS F CB    1 
ATOM 8056  C CG    . LYS H 4 37  ? 115.731 47.620  -4.898  1.00 86.02  ? 74  LYS F CG    1 
ATOM 8057  C CD    . LYS H 4 37  ? 115.538 48.560  -3.715  1.00 82.99  ? 74  LYS F CD    1 
ATOM 8058  C CE    . LYS H 4 37  ? 116.144 47.990  -2.430  1.00 82.14  ? 74  LYS F CE    1 
ATOM 8059  N NZ    . LYS H 4 37  ? 115.526 46.700  -1.988  1.00 78.52  ? 74  LYS F NZ    1 
ATOM 8060  N N     . ASN H 4 38  ? 114.757 49.058  -8.984  1.00 97.44  ? 75  ASN F N     1 
ATOM 8061  C CA    . ASN H 4 38  ? 114.025 49.696  -10.074 1.00 99.58  ? 75  ASN F CA    1 
ATOM 8062  C C     . ASN H 4 38  ? 114.692 49.357  -11.411 1.00 98.58  ? 75  ASN F C     1 
ATOM 8063  O O     . ASN H 4 38  ? 114.701 50.158  -12.348 1.00 98.55  ? 75  ASN F O     1 
ATOM 8064  C CB    . ASN H 4 38  ? 113.988 51.213  -9.860  1.00 103.34 ? 75  ASN F CB    1 
ATOM 8065  C CG    . ASN H 4 38  ? 113.282 51.609  -8.565  1.00 106.39 ? 75  ASN F CG    1 
ATOM 8066  O OD1   . ASN H 4 38  ? 113.230 52.788  -8.214  1.00 107.16 ? 75  ASN F OD1   1 
ATOM 8067  N ND2   . ASN H 4 38  ? 112.735 50.625  -7.853  1.00 106.32 ? 75  ASN F ND2   1 
ATOM 8068  N N     . LYS H 4 39  ? 115.247 48.150  -11.479 1.00 89.35  ? 76  LYS F N     1 
ATOM 8069  C CA    . LYS H 4 39  ? 115.923 47.660  -12.674 1.00 90.41  ? 76  LYS F CA    1 
ATOM 8070  C C     . LYS H 4 39  ? 116.332 46.196  -12.469 1.00 91.52  ? 76  LYS F C     1 
ATOM 8071  O O     . LYS H 4 39  ? 116.800 45.818  -11.392 1.00 63.54  ? 76  LYS F O     1 
ATOM 8072  C CB    . LYS H 4 39  ? 117.161 48.515  -12.957 1.00 68.77  ? 76  LYS F CB    1 
ATOM 8073  C CG    . LYS H 4 39  ? 117.481 48.684  -14.439 1.00 67.21  ? 76  LYS F CG    1 
ATOM 8074  C CD    . LYS H 4 39  ? 117.777 47.359  -15.129 1.00 65.22  ? 76  LYS F CD    1 
ATOM 8075  C CE    . LYS H 4 39  ? 117.973 47.566  -16.626 1.00 65.36  ? 76  LYS F CE    1 
ATOM 8076  N NZ    . LYS H 4 39  ? 118.292 46.298  -17.337 1.00 63.18  ? 76  LYS F NZ    1 
ATOM 8077  N N     . LYS H 4 40  ? 116.145 45.370  -13.494 1.00 92.98  ? 77  LYS F N     1 
ATOM 8078  C CA    . LYS H 4 40  ? 116.503 43.959  -13.398 1.00 92.45  ? 77  LYS F CA    1 
ATOM 8079  C C     . LYS H 4 40  ? 117.633 43.613  -14.363 1.00 92.01  ? 77  LYS F C     1 
ATOM 8080  O O     . LYS H 4 40  ? 118.095 44.465  -15.119 1.00 79.44  ? 77  LYS F O     1 
ATOM 8081  C CB    . LYS H 4 40  ? 115.280 43.076  -13.681 1.00 67.31  ? 77  LYS F CB    1 
ATOM 8082  C CG    . LYS H 4 40  ? 114.858 42.956  -15.149 1.00 65.56  ? 77  LYS F CG    1 
ATOM 8083  C CD    . LYS H 4 40  ? 114.379 44.268  -15.752 1.00 64.62  ? 77  LYS F CD    1 
ATOM 8084  C CE    . LYS H 4 40  ? 115.527 45.099  -16.301 1.00 63.44  ? 77  LYS F CE    1 
ATOM 8085  N NZ    . LYS H 4 40  ? 115.053 46.396  -16.862 1.00 63.96  ? 77  LYS F NZ    1 
ATOM 8086  N N     . SER H 4 41  ? 118.077 42.360  -14.323 1.00 113.89 ? 78  SER F N     1 
ATOM 8087  C CA    . SER H 4 41  ? 119.151 41.883  -15.192 1.00 112.58 ? 78  SER F CA    1 
ATOM 8088  C C     . SER H 4 41  ? 119.300 40.370  -15.076 1.00 112.33 ? 78  SER F C     1 
ATOM 8089  O O     . SER H 4 41  ? 118.624 39.736  -14.268 1.00 93.98  ? 78  SER F O     1 
ATOM 8090  C CB    . SER H 4 41  ? 120.479 42.555  -14.825 1.00 87.58  ? 78  SER F CB    1 
ATOM 8091  O OG    . SER H 4 41  ? 121.557 42.020  -15.583 1.00 86.08  ? 78  SER F OG    1 
ATOM 8092  N N     . TYR H 4 42  ? 120.180 39.798  -15.890 1.00 88.37  ? 79  TYR F N     1 
ATOM 8093  C CA    . TYR H 4 42  ? 120.422 38.362  -15.872 1.00 87.84  ? 79  TYR F CA    1 
ATOM 8094  C C     . TYR H 4 42  ? 121.741 38.055  -16.586 1.00 89.10  ? 79  TYR F C     1 
ATOM 8095  O O     . TYR H 4 42  ? 122.097 38.729  -17.553 1.00 95.93  ? 79  TYR F O     1 
ATOM 8096  C CB    . TYR H 4 42  ? 119.231 37.614  -16.510 1.00 95.64  ? 79  TYR F CB    1 
ATOM 8097  C CG    . TYR H 4 42  ? 118.754 38.132  -17.860 1.00 94.54  ? 79  TYR F CG    1 
ATOM 8098  C CD1   . TYR H 4 42  ? 118.475 39.487  -18.063 1.00 92.82  ? 79  TYR F CD1   1 
ATOM 8099  C CD2   . TYR H 4 42  ? 118.559 37.259  -18.931 1.00 93.33  ? 79  TYR F CD2   1 
ATOM 8100  C CE1   . TYR H 4 42  ? 118.019 39.956  -19.300 1.00 92.68  ? 79  TYR F CE1   1 
ATOM 8101  C CE2   . TYR H 4 42  ? 118.103 37.716  -20.168 1.00 91.65  ? 79  TYR F CE2   1 
ATOM 8102  C CZ    . TYR H 4 42  ? 117.835 39.064  -20.345 1.00 92.56  ? 79  TYR F CZ    1 
ATOM 8103  O OH    . TYR H 4 42  ? 117.388 39.517  -21.565 1.00 90.80  ? 79  TYR F OH    1 
ATOM 8104  N N     . PRO H 4 43  ? 122.485 37.035  -16.111 1.00 89.59  ? 80  PRO F N     1 
ATOM 8105  C CA    . PRO H 4 43  ? 123.770 36.656  -16.713 1.00 90.70  ? 80  PRO F CA    1 
ATOM 8106  C C     . PRO H 4 43  ? 123.711 36.563  -18.237 1.00 92.46  ? 80  PRO F C     1 
ATOM 8107  O O     . PRO H 4 43  ? 123.170 35.602  -18.787 1.00 113.75 ? 80  PRO F O     1 
ATOM 8108  C CB    . PRO H 4 43  ? 124.075 35.307  -16.058 1.00 103.23 ? 80  PRO F CB    1 
ATOM 8109  C CG    . PRO H 4 43  ? 122.716 34.748  -15.797 1.00 104.39 ? 80  PRO F CG    1 
ATOM 8110  C CD    . PRO H 4 43  ? 121.994 35.953  -15.240 1.00 103.99 ? 80  PRO F CD    1 
ATOM 8111  N N     . GLN H 4 44  ? 124.268 37.568  -18.910 1.00 82.62  ? 81  GLN F N     1 
ATOM 8112  C CA    . GLN H 4 44  ? 124.279 37.619  -20.372 1.00 83.05  ? 81  GLN F CA    1 
ATOM 8113  C C     . GLN H 4 44  ? 125.611 37.136  -20.945 1.00 84.12  ? 81  GLN F C     1 
ATOM 8114  O O     . GLN H 4 44  ? 126.677 37.507  -20.461 1.00 112.26 ? 81  GLN F O     1 
ATOM 8115  C CB    . GLN H 4 44  ? 124.010 39.057  -20.852 1.00 90.49  ? 81  GLN F CB    1 
ATOM 8116  C CG    . GLN H 4 44  ? 123.936 39.216  -22.369 1.00 90.26  ? 81  GLN F CG    1 
ATOM 8117  C CD    . GLN H 4 44  ? 123.517 40.614  -22.808 1.00 90.06  ? 81  GLN F CD    1 
ATOM 8118  O OE1   . GLN H 4 44  ? 123.343 40.876  -24.000 1.00 87.59  ? 81  GLN F OE1   1 
ATOM 8119  N NE2   . GLN H 4 44  ? 123.356 41.517  -21.846 1.00 88.79  ? 81  GLN F NE2   1 
ATOM 8120  N N     . VAL H 4 45  ? 125.542 36.305  -21.979 1.00 68.90  ? 82  VAL F N     1 
ATOM 8121  C CA    . VAL H 4 45  ? 126.737 35.786  -22.633 1.00 66.41  ? 82  VAL F CA    1 
ATOM 8122  C C     . VAL H 4 45  ? 126.736 36.304  -24.074 1.00 67.02  ? 82  VAL F C     1 
ATOM 8123  O O     . VAL H 4 45  ? 125.768 36.932  -24.501 1.00 94.81  ? 82  VAL F O     1 
ATOM 8124  C CB    . VAL H 4 45  ? 126.734 34.229  -22.604 1.00 94.56  ? 82  VAL F CB    1 
ATOM 8125  C CG1   . VAL H 4 45  ? 125.425 33.700  -23.163 1.00 93.08  ? 82  VAL F CG1   1 
ATOM 8126  C CG2   . VAL H 4 45  ? 127.910 33.680  -23.389 1.00 93.80  ? 82  VAL F CG2   1 
ATOM 8127  N N     . LYS H 4 46  ? 127.821 36.077  -24.809 1.00 98.79  ? 83  LYS F N     1 
ATOM 8128  C CA    . LYS H 4 46  ? 127.896 36.514  -26.201 1.00 97.41  ? 83  LYS F CA    1 
ATOM 8129  C C     . LYS H 4 46  ? 129.106 35.937  -26.923 1.00 96.22  ? 83  LYS F C     1 
ATOM 8130  O O     . LYS H 4 46  ? 130.149 35.702  -26.310 1.00 81.05  ? 83  LYS F O     1 
ATOM 8131  C CB    . LYS H 4 46  ? 127.939 38.046  -26.299 1.00 88.09  ? 83  LYS F CB    1 
ATOM 8132  C CG    . LYS H 4 46  ? 129.253 38.674  -25.856 1.00 88.62  ? 83  LYS F CG    1 
ATOM 8133  C CD    . LYS H 4 46  ? 129.321 40.155  -26.211 1.00 87.80  ? 83  LYS F CD    1 
ATOM 8134  C CE    . LYS H 4 46  ? 130.625 40.779  -25.727 1.00 88.94  ? 83  LYS F CE    1 
ATOM 8135  N NZ    . LYS H 4 46  ? 130.721 42.228  -26.056 1.00 89.91  ? 83  LYS F NZ    1 
ATOM 8136  N N     . ILE H 4 47  ? 128.947 35.704  -28.226 1.00 122.98 ? 84  ILE F N     1 
ATOM 8137  C CA    . ILE H 4 47  ? 130.015 35.177  -29.085 1.00 122.98 ? 84  ILE F CA    1 
ATOM 8138  C C     . ILE H 4 47  ? 130.570 36.402  -29.825 1.00 122.98 ? 84  ILE F C     1 
ATOM 8139  O O     . ILE H 4 47  ? 130.079 37.522  -29.638 1.00 63.34  ? 84  ILE F O     1 
ATOM 8140  C CB    . ILE H 4 47  ? 129.467 34.140  -30.149 1.00 54.57  ? 84  ILE F CB    1 
ATOM 8141  C CG1   . ILE H 4 47  ? 128.780 32.960  -29.454 1.00 50.90  ? 84  ILE F CG1   1 
ATOM 8142  C CG2   . ILE H 4 47  ? 130.611 33.608  -31.020 1.00 54.82  ? 84  ILE F CG2   1 
ATOM 8143  C CD1   . ILE H 4 47  ? 127.979 32.087  -30.402 1.00 47.17  ? 84  ILE F CD1   1 
ATOM 8144  N N     . CYS H 4 48  ? 131.588 36.200  -30.655 1.00 83.32  ? 85  CYS F N     1 
ATOM 8145  C CA    . CYS H 4 48  ? 132.161 37.311  -31.402 1.00 87.99  ? 85  CYS F CA    1 
ATOM 8146  C C     . CYS H 4 48  ? 132.146 37.042  -32.903 1.00 89.33  ? 85  CYS F C     1 
ATOM 8147  O O     . CYS H 4 48  ? 131.385 37.667  -33.636 1.00 103.66 ? 85  CYS F O     1 
ATOM 8148  C CB    . CYS H 4 48  ? 133.579 37.605  -30.898 1.00 97.39  ? 85  CYS F CB    1 
ATOM 8149  S SG    . CYS H 4 48  ? 133.615 38.325  -29.210 1.00 99.65  ? 85  CYS F SG    1 
ATOM 8150  N N     . ASN H 4 49  ? 132.977 36.119  -33.367 1.00 78.56  ? 86  ASN F N     1 
ATOM 8151  C CA    . ASN H 4 49  ? 132.982 35.807  -34.789 1.00 78.01  ? 86  ASN F CA    1 
ATOM 8152  C C     . ASN H 4 49  ? 131.741 34.997  -35.142 1.00 77.23  ? 86  ASN F C     1 
ATOM 8153  O O     . ASN H 4 49  ? 131.800 33.773  -35.273 1.00 94.78  ? 86  ASN F O     1 
ATOM 8154  C CB    . ASN H 4 49  ? 134.240 35.032  -35.161 1.00 96.59  ? 86  ASN F CB    1 
ATOM 8155  C CG    . ASN H 4 49  ? 135.428 35.934  -35.368 1.00 94.45  ? 86  ASN F CG    1 
ATOM 8156  O OD1   . ASN H 4 49  ? 135.516 36.648  -36.373 1.00 91.20  ? 86  ASN F OD1   1 
ATOM 8157  N ND2   . ASN H 4 49  ? 136.352 35.920  -34.411 1.00 91.73  ? 86  ASN F ND2   1 
ATOM 8158  N N     . TYR H 4 50  ? 130.622 35.705  -35.298 1.00 121.02 ? 87  TYR F N     1 
ATOM 8159  C CA    . TYR H 4 50  ? 129.318 35.116  -35.623 1.00 121.02 ? 87  TYR F CA    1 
ATOM 8160  C C     . TYR H 4 50  ? 129.367 33.751  -36.299 1.00 121.02 ? 87  TYR F C     1 
ATOM 8161  O O     . TYR H 4 50  ? 130.212 33.486  -37.161 1.00 102.15 ? 87  TYR F O     1 
ATOM 8162  C CB    . TYR H 4 50  ? 128.495 36.070  -36.510 1.00 106.70 ? 87  TYR F CB    1 
ATOM 8163  C CG    . TYR H 4 50  ? 128.557 35.783  -38.009 1.00 107.46 ? 87  TYR F CG    1 
ATOM 8164  C CD1   . TYR H 4 50  ? 129.754 35.912  -38.727 1.00 108.28 ? 87  TYR F CD1   1 
ATOM 8165  C CD2   . TYR H 4 50  ? 127.411 35.397  -38.711 1.00 107.13 ? 87  TYR F CD2   1 
ATOM 8166  C CE1   . TYR H 4 50  ? 129.803 35.667  -40.105 1.00 107.68 ? 87  TYR F CE1   1 
ATOM 8167  C CE2   . TYR H 4 50  ? 127.452 35.151  -40.087 1.00 107.36 ? 87  TYR F CE2   1 
ATOM 8168  C CZ    . TYR H 4 50  ? 128.649 35.290  -40.776 1.00 107.93 ? 87  TYR F CZ    1 
ATOM 8169  O OH    . TYR H 4 50  ? 128.689 35.060  -42.133 1.00 104.96 ? 87  TYR F OH    1 
ATOM 8170  N N     . VAL H 4 51  ? 128.436 32.894  -35.902 1.00 102.55 ? 88  VAL F N     1 
ATOM 8171  C CA    . VAL H 4 51  ? 128.334 31.558  -36.460 1.00 102.04 ? 88  VAL F CA    1 
ATOM 8172  C C     . VAL H 4 51  ? 126.860 31.337  -36.803 1.00 101.72 ? 88  VAL F C     1 
ATOM 8173  O O     . VAL H 4 51  ? 126.329 30.235  -36.647 1.00 102.41 ? 88  VAL F O     1 
ATOM 8174  C CB    . VAL H 4 51  ? 128.803 30.498  -35.432 1.00 99.65  ? 88  VAL F CB    1 
ATOM 8175  C CG1   . VAL H 4 51  ? 127.810 30.424  -34.265 1.00 97.65  ? 88  VAL F CG1   1 
ATOM 8176  C CG2   . VAL H 4 51  ? 128.980 29.146  -36.116 1.00 99.56  ? 88  VAL F CG2   1 
ATOM 8177  N N     . GLY H 4 52  ? 126.205 32.394  -37.283 1.00 82.74  ? 89  GLY F N     1 
ATOM 8178  C CA    . GLY H 4 52  ? 124.797 32.289  -37.607 1.00 83.14  ? 89  GLY F CA    1 
ATOM 8179  C C     . GLY H 4 52  ? 124.106 31.728  -36.379 1.00 84.53  ? 89  GLY F C     1 
ATOM 8180  O O     . GLY H 4 52  ? 124.023 32.403  -35.350 1.00 84.92  ? 89  GLY F O     1 
ATOM 8181  N N     . PRO H 4 53  ? 123.600 30.487  -36.455 1.00 113.77 ? 90  PRO F N     1 
ATOM 8182  C CA    . PRO H 4 53  ? 122.923 29.847  -35.324 1.00 112.33 ? 90  PRO F CA    1 
ATOM 8183  C C     . PRO H 4 53  ? 123.946 29.118  -34.448 1.00 112.46 ? 90  PRO F C     1 
ATOM 8184  O O     . PRO H 4 53  ? 125.017 28.724  -34.917 1.00 120.73 ? 90  PRO F O     1 
ATOM 8185  C CB    . PRO H 4 53  ? 121.957 28.889  -36.010 1.00 116.61 ? 90  PRO F CB    1 
ATOM 8186  C CG    . PRO H 4 53  ? 122.772 28.412  -37.169 1.00 116.61 ? 90  PRO F CG    1 
ATOM 8187  C CD    . PRO H 4 53  ? 123.420 29.695  -37.687 1.00 116.61 ? 90  PRO F CD    1 
ATOM 8188  N N     . ALA H 4 54  ? 123.614 28.935  -33.179 1.00 80.18  ? 91  ALA F N     1 
ATOM 8189  C CA    . ALA H 4 54  ? 124.519 28.263  -32.267 1.00 81.83  ? 91  ALA F CA    1 
ATOM 8190  C C     . ALA H 4 54  ? 123.773 27.833  -31.007 1.00 83.37  ? 91  ALA F C     1 
ATOM 8191  O O     . ALA H 4 54  ? 122.768 28.443  -30.628 1.00 86.05  ? 91  ALA F O     1 
ATOM 8192  C CB    . ALA H 4 54  ? 125.674 29.201  -31.916 1.00 80.63  ? 91  ALA F CB    1 
ATOM 8193  N N     . LYS H 4 55  ? 124.279 26.786  -30.361 1.00 107.30 ? 92  LYS F N     1 
ATOM 8194  C CA    . LYS H 4 55  ? 123.675 26.243  -29.148 1.00 108.23 ? 92  LYS F CA    1 
ATOM 8195  C C     . LYS H 4 55  ? 124.628 26.359  -27.953 1.00 107.43 ? 92  LYS F C     1 
ATOM 8196  O O     . LYS H 4 55  ? 125.704 25.752  -27.952 1.00 95.15  ? 92  LYS F O     1 
ATOM 8197  C CB    . LYS H 4 55  ? 123.309 24.784  -29.401 1.00 89.27  ? 92  LYS F CB    1 
ATOM 8198  C CG    . LYS H 4 55  ? 122.733 24.054  -28.213 1.00 91.50  ? 92  LYS F CG    1 
ATOM 8199  C CD    . LYS H 4 55  ? 122.618 22.565  -28.504 1.00 89.87  ? 92  LYS F CD    1 
ATOM 8200  C CE    . LYS H 4 55  ? 123.928 22.012  -29.055 1.00 90.28  ? 92  LYS F CE    1 
ATOM 8201  N NZ    . LYS H 4 55  ? 125.095 22.462  -28.245 1.00 89.05  ? 92  LYS F NZ    1 
ATOM 8202  N N     . VAL H 4 56  ? 124.225 27.139  -26.945 1.00 85.21  ? 93  VAL F N     1 
ATOM 8203  C CA    . VAL H 4 56  ? 125.033 27.354  -25.735 1.00 84.09  ? 93  VAL F CA    1 
ATOM 8204  C C     . VAL H 4 56  ? 124.449 26.677  -24.485 1.00 85.22  ? 93  VAL F C     1 
ATOM 8205  O O     . VAL H 4 56  ? 123.436 27.112  -23.934 1.00 86.26  ? 93  VAL F O     1 
ATOM 8206  C CB    . VAL H 4 56  ? 125.221 28.878  -25.436 1.00 78.80  ? 93  VAL F CB    1 
ATOM 8207  C CG1   . VAL H 4 56  ? 125.781 29.078  -24.035 1.00 76.67  ? 93  VAL F CG1   1 
ATOM 8208  C CG2   . VAL H 4 56  ? 126.162 29.501  -26.465 1.00 78.36  ? 93  VAL F CG2   1 
ATOM 8209  N N     . ILE H 4 57  ? 125.116 25.610  -24.051 1.00 94.02  ? 94  ILE F N     1 
ATOM 8210  C CA    . ILE H 4 57  ? 124.718 24.833  -22.879 1.00 93.05  ? 94  ILE F CA    1 
ATOM 8211  C C     . ILE H 4 57  ? 125.410 25.372  -21.635 1.00 92.95  ? 94  ILE F C     1 
ATOM 8212  O O     . ILE H 4 57  ? 126.589 25.710  -21.675 1.00 94.43  ? 94  ILE F O     1 
ATOM 8213  C CB    . ILE H 4 57  ? 125.128 23.346  -23.043 1.00 94.34  ? 94  ILE F CB    1 
ATOM 8214  C CG1   . ILE H 4 57  ? 124.263 22.682  -24.118 1.00 93.34  ? 94  ILE F CG1   1 
ATOM 8215  C CG2   . ILE H 4 57  ? 125.040 22.620  -21.705 1.00 96.30  ? 94  ILE F CG2   1 
ATOM 8216  C CD1   . ILE H 4 57  ? 124.464 23.251  -25.506 1.00 90.66  ? 94  ILE F CD1   1 
ATOM 8217  N N     . VAL H 4 58  ? 124.685 25.431  -20.528 1.00 48.07  ? 95  VAL F N     1 
ATOM 8218  C CA    . VAL H 4 58  ? 125.254 25.924  -19.283 1.00 46.21  ? 95  VAL F CA    1 
ATOM 8219  C C     . VAL H 4 58  ? 124.989 24.944  -18.135 1.00 44.87  ? 95  VAL F C     1 
ATOM 8220  O O     . VAL H 4 58  ? 123.869 24.459  -17.960 1.00 72.65  ? 95  VAL F O     1 
ATOM 8221  C CB    . VAL H 4 58  ? 124.663 27.306  -18.934 1.00 77.91  ? 95  VAL F CB    1 
ATOM 8222  C CG1   . VAL H 4 58  ? 123.180 27.170  -18.626 1.00 76.86  ? 95  VAL F CG1   1 
ATOM 8223  C CG2   . VAL H 4 58  ? 125.413 27.915  -17.761 1.00 77.50  ? 95  VAL F CG2   1 
ATOM 8224  N N     . GLN H 4 59  ? 126.030 24.649  -17.363 1.00 95.19  ? 96  GLN F N     1 
ATOM 8225  C CA    . GLN H 4 59  ? 125.909 23.738  -16.226 1.00 96.04  ? 96  GLN F CA    1 
ATOM 8226  C C     . GLN H 4 59  ? 126.613 24.301  -14.992 1.00 94.57  ? 96  GLN F C     1 
ATOM 8227  O O     . GLN H 4 59  ? 127.494 25.158  -15.105 1.00 87.35  ? 96  GLN F O     1 
ATOM 8228  C CB    . GLN H 4 59  ? 126.508 22.375  -16.566 1.00 88.80  ? 96  GLN F CB    1 
ATOM 8229  C CG    . GLN H 4 59  ? 126.580 21.434  -15.370 1.00 91.30  ? 96  GLN F CG    1 
ATOM 8230  C CD    . GLN H 4 59  ? 127.427 20.213  -15.642 1.00 93.08  ? 96  GLN F CD    1 
ATOM 8231  O OE1   . GLN H 4 59  ? 127.689 19.409  -14.744 1.00 93.67  ? 96  GLN F OE1   1 
ATOM 8232  N NE2   . GLN H 4 59  ? 127.864 20.065  -16.890 1.00 93.18  ? 96  GLN F NE2   1 
ATOM 8233  N N     . LEU H 4 60  ? 126.223 23.805  -13.819 1.00 116.73 ? 97  LEU F N     1 
ATOM 8234  C CA    . LEU H 4 60  ? 126.800 24.248  -12.549 1.00 116.73 ? 97  LEU F CA    1 
ATOM 8235  C C     . LEU H 4 60  ? 128.091 23.494  -12.243 1.00 115.62 ? 97  LEU F C     1 
ATOM 8236  O O     . LEU H 4 60  ? 128.072 22.275  -12.067 1.00 87.45  ? 97  LEU F O     1 
ATOM 8237  C CB    . LEU H 4 60  ? 125.811 24.013  -11.393 1.00 90.91  ? 97  LEU F CB    1 
ATOM 8238  C CG    . LEU H 4 60  ? 124.301 24.111  -11.651 1.00 91.12  ? 97  LEU F CG    1 
ATOM 8239  C CD1   . LEU H 4 60  ? 123.830 22.830  -12.332 1.00 92.23  ? 97  LEU F CD1   1 
ATOM 8240  C CD2   . LEU H 4 60  ? 123.553 24.303  -10.335 1.00 90.49  ? 97  LEU F CD2   1 
ATOM 8241  N N     . VAL H 4 61  ? 129.207 24.219  -12.181 1.00 52.53  ? 98  VAL F N     1 
ATOM 8242  C CA    . VAL H 4 61  ? 130.500 23.618  -11.873 1.00 50.85  ? 98  VAL F CA    1 
ATOM 8243  C C     . VAL H 4 61  ? 130.864 23.933  -10.424 1.00 51.94  ? 98  VAL F C     1 
ATOM 8244  O O     . VAL H 4 61  ? 130.090 24.573  -9.713  1.00 57.15  ? 98  VAL F O     1 
ATOM 8245  C CB    . VAL H 4 61  ? 131.589 24.177  -12.787 1.00 48.58  ? 98  VAL F CB    1 
ATOM 8246  C CG1   . VAL H 4 61  ? 131.309 23.788  -14.220 1.00 48.78  ? 98  VAL F CG1   1 
ATOM 8247  C CG2   . VAL H 4 61  ? 131.647 25.692  -12.646 1.00 46.56  ? 98  VAL F CG2   1 
ATOM 8248  N N     . THR H 4 62  ? 132.037 23.495  -9.978  1.00 93.99  ? 99  THR F N     1 
ATOM 8249  C CA    . THR H 4 62  ? 132.428 23.771  -8.600  1.00 95.92  ? 99  THR F CA    1 
ATOM 8250  C C     . THR H 4 62  ? 133.556 24.786  -8.495  1.00 97.45  ? 99  THR F C     1 
ATOM 8251  O O     . THR H 4 62  ? 134.538 24.734  -9.238  1.00 113.38 ? 99  THR F O     1 
ATOM 8252  C CB    . THR H 4 62  ? 132.850 22.487  -7.849  1.00 107.40 ? 99  THR F CB    1 
ATOM 8253  O OG1   . THR H 4 62  ? 132.959 22.766  -6.444  1.00 109.32 ? 99  THR F OG1   1 
ATOM 8254  C CG2   . THR H 4 62  ? 134.191 21.984  -8.369  1.00 107.07 ? 99  THR F CG2   1 
ATOM 8255  N N     . ASN H 4 63  ? 133.383 25.719  -7.565  1.00 85.15  ? 100 ASN F N     1 
ATOM 8256  C CA    . ASN H 4 63  ? 134.363 26.764  -7.309  1.00 83.79  ? 100 ASN F CA    1 
ATOM 8257  C C     . ASN H 4 63  ? 135.602 26.127  -6.686  1.00 84.08  ? 100 ASN F C     1 
ATOM 8258  O O     . ASN H 4 63  ? 135.533 25.545  -5.603  1.00 68.42  ? 100 ASN F O     1 
ATOM 8259  C CB    . ASN H 4 63  ? 133.780 27.788  -6.340  1.00 72.32  ? 100 ASN F CB    1 
ATOM 8260  C CG    . ASN H 4 63  ? 134.642 29.018  -6.211  1.00 73.06  ? 100 ASN F CG    1 
ATOM 8261  O OD1   . ASN H 4 63  ? 134.659 29.672  -5.166  1.00 74.70  ? 100 ASN F OD1   1 
ATOM 8262  N ND2   . ASN H 4 63  ? 135.354 29.354  -7.284  1.00 73.92  ? 100 ASN F ND2   1 
ATOM 8263  N N     . GLY H 4 64  ? 136.736 26.231  -7.364  1.00 62.79  ? 101 GLY F N     1 
ATOM 8264  C CA    . GLY H 4 64  ? 137.942 25.641  -6.820  1.00 64.96  ? 101 GLY F CA    1 
ATOM 8265  C C     . GLY H 4 64  ? 139.093 25.570  -7.800  1.00 65.25  ? 101 GLY F C     1 
ATOM 8266  O O     . GLY H 4 64  ? 139.198 26.393  -8.713  1.00 75.73  ? 101 GLY F O     1 
ATOM 8267  N N     . LYS H 4 65  ? 139.957 24.577  -7.608  1.00 78.39  ? 102 LYS F N     1 
ATOM 8268  C CA    . LYS H 4 65  ? 141.115 24.400  -8.470  1.00 77.00  ? 102 LYS F CA    1 
ATOM 8269  C C     . LYS H 4 65  ? 140.826 23.485  -9.661  1.00 78.74  ? 102 LYS F C     1 
ATOM 8270  O O     . LYS H 4 65  ? 140.932 23.912  -10.817 1.00 94.02  ? 102 LYS F O     1 
ATOM 8271  C CB    . LYS H 4 65  ? 142.305 23.881  -7.644  1.00 85.63  ? 102 LYS F CB    1 
ATOM 8272  C CG    . LYS H 4 65  ? 142.165 22.483  -7.048  1.00 85.50  ? 102 LYS F CG    1 
ATOM 8273  C CD    . LYS H 4 65  ? 142.850 21.432  -7.918  1.00 81.62  ? 102 LYS F CD    1 
ATOM 8274  C CE    . LYS H 4 65  ? 143.107 20.158  -7.135  1.00 82.85  ? 102 LYS F CE    1 
ATOM 8275  N NZ    . LYS H 4 65  ? 144.002 20.401  -5.967  1.00 82.89  ? 102 LYS F NZ    1 
ATOM 8276  N N     . ASN H 4 66  ? 140.462 22.235  -9.392  1.00 122.68 ? 103 ASN F N     1 
ATOM 8277  C CA    . ASN H 4 66  ? 140.153 21.310  -10.476 1.00 121.92 ? 103 ASN F CA    1 
ATOM 8278  C C     . ASN H 4 66  ? 138.658 21.447  -10.779 1.00 118.06 ? 103 ASN F C     1 
ATOM 8279  O O     . ASN H 4 66  ? 137.824 20.735  -10.210 1.00 49.70  ? 103 ASN F O     1 
ATOM 8280  C CB    . ASN H 4 66  ? 140.496 19.864  -10.083 1.00 60.28  ? 103 ASN F CB    1 
ATOM 8281  C CG    . ASN H 4 66  ? 140.872 19.007  -11.287 1.00 61.16  ? 103 ASN F CG    1 
ATOM 8282  O OD1   . ASN H 4 66  ? 142.009 19.042  -11.759 1.00 62.09  ? 103 ASN F OD1   1 
ATOM 8283  N ND2   . ASN H 4 66  ? 139.911 18.253  -11.799 1.00 62.42  ? 103 ASN F ND2   1 
ATOM 8284  N N     . ILE H 4 67  ? 138.339 22.388  -11.667 1.00 99.69  ? 104 ILE F N     1 
ATOM 8285  C CA    . ILE H 4 67  ? 136.965 22.679  -12.075 1.00 98.44  ? 104 ILE F CA    1 
ATOM 8286  C C     . ILE H 4 67  ? 136.181 21.383  -12.321 1.00 99.82  ? 104 ILE F C     1 
ATOM 8287  O O     . ILE H 4 67  ? 136.514 20.627  -13.233 1.00 63.35  ? 104 ILE F O     1 
ATOM 8288  C CB    . ILE H 4 67  ? 136.956 23.541  -13.371 1.00 29.78  ? 104 ILE F CB    1 
ATOM 8289  C CG1   . ILE H 4 67  ? 138.065 24.598  -13.311 1.00 24.17  ? 104 ILE F CG1   1 
ATOM 8290  C CG2   . ILE H 4 67  ? 135.612 24.231  -13.533 1.00 29.53  ? 104 ILE F CG2   1 
ATOM 8291  C CD1   . ILE H 4 67  ? 137.890 25.614  -12.230 1.00 20.83  ? 104 ILE F CD1   1 
ATOM 8292  N N     . HIS H 4 68  ? 135.156 21.123  -11.505 1.00 99.37  ? 105 HIS F N     1 
ATOM 8293  C CA    . HIS H 4 68  ? 134.341 19.912  -11.658 1.00 100.75 ? 105 HIS F CA    1 
ATOM 8294  C C     . HIS H 4 68  ? 132.838 20.181  -11.587 1.00 103.56 ? 105 HIS F C     1 
ATOM 8295  O O     . HIS H 4 68  ? 132.406 21.316  -11.377 1.00 105.36 ? 105 HIS F O     1 
ATOM 8296  C CB    . HIS H 4 68  ? 134.726 18.860  -10.610 1.00 95.35  ? 105 HIS F CB    1 
ATOM 8297  C CG    . HIS H 4 68  ? 135.668 17.810  -11.120 1.00 95.70  ? 105 HIS F CG    1 
ATOM 8298  N ND1   . HIS H 4 68  ? 135.846 16.599  -10.486 1.00 95.44  ? 105 HIS F ND1   1 
ATOM 8299  C CD2   . HIS H 4 68  ? 136.485 17.791  -12.201 1.00 95.28  ? 105 HIS F CD2   1 
ATOM 8300  C CE1   . HIS H 4 68  ? 136.730 15.879  -11.155 1.00 94.90  ? 105 HIS F CE1   1 
ATOM 8301  N NE2   . HIS H 4 68  ? 137.133 16.580  -12.199 1.00 93.29  ? 105 HIS F NE2   1 
ATOM 8302  N N     . LEU H 4 69  ? 132.040 19.133  -11.769 1.00 93.50  ? 106 LEU F N     1 
ATOM 8303  C CA    . LEU H 4 69  ? 130.598 19.308  -11.741 1.00 92.81  ? 106 LEU F CA    1 
ATOM 8304  C C     . LEU H 4 69  ? 130.043 19.347  -10.328 1.00 92.01  ? 106 LEU F C     1 
ATOM 8305  O O     . LEU H 4 69  ? 130.424 18.546  -9.464  1.00 77.28  ? 106 LEU F O     1 
ATOM 8306  C CB    . LEU H 4 69  ? 129.907 18.228  -12.586 1.00 69.66  ? 106 LEU F CB    1 
ATOM 8307  C CG    . LEU H 4 69  ? 130.114 16.731  -12.360 1.00 69.73  ? 106 LEU F CG    1 
ATOM 8308  C CD1   . LEU H 4 69  ? 129.181 16.230  -11.262 1.00 71.66  ? 106 LEU F CD1   1 
ATOM 8309  C CD2   . LEU H 4 69  ? 129.815 16.005  -13.671 1.00 70.57  ? 106 LEU F CD2   1 
ATOM 8310  N N     . HIS H 4 70  ? 129.149 20.308  -10.106 1.00 93.42  ? 107 HIS F N     1 
ATOM 8311  C CA    . HIS H 4 70  ? 128.518 20.514  -8.810  1.00 93.00  ? 107 HIS F CA    1 
ATOM 8312  C C     . HIS H 4 70  ? 127.165 19.801  -8.767  1.00 90.95  ? 107 HIS F C     1 
ATOM 8313  O O     . HIS H 4 70  ? 126.423 19.789  -9.756  1.00 76.22  ? 107 HIS F O     1 
ATOM 8314  C CB    . HIS H 4 70  ? 128.346 22.015  -8.571  1.00 74.81  ? 107 HIS F CB    1 
ATOM 8315  C CG    . HIS H 4 70  ? 128.502 22.424  -7.141  1.00 76.09  ? 107 HIS F CG    1 
ATOM 8316  N ND1   . HIS H 4 70  ? 127.526 22.215  -6.194  1.00 75.71  ? 107 HIS F ND1   1 
ATOM 8317  C CD2   . HIS H 4 70  ? 129.532 23.026  -6.494  1.00 76.45  ? 107 HIS F CD2   1 
ATOM 8318  C CE1   . HIS H 4 70  ? 127.942 22.671  -5.026  1.00 74.34  ? 107 HIS F CE1   1 
ATOM 8319  N NE2   . HIS H 4 70  ? 129.158 23.167  -5.181  1.00 73.02  ? 107 HIS F NE2   1 
ATOM 8320  N N     . ALA H 4 71  ? 126.858 19.214  -7.612  1.00 97.29  ? 108 ALA F N     1 
ATOM 8321  C CA    . ALA H 4 71  ? 125.619 18.475  -7.398  1.00 96.19  ? 108 ALA F CA    1 
ATOM 8322  C C     . ALA H 4 71  ? 124.346 19.270  -7.691  1.00 95.73  ? 108 ALA F C     1 
ATOM 8323  O O     . ALA H 4 71  ? 123.458 18.780  -8.387  1.00 71.21  ? 108 ALA F O     1 
ATOM 8324  C CB    . ALA H 4 71  ? 125.587 17.939  -5.961  1.00 63.41  ? 108 ALA F CB    1 
ATOM 8325  N N     . HIS H 4 72  ? 124.250 20.486  -7.160  1.00 112.42 ? 109 HIS F N     1 
ATOM 8326  C CA    . HIS H 4 72  ? 123.063 21.312  -7.381  1.00 112.38 ? 109 HIS F CA    1 
ATOM 8327  C C     . HIS H 4 72  ? 122.690 21.308  -8.849  1.00 110.80 ? 109 HIS F C     1 
ATOM 8328  O O     . HIS H 4 72  ? 123.540 21.094  -9.717  1.00 61.51  ? 109 HIS F O     1 
ATOM 8329  C CB    . HIS H 4 72  ? 123.306 22.756  -6.958  1.00 52.04  ? 109 HIS F CB    1 
ATOM 8330  C CG    . HIS H 4 72  ? 123.829 22.894  -5.568  1.00 52.14  ? 109 HIS F CG    1 
ATOM 8331  N ND1   . HIS H 4 72  ? 124.186 24.110  -5.030  1.00 51.26  ? 109 HIS F ND1   1 
ATOM 8332  C CD2   . HIS H 4 72  ? 124.081 21.966  -4.613  1.00 51.77  ? 109 HIS F CD2   1 
ATOM 8333  C CE1   . HIS H 4 72  ? 124.640 23.926  -3.804  1.00 50.79  ? 109 HIS F CE1   1 
ATOM 8334  N NE2   . HIS H 4 72  ? 124.588 22.634  -3.526  1.00 51.42  ? 109 HIS F NE2   1 
ATOM 8335  N N     . SER H 4 73  ? 121.415 21.542  -9.129  1.00 62.78  ? 110 SER F N     1 
ATOM 8336  C CA    . SER H 4 73  ? 120.971 21.576  -10.507 1.00 61.25  ? 110 SER F CA    1 
ATOM 8337  C C     . SER H 4 73  ? 120.410 22.941  -10.867 1.00 59.74  ? 110 SER F C     1 
ATOM 8338  O O     . SER H 4 73  ? 119.562 23.486  -10.151 1.00 79.24  ? 110 SER F O     1 
ATOM 8339  C CB    . SER H 4 73  ? 119.905 20.507  -10.760 1.00 83.38  ? 110 SER F CB    1 
ATOM 8340  O OG    . SER H 4 73  ? 119.398 20.606  -12.087 1.00 83.17  ? 110 SER F OG    1 
ATOM 8341  N N     . LEU H 4 74  ? 120.889 23.502  -11.973 1.00 40.43  ? 111 LEU F N     1 
ATOM 8342  C CA    . LEU H 4 74  ? 120.377 24.790  -12.413 1.00 40.39  ? 111 LEU F CA    1 
ATOM 8343  C C     . LEU H 4 74  ? 119.021 24.589  -13.084 1.00 41.31  ? 111 LEU F C     1 
ATOM 8344  O O     . LEU H 4 74  ? 118.920 24.382  -14.291 1.00 54.87  ? 111 LEU F O     1 
ATOM 8345  C CB    . LEU H 4 74  ? 121.366 25.492  -13.353 1.00 55.01  ? 111 LEU F CB    1 
ATOM 8346  C CG    . LEU H 4 74  ? 122.136 24.773  -14.462 1.00 54.45  ? 111 LEU F CG    1 
ATOM 8347  C CD1   . LEU H 4 74  ? 121.236 24.369  -15.617 1.00 53.52  ? 111 LEU F CD1   1 
ATOM 8348  C CD2   . LEU H 4 74  ? 123.201 25.729  -14.957 1.00 55.17  ? 111 LEU F CD2   1 
ATOM 8349  N N     . VAL H 4 75  ? 117.979 24.639  -12.263 1.00 88.38  ? 112 VAL F N     1 
ATOM 8350  C CA    . VAL H 4 75  ? 116.601 24.465  -12.708 1.00 87.23  ? 112 VAL F CA    1 
ATOM 8351  C C     . VAL H 4 75  ? 116.042 25.763  -13.282 1.00 88.31  ? 112 VAL F C     1 
ATOM 8352  O O     . VAL H 4 75  ? 116.120 26.805  -12.642 1.00 56.59  ? 112 VAL F O     1 
ATOM 8353  C CB    . VAL H 4 75  ? 115.715 24.046  -11.519 1.00 56.40  ? 112 VAL F CB    1 
ATOM 8354  C CG1   . VAL H 4 75  ? 114.306 23.693  -11.999 1.00 51.11  ? 112 VAL F CG1   1 
ATOM 8355  C CG2   . VAL H 4 75  ? 116.374 22.885  -10.778 1.00 51.97  ? 112 VAL F CG2   1 
ATOM 8356  N N     . GLY H 4 76  ? 115.468 25.702  -14.479 1.00 104.36 ? 113 GLY F N     1 
ATOM 8357  C CA    . GLY H 4 76  ? 114.904 26.900  -15.075 1.00 106.17 ? 113 GLY F CA    1 
ATOM 8358  C C     . GLY H 4 76  ? 113.895 26.626  -16.174 1.00 106.31 ? 113 GLY F C     1 
ATOM 8359  O O     . GLY H 4 76  ? 112.893 25.931  -15.983 1.00 52.67  ? 113 GLY F O     1 
ATOM 8360  N N     . LYS H 4 77  ? 114.160 27.193  -17.339 1.00 66.01  ? 114 LYS F N     1 
ATOM 8361  C CA    . LYS H 4 77  ? 113.290 27.019  -18.487 1.00 67.05  ? 114 LYS F CA    1 
ATOM 8362  C C     . LYS H 4 77  ? 113.800 25.863  -19.337 1.00 67.82  ? 114 LYS F C     1 
ATOM 8363  O O     . LYS H 4 77  ? 113.394 24.714  -19.162 1.00 61.26  ? 114 LYS F O     1 
ATOM 8364  C CB    . LYS H 4 77  ? 113.252 28.311  -19.312 1.00 67.07  ? 114 LYS F CB    1 
ATOM 8365  C CG    . LYS H 4 77  ? 114.597 29.037  -19.435 1.00 65.99  ? 114 LYS F CG    1 
ATOM 8366  C CD    . LYS H 4 77  ? 115.030 29.705  -18.120 1.00 65.77  ? 114 LYS F CD    1 
ATOM 8367  C CE    . LYS H 4 77  ? 116.287 30.563  -18.294 1.00 62.75  ? 114 LYS F CE    1 
ATOM 8368  N NZ    . LYS H 4 77  ? 116.102 31.684  -19.275 1.00 59.99  ? 114 LYS F NZ    1 
ATOM 8369  N N     . HIS H 4 78  ? 114.706 26.175  -20.254 1.00 61.17  ? 115 HIS F N     1 
ATOM 8370  C CA    . HIS H 4 78  ? 115.283 25.166  -21.132 1.00 63.57  ? 115 HIS F CA    1 
ATOM 8371  C C     . HIS H 4 78  ? 116.067 24.123  -20.346 1.00 65.72  ? 115 HIS F C     1 
ATOM 8372  O O     . HIS H 4 78  ? 116.458 23.082  -20.881 1.00 116.02 ? 115 HIS F O     1 
ATOM 8373  C CB    . HIS H 4 78  ? 116.195 25.829  -22.181 1.00 113.89 ? 115 HIS F CB    1 
ATOM 8374  C CG    . HIS H 4 78  ? 116.631 27.220  -21.830 1.00 113.89 ? 115 HIS F CG    1 
ATOM 8375  N ND1   . HIS H 4 78  ? 117.461 27.499  -20.766 1.00 113.89 ? 115 HIS F ND1   1 
ATOM 8376  C CD2   . HIS H 4 78  ? 116.351 28.413  -22.409 1.00 113.89 ? 115 HIS F CD2   1 
ATOM 8377  C CE1   . HIS H 4 78  ? 117.674 28.802  -20.704 1.00 113.89 ? 115 HIS F CE1   1 
ATOM 8378  N NE2   . HIS H 4 78  ? 117.011 29.379  -21.690 1.00 113.89 ? 115 HIS F NE2   1 
ATOM 8379  N N     . CYS H 4 79  ? 116.293 24.417  -19.070 1.00 90.17  ? 116 CYS F N     1 
ATOM 8380  C CA    . CYS H 4 79  ? 117.033 23.518  -18.195 1.00 92.09  ? 116 CYS F CA    1 
ATOM 8381  C C     . CYS H 4 79  ? 116.302 22.193  -18.067 1.00 91.91  ? 116 CYS F C     1 
ATOM 8382  O O     . CYS H 4 79  ? 115.107 22.091  -18.342 1.00 76.07  ? 116 CYS F O     1 
ATOM 8383  C CB    . CYS H 4 79  ? 117.177 24.097  -16.775 1.00 84.34  ? 116 CYS F CB    1 
ATOM 8384  S SG    . CYS H 4 79  ? 118.073 25.665  -16.485 1.00 89.41  ? 116 CYS F SG    1 
ATOM 8385  N N     . GLU H 4 80  ? 117.049 21.190  -17.626 1.00 105.29 ? 117 GLU F N     1 
ATOM 8386  C CA    . GLU H 4 80  ? 116.546 19.847  -17.380 1.00 105.67 ? 117 GLU F CA    1 
ATOM 8387  C C     . GLU H 4 80  ? 117.778 19.005  -17.065 1.00 106.15 ? 117 GLU F C     1 
ATOM 8388  O O     . GLU H 4 80  ? 118.674 18.856  -17.895 1.00 84.77  ? 117 GLU F O     1 
ATOM 8389  C CB    . GLU H 4 80  ? 115.773 19.313  -18.595 1.00 91.00  ? 117 GLU F CB    1 
ATOM 8390  C CG    . GLU H 4 80  ? 114.465 18.591  -18.226 1.00 87.21  ? 117 GLU F CG    1 
ATOM 8391  C CD    . GLU H 4 80  ? 113.562 19.398  -17.275 1.00 84.37  ? 117 GLU F CD    1 
ATOM 8392  O OE1   . GLU H 4 80  ? 113.942 19.577  -16.096 1.00 83.30  ? 117 GLU F OE1   1 
ATOM 8393  O OE2   . GLU H 4 80  ? 112.470 19.849  -17.701 1.00 80.71  ? 117 GLU F OE2   1 
ATOM 8394  N N     . ASP H 4 81  ? 117.835 18.492  -15.839 1.00 112.38 ? 118 ASP F N     1 
ATOM 8395  C CA    . ASP H 4 81  ? 118.970 17.691  -15.401 1.00 112.21 ? 118 ASP F CA    1 
ATOM 8396  C C     . ASP H 4 81  ? 120.141 18.647  -15.137 1.00 113.74 ? 118 ASP F C     1 
ATOM 8397  O O     . ASP H 4 81  ? 121.276 18.221  -14.913 1.00 93.55  ? 118 ASP F O     1 
ATOM 8398  C CB    . ASP H 4 81  ? 119.338 16.673  -16.487 1.00 86.97  ? 118 ASP F CB    1 
ATOM 8399  C CG    . ASP H 4 81  ? 118.108 16.052  -17.143 1.00 85.61  ? 118 ASP F CG    1 
ATOM 8400  O OD1   . ASP H 4 81  ? 118.256 15.395  -18.199 1.00 85.09  ? 118 ASP F OD1   1 
ATOM 8401  O OD2   . ASP H 4 81  ? 116.994 16.224  -16.600 1.00 85.76  ? 118 ASP F OD2   1 
ATOM 8402  N N     . GLY H 4 82  ? 119.848 19.946  -15.177 1.00 77.42  ? 119 GLY F N     1 
ATOM 8403  C CA    . GLY H 4 82  ? 120.859 20.955  -14.924 1.00 78.99  ? 119 GLY F CA    1 
ATOM 8404  C C     . GLY H 4 82  ? 121.724 21.397  -16.093 1.00 79.54  ? 119 GLY F C     1 
ATOM 8405  O O     . GLY H 4 82  ? 122.890 21.742  -15.889 1.00 82.33  ? 119 GLY F O     1 
ATOM 8406  N N     . VAL H 4 83  ? 121.187 21.396  -17.311 1.00 80.28  ? 120 VAL F N     1 
ATOM 8407  C CA    . VAL H 4 83  ? 121.972 21.836  -18.473 1.00 80.31  ? 120 VAL F CA    1 
ATOM 8408  C C     . VAL H 4 83  ? 121.183 22.729  -19.425 1.00 80.39  ? 120 VAL F C     1 
ATOM 8409  O O     . VAL H 4 83  ? 121.101 22.464  -20.628 1.00 96.34  ? 120 VAL F O     1 
ATOM 8410  C CB    . VAL H 4 83  ? 122.560 20.643  -19.289 1.00 89.69  ? 120 VAL F CB    1 
ATOM 8411  C CG1   . VAL H 4 83  ? 123.764 20.056  -18.560 1.00 88.89  ? 120 VAL F CG1   1 
ATOM 8412  C CG2   . VAL H 4 83  ? 121.500 19.580  -19.511 1.00 91.82  ? 120 VAL F CG2   1 
ATOM 8413  N N     . CYS H 4 84  ? 120.603 23.788  -18.866 1.00 84.31  ? 121 CYS F N     1 
ATOM 8414  C CA    . CYS H 4 84  ? 119.828 24.752  -19.636 1.00 82.74  ? 121 CYS F CA    1 
ATOM 8415  C C     . CYS H 4 84  ? 120.460 24.949  -20.990 1.00 83.21  ? 121 CYS F C     1 
ATOM 8416  O O     . CYS H 4 84  ? 121.609 25.375  -21.095 1.00 93.32  ? 121 CYS F O     1 
ATOM 8417  C CB    . CYS H 4 84  ? 119.797 26.094  -18.927 1.00 86.51  ? 121 CYS F CB    1 
ATOM 8418  S SG    . CYS H 4 84  ? 118.174 26.580  -18.292 1.00 81.71  ? 121 CYS F SG    1 
ATOM 8419  N N     . THR H 4 85  ? 119.704 24.637  -22.030 1.00 102.99 ? 122 THR F N     1 
ATOM 8420  C CA    . THR H 4 85  ? 120.209 24.789  -23.380 1.00 103.50 ? 122 THR F CA    1 
ATOM 8421  C C     . THR H 4 85  ? 119.465 25.911  -24.102 1.00 103.85 ? 122 THR F C     1 
ATOM 8422  O O     . THR H 4 85  ? 118.242 25.872  -24.238 1.00 96.06  ? 122 THR F O     1 
ATOM 8423  C CB    . THR H 4 85  ? 120.053 23.478  -24.177 1.00 92.24  ? 122 THR F CB    1 
ATOM 8424  O OG1   . THR H 4 85  ? 120.437 22.369  -23.351 1.00 92.61  ? 122 THR F OG1   1 
ATOM 8425  C CG2   . THR H 4 85  ? 120.947 23.500  -25.409 1.00 89.37  ? 122 THR F CG2   1 
ATOM 8426  N N     . VAL H 4 86  ? 120.215 26.917  -24.547 1.00 64.28  ? 123 VAL F N     1 
ATOM 8427  C CA    . VAL H 4 86  ? 119.647 28.055  -25.272 1.00 63.66  ? 123 VAL F CA    1 
ATOM 8428  C C     . VAL H 4 86  ? 120.117 28.036  -26.719 1.00 62.75  ? 123 VAL F C     1 
ATOM 8429  O O     . VAL H 4 86  ? 121.286 27.764  -27.002 1.00 73.64  ? 123 VAL F O     1 
ATOM 8430  C CB    . VAL H 4 86  ? 120.065 29.432  -24.655 1.00 82.52  ? 123 VAL F CB    1 
ATOM 8431  C CG1   . VAL H 4 86  ? 119.663 29.492  -23.197 1.00 83.40  ? 123 VAL F CG1   1 
ATOM 8432  C CG2   . VAL H 4 86  ? 121.568 29.664  -24.807 1.00 81.40  ? 123 VAL F CG2   1 
ATOM 8433  N N     . THR H 4 87  ? 119.194 28.332  -27.628 1.00 96.06  ? 124 THR F N     1 
ATOM 8434  C CA    . THR H 4 87  ? 119.482 28.361  -29.061 1.00 94.30  ? 124 THR F CA    1 
ATOM 8435  C C     . THR H 4 87  ? 119.832 29.782  -29.499 1.00 95.77  ? 124 THR F C     1 
ATOM 8436  O O     . THR H 4 87  ? 118.960 30.529  -29.947 1.00 100.94 ? 124 THR F O     1 
ATOM 8437  C CB    . THR H 4 87  ? 118.254 27.888  -29.873 1.00 86.77  ? 124 THR F CB    1 
ATOM 8438  O OG1   . THR H 4 87  ? 117.832 26.601  -29.400 1.00 83.48  ? 124 THR F OG1   1 
ATOM 8439  C CG2   . THR H 4 87  ? 118.592 27.803  -31.356 1.00 86.36  ? 124 THR F CG2   1 
ATOM 8440  N N     . ALA H 4 88  ? 121.104 30.152  -29.365 1.00 106.68 ? 125 ALA F N     1 
ATOM 8441  C CA    . ALA H 4 88  ? 121.559 31.488  -29.742 1.00 107.19 ? 125 ALA F CA    1 
ATOM 8442  C C     . ALA H 4 88  ? 121.006 31.884  -31.113 1.00 107.48 ? 125 ALA F C     1 
ATOM 8443  O O     . ALA H 4 88  ? 121.430 31.351  -32.143 1.00 102.27 ? 125 ALA F O     1 
ATOM 8444  C CB    . ALA H 4 88  ? 123.088 31.537  -29.750 1.00 92.82  ? 125 ALA F CB    1 
ATOM 8445  N N     . GLY H 4 89  ? 120.055 32.817  -31.114 1.00 85.72  ? 126 GLY F N     1 
ATOM 8446  C CA    . GLY H 4 89  ? 119.455 33.265  -32.357 1.00 85.73  ? 126 GLY F CA    1 
ATOM 8447  C C     . GLY H 4 89  ? 120.481 33.678  -33.396 1.00 85.88  ? 126 GLY F C     1 
ATOM 8448  O O     . GLY H 4 89  ? 121.631 33.952  -33.050 1.00 110.22 ? 126 GLY F O     1 
ATOM 8449  N N     . PRO H 4 90  ? 120.101 33.711  -34.685 1.00 115.43 ? 127 PRO F N     1 
ATOM 8450  C CA    . PRO H 4 90  ? 120.997 34.096  -35.786 1.00 114.49 ? 127 PRO F CA    1 
ATOM 8451  C C     . PRO H 4 90  ? 121.252 35.604  -35.814 1.00 113.55 ? 127 PRO F C     1 
ATOM 8452  O O     . PRO H 4 90  ? 120.401 36.388  -35.384 1.00 86.95  ? 127 PRO F O     1 
ATOM 8453  C CB    . PRO H 4 90  ? 120.244 33.621  -37.028 1.00 88.08  ? 127 PRO F CB    1 
ATOM 8454  C CG    . PRO H 4 90  ? 119.392 32.489  -36.503 1.00 87.74  ? 127 PRO F CG    1 
ATOM 8455  C CD    . PRO H 4 90  ? 118.892 33.055  -35.209 1.00 88.51  ? 127 PRO F CD    1 
ATOM 8456  N N     . LYS H 4 91  ? 122.420 35.996  -36.328 1.00 93.69  ? 128 LYS F N     1 
ATOM 8457  C CA    . LYS H 4 91  ? 122.826 37.404  -36.408 1.00 92.37  ? 128 LYS F CA    1 
ATOM 8458  C C     . LYS H 4 91  ? 123.069 37.990  -35.020 1.00 92.38  ? 128 LYS F C     1 
ATOM 8459  O O     . LYS H 4 91  ? 124.106 38.609  -34.773 1.00 106.79 ? 128 LYS F O     1 
ATOM 8460  C CB    . LYS H 4 91  ? 121.767 38.242  -37.135 1.00 100.14 ? 128 LYS F CB    1 
ATOM 8461  C CG    . LYS H 4 91  ? 121.989 39.764  -37.071 1.00 95.46  ? 128 LYS F CG    1 
ATOM 8462  C CD    . LYS H 4 91  ? 123.243 40.213  -37.821 1.00 93.67  ? 128 LYS F CD    1 
ATOM 8463  C CE    . LYS H 4 91  ? 124.470 40.314  -36.923 1.00 91.79  ? 128 LYS F CE    1 
ATOM 8464  N NZ    . LYS H 4 91  ? 124.366 41.450  -35.964 1.00 88.10  ? 128 LYS F NZ    1 
ATOM 8465  N N     . ASP H 4 92  ? 122.106 37.805  -34.120 1.00 112.15 ? 129 ASP F N     1 
ATOM 8466  C CA    . ASP H 4 92  ? 122.224 38.303  -32.752 1.00 113.14 ? 129 ASP F CA    1 
ATOM 8467  C C     . ASP H 4 92  ? 122.954 37.265  -31.890 1.00 115.30 ? 129 ASP F C     1 
ATOM 8468  O O     . ASP H 4 92  ? 122.342 36.332  -31.359 1.00 116.20 ? 129 ASP F O     1 
ATOM 8469  C CB    . ASP H 4 92  ? 120.832 38.597  -32.161 1.00 107.20 ? 129 ASP F CB    1 
ATOM 8470  C CG    . ASP H 4 92  ? 120.152 39.808  -32.808 1.00 104.53 ? 129 ASP F CG    1 
ATOM 8471  O OD1   . ASP H 4 92  ? 119.002 40.120  -32.418 1.00 102.53 ? 129 ASP F OD1   1 
ATOM 8472  O OD2   . ASP H 4 92  ? 120.761 40.444  -33.697 1.00 104.71 ? 129 ASP F OD2   1 
ATOM 8473  N N     . MET H 4 93  ? 124.267 37.432  -31.763 1.00 101.13 ? 130 MET F N     1 
ATOM 8474  C CA    . MET H 4 93  ? 125.089 36.514  -30.982 1.00 104.10 ? 130 MET F CA    1 
ATOM 8475  C C     . MET H 4 93  ? 125.054 36.815  -29.487 1.00 104.71 ? 130 MET F C     1 
ATOM 8476  O O     . MET H 4 93  ? 126.023 36.550  -28.774 1.00 91.78  ? 130 MET F O     1 
ATOM 8477  C CB    . MET H 4 93  ? 126.535 36.561  -31.487 1.00 100.99 ? 130 MET F CB    1 
ATOM 8478  C CG    . MET H 4 93  ? 127.112 37.969  -31.591 1.00 103.02 ? 130 MET F CG    1 
ATOM 8479  S SD    . MET H 4 93  ? 128.611 38.049  -32.618 1.00 105.47 ? 130 MET F SD    1 
ATOM 8480  C CE    . MET H 4 93  ? 127.903 38.384  -34.271 1.00 106.31 ? 130 MET F CE    1 
ATOM 8481  N N     . VAL H 4 94  ? 123.934 37.361  -29.019 1.00 124.65 ? 131 VAL F N     1 
ATOM 8482  C CA    . VAL H 4 94  ? 123.773 37.696  -27.605 1.00 124.65 ? 131 VAL F CA    1 
ATOM 8483  C C     . VAL H 4 94  ? 122.446 37.219  -26.999 1.00 124.65 ? 131 VAL F C     1 
ATOM 8484  O O     . VAL H 4 94  ? 121.430 37.920  -27.068 1.00 114.15 ? 131 VAL F O     1 
ATOM 8485  C CB    . VAL H 4 94  ? 123.893 39.227  -27.367 1.00 103.98 ? 131 VAL F CB    1 
ATOM 8486  C CG1   . VAL H 4 94  ? 125.331 39.674  -27.571 1.00 106.22 ? 131 VAL F CG1   1 
ATOM 8487  C CG2   . VAL H 4 94  ? 122.964 39.980  -28.314 1.00 102.01 ? 131 VAL F CG2   1 
ATOM 8488  N N     . VAL H 4 95  ? 122.458 36.025  -26.406 1.00 92.30  ? 132 VAL F N     1 
ATOM 8489  C CA    . VAL H 4 95  ? 121.260 35.479  -25.765 1.00 89.61  ? 132 VAL F CA    1 
ATOM 8490  C C     . VAL H 4 95  ? 121.501 35.329  -24.263 1.00 88.35  ? 132 VAL F C     1 
ATOM 8491  O O     . VAL H 4 95  ? 122.362 34.560  -23.824 1.00 69.21  ? 132 VAL F O     1 
ATOM 8492  C CB    . VAL H 4 95  ? 120.854 34.098  -26.359 1.00 72.38  ? 132 VAL F CB    1 
ATOM 8493  C CG1   . VAL H 4 95  ? 119.644 33.533  -25.605 1.00 72.53  ? 132 VAL F CG1   1 
ATOM 8494  C CG2   . VAL H 4 95  ? 120.526 34.245  -27.845 1.00 71.54  ? 132 VAL F CG2   1 
ATOM 8495  N N     . GLY H 4 96  ? 120.737 36.084  -23.480 1.00 93.36  ? 133 GLY F N     1 
ATOM 8496  C CA    . GLY H 4 96  ? 120.876 36.035  -22.036 1.00 93.08  ? 133 GLY F CA    1 
ATOM 8497  C C     . GLY H 4 96  ? 120.028 34.952  -21.400 1.00 93.30  ? 133 GLY F C     1 
ATOM 8498  O O     . GLY H 4 96  ? 119.155 34.373  -22.048 1.00 60.12  ? 133 GLY F O     1 
ATOM 8499  N N     . PHE H 4 97  ? 120.292 34.671  -20.128 1.00 87.75  ? 134 PHE F N     1 
ATOM 8500  C CA    . PHE H 4 97  ? 119.539 33.656  -19.397 1.00 86.34  ? 134 PHE F CA    1 
ATOM 8501  C C     . PHE H 4 97  ? 118.644 34.300  -18.344 1.00 86.01  ? 134 PHE F C     1 
ATOM 8502  O O     . PHE H 4 97  ? 119.119 34.737  -17.296 1.00 99.95  ? 134 PHE F O     1 
ATOM 8503  C CB    . PHE H 4 97  ? 120.489 32.654  -18.730 1.00 93.03  ? 134 PHE F CB    1 
ATOM 8504  C CG    . PHE H 4 97  ? 121.191 31.750  -19.699 1.00 93.68  ? 134 PHE F CG    1 
ATOM 8505  C CD1   . PHE H 4 97  ? 121.637 30.497  -19.300 1.00 93.40  ? 134 PHE F CD1   1 
ATOM 8506  C CD2   . PHE H 4 97  ? 121.403 32.150  -21.017 1.00 95.70  ? 134 PHE F CD2   1 
ATOM 8507  C CE1   . PHE H 4 97  ? 122.279 29.654  -20.201 1.00 95.32  ? 134 PHE F CE1   1 
ATOM 8508  C CE2   . PHE H 4 97  ? 122.045 31.316  -21.925 1.00 97.13  ? 134 PHE F CE2   1 
ATOM 8509  C CZ    . PHE H 4 97  ? 122.485 30.064  -21.516 1.00 96.88  ? 134 PHE F CZ    1 
ATOM 8510  N N     . ALA H 4 98  ? 117.348 34.357  -18.634 1.00 62.27  ? 135 ALA F N     1 
ATOM 8511  C CA    . ALA H 4 98  ? 116.373 34.956  -17.729 1.00 63.34  ? 135 ALA F CA    1 
ATOM 8512  C C     . ALA H 4 98  ? 116.384 34.327  -16.338 1.00 64.47  ? 135 ALA F C     1 
ATOM 8513  O O     . ALA H 4 98  ? 117.427 33.906  -15.836 1.00 65.39  ? 135 ALA F O     1 
ATOM 8514  C CB    . ALA H 4 98  ? 114.966 34.855  -18.335 1.00 59.23  ? 135 ALA F CB    1 
ATOM 8515  N N     . ASN H 4 99  ? 115.209 34.267  -15.720 1.00 86.68  ? 136 ASN F N     1 
ATOM 8516  C CA    . ASN H 4 99  ? 115.073 33.704  -14.385 1.00 87.02  ? 136 ASN F CA    1 
ATOM 8517  C C     . ASN H 4 99  ? 115.480 32.235  -14.360 1.00 88.43  ? 136 ASN F C     1 
ATOM 8518  O O     . ASN H 4 99  ? 114.696 31.349  -14.720 1.00 102.43 ? 136 ASN F O     1 
ATOM 8519  C CB    . ASN H 4 99  ? 113.632 33.865  -13.891 1.00 92.74  ? 136 ASN F CB    1 
ATOM 8520  C CG    . ASN H 4 99  ? 113.221 35.322  -13.739 1.00 93.78  ? 136 ASN F CG    1 
ATOM 8521  O OD1   . ASN H 4 99  ? 112.130 35.618  -13.249 1.00 93.27  ? 136 ASN F OD1   1 
ATOM 8522  N ND2   . ASN H 4 99  ? 114.090 36.238  -14.161 1.00 94.96  ? 136 ASN F ND2   1 
ATOM 8523  N N     . LEU H 4 100 ? 116.720 31.987  -13.943 1.00 125.14 ? 137 LEU F N     1 
ATOM 8524  C CA    . LEU H 4 100 ? 117.237 30.625  -13.864 1.00 125.14 ? 137 LEU F CA    1 
ATOM 8525  C C     . LEU H 4 100 ? 116.842 29.959  -12.550 1.00 125.14 ? 137 LEU F C     1 
ATOM 8526  O O     . LEU H 4 100 ? 115.938 29.125  -12.530 1.00 99.24  ? 137 LEU F O     1 
ATOM 8527  C CB    . LEU H 4 100 ? 118.768 30.602  -14.028 1.00 87.82  ? 137 LEU F CB    1 
ATOM 8528  C CG    . LEU H 4 100 ? 119.328 30.261  -15.419 1.00 85.89  ? 137 LEU F CG    1 
ATOM 8529  C CD1   . LEU H 4 100 ? 120.856 30.313  -15.402 1.00 81.52  ? 137 LEU F CD1   1 
ATOM 8530  C CD2   . LEU H 4 100 ? 118.851 28.871  -15.835 1.00 83.26  ? 137 LEU F CD2   1 
ATOM 8531  N N     . GLY H 4 101 ? 117.504 30.340  -11.457 1.00 80.43  ? 138 GLY F N     1 
ATOM 8532  C CA    . GLY H 4 101 ? 117.207 29.745  -10.165 1.00 80.17  ? 138 GLY F CA    1 
ATOM 8533  C C     . GLY H 4 101 ? 118.042 28.498  -9.932  1.00 80.86  ? 138 GLY F C     1 
ATOM 8534  O O     . GLY H 4 101 ? 118.091 27.603  -10.781 1.00 82.29  ? 138 GLY F O     1 
ATOM 8535  N N     . ILE H 4 102 ? 118.708 28.429  -8.784  1.00 72.82  ? 139 ILE F N     1 
ATOM 8536  C CA    . ILE H 4 102 ? 119.546 27.277  -8.472  1.00 73.31  ? 139 ILE F CA    1 
ATOM 8537  C C     . ILE H 4 102 ? 118.838 26.319  -7.534  1.00 75.18  ? 139 ILE F C     1 
ATOM 8538  O O     . ILE H 4 102 ? 118.118 26.738  -6.631  1.00 85.98  ? 139 ILE F O     1 
ATOM 8539  C CB    . ILE H 4 102 ? 120.889 27.705  -7.818  1.00 87.40  ? 139 ILE F CB    1 
ATOM 8540  C CG1   . ILE H 4 102 ? 121.745 28.492  -8.822  1.00 84.35  ? 139 ILE F CG1   1 
ATOM 8541  C CG2   . ILE H 4 102 ? 121.647 26.470  -7.328  1.00 86.77  ? 139 ILE F CG2   1 
ATOM 8542  C CD1   . ILE H 4 102 ? 121.190 29.859  -9.207  1.00 82.51  ? 139 ILE F CD1   1 
ATOM 8543  N N     . LEU H 4 103 ? 119.031 25.027  -7.754  1.00 84.51  ? 140 LEU F N     1 
ATOM 8544  C CA    . LEU H 4 103 ? 118.411 24.046  -6.881  1.00 85.98  ? 140 LEU F CA    1 
ATOM 8545  C C     . LEU H 4 103 ? 119.507 23.424  -6.026  1.00 87.34  ? 140 LEU F C     1 
ATOM 8546  O O     . LEU H 4 103 ? 120.560 23.033  -6.531  1.00 85.68  ? 140 LEU F O     1 
ATOM 8547  C CB    . LEU H 4 103 ? 117.675 22.971  -7.693  1.00 86.40  ? 140 LEU F CB    1 
ATOM 8548  C CG    . LEU H 4 103 ? 116.330 22.495  -7.113  1.00 85.09  ? 140 LEU F CG    1 
ATOM 8549  C CD1   . LEU H 4 103 ? 116.534 21.750  -5.799  1.00 85.13  ? 140 LEU F CD1   1 
ATOM 8550  C CD2   . LEU H 4 103 ? 115.422 23.699  -6.902  1.00 84.74  ? 140 LEU F CD2   1 
ATOM 8551  N N     . HIS H 4 104 ? 119.249 23.351  -4.726  1.00 88.90  ? 141 HIS F N     1 
ATOM 8552  C CA    . HIS H 4 104 ? 120.201 22.801  -3.770  1.00 89.43  ? 141 HIS F CA    1 
ATOM 8553  C C     . HIS H 4 104 ? 119.815 21.377  -3.334  1.00 88.38  ? 141 HIS F C     1 
ATOM 8554  O O     . HIS H 4 104 ? 118.706 21.151  -2.846  1.00 100.57 ? 141 HIS F O     1 
ATOM 8555  C CB    . HIS H 4 104 ? 120.279 23.746  -2.561  1.00 104.30 ? 141 HIS F CB    1 
ATOM 8556  C CG    . HIS H 4 104 ? 121.365 23.413  -1.585  1.00 108.15 ? 141 HIS F CG    1 
ATOM 8557  N ND1   . HIS H 4 104 ? 121.731 24.266  -0.569  1.00 109.13 ? 141 HIS F ND1   1 
ATOM 8558  C CD2   . HIS H 4 104 ? 122.157 22.321  -1.463  1.00 110.34 ? 141 HIS F CD2   1 
ATOM 8559  C CE1   . HIS H 4 104 ? 122.704 23.716  0.137   1.00 111.01 ? 141 HIS F CE1   1 
ATOM 8560  N NE2   . HIS H 4 104 ? 122.980 22.535  -0.384  1.00 110.96 ? 141 HIS F NE2   1 
ATOM 8561  N N     . VAL H 4 105 ? 120.718 20.412  -3.510  1.00 81.63  ? 142 VAL F N     1 
ATOM 8562  C CA    . VAL H 4 105 ? 120.416 19.031  -3.109  1.00 80.64  ? 142 VAL F CA    1 
ATOM 8563  C C     . VAL H 4 105 ? 120.935 18.743  -1.701  1.00 78.26  ? 142 VAL F C     1 
ATOM 8564  O O     . VAL H 4 105 ? 121.950 19.295  -1.287  1.00 85.27  ? 142 VAL F O     1 
ATOM 8565  C CB    . VAL H 4 105 ? 121.032 17.980  -4.093  1.00 88.40  ? 142 VAL F CB    1 
ATOM 8566  C CG1   . VAL H 4 105 ? 120.977 18.508  -5.521  1.00 88.28  ? 142 VAL F CG1   1 
ATOM 8567  C CG2   . VAL H 4 105 ? 122.458 17.624  -3.686  1.00 88.72  ? 142 VAL F CG2   1 
ATOM 8568  N N     . THR H 4 106 ? 120.242 17.877  -0.968  1.00 59.15  ? 143 THR F N     1 
ATOM 8569  C CA    . THR H 4 106 ? 120.671 17.536  0.389   1.00 56.63  ? 143 THR F CA    1 
ATOM 8570  C C     . THR H 4 106 ? 122.120 17.061  0.417   1.00 54.22  ? 143 THR F C     1 
ATOM 8571  O O     . THR H 4 106 ? 122.696 16.736  -0.619  1.00 58.17  ? 143 THR F O     1 
ATOM 8572  C CB    . THR H 4 106 ? 119.833 16.397  1.006   1.00 70.28  ? 143 THR F CB    1 
ATOM 8573  O OG1   . THR H 4 106 ? 118.440 16.613  0.742   1.00 70.58  ? 143 THR F OG1   1 
ATOM 8574  C CG2   . THR H 4 106 ? 120.067 16.339  2.523   1.00 70.33  ? 143 THR F CG2   1 
ATOM 8575  N N     . LYS H 4 107 ? 122.695 17.027  1.613   1.00 66.22  ? 144 LYS F N     1 
ATOM 8576  C CA    . LYS H 4 107 ? 124.066 16.570  1.803   1.00 64.24  ? 144 LYS F CA    1 
ATOM 8577  C C     . LYS H 4 107 ? 124.097 15.098  1.442   1.00 63.42  ? 144 LYS F C     1 
ATOM 8578  O O     . LYS H 4 107 ? 125.110 14.571  0.976   1.00 82.14  ? 144 LYS F O     1 
ATOM 8579  C CB    . LYS H 4 107 ? 124.486 16.723  3.270   1.00 83.25  ? 144 LYS F CB    1 
ATOM 8580  C CG    . LYS H 4 107 ? 125.757 15.955  3.637   1.00 81.63  ? 144 LYS F CG    1 
ATOM 8581  C CD    . LYS H 4 107 ? 126.057 16.011  5.132   1.00 77.76  ? 144 LYS F CD    1 
ATOM 8582  C CE    . LYS H 4 107 ? 127.345 15.265  5.469   1.00 75.15  ? 144 LYS F CE    1 
ATOM 8583  N NZ    . LYS H 4 107 ? 127.305 13.829  5.038   1.00 72.23  ? 144 LYS F NZ    1 
ATOM 8584  N N     . LYS H 4 108 ? 122.963 14.445  1.669   1.00 88.30  ? 145 LYS F N     1 
ATOM 8585  C CA    . LYS H 4 108 ? 122.813 13.022  1.404   1.00 86.91  ? 145 LYS F CA    1 
ATOM 8586  C C     . LYS H 4 108 ? 122.625 12.733  -0.086  1.00 87.65  ? 145 LYS F C     1 
ATOM 8587  O O     . LYS H 4 108 ? 122.991 11.665  -0.583  1.00 88.39  ? 145 LYS F O     1 
ATOM 8588  C CB    . LYS H 4 108 ? 121.615 12.476  2.198   1.00 61.52  ? 145 LYS F CB    1 
ATOM 8589  C CG    . LYS H 4 108 ? 120.272 13.094  1.836   1.00 55.73  ? 145 LYS F CG    1 
ATOM 8590  C CD    . LYS H 4 108 ? 119.165 12.570  2.739   1.00 52.94  ? 145 LYS F CD    1 
ATOM 8591  C CE    . LYS H 4 108 ? 117.790 13.155  2.381   1.00 48.92  ? 145 LYS F CE    1 
ATOM 8592  N NZ    . LYS H 4 108 ? 117.612 14.593  2.739   1.00 46.11  ? 145 LYS F NZ    1 
ATOM 8593  N N     . LYS H 4 109 ? 122.073 13.710  -0.795  1.00 43.35  ? 146 LYS F N     1 
ATOM 8594  C CA    . LYS H 4 109 ? 121.786 13.576  -2.212  1.00 43.22  ? 146 LYS F CA    1 
ATOM 8595  C C     . LYS H 4 109 ? 122.948 14.004  -3.103  1.00 43.81  ? 146 LYS F C     1 
ATOM 8596  O O     . LYS H 4 109 ? 122.776 14.147  -4.310  1.00 69.17  ? 146 LYS F O     1 
ATOM 8597  C CB    . LYS H 4 109 ? 120.555 14.429  -2.527  1.00 63.37  ? 146 LYS F CB    1 
ATOM 8598  C CG    . LYS H 4 109 ? 119.800 14.039  -3.768  1.00 60.31  ? 146 LYS F CG    1 
ATOM 8599  C CD    . LYS H 4 109 ? 118.580 14.916  -3.945  1.00 58.32  ? 146 LYS F CD    1 
ATOM 8600  C CE    . LYS H 4 109 ? 117.635 14.307  -4.963  1.00 56.83  ? 146 LYS F CE    1 
ATOM 8601  N NZ    . LYS H 4 109 ? 117.081 13.002  -4.482  1.00 52.89  ? 146 LYS F NZ    1 
ATOM 8602  N N     . VAL H 4 110 ? 124.128 14.206  -2.523  1.00 75.64  ? 147 VAL F N     1 
ATOM 8603  C CA    . VAL H 4 110 ? 125.276 14.655  -3.314  1.00 78.38  ? 147 VAL F CA    1 
ATOM 8604  C C     . VAL H 4 110 ? 125.845 13.607  -4.275  1.00 81.54  ? 147 VAL F C     1 
ATOM 8605  O O     . VAL H 4 110 ? 125.874 13.843  -5.482  1.00 95.99  ? 147 VAL F O     1 
ATOM 8606  C CB    . VAL H 4 110 ? 126.415 15.214  -2.406  1.00 78.85  ? 147 VAL F CB    1 
ATOM 8607  C CG1   . VAL H 4 110 ? 126.918 14.137  -1.465  1.00 76.12  ? 147 VAL F CG1   1 
ATOM 8608  C CG2   . VAL H 4 110 ? 127.545 15.769  -3.264  1.00 79.43  ? 147 VAL F CG2   1 
ATOM 8609  N N     . PHE H 4 111 ? 126.299 12.465  -3.759  1.00 102.00 ? 148 PHE F N     1 
ATOM 8610  C CA    . PHE H 4 111 ? 126.842 11.405  -4.614  1.00 102.97 ? 148 PHE F CA    1 
ATOM 8611  C C     . PHE H 4 111 ? 125.711 10.796  -5.439  1.00 102.33 ? 148 PHE F C     1 
ATOM 8612  O O     . PHE H 4 111 ? 125.883 10.473  -6.616  1.00 92.15  ? 148 PHE F O     1 
ATOM 8613  C CB    . PHE H 4 111 ? 127.519 10.322  -3.762  1.00 95.13  ? 148 PHE F CB    1 
ATOM 8614  C CG    . PHE H 4 111 ? 127.806 9.044   -4.510  1.00 95.25  ? 148 PHE F CG    1 
ATOM 8615  C CD1   . PHE H 4 111 ? 126.785 8.128   -4.773  1.00 93.47  ? 148 PHE F CD1   1 
ATOM 8616  C CD2   . PHE H 4 111 ? 129.096 8.757   -4.958  1.00 95.65  ? 148 PHE F CD2   1 
ATOM 8617  C CE1   . PHE H 4 111 ? 127.044 6.943   -5.473  1.00 93.82  ? 148 PHE F CE1   1 
ATOM 8618  C CE2   . PHE H 4 111 ? 129.368 7.574   -5.660  1.00 94.86  ? 148 PHE F CE2   1 
ATOM 8619  C CZ    . PHE H 4 111 ? 128.339 6.665   -5.918  1.00 94.95  ? 148 PHE F CZ    1 
ATOM 8620  N N     . GLU H 4 112 ? 124.555 10.639  -4.805  1.00 95.94  ? 149 GLU F N     1 
ATOM 8621  C CA    . GLU H 4 112 ? 123.389 10.088  -5.477  1.00 95.41  ? 149 GLU F CA    1 
ATOM 8622  C C     . GLU H 4 112 ? 123.068 10.948  -6.724  1.00 95.04  ? 149 GLU F C     1 
ATOM 8623  O O     . GLU H 4 112 ? 123.058 10.434  -7.845  1.00 59.12  ? 149 GLU F O     1 
ATOM 8624  C CB    . GLU H 4 112 ? 122.201 10.025  -4.486  1.00 65.65  ? 149 GLU F CB    1 
ATOM 8625  C CG    . GLU H 4 112 ? 120.941 9.296   -5.006  1.00 66.17  ? 149 GLU F CG    1 
ATOM 8626  C CD    . GLU H 4 112 ? 119.895 8.988   -3.913  1.00 67.56  ? 149 GLU F CD    1 
ATOM 8627  O OE1   . GLU H 4 112 ? 120.137 8.079   -3.084  1.00 67.52  ? 149 GLU F OE1   1 
ATOM 8628  O OE2   . GLU H 4 112 ? 118.828 9.649   -3.889  1.00 64.83  ? 149 GLU F OE2   1 
ATOM 8629  N N     . THR H 4 113 ? 122.831 12.251  -6.545  1.00 116.13 ? 150 THR F N     1 
ATOM 8630  C CA    . THR H 4 113 ? 122.531 13.130  -7.689  1.00 116.70 ? 150 THR F CA    1 
ATOM 8631  C C     . THR H 4 113 ? 123.780 13.321  -8.560  1.00 117.48 ? 150 THR F C     1 
ATOM 8632  O O     . THR H 4 113 ? 123.679 13.558  -9.765  1.00 79.03  ? 150 THR F O     1 
ATOM 8633  C CB    . THR H 4 113 ? 121.991 14.542  -7.241  1.00 73.23  ? 150 THR F CB    1 
ATOM 8634  O OG1   . THR H 4 113 ? 120.639 14.425  -6.766  1.00 71.98  ? 150 THR F OG1   1 
ATOM 8635  C CG2   . THR H 4 113 ? 122.009 15.528  -8.410  1.00 72.18  ? 150 THR F CG2   1 
ATOM 8636  N N     . LEU H 4 114 ? 124.951 13.202  -7.941  1.00 50.64  ? 151 LEU F N     1 
ATOM 8637  C CA    . LEU H 4 114 ? 126.227 13.349  -8.633  1.00 50.36  ? 151 LEU F CA    1 
ATOM 8638  C C     . LEU H 4 114 ? 126.321 12.368  -9.785  1.00 50.96  ? 151 LEU F C     1 
ATOM 8639  O O     . LEU H 4 114 ? 126.608 12.750  -10.917 1.00 59.51  ? 151 LEU F O     1 
ATOM 8640  C CB    . LEU H 4 114 ? 127.386 13.079  -7.669  1.00 55.95  ? 151 LEU F CB    1 
ATOM 8641  C CG    . LEU H 4 114 ? 128.604 14.014  -7.703  1.00 54.82  ? 151 LEU F CG    1 
ATOM 8642  C CD1   . LEU H 4 114 ? 129.525 13.641  -6.571  1.00 56.11  ? 151 LEU F CD1   1 
ATOM 8643  C CD2   . LEU H 4 114 ? 129.342 13.932  -9.029  1.00 55.70  ? 151 LEU F CD2   1 
ATOM 8644  N N     . GLU H 4 115 ? 126.097 11.095  -9.480  1.00 99.45  ? 152 GLU F N     1 
ATOM 8645  C CA    . GLU H 4 115 ? 126.153 10.031  -10.480 1.00 100.56 ? 152 GLU F CA    1 
ATOM 8646  C C     . GLU H 4 115 ? 125.573 10.454  -11.829 1.00 100.95 ? 152 GLU F C     1 
ATOM 8647  O O     . GLU H 4 115 ? 126.271 10.459  -12.846 1.00 75.07  ? 152 GLU F O     1 
ATOM 8648  C CB    . GLU H 4 115 ? 125.385 8.804   -9.981  1.00 79.67  ? 152 GLU F CB    1 
ATOM 8649  C CG    . GLU H 4 115 ? 126.120 7.968   -8.952  1.00 81.29  ? 152 GLU F CG    1 
ATOM 8650  C CD    . GLU H 4 115 ? 127.166 7.058   -9.572  1.00 81.18  ? 152 GLU F CD    1 
ATOM 8651  O OE1   . GLU H 4 115 ? 126.801 6.157   -10.357 1.00 83.39  ? 152 GLU F OE1   1 
ATOM 8652  O OE2   . GLU H 4 115 ? 128.358 7.248   -9.270  1.00 81.81  ? 152 GLU F OE2   1 
ATOM 8653  N N     . ALA H 4 116 ? 124.290 10.810  -11.822 1.00 80.91  ? 153 ALA F N     1 
ATOM 8654  C CA    . ALA H 4 116 ? 123.585 11.215  -13.034 1.00 81.16  ? 153 ALA F CA    1 
ATOM 8655  C C     . ALA H 4 116 ? 124.249 12.348  -13.810 1.00 81.34  ? 153 ALA F C     1 
ATOM 8656  O O     . ALA H 4 116 ? 124.344 12.291  -15.034 1.00 89.52  ? 153 ALA F O     1 
ATOM 8657  C CB    . ALA H 4 116 ? 122.156 11.593  -12.691 1.00 92.68  ? 153 ALA F CB    1 
ATOM 8658  N N     . ARG H 4 117 ? 124.699 13.377  -13.099 1.00 101.78 ? 154 ARG F N     1 
ATOM 8659  C CA    . ARG H 4 117 ? 125.348 14.521  -13.734 1.00 103.49 ? 154 ARG F CA    1 
ATOM 8660  C C     . ARG H 4 117 ? 126.563 14.097  -14.562 1.00 104.08 ? 154 ARG F C     1 
ATOM 8661  O O     . ARG H 4 117 ? 126.782 14.604  -15.666 1.00 94.08  ? 154 ARG F O     1 
ATOM 8662  C CB    . ARG H 4 117 ? 125.774 15.538  -12.670 1.00 85.47  ? 154 ARG F CB    1 
ATOM 8663  C CG    . ARG H 4 117 ? 126.122 16.908  -13.229 1.00 83.17  ? 154 ARG F CG    1 
ATOM 8664  C CD    . ARG H 4 117 ? 125.001 17.416  -14.133 1.00 83.22  ? 154 ARG F CD    1 
ATOM 8665  N NE    . ARG H 4 117 ? 123.693 17.127  -13.558 1.00 81.81  ? 154 ARG F NE    1 
ATOM 8666  C CZ    . ARG H 4 117 ? 123.237 17.675  -12.439 1.00 81.71  ? 154 ARG F CZ    1 
ATOM 8667  N NH1   . ARG H 4 117 ? 123.985 18.551  -11.778 1.00 82.07  ? 154 ARG F NH1   1 
ATOM 8668  N NH2   . ARG H 4 117 ? 122.044 17.327  -11.970 1.00 80.46  ? 154 ARG F NH2   1 
ATOM 8669  N N     . MET H 4 118 ? 127.351 13.172  -14.020 1.00 111.39 ? 155 MET F N     1 
ATOM 8670  C CA    . MET H 4 118 ? 128.535 12.673  -14.708 1.00 111.27 ? 155 MET F CA    1 
ATOM 8671  C C     . MET H 4 118 ? 128.118 11.632  -15.749 1.00 110.09 ? 155 MET F C     1 
ATOM 8672  O O     . MET H 4 118 ? 128.657 11.599  -16.854 1.00 73.55  ? 155 MET F O     1 
ATOM 8673  C CB    . MET H 4 118 ? 129.515 12.069  -13.698 1.00 79.83  ? 155 MET F CB    1 
ATOM 8674  C CG    . MET H 4 118 ? 129.946 13.038  -12.600 1.00 83.27  ? 155 MET F CG    1 
ATOM 8675  S SD    . MET H 4 118 ? 131.176 12.375  -11.437 1.00 87.60  ? 155 MET F SD    1 
ATOM 8676  C CE    . MET H 4 118 ? 132.710 12.903  -12.208 1.00 86.56  ? 155 MET F CE    1 
ATOM 8677  N N     . THR H 4 119 ? 127.159 10.779  -15.401 1.00 77.57  ? 156 THR F N     1 
ATOM 8678  C CA    . THR H 4 119 ? 126.694 9.782   -16.359 1.00 77.52  ? 156 THR F CA    1 
ATOM 8679  C C     . THR H 4 119 ? 126.248 10.596  -17.568 1.00 76.89  ? 156 THR F C     1 
ATOM 8680  O O     . THR H 4 119 ? 126.737 10.398  -18.680 1.00 120.19 ? 156 THR F O     1 
ATOM 8681  C CB    . THR H 4 119 ? 125.499 8.953   -15.819 1.00 116.60 ? 156 THR F CB    1 
ATOM 8682  O OG1   . THR H 4 119 ? 124.389 9.818   -15.554 1.00 116.60 ? 156 THR F OG1   1 
ATOM 8683  C CG2   . THR H 4 119 ? 125.892 8.216   -14.544 1.00 116.60 ? 156 THR F CG2   1 
ATOM 8684  N N     . GLU H 4 120 ? 125.334 11.532  -17.330 1.00 98.57  ? 157 GLU F N     1 
ATOM 8685  C CA    . GLU H 4 120 ? 124.832 12.420  -18.374 1.00 97.27  ? 157 GLU F CA    1 
ATOM 8686  C C     . GLU H 4 120 ? 126.049 13.206  -18.875 1.00 97.58  ? 157 GLU F C     1 
ATOM 8687  O O     . GLU H 4 120 ? 127.141 13.066  -18.319 1.00 71.91  ? 157 GLU F O     1 
ATOM 8688  C CB    . GLU H 4 120 ? 123.795 13.368  -17.764 1.00 79.52  ? 157 GLU F CB    1 
ATOM 8689  C CG    . GLU H 4 120 ? 122.519 13.578  -18.574 1.00 77.13  ? 157 GLU F CG    1 
ATOM 8690  C CD    . GLU H 4 120 ? 122.604 14.748  -19.551 1.00 75.95  ? 157 GLU F CD    1 
ATOM 8691  O OE1   . GLU H 4 120 ? 121.530 15.216  -20.005 1.00 74.11  ? 157 GLU F OE1   1 
ATOM 8692  O OE2   . GLU H 4 120 ? 123.732 15.192  -19.866 1.00 75.02  ? 157 GLU F OE2   1 
ATOM 8693  N N     . ALA H 4 121 ? 125.867 14.029  -19.906 1.00 69.30  ? 158 ALA F N     1 
ATOM 8694  C CA    . ALA H 4 121 ? 126.966 14.819  -20.470 1.00 67.53  ? 158 ALA F CA    1 
ATOM 8695  C C     . ALA H 4 121 ? 127.927 13.852  -21.135 1.00 66.27  ? 158 ALA F C     1 
ATOM 8696  O O     . ALA H 4 121 ? 128.320 14.049  -22.280 1.00 46.49  ? 158 ALA F O     1 
ATOM 8697  C CB    . ALA H 4 121 ? 127.679 15.615  -19.383 1.00 61.06  ? 158 ALA F CB    1 
ATOM 8698  N N     . CYS H 4 122 ? 128.304 12.810  -20.400 1.00 80.67  ? 159 CYS F N     1 
ATOM 8699  C CA    . CYS H 4 122 ? 129.175 11.771  -20.929 1.00 79.90  ? 159 CYS F CA    1 
ATOM 8700  C C     . CYS H 4 122 ? 128.386 11.182  -22.083 1.00 79.53  ? 159 CYS F C     1 
ATOM 8701  O O     . CYS H 4 122 ? 128.955 10.607  -23.008 1.00 67.67  ? 159 CYS F O     1 
ATOM 8702  C CB    . CYS H 4 122 ? 129.413 10.670  -19.890 1.00 72.12  ? 159 CYS F CB    1 
ATOM 8703  S SG    . CYS H 4 122 ? 130.675 10.991  -18.634 1.00 75.88  ? 159 CYS F SG    1 
ATOM 8704  N N     . ILE H 4 123 ? 127.061 11.320  -21.998 1.00 85.09  ? 160 ILE F N     1 
ATOM 8705  C CA    . ILE H 4 123 ? 126.145 10.826  -23.024 1.00 84.34  ? 160 ILE F CA    1 
ATOM 8706  C C     . ILE H 4 123 ? 125.745 11.969  -23.952 1.00 85.26  ? 160 ILE F C     1 
ATOM 8707  O O     . ILE H 4 123 ? 125.988 11.902  -25.155 1.00 99.87  ? 160 ILE F O     1 
ATOM 8708  C CB    . ILE H 4 123 ? 124.855 10.236  -22.416 1.00 83.12  ? 160 ILE F CB    1 
ATOM 8709  C CG1   . ILE H 4 123 ? 125.197 9.099   -21.446 1.00 82.35  ? 160 ILE F CG1   1 
ATOM 8710  C CG2   . ILE H 4 123 ? 123.940 9.736   -23.537 1.00 81.42  ? 160 ILE F CG2   1 
ATOM 8711  C CD1   . ILE H 4 123 ? 125.914 7.918   -22.094 1.00 79.81  ? 160 ILE F CD1   1 
ATOM 8712  N N     . ARG H 4 124 ? 125.138 13.013  -23.386 1.00 110.92 ? 161 ARG F N     1 
ATOM 8713  C CA    . ARG H 4 124 ? 124.707 14.183  -24.161 1.00 112.78 ? 161 ARG F CA    1 
ATOM 8714  C C     . ARG H 4 124 ? 125.854 14.878  -24.892 1.00 113.14 ? 161 ARG F C     1 
ATOM 8715  O O     . ARG H 4 124 ? 125.622 15.736  -25.751 1.00 91.26  ? 161 ARG F O     1 
ATOM 8716  C CB    . ARG H 4 124 ? 124.016 15.213  -23.257 1.00 92.92  ? 161 ARG F CB    1 
ATOM 8717  C CG    . ARG H 4 124 ? 122.518 15.017  -23.116 1.00 94.92  ? 161 ARG F CG    1 
ATOM 8718  C CD    . ARG H 4 124 ? 121.845 16.246  -22.528 1.00 97.56  ? 161 ARG F CD    1 
ATOM 8719  N NE    . ARG H 4 124 ? 120.402 16.053  -22.386 1.00 99.34  ? 161 ARG F NE    1 
ATOM 8720  C CZ    . ARG H 4 124 ? 119.569 15.837  -23.402 1.00 99.35  ? 161 ARG F CZ    1 
ATOM 8721  N NH1   . ARG H 4 124 ? 120.029 15.786  -24.646 1.00 98.27  ? 161 ARG F NH1   1 
ATOM 8722  N NH2   . ARG H 4 124 ? 118.271 15.675  -23.176 1.00 98.15  ? 161 ARG F NH2   1 
ATOM 8723  N N     . GLY H 4 125 ? 127.084 14.518  -24.531 1.00 98.24  ? 162 GLY F N     1 
ATOM 8724  C CA    . GLY H 4 125 ? 128.257 15.101  -25.157 1.00 99.41  ? 162 GLY F CA    1 
ATOM 8725  C C     . GLY H 4 125 ? 128.526 16.568  -24.857 1.00 100.29 ? 162 GLY F C     1 
ATOM 8726  O O     . GLY H 4 125 ? 128.726 17.366  -25.779 1.00 51.66  ? 162 GLY F O     1 
ATOM 8727  N N     . TYR H 4 126 ? 128.544 16.932  -23.577 1.00 117.88 ? 163 TYR F N     1 
ATOM 8728  C CA    . TYR H 4 126 ? 128.794 18.321  -23.188 1.00 119.61 ? 163 TYR F CA    1 
ATOM 8729  C C     . TYR H 4 126 ? 129.738 18.418  -21.978 1.00 119.06 ? 163 TYR F C     1 
ATOM 8730  O O     . TYR H 4 126 ? 129.457 17.865  -20.909 1.00 116.02 ? 163 TYR F O     1 
ATOM 8731  C CB    . TYR H 4 126 ? 127.457 19.031  -22.903 1.00 116.20 ? 163 TYR F CB    1 
ATOM 8732  C CG    . TYR H 4 126 ? 126.462 18.934  -24.051 1.00 117.92 ? 163 TYR F CG    1 
ATOM 8733  C CD1   . TYR H 4 126 ? 126.777 19.426  -25.321 1.00 117.92 ? 163 TYR F CD1   1 
ATOM 8734  C CD2   . TYR H 4 126 ? 125.227 18.302  -23.880 1.00 117.92 ? 163 TYR F CD2   1 
ATOM 8735  C CE1   . TYR H 4 126 ? 125.893 19.283  -26.397 1.00 117.92 ? 163 TYR F CE1   1 
ATOM 8736  C CE2   . TYR H 4 126 ? 124.335 18.155  -24.950 1.00 117.92 ? 163 TYR F CE2   1 
ATOM 8737  C CZ    . TYR H 4 126 ? 124.677 18.646  -26.204 1.00 117.92 ? 163 TYR F CZ    1 
ATOM 8738  O OH    . TYR H 4 126 ? 123.815 18.483  -27.264 1.00 117.92 ? 163 TYR F OH    1 
ATOM 8739  N N     . ASN H 4 127 ? 130.856 19.122  -22.182 1.00 124.93 ? 164 ASN F N     1 
ATOM 8740  C CA    . ASN H 4 127 ? 131.914 19.333  -21.183 1.00 124.93 ? 164 ASN F CA    1 
ATOM 8741  C C     . ASN H 4 127 ? 133.030 18.285  -21.371 1.00 124.93 ? 164 ASN F C     1 
ATOM 8742  O O     . ASN H 4 127 ? 133.164 17.342  -20.584 1.00 81.92  ? 164 ASN F O     1 
ATOM 8743  C CB    . ASN H 4 127 ? 131.339 19.275  -19.757 1.00 69.50  ? 164 ASN F CB    1 
ATOM 8744  C CG    . ASN H 4 127 ? 132.403 19.462  -18.686 1.00 66.44  ? 164 ASN F CG    1 
ATOM 8745  O OD1   . ASN H 4 127 ? 132.989 20.544  -18.545 1.00 64.77  ? 164 ASN F OD1   1 
ATOM 8746  N ND2   . ASN H 4 127 ? 132.663 18.397  -17.930 1.00 65.68  ? 164 ASN F ND2   1 
ATOM 8747  N N     . PRO H 4 128 ? 133.849 18.452  -22.429 1.00 116.85 ? 165 PRO F N     1 
ATOM 8748  C CA    . PRO H 4 128 ? 134.974 17.590  -22.822 1.00 115.05 ? 165 PRO F CA    1 
ATOM 8749  C C     . PRO H 4 128 ? 135.791 16.974  -21.681 1.00 113.87 ? 165 PRO F C     1 
ATOM 8750  O O     . PRO H 4 128 ? 136.940 17.362  -21.453 1.00 108.21 ? 165 PRO F O     1 
ATOM 8751  C CB    . PRO H 4 128 ? 135.817 18.515  -23.699 1.00 104.23 ? 165 PRO F CB    1 
ATOM 8752  C CG    . PRO H 4 128 ? 134.776 19.322  -24.395 1.00 105.24 ? 165 PRO F CG    1 
ATOM 8753  C CD    . PRO H 4 128 ? 133.819 19.668  -23.265 1.00 105.72 ? 165 PRO F CD    1 
ATOM 8754  N N     . GLY H 4 129 ? 135.209 15.997  -20.987 1.00 97.54  ? 166 GLY F N     1 
ATOM 8755  C CA    . GLY H 4 129 ? 135.908 15.362  -19.884 1.00 98.06  ? 166 GLY F CA    1 
ATOM 8756  C C     . GLY H 4 129 ? 136.681 16.368  -19.051 1.00 98.66  ? 166 GLY F C     1 
ATOM 8757  O O     . GLY H 4 129 ? 137.822 16.110  -18.656 1.00 66.84  ? 166 GLY F O     1 
ATOM 8758  N N     . LEU H 4 130 ? 136.062 17.522  -18.801 1.00 86.12  ? 167 LEU F N     1 
ATOM 8759  C CA    . LEU H 4 130 ? 136.677 18.588  -18.008 1.00 86.81  ? 167 LEU F CA    1 
ATOM 8760  C C     . LEU H 4 130 ? 136.081 18.628  -16.600 1.00 88.83  ? 167 LEU F C     1 
ATOM 8761  O O     . LEU H 4 130 ? 136.798 18.867  -15.629 1.00 71.27  ? 167 LEU F O     1 
ATOM 8762  C CB    . LEU H 4 130 ? 136.490 19.949  -18.695 1.00 73.30  ? 167 LEU F CB    1 
ATOM 8763  C CG    . LEU H 4 130 ? 137.196 20.146  -20.047 1.00 73.99  ? 167 LEU F CG    1 
ATOM 8764  C CD1   . LEU H 4 130 ? 136.884 21.522  -20.628 1.00 74.81  ? 167 LEU F CD1   1 
ATOM 8765  C CD2   . LEU H 4 130 ? 138.694 19.990  -19.850 1.00 73.97  ? 167 LEU F CD2   1 
ATOM 8766  N N     . LEU H 4 131 ? 134.771 18.397  -16.504 1.00 123.91 ? 168 LEU F N     1 
ATOM 8767  C CA    . LEU H 4 131 ? 134.054 18.366  -15.223 1.00 123.91 ? 168 LEU F CA    1 
ATOM 8768  C C     . LEU H 4 131 ? 133.788 16.905  -14.860 1.00 123.91 ? 168 LEU F C     1 
ATOM 8769  O O     . LEU H 4 131 ? 133.201 16.602  -13.810 1.00 67.86  ? 168 LEU F O     1 
ATOM 8770  C CB    . LEU H 4 131 ? 132.706 19.093  -15.329 1.00 56.05  ? 168 LEU F CB    1 
ATOM 8771  C CG    . LEU H 4 131 ? 132.515 20.538  -14.855 1.00 56.80  ? 168 LEU F CG    1 
ATOM 8772  C CD1   . LEU H 4 131 ? 133.461 21.502  -15.553 1.00 57.17  ? 168 LEU F CD1   1 
ATOM 8773  C CD2   . LEU H 4 131 ? 131.078 20.916  -15.134 1.00 55.40  ? 168 LEU F CD2   1 
ATOM 8774  N N     . VAL H 4 132 ? 134.228 16.012  -15.748 1.00 108.15 ? 169 VAL F N     1 
ATOM 8775  C CA    . VAL H 4 132 ? 134.048 14.573  -15.589 1.00 108.03 ? 169 VAL F CA    1 
ATOM 8776  C C     . VAL H 4 132 ? 135.305 13.897  -15.052 1.00 109.52 ? 169 VAL F C     1 
ATOM 8777  O O     . VAL H 4 132 ? 135.303 13.329  -13.960 1.00 78.79  ? 169 VAL F O     1 
ATOM 8778  C CB    . VAL H 4 132 ? 133.701 13.913  -16.939 1.00 80.69  ? 169 VAL F CB    1 
ATOM 8779  C CG1   . VAL H 4 132 ? 133.046 12.567  -16.699 1.00 78.44  ? 169 VAL F CG1   1 
ATOM 8780  C CG2   . VAL H 4 132 ? 132.802 14.829  -17.761 1.00 81.44  ? 169 VAL F CG2   1 
ATOM 8781  N N     . HIS H 4 133 ? 136.375 13.958  -15.839 1.00 117.09 ? 170 HIS F N     1 
ATOM 8782  C CA    . HIS H 4 133 ? 137.647 13.351  -15.465 1.00 117.09 ? 170 HIS F CA    1 
ATOM 8783  C C     . HIS H 4 133 ? 138.660 13.510  -16.604 1.00 117.09 ? 170 HIS F C     1 
ATOM 8784  O O     . HIS H 4 133 ? 138.286 13.748  -17.757 1.00 113.51 ? 170 HIS F O     1 
ATOM 8785  C CB    . HIS H 4 133 ? 137.429 11.868  -15.123 1.00 114.71 ? 170 HIS F CB    1 
ATOM 8786  C CG    . HIS H 4 133 ? 138.684 11.123  -14.790 1.00 114.71 ? 170 HIS F CG    1 
ATOM 8787  N ND1   . HIS H 4 133 ? 139.710 11.676  -14.052 1.00 114.71 ? 170 HIS F ND1   1 
ATOM 8788  C CD2   . HIS H 4 133 ? 139.068 9.855   -15.071 1.00 114.71 ? 170 HIS F CD2   1 
ATOM 8789  C CE1   . HIS H 4 133 ? 140.670 10.783  -13.896 1.00 114.71 ? 170 HIS F CE1   1 
ATOM 8790  N NE2   . HIS H 4 133 ? 140.305 9.668   -14.505 1.00 114.71 ? 170 HIS F NE2   1 
ATOM 8791  N N     . SER H 4 134 ? 139.942 13.386  -16.272 1.00 118.37 ? 171 SER F N     1 
ATOM 8792  C CA    . SER H 4 134 ? 141.015 13.522  -17.252 1.00 118.37 ? 171 SER F CA    1 
ATOM 8793  C C     . SER H 4 134 ? 141.119 12.321  -18.190 1.00 118.37 ? 171 SER F C     1 
ATOM 8794  O O     . SER H 4 134 ? 142.076 12.205  -18.961 1.00 118.37 ? 171 SER F O     1 
ATOM 8795  C CB    . SER H 4 134 ? 142.357 13.709  -16.538 1.00 117.76 ? 171 SER F CB    1 
ATOM 8796  O OG    . SER H 4 134 ? 142.789 12.504  -15.924 1.00 117.76 ? 171 SER F OG    1 
ATOM 8797  N N     . ASP H 4 135 ? 140.138 11.428  -18.125 1.00 96.42  ? 172 ASP F N     1 
ATOM 8798  C CA    . ASP H 4 135 ? 140.145 10.242  -18.968 1.00 96.06  ? 172 ASP F CA    1 
ATOM 8799  C C     . ASP H 4 135 ? 139.242 10.346  -20.183 1.00 94.44  ? 172 ASP F C     1 
ATOM 8800  O O     . ASP H 4 135 ? 139.571 9.813   -21.246 1.00 81.78  ? 172 ASP F O     1 
ATOM 8801  C CB    . ASP H 4 135 ? 139.758 9.018   -18.146 1.00 89.09  ? 172 ASP F CB    1 
ATOM 8802  C CG    . ASP H 4 135 ? 140.906 8.503   -17.307 1.00 89.93  ? 172 ASP F CG    1 
ATOM 8803  O OD1   . ASP H 4 135 ? 141.561 9.324   -16.627 1.00 88.15  ? 172 ASP F OD1   1 
ATOM 8804  O OD2   . ASP H 4 135 ? 141.151 7.277   -17.330 1.00 88.68  ? 172 ASP F OD2   1 
ATOM 8805  N N     . LEU H 4 136 ? 138.113 11.035  -20.032 1.00 62.96  ? 173 LEU F N     1 
ATOM 8806  C CA    . LEU H 4 136 ? 137.167 11.187  -21.136 1.00 60.97  ? 173 LEU F CA    1 
ATOM 8807  C C     . LEU H 4 136 ? 137.603 12.264  -22.146 1.00 60.65  ? 173 LEU F C     1 
ATOM 8808  O O     . LEU H 4 136 ? 138.473 12.014  -22.987 1.00 87.21  ? 173 LEU F O     1 
ATOM 8809  C CB    . LEU H 4 136 ? 135.766 11.486  -20.585 1.00 84.91  ? 173 LEU F CB    1 
ATOM 8810  C CG    . LEU H 4 136 ? 134.578 10.915  -21.376 1.00 83.69  ? 173 LEU F CG    1 
ATOM 8811  C CD1   . LEU H 4 136 ? 134.719 9.406   -21.542 1.00 83.09  ? 173 LEU F CD1   1 
ATOM 8812  C CD2   . LEU H 4 136 ? 133.279 11.245  -20.646 1.00 83.63  ? 173 LEU F CD2   1 
ATOM 8813  N N     . ALA H 4 137 ? 137.001 13.450  -22.071 1.00 90.33  ? 174 ALA F N     1 
ATOM 8814  C CA    . ALA H 4 137 ? 137.338 14.547  -22.983 1.00 90.96  ? 174 ALA F CA    1 
ATOM 8815  C C     . ALA H 4 137 ? 136.773 14.369  -24.403 1.00 91.28  ? 174 ALA F C     1 
ATOM 8816  O O     . ALA H 4 137 ? 136.961 15.230  -25.268 1.00 68.73  ? 174 ALA F O     1 
ATOM 8817  C CB    . ALA H 4 137 ? 138.853 14.729  -23.040 1.00 67.31  ? 174 ALA F CB    1 
ATOM 8818  N N     . TYR H 4 138 ? 136.088 13.250  -24.643 1.00 123.24 ? 175 TYR F N     1 
ATOM 8819  C CA    . TYR H 4 138 ? 135.480 12.972  -25.949 1.00 123.24 ? 175 TYR F CA    1 
ATOM 8820  C C     . TYR H 4 138 ? 134.007 12.576  -25.833 1.00 123.24 ? 175 TYR F C     1 
ATOM 8821  O O     . TYR H 4 138 ? 133.672 11.419  -25.550 1.00 104.49 ? 175 TYR F O     1 
ATOM 8822  C CB    . TYR H 4 138 ? 136.237 11.865  -26.694 1.00 98.25  ? 175 TYR F CB    1 
ATOM 8823  C CG    . TYR H 4 138 ? 137.509 12.323  -27.386 1.00 96.76  ? 175 TYR F CG    1 
ATOM 8824  C CD1   . TYR H 4 138 ? 138.658 12.636  -26.651 1.00 95.85  ? 175 TYR F CD1   1 
ATOM 8825  C CD2   . TYR H 4 138 ? 137.573 12.417  -28.780 1.00 95.30  ? 175 TYR F CD2   1 
ATOM 8826  C CE1   . TYR H 4 138 ? 139.842 13.022  -27.286 1.00 92.38  ? 175 TYR F CE1   1 
ATOM 8827  C CE2   . TYR H 4 138 ? 138.750 12.803  -29.422 1.00 90.57  ? 175 TYR F CE2   1 
ATOM 8828  C CZ    . TYR H 4 138 ? 139.881 13.102  -28.669 1.00 91.06  ? 175 TYR F CZ    1 
ATOM 8829  O OH    . TYR H 4 138 ? 141.052 13.468  -29.298 1.00 90.90  ? 175 TYR F OH    1 
ATOM 8830  N N     . LEU H 4 139 ? 133.140 13.559  -26.063 1.00 110.31 ? 176 LEU F N     1 
ATOM 8831  C CA    . LEU H 4 139 ? 131.691 13.382  -26.003 1.00 109.47 ? 176 LEU F CA    1 
ATOM 8832  C C     . LEU H 4 139 ? 131.030 14.326  -27.016 1.00 109.85 ? 176 LEU F C     1 
ATOM 8833  O O     . LEU H 4 139 ? 129.802 14.355  -27.161 1.00 74.44  ? 176 LEU F O     1 
ATOM 8834  C CB    . LEU H 4 139 ? 131.183 13.661  -24.577 1.00 73.11  ? 176 LEU F CB    1 
ATOM 8835  C CG    . LEU H 4 139 ? 131.772 14.822  -23.751 1.00 72.38  ? 176 LEU F CG    1 
ATOM 8836  C CD1   . LEU H 4 139 ? 130.867 15.088  -22.541 1.00 72.87  ? 176 LEU F CD1   1 
ATOM 8837  C CD2   . LEU H 4 139 ? 133.207 14.499  -23.284 1.00 71.59  ? 176 LEU F CD2   1 
ATOM 8838  N N     . GLN H 4 140 ? 131.879 15.074  -27.722 1.00 86.35  ? 177 GLN F N     1 
ATOM 8839  C CA    . GLN H 4 140 ? 131.484 16.044  -28.749 1.00 85.39  ? 177 GLN F CA    1 
ATOM 8840  C C     . GLN H 4 140 ? 130.401 15.506  -29.692 1.00 84.99  ? 177 GLN F C     1 
ATOM 8841  O O     . GLN H 4 140 ? 129.208 15.518  -29.368 1.00 93.19  ? 177 GLN F O     1 
ATOM 8842  C CB    . GLN H 4 140 ? 132.721 16.432  -29.568 1.00 87.61  ? 177 GLN F CB    1 
ATOM 8843  C CG    . GLN H 4 140 ? 134.008 16.497  -28.745 1.00 88.41  ? 177 GLN F CG    1 
ATOM 8844  C CD    . GLN H 4 140 ? 135.255 16.702  -29.593 1.00 89.98  ? 177 GLN F CD    1 
ATOM 8845  O OE1   . GLN H 4 140 ? 135.453 17.767  -30.185 1.00 89.79  ? 177 GLN F OE1   1 
ATOM 8846  N NE2   . GLN H 4 140 ? 136.103 15.678  -29.654 1.00 91.57  ? 177 GLN F NE2   1 
ATOM 8847  N N     . ALA H 4 141 ? 130.830 15.052  -30.868 1.00 106.87 ? 178 ALA F N     1 
ATOM 8848  C CA    . ALA H 4 141 ? 129.917 14.491  -31.858 1.00 106.60 ? 178 ALA F CA    1 
ATOM 8849  C C     . ALA H 4 141 ? 129.423 13.154  -31.319 1.00 107.89 ? 178 ALA F C     1 
ATOM 8850  O O     . ALA H 4 141 ? 128.310 12.710  -31.625 1.00 78.49  ? 178 ALA F O     1 
ATOM 8851  C CB    . ALA H 4 141 ? 130.641 14.287  -33.192 1.00 72.09  ? 178 ALA F CB    1 
ATOM 8852  N N     . GLU H 4 142 ? 130.283 12.527  -30.515 1.00 112.28 ? 179 GLU F N     1 
ATOM 8853  C CA    . GLU H 4 142 ? 130.018 11.242  -29.875 1.00 114.39 ? 179 GLU F CA    1 
ATOM 8854  C C     . GLU H 4 142 ? 129.548 10.171  -30.857 1.00 114.60 ? 179 GLU F C     1 
ATOM 8855  O O     . GLU H 4 142 ? 129.097 9.096   -30.448 1.00 88.69  ? 179 GLU F O     1 
ATOM 8856  C CB    . GLU H 4 142 ? 128.975 11.418  -28.775 1.00 84.49  ? 179 GLU F CB    1 
ATOM 8857  C CG    . GLU H 4 142 ? 129.014 10.339  -27.719 1.00 86.28  ? 179 GLU F CG    1 
ATOM 8858  C CD    . GLU H 4 142 ? 127.688 10.190  -27.013 1.00 87.02  ? 179 GLU F CD    1 
ATOM 8859  O OE1   . GLU H 4 142 ? 127.636 9.521   -25.960 1.00 85.14  ? 179 GLU F OE1   1 
ATOM 8860  O OE2   . GLU H 4 142 ? 126.689 10.736  -27.524 1.00 87.24  ? 179 GLU F OE2   1 
ATOM 8861  N N     . GLY H 4 143 ? 129.662 10.469  -32.150 1.00 89.46  ? 180 GLY F N     1 
ATOM 8862  C CA    . GLY H 4 143 ? 129.239 9.530   -33.172 1.00 90.90  ? 180 GLY F CA    1 
ATOM 8863  C C     . GLY H 4 143 ? 127.727 9.467   -33.332 1.00 90.62  ? 180 GLY F C     1 
ATOM 8864  O O     . GLY H 4 143 ? 127.211 8.639   -34.090 1.00 113.91 ? 180 GLY F O     1 
ATOM 8865  N N     . GLY H 4 144 ? 127.016 10.339  -32.618 1.00 111.06 ? 181 GLY F N     1 
ATOM 8866  C CA    . GLY H 4 144 ? 125.564 10.364  -32.696 1.00 112.02 ? 181 GLY F CA    1 
ATOM 8867  C C     . GLY H 4 144 ? 124.924 9.200   -31.965 1.00 113.27 ? 181 GLY F C     1 
ATOM 8868  O O     . GLY H 4 144 ? 125.232 8.958   -30.798 1.00 94.63  ? 181 GLY F O     1 
ATOM 8869  N N     . GLY H 4 145 ? 124.028 8.491   -32.652 1.00 115.45 ? 182 GLY F N     1 
ATOM 8870  C CA    . GLY H 4 145 ? 123.346 7.338   -32.077 1.00 115.45 ? 182 GLY F CA    1 
ATOM 8871  C C     . GLY H 4 145 ? 122.763 7.520   -30.686 1.00 115.45 ? 182 GLY F C     1 
ATOM 8872  O O     . GLY H 4 145 ? 121.586 7.843   -30.532 1.00 65.31  ? 182 GLY F O     1 
ATOM 8873  N N     . ASP H 4 146 ? 123.586 7.280   -29.670 1.00 95.86  ? 183 ASP F N     1 
ATOM 8874  C CA    . ASP H 4 146 ? 123.176 7.428   -28.277 1.00 93.21  ? 183 ASP F CA    1 
ATOM 8875  C C     . ASP H 4 146 ? 124.349 7.105   -27.344 1.00 92.12  ? 183 ASP F C     1 
ATOM 8876  O O     . ASP H 4 146 ? 124.536 7.761   -26.313 1.00 108.67 ? 183 ASP F O     1 
ATOM 8877  C CB    . ASP H 4 146 ? 121.975 6.518   -27.966 1.00 98.79  ? 183 ASP F CB    1 
ATOM 8878  C CG    . ASP H 4 146 ? 122.340 5.044   -27.951 1.00 95.51  ? 183 ASP F CG    1 
ATOM 8879  O OD1   . ASP H 4 146 ? 122.836 4.538   -28.980 1.00 94.41  ? 183 ASP F OD1   1 
ATOM 8880  O OD2   . ASP H 4 146 ? 122.126 4.390   -26.905 1.00 95.76  ? 183 ASP F OD2   1 
ATOM 8881  N N     . ARG H 4 147 ? 125.136 6.097   -27.723 1.00 87.79  ? 184 ARG F N     1 
ATOM 8882  C CA    . ARG H 4 147 ? 126.305 5.665   -26.952 1.00 86.91  ? 184 ARG F CA    1 
ATOM 8883  C C     . ARG H 4 147 ? 125.945 5.211   -25.533 1.00 86.99  ? 184 ARG F C     1 
ATOM 8884  O O     . ARG H 4 147 ? 124.839 5.459   -25.052 1.00 99.68  ? 184 ARG F O     1 
ATOM 8885  C CB    . ARG H 4 147 ? 127.340 6.797   -26.881 1.00 93.65  ? 184 ARG F CB    1 
ATOM 8886  C CG    . ARG H 4 147 ? 127.816 7.348   -28.233 1.00 92.68  ? 184 ARG F CG    1 
ATOM 8887  C CD    . ARG H 4 147 ? 128.838 6.453   -28.919 1.00 91.42  ? 184 ARG F CD    1 
ATOM 8888  N NE    . ARG H 4 147 ? 128.230 5.432   -29.768 1.00 92.38  ? 184 ARG F NE    1 
ATOM 8889  C CZ    . ARG H 4 147 ? 127.578 5.687   -30.898 1.00 91.58  ? 184 ARG F CZ    1 
ATOM 8890  N NH1   . ARG H 4 147 ? 127.443 6.935   -31.325 1.00 91.28  ? 184 ARG F NH1   1 
ATOM 8891  N NH2   . ARG H 4 147 ? 127.065 4.689   -31.608 1.00 87.66  ? 184 ARG F NH2   1 
ATOM 8892  N N     . GLN H 4 148 ? 126.894 4.550   -24.873 1.00 89.53  ? 185 GLN F N     1 
ATOM 8893  C CA    . GLN H 4 148 ? 126.723 4.037   -23.511 1.00 87.92  ? 185 GLN F CA    1 
ATOM 8894  C C     . GLN H 4 148 ? 128.098 3.750   -22.894 1.00 87.32  ? 185 GLN F C     1 
ATOM 8895  O O     . GLN H 4 148 ? 128.201 3.084   -21.862 1.00 102.58 ? 185 GLN F O     1 
ATOM 8896  C CB    . GLN H 4 148 ? 125.889 2.746   -23.522 1.00 98.23  ? 185 GLN F CB    1 
ATOM 8897  C CG    . GLN H 4 148 ? 124.431 2.909   -23.965 1.00 97.20  ? 185 GLN F CG    1 
ATOM 8898  C CD    . GLN H 4 148 ? 123.530 3.492   -22.886 1.00 95.40  ? 185 GLN F CD    1 
ATOM 8899  O OE1   . GLN H 4 148 ? 122.369 3.822   -23.140 1.00 95.43  ? 185 GLN F OE1   1 
ATOM 8900  N NE2   . GLN H 4 148 ? 124.057 3.610   -21.672 1.00 89.87  ? 185 GLN F NE2   1 
ATOM 8901  N N     . LEU H 4 149 ? 129.141 4.266   -23.542 1.00 115.81 ? 186 LEU F N     1 
ATOM 8902  C CA    . LEU H 4 149 ? 130.532 4.097   -23.121 1.00 116.07 ? 186 LEU F CA    1 
ATOM 8903  C C     . LEU H 4 149 ? 130.822 2.804   -22.369 1.00 117.48 ? 186 LEU F C     1 
ATOM 8904  O O     . LEU H 4 149 ? 131.740 2.737   -21.538 1.00 75.83  ? 186 LEU F O     1 
ATOM 8905  C CB    . LEU H 4 149 ? 130.999 5.316   -22.311 1.00 70.50  ? 186 LEU F CB    1 
ATOM 8906  C CG    . LEU H 4 149 ? 131.116 6.613   -23.134 1.00 69.01  ? 186 LEU F CG    1 
ATOM 8907  C CD1   . LEU H 4 149 ? 131.539 7.774   -22.249 1.00 66.65  ? 186 LEU F CD1   1 
ATOM 8908  C CD2   . LEU H 4 149 ? 132.120 6.418   -24.261 1.00 68.37  ? 186 LEU F CD2   1 
ATOM 8909  N N     . THR H 4 150 ? 130.034 1.778   -22.681 1.00 55.03  ? 187 THR F N     1 
ATOM 8910  C CA    . THR H 4 150 ? 130.200 0.460   -22.086 1.00 58.44  ? 187 THR F CA    1 
ATOM 8911  C C     . THR H 4 150 ? 130.051 0.434   -20.565 1.00 58.20  ? 187 THR F C     1 
ATOM 8912  O O     . THR H 4 150 ? 130.218 1.451   -19.885 1.00 77.31  ? 187 THR F O     1 
ATOM 8913  C CB    . THR H 4 150 ? 131.582 -0.141  -22.502 1.00 81.03  ? 187 THR F CB    1 
ATOM 8914  O OG1   . THR H 4 150 ? 131.584 -0.378  -23.916 1.00 85.47  ? 187 THR F OG1   1 
ATOM 8915  C CG2   . THR H 4 150 ? 131.865 -1.453  -21.786 1.00 81.07  ? 187 THR F CG2   1 
ATOM 8916  N N     . ASP H 4 151 ? 129.732 -0.754  -20.053 1.00 116.49 ? 188 ASP F N     1 
ATOM 8917  C CA    . ASP H 4 151 ? 129.541 -0.996  -18.625 1.00 115.40 ? 188 ASP F CA    1 
ATOM 8918  C C     . ASP H 4 151 ? 130.866 -0.880  -17.864 1.00 114.34 ? 188 ASP F C     1 
ATOM 8919  O O     . ASP H 4 151 ? 130.885 -0.871  -16.635 1.00 88.43  ? 188 ASP F O     1 
ATOM 8920  C CB    . ASP H 4 151 ? 128.953 -2.402  -18.395 1.00 75.35  ? 188 ASP F CB    1 
ATOM 8921  C CG    . ASP H 4 151 ? 127.851 -2.764  -19.392 1.00 76.41  ? 188 ASP F CG    1 
ATOM 8922  O OD1   . ASP H 4 151 ? 127.231 -3.836  -19.220 1.00 76.50  ? 188 ASP F OD1   1 
ATOM 8923  O OD2   . ASP H 4 151 ? 127.608 -1.994  -20.347 1.00 75.71  ? 188 ASP F OD2   1 
ATOM 8924  N N     . ARG H 4 152 ? 131.972 -0.805  -18.596 1.00 95.49  ? 189 ARG F N     1 
ATOM 8925  C CA    . ARG H 4 152 ? 133.279 -0.694  -17.967 1.00 94.60  ? 189 ARG F CA    1 
ATOM 8926  C C     . ARG H 4 152 ? 133.536 0.724   -17.496 1.00 93.59  ? 189 ARG F C     1 
ATOM 8927  O O     . ARG H 4 152 ? 133.570 0.993   -16.295 1.00 100.38 ? 189 ARG F O     1 
ATOM 8928  C CB    . ARG H 4 152 ? 134.386 -1.135  -18.935 1.00 106.08 ? 189 ARG F CB    1 
ATOM 8929  C CG    . ARG H 4 152 ? 134.486 -2.646  -19.076 1.00 104.20 ? 189 ARG F CG    1 
ATOM 8930  C CD    . ARG H 4 152 ? 135.706 -3.087  -19.870 1.00 102.67 ? 189 ARG F CD    1 
ATOM 8931  N NE    . ARG H 4 152 ? 135.844 -4.545  -19.853 1.00 102.68 ? 189 ARG F NE    1 
ATOM 8932  C CZ    . ARG H 4 152 ? 136.810 -5.222  -20.470 1.00 101.66 ? 189 ARG F CZ    1 
ATOM 8933  N NH1   . ARG H 4 152 ? 137.740 -4.577  -21.165 1.00 99.70  ? 189 ARG F NH1   1 
ATOM 8934  N NH2   . ARG H 4 152 ? 136.849 -6.547  -20.395 1.00 103.46 ? 189 ARG F NH2   1 
ATOM 8935  N N     . GLU H 4 153 ? 133.709 1.629   -18.451 1.00 92.49  ? 190 GLU F N     1 
ATOM 8936  C CA    . GLU H 4 153 ? 133.970 3.025   -18.145 1.00 92.56  ? 190 GLU F CA    1 
ATOM 8937  C C     . GLU H 4 153 ? 133.187 3.515   -16.931 1.00 92.83  ? 190 GLU F C     1 
ATOM 8938  O O     . GLU H 4 153 ? 133.631 4.417   -16.222 1.00 110.38 ? 190 GLU F O     1 
ATOM 8939  C CB    . GLU H 4 153 ? 133.641 3.899   -19.362 1.00 107.61 ? 190 GLU F CB    1 
ATOM 8940  C CG    . GLU H 4 153 ? 134.675 3.834   -20.481 1.00 106.97 ? 190 GLU F CG    1 
ATOM 8941  C CD    . GLU H 4 153 ? 135.265 5.202   -20.822 1.00 107.14 ? 190 GLU F CD    1 
ATOM 8942  O OE1   . GLU H 4 153 ? 136.192 5.264   -21.659 1.00 104.83 ? 190 GLU F OE1   1 
ATOM 8943  O OE2   . GLU H 4 153 ? 134.802 6.218   -20.258 1.00 107.21 ? 190 GLU F OE2   1 
ATOM 8944  N N     . LYS H 4 154 ? 132.030 2.913   -16.684 1.00 95.00  ? 191 LYS F N     1 
ATOM 8945  C CA    . LYS H 4 154 ? 131.204 3.330   -15.560 1.00 96.36  ? 191 LYS F CA    1 
ATOM 8946  C C     . LYS H 4 154 ? 131.948 3.412   -14.215 1.00 97.18  ? 191 LYS F C     1 
ATOM 8947  O O     . LYS H 4 154 ? 131.593 4.233   -13.362 1.00 82.70  ? 191 LYS F O     1 
ATOM 8948  C CB    . LYS H 4 154 ? 129.986 2.406   -15.420 1.00 69.88  ? 191 LYS F CB    1 
ATOM 8949  C CG    . LYS H 4 154 ? 128.919 2.947   -14.464 1.00 69.42  ? 191 LYS F CG    1 
ATOM 8950  C CD    . LYS H 4 154 ? 128.242 4.195   -15.046 1.00 67.23  ? 191 LYS F CD    1 
ATOM 8951  C CE    . LYS H 4 154 ? 127.488 5.016   -13.995 1.00 66.21  ? 191 LYS F CE    1 
ATOM 8952  N NZ    . LYS H 4 154 ? 128.392 5.829   -13.127 1.00 64.67  ? 191 LYS F NZ    1 
ATOM 8953  N N     . GLU H 4 155 ? 132.983 2.597   -14.017 1.00 63.13  ? 192 GLU F N     1 
ATOM 8954  C CA    . GLU H 4 155 ? 133.692 2.627   -12.736 1.00 63.73  ? 192 GLU F CA    1 
ATOM 8955  C C     . GLU H 4 155 ? 134.533 3.875   -12.442 1.00 62.91  ? 192 GLU F C     1 
ATOM 8956  O O     . GLU H 4 155 ? 134.807 4.161   -11.280 1.00 107.37 ? 192 GLU F O     1 
ATOM 8957  C CB    . GLU H 4 155 ? 134.536 1.357   -12.543 1.00 112.06 ? 192 GLU F CB    1 
ATOM 8958  C CG    . GLU H 4 155 ? 135.461 1.013   -13.686 1.00 113.54 ? 192 GLU F CG    1 
ATOM 8959  C CD    . GLU H 4 155 ? 136.410 2.137   -14.020 1.00 114.77 ? 192 GLU F CD    1 
ATOM 8960  O OE1   . GLU H 4 155 ? 137.106 2.621   -13.101 1.00 116.90 ? 192 GLU F OE1   1 
ATOM 8961  O OE2   . GLU H 4 155 ? 136.459 2.534   -15.203 1.00 114.89 ? 192 GLU F OE2   1 
ATOM 8962  N N     . ILE H 4 156 ? 134.947 4.617   -13.468 1.00 71.38  ? 193 ILE F N     1 
ATOM 8963  C CA    . ILE H 4 156 ? 135.715 5.841   -13.221 1.00 70.19  ? 193 ILE F CA    1 
ATOM 8964  C C     . ILE H 4 156 ? 134.731 6.933   -12.832 1.00 70.17  ? 193 ILE F C     1 
ATOM 8965  O O     . ILE H 4 156 ? 134.948 7.646   -11.853 1.00 86.16  ? 193 ILE F O     1 
ATOM 8966  C CB    . ILE H 4 156 ? 136.514 6.322   -14.461 1.00 81.16  ? 193 ILE F CB    1 
ATOM 8967  C CG1   . ILE H 4 156 ? 135.638 6.238   -15.713 1.00 79.85  ? 193 ILE F CG1   1 
ATOM 8968  C CG2   . ILE H 4 156 ? 137.812 5.530   -14.586 1.00 80.97  ? 193 ILE F CG2   1 
ATOM 8969  C CD1   . ILE H 4 156 ? 136.334 6.676   -16.979 1.00 79.66  ? 193 ILE F CD1   1 
ATOM 8970  N N     . ILE H 4 157 ? 133.647 7.052   -13.599 1.00 95.74  ? 194 ILE F N     1 
ATOM 8971  C CA    . ILE H 4 157 ? 132.612 8.047   -13.335 1.00 95.73  ? 194 ILE F CA    1 
ATOM 8972  C C     . ILE H 4 157 ? 132.074 7.915   -11.905 1.00 97.93  ? 194 ILE F C     1 
ATOM 8973  O O     . ILE H 4 157 ? 132.161 8.861   -11.111 1.00 65.21  ? 194 ILE F O     1 
ATOM 8974  C CB    . ILE H 4 157 ? 131.473 7.920   -14.381 1.00 55.07  ? 194 ILE F CB    1 
ATOM 8975  C CG1   . ILE H 4 157 ? 131.924 8.598   -15.682 1.00 56.60  ? 194 ILE F CG1   1 
ATOM 8976  C CG2   . ILE H 4 157 ? 130.182 8.523   -13.855 1.00 54.26  ? 194 ILE F CG2   1 
ATOM 8977  C CD1   . ILE H 4 157 ? 130.930 8.503   -16.835 1.00 53.20  ? 194 ILE F CD1   1 
ATOM 8978  N N     . ARG H 4 158 ? 131.546 6.738   -11.572 1.00 106.16 ? 195 ARG F N     1 
ATOM 8979  C CA    . ARG H 4 158 ? 131.009 6.488   -10.234 1.00 106.44 ? 195 ARG F CA    1 
ATOM 8980  C C     . ARG H 4 158 ? 132.078 6.715   -9.155  1.00 107.58 ? 195 ARG F C     1 
ATOM 8981  O O     . ARG H 4 158 ? 131.791 7.257   -8.087  1.00 88.00  ? 195 ARG F O     1 
ATOM 8982  C CB    . ARG H 4 158 ? 130.461 5.059   -10.151 1.00 83.82  ? 195 ARG F CB    1 
ATOM 8983  C CG    . ARG H 4 158 ? 129.511 4.825   -8.988  1.00 79.70  ? 195 ARG F CG    1 
ATOM 8984  C CD    . ARG H 4 158 ? 128.323 3.987   -9.440  1.00 75.11  ? 195 ARG F CD    1 
ATOM 8985  N NE    . ARG H 4 158 ? 127.333 3.768   -8.386  1.00 69.53  ? 195 ARG F NE    1 
ATOM 8986  C CZ    . ARG H 4 158 ? 127.591 3.165   -7.228  1.00 66.88  ? 195 ARG F CZ    1 
ATOM 8987  N NH1   . ARG H 4 158 ? 128.815 2.723   -6.968  1.00 65.84  ? 195 ARG F NH1   1 
ATOM 8988  N NH2   . ARG H 4 158 ? 126.624 2.982   -6.339  1.00 67.00  ? 195 ARG F NH2   1 
ATOM 8989  N N     . GLN H 4 159 ? 133.309 6.305   -9.446  1.00 72.98  ? 196 GLN F N     1 
ATOM 8990  C CA    . GLN H 4 159 ? 134.429 6.473   -8.523  1.00 73.12  ? 196 GLN F CA    1 
ATOM 8991  C C     . GLN H 4 159 ? 134.839 7.942   -8.464  1.00 71.14  ? 196 GLN F C     1 
ATOM 8992  O O     . GLN H 4 159 ? 135.431 8.393   -7.486  1.00 108.23 ? 196 GLN F O     1 
ATOM 8993  C CB    . GLN H 4 159 ? 135.617 5.623   -8.994  1.00 116.01 ? 196 GLN F CB    1 
ATOM 8994  C CG    . GLN H 4 159 ? 136.846 5.622   -8.083  1.00 116.01 ? 196 GLN F CG    1 
ATOM 8995  C CD    . GLN H 4 159 ? 137.687 6.881   -8.193  1.00 116.01 ? 196 GLN F CD    1 
ATOM 8996  O OE1   . GLN H 4 159 ? 138.109 7.271   -9.283  1.00 116.01 ? 196 GLN F OE1   1 
ATOM 8997  N NE2   . GLN H 4 159 ? 137.944 7.517   -7.057  1.00 116.01 ? 196 GLN F NE2   1 
ATOM 8998  N N     . ALA H 4 160 ? 134.537 8.681   -9.526  1.00 63.13  ? 197 ALA F N     1 
ATOM 8999  C CA    . ALA H 4 160 ? 134.862 10.102  -9.590  1.00 63.78  ? 197 ALA F CA    1 
ATOM 9000  C C     . ALA H 4 160 ? 133.824 10.832  -8.763  1.00 62.85  ? 197 ALA F C     1 
ATOM 9001  O O     . ALA H 4 160 ? 134.066 11.912  -8.222  1.00 64.39  ? 197 ALA F O     1 
ATOM 9002  C CB    . ALA H 4 160 ? 134.815 10.588  -11.026 1.00 71.86  ? 197 ALA F CB    1 
ATOM 9003  N N     . ALA H 4 161 ? 132.655 10.223  -8.677  1.00 56.46  ? 198 ALA F N     1 
ATOM 9004  C CA    . ALA H 4 161 ? 131.576 10.792  -7.906  1.00 58.12  ? 198 ALA F CA    1 
ATOM 9005  C C     . ALA H 4 161 ? 131.782 10.484  -6.417  1.00 60.07  ? 198 ALA F C     1 
ATOM 9006  O O     . ALA H 4 161 ? 130.980 10.906  -5.585  1.00 95.36  ? 198 ALA F O     1 
ATOM 9007  C CB    . ALA H 4 161 ? 130.241 10.228  -8.386  1.00 90.83  ? 198 ALA F CB    1 
ATOM 9008  N N     . VAL H 4 162 ? 132.851 9.757   -6.078  1.00 116.59 ? 199 VAL F N     1 
ATOM 9009  C CA    . VAL H 4 162 ? 133.109 9.415   -4.672  1.00 117.45 ? 199 VAL F CA    1 
ATOM 9010  C C     . VAL H 4 162 ? 134.187 10.270  -4.008  1.00 115.06 ? 199 VAL F C     1 
ATOM 9011  O O     . VAL H 4 162 ? 134.216 10.398  -2.782  1.00 106.02 ? 199 VAL F O     1 
ATOM 9012  C CB    . VAL H 4 162 ? 133.494 7.912   -4.486  1.00 105.74 ? 199 VAL F CB    1 
ATOM 9013  C CG1   . VAL H 4 162 ? 132.590 7.036   -5.330  1.00 105.37 ? 199 VAL F CG1   1 
ATOM 9014  C CG2   . VAL H 4 162 ? 134.964 7.684   -4.815  1.00 107.82 ? 199 VAL F CG2   1 
ATOM 9015  N N     . GLN H 4 163 ? 135.077 10.850  -4.804  1.00 74.85  ? 200 GLN F N     1 
ATOM 9016  C CA    . GLN H 4 163 ? 136.120 11.691  -4.238  1.00 74.47  ? 200 GLN F CA    1 
ATOM 9017  C C     . GLN H 4 163 ? 135.824 13.179  -4.364  1.00 74.73  ? 200 GLN F C     1 
ATOM 9018  O O     . GLN H 4 163 ? 136.448 13.995  -3.686  1.00 70.88  ? 200 GLN F O     1 
ATOM 9019  C CB    . GLN H 4 163 ? 137.474 11.365  -4.867  1.00 79.29  ? 200 GLN F CB    1 
ATOM 9020  C CG    . GLN H 4 163 ? 138.000 10.001  -4.449  1.00 76.79  ? 200 GLN F CG    1 
ATOM 9021  C CD    . GLN H 4 163 ? 137.691 9.670   -2.989  1.00 77.83  ? 200 GLN F CD    1 
ATOM 9022  O OE1   . GLN H 4 163 ? 138.030 10.425  -2.074  1.00 76.51  ? 200 GLN F OE1   1 
ATOM 9023  N NE2   . GLN H 4 163 ? 137.042 8.532   -2.771  1.00 78.77  ? 200 GLN F NE2   1 
ATOM 9024  N N     . GLN H 4 164 ? 134.873 13.533  -5.228  1.00 96.52  ? 201 GLN F N     1 
ATOM 9025  C CA    . GLN H 4 164 ? 134.498 14.938  -5.404  1.00 95.05  ? 201 GLN F CA    1 
ATOM 9026  C C     . GLN H 4 164 ? 133.344 15.232  -4.432  1.00 92.41  ? 201 GLN F C     1 
ATOM 9027  O O     . GLN H 4 164 ? 133.215 16.337  -3.899  1.00 52.77  ? 201 GLN F O     1 
ATOM 9028  C CB    . GLN H 4 164 ? 134.062 15.208  -6.857  1.00 57.08  ? 201 GLN F CB    1 
ATOM 9029  C CG    . GLN H 4 164 ? 134.223 16.676  -7.330  1.00 61.98  ? 201 GLN F CG    1 
ATOM 9030  C CD    . GLN H 4 164 ? 133.026 17.186  -8.137  1.00 64.21  ? 201 GLN F CD    1 
ATOM 9031  O OE1   . GLN H 4 164 ? 132.067 17.726  -7.580  1.00 65.98  ? 201 GLN F OE1   1 
ATOM 9032  N NE2   . GLN H 4 164 ? 133.075 16.998  -9.451  1.00 64.25  ? 201 GLN F NE2   1 
ATOM 9033  N N     . THR H 4 165 ? 132.524 14.218  -4.191  1.00 68.32  ? 202 THR F N     1 
ATOM 9034  C CA    . THR H 4 165 ? 131.391 14.338  -3.289  1.00 68.85  ? 202 THR F CA    1 
ATOM 9035  C C     . THR H 4 165 ? 131.856 14.532  -1.846  1.00 67.93  ? 202 THR F C     1 
ATOM 9036  O O     . THR H 4 165 ? 131.076 14.931  -0.981  1.00 96.63  ? 202 THR F O     1 
ATOM 9037  C CB    . THR H 4 165 ? 130.511 13.072  -3.365  1.00 101.40 ? 202 THR F CB    1 
ATOM 9038  O OG1   . THR H 4 165 ? 129.357 13.229  -2.532  1.00 101.20 ? 202 THR F OG1   1 
ATOM 9039  C CG2   . THR H 4 165 ? 131.300 11.850  -2.912  1.00 102.94 ? 202 THR F CG2   1 
ATOM 9040  N N     . LYS H 4 166 ? 133.127 14.246  -1.584  1.00 76.69  ? 203 LYS F N     1 
ATOM 9041  C CA    . LYS H 4 166 ? 133.660 14.384  -0.231  1.00 75.51  ? 203 LYS F CA    1 
ATOM 9042  C C     . LYS H 4 166 ? 134.184 15.782  0.029   1.00 77.76  ? 203 LYS F C     1 
ATOM 9043  O O     . LYS H 4 166 ? 134.212 16.234  1.169   1.00 91.30  ? 203 LYS F O     1 
ATOM 9044  C CB    . LYS H 4 166 ? 134.788 13.378  0.012   1.00 92.04  ? 203 LYS F CB    1 
ATOM 9045  C CG    . LYS H 4 166 ? 135.213 13.240  1.476   1.00 86.25  ? 203 LYS F CG    1 
ATOM 9046  C CD    . LYS H 4 166 ? 134.049 12.762  2.342   1.00 78.20  ? 203 LYS F CD    1 
ATOM 9047  C CE    . LYS H 4 166 ? 134.521 11.987  3.568   1.00 75.89  ? 203 LYS F CE    1 
ATOM 9048  N NZ    . LYS H 4 166 ? 135.365 12.790  4.492   1.00 71.89  ? 203 LYS F NZ    1 
ATOM 9049  N N     . GLU H 4 167 ? 134.596 16.458  -1.039  1.00 92.80  ? 204 GLU F N     1 
ATOM 9050  C CA    . GLU H 4 167 ? 135.142 17.812  -0.957  1.00 94.65  ? 204 GLU F CA    1 
ATOM 9051  C C     . GLU H 4 167 ? 134.086 18.853  -1.318  1.00 97.27  ? 204 GLU F C     1 
ATOM 9052  O O     . GLU H 4 167 ? 134.134 20.001  -0.863  1.00 94.30  ? 204 GLU F O     1 
ATOM 9053  C CB    . GLU H 4 167 ? 136.343 17.931  -1.910  1.00 89.16  ? 204 GLU F CB    1 
ATOM 9054  C CG    . GLU H 4 167 ? 136.022 17.587  -3.372  1.00 87.49  ? 204 GLU F CG    1 
ATOM 9055  C CD    . GLU H 4 167 ? 137.263 17.361  -4.230  1.00 87.82  ? 204 GLU F CD    1 
ATOM 9056  O OE1   . GLU H 4 167 ? 138.066 16.468  -3.890  1.00 88.36  ? 204 GLU F OE1   1 
ATOM 9057  O OE2   . GLU H 4 167 ? 137.431 18.067  -5.249  1.00 87.21  ? 204 GLU F OE2   1 
ATOM 9058  N N     . MET H 4 168 ? 133.137 18.430  -2.144  1.00 88.29  ? 205 MET F N     1 
ATOM 9059  C CA    . MET H 4 168 ? 132.048 19.278  -2.599  1.00 92.38  ? 205 MET F CA    1 
ATOM 9060  C C     . MET H 4 168 ? 131.562 20.249  -1.526  1.00 92.61  ? 205 MET F C     1 
ATOM 9061  O O     . MET H 4 168 ? 131.364 19.879  -0.369  1.00 83.33  ? 205 MET F O     1 
ATOM 9062  C CB    . MET H 4 168 ? 130.876 18.404  -3.060  1.00 99.05  ? 205 MET F CB    1 
ATOM 9063  C CG    . MET H 4 168 ? 129.677 19.169  -3.614  1.00 103.86 ? 205 MET F CG    1 
ATOM 9064  S SD    . MET H 4 168 ? 130.024 19.980  -5.197  1.00 108.32 ? 205 MET F SD    1 
ATOM 9065  C CE    . MET H 4 168 ? 129.706 18.634  -6.339  1.00 109.63 ? 205 MET F CE    1 
ATOM 9066  N N     . ASP H 4 169 ? 131.380 21.498  -1.929  1.00 77.32  ? 206 ASP F N     1 
ATOM 9067  C CA    . ASP H 4 169 ? 130.889 22.541  -1.040  1.00 77.65  ? 206 ASP F CA    1 
ATOM 9068  C C     . ASP H 4 169 ? 129.522 22.924  -1.590  1.00 76.48  ? 206 ASP F C     1 
ATOM 9069  O O     . ASP H 4 169 ? 129.418 23.450  -2.698  1.00 102.28 ? 206 ASP F O     1 
ATOM 9070  C CB    . ASP H 4 169 ? 131.844 23.732  -1.069  1.00 112.38 ? 206 ASP F CB    1 
ATOM 9071  C CG    . ASP H 4 169 ? 132.557 23.867  -2.399  1.00 113.84 ? 206 ASP F CG    1 
ATOM 9072  O OD1   . ASP H 4 169 ? 131.864 24.016  -3.433  1.00 113.80 ? 206 ASP F OD1   1 
ATOM 9073  O OD2   . ASP H 4 169 ? 133.809 23.813  -2.411  1.00 114.82 ? 206 ASP F OD2   1 
ATOM 9074  N N     . LEU H 4 170 ? 128.479 22.658  -0.811  1.00 100.14 ? 207 LEU F N     1 
ATOM 9075  C CA    . LEU H 4 170 ? 127.109 22.923  -1.241  1.00 98.71  ? 207 LEU F CA    1 
ATOM 9076  C C     . LEU H 4 170 ? 126.611 24.361  -1.127  1.00 97.66  ? 207 LEU F C     1 
ATOM 9077  O O     . LEU H 4 170 ? 125.431 24.624  -1.365  1.00 98.02  ? 207 LEU F O     1 
ATOM 9078  C CB    . LEU H 4 170 ? 126.143 22.003  -0.481  1.00 97.92  ? 207 LEU F CB    1 
ATOM 9079  C CG    . LEU H 4 170 ? 126.399 20.492  -0.516  1.00 96.74  ? 207 LEU F CG    1 
ATOM 9080  C CD1   . LEU H 4 170 ? 126.468 20.021  -1.960  1.00 98.51  ? 207 LEU F CD1   1 
ATOM 9081  C CD2   . LEU H 4 170 ? 127.692 20.159  0.217   1.00 96.30  ? 207 LEU F CD2   1 
ATOM 9082  N N     . SER H 4 171 ? 127.477 25.303  -0.775  1.00 83.97  ? 208 SER F N     1 
ATOM 9083  C CA    . SER H 4 171 ? 126.995 26.670  -0.648  1.00 82.84  ? 208 SER F CA    1 
ATOM 9084  C C     . SER H 4 171 ? 127.490 27.665  -1.701  1.00 82.00  ? 208 SER F C     1 
ATOM 9085  O O     . SER H 4 171 ? 127.102 28.835  -1.692  1.00 87.46  ? 208 SER F O     1 
ATOM 9086  C CB    . SER H 4 171 ? 127.264 27.176  0.773   1.00 83.18  ? 208 SER F CB    1 
ATOM 9087  O OG    . SER H 4 171 ? 126.408 26.514  1.702   1.00 81.63  ? 208 SER F OG    1 
ATOM 9088  N N     . VAL H 4 172 ? 128.312 27.187  -2.630  1.00 82.95  ? 209 VAL F N     1 
ATOM 9089  C CA    . VAL H 4 172 ? 128.849 28.032  -3.690  1.00 81.10  ? 209 VAL F CA    1 
ATOM 9090  C C     . VAL H 4 172 ? 128.876 27.259  -5.004  1.00 78.97  ? 209 VAL F C     1 
ATOM 9091  O O     . VAL H 4 172 ? 129.178 26.066  -5.022  1.00 112.00 ? 209 VAL F O     1 
ATOM 9092  C CB    . VAL H 4 172 ? 130.303 28.467  -3.383  1.00 109.43 ? 209 VAL F CB    1 
ATOM 9093  C CG1   . VAL H 4 172 ? 130.700 29.617  -4.288  1.00 109.88 ? 209 VAL F CG1   1 
ATOM 9094  C CG2   . VAL H 4 172 ? 130.447 28.848  -1.921  1.00 108.65 ? 209 VAL F CG2   1 
ATOM 9095  N N     . VAL H 4 173 ? 128.569 27.937  -6.102  1.00 27.27  ? 210 VAL F N     1 
ATOM 9096  C CA    . VAL H 4 173 ? 128.597 27.296  -7.414  1.00 27.55  ? 210 VAL F CA    1 
ATOM 9097  C C     . VAL H 4 173 ? 129.107 28.291  -8.458  1.00 29.00  ? 210 VAL F C     1 
ATOM 9098  O O     . VAL H 4 173 ? 129.346 29.461  -8.147  1.00 81.48  ? 210 VAL F O     1 
ATOM 9099  C CB    . VAL H 4 173 ? 127.188 26.788  -7.839  1.00 69.75  ? 210 VAL F CB    1 
ATOM 9100  C CG1   . VAL H 4 173 ? 126.385 27.917  -8.482  1.00 69.13  ? 210 VAL F CG1   1 
ATOM 9101  C CG2   . VAL H 4 173 ? 127.323 25.606  -8.788  1.00 67.06  ? 210 VAL F CG2   1 
ATOM 9102  N N     . ARG H 4 174 ? 129.268 27.819  -9.689  1.00 92.17  ? 211 ARG F N     1 
ATOM 9103  C CA    . ARG H 4 174 ? 129.750 28.655  -10.780 1.00 91.93  ? 211 ARG F CA    1 
ATOM 9104  C C     . ARG H 4 174 ? 129.174 28.189  -12.111 1.00 91.52  ? 211 ARG F C     1 
ATOM 9105  O O     . ARG H 4 174 ? 129.115 26.991  -12.387 1.00 54.75  ? 211 ARG F O     1 
ATOM 9106  C CB    . ARG H 4 174 ? 131.281 28.621  -10.835 1.00 55.58  ? 211 ARG F CB    1 
ATOM 9107  C CG    . ARG H 4 174 ? 131.943 29.176  -9.584  1.00 55.24  ? 211 ARG F CG    1 
ATOM 9108  C CD    . ARG H 4 174 ? 133.433 29.280  -9.746  1.00 58.39  ? 211 ARG F CD    1 
ATOM 9109  N NE    . ARG H 4 174 ? 134.018 27.973  -9.991  1.00 58.77  ? 211 ARG F NE    1 
ATOM 9110  C CZ    . ARG H 4 174 ? 135.320 27.769  -10.117 1.00 59.69  ? 211 ARG F CZ    1 
ATOM 9111  N NH1   . ARG H 4 174 ? 136.151 28.792  -10.017 1.00 58.40  ? 211 ARG F NH1   1 
ATOM 9112  N NH2   . ARG H 4 174 ? 135.791 26.553  -10.340 1.00 58.12  ? 211 ARG F NH2   1 
ATOM 9113  N N     . LEU H 4 175 ? 128.743 29.145  -12.927 1.00 76.02  ? 212 LEU F N     1 
ATOM 9114  C CA    . LEU H 4 175 ? 128.174 28.834  -14.231 1.00 73.97  ? 212 LEU F CA    1 
ATOM 9115  C C     . LEU H 4 175 ? 129.260 28.301  -15.154 1.00 75.19  ? 212 LEU F C     1 
ATOM 9116  O O     . LEU H 4 175 ? 130.440 28.609  -14.971 1.00 75.04  ? 212 LEU F O     1 
ATOM 9117  C CB    . LEU H 4 175 ? 127.572 30.089  -14.854 1.00 70.61  ? 212 LEU F CB    1 
ATOM 9118  C CG    . LEU H 4 175 ? 126.478 30.812  -14.079 1.00 69.52  ? 212 LEU F CG    1 
ATOM 9119  C CD1   . LEU H 4 175 ? 126.069 32.074  -14.841 1.00 67.58  ? 212 LEU F CD1   1 
ATOM 9120  C CD2   . LEU H 4 175 ? 125.288 29.872  -13.895 1.00 70.10  ? 212 LEU F CD2   1 
ATOM 9121  N N     . MET H 4 176 ? 128.861 27.508  -16.144 1.00 77.76  ? 213 MET F N     1 
ATOM 9122  C CA    . MET H 4 176 ? 129.809 26.954  -17.101 1.00 78.26  ? 213 MET F CA    1 
ATOM 9123  C C     . MET H 4 176 ? 129.299 27.102  -18.535 1.00 78.56  ? 213 MET F C     1 
ATOM 9124  O O     . MET H 4 176 ? 128.761 26.153  -19.110 1.00 84.30  ? 213 MET F O     1 
ATOM 9125  C CB    . MET H 4 176 ? 130.059 25.478  -16.800 1.00 93.31  ? 213 MET F CB    1 
ATOM 9126  C CG    . MET H 4 176 ? 131.075 24.833  -17.722 1.00 95.40  ? 213 MET F CG    1 
ATOM 9127  S SD    . MET H 4 176 ? 131.225 23.083  -17.406 1.00 97.64  ? 213 MET F SD    1 
ATOM 9128  C CE    . MET H 4 176 ? 129.637 22.485  -18.112 1.00 97.01  ? 213 MET F CE    1 
ATOM 9129  N N     . PHE H 4 177 ? 129.480 28.294  -19.100 1.00 80.55  ? 214 PHE F N     1 
ATOM 9130  C CA    . PHE H 4 177 ? 129.052 28.613  -20.462 1.00 81.38  ? 214 PHE F CA    1 
ATOM 9131  C C     . PHE H 4 177 ? 129.852 27.875  -21.524 1.00 82.25  ? 214 PHE F C     1 
ATOM 9132  O O     . PHE H 4 177 ? 131.062 28.062  -21.630 1.00 78.37  ? 214 PHE F O     1 
ATOM 9133  C CB    . PHE H 4 177 ? 129.185 30.118  -20.709 1.00 82.76  ? 214 PHE F CB    1 
ATOM 9134  C CG    . PHE H 4 177 ? 128.153 30.942  -20.000 1.00 84.59  ? 214 PHE F CG    1 
ATOM 9135  C CD1   . PHE H 4 177 ? 126.966 31.286  -20.634 1.00 84.34  ? 214 PHE F CD1   1 
ATOM 9136  C CD2   . PHE H 4 177 ? 128.358 31.354  -18.686 1.00 85.37  ? 214 PHE F CD2   1 
ATOM 9137  C CE1   . PHE H 4 177 ? 125.993 32.027  -19.968 1.00 82.25  ? 214 PHE F CE1   1 
ATOM 9138  C CE2   . PHE H 4 177 ? 127.391 32.096  -18.005 1.00 85.42  ? 214 PHE F CE2   1 
ATOM 9139  C CZ    . PHE H 4 177 ? 126.206 32.434  -18.646 1.00 83.91  ? 214 PHE F CZ    1 
ATOM 9140  N N     . THR H 4 178 ? 129.169 27.047  -22.313 1.00 91.09  ? 215 THR F N     1 
ATOM 9141  C CA    . THR H 4 178 ? 129.803 26.287  -23.391 1.00 88.83  ? 215 THR F CA    1 
ATOM 9142  C C     . THR H 4 178 ? 128.968 26.414  -24.665 1.00 88.59  ? 215 THR F C     1 
ATOM 9143  O O     . THR H 4 178 ? 127.768 26.151  -24.651 1.00 81.19  ? 215 THR F O     1 
ATOM 9144  C CB    . THR H 4 178 ? 129.928 24.796  -23.028 1.00 87.01  ? 215 THR F CB    1 
ATOM 9145  O OG1   . THR H 4 178 ? 130.765 24.653  -21.870 1.00 87.18  ? 215 THR F OG1   1 
ATOM 9146  C CG2   . THR H 4 178 ? 130.517 24.011  -24.194 1.00 87.43  ? 215 THR F CG2   1 
ATOM 9147  N N     . ALA H 4 179 ? 129.600 26.813  -25.768 1.00 83.28  ? 216 ALA F N     1 
ATOM 9148  C CA    . ALA H 4 179 ? 128.868 26.980  -27.023 1.00 84.70  ? 216 ALA F CA    1 
ATOM 9149  C C     . ALA H 4 179 ? 129.236 25.958  -28.086 1.00 86.40  ? 216 ALA F C     1 
ATOM 9150  O O     . ALA H 4 179 ? 130.401 25.580  -28.232 1.00 73.62  ? 216 ALA F O     1 
ATOM 9151  C CB    . ALA H 4 179 ? 129.058 28.398  -27.571 1.00 63.30  ? 216 ALA F CB    1 
ATOM 9152  N N     . PHE H 4 180 ? 128.213 25.509  -28.813 1.00 121.25 ? 217 PHE F N     1 
ATOM 9153  C CA    . PHE H 4 180 ? 128.357 24.530  -29.893 1.00 120.61 ? 217 PHE F CA    1 
ATOM 9154  C C     . PHE H 4 180 ? 127.913 25.122  -31.226 1.00 119.14 ? 217 PHE F C     1 
ATOM 9155  O O     . PHE H 4 180 ? 126.758 25.521  -31.393 1.00 117.74 ? 217 PHE F O     1 
ATOM 9156  C CB    . PHE H 4 180 ? 127.521 23.270  -29.626 1.00 118.13 ? 217 PHE F CB    1 
ATOM 9157  C CG    . PHE H 4 180 ? 128.221 22.228  -28.797 1.00 118.13 ? 217 PHE F CG    1 
ATOM 9158  C CD1   . PHE H 4 180 ? 128.298 22.350  -27.414 1.00 118.13 ? 217 PHE F CD1   1 
ATOM 9159  C CD2   . PHE H 4 180 ? 128.803 21.118  -29.405 1.00 118.13 ? 217 PHE F CD2   1 
ATOM 9160  C CE1   . PHE H 4 180 ? 128.945 21.381  -26.646 1.00 118.13 ? 217 PHE F CE1   1 
ATOM 9161  C CE2   . PHE H 4 180 ? 129.451 20.144  -28.649 1.00 118.13 ? 217 PHE F CE2   1 
ATOM 9162  C CZ    . PHE H 4 180 ? 129.522 20.276  -27.267 1.00 118.13 ? 217 PHE F CZ    1 
ATOM 9163  N N     . LEU H 4 181 ? 128.838 25.161  -32.177 1.00 86.09  ? 218 LEU F N     1 
ATOM 9164  C CA    . LEU H 4 181 ? 128.548 25.700  -33.492 1.00 87.32  ? 218 LEU F CA    1 
ATOM 9165  C C     . LEU H 4 181 ? 128.188 24.548  -34.412 1.00 89.21  ? 218 LEU F C     1 
ATOM 9166  O O     . LEU H 4 181 ? 128.799 23.478  -34.338 1.00 72.52  ? 218 LEU F O     1 
ATOM 9167  C CB    . LEU H 4 181 ? 129.777 26.411  -34.052 1.00 69.68  ? 218 LEU F CB    1 
ATOM 9168  C CG    . LEU H 4 181 ? 130.540 27.337  -33.109 1.00 69.00  ? 218 LEU F CG    1 
ATOM 9169  C CD1   . LEU H 4 181 ? 131.787 27.858  -33.823 1.00 67.84  ? 218 LEU F CD1   1 
ATOM 9170  C CD2   . LEU H 4 181 ? 129.629 28.475  -32.641 1.00 68.29  ? 218 LEU F CD2   1 
ATOM 9171  N N     . PRO H 4 182 ? 127.196 24.747  -35.297 1.00 95.74  ? 219 PRO F N     1 
ATOM 9172  C CA    . PRO H 4 182 ? 126.797 23.679  -36.221 1.00 94.90  ? 219 PRO F CA    1 
ATOM 9173  C C     . PRO H 4 182 ? 128.008 23.077  -36.956 1.00 92.89  ? 219 PRO F C     1 
ATOM 9174  O O     . PRO H 4 182 ? 129.111 23.631  -36.906 1.00 61.81  ? 219 PRO F O     1 
ATOM 9175  C CB    . PRO H 4 182 ? 125.823 24.389  -37.164 1.00 69.21  ? 219 PRO F CB    1 
ATOM 9176  C CG    . PRO H 4 182 ? 125.177 25.413  -36.270 1.00 68.33  ? 219 PRO F CG    1 
ATOM 9177  C CD    . PRO H 4 182 ? 126.347 25.945  -35.464 1.00 68.24  ? 219 PRO F CD    1 
ATOM 9178  N N     . ASP H 4 183 ? 127.802 21.936  -37.612 1.00 107.84 ? 220 ASP F N     1 
ATOM 9179  C CA    . ASP H 4 183 ? 128.871 21.281  -38.367 1.00 105.13 ? 220 ASP F CA    1 
ATOM 9180  C C     . ASP H 4 183 ? 128.398 20.898  -39.770 1.00 102.53 ? 220 ASP F C     1 
ATOM 9181  O O     . ASP H 4 183 ? 127.416 21.449  -40.273 1.00 90.64  ? 220 ASP F O     1 
ATOM 9182  C CB    . ASP H 4 183 ? 129.419 20.047  -37.613 1.00 92.08  ? 220 ASP F CB    1 
ATOM 9183  C CG    . ASP H 4 183 ? 128.379 18.943  -37.409 1.00 93.06  ? 220 ASP F CG    1 
ATOM 9184  O OD1   . ASP H 4 183 ? 127.361 19.174  -36.726 1.00 93.21  ? 220 ASP F OD1   1 
ATOM 9185  O OD2   . ASP H 4 183 ? 128.595 17.826  -37.924 1.00 90.26  ? 220 ASP F OD2   1 
ATOM 9186  N N     . SER H 4 184 ? 129.092 19.960  -40.403 1.00 82.85  ? 221 SER F N     1 
ATOM 9187  C CA    . SER H 4 184 ? 128.734 19.535  -41.754 1.00 80.39  ? 221 SER F CA    1 
ATOM 9188  C C     . SER H 4 184 ? 127.338 18.912  -41.836 1.00 79.18  ? 221 SER F C     1 
ATOM 9189  O O     . SER H 4 184 ? 126.587 19.172  -42.784 1.00 72.15  ? 221 SER F O     1 
ATOM 9190  C CB    . SER H 4 184 ? 129.783 18.550  -42.273 1.00 71.75  ? 221 SER F CB    1 
ATOM 9191  O OG    . SER H 4 184 ? 131.069 19.153  -42.275 1.00 70.62  ? 221 SER F OG    1 
ATOM 9192  N N     . THR H 4 185 ? 126.998 18.096  -40.841 1.00 79.66  ? 222 THR F N     1 
ATOM 9193  C CA    . THR H 4 185 ? 125.698 17.435  -40.789 1.00 78.98  ? 222 THR F CA    1 
ATOM 9194  C C     . THR H 4 185 ? 124.623 18.409  -40.280 1.00 80.58  ? 222 THR F C     1 
ATOM 9195  O O     . THR H 4 185 ? 123.478 18.023  -40.053 1.00 88.25  ? 222 THR F O     1 
ATOM 9196  C CB    . THR H 4 185 ? 125.767 16.177  -39.879 1.00 63.17  ? 222 THR F CB    1 
ATOM 9197  O OG1   . THR H 4 185 ? 126.790 15.294  -40.362 1.00 62.07  ? 222 THR F OG1   1 
ATOM 9198  C CG2   . THR H 4 185 ? 124.443 15.434  -39.877 1.00 62.16  ? 222 THR F CG2   1 
ATOM 9199  N N     . GLY H 4 186 ? 124.999 19.676  -40.117 1.00 78.06  ? 223 GLY F N     1 
ATOM 9200  C CA    . GLY H 4 186 ? 124.060 20.681  -39.646 1.00 79.19  ? 223 GLY F CA    1 
ATOM 9201  C C     . GLY H 4 186 ? 123.879 20.640  -38.140 1.00 80.95  ? 223 GLY F C     1 
ATOM 9202  O O     . GLY H 4 186 ? 123.249 21.520  -37.548 1.00 92.59  ? 223 GLY F O     1 
ATOM 9203  N N     . SER H 4 187 ? 124.440 19.606  -37.524 1.00 48.65  ? 224 SER F N     1 
ATOM 9204  C CA    . SER H 4 187 ? 124.370 19.409  -36.080 1.00 51.53  ? 224 SER F CA    1 
ATOM 9205  C C     . SER H 4 187 ? 125.358 20.334  -35.362 1.00 53.84  ? 224 SER F C     1 
ATOM 9206  O O     . SER H 4 187 ? 126.184 20.977  -35.999 1.00 53.71  ? 224 SER F O     1 
ATOM 9207  C CB    . SER H 4 187 ? 124.689 17.948  -35.762 1.00 52.49  ? 224 SER F CB    1 
ATOM 9208  O OG    . SER H 4 187 ? 123.917 17.086  -36.581 1.00 53.25  ? 224 SER F OG    1 
ATOM 9209  N N     . PHE H 4 188 ? 125.284 20.390  -34.037 1.00 97.69  ? 225 PHE F N     1 
ATOM 9210  C CA    . PHE H 4 188 ? 126.179 21.254  -33.268 1.00 98.57  ? 225 PHE F CA    1 
ATOM 9211  C C     . PHE H 4 188 ? 127.211 20.447  -32.473 1.00 98.98  ? 225 PHE F C     1 
ATOM 9212  O O     . PHE H 4 188 ? 126.989 20.128  -31.305 1.00 119.94 ? 225 PHE F O     1 
ATOM 9213  C CB    . PHE H 4 188 ? 125.349 22.126  -32.324 1.00 119.58 ? 225 PHE F CB    1 
ATOM 9214  C CG    . PHE H 4 188 ? 124.327 22.975  -33.029 1.00 119.55 ? 225 PHE F CG    1 
ATOM 9215  C CD1   . PHE H 4 188 ? 124.458 24.361  -33.056 1.00 118.34 ? 225 PHE F CD1   1 
ATOM 9216  C CD2   . PHE H 4 188 ? 123.233 22.393  -33.662 1.00 118.13 ? 225 PHE F CD2   1 
ATOM 9217  C CE1   . PHE H 4 188 ? 123.508 25.159  -33.703 1.00 118.24 ? 225 PHE F CE1   1 
ATOM 9218  C CE2   . PHE H 4 188 ? 122.280 23.178  -34.313 1.00 117.24 ? 225 PHE F CE2   1 
ATOM 9219  C CZ    . PHE H 4 188 ? 122.419 24.566  -34.333 1.00 117.49 ? 225 PHE F CZ    1 
ATOM 9220  N N     . THR H 4 189 ? 128.345 20.140  -33.104 1.00 96.25  ? 226 THR F N     1 
ATOM 9221  C CA    . THR H 4 189 ? 129.391 19.339  -32.463 1.00 93.18  ? 226 THR F CA    1 
ATOM 9222  C C     . THR H 4 189 ? 130.724 20.033  -32.138 1.00 92.78  ? 226 THR F C     1 
ATOM 9223  O O     . THR H 4 189 ? 131.579 19.451  -31.464 1.00 59.13  ? 226 THR F O     1 
ATOM 9224  C CB    . THR H 4 189 ? 129.685 18.055  -33.305 1.00 66.84  ? 226 THR F CB    1 
ATOM 9225  O OG1   . THR H 4 189 ? 130.659 17.252  -32.629 1.00 66.91  ? 226 THR F OG1   1 
ATOM 9226  C CG2   . THR H 4 189 ? 130.211 18.411  -34.692 1.00 64.03  ? 226 THR F CG2   1 
ATOM 9227  N N     . ARG H 4 190 ? 130.911 21.266  -32.598 1.00 105.58 ? 227 ARG F N     1 
ATOM 9228  C CA    . ARG H 4 190 ? 132.158 21.983  -32.325 1.00 106.65 ? 227 ARG F CA    1 
ATOM 9229  C C     . ARG H 4 190 ? 132.133 22.642  -30.943 1.00 107.30 ? 227 ARG F C     1 
ATOM 9230  O O     . ARG H 4 190 ? 131.456 23.656  -30.742 1.00 88.77  ? 227 ARG F O     1 
ATOM 9231  C CB    . ARG H 4 190 ? 132.405 23.042  -33.404 1.00 93.08  ? 227 ARG F CB    1 
ATOM 9232  C CG    . ARG H 4 190 ? 133.670 23.874  -33.199 1.00 94.23  ? 227 ARG F CG    1 
ATOM 9233  C CD    . ARG H 4 190 ? 134.884 23.315  -33.942 1.00 93.96  ? 227 ARG F CD    1 
ATOM 9234  N NE    . ARG H 4 190 ? 136.063 24.169  -33.768 1.00 94.82  ? 227 ARG F NE    1 
ATOM 9235  C CZ    . ARG H 4 190 ? 137.186 24.059  -34.476 1.00 94.72  ? 227 ARG F CZ    1 
ATOM 9236  N NH1   . ARG H 4 190 ? 137.292 23.130  -35.416 1.00 94.32  ? 227 ARG F NH1   1 
ATOM 9237  N NH2   . ARG H 4 190 ? 138.205 24.876  -34.246 1.00 95.55  ? 227 ARG F NH2   1 
ATOM 9238  N N     . ARG H 4 191 ? 132.875 22.061  -29.998 1.00 111.23 ? 228 ARG F N     1 
ATOM 9239  C CA    . ARG H 4 191 ? 132.935 22.582  -28.628 1.00 111.20 ? 228 ARG F CA    1 
ATOM 9240  C C     . ARG H 4 191 ? 133.835 23.809  -28.472 1.00 111.24 ? 228 ARG F C     1 
ATOM 9241  O O     . ARG H 4 191 ? 135.047 23.759  -28.692 1.00 97.79  ? 228 ARG F O     1 
ATOM 9242  C CB    . ARG H 4 191 ? 133.356 21.474  -27.635 1.00 90.60  ? 228 ARG F CB    1 
ATOM 9243  C CG    . ARG H 4 191 ? 134.626 20.695  -27.998 1.00 92.94  ? 228 ARG F CG    1 
ATOM 9244  C CD    . ARG H 4 191 ? 135.892 21.405  -27.546 1.00 96.17  ? 228 ARG F CD    1 
ATOM 9245  N NE    . ARG H 4 191 ? 137.088 20.802  -28.128 1.00 97.61  ? 228 ARG F NE    1 
ATOM 9246  C CZ    . ARG H 4 191 ? 138.326 21.236  -27.913 1.00 97.10  ? 228 ARG F CZ    1 
ATOM 9247  N NH1   . ARG H 4 191 ? 138.540 22.282  -27.126 1.00 96.17  ? 228 ARG F NH1   1 
ATOM 9248  N NH2   . ARG H 4 191 ? 139.354 20.624  -28.488 1.00 96.50  ? 228 ARG F NH2   1 
ATOM 9249  N N     . LEU H 4 192 ? 133.209 24.917  -28.095 1.00 89.12  ? 229 LEU F N     1 
ATOM 9250  C CA    . LEU H 4 192 ? 133.901 26.178  -27.892 1.00 88.92  ? 229 LEU F CA    1 
ATOM 9251  C C     . LEU H 4 192 ? 134.347 26.259  -26.442 1.00 89.56  ? 229 LEU F C     1 
ATOM 9252  O O     . LEU H 4 192 ? 133.510 26.195  -25.544 1.00 71.63  ? 229 LEU F O     1 
ATOM 9253  C CB    . LEU H 4 192 ? 132.952 27.332  -28.208 1.00 73.84  ? 229 LEU F CB    1 
ATOM 9254  C CG    . LEU H 4 192 ? 132.765 27.742  -29.673 1.00 72.89  ? 229 LEU F CG    1 
ATOM 9255  C CD1   . LEU H 4 192 ? 132.903 26.548  -30.611 1.00 72.35  ? 229 LEU F CD1   1 
ATOM 9256  C CD2   . LEU H 4 192 ? 131.413 28.421  -29.804 1.00 71.68  ? 229 LEU F CD2   1 
ATOM 9257  N N     . GLU H 4 193 ? 135.654 26.408  -26.228 1.00 75.99  ? 230 GLU F N     1 
ATOM 9258  C CA    . GLU H 4 193 ? 136.237 26.481  -24.885 1.00 76.84  ? 230 GLU F CA    1 
ATOM 9259  C C     . GLU H 4 193 ? 135.271 27.115  -23.899 1.00 76.83  ? 230 GLU F C     1 
ATOM 9260  O O     . GLU H 4 193 ? 134.911 28.285  -24.029 1.00 54.46  ? 230 GLU F O     1 
ATOM 9261  C CB    . GLU H 4 193 ? 137.542 27.290  -24.903 1.00 60.18  ? 230 GLU F CB    1 
ATOM 9262  C CG    . GLU H 4 193 ? 138.618 26.855  -23.897 1.00 64.24  ? 230 GLU F CG    1 
ATOM 9263  C CD    . GLU H 4 193 ? 138.217 27.031  -22.434 1.00 66.34  ? 230 GLU F CD    1 
ATOM 9264  O OE1   . GLU H 4 193 ? 137.302 26.311  -21.972 1.00 66.48  ? 230 GLU F OE1   1 
ATOM 9265  O OE2   . GLU H 4 193 ? 138.828 27.887  -21.746 1.00 67.04  ? 230 GLU F OE2   1 
ATOM 9266  N N     . PRO H 4 194 ? 134.819 26.339  -22.906 1.00 89.94  ? 231 PRO F N     1 
ATOM 9267  C CA    . PRO H 4 194 ? 133.886 26.849  -21.900 1.00 88.49  ? 231 PRO F CA    1 
ATOM 9268  C C     . PRO H 4 194 ? 134.464 28.013  -21.099 1.00 86.36  ? 231 PRO F C     1 
ATOM 9269  O O     . PRO H 4 194 ? 135.681 28.149  -20.968 1.00 76.73  ? 231 PRO F O     1 
ATOM 9270  C CB    . PRO H 4 194 ? 133.620 25.626  -21.028 1.00 83.11  ? 231 PRO F CB    1 
ATOM 9271  C CG    . PRO H 4 194 ? 133.708 24.504  -22.010 1.00 84.67  ? 231 PRO F CG    1 
ATOM 9272  C CD    . PRO H 4 194 ? 134.936 24.873  -22.811 1.00 85.43  ? 231 PRO F CD    1 
ATOM 9273  N N     . VAL H 4 195 ? 133.584 28.853  -20.569 1.00 103.83 ? 232 VAL F N     1 
ATOM 9274  C CA    . VAL H 4 195 ? 134.009 30.001  -19.776 1.00 103.44 ? 232 VAL F CA    1 
ATOM 9275  C C     . VAL H 4 195 ? 133.233 30.058  -18.474 1.00 101.75 ? 232 VAL F C     1 
ATOM 9276  O O     . VAL H 4 195 ? 132.078 30.480  -18.451 1.00 73.11  ? 232 VAL F O     1 
ATOM 9277  C CB    . VAL H 4 195 ? 133.774 31.328  -20.519 1.00 78.43  ? 232 VAL F CB    1 
ATOM 9278  C CG1   . VAL H 4 195 ? 134.315 32.493  -19.687 1.00 80.45  ? 232 VAL F CG1   1 
ATOM 9279  C CG2   . VAL H 4 195 ? 134.425 31.274  -21.900 1.00 77.80  ? 232 VAL F CG2   1 
ATOM 9280  N N     . VAL H 4 196 ? 133.873 29.642  -17.389 1.00 67.27  ? 233 VAL F N     1 
ATOM 9281  C CA    . VAL H 4 196 ? 133.224 29.652  -16.084 1.00 66.83  ? 233 VAL F CA    1 
ATOM 9282  C C     . VAL H 4 196 ? 132.841 31.058  -15.610 1.00 66.61  ? 233 VAL F C     1 
ATOM 9283  O O     . VAL H 4 196 ? 133.514 32.046  -15.925 1.00 66.08  ? 233 VAL F O     1 
ATOM 9284  C CB    . VAL H 4 196 ? 134.130 29.006  -15.003 1.00 64.76  ? 233 VAL F CB    1 
ATOM 9285  C CG1   . VAL H 4 196 ? 134.343 27.527  -15.322 1.00 66.05  ? 233 VAL F CG1   1 
ATOM 9286  C CG2   . VAL H 4 196 ? 135.471 29.749  -14.929 1.00 62.81  ? 233 VAL F CG2   1 
ATOM 9287  N N     . SER H 4 197 ? 131.750 31.132  -14.853 1.00 59.50  ? 234 SER F N     1 
ATOM 9288  C CA    . SER H 4 197 ? 131.287 32.394  -14.304 1.00 61.93  ? 234 SER F CA    1 
ATOM 9289  C C     . SER H 4 197 ? 132.222 32.754  -13.169 1.00 62.46  ? 234 SER F C     1 
ATOM 9290  O O     . SER H 4 197 ? 133.198 32.052  -12.910 1.00 85.45  ? 234 SER F O     1 
ATOM 9291  C CB    . SER H 4 197 ? 129.860 32.266  -13.762 1.00 92.16  ? 234 SER F CB    1 
ATOM 9292  O OG    . SER H 4 197 ? 128.905 32.363  -14.802 1.00 90.42  ? 234 SER F OG    1 
ATOM 9293  N N     . ASP H 4 198 ? 131.912 33.846  -12.485 1.00 94.45  ? 235 ASP F N     1 
ATOM 9294  C CA    . ASP H 4 198 ? 132.730 34.311  -11.376 1.00 94.90  ? 235 ASP F CA    1 
ATOM 9295  C C     . ASP H 4 198 ? 132.639 33.397  -10.141 1.00 96.17  ? 235 ASP F C     1 
ATOM 9296  O O     . ASP H 4 198 ? 133.573 32.636  -9.846  1.00 55.59  ? 235 ASP F O     1 
ATOM 9297  C CB    . ASP H 4 198 ? 132.329 35.750  -11.032 1.00 51.95  ? 235 ASP F CB    1 
ATOM 9298  C CG    . ASP H 4 198 ? 131.137 36.236  -11.857 1.00 49.81  ? 235 ASP F CG    1 
ATOM 9299  O OD1   . ASP H 4 198 ? 131.255 36.323  -13.102 1.00 50.20  ? 235 ASP F OD1   1 
ATOM 9300  O OD2   . ASP H 4 198 ? 130.079 36.524  -11.254 1.00 45.58  ? 235 ASP F OD2   1 
ATOM 9301  N N     . ALA H 4 199 ? 131.517 33.466  -9.428  1.00 99.67  ? 236 ALA F N     1 
ATOM 9302  C CA    . ALA H 4 199 ? 131.320 32.654  -8.228  1.00 98.43  ? 236 ALA F CA    1 
ATOM 9303  C C     . ALA H 4 199 ? 130.082 33.136  -7.483  1.00 97.87  ? 236 ALA F C     1 
ATOM 9304  O O     . ALA H 4 199 ? 130.045 34.276  -7.027  1.00 78.74  ? 236 ALA F O     1 
ATOM 9305  C CB    . ALA H 4 199 ? 132.551 32.761  -7.316  1.00 71.34  ? 236 ALA F CB    1 
ATOM 9306  N N     . ILE H 4 200 ? 129.070 32.280  -7.359  1.00 75.34  ? 237 ILE F N     1 
ATOM 9307  C CA    . ILE H 4 200 ? 127.858 32.672  -6.654  1.00 76.18  ? 237 ILE F CA    1 
ATOM 9308  C C     . ILE H 4 200 ? 127.703 31.932  -5.323  1.00 74.11  ? 237 ILE F C     1 
ATOM 9309  O O     . ILE H 4 200 ? 127.878 30.708  -5.238  1.00 44.59  ? 237 ILE F O     1 
ATOM 9310  C CB    . ILE H 4 200 ? 126.609 32.480  -7.545  1.00 56.86  ? 237 ILE F CB    1 
ATOM 9311  C CG1   . ILE H 4 200 ? 126.620 33.526  -8.673  1.00 59.03  ? 237 ILE F CG1   1 
ATOM 9312  C CG2   . ILE H 4 200 ? 125.338 32.611  -6.709  1.00 56.52  ? 237 ILE F CG2   1 
ATOM 9313  C CD1   . ILE H 4 200 ? 127.814 33.428  -9.634  1.00 61.38  ? 237 ILE F CD1   1 
ATOM 9314  N N     . TYR H 4 201 ? 127.401 32.705  -4.282  1.00 67.38  ? 238 TYR F N     1 
ATOM 9315  C CA    . TYR H 4 201 ? 127.230 32.179  -2.933  1.00 65.10  ? 238 TYR F CA    1 
ATOM 9316  C C     . TYR H 4 201 ? 125.782 32.327  -2.494  1.00 62.80  ? 238 TYR F C     1 
ATOM 9317  O O     . TYR H 4 201 ? 125.107 33.278  -2.875  1.00 108.88 ? 238 TYR F O     1 
ATOM 9318  C CB    . TYR H 4 201 ? 128.112 32.937  -1.941  1.00 125.17 ? 238 TYR F CB    1 
ATOM 9319  C CG    . TYR H 4 201 ? 129.602 32.732  -2.095  1.00 125.17 ? 238 TYR F CG    1 
ATOM 9320  C CD1   . TYR H 4 201 ? 130.233 32.920  -3.326  1.00 125.17 ? 238 TYR F CD1   1 
ATOM 9321  C CD2   . TYR H 4 201 ? 130.393 32.394  -0.994  1.00 125.17 ? 238 TYR F CD2   1 
ATOM 9322  C CE1   . TYR H 4 201 ? 131.618 32.780  -3.457  1.00 125.17 ? 238 TYR F CE1   1 
ATOM 9323  C CE2   . TYR H 4 201 ? 131.775 32.253  -1.113  1.00 125.17 ? 238 TYR F CE2   1 
ATOM 9324  C CZ    . TYR H 4 201 ? 132.382 32.447  -2.346  1.00 125.17 ? 238 TYR F CZ    1 
ATOM 9325  O OH    . TYR H 4 201 ? 133.749 32.314  -2.464  1.00 125.17 ? 238 TYR F OH    1 
ATOM 9326  N N     . ASP H 4 202 ? 125.313 31.410  -1.656  1.00 71.98  ? 239 ASP F N     1 
ATOM 9327  C CA    . ASP H 4 202 ? 123.928 31.452  -1.189  1.00 69.53  ? 239 ASP F CA    1 
ATOM 9328  C C     . ASP H 4 202 ? 123.695 32.399  -0.009  1.00 65.43  ? 239 ASP F C     1 
ATOM 9329  O O     . ASP H 4 202 ? 124.377 32.319  1.014   1.00 65.35  ? 239 ASP F O     1 
ATOM 9330  C CB    . ASP H 4 202 ? 123.474 30.043  -0.808  1.00 68.44  ? 239 ASP F CB    1 
ATOM 9331  C CG    . ASP H 4 202 ? 121.988 29.958  -0.579  1.00 71.44  ? 239 ASP F CG    1 
ATOM 9332  O OD1   . ASP H 4 202 ? 121.502 28.858  -0.252  1.00 71.69  ? 239 ASP F OD1   1 
ATOM 9333  O OD2   . ASP H 4 202 ? 121.309 30.991  -0.730  1.00 70.62  ? 239 ASP F OD2   1 
ATOM 9334  N N     . SER H 4 203 ? 122.717 33.291  -0.152  1.00 75.65  ? 240 SER F N     1 
ATOM 9335  C CA    . SER H 4 203 ? 122.399 34.237  0.912   1.00 72.35  ? 240 SER F CA    1 
ATOM 9336  C C     . SER H 4 203 ? 122.077 33.436  2.162   1.00 69.95  ? 240 SER F C     1 
ATOM 9337  O O     . SER H 4 203 ? 122.351 33.879  3.278   1.00 77.08  ? 240 SER F O     1 
ATOM 9338  C CB    . SER H 4 203 ? 121.189 35.094  0.539   1.00 71.22  ? 240 SER F CB    1 
ATOM 9339  O OG    . SER H 4 203 ? 120.000 34.330  0.605   1.00 71.24  ? 240 SER F OG    1 
ATOM 9340  N N     . LYS H 4 204 ? 121.490 32.258  1.962   1.00 36.89  ? 241 LYS F N     1 
ATOM 9341  C CA    . LYS H 4 204 ? 121.132 31.386  3.072   1.00 35.05  ? 241 LYS F CA    1 
ATOM 9342  C C     . LYS H 4 204 ? 122.399 30.959  3.826   1.00 36.03  ? 241 LYS F C     1 
ATOM 9343  O O     . LYS H 4 204 ? 122.344 30.659  5.020   1.00 29.48  ? 241 LYS F O     1 
ATOM 9344  C CB    . LYS H 4 204 ? 120.357 30.164  2.547   1.00 28.47  ? 241 LYS F CB    1 
ATOM 9345  C CG    . LYS H 4 204 ? 119.679 29.289  3.609   1.00 27.87  ? 241 LYS F CG    1 
ATOM 9346  C CD    . LYS H 4 204 ? 120.627 28.265  4.234   1.00 27.45  ? 241 LYS F CD    1 
ATOM 9347  C CE    . LYS H 4 204 ? 121.000 27.122  3.280   1.00 28.89  ? 241 LYS F CE    1 
ATOM 9348  N NZ    . LYS H 4 204 ? 121.765 27.544  2.050   1.00 24.13  ? 241 LYS F NZ    1 
ATOM 9349  N N     . ALA H 4 205 ? 123.539 30.949  3.134   1.00 75.88  ? 242 ALA F N     1 
ATOM 9350  C CA    . ALA H 4 205 ? 124.812 30.572  3.758   1.00 76.08  ? 242 ALA F CA    1 
ATOM 9351  C C     . ALA H 4 205 ? 125.303 31.703  4.675   1.00 77.65  ? 242 ALA F C     1 
ATOM 9352  O O     . ALA H 4 205 ? 125.713 32.780  4.212   1.00 28.78  ? 242 ALA F O     1 
ATOM 9353  C CB    . ALA H 4 205 ? 125.860 30.263  2.689   1.00 18.35  ? 242 ALA F CB    1 
ATOM 9354  N N     . PRO H 4 206 ? 125.277 31.467  5.997   1.00 55.64  ? 243 PRO F N     1 
ATOM 9355  C CA    . PRO H 4 206 ? 125.720 32.507  6.925   1.00 56.24  ? 243 PRO F CA    1 
ATOM 9356  C C     . PRO H 4 206 ? 126.963 33.272  6.494   1.00 59.31  ? 243 PRO F C     1 
ATOM 9357  O O     . PRO H 4 206 ? 126.881 34.464  6.200   1.00 52.64  ? 243 PRO F O     1 
ATOM 9358  C CB    . PRO H 4 206 ? 125.897 31.752  8.254   1.00 36.21  ? 243 PRO F CB    1 
ATOM 9359  C CG    . PRO H 4 206 ? 125.890 30.294  7.882   1.00 32.98  ? 243 PRO F CG    1 
ATOM 9360  C CD    . PRO H 4 206 ? 124.959 30.221  6.716   1.00 34.11  ? 243 PRO F CD    1 
ATOM 9361  N N     . ASN H 4 207 ? 128.092 32.573  6.434   1.00 68.51  ? 244 ASN F N     1 
ATOM 9362  C CA    . ASN H 4 207 ? 129.387 33.153  6.069   1.00 69.13  ? 244 ASN F CA    1 
ATOM 9363  C C     . ASN H 4 207 ? 129.452 33.911  4.744   1.00 67.80  ? 244 ASN F C     1 
ATOM 9364  O O     . ASN H 4 207 ? 130.448 34.571  4.465   1.00 57.43  ? 244 ASN F O     1 
ATOM 9365  C CB    . ASN H 4 207 ? 130.452 32.052  6.067   1.00 58.43  ? 244 ASN F CB    1 
ATOM 9366  C CG    . ASN H 4 207 ? 130.203 30.999  4.995   1.00 61.78  ? 244 ASN F CG    1 
ATOM 9367  O OD1   . ASN H 4 207 ? 130.639 31.145  3.848   1.00 63.68  ? 244 ASN F OD1   1 
ATOM 9368  N ND2   . ASN H 4 207 ? 129.488 29.940  5.363   1.00 63.26  ? 244 ASN F ND2   1 
ATOM 9369  N N     . ALA H 4 208 ? 128.411 33.813  3.923   1.00 37.32  ? 245 ALA F N     1 
ATOM 9370  C CA    . ALA H 4 208 ? 128.400 34.518  2.639   1.00 35.46  ? 245 ALA F CA    1 
ATOM 9371  C C     . ALA H 4 208 ? 127.334 35.620  2.581   1.00 34.39  ? 245 ALA F C     1 
ATOM 9372  O O     . ALA H 4 208 ? 127.398 36.511  1.731   1.00 63.91  ? 245 ALA F O     1 
ATOM 9373  C CB    . ALA H 4 208 ? 128.193 33.528  1.503   1.00 67.26  ? 245 ALA F CB    1 
ATOM 9374  N N     . SER H 4 209 ? 126.366 35.545  3.497   1.00 39.32  ? 246 SER F N     1 
ATOM 9375  C CA    . SER H 4 209 ? 125.276 36.514  3.609   1.00 40.20  ? 246 SER F CA    1 
ATOM 9376  C C     . SER H 4 209 ? 125.685 37.957  3.341   1.00 41.70  ? 246 SER F C     1 
ATOM 9377  O O     . SER H 4 209 ? 126.872 38.283  3.277   1.00 64.31  ? 246 SER F O     1 
ATOM 9378  C CB    . SER H 4 209 ? 124.668 36.444  5.010   1.00 57.39  ? 246 SER F CB    1 
ATOM 9379  O OG    . SER H 4 209 ? 124.056 37.682  5.360   1.00 57.18  ? 246 SER F OG    1 
ATOM 9380  N N     . ASN H 4 210 ? 124.692 38.830  3.196   1.00 54.67  ? 247 ASN F N     1 
ATOM 9381  C CA    . ASN H 4 210 ? 124.986 40.237  2.973   1.00 57.89  ? 247 ASN F CA    1 
ATOM 9382  C C     . ASN H 4 210 ? 124.838 40.979  4.283   1.00 57.53  ? 247 ASN F C     1 
ATOM 9383  O O     . ASN H 4 210 ? 123.744 41.090  4.849   1.00 50.29  ? 247 ASN F O     1 
ATOM 9384  C CB    . ASN H 4 210 ? 124.069 40.833  1.912   1.00 63.25  ? 247 ASN F CB    1 
ATOM 9385  C CG    . ASN H 4 210 ? 124.294 40.217  0.544   1.00 67.30  ? 247 ASN F CG    1 
ATOM 9386  O OD1   . ASN H 4 210 ? 125.439 39.953  0.145   1.00 73.08  ? 247 ASN F OD1   1 
ATOM 9387  N ND2   . ASN H 4 210 ? 123.205 39.997  -0.191  1.00 68.97  ? 247 ASN F ND2   1 
ATOM 9388  N N     . LEU H 4 211 ? 125.970 41.481  4.756   1.00 58.62  ? 248 LEU F N     1 
ATOM 9389  C CA    . LEU H 4 211 ? 126.034 42.192  6.018   1.00 56.60  ? 248 LEU F CA    1 
ATOM 9390  C C     . LEU H 4 211 ? 125.239 43.488  6.009   1.00 53.62  ? 248 LEU F C     1 
ATOM 9391  O O     . LEU H 4 211 ? 125.195 44.213  5.014   1.00 48.68  ? 248 LEU F O     1 
ATOM 9392  C CB    . LEU H 4 211 ? 127.504 42.441  6.406   1.00 54.07  ? 248 LEU F CB    1 
ATOM 9393  C CG    . LEU H 4 211 ? 128.337 41.202  6.793   1.00 54.42  ? 248 LEU F CG    1 
ATOM 9394  C CD1   . LEU H 4 211 ? 128.538 40.321  5.581   1.00 51.97  ? 248 LEU F CD1   1 
ATOM 9395  C CD2   . LEU H 4 211 ? 129.682 41.617  7.343   1.00 55.73  ? 248 LEU F CD2   1 
ATOM 9396  N N     . LYS H 4 212 ? 124.594 43.763  7.134   1.00 35.53  ? 249 LYS F N     1 
ATOM 9397  C CA    . LYS H 4 212 ? 123.789 44.964  7.273   1.00 32.94  ? 249 LYS F CA    1 
ATOM 9398  C C     . LYS H 4 212 ? 123.672 45.356  8.735   1.00 30.86  ? 249 LYS F C     1 
ATOM 9399  O O     . LYS H 4 212 ? 123.503 44.494  9.607   1.00 38.34  ? 249 LYS F O     1 
ATOM 9400  C CB    . LYS H 4 212 ? 122.388 44.740  6.705   1.00 34.92  ? 249 LYS F CB    1 
ATOM 9401  C CG    . LYS H 4 212 ? 121.550 45.999  6.700   1.00 35.91  ? 249 LYS F CG    1 
ATOM 9402  C CD    . LYS H 4 212 ? 120.115 45.715  6.335   1.00 39.15  ? 249 LYS F CD    1 
ATOM 9403  C CE    . LYS H 4 212 ? 119.285 46.987  6.413   1.00 38.80  ? 249 LYS F CE    1 
ATOM 9404  N NZ    . LYS H 4 212 ? 117.848 46.751  6.091   1.00 42.05  ? 249 LYS F NZ    1 
ATOM 9405  N N     . ILE H 4 213 ? 123.782 46.657  8.998   1.00 36.33  ? 250 ILE F N     1 
ATOM 9406  C CA    . ILE H 4 213 ? 123.647 47.195  10.351  1.00 33.74  ? 250 ILE F CA    1 
ATOM 9407  C C     . ILE H 4 213 ? 122.202 47.638  10.391  1.00 31.99  ? 250 ILE F C     1 
ATOM 9408  O O     . ILE H 4 213 ? 121.834 48.592  9.718   1.00 19.71  ? 250 ILE F O     1 
ATOM 9409  C CB    . ILE H 4 213 ? 124.572 48.458  10.604  1.00 25.40  ? 250 ILE F CB    1 
ATOM 9410  C CG1   . ILE H 4 213 ? 126.028 48.020  10.838  1.00 25.97  ? 250 ILE F CG1   1 
ATOM 9411  C CG2   . ILE H 4 213 ? 124.062 49.272  11.808  1.00 21.73  ? 250 ILE F CG2   1 
ATOM 9412  C CD1   . ILE H 4 213 ? 127.017 49.161  10.890  1.00 26.11  ? 250 ILE F CD1   1 
ATOM 9413  N N     . VAL H 4 214 ? 121.375 46.939  11.153  1.00 11.77  ? 251 VAL F N     1 
ATOM 9414  C CA    . VAL H 4 214 ? 119.968 47.303  11.240  1.00 10.91  ? 251 VAL F CA    1 
ATOM 9415  C C     . VAL H 4 214 ? 119.685 48.366  12.303  1.00 11.39  ? 251 VAL F C     1 
ATOM 9416  O O     . VAL H 4 214 ? 118.908 49.288  12.071  1.00 9.31   ? 251 VAL F O     1 
ATOM 9417  C CB    . VAL H 4 214 ? 119.122 46.080  11.535  1.00 2.19   ? 251 VAL F CB    1 
ATOM 9418  C CG1   . VAL H 4 214 ? 117.668 46.422  11.367  1.00 2.00   ? 251 VAL F CG1   1 
ATOM 9419  C CG2   . VAL H 4 214 ? 119.537 44.951  10.622  1.00 2.00   ? 251 VAL F CG2   1 
ATOM 9420  N N     . ARG H 4 215 ? 120.316 48.238  13.467  1.00 24.25  ? 252 ARG F N     1 
ATOM 9421  C CA    . ARG H 4 215 ? 120.088 49.213  14.514  1.00 23.01  ? 252 ARG F CA    1 
ATOM 9422  C C     . ARG H 4 215 ? 121.256 49.355  15.462  1.00 23.01  ? 252 ARG F C     1 
ATOM 9423  O O     . ARG H 4 215 ? 122.037 48.418  15.672  1.00 45.16  ? 252 ARG F O     1 
ATOM 9424  C CB    . ARG H 4 215 ? 118.839 48.851  15.309  1.00 15.69  ? 252 ARG F CB    1 
ATOM 9425  C CG    . ARG H 4 215 ? 118.090 50.030  15.890  1.00 17.86  ? 252 ARG F CG    1 
ATOM 9426  C CD    . ARG H 4 215 ? 116.656 49.599  16.136  1.00 18.39  ? 252 ARG F CD    1 
ATOM 9427  N NE    . ARG H 4 215 ? 115.804 50.618  16.738  1.00 19.27  ? 252 ARG F NE    1 
ATOM 9428  C CZ    . ARG H 4 215 ? 114.528 50.404  17.037  1.00 19.59  ? 252 ARG F CZ    1 
ATOM 9429  N NH1   . ARG H 4 215 ? 113.790 51.358  17.590  1.00 16.62  ? 252 ARG F NH1   1 
ATOM 9430  N NH2   . ARG H 4 215 ? 113.992 49.222  16.775  1.00 18.44  ? 252 ARG F NH2   1 
ATOM 9431  N N     . MET H 4 216 ? 121.363 50.554  16.028  1.00 16.61  ? 253 MET F N     1 
ATOM 9432  C CA    . MET H 4 216 ? 122.393 50.889  16.995  1.00 17.50  ? 253 MET F CA    1 
ATOM 9433  C C     . MET H 4 216 ? 121.666 51.770  17.992  1.00 18.38  ? 253 MET F C     1 
ATOM 9434  O O     . MET H 4 216 ? 121.030 52.732  17.596  1.00 18.09  ? 253 MET F O     1 
ATOM 9435  C CB    . MET H 4 216 ? 123.532 51.655  16.329  1.00 13.24  ? 253 MET F CB    1 
ATOM 9436  C CG    . MET H 4 216 ? 124.599 50.768  15.703  1.00 16.57  ? 253 MET F CG    1 
ATOM 9437  S SD    . MET H 4 216 ? 126.049 51.734  15.096  1.00 22.74  ? 253 MET F SD    1 
ATOM 9438  C CE    . MET H 4 216 ? 125.420 52.216  13.443  1.00 16.79  ? 253 MET F CE    1 
ATOM 9439  N N     . ASP H 4 217 ? 121.730 51.441  19.278  1.00 14.16  ? 254 ASP F N     1 
ATOM 9440  C CA    . ASP H 4 217 ? 121.026 52.244  20.280  1.00 13.69  ? 254 ASP F CA    1 
ATOM 9441  C C     . ASP H 4 217 ? 121.580 53.656  20.414  1.00 12.61  ? 254 ASP F C     1 
ATOM 9442  O O     . ASP H 4 217 ? 120.914 54.539  20.939  1.00 12.61  ? 254 ASP F O     1 
ATOM 9443  C CB    . ASP H 4 217 ? 121.022 51.524  21.631  1.00 22.45  ? 254 ASP F CB    1 
ATOM 9444  C CG    . ASP H 4 217 ? 122.405 51.293  22.173  1.00 22.45  ? 254 ASP F CG    1 
ATOM 9445  O OD1   . ASP H 4 217 ? 123.345 51.104  21.362  1.00 22.45  ? 254 ASP F OD1   1 
ATOM 9446  O OD2   . ASP H 4 217 ? 122.543 51.279  23.418  1.00 22.45  ? 254 ASP F OD2   1 
ATOM 9447  N N     . ARG H 4 218 ? 122.785 53.858  19.899  1.00 2.00   ? 255 ARG F N     1 
ATOM 9448  C CA    . ARG H 4 218 ? 123.445 55.148  19.923  1.00 2.00   ? 255 ARG F CA    1 
ATOM 9449  C C     . ARG H 4 218 ? 124.403 55.223  18.753  1.00 2.00   ? 255 ARG F C     1 
ATOM 9450  O O     . ARG H 4 218 ? 125.065 54.250  18.424  1.00 9.16   ? 255 ARG F O     1 
ATOM 9451  C CB    . ARG H 4 218 ? 124.198 55.341  21.238  1.00 34.66  ? 255 ARG F CB    1 
ATOM 9452  C CG    . ARG H 4 218 ? 123.316 55.681  22.427  1.00 40.35  ? 255 ARG F CG    1 
ATOM 9453  C CD    . ARG H 4 218 ? 124.062 56.613  23.371  1.00 48.89  ? 255 ARG F CD    1 
ATOM 9454  N NE    . ARG H 4 218 ? 124.420 57.890  22.734  1.00 51.56  ? 255 ARG F NE    1 
ATOM 9455  C CZ    . ARG H 4 218 ? 125.269 58.789  23.241  1.00 46.11  ? 255 ARG F CZ    1 
ATOM 9456  N NH1   . ARG H 4 218 ? 125.877 58.567  24.407  1.00 45.78  ? 255 ARG F NH1   1 
ATOM 9457  N NH2   . ARG H 4 218 ? 125.496 59.924  22.587  1.00 41.04  ? 255 ARG F NH2   1 
ATOM 9458  N N     . THR H 4 219 ? 124.484 56.391  18.136  1.00 2.00   ? 256 THR F N     1 
ATOM 9459  C CA    . THR H 4 219 ? 125.330 56.605  16.968  1.00 2.00   ? 256 THR F CA    1 
ATOM 9460  C C     . THR H 4 219 ? 126.318 57.735  17.194  1.00 2.00   ? 256 THR F C     1 
ATOM 9461  O O     . THR H 4 219 ? 126.693 58.440  16.246  1.00 12.53  ? 256 THR F O     1 
ATOM 9462  C CB    . THR H 4 219 ? 124.467 57.008  15.827  1.00 10.10  ? 256 THR F CB    1 
ATOM 9463  O OG1   . THR H 4 219 ? 123.735 58.173  16.221  1.00 13.06  ? 256 THR F OG1   1 
ATOM 9464  C CG2   . THR H 4 219 ? 123.494 55.896  15.479  1.00 11.83  ? 256 THR F CG2   1 
ATOM 9465  N N     . ALA H 4 220 ? 126.718 57.908  18.451  1.00 36.76  ? 257 ALA F N     1 
ATOM 9466  C CA    . ALA H 4 220 ? 127.646 58.955  18.832  1.00 39.95  ? 257 ALA F CA    1 
ATOM 9467  C C     . ALA H 4 220 ? 128.287 58.646  20.175  1.00 42.51  ? 257 ALA F C     1 
ATOM 9468  O O     . ALA H 4 220 ? 127.638 58.138  21.094  1.00 40.61  ? 257 ALA F O     1 
ATOM 9469  C CB    . ALA H 4 220 ? 126.925 60.281  18.892  1.00 30.86  ? 257 ALA F CB    1 
ATOM 9470  N N     . GLY H 4 221 ? 129.573 58.964  20.277  1.00 34.17  ? 258 GLY F N     1 
ATOM 9471  C CA    . GLY H 4 221 ? 130.307 58.721  21.505  1.00 34.72  ? 258 GLY F CA    1 
ATOM 9472  C C     . GLY H 4 221 ? 131.470 59.683  21.666  1.00 35.53  ? 258 GLY F C     1 
ATOM 9473  O O     . GLY H 4 221 ? 131.807 60.429  20.734  1.00 47.45  ? 258 GLY F O     1 
ATOM 9474  N N     . CYS H 4 222 ? 132.090 59.657  22.844  1.00 29.06  ? 259 CYS F N     1 
ATOM 9475  C CA    . CYS H 4 222 ? 133.218 60.531  23.150  1.00 30.07  ? 259 CYS F CA    1 
ATOM 9476  C C     . CYS H 4 222 ? 134.490 60.020  22.479  1.00 30.76  ? 259 CYS F C     1 
ATOM 9477  O O     . CYS H 4 222 ? 134.704 58.811  22.377  1.00 25.48  ? 259 CYS F O     1 
ATOM 9478  C CB    . CYS H 4 222 ? 133.403 60.596  24.667  1.00 16.48  ? 259 CYS F CB    1 
ATOM 9479  S SG    . CYS H 4 222 ? 134.462 61.894  25.273  1.00 20.58  ? 259 CYS F SG    1 
ATOM 9480  N N     . VAL H 4 223 ? 135.321 60.951  22.019  1.00 28.12  ? 260 VAL F N     1 
ATOM 9481  C CA    . VAL H 4 223 ? 136.580 60.619  21.355  1.00 23.90  ? 260 VAL F CA    1 
ATOM 9482  C C     . VAL H 4 223 ? 137.434 59.695  22.197  1.00 22.98  ? 260 VAL F C     1 
ATOM 9483  O O     . VAL H 4 223 ? 138.299 58.984  21.683  1.00 17.53  ? 260 VAL F O     1 
ATOM 9484  C CB    . VAL H 4 223 ? 137.394 61.865  21.089  1.00 12.07  ? 260 VAL F CB    1 
ATOM 9485  C CG1   . VAL H 4 223 ? 136.997 62.491  19.755  1.00 10.76  ? 260 VAL F CG1   1 
ATOM 9486  C CG2   . VAL H 4 223 ? 137.185 62.826  22.228  1.00 7.60   ? 260 VAL F CG2   1 
ATOM 9487  N N     . THR H 4 224 ? 137.195 59.723  23.498  1.00 21.46  ? 261 THR F N     1 
ATOM 9488  C CA    . THR H 4 224 ? 137.918 58.880  24.427  1.00 22.33  ? 261 THR F CA    1 
ATOM 9489  C C     . THR H 4 224 ? 137.624 57.427  24.091  1.00 23.26  ? 261 THR F C     1 
ATOM 9490  O O     . THR H 4 224 ? 138.498 56.562  24.162  1.00 23.91  ? 261 THR F O     1 
ATOM 9491  C CB    . THR H 4 224 ? 137.455 59.176  25.831  1.00 23.03  ? 261 THR F CB    1 
ATOM 9492  O OG1   . THR H 4 224 ? 137.901 60.490  26.191  1.00 19.08  ? 261 THR F OG1   1 
ATOM 9493  C CG2   . THR H 4 224 ? 137.972 58.132  26.803  1.00 24.76  ? 261 THR F CG2   1 
ATOM 9494  N N     . GLY H 4 225 ? 136.381 57.169  23.708  1.00 22.58  ? 262 GLY F N     1 
ATOM 9495  C CA    . GLY H 4 225 ? 135.982 55.819  23.357  1.00 26.27  ? 262 GLY F CA    1 
ATOM 9496  C C     . GLY H 4 225 ? 135.693 55.011  24.598  1.00 26.70  ? 262 GLY F C     1 
ATOM 9497  O O     . GLY H 4 225 ? 135.718 55.544  25.714  1.00 23.40  ? 262 GLY F O     1 
ATOM 9498  N N     . GLY H 4 226 ? 135.405 53.730  24.412  1.00 8.55   ? 263 GLY F N     1 
ATOM 9499  C CA    . GLY H 4 226 ? 135.133 52.875  25.550  1.00 8.55   ? 263 GLY F CA    1 
ATOM 9500  C C     . GLY H 4 226 ? 133.744 53.104  26.097  1.00 8.55   ? 263 GLY F C     1 
ATOM 9501  O O     . GLY H 4 226 ? 133.483 52.945  27.295  1.00 8.55   ? 263 GLY F O     1 
ATOM 9502  N N     . GLU H 4 227 ? 132.853 53.505  25.199  1.00 32.34  ? 264 GLU F N     1 
ATOM 9503  C CA    . GLU H 4 227 ? 131.465 53.741  25.548  1.00 30.56  ? 264 GLU F CA    1 
ATOM 9504  C C     . GLU H 4 227 ? 130.682 52.603  24.914  1.00 29.59  ? 264 GLU F C     1 
ATOM 9505  O O     . GLU H 4 227 ? 130.701 52.448  23.695  1.00 24.21  ? 264 GLU F O     1 
ATOM 9506  C CB    . GLU H 4 227 ? 130.986 55.079  24.991  1.00 25.08  ? 264 GLU F CB    1 
ATOM 9507  C CG    . GLU H 4 227 ? 131.752 56.278  25.504  1.00 30.87  ? 264 GLU F CG    1 
ATOM 9508  C CD    . GLU H 4 227 ? 130.910 57.535  25.520  1.00 36.34  ? 264 GLU F CD    1 
ATOM 9509  O OE1   . GLU H 4 227 ? 130.181 57.751  26.511  1.00 36.20  ? 264 GLU F OE1   1 
ATOM 9510  O OE2   . GLU H 4 227 ? 130.963 58.302  24.535  1.00 34.62  ? 264 GLU F OE2   1 
ATOM 9511  N N     . GLU H 4 228 ? 130.004 51.815  25.745  1.00 33.24  ? 265 GLU F N     1 
ATOM 9512  C CA    . GLU H 4 228 ? 129.234 50.665  25.284  1.00 32.50  ? 265 GLU F CA    1 
ATOM 9513  C C     . GLU H 4 228 ? 128.159 51.016  24.250  1.00 29.69  ? 265 GLU F C     1 
ATOM 9514  O O     . GLU H 4 228 ? 127.555 52.089  24.317  1.00 29.65  ? 265 GLU F O     1 
ATOM 9515  C CB    . GLU H 4 228 ? 128.595 49.978  26.480  1.00 20.23  ? 265 GLU F CB    1 
ATOM 9516  C CG    . GLU H 4 228 ? 127.875 48.713  26.138  1.00 24.87  ? 265 GLU F CG    1 
ATOM 9517  C CD    . GLU H 4 228 ? 127.331 48.036  27.372  1.00 24.22  ? 265 GLU F CD    1 
ATOM 9518  O OE1   . GLU H 4 228 ? 126.605 48.703  28.145  1.00 19.82  ? 265 GLU F OE1   1 
ATOM 9519  O OE2   . GLU H 4 228 ? 127.628 46.839  27.566  1.00 25.95  ? 265 GLU F OE2   1 
ATOM 9520  N N     . ILE H 4 229 ? 127.928 50.106  23.302  1.00 15.90  ? 266 ILE F N     1 
ATOM 9521  C CA    . ILE H 4 229 ? 126.940 50.309  22.250  1.00 16.58  ? 266 ILE F CA    1 
ATOM 9522  C C     . ILE H 4 229 ? 126.304 48.988  21.816  1.00 19.44  ? 266 ILE F C     1 
ATOM 9523  O O     . ILE H 4 229 ? 126.948 47.942  21.862  1.00 26.61  ? 266 ILE F O     1 
ATOM 9524  C CB    . ILE H 4 229 ? 127.578 50.991  21.009  1.00 4.66   ? 266 ILE F CB    1 
ATOM 9525  C CG1   . ILE H 4 229 ? 127.873 52.455  21.317  1.00 7.15   ? 266 ILE F CG1   1 
ATOM 9526  C CG2   . ILE H 4 229 ? 126.634 50.951  19.825  1.00 8.17   ? 266 ILE F CG2   1 
ATOM 9527  C CD1   . ILE H 4 229 ? 128.266 53.275  20.101  1.00 8.44   ? 266 ILE F CD1   1 
ATOM 9528  N N     . TYR H 4 230 ? 125.034 49.053  21.410  1.00 19.41  ? 267 TYR F N     1 
ATOM 9529  C CA    . TYR H 4 230 ? 124.273 47.896  20.940  1.00 16.84  ? 267 TYR F CA    1 
ATOM 9530  C C     . TYR H 4 230 ? 124.041 47.985  19.452  1.00 16.67  ? 267 TYR F C     1 
ATOM 9531  O O     . TYR H 4 230 ? 123.477 48.956  18.975  1.00 14.57  ? 267 TYR F O     1 
ATOM 9532  C CB    . TYR H 4 230 ? 122.905 47.844  21.604  1.00 3.83   ? 267 TYR F CB    1 
ATOM 9533  C CG    . TYR H 4 230 ? 122.941 47.167  22.920  1.00 3.83   ? 267 TYR F CG    1 
ATOM 9534  C CD1   . TYR H 4 230 ? 123.680 47.698  23.956  1.00 3.83   ? 267 TYR F CD1   1 
ATOM 9535  C CD2   . TYR H 4 230 ? 122.302 45.969  23.111  1.00 3.83   ? 267 TYR F CD2   1 
ATOM 9536  C CE1   . TYR H 4 230 ? 123.796 47.051  25.153  1.00 6.64   ? 267 TYR F CE1   1 
ATOM 9537  C CE2   . TYR H 4 230 ? 122.403 45.304  24.307  1.00 3.83   ? 267 TYR F CE2   1 
ATOM 9538  C CZ    . TYR H 4 230 ? 123.159 45.847  25.336  1.00 6.83   ? 267 TYR F CZ    1 
ATOM 9539  O OH    . TYR H 4 230 ? 123.300 45.186  26.550  1.00 10.75  ? 267 TYR F OH    1 
ATOM 9540  N N     . LEU H 4 231 ? 124.451 46.973  18.709  1.00 18.23  ? 268 LEU F N     1 
ATOM 9541  C CA    . LEU H 4 231 ? 124.243 46.985  17.278  1.00 20.39  ? 268 LEU F CA    1 
ATOM 9542  C C     . LEU H 4 231 ? 123.443 45.764  16.920  1.00 23.76  ? 268 LEU F C     1 
ATOM 9543  O O     . LEU H 4 231 ? 123.903 44.650  17.134  1.00 16.87  ? 268 LEU F O     1 
ATOM 9544  C CB    . LEU H 4 231 ? 125.581 46.942  16.548  1.00 4.52   ? 268 LEU F CB    1 
ATOM 9545  C CG    . LEU H 4 231 ? 125.587 46.763  15.020  1.00 4.52   ? 268 LEU F CG    1 
ATOM 9546  C CD1   . LEU H 4 231 ? 126.908 47.216  14.433  1.00 4.52   ? 268 LEU F CD1   1 
ATOM 9547  C CD2   . LEU H 4 231 ? 125.347 45.309  14.661  1.00 4.52   ? 268 LEU F CD2   1 
ATOM 9548  N N     . LEU H 4 232 ? 122.241 45.966  16.398  1.00 41.81  ? 269 LEU F N     1 
ATOM 9549  C CA    . LEU H 4 232 ? 121.402 44.856  15.978  1.00 41.55  ? 269 LEU F CA    1 
ATOM 9550  C C     . LEU H 4 232 ? 121.692 44.628  14.500  1.00 44.72  ? 269 LEU F C     1 
ATOM 9551  O O     . LEU H 4 232 ? 121.599 45.562  13.691  1.00 28.86  ? 269 LEU F O     1 
ATOM 9552  C CB    . LEU H 4 232 ? 119.949 45.212  16.175  1.00 5.42   ? 269 LEU F CB    1 
ATOM 9553  C CG    . LEU H 4 232 ? 119.574 45.408  17.632  1.00 4.46   ? 269 LEU F CG    1 
ATOM 9554  C CD1   . LEU H 4 232 ? 118.170 45.972  17.677  1.00 4.46   ? 269 LEU F CD1   1 
ATOM 9555  C CD2   . LEU H 4 232 ? 119.703 44.094  18.398  1.00 4.46   ? 269 LEU F CD2   1 
ATOM 9556  N N     . CYS H 4 233 ? 122.017 43.388  14.142  1.00 34.11  ? 270 CYS F N     1 
ATOM 9557  C CA    . CYS H 4 233 ? 122.388 43.075  12.763  1.00 33.61  ? 270 CYS F CA    1 
ATOM 9558  C C     . CYS H 4 233 ? 121.729 41.851  12.133  1.00 31.60  ? 270 CYS F C     1 
ATOM 9559  O O     . CYS H 4 233 ? 120.915 41.170  12.754  1.00 30.42  ? 270 CYS F O     1 
ATOM 9560  C CB    . CYS H 4 233 ? 123.888 42.865  12.721  1.00 21.46  ? 270 CYS F CB    1 
ATOM 9561  S SG    . CYS H 4 233 ? 124.327 41.496  13.811  1.00 31.43  ? 270 CYS F SG    1 
ATOM 9562  N N     . ASP H 4 234 ? 122.108 41.588  10.882  1.00 24.83  ? 271 ASP F N     1 
ATOM 9563  C CA    . ASP H 4 234 ? 121.621 40.432  10.121  1.00 23.70  ? 271 ASP F CA    1 
ATOM 9564  C C     . ASP H 4 234 ? 122.559 39.310  10.491  1.00 23.87  ? 271 ASP F C     1 
ATOM 9565  O O     . ASP H 4 234 ? 123.714 39.552  10.817  1.00 39.81  ? 271 ASP F O     1 
ATOM 9566  C CB    . ASP H 4 234 ? 121.723 40.655  8.602   1.00 44.93  ? 271 ASP F CB    1 
ATOM 9567  C CG    . ASP H 4 234 ? 120.719 41.659  8.082   1.00 44.99  ? 271 ASP F CG    1 
ATOM 9568  O OD1   . ASP H 4 234 ? 120.865 42.102  6.922   1.00 44.21  ? 271 ASP F OD1   1 
ATOM 9569  O OD2   . ASP H 4 234 ? 119.787 42.003  8.832   1.00 47.12  ? 271 ASP F OD2   1 
ATOM 9570  N N     . LYS H 4 235 ? 122.064 38.082  10.432  1.00 24.93  ? 272 LYS F N     1 
ATOM 9571  C CA    . LYS H 4 235 ? 122.877 36.919  10.763  1.00 24.75  ? 272 LYS F CA    1 
ATOM 9572  C C     . LYS H 4 235 ? 124.368 37.145  10.492  1.00 25.44  ? 272 LYS F C     1 
ATOM 9573  O O     . LYS H 4 235 ? 124.760 37.338  9.344   1.00 40.93  ? 272 LYS F O     1 
ATOM 9574  C CB    . LYS H 4 235 ? 122.395 35.715  9.943   1.00 37.09  ? 272 LYS F CB    1 
ATOM 9575  C CG    . LYS H 4 235 ? 123.356 34.524  9.927   1.00 36.78  ? 272 LYS F CG    1 
ATOM 9576  C CD    . LYS H 4 235 ? 123.265 33.696  11.203  1.00 38.78  ? 272 LYS F CD    1 
ATOM 9577  C CE    . LYS H 4 235 ? 122.520 32.368  10.981  1.00 41.01  ? 272 LYS F CE    1 
ATOM 9578  N NZ    . LYS H 4 235 ? 121.116 32.536  10.515  1.00 40.83  ? 272 LYS F NZ    1 
ATOM 9579  N N     . VAL H 4 236 ? 125.189 37.155  11.541  1.00 13.64  ? 273 VAL F N     1 
ATOM 9580  C CA    . VAL H 4 236 ? 126.633 37.304  11.356  1.00 14.95  ? 273 VAL F CA    1 
ATOM 9581  C C     . VAL H 4 236 ? 127.287 36.131  12.062  1.00 18.03  ? 273 VAL F C     1 
ATOM 9582  O O     . VAL H 4 236 ? 126.766 35.646  13.061  1.00 44.94  ? 273 VAL F O     1 
ATOM 9583  C CB    . VAL H 4 236 ? 127.221 38.613  11.957  1.00 37.39  ? 273 VAL F CB    1 
ATOM 9584  C CG1   . VAL H 4 236 ? 126.690 39.817  11.223  1.00 35.97  ? 273 VAL F CG1   1 
ATOM 9585  C CG2   . VAL H 4 236 ? 126.919 38.698  13.433  1.00 39.98  ? 273 VAL F CG2   1 
ATOM 9586  N N     . GLN H 4 237 ? 128.419 35.675  11.538  1.00 35.76  ? 274 GLN F N     1 
ATOM 9587  C CA    . GLN H 4 237 ? 129.142 34.553  12.128  1.00 39.39  ? 274 GLN F CA    1 
ATOM 9588  C C     . GLN H 4 237 ? 129.928 34.992  13.367  1.00 40.60  ? 274 GLN F C     1 
ATOM 9589  O O     . GLN H 4 237 ? 130.926 35.706  13.276  1.00 44.59  ? 274 GLN F O     1 
ATOM 9590  C CB    . GLN H 4 237 ? 130.098 33.926  11.097  1.00 55.83  ? 274 GLN F CB    1 
ATOM 9591  C CG    . GLN H 4 237 ? 130.051 34.535  9.686   1.00 62.15  ? 274 GLN F CG    1 
ATOM 9592  C CD    . GLN H 4 237 ? 130.457 36.010  9.647   1.00 66.07  ? 274 GLN F CD    1 
ATOM 9593  O OE1   . GLN H 4 237 ? 130.387 36.656  8.599   1.00 66.70  ? 274 GLN F OE1   1 
ATOM 9594  N NE2   . GLN H 4 237 ? 130.880 36.544  10.790  1.00 66.65  ? 274 GLN F NE2   1 
ATOM 9595  N N     . LYS H 4 238 ? 129.449 34.545  14.520  1.00 43.29  ? 275 LYS F N     1 
ATOM 9596  C CA    . LYS H 4 238 ? 130.020 34.826  15.832  1.00 44.95  ? 275 LYS F CA    1 
ATOM 9597  C C     . LYS H 4 238 ? 131.497 35.217  15.898  1.00 43.13  ? 275 LYS F C     1 
ATOM 9598  O O     . LYS H 4 238 ? 131.846 36.272  16.430  1.00 23.29  ? 275 LYS F O     1 
ATOM 9599  C CB    . LYS H 4 238 ? 129.768 33.608  16.723  1.00 27.76  ? 275 LYS F CB    1 
ATOM 9600  C CG    . LYS H 4 238 ? 130.248 33.723  18.151  1.00 29.05  ? 275 LYS F CG    1 
ATOM 9601  C CD    . LYS H 4 238 ? 129.563 32.676  19.032  1.00 29.97  ? 275 LYS F CD    1 
ATOM 9602  C CE    . LYS H 4 238 ? 129.814 31.250  18.545  1.00 29.79  ? 275 LYS F CE    1 
ATOM 9603  N NZ    . LYS H 4 238 ? 129.147 30.257  19.437  1.00 27.25  ? 275 LYS F NZ    1 
ATOM 9604  N N     . ASP H 4 239 ? 132.374 34.369  15.376  1.00 54.73  ? 276 ASP F N     1 
ATOM 9605  C CA    . ASP H 4 239 ? 133.785 34.688  15.436  1.00 55.99  ? 276 ASP F CA    1 
ATOM 9606  C C     . ASP H 4 239 ? 134.450 35.016  14.102  1.00 56.07  ? 276 ASP F C     1 
ATOM 9607  O O     . ASP H 4 239 ? 135.568 34.595  13.818  1.00 36.34  ? 276 ASP F O     1 
ATOM 9608  C CB    . ASP H 4 239 ? 134.534 33.580  16.162  1.00 26.02  ? 276 ASP F CB    1 
ATOM 9609  C CG    . ASP H 4 239 ? 134.061 32.226  15.770  1.00 27.53  ? 276 ASP F CG    1 
ATOM 9610  O OD1   . ASP H 4 239 ? 133.626 32.097  14.597  1.00 28.23  ? 276 ASP F OD1   1 
ATOM 9611  O OD2   . ASP H 4 239 ? 134.132 31.311  16.625  1.00 27.05  ? 276 ASP F OD2   1 
ATOM 9612  N N     . ASP H 4 240 ? 133.765 35.799  13.289  1.00 47.25  ? 277 ASP F N     1 
ATOM 9613  C CA    . ASP H 4 240 ? 134.330 36.207  12.020  1.00 44.11  ? 277 ASP F CA    1 
ATOM 9614  C C     . ASP H 4 240 ? 133.690 37.519  11.619  1.00 46.29  ? 277 ASP F C     1 
ATOM 9615  O O     . ASP H 4 240 ? 133.523 37.810  10.434  1.00 39.04  ? 277 ASP F O     1 
ATOM 9616  C CB    . ASP H 4 240 ? 134.078 35.152  10.948  1.00 21.05  ? 277 ASP F CB    1 
ATOM 9617  C CG    . ASP H 4 240 ? 134.810 35.453  9.655   1.00 17.14  ? 277 ASP F CG    1 
ATOM 9618  O OD1   . ASP H 4 240 ? 134.127 35.704  8.639   1.00 15.91  ? 277 ASP F OD1   1 
ATOM 9619  O OD2   . ASP H 4 240 ? 136.064 35.443  9.653   1.00 15.91  ? 277 ASP F OD2   1 
ATOM 9620  N N     . ILE H 4 241 ? 133.334 38.320  12.613  1.00 29.80  ? 278 ILE F N     1 
ATOM 9621  C CA    . ILE H 4 241 ? 132.700 39.592  12.335  1.00 25.59  ? 278 ILE F CA    1 
ATOM 9622  C C     . ILE H 4 241 ? 133.374 40.652  13.163  1.00 25.06  ? 278 ILE F C     1 
ATOM 9623  O O     . ILE H 4 241 ? 133.780 40.384  14.286  1.00 17.59  ? 278 ILE F O     1 
ATOM 9624  C CB    . ILE H 4 241 ? 131.200 39.563  12.724  1.00 10.91  ? 278 ILE F CB    1 
ATOM 9625  C CG1   . ILE H 4 241 ? 130.428 40.642  11.953  1.00 6.14   ? 278 ILE F CG1   1 
ATOM 9626  C CG2   . ILE H 4 241 ? 131.050 39.779  14.219  1.00 12.97  ? 278 ILE F CG2   1 
ATOM 9627  C CD1   . ILE H 4 241 ? 130.489 40.477  10.433  1.00 6.14   ? 278 ILE F CD1   1 
ATOM 9628  N N     . GLN H 4 242 ? 133.489 41.852  12.615  1.00 68.66  ? 279 GLN F N     1 
ATOM 9629  C CA    . GLN H 4 242 ? 134.093 42.933  13.356  1.00 67.87  ? 279 GLN F CA    1 
ATOM 9630  C C     . GLN H 4 242 ? 133.452 44.255  12.984  1.00 68.65  ? 279 GLN F C     1 
ATOM 9631  O O     . GLN H 4 242 ? 132.903 44.413  11.889  1.00 29.61  ? 279 GLN F O     1 
ATOM 9632  C CB    . GLN H 4 242 ? 135.606 42.973  13.126  1.00 30.36  ? 279 GLN F CB    1 
ATOM 9633  C CG    . GLN H 4 242 ? 136.071 43.191  11.698  1.00 35.10  ? 279 GLN F CG    1 
ATOM 9634  C CD    . GLN H 4 242 ? 137.601 43.179  11.589  1.00 34.15  ? 279 GLN F CD    1 
ATOM 9635  O OE1   . GLN H 4 242 ? 138.167 43.268  10.493  1.00 32.23  ? 279 GLN F OE1   1 
ATOM 9636  N NE2   . GLN H 4 242 ? 138.274 43.067  12.736  1.00 33.98  ? 279 GLN F NE2   1 
ATOM 9637  N N     . ILE H 4 243 ? 133.511 45.191  13.926  1.00 39.83  ? 280 ILE F N     1 
ATOM 9638  C CA    . ILE H 4 243 ? 132.938 46.515  13.761  1.00 40.11  ? 280 ILE F CA    1 
ATOM 9639  C C     . ILE H 4 243 ? 134.078 47.455  13.398  1.00 40.26  ? 280 ILE F C     1 
ATOM 9640  O O     . ILE H 4 243 ? 135.031 47.587  14.153  1.00 29.70  ? 280 ILE F O     1 
ATOM 9641  C CB    . ILE H 4 243 ? 132.283 46.931  15.076  1.00 21.00  ? 280 ILE F CB    1 
ATOM 9642  C CG1   . ILE H 4 243 ? 131.354 45.808  15.532  1.00 17.06  ? 280 ILE F CG1   1 
ATOM 9643  C CG2   . ILE H 4 243 ? 131.497 48.200  14.895  1.00 21.53  ? 280 ILE F CG2   1 
ATOM 9644  C CD1   . ILE H 4 243 ? 130.674 46.062  16.815  1.00 15.26  ? 280 ILE F CD1   1 
ATOM 9645  N N     . ARG H 4 244 ? 134.002 48.094  12.237  1.00 29.89  ? 281 ARG F N     1 
ATOM 9646  C CA    . ARG H 4 244 ? 135.083 48.976  11.824  1.00 31.09  ? 281 ARG F CA    1 
ATOM 9647  C C     . ARG H 4 244 ? 134.651 50.419  11.717  1.00 29.69  ? 281 ARG F C     1 
ATOM 9648  O O     . ARG H 4 244 ? 133.647 50.735  11.089  1.00 28.87  ? 281 ARG F O     1 
ATOM 9649  C CB    . ARG H 4 244 ? 135.652 48.517  10.483  1.00 32.34  ? 281 ARG F CB    1 
ATOM 9650  C CG    . ARG H 4 244 ? 136.883 49.281  10.025  1.00 36.49  ? 281 ARG F CG    1 
ATOM 9651  C CD    . ARG H 4 244 ? 137.032 49.194  8.514   1.00 40.10  ? 281 ARG F CD    1 
ATOM 9652  N NE    . ARG H 4 244 ? 137.887 50.253  7.990   1.00 45.29  ? 281 ARG F NE    1 
ATOM 9653  C CZ    . ARG H 4 244 ? 137.854 50.673  6.729   1.00 48.56  ? 281 ARG F CZ    1 
ATOM 9654  N NH1   . ARG H 4 244 ? 137.007 50.127  5.870   1.00 48.64  ? 281 ARG F NH1   1 
ATOM 9655  N NH2   . ARG H 4 244 ? 138.669 51.633  6.319   1.00 49.50  ? 281 ARG F NH2   1 
ATOM 9656  N N     . PHE H 4 245 ? 135.423 51.287  12.354  1.00 10.07  ? 282 PHE F N     1 
ATOM 9657  C CA    . PHE H 4 245 ? 135.171 52.720  12.332  1.00 10.07  ? 282 PHE F CA    1 
ATOM 9658  C C     . PHE H 4 245 ? 136.257 53.254  11.439  1.00 10.07  ? 282 PHE F C     1 
ATOM 9659  O O     . PHE H 4 245 ? 137.424 52.903  11.608  1.00 27.71  ? 282 PHE F O     1 
ATOM 9660  C CB    . PHE H 4 245 ? 135.355 53.355  13.718  1.00 27.64  ? 282 PHE F CB    1 
ATOM 9661  C CG    . PHE H 4 245 ? 134.200 53.153  14.655  1.00 25.05  ? 282 PHE F CG    1 
ATOM 9662  C CD1   . PHE H 4 245 ? 133.972 51.927  15.243  1.00 23.11  ? 282 PHE F CD1   1 
ATOM 9663  C CD2   . PHE H 4 245 ? 133.344 54.208  14.953  1.00 23.05  ? 282 PHE F CD2   1 
ATOM 9664  C CE1   . PHE H 4 245 ? 132.909 51.754  16.113  1.00 17.65  ? 282 PHE F CE1   1 
ATOM 9665  C CE2   . PHE H 4 245 ? 132.275 54.041  15.825  1.00 20.08  ? 282 PHE F CE2   1 
ATOM 9666  C CZ    . PHE H 4 245 ? 132.058 52.810  16.404  1.00 13.53  ? 282 PHE F CZ    1 
ATOM 9667  N N     . TYR H 4 246 ? 135.905 54.103  10.490  1.00 19.58  ? 283 TYR F N     1 
ATOM 9668  C CA    . TYR H 4 246 ? 136.938 54.644  9.629   1.00 24.53  ? 283 TYR F CA    1 
ATOM 9669  C C     . TYR H 4 246 ? 136.603 56.051  9.235   1.00 28.48  ? 283 TYR F C     1 
ATOM 9670  O O     . TYR H 4 246 ? 135.472 56.487  9.387   1.00 46.38  ? 283 TYR F O     1 
ATOM 9671  C CB    . TYR H 4 246 ? 137.095 53.770  8.388   1.00 32.56  ? 283 TYR F CB    1 
ATOM 9672  C CG    . TYR H 4 246 ? 135.869 53.724  7.513   1.00 33.24  ? 283 TYR F CG    1 
ATOM 9673  C CD1   . TYR H 4 246 ? 135.556 54.777  6.659   1.00 32.68  ? 283 TYR F CD1   1 
ATOM 9674  C CD2   . TYR H 4 246 ? 135.023 52.622  7.534   1.00 33.87  ? 283 TYR F CD2   1 
ATOM 9675  C CE1   . TYR H 4 246 ? 134.443 54.735  5.849   1.00 31.39  ? 283 TYR F CE1   1 
ATOM 9676  C CE2   . TYR H 4 246 ? 133.904 52.571  6.725   1.00 34.93  ? 283 TYR F CE2   1 
ATOM 9677  C CZ    . TYR H 4 246 ? 133.627 53.630  5.884   1.00 33.80  ? 283 TYR F CZ    1 
ATOM 9678  O OH    . TYR H 4 246 ? 132.552 53.554  5.038   1.00 35.64  ? 283 TYR F OH    1 
ATOM 9679  N N     . GLU H 4 247 ? 137.598 56.763  8.736   1.00 52.16  ? 284 GLU F N     1 
ATOM 9680  C CA    . GLU H 4 247 ? 137.392 58.127  8.297   1.00 57.45  ? 284 GLU F CA    1 
ATOM 9681  C C     . GLU H 4 247 ? 138.329 58.447  7.151   1.00 62.80  ? 284 GLU F C     1 
ATOM 9682  O O     . GLU H 4 247 ? 139.398 57.848  7.035   1.00 52.43  ? 284 GLU F O     1 
ATOM 9683  C CB    . GLU H 4 247 ? 137.636 59.104  9.446   1.00 33.45  ? 284 GLU F CB    1 
ATOM 9684  C CG    . GLU H 4 247 ? 137.848 60.535  8.981   1.00 30.00  ? 284 GLU F CG    1 
ATOM 9685  C CD    . GLU H 4 247 ? 137.909 61.513  10.118  1.00 28.35  ? 284 GLU F CD    1 
ATOM 9686  O OE1   . GLU H 4 247 ? 138.580 61.211  11.129  1.00 26.85  ? 284 GLU F OE1   1 
ATOM 9687  O OE2   . GLU H 4 247 ? 137.293 62.590  9.990   1.00 27.25  ? 284 GLU F OE2   1 
ATOM 9688  N N     . GLU H 4 248 ? 137.920 59.385  6.305   1.00 71.44  ? 285 GLU F N     1 
ATOM 9689  C CA    . GLU H 4 248 ? 138.742 59.806  5.181   1.00 75.85  ? 285 GLU F CA    1 
ATOM 9690  C C     . GLU H 4 248 ? 139.405 61.103  5.629   1.00 76.37  ? 285 GLU F C     1 
ATOM 9691  O O     . GLU H 4 248 ? 138.733 62.027  6.097   1.00 103.49 ? 285 GLU F O     1 
ATOM 9692  C CB    . GLU H 4 248 ? 137.872 60.051  3.941   1.00 110.43 ? 285 GLU F CB    1 
ATOM 9693  C CG    . GLU H 4 248 ? 138.606 59.997  2.588   1.00 114.35 ? 285 GLU F CG    1 
ATOM 9694  C CD    . GLU H 4 248 ? 139.308 61.295  2.210   1.00 114.35 ? 285 GLU F CD    1 
ATOM 9695  O OE1   . GLU H 4 248 ? 138.659 62.360  2.273   1.00 114.35 ? 285 GLU F OE1   1 
ATOM 9696  O OE2   . GLU H 4 248 ? 140.499 61.251  1.832   1.00 114.35 ? 285 GLU F OE2   1 
ATOM 9697  N N     . GLU H 4 249 ? 140.727 61.153  5.512   1.00 88.73  ? 286 GLU F N     1 
ATOM 9698  C CA    . GLU H 4 249 ? 141.481 62.337  5.899   1.00 91.28  ? 286 GLU F CA    1 
ATOM 9699  C C     . GLU H 4 249 ? 141.955 63.043  4.630   1.00 94.28  ? 286 GLU F C     1 
ATOM 9700  O O     . GLU H 4 249 ? 142.387 62.396  3.676   1.00 91.18  ? 286 GLU F O     1 
ATOM 9701  C CB    . GLU H 4 249 ? 142.682 61.941  6.768   1.00 85.66  ? 286 GLU F CB    1 
ATOM 9702  C CG    . GLU H 4 249 ? 142.388 60.813  7.756   1.00 86.97  ? 286 GLU F CG    1 
ATOM 9703  C CD    . GLU H 4 249 ? 143.519 60.561  8.752   1.00 87.77  ? 286 GLU F CD    1 
ATOM 9704  O OE1   . GLU H 4 249 ? 143.574 61.282  9.774   1.00 87.50  ? 286 GLU F OE1   1 
ATOM 9705  O OE2   . GLU H 4 249 ? 144.350 59.651  8.516   1.00 88.65  ? 286 GLU F OE2   1 
ATOM 9706  N N     . GLU H 4 250 ? 141.862 64.369  4.620   1.00 87.74  ? 287 GLU F N     1 
ATOM 9707  C CA    . GLU H 4 250 ? 142.275 65.171  3.471   1.00 88.65  ? 287 GLU F CA    1 
ATOM 9708  C C     . GLU H 4 250 ? 143.676 64.788  2.981   1.00 87.38  ? 287 GLU F C     1 
ATOM 9709  O O     . GLU H 4 250 ? 144.009 64.960  1.805   1.00 81.63  ? 287 GLU F O     1 
ATOM 9710  C CB    . GLU H 4 250 ? 142.228 66.663  3.834   1.00 89.95  ? 287 GLU F CB    1 
ATOM 9711  C CG    . GLU H 4 250 ? 142.413 67.607  2.649   1.00 93.97  ? 287 GLU F CG    1 
ATOM 9712  C CD    . GLU H 4 250 ? 142.170 69.067  3.006   1.00 94.97  ? 287 GLU F CD    1 
ATOM 9713  O OE1   . GLU H 4 250 ? 142.331 69.931  2.115   1.00 96.10  ? 287 GLU F OE1   1 
ATOM 9714  O OE2   . GLU H 4 250 ? 141.815 69.350  4.172   1.00 94.24  ? 287 GLU F OE2   1 
ATOM 9715  N N     . ASN H 4 251 ? 144.493 64.264  3.886   1.00 79.21  ? 288 ASN F N     1 
ATOM 9716  C CA    . ASN H 4 251 ? 145.846 63.858  3.539   1.00 79.54  ? 288 ASN F CA    1 
ATOM 9717  C C     . ASN H 4 251 ? 146.052 62.413  4.000   1.00 79.93  ? 288 ASN F C     1 
ATOM 9718  O O     . ASN H 4 251 ? 146.877 62.134  4.877   1.00 79.43  ? 288 ASN F O     1 
ATOM 9719  C CB    . ASN H 4 251 ? 146.852 64.803  4.215   1.00 74.46  ? 288 ASN F CB    1 
ATOM 9720  C CG    . ASN H 4 251 ? 148.237 64.753  3.578   1.00 74.30  ? 288 ASN F CG    1 
ATOM 9721  O OD1   . ASN H 4 251 ? 148.378 64.801  2.352   1.00 71.56  ? 288 ASN F OD1   1 
ATOM 9722  N ND2   . ASN H 4 251 ? 149.269 64.678  4.415   1.00 71.69  ? 288 ASN F ND2   1 
ATOM 9723  N N     . GLY H 4 252 ? 145.285 61.497  3.407   1.00 85.56  ? 289 GLY F N     1 
ATOM 9724  C CA    . GLY H 4 252 ? 145.397 60.094  3.770   1.00 84.53  ? 289 GLY F CA    1 
ATOM 9725  C C     . GLY H 4 252 ? 144.159 59.230  3.572   1.00 83.21  ? 289 GLY F C     1 
ATOM 9726  O O     . GLY H 4 252 ? 144.137 58.386  2.679   1.00 70.55  ? 289 GLY F O     1 
ATOM 9727  N N     . GLY H 4 253 ? 143.134 59.435  4.402   1.00 80.08  ? 290 GLY F N     1 
ATOM 9728  C CA    . GLY H 4 253 ? 141.915 58.641  4.312   1.00 79.62  ? 290 GLY F CA    1 
ATOM 9729  C C     . GLY H 4 253 ? 142.157 57.311  5.002   1.00 78.39  ? 290 GLY F C     1 
ATOM 9730  O O     . GLY H 4 253 ? 141.679 56.260  4.565   1.00 55.40  ? 290 GLY F O     1 
ATOM 9731  N N     . VAL H 4 254 ? 142.891 57.382  6.111   1.00 67.25  ? 291 VAL F N     1 
ATOM 9732  C CA    . VAL H 4 254 ? 143.287 56.217  6.888   1.00 62.70  ? 291 VAL F CA    1 
ATOM 9733  C C     . VAL H 4 254 ? 142.475 55.865  8.137   1.00 62.29  ? 291 VAL F C     1 
ATOM 9734  O O     . VAL H 4 254 ? 141.533 55.084  8.060   1.00 36.90  ? 291 VAL F O     1 
ATOM 9735  C CB    . VAL H 4 254 ? 144.768 56.353  7.305   1.00 40.73  ? 291 VAL F CB    1 
ATOM 9736  C CG1   . VAL H 4 254 ? 145.304 55.012  7.772   1.00 36.72  ? 291 VAL F CG1   1 
ATOM 9737  C CG2   . VAL H 4 254 ? 145.589 56.892  6.142   1.00 36.95  ? 291 VAL F CG2   1 
ATOM 9738  N N     . TRP H 4 255 ? 142.857 56.446  9.278   1.00 69.76  ? 292 TRP F N     1 
ATOM 9739  C CA    . TRP H 4 255 ? 142.234 56.181  10.586  1.00 66.84  ? 292 TRP F CA    1 
ATOM 9740  C C     . TRP H 4 255 ? 141.035 55.243  10.637  1.00 63.62  ? 292 TRP F C     1 
ATOM 9741  O O     . TRP H 4 255 ? 139.927 55.589  10.217  1.00 52.95  ? 292 TRP F O     1 
ATOM 9742  C CB    . TRP H 4 255 ? 141.848 57.476  11.322  1.00 40.27  ? 292 TRP F CB    1 
ATOM 9743  C CG    . TRP H 4 255 ? 141.570 57.190  12.780  1.00 44.14  ? 292 TRP F CG    1 
ATOM 9744  C CD1   . TRP H 4 255 ? 142.494 56.876  13.750  1.00 46.08  ? 292 TRP F CD1   1 
ATOM 9745  C CD2   . TRP H 4 255 ? 140.286 57.026  13.391  1.00 45.68  ? 292 TRP F CD2   1 
ATOM 9746  N NE1   . TRP H 4 255 ? 141.863 56.517  14.915  1.00 46.07  ? 292 TRP F NE1   1 
ATOM 9747  C CE2   . TRP H 4 255 ? 140.508 56.598  14.725  1.00 46.95  ? 292 TRP F CE2   1 
ATOM 9748  C CE3   . TRP H 4 255 ? 138.966 57.188  12.941  1.00 44.33  ? 292 TRP F CE3   1 
ATOM 9749  C CZ2   . TRP H 4 255 ? 139.458 56.330  15.609  1.00 45.85  ? 292 TRP F CZ2   1 
ATOM 9750  C CZ3   . TRP H 4 255 ? 137.927 56.919  13.821  1.00 44.33  ? 292 TRP F CZ3   1 
ATOM 9751  C CH2   . TRP H 4 255 ? 138.180 56.494  15.141  1.00 46.46  ? 292 TRP F CH2   1 
ATOM 9752  N N     . GLU H 4 256 ? 141.278 54.062  11.198  1.00 10.88  ? 293 GLU F N     1 
ATOM 9753  C CA    . GLU H 4 256 ? 140.267 53.023  11.347  1.00 8.76   ? 293 GLU F CA    1 
ATOM 9754  C C     . GLU H 4 256 ? 140.301 52.422  12.762  1.00 6.44   ? 293 GLU F C     1 
ATOM 9755  O O     . GLU H 4 256 ? 141.310 51.864  13.187  1.00 31.03  ? 293 GLU F O     1 
ATOM 9756  C CB    . GLU H 4 256 ? 140.505 51.912  10.319  1.00 43.81  ? 293 GLU F CB    1 
ATOM 9757  C CG    . GLU H 4 256 ? 141.941 51.392  10.322  1.00 50.81  ? 293 GLU F CG    1 
ATOM 9758  C CD    . GLU H 4 256 ? 142.112 50.103  9.548   1.00 57.28  ? 293 GLU F CD    1 
ATOM 9759  O OE1   . GLU H 4 256 ? 141.693 50.045  8.370   1.00 62.27  ? 293 GLU F OE1   1 
ATOM 9760  O OE2   . GLU H 4 256 ? 142.678 49.147  10.121  1.00 57.74  ? 293 GLU F OE2   1 
ATOM 9761  N N     . GLY H 4 257 ? 139.184 52.539  13.476  1.00 31.87  ? 294 GLY F N     1 
ATOM 9762  C CA    . GLY H 4 257 ? 139.090 51.995  14.819  1.00 30.32  ? 294 GLY F CA    1 
ATOM 9763  C C     . GLY H 4 257 ? 138.223 50.751  14.867  1.00 32.02  ? 294 GLY F C     1 
ATOM 9764  O O     . GLY H 4 257 ? 137.358 50.539  14.015  1.00 26.87  ? 294 GLY F O     1 
ATOM 9765  N N     . PHE H 4 258 ? 138.462 49.916  15.872  1.00 31.80  ? 295 PHE F N     1 
ATOM 9766  C CA    . PHE H 4 258 ? 137.697 48.684  16.036  1.00 31.17  ? 295 PHE F CA    1 
ATOM 9767  C C     . PHE H 4 258 ? 137.020 48.576  17.386  1.00 30.34  ? 295 PHE F C     1 
ATOM 9768  O O     . PHE H 4 258 ? 137.644 48.775  18.423  1.00 30.16  ? 295 PHE F O     1 
ATOM 9769  C CB    . PHE H 4 258 ? 138.584 47.463  15.852  1.00 33.72  ? 295 PHE F CB    1 
ATOM 9770  C CG    . PHE H 4 258 ? 139.044 47.260  14.448  1.00 33.87  ? 295 PHE F CG    1 
ATOM 9771  C CD1   . PHE H 4 258 ? 138.149 47.365  13.392  1.00 34.26  ? 295 PHE F CD1   1 
ATOM 9772  C CD2   . PHE H 4 258 ? 140.368 46.927  14.179  1.00 33.75  ? 295 PHE F CD2   1 
ATOM 9773  C CE1   . PHE H 4 258 ? 138.564 47.138  12.080  1.00 35.72  ? 295 PHE F CE1   1 
ATOM 9774  C CE2   . PHE H 4 258 ? 140.793 46.700  12.876  1.00 34.47  ? 295 PHE F CE2   1 
ATOM 9775  C CZ    . PHE H 4 258 ? 139.888 46.804  11.821  1.00 35.69  ? 295 PHE F CZ    1 
ATOM 9776  N N     . GLY H 4 259 ? 135.727 48.280  17.367  1.00 30.60  ? 296 GLY F N     1 
ATOM 9777  C CA    . GLY H 4 259 ? 135.013 48.114  18.614  1.00 30.50  ? 296 GLY F CA    1 
ATOM 9778  C C     . GLY H 4 259 ? 135.521 46.804  19.184  1.00 29.85  ? 296 GLY F C     1 
ATOM 9779  O O     . GLY H 4 259 ? 135.761 45.861  18.429  1.00 38.33  ? 296 GLY F O     1 
ATOM 9780  N N     . ASP H 4 260 ? 135.719 46.736  20.495  1.00 36.57  ? 297 ASP F N     1 
ATOM 9781  C CA    . ASP H 4 260 ? 136.198 45.499  21.085  1.00 36.84  ? 297 ASP F CA    1 
ATOM 9782  C C     . ASP H 4 260 ? 135.058 44.706  21.686  1.00 36.45  ? 297 ASP F C     1 
ATOM 9783  O O     . ASP H 4 260 ? 134.350 45.176  22.576  1.00 45.12  ? 297 ASP F O     1 
ATOM 9784  C CB    . ASP H 4 260 ? 137.287 45.777  22.127  1.00 50.61  ? 297 ASP F CB    1 
ATOM 9785  C CG    . ASP H 4 260 ? 138.682 45.782  21.511  1.00 56.47  ? 297 ASP F CG    1 
ATOM 9786  O OD1   . ASP H 4 260 ? 139.141 44.698  21.083  1.00 57.15  ? 297 ASP F OD1   1 
ATOM 9787  O OD2   . ASP H 4 260 ? 139.317 46.863  21.432  1.00 55.15  ? 297 ASP F OD2   1 
ATOM 9788  N N     . PHE H 4 261 ? 134.869 43.501  21.167  1.00 47.42  ? 298 PHE F N     1 
ATOM 9789  C CA    . PHE H 4 261 ? 133.816 42.642  21.658  1.00 42.44  ? 298 PHE F CA    1 
ATOM 9790  C C     . PHE H 4 261 ? 134.184 41.184  21.498  1.00 44.64  ? 298 PHE F C     1 
ATOM 9791  O O     . PHE H 4 261 ? 134.422 40.710  20.392  1.00 27.54  ? 298 PHE F O     1 
ATOM 9792  C CB    . PHE H 4 261 ? 132.514 42.915  20.910  1.00 18.99  ? 298 PHE F CB    1 
ATOM 9793  C CG    . PHE H 4 261 ? 132.558 42.546  19.454  1.00 17.77  ? 298 PHE F CG    1 
ATOM 9794  C CD1   . PHE H 4 261 ? 133.117 43.407  18.518  1.00 14.05  ? 298 PHE F CD1   1 
ATOM 9795  C CD2   . PHE H 4 261 ? 132.030 41.330  19.015  1.00 18.73  ? 298 PHE F CD2   1 
ATOM 9796  C CE1   . PHE H 4 261 ? 133.140 43.055  17.161  1.00 13.62  ? 298 PHE F CE1   1 
ATOM 9797  C CE2   . PHE H 4 261 ? 132.055 40.978  17.669  1.00 12.44  ? 298 PHE F CE2   1 
ATOM 9798  C CZ    . PHE H 4 261 ? 132.610 41.841  16.742  1.00 11.70  ? 298 PHE F CZ    1 
ATOM 9799  N N     . SER H 4 262 ? 134.237 40.464  22.608  1.00 16.66  ? 299 SER F N     1 
ATOM 9800  C CA    . SER H 4 262 ? 134.560 39.055  22.539  1.00 15.03  ? 299 SER F CA    1 
ATOM 9801  C C     . SER H 4 262 ? 133.400 38.414  21.802  1.00 16.12  ? 299 SER F C     1 
ATOM 9802  O O     . SER H 4 262 ? 132.265 38.891  21.885  1.00 50.62  ? 299 SER F O     1 
ATOM 9803  C CB    . SER H 4 262 ? 134.701 38.476  23.945  1.00 56.61  ? 299 SER F CB    1 
ATOM 9804  O OG    . SER H 4 262 ? 133.718 39.017  24.811  1.00 58.62  ? 299 SER F OG    1 
ATOM 9805  N N     . PRO H 4 263 ? 133.656 37.330  21.063  1.00 18.44  ? 300 PRO F N     1 
ATOM 9806  C CA    . PRO H 4 263 ? 132.555 36.692  20.336  1.00 18.44  ? 300 PRO F CA    1 
ATOM 9807  C C     . PRO H 4 263 ? 131.398 36.261  21.244  1.00 18.44  ? 300 PRO F C     1 
ATOM 9808  O O     . PRO H 4 263 ? 130.368 35.804  20.770  1.00 38.83  ? 300 PRO F O     1 
ATOM 9809  C CB    . PRO H 4 263 ? 133.241 35.523  19.638  1.00 18.72  ? 300 PRO F CB    1 
ATOM 9810  C CG    . PRO H 4 263 ? 134.343 35.177  20.591  1.00 19.13  ? 300 PRO F CG    1 
ATOM 9811  C CD    . PRO H 4 263 ? 134.887 36.527  20.973  1.00 21.09  ? 300 PRO F CD    1 
ATOM 9812  N N     . THR H 4 264 ? 131.584 36.414  22.550  1.00 12.11  ? 301 THR F N     1 
ATOM 9813  C CA    . THR H 4 264 ? 130.560 36.042  23.522  1.00 12.11  ? 301 THR F CA    1 
ATOM 9814  C C     . THR H 4 264 ? 129.459 37.093  23.499  1.00 12.11  ? 301 THR F C     1 
ATOM 9815  O O     . THR H 4 264 ? 128.272 36.802  23.689  1.00 39.72  ? 301 THR F O     1 
ATOM 9816  C CB    . THR H 4 264 ? 131.132 36.004  24.957  1.00 34.98  ? 301 THR F CB    1 
ATOM 9817  O OG1   . THR H 4 264 ? 132.513 35.628  24.923  1.00 32.00  ? 301 THR F OG1   1 
ATOM 9818  C CG2   . THR H 4 264 ? 130.369 34.995  25.798  1.00 34.43  ? 301 THR F CG2   1 
ATOM 9819  N N     . ASP H 4 265 ? 129.888 38.325  23.260  1.00 48.08  ? 302 ASP F N     1 
ATOM 9820  C CA    . ASP H 4 265 ? 129.012 39.484  23.226  1.00 49.01  ? 302 ASP F CA    1 
ATOM 9821  C C     . ASP H 4 265 ? 128.077 39.490  22.012  1.00 49.72  ? 302 ASP F C     1 
ATOM 9822  O O     . ASP H 4 265 ? 127.098 40.238  21.992  1.00 60.64  ? 302 ASP F O     1 
ATOM 9823  C CB    . ASP H 4 265 ? 129.868 40.763  23.269  1.00 68.61  ? 302 ASP F CB    1 
ATOM 9824  C CG    . ASP H 4 265 ? 130.730 40.860  24.537  1.00 69.94  ? 302 ASP F CG    1 
ATOM 9825  O OD1   . ASP H 4 265 ? 131.762 41.573  24.524  1.00 66.84  ? 302 ASP F OD1   1 
ATOM 9826  O OD2   . ASP H 4 265 ? 130.371 40.229  25.554  1.00 74.40  ? 302 ASP F OD2   1 
ATOM 9827  N N     . VAL H 4 266 ? 128.370 38.664  21.005  1.00 29.15  ? 303 VAL F N     1 
ATOM 9828  C CA    . VAL H 4 266 ? 127.504 38.605  19.826  1.00 27.35  ? 303 VAL F CA    1 
ATOM 9829  C C     . VAL H 4 266 ? 126.280 37.781  20.184  1.00 26.23  ? 303 VAL F C     1 
ATOM 9830  O O     . VAL H 4 266 ? 126.313 36.549  20.159  1.00 25.87  ? 303 VAL F O     1 
ATOM 9831  C CB    . VAL H 4 266 ? 128.203 37.958  18.598  1.00 9.23   ? 303 VAL F CB    1 
ATOM 9832  C CG1   . VAL H 4 266 ? 127.158 37.489  17.580  1.00 7.95   ? 303 VAL F CG1   1 
ATOM 9833  C CG2   . VAL H 4 266 ? 129.130 38.968  17.929  1.00 11.66  ? 303 VAL F CG2   1 
ATOM 9834  N N     . HIS H 4 267 ? 125.196 38.467  20.526  1.00 20.55  ? 304 HIS F N     1 
ATOM 9835  C CA    . HIS H 4 267 ? 123.984 37.763  20.895  1.00 19.47  ? 304 HIS F CA    1 
ATOM 9836  C C     . HIS H 4 267 ? 123.336 37.058  19.700  1.00 17.85  ? 304 HIS F C     1 
ATOM 9837  O O     . HIS H 4 267 ? 123.071 37.667  18.667  1.00 18.96  ? 304 HIS F O     1 
ATOM 9838  C CB    . HIS H 4 267 ? 122.979 38.715  21.529  1.00 29.59  ? 304 HIS F CB    1 
ATOM 9839  C CG    . HIS H 4 267 ? 121.873 38.014  22.250  1.00 29.23  ? 304 HIS F CG    1 
ATOM 9840  N ND1   . HIS H 4 267 ? 120.754 38.666  22.717  1.00 31.37  ? 304 HIS F ND1   1 
ATOM 9841  C CD2   . HIS H 4 267 ? 121.713 36.712  22.579  1.00 29.11  ? 304 HIS F CD2   1 
ATOM 9842  C CE1   . HIS H 4 267 ? 119.948 37.796  23.298  1.00 31.79  ? 304 HIS F CE1   1 
ATOM 9843  N NE2   . HIS H 4 267 ? 120.508 36.601  23.228  1.00 30.79  ? 304 HIS F NE2   1 
ATOM 9844  N N     . ARG H 4 268 ? 123.087 35.762  19.865  1.00 13.60  ? 305 ARG F N     1 
ATOM 9845  C CA    . ARG H 4 268 ? 122.482 34.886  18.850  1.00 13.60  ? 305 ARG F CA    1 
ATOM 9846  C C     . ARG H 4 268 ? 122.587 35.290  17.382  1.00 13.60  ? 305 ARG F C     1 
ATOM 9847  O O     . ARG H 4 268 ? 121.570 35.336  16.678  1.00 13.60  ? 305 ARG F O     1 
ATOM 9848  C CB    . ARG H 4 268 ? 120.996 34.627  19.157  1.00 19.54  ? 305 ARG F CB    1 
ATOM 9849  C CG    . ARG H 4 268 ? 120.703 34.276  20.601  1.00 19.54  ? 305 ARG F CG    1 
ATOM 9850  C CD    . ARG H 4 268 ? 120.273 32.829  20.860  1.00 19.54  ? 305 ARG F CD    1 
ATOM 9851  N NE    . ARG H 4 268 ? 120.069 32.632  22.302  1.00 21.51  ? 305 ARG F NE    1 
ATOM 9852  C CZ    . ARG H 4 268 ? 121.035 32.771  23.215  1.00 24.34  ? 305 ARG F CZ    1 
ATOM 9853  N NH1   . ARG H 4 268 ? 122.270 33.091  22.829  1.00 22.18  ? 305 ARG F NH1   1 
ATOM 9854  N NH2   . ARG H 4 268 ? 120.773 32.634  24.508  1.00 22.96  ? 305 ARG F NH2   1 
ATOM 9855  N N     . GLN H 4 269 ? 123.804 35.563  16.922  1.00 11.63  ? 306 GLN F N     1 
ATOM 9856  C CA    . GLN H 4 269 ? 124.070 35.929  15.523  1.00 11.63  ? 306 GLN F CA    1 
ATOM 9857  C C     . GLN H 4 269 ? 123.323 37.123  14.960  1.00 11.63  ? 306 GLN F C     1 
ATOM 9858  O O     . GLN H 4 269 ? 123.327 37.323  13.751  1.00 35.01  ? 306 GLN F O     1 
ATOM 9859  C CB    . GLN H 4 269 ? 123.806 34.728  14.605  1.00 29.94  ? 306 GLN F CB    1 
ATOM 9860  C CG    . GLN H 4 269 ? 124.724 33.547  14.836  1.00 31.22  ? 306 GLN F CG    1 
ATOM 9861  C CD    . GLN H 4 269 ? 124.321 32.316  14.049  1.00 34.98  ? 306 GLN F CD    1 
ATOM 9862  O OE1   . GLN H 4 269 ? 123.256 31.731  14.266  1.00 35.10  ? 306 GLN F OE1   1 
ATOM 9863  N NE2   . GLN H 4 269 ? 125.178 31.911  13.127  1.00 33.70  ? 306 GLN F NE2   1 
ATOM 9864  N N     . PHE H 4 270 ? 122.693 37.921  15.811  1.00 15.48  ? 307 PHE F N     1 
ATOM 9865  C CA    . PHE H 4 270 ? 121.945 39.070  15.314  1.00 18.19  ? 307 PHE F CA    1 
ATOM 9866  C C     . PHE H 4 270 ? 122.163 40.363  16.068  1.00 17.83  ? 307 PHE F C     1 
ATOM 9867  O O     . PHE H 4 270 ? 121.635 41.414  15.701  1.00 2.00   ? 307 PHE F O     1 
ATOM 9868  C CB    . PHE H 4 270 ? 120.463 38.748  15.300  1.00 6.23   ? 307 PHE F CB    1 
ATOM 9869  C CG    . PHE H 4 270 ? 120.080 37.761  14.237  1.00 8.83   ? 307 PHE F CG    1 
ATOM 9870  C CD1   . PHE H 4 270 ? 120.101 38.131  12.890  1.00 6.64   ? 307 PHE F CD1   1 
ATOM 9871  C CD2   . PHE H 4 270 ? 119.722 36.460  14.574  1.00 9.23   ? 307 PHE F CD2   1 
ATOM 9872  C CE1   . PHE H 4 270 ? 119.776 37.234  11.895  1.00 5.79   ? 307 PHE F CE1   1 
ATOM 9873  C CE2   . PHE H 4 270 ? 119.397 35.559  13.589  1.00 6.83   ? 307 PHE F CE2   1 
ATOM 9874  C CZ    . PHE H 4 270 ? 119.426 35.953  12.236  1.00 5.79   ? 307 PHE F CZ    1 
ATOM 9875  N N     . ALA H 4 271 ? 122.953 40.287  17.122  1.00 33.04  ? 308 ALA F N     1 
ATOM 9876  C CA    . ALA H 4 271 ? 123.231 41.457  17.919  1.00 31.81  ? 308 ALA F CA    1 
ATOM 9877  C C     . ALA H 4 271 ? 124.686 41.451  18.339  1.00 32.83  ? 308 ALA F C     1 
ATOM 9878  O O     . ALA H 4 271 ? 125.308 40.395  18.456  1.00 17.08  ? 308 ALA F O     1 
ATOM 9879  C CB    . ALA H 4 271 ? 122.336 41.459  19.139  1.00 15.55  ? 308 ALA F CB    1 
ATOM 9880  N N     . ILE H 4 272 ? 125.237 42.639  18.537  1.00 12.89  ? 309 ILE F N     1 
ATOM 9881  C CA    . ILE H 4 272 ? 126.606 42.747  18.992  1.00 12.89  ? 309 ILE F CA    1 
ATOM 9882  C C     . ILE H 4 272 ? 126.676 43.925  19.945  1.00 12.89  ? 309 ILE F C     1 
ATOM 9883  O O     . ILE H 4 272 ? 126.189 45.011  19.646  1.00 23.12  ? 309 ILE F O     1 
ATOM 9884  C CB    . ILE H 4 272 ? 127.580 42.950  17.848  1.00 12.70  ? 309 ILE F CB    1 
ATOM 9885  C CG1   . ILE H 4 272 ? 127.518 41.762  16.888  1.00 12.59  ? 309 ILE F CG1   1 
ATOM 9886  C CG2   . ILE H 4 272 ? 128.973 43.089  18.400  1.00 13.15  ? 309 ILE F CG2   1 
ATOM 9887  C CD1   . ILE H 4 272 ? 128.476 41.881  15.695  1.00 8.61   ? 309 ILE F CD1   1 
ATOM 9888  N N     . VAL H 4 273 ? 127.241 43.675  21.118  1.00 2.00   ? 310 VAL F N     1 
ATOM 9889  C CA    . VAL H 4 273 ? 127.397 44.679  22.143  1.00 2.00   ? 310 VAL F CA    1 
ATOM 9890  C C     . VAL H 4 273 ? 128.869 44.955  22.152  1.00 2.00   ? 310 VAL F C     1 
ATOM 9891  O O     . VAL H 4 273 ? 129.660 44.063  22.400  1.00 2.00   ? 310 VAL F O     1 
ATOM 9892  C CB    . VAL H 4 273 ? 127.013 44.127  23.490  1.00 2.35   ? 310 VAL F CB    1 
ATOM 9893  C CG1   . VAL H 4 273 ? 127.368 45.116  24.572  1.00 3.44   ? 310 VAL F CG1   1 
ATOM 9894  C CG2   . VAL H 4 273 ? 125.544 43.801  23.500  1.00 2.53   ? 310 VAL F CG2   1 
ATOM 9895  N N     . PHE H 4 274 ? 129.255 46.191  21.891  1.00 14.47  ? 311 PHE F N     1 
ATOM 9896  C CA    . PHE H 4 274 ? 130.670 46.516  21.851  1.00 14.47  ? 311 PHE F CA    1 
ATOM 9897  C C     . PHE H 4 274 ? 131.017 47.850  22.482  1.00 14.47  ? 311 PHE F C     1 
ATOM 9898  O O     . PHE H 4 274 ? 130.142 48.672  22.748  1.00 20.08  ? 311 PHE F O     1 
ATOM 9899  C CB    . PHE H 4 274 ? 131.131 46.524  20.400  1.00 9.96   ? 311 PHE F CB    1 
ATOM 9900  C CG    . PHE H 4 274 ? 130.594 47.680  19.586  1.00 4.70   ? 311 PHE F CG    1 
ATOM 9901  C CD1   . PHE H 4 274 ? 131.461 48.611  19.032  1.00 5.25   ? 311 PHE F CD1   1 
ATOM 9902  C CD2   . PHE H 4 274 ? 129.241 47.789  19.306  1.00 5.56   ? 311 PHE F CD2   1 
ATOM 9903  C CE1   . PHE H 4 274 ? 130.986 49.624  18.214  1.00 11.01  ? 311 PHE F CE1   1 
ATOM 9904  C CE2   . PHE H 4 274 ? 128.756 48.807  18.484  1.00 7.04   ? 311 PHE F CE2   1 
ATOM 9905  C CZ    . PHE H 4 274 ? 129.632 49.722  17.935  1.00 10.73  ? 311 PHE F CZ    1 
ATOM 9906  N N     . LYS H 4 275 ? 132.309 48.054  22.710  1.00 6.94   ? 312 LYS F N     1 
ATOM 9907  C CA    . LYS H 4 275 ? 132.781 49.296  23.285  1.00 6.94   ? 312 LYS F CA    1 
ATOM 9908  C C     . LYS H 4 275 ? 133.463 50.038  22.156  1.00 6.94   ? 312 LYS F C     1 
ATOM 9909  O O     . LYS H 4 275 ? 134.060 49.426  21.271  1.00 13.35  ? 312 LYS F O     1 
ATOM 9910  C CB    . LYS H 4 275 ? 133.738 49.030  24.450  1.00 12.00  ? 312 LYS F CB    1 
ATOM 9911  C CG    . LYS H 4 275 ? 133.089 48.340  25.663  1.00 11.08  ? 312 LYS F CG    1 
ATOM 9912  C CD    . LYS H 4 275 ? 133.370 49.122  26.947  1.00 9.41   ? 312 LYS F CD    1 
ATOM 9913  C CE    . LYS H 4 275 ? 132.785 48.468  28.200  1.00 8.63   ? 312 LYS F CE    1 
ATOM 9914  N NZ    . LYS H 4 275 ? 133.426 47.160  28.452  1.00 8.63   ? 312 LYS F NZ    1 
ATOM 9915  N N     . THR H 4 276 ? 133.333 51.362  22.184  1.00 32.32  ? 313 THR F N     1 
ATOM 9916  C CA    . THR H 4 276 ? 133.885 52.244  21.159  1.00 31.26  ? 313 THR F CA    1 
ATOM 9917  C C     . THR H 4 276 ? 135.365 52.505  21.284  1.00 33.46  ? 313 THR F C     1 
ATOM 9918  O O     . THR H 4 276 ? 135.870 52.656  22.388  1.00 25.56  ? 313 THR F O     1 
ATOM 9919  C CB    . THR H 4 276 ? 133.181 53.582  21.189  1.00 17.39  ? 313 THR F CB    1 
ATOM 9920  O OG1   . THR H 4 276 ? 132.968 53.982  22.552  1.00 9.94   ? 313 THR F OG1   1 
ATOM 9921  C CG2   . THR H 4 276 ? 131.866 53.475  20.484  1.00 14.03  ? 313 THR F CG2   1 
ATOM 9922  N N     . PRO H 4 277 ? 136.073 52.572  20.138  1.00 23.67  ? 314 PRO F N     1 
ATOM 9923  C CA    . PRO H 4 277 ? 137.512 52.814  19.992  1.00 23.00  ? 314 PRO F CA    1 
ATOM 9924  C C     . PRO H 4 277 ? 137.817 54.280  20.196  1.00 24.62  ? 314 PRO F C     1 
ATOM 9925  O O     . PRO H 4 277 ? 136.953 55.131  20.004  1.00 31.34  ? 314 PRO F O     1 
ATOM 9926  C CB    . PRO H 4 277 ? 137.792 52.425  18.533  1.00 21.26  ? 314 PRO F CB    1 
ATOM 9927  C CG    . PRO H 4 277 ? 136.593 51.630  18.113  1.00 21.27  ? 314 PRO F CG    1 
ATOM 9928  C CD    . PRO H 4 277 ? 135.475 52.319  18.819  1.00 21.31  ? 314 PRO F CD    1 
ATOM 9929  N N     . LYS H 4 278 ? 139.056 54.576  20.555  1.00 19.00  ? 315 LYS F N     1 
ATOM 9930  C CA    . LYS H 4 278 ? 139.465 55.951  20.739  1.00 16.84  ? 315 LYS F CA    1 
ATOM 9931  C C     . LYS H 4 278 ? 139.545 56.561  19.317  1.00 19.65  ? 315 LYS F C     1 
ATOM 9932  O O     . LYS H 4 278 ? 139.914 55.874  18.358  1.00 21.54  ? 315 LYS F O     1 
ATOM 9933  C CB    . LYS H 4 278 ? 140.810 55.938  21.449  1.00 9.59   ? 315 LYS F CB    1 
ATOM 9934  C CG    . LYS H 4 278 ? 141.266 57.246  21.966  1.00 9.62   ? 315 LYS F CG    1 
ATOM 9935  C CD    . LYS H 4 278 ? 142.463 57.021  22.845  1.00 8.62   ? 315 LYS F CD    1 
ATOM 9936  C CE    . LYS H 4 278 ? 142.081 56.370  24.182  1.00 10.15  ? 315 LYS F CE    1 
ATOM 9937  N NZ    . LYS H 4 278 ? 141.242 57.263  25.059  1.00 9.05   ? 315 LYS F NZ    1 
ATOM 9938  N N     . TYR H 4 279 ? 139.145 57.821  19.172  1.00 34.45  ? 316 TYR F N     1 
ATOM 9939  C CA    . TYR H 4 279 ? 139.195 58.484  17.872  1.00 37.71  ? 316 TYR F CA    1 
ATOM 9940  C C     . TYR H 4 279 ? 140.593 59.052  17.688  1.00 39.89  ? 316 TYR F C     1 
ATOM 9941  O O     . TYR H 4 279 ? 141.326 59.212  18.667  1.00 32.92  ? 316 TYR F O     1 
ATOM 9942  C CB    . TYR H 4 279 ? 138.172 59.616  17.800  1.00 28.53  ? 316 TYR F CB    1 
ATOM 9943  C CG    . TYR H 4 279 ? 138.272 60.456  16.542  1.00 26.96  ? 316 TYR F CG    1 
ATOM 9944  C CD1   . TYR H 4 279 ? 138.198 59.871  15.273  1.00 25.00  ? 316 TYR F CD1   1 
ATOM 9945  C CD2   . TYR H 4 279 ? 138.408 61.839  16.620  1.00 24.78  ? 316 TYR F CD2   1 
ATOM 9946  C CE1   . TYR H 4 279 ? 138.254 60.648  14.108  1.00 23.87  ? 316 TYR F CE1   1 
ATOM 9947  C CE2   . TYR H 4 279 ? 138.464 62.628  15.462  1.00 26.54  ? 316 TYR F CE2   1 
ATOM 9948  C CZ    . TYR H 4 279 ? 138.382 62.025  14.217  1.00 25.24  ? 316 TYR F CZ    1 
ATOM 9949  O OH    . TYR H 4 279 ? 138.393 62.817  13.104  1.00 23.43  ? 316 TYR F OH    1 
ATOM 9950  N N     . LYS H 4 280 ? 140.973 59.359  16.449  1.00 49.76  ? 317 LYS F N     1 
ATOM 9951  C CA    . LYS H 4 280 ? 142.307 59.888  16.213  1.00 46.81  ? 317 LYS F CA    1 
ATOM 9952  C C     . LYS H 4 280 ? 142.597 61.134  17.043  1.00 47.37  ? 317 LYS F C     1 
ATOM 9953  O O     . LYS H 4 280 ? 143.386 61.072  17.990  1.00 51.09  ? 317 LYS F O     1 
ATOM 9954  C CB    . LYS H 4 280 ? 142.528 60.157  14.720  1.00 32.63  ? 317 LYS F CB    1 
ATOM 9955  C CG    . LYS H 4 280 ? 141.619 61.185  14.068  1.00 29.83  ? 317 LYS F CG    1 
ATOM 9956  C CD    . LYS H 4 280 ? 141.818 61.133  12.549  1.00 28.38  ? 317 LYS F CD    1 
ATOM 9957  C CE    . LYS H 4 280 ? 141.297 62.374  11.814  1.00 28.09  ? 317 LYS F CE    1 
ATOM 9958  N NZ    . LYS H 4 280 ? 142.160 63.598  11.965  1.00 25.16  ? 317 LYS F NZ    1 
ATOM 9959  N N     . ASP H 4 281 ? 141.958 62.258  16.730  1.00 47.72  ? 318 ASP F N     1 
ATOM 9960  C CA    . ASP H 4 281 ? 142.229 63.477  17.502  1.00 50.96  ? 318 ASP F CA    1 
ATOM 9961  C C     . ASP H 4 281 ? 141.339 63.725  18.727  1.00 50.22  ? 318 ASP F C     1 
ATOM 9962  O O     . ASP H 4 281 ? 140.289 64.358  18.638  1.00 44.22  ? 318 ASP F O     1 
ATOM 9963  C CB    . ASP H 4 281 ? 142.211 64.702  16.588  1.00 47.44  ? 318 ASP F CB    1 
ATOM 9964  C CG    . ASP H 4 281 ? 143.261 64.619  15.506  1.00 51.46  ? 318 ASP F CG    1 
ATOM 9965  O OD1   . ASP H 4 281 ? 144.444 64.400  15.853  1.00 50.77  ? 318 ASP F OD1   1 
ATOM 9966  O OD2   . ASP H 4 281 ? 142.905 64.768  14.316  1.00 54.96  ? 318 ASP F OD2   1 
ATOM 9967  N N     . VAL H 4 282 ? 141.785 63.221  19.874  1.00 25.14  ? 319 VAL F N     1 
ATOM 9968  C CA    . VAL H 4 282 ? 141.069 63.378  21.130  1.00 22.73  ? 319 VAL F CA    1 
ATOM 9969  C C     . VAL H 4 282 ? 141.229 64.827  21.605  1.00 20.17  ? 319 VAL F C     1 
ATOM 9970  O O     . VAL H 4 282 ? 140.742 65.214  22.673  1.00 42.58  ? 319 VAL F O     1 
ATOM 9971  C CB    . VAL H 4 282 ? 141.644 62.382  22.188  1.00 39.00  ? 319 VAL F CB    1 
ATOM 9972  C CG1   . VAL H 4 282 ? 141.043 62.635  23.568  1.00 39.27  ? 319 VAL F CG1   1 
ATOM 9973  C CG2   . VAL H 4 282 ? 141.381 60.947  21.732  1.00 42.62  ? 319 VAL F CG2   1 
ATOM 9974  N N     . ASN H 4 283 ? 141.919 65.619  20.787  1.00 39.78  ? 320 ASN F N     1 
ATOM 9975  C CA    . ASN H 4 283 ? 142.187 67.029  21.061  1.00 40.59  ? 320 ASN F CA    1 
ATOM 9976  C C     . ASN H 4 283 ? 141.158 67.895  20.341  1.00 41.42  ? 320 ASN F C     1 
ATOM 9977  O O     . ASN H 4 283 ? 141.266 69.119  20.329  1.00 44.06  ? 320 ASN F O     1 
ATOM 9978  C CB    . ASN H 4 283 ? 143.585 67.376  20.557  1.00 46.72  ? 320 ASN F CB    1 
ATOM 9979  C CG    . ASN H 4 283 ? 143.860 66.807  19.162  1.00 45.45  ? 320 ASN F CG    1 
ATOM 9980  O OD1   . ASN H 4 283 ? 143.153 67.112  18.185  1.00 47.44  ? 320 ASN F OD1   1 
ATOM 9981  N ND2   . ASN H 4 283 ? 144.889 65.965  19.066  1.00 42.17  ? 320 ASN F ND2   1 
ATOM 9982  N N     . ILE H 4 284 ? 140.173 67.242  19.729  1.00 50.71  ? 321 ILE F N     1 
ATOM 9983  C CA    . ILE H 4 284 ? 139.116 67.927  18.985  1.00 52.03  ? 321 ILE F CA    1 
ATOM 9984  C C     . ILE H 4 284 ? 138.288 68.839  19.883  1.00 54.52  ? 321 ILE F C     1 
ATOM 9985  O O     . ILE H 4 284 ? 138.069 68.547  21.062  1.00 28.67  ? 321 ILE F O     1 
ATOM 9986  C CB    . ILE H 4 284 ? 138.074 66.935  18.322  1.00 20.91  ? 321 ILE F CB    1 
ATOM 9987  C CG1   . ILE H 4 284 ? 137.453 66.043  19.398  1.00 24.28  ? 321 ILE F CG1   1 
ATOM 9988  C CG2   . ILE H 4 284 ? 138.719 66.084  17.216  1.00 19.63  ? 321 ILE F CG2   1 
ATOM 9989  C CD1   . ILE H 4 284 ? 136.015 65.653  19.140  1.00 24.49  ? 321 ILE F CD1   1 
ATOM 9990  N N     . THR H 4 285 ? 137.823 69.945  19.319  1.00 48.62  ? 322 THR F N     1 
ATOM 9991  C CA    . THR H 4 285 ? 136.975 70.860  20.060  1.00 49.68  ? 322 THR F CA    1 
ATOM 9992  C C     . THR H 4 285 ? 135.601 70.871  19.379  1.00 47.97  ? 322 THR F C     1 
ATOM 9993  O O     . THR H 4 285 ? 134.577 71.168  19.999  1.00 42.02  ? 322 THR F O     1 
ATOM 9994  C CB    . THR H 4 285 ? 137.579 72.293  20.123  1.00 49.74  ? 322 THR F CB    1 
ATOM 9995  O OG1   . THR H 4 285 ? 137.901 72.768  18.809  1.00 50.34  ? 322 THR F OG1   1 
ATOM 9996  C CG2   . THR H 4 285 ? 138.835 72.279  20.980  1.00 51.28  ? 322 THR F CG2   1 
ATOM 9997  N N     . LYS H 4 286 ? 135.590 70.534  18.094  1.00 32.44  ? 323 LYS F N     1 
ATOM 9998  C CA    . LYS H 4 286 ? 134.356 70.466  17.331  1.00 29.07  ? 323 LYS F CA    1 
ATOM 9999  C C     . LYS H 4 286 ? 134.214 68.977  17.002  1.00 29.50  ? 323 LYS F C     1 
ATOM 10000 O O     . LYS H 4 286 ? 135.166 68.355  16.520  1.00 63.62  ? 323 LYS F O     1 
ATOM 10001 C CB    . LYS H 4 286 ? 134.488 71.262  16.028  1.00 58.11  ? 323 LYS F CB    1 
ATOM 10002 C CG    . LYS H 4 286 ? 135.205 72.599  16.149  1.00 58.48  ? 323 LYS F CG    1 
ATOM 10003 C CD    . LYS H 4 286 ? 134.455 73.587  17.017  1.00 56.49  ? 323 LYS F CD    1 
ATOM 10004 C CE    . LYS H 4 286 ? 135.311 74.804  17.295  1.00 53.16  ? 323 LYS F CE    1 
ATOM 10005 N NZ    . LYS H 4 286 ? 134.706 75.672  18.331  1.00 51.48  ? 323 LYS F NZ    1 
ATOM 10006 N N     . PRO H 4 287 ? 133.031 68.387  17.240  1.00 33.74  ? 324 PRO F N     1 
ATOM 10007 C CA    . PRO H 4 287 ? 132.858 66.965  16.941  1.00 31.91  ? 324 PRO F CA    1 
ATOM 10008 C C     . PRO H 4 287 ? 133.083 66.646  15.461  1.00 32.89  ? 324 PRO F C     1 
ATOM 10009 O O     . PRO H 4 287 ? 132.885 67.505  14.586  1.00 11.34  ? 324 PRO F O     1 
ATOM 10010 C CB    . PRO H 4 287 ? 131.432 66.707  17.388  1.00 4.76   ? 324 PRO F CB    1 
ATOM 10011 C CG    . PRO H 4 287 ? 130.763 67.960  17.008  1.00 4.24   ? 324 PRO F CG    1 
ATOM 10012 C CD    . PRO H 4 287 ? 131.725 69.023  17.477  1.00 7.06   ? 324 PRO F CD    1 
ATOM 10013 N N     . ALA H 4 288 ? 133.490 65.405  15.197  1.00 52.62  ? 325 ALA F N     1 
ATOM 10014 C CA    . ALA H 4 288 ? 133.770 64.937  13.840  1.00 50.08  ? 325 ALA F CA    1 
ATOM 10015 C C     . ALA H 4 288 ? 132.920 63.729  13.436  1.00 49.30  ? 325 ALA F C     1 
ATOM 10016 O O     . ALA H 4 288 ? 132.736 62.795  14.219  1.00 59.90  ? 325 ALA F O     1 
ATOM 10017 C CB    . ALA H 4 288 ? 135.248 64.581  13.720  1.00 56.31  ? 325 ALA F CB    1 
ATOM 10018 N N     . SER H 4 289 ? 132.415 63.750  12.204  1.00 22.81  ? 326 SER F N     1 
ATOM 10019 C CA    . SER H 4 289 ? 131.596 62.665  11.688  1.00 23.66  ? 326 SER F CA    1 
ATOM 10020 C C     . SER H 4 289 ? 132.469 61.607  11.045  1.00 25.32  ? 326 SER F C     1 
ATOM 10021 O O     . SER H 4 289 ? 133.123 61.859  10.038  1.00 41.28  ? 326 SER F O     1 
ATOM 10022 C CB    . SER H 4 289 ? 130.600 63.180  10.645  1.00 46.01  ? 326 SER F CB    1 
ATOM 10023 O OG    . SER H 4 289 ? 129.599 63.991  11.232  1.00 49.50  ? 326 SER F OG    1 
ATOM 10024 N N     . VAL H 4 290 ? 132.469 60.419  11.637  1.00 49.67  ? 327 VAL F N     1 
ATOM 10025 C CA    . VAL H 4 290 ? 133.239 59.289  11.130  1.00 50.94  ? 327 VAL F CA    1 
ATOM 10026 C C     . VAL H 4 290 ? 132.245 58.183  10.744  1.00 52.09  ? 327 VAL F C     1 
ATOM 10027 O O     . VAL H 4 290 ? 131.026 58.356  10.887  1.00 25.20  ? 327 VAL F O     1 
ATOM 10028 C CB    . VAL H 4 290 ? 134.222 58.758  12.207  1.00 13.73  ? 327 VAL F CB    1 
ATOM 10029 C CG1   . VAL H 4 290 ? 133.507 57.857  13.175  1.00 11.23  ? 327 VAL F CG1   1 
ATOM 10030 C CG2   . VAL H 4 290 ? 135.348 58.006  11.563  1.00 16.16  ? 327 VAL F CG2   1 
ATOM 10031 N N     . PHE H 4 291 ? 132.751 57.046  10.280  1.00 37.94  ? 328 PHE F N     1 
ATOM 10032 C CA    . PHE H 4 291 ? 131.874 55.960  9.864   1.00 40.46  ? 328 PHE F CA    1 
ATOM 10033 C C     . PHE H 4 291 ? 131.996 54.681  10.669  1.00 41.28  ? 328 PHE F C     1 
ATOM 10034 O O     . PHE H 4 291 ? 132.998 54.439  11.348  1.00 59.14  ? 328 PHE F O     1 
ATOM 10035 C CB    . PHE H 4 291 ? 132.123 55.630  8.391   1.00 48.19  ? 328 PHE F CB    1 
ATOM 10036 C CG    . PHE H 4 291 ? 131.370 56.501  7.439   1.00 49.57  ? 328 PHE F CG    1 
ATOM 10037 C CD1   . PHE H 4 291 ? 129.993 56.389  7.319   1.00 49.17  ? 328 PHE F CD1   1 
ATOM 10038 C CD2   . PHE H 4 291 ? 132.037 57.422  6.644   1.00 50.72  ? 328 PHE F CD2   1 
ATOM 10039 C CE1   . PHE H 4 291 ? 129.291 57.182  6.415   1.00 48.19  ? 328 PHE F CE1   1 
ATOM 10040 C CE2   . PHE H 4 291 ? 131.339 58.222  5.736   1.00 48.68  ? 328 PHE F CE2   1 
ATOM 10041 C CZ    . PHE H 4 291 ? 129.968 58.099  5.623   1.00 49.57  ? 328 PHE F CZ    1 
ATOM 10042 N N     . VAL H 4 292 ? 130.955 53.860  10.566  1.00 28.25  ? 329 VAL F N     1 
ATOM 10043 C CA    . VAL H 4 292 ? 130.901 52.569  11.230  1.00 26.46  ? 329 VAL F CA    1 
ATOM 10044 C C     . VAL H 4 292 ? 130.562 51.600  10.111  1.00 28.30  ? 329 VAL F C     1 
ATOM 10045 O O     . VAL H 4 292 ? 129.871 51.967  9.161   1.00 26.37  ? 329 VAL F O     1 
ATOM 10046 C CB    . VAL H 4 292 ? 129.802 52.537  12.303  1.00 30.62  ? 329 VAL F CB    1 
ATOM 10047 C CG1   . VAL H 4 292 ? 129.872 51.243  13.078  1.00 28.61  ? 329 VAL F CG1   1 
ATOM 10048 C CG2   . VAL H 4 292 ? 129.960 53.710  13.234  1.00 28.89  ? 329 VAL F CG2   1 
ATOM 10049 N N     . GLN H 4 293 ? 131.038 50.367  10.214  1.00 29.15  ? 330 GLN F N     1 
ATOM 10050 C CA    . GLN H 4 293 ? 130.789 49.399  9.159   1.00 28.95  ? 330 GLN F CA    1 
ATOM 10051 C C     . GLN H 4 293 ? 130.980 47.985  9.660   1.00 29.20  ? 330 GLN F C     1 
ATOM 10052 O O     . GLN H 4 293 ? 131.921 47.705  10.398  1.00 38.56  ? 330 GLN F O     1 
ATOM 10053 C CB    . GLN H 4 293 ? 131.763 49.648  8.009   1.00 62.35  ? 330 GLN F CB    1 
ATOM 10054 C CG    . GLN H 4 293 ? 131.257 49.275  6.631   1.00 63.43  ? 330 GLN F CG    1 
ATOM 10055 C CD    . GLN H 4 293 ? 132.266 49.636  5.540   1.00 66.31  ? 330 GLN F CD    1 
ATOM 10056 O OE1   . GLN H 4 293 ? 131.898 49.905  4.380   1.00 68.91  ? 330 GLN F OE1   1 
ATOM 10057 N NE2   . GLN H 4 293 ? 133.551 49.635  5.908   1.00 67.99  ? 330 GLN F NE2   1 
ATOM 10058 N N     . LEU H 4 294 ? 130.086 47.090  9.265   1.00 21.70  ? 331 LEU F N     1 
ATOM 10059 C CA    . LEU H 4 294 ? 130.239 45.704  9.660   1.00 21.91  ? 331 LEU F CA    1 
ATOM 10060 C C     . LEU H 4 294 ? 131.183 45.123  8.627   1.00 21.37  ? 331 LEU F C     1 
ATOM 10061 O O     . LEU H 4 294 ? 131.043 45.384  7.430   1.00 23.25  ? 331 LEU F O     1 
ATOM 10062 C CB    . LEU H 4 294 ? 128.903 44.965  9.645   1.00 20.15  ? 331 LEU F CB    1 
ATOM 10063 C CG    . LEU H 4 294 ? 128.042 45.103  10.912  1.00 24.53  ? 331 LEU F CG    1 
ATOM 10064 C CD1   . LEU H 4 294 ? 126.733 44.356  10.729  1.00 24.85  ? 331 LEU F CD1   1 
ATOM 10065 C CD2   . LEU H 4 294 ? 128.780 44.545  12.120  1.00 27.91  ? 331 LEU F CD2   1 
ATOM 10066 N N     . ARG H 4 295 ? 132.167 44.362  9.090   1.00 36.67  ? 332 ARG F N     1 
ATOM 10067 C CA    . ARG H 4 295 ? 133.139 43.767  8.186   1.00 38.32  ? 332 ARG F CA    1 
ATOM 10068 C C     . ARG H 4 295 ? 133.397 42.316  8.570   1.00 38.23  ? 332 ARG F C     1 
ATOM 10069 O O     . ARG H 4 295 ? 133.523 41.991  9.753   1.00 49.87  ? 332 ARG F O     1 
ATOM 10070 C CB    . ARG H 4 295 ? 134.449 44.562  8.230   1.00 46.70  ? 332 ARG F CB    1 
ATOM 10071 C CG    . ARG H 4 295 ? 135.397 44.245  7.081   1.00 47.95  ? 332 ARG F CG    1 
ATOM 10072 C CD    . ARG H 4 295 ? 136.594 43.420  7.519   1.00 50.74  ? 332 ARG F CD    1 
ATOM 10073 N NE    . ARG H 4 295 ? 137.613 44.234  8.185   1.00 48.33  ? 332 ARG F NE    1 
ATOM 10074 C CZ    . ARG H 4 295 ? 138.254 45.254  7.617   1.00 46.48  ? 332 ARG F CZ    1 
ATOM 10075 N NH1   . ARG H 4 295 ? 137.984 45.596  6.362   1.00 44.08  ? 332 ARG F NH1   1 
ATOM 10076 N NH2   . ARG H 4 295 ? 139.167 45.929  8.305   1.00 47.14  ? 332 ARG F NH2   1 
ATOM 10077 N N     . ARG H 4 296 ? 133.470 41.442  7.569   1.00 52.87  ? 333 ARG F N     1 
ATOM 10078 C CA    . ARG H 4 296 ? 133.718 40.023  7.815   1.00 55.01  ? 333 ARG F CA    1 
ATOM 10079 C C     . ARG H 4 296 ? 135.209 39.759  7.762   1.00 55.22  ? 333 ARG F C     1 
ATOM 10080 O O     . ARG H 4 296 ? 135.840 39.931  6.721   1.00 44.34  ? 333 ARG F O     1 
ATOM 10081 C CB    . ARG H 4 296 ? 132.996 39.187  6.770   1.00 41.77  ? 333 ARG F CB    1 
ATOM 10082 C CG    . ARG H 4 296 ? 133.090 37.698  6.980   1.00 39.26  ? 333 ARG F CG    1 
ATOM 10083 C CD    . ARG H 4 296 ? 131.867 37.066  6.384   1.00 35.46  ? 333 ARG F CD    1 
ATOM 10084 N NE    . ARG H 4 296 ? 131.512 37.717  5.123   1.00 28.27  ? 333 ARG F NE    1 
ATOM 10085 C CZ    . ARG H 4 296 ? 130.308 37.648  4.561   1.00 24.77  ? 333 ARG F CZ    1 
ATOM 10086 N NH1   . ARG H 4 296 ? 129.347 36.957  5.158   1.00 19.81  ? 333 ARG F NH1   1 
ATOM 10087 N NH2   . ARG H 4 296 ? 130.066 38.259  3.402   1.00 23.49  ? 333 ARG F NH2   1 
ATOM 10088 N N     . LYS H 4 297 ? 135.773 39.336  8.885   1.00 34.60  ? 334 LYS F N     1 
ATOM 10089 C CA    . LYS H 4 297 ? 137.203 39.087  8.939   1.00 34.85  ? 334 LYS F CA    1 
ATOM 10090 C C     . LYS H 4 297 ? 137.685 38.222  7.776   1.00 35.92  ? 334 LYS F C     1 
ATOM 10091 O O     . LYS H 4 297 ? 138.793 38.414  7.271   1.00 56.43  ? 334 LYS F O     1 
ATOM 10092 C CB    . LYS H 4 297 ? 137.588 38.457  10.283  1.00 57.15  ? 334 LYS F CB    1 
ATOM 10093 C CG    . LYS H 4 297 ? 139.089 38.523  10.562  1.00 58.94  ? 334 LYS F CG    1 
ATOM 10094 C CD    . LYS H 4 297 ? 139.660 39.886  10.152  1.00 59.13  ? 334 LYS F CD    1 
ATOM 10095 C CE    . LYS H 4 297 ? 141.159 40.001  10.413  1.00 56.39  ? 334 LYS F CE    1 
ATOM 10096 N NZ    . LYS H 4 297 ? 141.972 39.041  9.628   1.00 53.94  ? 334 LYS F NZ    1 
ATOM 10097 N N     . SER H 4 298 ? 136.846 37.285  7.344   1.00 37.02  ? 335 SER F N     1 
ATOM 10098 C CA    . SER H 4 298 ? 137.176 36.395  6.231   1.00 34.96  ? 335 SER F CA    1 
ATOM 10099 C C     . SER H 4 298 ? 137.422 37.190  4.966   1.00 36.13  ? 335 SER F C     1 
ATOM 10100 O O     . SER H 4 298 ? 138.456 37.819  4.800   1.00 48.36  ? 335 SER F O     1 
ATOM 10101 C CB    . SER H 4 298 ? 136.025 35.423  5.970   1.00 40.10  ? 335 SER F CB    1 
ATOM 10102 O OG    . SER H 4 298 ? 135.750 34.666  7.125   1.00 42.22  ? 335 SER F OG    1 
ATOM 10103 N N     . ASP H 4 299 ? 136.437 37.141  4.080   1.00 42.78  ? 336 ASP F N     1 
ATOM 10104 C CA    . ASP H 4 299 ? 136.431 37.816  2.783   1.00 44.07  ? 336 ASP F CA    1 
ATOM 10105 C C     . ASP H 4 299 ? 136.602 39.323  2.868   1.00 44.55  ? 336 ASP F C     1 
ATOM 10106 O O     . ASP H 4 299 ? 136.876 39.987  1.862   1.00 60.80  ? 336 ASP F O     1 
ATOM 10107 C CB    . ASP H 4 299 ? 135.097 37.541  2.112   1.00 68.62  ? 336 ASP F CB    1 
ATOM 10108 C CG    . ASP H 4 299 ? 133.931 37.906  3.010   1.00 70.66  ? 336 ASP F CG    1 
ATOM 10109 O OD1   . ASP H 4 299 ? 132.774 37.669  2.620   1.00 70.06  ? 336 ASP F OD1   1 
ATOM 10110 O OD2   . ASP H 4 299 ? 134.172 38.432  4.116   1.00 72.50  ? 336 ASP F OD2   1 
ATOM 10111 N N     . LEU H 4 300 ? 136.403 39.853  4.068   1.00 52.30  ? 337 LEU F N     1 
ATOM 10112 C CA    . LEU H 4 300 ? 136.497 41.284  4.319   1.00 53.99  ? 337 LEU F CA    1 
ATOM 10113 C C     . LEU H 4 300 ? 135.349 42.049  3.649   1.00 54.84  ? 337 LEU F C     1 
ATOM 10114 O O     . LEU H 4 300 ? 135.483 43.222  3.294   1.00 53.29  ? 337 LEU F O     1 
ATOM 10115 C CB    . LEU H 4 300 ? 137.854 41.824  3.855   1.00 49.55  ? 337 LEU F CB    1 
ATOM 10116 C CG    . LEU H 4 300 ? 139.065 41.182  4.537   1.00 51.80  ? 337 LEU F CG    1 
ATOM 10117 C CD1   . LEU H 4 300 ? 139.742 40.203  3.566   1.00 50.65  ? 337 LEU F CD1   1 
ATOM 10118 C CD2   . LEU H 4 300 ? 140.034 42.272  4.974   1.00 53.69  ? 337 LEU F CD2   1 
ATOM 10119 N N     . GLU H 4 301 ? 134.222 41.372  3.464   1.00 38.77  ? 338 GLU F N     1 
ATOM 10120 C CA    . GLU H 4 301 ? 133.062 42.026  2.886   1.00 37.88  ? 338 GLU F CA    1 
ATOM 10121 C C     . GLU H 4 301 ? 132.598 43.023  3.934   1.00 36.69  ? 338 GLU F C     1 
ATOM 10122 O O     . GLU H 4 301 ? 132.833 42.824  5.135   1.00 35.24  ? 338 GLU F O     1 
ATOM 10123 C CB    . GLU H 4 301 ? 131.957 41.013  2.597   1.00 38.26  ? 338 GLU F CB    1 
ATOM 10124 C CG    . GLU H 4 301 ? 132.328 40.110  1.478   1.00 37.71  ? 338 GLU F CG    1 
ATOM 10125 C CD    . GLU H 4 301 ? 133.132 40.847  0.446   1.00 38.55  ? 338 GLU F CD    1 
ATOM 10126 O OE1   . GLU H 4 301 ? 132.651 41.901  -0.018  1.00 39.00  ? 338 GLU F OE1   1 
ATOM 10127 O OE2   . GLU H 4 301 ? 134.244 40.382  0.111   1.00 38.58  ? 338 GLU F OE2   1 
ATOM 10128 N N     . THR H 4 302 ? 131.951 44.095  3.486   1.00 74.62  ? 339 THR F N     1 
ATOM 10129 C CA    . THR H 4 302 ? 131.471 45.124  4.398   1.00 71.32  ? 339 THR F CA    1 
ATOM 10130 C C     . THR H 4 302 ? 130.054 45.600  4.122   1.00 72.87  ? 339 THR F C     1 
ATOM 10131 O O     . THR H 4 302 ? 129.568 45.595  2.990   1.00 42.38  ? 339 THR F O     1 
ATOM 10132 C CB    . THR H 4 302 ? 132.374 46.379  4.391   1.00 29.01  ? 339 THR F CB    1 
ATOM 10133 O OG1   . THR H 4 302 ? 132.605 46.799  3.043   1.00 30.61  ? 339 THR F OG1   1 
ATOM 10134 C CG2   . THR H 4 302 ? 133.685 46.112  5.073   1.00 28.04  ? 339 THR F CG2   1 
ATOM 10135 N N     . SER H 4 303 ? 129.407 46.041  5.187   1.00 19.09  ? 340 SER F N     1 
ATOM 10136 C CA    . SER H 4 303 ? 128.050 46.551  5.122   1.00 19.18  ? 340 SER F CA    1 
ATOM 10137 C C     . SER H 4 303 ? 128.087 47.969  4.584   1.00 20.29  ? 340 SER F C     1 
ATOM 10138 O O     . SER H 4 303 ? 129.158 48.562  4.432   1.00 35.15  ? 340 SER F O     1 
ATOM 10139 C CB    . SER H 4 303 ? 127.454 46.603  6.523   1.00 37.17  ? 340 SER F CB    1 
ATOM 10140 O OG    . SER H 4 303 ? 128.162 47.545  7.320   1.00 36.90  ? 340 SER F OG    1 
ATOM 10141 N N     . GLU H 4 304 ? 126.916 48.517  4.285   1.00 61.20  ? 341 GLU F N     1 
ATOM 10142 C CA    . GLU H 4 304 ? 126.879 49.888  3.829   1.00 63.66  ? 341 GLU F CA    1 
ATOM 10143 C C     . GLU H 4 304 ? 127.267 50.569  5.127   1.00 64.05  ? 341 GLU F C     1 
ATOM 10144 O O     . GLU H 4 304 ? 126.778 50.204  6.195   1.00 41.70  ? 341 GLU F O     1 
ATOM 10145 C CB    . GLU H 4 304 ? 125.472 50.297  3.402   1.00 70.35  ? 341 GLU F CB    1 
ATOM 10146 C CG    . GLU H 4 304 ? 125.432 51.564  2.553   1.00 75.53  ? 341 GLU F CG    1 
ATOM 10147 C CD    . GLU H 4 304 ? 126.172 51.413  1.225   1.00 76.97  ? 341 GLU F CD    1 
ATOM 10148 O OE1   . GLU H 4 304 ? 125.766 50.547  0.414   1.00 79.46  ? 341 GLU F OE1   1 
ATOM 10149 O OE2   . GLU H 4 304 ? 127.153 52.159  0.989   1.00 77.10  ? 341 GLU F OE2   1 
ATOM 10150 N N     . PRO H 4 305 ? 128.176 51.546  5.062   1.00 43.20  ? 342 PRO F N     1 
ATOM 10151 C CA    . PRO H 4 305 ? 128.615 52.250  6.262   1.00 43.65  ? 342 PRO F CA    1 
ATOM 10152 C C     . PRO H 4 305 ? 127.543 53.147  6.840   1.00 44.15  ? 342 PRO F C     1 
ATOM 10153 O O     . PRO H 4 305 ? 126.804 53.787  6.103   1.00 52.23  ? 342 PRO F O     1 
ATOM 10154 C CB    . PRO H 4 305 ? 129.797 53.050  5.757   1.00 50.34  ? 342 PRO F CB    1 
ATOM 10155 C CG    . PRO H 4 305 ? 129.313 53.472  4.426   1.00 51.66  ? 342 PRO F CG    1 
ATOM 10156 C CD    . PRO H 4 305 ? 128.769 52.168  3.870   1.00 51.03  ? 342 PRO F CD    1 
ATOM 10157 N N     . LYS H 4 306 ? 127.472 53.193  8.166   1.00 30.42  ? 343 LYS F N     1 
ATOM 10158 C CA    . LYS H 4 306 ? 126.499 54.030  8.865   1.00 30.60  ? 343 LYS F CA    1 
ATOM 10159 C C     . LYS H 4 306 ? 127.272 55.118  9.594   1.00 27.18  ? 343 LYS F C     1 
ATOM 10160 O O     . LYS H 4 306 ? 128.315 54.853  10.181  1.00 38.71  ? 343 LYS F O     1 
ATOM 10161 C CB    . LYS H 4 306 ? 125.703 53.193  9.870   1.00 50.40  ? 343 LYS F CB    1 
ATOM 10162 C CG    . LYS H 4 306 ? 124.892 52.047  9.252   1.00 54.86  ? 343 LYS F CG    1 
ATOM 10163 C CD    . LYS H 4 306 ? 123.499 52.485  8.796   1.00 57.20  ? 343 LYS F CD    1 
ATOM 10164 C CE    . LYS H 4 306 ? 122.637 52.892  9.981   1.00 56.35  ? 343 LYS F CE    1 
ATOM 10165 N NZ    . LYS H 4 306 ? 121.228 53.163  9.598   1.00 55.16  ? 343 LYS F NZ    1 
ATOM 10166 N N     . PRO H 4 307 ? 126.775 56.359  9.563   1.00 45.46  ? 344 PRO F N     1 
ATOM 10167 C CA    . PRO H 4 307 ? 127.463 57.462  10.242  1.00 43.75  ? 344 PRO F CA    1 
ATOM 10168 C C     . PRO H 4 307 ? 127.544 57.344  11.771  1.00 41.69  ? 344 PRO F C     1 
ATOM 10169 O O     . PRO H 4 307 ? 126.705 56.708  12.417  1.00 27.60  ? 344 PRO F O     1 
ATOM 10170 C CB    . PRO H 4 307 ? 126.681 58.693  9.780   1.00 21.40  ? 344 PRO F CB    1 
ATOM 10171 C CG    . PRO H 4 307 ? 125.312 58.162  9.564   1.00 24.29  ? 344 PRO F CG    1 
ATOM 10172 C CD    . PRO H 4 307 ? 125.574 56.843  8.865   1.00 24.72  ? 344 PRO F CD    1 
ATOM 10173 N N     . PHE H 4 308 ? 128.582 57.950  12.336  1.00 42.27  ? 345 PHE F N     1 
ATOM 10174 C CA    . PHE H 4 308 ? 128.799 57.948  13.780  1.00 38.23  ? 345 PHE F CA    1 
ATOM 10175 C C     . PHE H 4 308 ? 129.473 59.272  14.102  1.00 38.39  ? 345 PHE F C     1 
ATOM 10176 O O     . PHE H 4 308 ? 130.408 59.677  13.425  1.00 13.26  ? 345 PHE F O     1 
ATOM 10177 C CB    . PHE H 4 308 ? 129.681 56.764  14.198  1.00 17.36  ? 345 PHE F CB    1 
ATOM 10178 C CG    . PHE H 4 308 ? 129.763 56.577  15.682  1.00 17.36  ? 345 PHE F CG    1 
ATOM 10179 C CD1   . PHE H 4 308 ? 130.720 57.250  16.428  1.00 17.36  ? 345 PHE F CD1   1 
ATOM 10180 C CD2   . PHE H 4 308 ? 128.835 55.796  16.341  1.00 17.36  ? 345 PHE F CD2   1 
ATOM 10181 C CE1   . PHE H 4 308 ? 130.742 57.147  17.816  1.00 17.36  ? 345 PHE F CE1   1 
ATOM 10182 C CE2   . PHE H 4 308 ? 128.841 55.686  17.723  1.00 17.36  ? 345 PHE F CE2   1 
ATOM 10183 C CZ    . PHE H 4 308 ? 129.791 56.358  18.468  1.00 17.36  ? 345 PHE F CZ    1 
ATOM 10184 N N     . LEU H 4 309 ? 128.990 59.954  15.129  1.00 14.95  ? 346 LEU F N     1 
ATOM 10185 C CA    . LEU H 4 309 ? 129.526 61.266  15.484  1.00 15.46  ? 346 LEU F CA    1 
ATOM 10186 C C     . LEU H 4 309 ? 130.320 61.303  16.805  1.00 16.60  ? 346 LEU F C     1 
ATOM 10187 O O     . LEU H 4 309 ? 129.771 61.036  17.877  1.00 48.36  ? 346 LEU F O     1 
ATOM 10188 C CB    . LEU H 4 309 ? 128.348 62.261  15.526  1.00 45.64  ? 346 LEU F CB    1 
ATOM 10189 C CG    . LEU H 4 309 ? 128.419 63.762  15.844  1.00 53.65  ? 346 LEU F CG    1 
ATOM 10190 C CD1   . LEU H 4 309 ? 128.842 63.950  17.284  1.00 55.21  ? 346 LEU F CD1   1 
ATOM 10191 C CD2   . LEU H 4 309 ? 129.358 64.486  14.891  1.00 54.05  ? 346 LEU F CD2   1 
ATOM 10192 N N     . TYR H 4 310 ? 131.609 61.631  16.714  1.00 17.77  ? 347 TYR F N     1 
ATOM 10193 C CA    . TYR H 4 310 ? 132.463 61.737  17.889  1.00 17.06  ? 347 TYR F CA    1 
ATOM 10194 C C     . TYR H 4 310 ? 132.469 63.172  18.387  1.00 19.01  ? 347 TYR F C     1 
ATOM 10195 O O     . TYR H 4 310 ? 132.661 64.105  17.602  1.00 19.60  ? 347 TYR F O     1 
ATOM 10196 C CB    . TYR H 4 310 ? 133.903 61.391  17.566  1.00 10.57  ? 347 TYR F CB    1 
ATOM 10197 C CG    . TYR H 4 310 ? 134.237 59.929  17.525  1.00 6.85   ? 347 TYR F CG    1 
ATOM 10198 C CD1   . TYR H 4 310 ? 134.553 59.304  16.310  1.00 2.93   ? 347 TYR F CD1   1 
ATOM 10199 C CD2   . TYR H 4 310 ? 134.290 59.168  18.704  1.00 5.86   ? 347 TYR F CD2   1 
ATOM 10200 C CE1   . TYR H 4 310 ? 134.912 57.964  16.268  1.00 2.00   ? 347 TYR F CE1   1 
ATOM 10201 C CE2   . TYR H 4 310 ? 134.647 57.819  18.667  1.00 4.64   ? 347 TYR F CE2   1 
ATOM 10202 C CZ    . TYR H 4 310 ? 134.951 57.238  17.442  1.00 2.53   ? 347 TYR F CZ    1 
ATOM 10203 O OH    . TYR H 4 310 ? 135.263 55.923  17.367  1.00 4.29   ? 347 TYR F OH    1 
ATOM 10204 N N     . TYR H 4 311 ? 132.268 63.336  19.693  1.00 36.37  ? 348 TYR F N     1 
ATOM 10205 C CA    . TYR H 4 311 ? 132.297 64.647  20.333  1.00 39.09  ? 348 TYR F CA    1 
ATOM 10206 C C     . TYR H 4 311 ? 133.327 64.561  21.474  1.00 38.60  ? 348 TYR F C     1 
ATOM 10207 O O     . TYR H 4 311 ? 133.587 63.481  22.001  1.00 30.80  ? 348 TYR F O     1 
ATOM 10208 C CB    . TYR H 4 311 ? 130.904 65.045  20.856  1.00 47.75  ? 348 TYR F CB    1 
ATOM 10209 C CG    . TYR H 4 311 ? 130.250 64.026  21.757  1.00 47.70  ? 348 TYR F CG    1 
ATOM 10210 C CD1   . TYR H 4 311 ? 129.372 63.072  21.252  1.00 48.82  ? 348 TYR F CD1   1 
ATOM 10211 C CD2   . TYR H 4 311 ? 130.566 63.972  23.103  1.00 49.11  ? 348 TYR F CD2   1 
ATOM 10212 C CE1   . TYR H 4 311 ? 128.836 62.082  22.072  1.00 48.68  ? 348 TYR F CE1   1 
ATOM 10213 C CE2   . TYR H 4 311 ? 130.039 62.990  23.926  1.00 50.22  ? 348 TYR F CE2   1 
ATOM 10214 C CZ    . TYR H 4 311 ? 129.183 62.051  23.404  1.00 50.35  ? 348 TYR F CZ    1 
ATOM 10215 O OH    . TYR H 4 311 ? 128.724 61.059  24.223  1.00 47.65  ? 348 TYR F OH    1 
ATOM 10216 N N     . PRO H 4 312 ? 133.912 65.702  21.881  1.00 22.16  ? 349 PRO F N     1 
ATOM 10217 C CA    . PRO H 4 312 ? 134.927 65.774  22.952  1.00 22.09  ? 349 PRO F CA    1 
ATOM 10218 C C     . PRO H 4 312 ? 134.504 65.515  24.402  1.00 21.21  ? 349 PRO F C     1 
ATOM 10219 O O     . PRO H 4 312 ? 133.321 65.411  24.715  1.00 8.89   ? 349 PRO F O     1 
ATOM 10220 C CB    . PRO H 4 312 ? 135.489 67.174  22.787  1.00 12.94  ? 349 PRO F CB    1 
ATOM 10221 C CG    . PRO H 4 312 ? 134.244 67.951  22.437  1.00 15.65  ? 349 PRO F CG    1 
ATOM 10222 C CD    . PRO H 4 312 ? 133.570 67.055  21.397  1.00 15.40  ? 349 PRO F CD    1 
ATOM 10223 N N     . GLU H 4 313 ? 135.507 65.432  25.275  1.00 14.05  ? 350 GLU F N     1 
ATOM 10224 C CA    . GLU H 4 313 ? 135.320 65.188  26.705  1.00 12.53  ? 350 GLU F CA    1 
ATOM 10225 C C     . GLU H 4 313 ? 135.063 66.495  27.438  1.00 11.01  ? 350 GLU F C     1 
ATOM 10226 O O     . GLU H 4 313 ? 134.583 66.453  28.589  1.00 10.12  ? 350 GLU F O     1 
ATOM 10227 C CB    . GLU H 4 313 ? 136.558 64.517  27.307  1.00 22.10  ? 350 GLU F CB    1 
ATOM 10228 C CG    . GLU H 4 313 ? 136.310 64.004  28.708  1.00 24.10  ? 350 GLU F CG    1 
ATOM 10229 C CD    . GLU H 4 313 ? 135.378 62.782  28.725  1.00 28.78  ? 350 GLU F CD    1 
ATOM 10230 O OE1   . GLU H 4 313 ? 134.529 62.668  29.650  1.00 28.35  ? 350 GLU F OE1   1 
ATOM 10231 O OE2   . GLU H 4 313 ? 135.505 61.924  27.812  1.00 33.53  ? 350 GLU F OE2   1 
ATOM 10232 O OXT   . GLU H 4 313 ? 135.367 67.546  26.843  1.00 23.31  ? 350 GLU F OXT   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   701 701 DT  T   C . n 
A 1 2   DG  2   702 702 DG  G   C . n 
A 1 3   DG  3   703 703 DG  G   C . n 
A 1 4   DG  4   704 704 DG  G   C . n 
A 1 5   DA  5   705 705 DA  A   C . n 
A 1 6   DC  6   706 706 DC  C   C . n 
A 1 7   DT  7   707 707 DT  T   C . n 
A 1 8   DT  8   708 708 DT  T   C . n 
A 1 9   DT  9   709 709 DT  T   C . n 
A 1 10  DC  10  710 710 DC  C   C . n 
A 1 11  DC  11  711 711 DC  C   C . n 
A 1 12  DT  12  712 712 DT  T   C . n 
B 2 1   DA  1   713 713 DA  A   D . n 
B 2 2   DA  2   714 714 DA  A   D . n 
B 2 3   DG  3   715 715 DG  G   D . n 
B 2 4   DG  4   716 716 DG  G   D . n 
B 2 5   DA  5   717 717 DA  A   D . n 
B 2 6   DA  6   718 718 DA  A   D . n 
B 2 7   DA  7   719 719 DA  A   D . n 
B 2 8   DG  8   720 720 DG  G   D . n 
B 2 9   DT  9   721 721 DT  T   D . n 
B 2 10  DC  10  722 722 DC  C   D . n 
B 2 11  DC  11  723 723 DC  C   D . n 
B 2 12  DC  12  724 724 DC  C   D . n 
C 1 1   DT  1   801 801 DT  T   G . n 
C 1 2   DG  2   802 802 DG  G   G . n 
C 1 3   DG  3   803 803 DG  G   G . n 
C 1 4   DG  4   804 804 DG  G   G . n 
C 1 5   DA  5   805 805 DA  A   G . n 
C 1 6   DC  6   806 806 DC  C   G . n 
C 1 7   DT  7   807 807 DT  T   G . n 
C 1 8   DT  8   808 808 DT  T   G . n 
C 1 9   DT  9   809 809 DT  T   G . n 
C 1 10  DC  10  810 810 DC  C   G . n 
C 1 11  DC  11  811 811 DC  C   G . n 
C 1 12  DT  12  812 812 DT  T   G . n 
D 2 1   DA  1   813 813 DA  A   H . n 
D 2 2   DA  2   814 814 DA  A   H . n 
D 2 3   DG  3   815 815 DG  G   H . n 
D 2 4   DG  4   816 816 DG  G   H . n 
D 2 5   DA  5   817 817 DA  A   H . n 
D 2 6   DA  6   818 818 DA  A   H . n 
D 2 7   DA  7   819 819 DA  A   H . n 
D 2 8   DG  8   820 820 DG  G   H . n 
D 2 9   DT  9   821 821 DT  T   H . n 
D 2 10  DC  10  822 822 DC  C   H . n 
D 2 11  DC  11  823 823 DC  C   H . n 
D 2 12  DC  12  824 824 DC  C   H . n 
E 3 1   MET 1   18  ?   ?   ?   A . n 
E 3 2   ALA 2   19  19  ALA ALA A . n 
E 3 3   TYR 3   20  20  TYR TYR A . n 
E 3 4   VAL 4   21  21  VAL VAL A . n 
E 3 5   GLU 5   22  22  GLU GLU A . n 
E 3 6   ILE 6   23  23  ILE ILE A . n 
E 3 7   ILE 7   24  24  ILE ILE A . n 
E 3 8   GLU 8   25  25  GLU GLU A . n 
E 3 9   GLN 9   26  26  GLN GLN A . n 
E 3 10  PRO 10  27  27  PRO PRO A . n 
E 3 11  LYS 11  28  28  LYS LYS A . n 
E 3 12  GLN 12  29  29  GLN GLN A . n 
E 3 13  ARG 13  30  30  ARG ARG A . n 
E 3 14  GLY 14  31  31  GLY GLY A . n 
E 3 15  MET 15  32  32  MET MET A . n 
E 3 16  ARG 16  33  33  ARG ARG A . n 
E 3 17  PHE 17  34  34  PHE PHE A . n 
E 3 18  ARG 18  35  35  ARG ARG A . n 
E 3 19  TYR 19  36  36  TYR TYR A . n 
E 3 20  LYS 20  37  37  LYS LYS A . n 
E 3 21  CYS 21  38  38  CYS CYS A . n 
E 3 22  GLU 22  39  39  GLU GLU A . n 
E 3 23  GLY 23  40  40  GLY GLY A . n 
E 3 24  ARG 24  41  41  ARG ARG A . n 
E 3 25  SER 25  42  42  SER SER A . n 
E 3 26  ALA 26  43  43  ALA ALA A . n 
E 3 27  GLY 27  44  44  GLY GLY A . n 
E 3 28  SER 28  45  45  SER SER A . n 
E 3 29  ILE 29  46  46  ILE ILE A . n 
E 3 30  PRO 30  47  47  PRO PRO A . n 
E 3 31  GLY 31  48  48  GLY GLY A . n 
E 3 32  GLU 32  49  49  GLU GLU A . n 
E 3 33  ARG 33  50  50  ARG ARG A . n 
E 3 34  SER 34  51  51  SER SER A . n 
E 3 35  THR 35  52  52  THR THR A . n 
E 3 36  ASP 36  53  53  ASP ASP A . n 
E 3 37  THR 37  54  54  THR THR A . n 
E 3 38  THR 38  55  55  THR THR A . n 
E 3 39  LYS 39  56  56  LYS LYS A . n 
E 3 40  THR 40  57  57  THR THR A . n 
E 3 41  HIS 41  58  58  HIS HIS A . n 
E 3 42  PRO 42  59  59  PRO PRO A . n 
E 3 43  THR 43  60  60  THR THR A . n 
E 3 44  ILE 44  61  61  ILE ILE A . n 
E 3 45  LYS 45  62  62  LYS LYS A . n 
E 3 46  ILE 46  63  63  ILE ILE A . n 
E 3 47  ASN 47  64  64  ASN ASN A . n 
E 3 48  GLY 48  65  65  GLY GLY A . n 
E 3 49  TYR 49  66  66  TYR TYR A . n 
E 3 50  THR 50  67  67  THR THR A . n 
E 3 51  GLY 51  68  68  GLY GLY A . n 
E 3 52  PRO 52  69  69  PRO PRO A . n 
E 3 53  GLY 53  70  70  GLY GLY A . n 
E 3 54  THR 54  71  71  THR THR A . n 
E 3 55  VAL 55  72  72  VAL VAL A . n 
E 3 56  ARG 56  73  73  ARG ARG A . n 
E 3 57  ILE 57  74  74  ILE ILE A . n 
E 3 58  SER 58  75  75  SER SER A . n 
E 3 59  LEU 59  76  76  LEU LEU A . n 
E 3 60  VAL 60  77  77  VAL VAL A . n 
E 3 61  THR 61  78  78  THR THR A . n 
E 3 62  LYS 62  79  79  LYS LYS A . n 
E 3 63  ASP 63  80  80  ASP ASP A . n 
E 3 64  PRO 64  81  81  PRO PRO A . n 
E 3 65  PRO 65  82  82  PRO PRO A . n 
E 3 66  HIS 66  83  83  HIS HIS A . n 
E 3 67  ARG 67  84  84  ARG ARG A . n 
E 3 68  PRO 68  85  85  PRO PRO A . n 
E 3 69  HIS 69  86  86  HIS HIS A . n 
E 3 70  PRO 70  87  87  PRO PRO A . n 
E 3 71  HIS 71  88  88  HIS HIS A . n 
E 3 72  GLU 72  89  89  GLU GLU A . n 
E 3 73  LEU 73  90  90  LEU LEU A . n 
E 3 74  VAL 74  91  91  VAL VAL A . n 
E 3 75  GLY 75  92  92  GLY GLY A . n 
E 3 76  LYS 76  93  93  LYS LYS A . n 
E 3 77  ASP 77  94  94  ASP ASP A . n 
E 3 78  CYS 78  95  95  CYS CYS A . n 
E 3 79  ARG 79  96  96  ARG ARG A . n 
E 3 80  ASP 80  97  97  ASP ASP A . n 
E 3 81  GLY 81  98  98  GLY GLY A . n 
E 3 82  TYR 82  99  99  TYR TYR A . n 
E 3 83  TYR 83  100 100 TYR TYR A . n 
E 3 84  GLU 84  101 101 GLU GLU A . n 
E 3 85  ALA 85  102 102 ALA ALA A . n 
E 3 86  ASP 86  103 103 ASP ASP A . n 
E 3 87  LEU 87  104 104 LEU LEU A . n 
E 3 88  CYS 88  105 105 CYS CYS A . n 
E 3 89  PRO 89  106 106 PRO PRO A . n 
E 3 90  ASP 90  107 107 ASP ASP A . n 
E 3 91  ARG 91  108 108 ARG ARG A . n 
E 3 92  SER 92  109 109 SER SER A . n 
E 3 93  ILE 93  110 110 ILE ILE A . n 
E 3 94  HIS 94  111 111 HIS HIS A . n 
E 3 95  SER 95  112 112 SER SER A . n 
E 3 96  PHE 96  113 113 PHE PHE A . n 
E 3 97  GLN 97  114 114 GLN GLN A . n 
E 3 98  ASN 98  115 115 ASN ASN A . n 
E 3 99  LEU 99  116 116 LEU LEU A . n 
E 3 100 GLY 100 117 117 GLY GLY A . n 
E 3 101 ILE 101 118 118 ILE ILE A . n 
E 3 102 GLN 102 119 119 GLN GLN A . n 
E 3 103 CYS 103 120 120 CYS CYS A . n 
E 3 104 VAL 104 121 121 VAL VAL A . n 
E 3 105 LYS 105 122 122 LYS LYS A . n 
E 3 106 LYS 106 123 123 LYS LYS A . n 
E 3 107 ARG 107 124 124 ARG ARG A . n 
E 3 108 ASP 108 125 125 ASP ASP A . n 
E 3 109 LEU 109 126 126 LEU LEU A . n 
E 3 110 GLU 110 127 127 GLU GLU A . n 
E 3 111 GLN 111 128 128 GLN GLN A . n 
E 3 112 ALA 112 129 129 ALA ALA A . n 
E 3 113 ILE 113 130 130 ILE ILE A . n 
E 3 114 SER 114 131 131 SER SER A . n 
E 3 115 GLN 115 132 132 GLN GLN A . n 
E 3 116 ARG 116 133 133 ARG ARG A . n 
E 3 117 ILE 117 134 134 ILE ILE A . n 
E 3 118 GLN 118 135 135 GLN GLN A . n 
E 3 119 THR 119 136 136 THR THR A . n 
E 3 120 ASN 120 137 137 ASN ASN A . n 
E 3 121 ASN 121 138 138 ASN ASN A . n 
E 3 122 ASN 122 139 139 ASN ASN A . n 
E 3 123 PRO 123 140 140 PRO PRO A . n 
E 3 124 PHE 124 141 141 PHE PHE A . n 
E 3 125 HIS 125 142 142 HIS HIS A . n 
E 3 126 VAL 126 143 143 VAL VAL A . n 
E 3 127 PRO 127 144 144 PRO PRO A . n 
E 3 128 ILE 128 145 145 ILE ILE A . n 
E 3 129 GLU 129 146 146 GLU GLU A . n 
E 3 130 GLU 130 147 147 GLU GLU A . n 
E 3 131 GLN 131 148 148 GLN GLN A . n 
E 3 132 ARG 132 149 149 ARG ARG A . n 
E 3 133 GLY 133 150 150 GLY GLY A . n 
E 3 134 ASP 134 151 151 ASP ASP A . n 
E 3 135 TYR 135 152 152 TYR TYR A . n 
E 3 136 ASP 136 153 153 ASP ASP A . n 
E 3 137 LEU 137 154 154 LEU LEU A . n 
E 3 138 ASN 138 155 155 ASN ASN A . n 
E 3 139 ALA 139 156 156 ALA ALA A . n 
E 3 140 VAL 140 157 157 VAL VAL A . n 
E 3 141 ARG 141 158 158 ARG ARG A . n 
E 3 142 LEU 142 159 159 LEU LEU A . n 
E 3 143 CYS 143 160 160 CYS CYS A . n 
E 3 144 PHE 144 161 161 PHE PHE A . n 
E 3 145 GLN 145 162 162 GLN GLN A . n 
E 3 146 VAL 146 163 163 VAL VAL A . n 
E 3 147 THR 147 164 164 THR THR A . n 
E 3 148 VAL 148 165 165 VAL VAL A . n 
E 3 149 ARG 149 166 166 ARG ARG A . n 
E 3 150 ASP 150 167 167 ASP ASP A . n 
E 3 151 PRO 151 168 168 PRO PRO A . n 
E 3 152 ALA 152 169 169 ALA ALA A . n 
E 3 153 GLY 153 170 170 GLY GLY A . n 
E 3 154 ARG 154 171 171 ARG ARG A . n 
E 3 155 PRO 155 172 172 PRO PRO A . n 
E 3 156 LEU 156 173 173 LEU LEU A . n 
E 3 157 LEU 157 174 174 LEU LEU A . n 
E 3 158 LEU 158 175 175 LEU LEU A . n 
E 3 159 THR 159 176 176 THR THR A . n 
E 3 160 PRO 160 177 177 PRO PRO A . n 
E 3 161 VAL 161 178 178 VAL VAL A . n 
E 3 162 LEU 162 179 179 LEU LEU A . n 
E 3 163 SER 163 180 180 SER SER A . n 
E 3 164 HIS 164 181 181 HIS HIS A . n 
E 3 165 PRO 165 182 182 PRO PRO A . n 
E 3 166 ILE 166 183 183 ILE ILE A . n 
E 3 167 PHE 167 184 184 PHE PHE A . n 
E 3 168 ASP 168 185 185 ASP ASP A . n 
E 3 169 ASN 169 186 186 ASN ASN A . n 
E 3 170 ARG 170 187 187 ARG ARG A . n 
E 3 171 ALA 171 188 188 ALA ALA A . n 
E 3 172 PRO 172 189 189 PRO PRO A . n 
E 3 173 ASN 173 190 190 ASN ASN A . n 
E 3 174 THR 174 191 191 THR THR A . n 
E 3 175 ALA 175 192 192 ALA ALA A . n 
E 3 176 GLU 176 193 193 GLU GLU A . n 
E 3 177 LEU 177 194 194 LEU LEU A . n 
E 3 178 LYS 178 195 195 LYS LYS A . n 
E 3 179 ILE 179 196 196 ILE ILE A . n 
E 3 180 CYS 180 197 197 CYS CYS A . n 
E 3 181 ARG 181 198 198 ARG ARG A . n 
E 3 182 VAL 182 199 199 VAL VAL A . n 
E 3 183 ASN 183 200 200 ASN ASN A . n 
E 3 184 ARG 184 201 201 ARG ARG A . n 
E 3 185 ASN 185 202 202 ASN ASN A . n 
E 3 186 SER 186 203 203 SER SER A . n 
E 3 187 GLY 187 204 204 GLY GLY A . n 
E 3 188 SER 188 205 205 SER SER A . n 
E 3 189 CYS 189 206 206 CYS CYS A . n 
E 3 190 LEU 190 207 207 LEU LEU A . n 
E 3 191 GLY 191 208 208 GLY GLY A . n 
E 3 192 GLY 192 209 209 GLY GLY A . n 
E 3 193 ASP 193 210 210 ASP ASP A . n 
E 3 194 GLU 194 211 211 GLU GLU A . n 
E 3 195 ILE 195 212 212 ILE ILE A . n 
E 3 196 PHE 196 213 213 PHE PHE A . n 
E 3 197 LEU 197 214 214 LEU LEU A . n 
E 3 198 LEU 198 215 215 LEU LEU A . n 
E 3 199 CYS 199 216 216 CYS CYS A . n 
E 3 200 ASP 200 217 217 ASP ASP A . n 
E 3 201 LYS 201 218 218 LYS LYS A . n 
E 3 202 VAL 202 219 219 VAL VAL A . n 
E 3 203 GLN 203 220 220 GLN GLN A . n 
E 3 204 LYS 204 221 221 LYS LYS A . n 
E 3 205 GLU 205 222 222 GLU GLU A . n 
E 3 206 ASP 206 223 223 ASP ASP A . n 
E 3 207 ILE 207 224 224 ILE ILE A . n 
E 3 208 GLU 208 225 225 GLU GLU A . n 
E 3 209 VAL 209 226 226 VAL VAL A . n 
E 3 210 TYR 210 227 227 TYR TYR A . n 
E 3 211 PHE 211 228 228 PHE PHE A . n 
E 3 212 THR 212 229 229 THR THR A . n 
E 3 213 GLY 213 230 230 GLY GLY A . n 
E 3 214 PRO 214 231 231 PRO PRO A . n 
E 3 215 GLY 215 232 232 GLY GLY A . n 
E 3 216 TRP 216 233 233 TRP TRP A . n 
E 3 217 GLU 217 234 234 GLU GLU A . n 
E 3 218 ALA 218 235 235 ALA ALA A . n 
E 3 219 ARG 219 236 236 ARG ARG A . n 
E 3 220 GLY 220 237 237 GLY GLY A . n 
E 3 221 SER 221 238 238 SER SER A . n 
E 3 222 PHE 222 239 239 PHE PHE A . n 
E 3 223 SER 223 240 240 SER SER A . n 
E 3 224 GLN 224 241 241 GLN GLN A . n 
E 3 225 ALA 225 242 242 ALA ALA A . n 
E 3 226 ASP 226 243 243 ASP ASP A . n 
E 3 227 VAL 227 244 244 VAL VAL A . n 
E 3 228 HIS 228 245 245 HIS HIS A . n 
E 3 229 ARG 229 246 246 ARG ARG A . n 
E 3 230 GLN 230 247 247 GLN GLN A . n 
E 3 231 VAL 231 248 248 VAL VAL A . n 
E 3 232 ALA 232 249 249 ALA ALA A . n 
E 3 233 ILE 233 250 250 ILE ILE A . n 
E 3 234 VAL 234 251 251 VAL VAL A . n 
E 3 235 PHE 235 252 252 PHE PHE A . n 
E 3 236 ARG 236 253 253 ARG ARG A . n 
E 3 237 THR 237 254 254 THR THR A . n 
E 3 238 PRO 238 255 255 PRO PRO A . n 
E 3 239 PRO 239 256 256 PRO PRO A . n 
E 3 240 TYR 240 257 257 TYR TYR A . n 
E 3 241 ALA 241 258 258 ALA ALA A . n 
E 3 242 ASP 242 259 259 ASP ASP A . n 
E 3 243 PRO 243 260 260 PRO PRO A . n 
E 3 244 SER 244 261 261 SER SER A . n 
E 3 245 LEU 245 262 262 LEU LEU A . n 
E 3 246 GLN 246 263 263 GLN GLN A . n 
E 3 247 ALA 247 264 264 ALA ALA A . n 
E 3 248 PRO 248 265 265 PRO PRO A . n 
E 3 249 VAL 249 266 266 VAL VAL A . n 
E 3 250 ARG 250 267 267 ARG ARG A . n 
E 3 251 VAL 251 268 268 VAL VAL A . n 
E 3 252 SER 252 269 269 SER SER A . n 
E 3 253 MET 253 270 270 MET MET A . n 
E 3 254 GLN 254 271 271 GLN GLN A . n 
E 3 255 LEU 255 272 272 LEU LEU A . n 
E 3 256 ARG 256 273 273 ARG ARG A . n 
E 3 257 ARG 257 274 274 ARG ARG A . n 
E 3 258 PRO 258 275 275 PRO PRO A . n 
E 3 259 SER 259 276 276 SER SER A . n 
E 3 260 ASP 260 277 277 ASP ASP A . n 
E 3 261 ARG 261 278 278 ARG ARG A . n 
E 3 262 GLU 262 279 279 GLU GLU A . n 
E 3 263 LEU 263 280 280 LEU LEU A . n 
E 3 264 SER 264 281 281 SER SER A . n 
E 3 265 GLU 265 282 282 GLU GLU A . n 
E 3 266 PRO 266 283 283 PRO PRO A . n 
E 3 267 MET 267 284 284 MET MET A . n 
E 3 268 GLU 268 285 285 GLU GLU A . n 
E 3 269 PHE 269 286 286 PHE PHE A . n 
E 3 270 GLN 270 287 287 GLN GLN A . n 
E 3 271 TYR 271 288 288 TYR TYR A . n 
E 3 272 LEU 272 289 289 LEU LEU A . n 
E 3 273 PRO 273 290 290 PRO PRO A . n 
E 3 274 ASP 274 291 291 ASP ASP A . n 
F 4 1   MET 1   38  ?   ?   ?   B . n 
F 4 2   GLY 2   39  339 GLY GLY B . n 
F 4 3   PRO 3   40  340 PRO PRO B . n 
F 4 4   TYR 4   41  341 TYR TYR B . n 
F 4 5   LEU 5   42  342 LEU LEU B . n 
F 4 6   GLN 6   43  343 GLN GLN B . n 
F 4 7   ILE 7   44  344 ILE ILE B . n 
F 4 8   LEU 8   45  345 LEU LEU B . n 
F 4 9   GLU 9   46  346 GLU GLU B . n 
F 4 10  GLN 10  47  347 GLN GLN B . n 
F 4 11  PRO 11  48  348 PRO PRO B . n 
F 4 12  LYS 12  49  349 LYS LYS B . n 
F 4 13  GLN 13  50  350 GLN GLN B . n 
F 4 14  ARG 14  51  351 ARG ARG B . n 
F 4 15  GLY 15  52  352 GLY GLY B . n 
F 4 16  PHE 16  53  353 PHE PHE B . n 
F 4 17  ARG 17  54  354 ARG ARG B . n 
F 4 18  PHE 18  55  355 PHE PHE B . n 
F 4 19  ARG 19  56  356 ARG ARG B . n 
F 4 20  TYR 20  57  357 TYR TYR B . n 
F 4 21  VAL 21  58  358 VAL VAL B . n 
F 4 22  CYS 22  59  359 CYS CYS B . n 
F 4 23  GLU 23  60  360 GLU GLU B . n 
F 4 24  GLY 24  61  361 GLY GLY B . n 
F 4 25  PRO 25  62  362 PRO PRO B . n 
F 4 26  SER 26  63  363 SER SER B . n 
F 4 27  HIS 27  64  364 HIS HIS B . n 
F 4 28  GLY 28  65  365 GLY GLY B . n 
F 4 29  GLY 29  66  366 GLY GLY B . n 
F 4 30  LEU 30  67  367 LEU LEU B . n 
F 4 31  PRO 31  68  368 PRO PRO B . n 
F 4 32  GLY 32  69  369 GLY GLY B . n 
F 4 33  ALA 33  70  370 ALA ALA B . n 
F 4 34  SER 34  71  371 SER SER B . n 
F 4 35  SER 35  72  372 SER SER B . n 
F 4 36  GLU 36  73  373 GLU GLU B . n 
F 4 37  LYS 37  74  374 LYS LYS B . n 
F 4 38  ASN 38  75  375 ASN ASN B . n 
F 4 39  LYS 39  76  376 LYS LYS B . n 
F 4 40  LYS 40  77  377 LYS LYS B . n 
F 4 41  SER 41  78  378 SER SER B . n 
F 4 42  TYR 42  79  379 TYR TYR B . n 
F 4 43  PRO 43  80  380 PRO PRO B . n 
F 4 44  GLN 44  81  381 GLN GLN B . n 
F 4 45  VAL 45  82  382 VAL VAL B . n 
F 4 46  LYS 46  83  383 LYS LYS B . n 
F 4 47  ILE 47  84  384 ILE ILE B . n 
F 4 48  CYS 48  85  385 CYS CYS B . n 
F 4 49  ASN 49  86  386 ASN ASN B . n 
F 4 50  TYR 50  87  387 TYR TYR B . n 
F 4 51  VAL 51  88  388 VAL VAL B . n 
F 4 52  GLY 52  89  389 GLY GLY B . n 
F 4 53  PRO 53  90  390 PRO PRO B . n 
F 4 54  ALA 54  91  391 ALA ALA B . n 
F 4 55  LYS 55  92  392 LYS LYS B . n 
F 4 56  VAL 56  93  393 VAL VAL B . n 
F 4 57  ILE 57  94  394 ILE ILE B . n 
F 4 58  VAL 58  95  395 VAL VAL B . n 
F 4 59  GLN 59  96  396 GLN GLN B . n 
F 4 60  LEU 60  97  397 LEU LEU B . n 
F 4 61  VAL 61  98  398 VAL VAL B . n 
F 4 62  THR 62  99  399 THR THR B . n 
F 4 63  ASN 63  100 400 ASN ASN B . n 
F 4 64  GLY 64  101 401 GLY GLY B . n 
F 4 65  LYS 65  102 402 LYS LYS B . n 
F 4 66  ASN 66  103 403 ASN ASN B . n 
F 4 67  ILE 67  104 404 ILE ILE B . n 
F 4 68  HIS 68  105 405 HIS HIS B . n 
F 4 69  LEU 69  106 406 LEU LEU B . n 
F 4 70  HIS 70  107 407 HIS HIS B . n 
F 4 71  ALA 71  108 408 ALA ALA B . n 
F 4 72  HIS 72  109 409 HIS HIS B . n 
F 4 73  SER 73  110 410 SER SER B . n 
F 4 74  LEU 74  111 411 LEU LEU B . n 
F 4 75  VAL 75  112 412 VAL VAL B . n 
F 4 76  GLY 76  113 413 GLY GLY B . n 
F 4 77  LYS 77  114 414 LYS LYS B . n 
F 4 78  HIS 78  115 415 HIS HIS B . n 
F 4 79  CYS 79  116 416 CYS CYS B . n 
F 4 80  GLU 80  117 417 GLU GLU B . n 
F 4 81  ASP 81  118 418 ASP ASP B . n 
F 4 82  GLY 82  119 419 GLY GLY B . n 
F 4 83  VAL 83  120 420 VAL VAL B . n 
F 4 84  CYS 84  121 421 CYS CYS B . n 
F 4 85  THR 85  122 422 THR THR B . n 
F 4 86  VAL 86  123 423 VAL VAL B . n 
F 4 87  THR 87  124 424 THR THR B . n 
F 4 88  ALA 88  125 425 ALA ALA B . n 
F 4 89  GLY 89  126 426 GLY GLY B . n 
F 4 90  PRO 90  127 427 PRO PRO B . n 
F 4 91  LYS 91  128 428 LYS LYS B . n 
F 4 92  ASP 92  129 429 ASP ASP B . n 
F 4 93  MET 93  130 430 MET MET B . n 
F 4 94  VAL 94  131 431 VAL VAL B . n 
F 4 95  VAL 95  132 432 VAL VAL B . n 
F 4 96  GLY 96  133 433 GLY GLY B . n 
F 4 97  PHE 97  134 434 PHE PHE B . n 
F 4 98  ALA 98  135 435 ALA ALA B . n 
F 4 99  ASN 99  136 436 ASN ASN B . n 
F 4 100 LEU 100 137 437 LEU LEU B . n 
F 4 101 GLY 101 138 438 GLY GLY B . n 
F 4 102 ILE 102 139 439 ILE ILE B . n 
F 4 103 LEU 103 140 440 LEU LEU B . n 
F 4 104 HIS 104 141 441 HIS HIS B . n 
F 4 105 VAL 105 142 442 VAL VAL B . n 
F 4 106 THR 106 143 443 THR THR B . n 
F 4 107 LYS 107 144 444 LYS LYS B . n 
F 4 108 LYS 108 145 445 LYS LYS B . n 
F 4 109 LYS 109 146 446 LYS LYS B . n 
F 4 110 VAL 110 147 447 VAL VAL B . n 
F 4 111 PHE 111 148 448 PHE PHE B . n 
F 4 112 GLU 112 149 449 GLU GLU B . n 
F 4 113 THR 113 150 450 THR THR B . n 
F 4 114 LEU 114 151 451 LEU LEU B . n 
F 4 115 GLU 115 152 452 GLU GLU B . n 
F 4 116 ALA 116 153 453 ALA ALA B . n 
F 4 117 ARG 117 154 454 ARG ARG B . n 
F 4 118 MET 118 155 455 MET MET B . n 
F 4 119 THR 119 156 456 THR THR B . n 
F 4 120 GLU 120 157 457 GLU GLU B . n 
F 4 121 ALA 121 158 458 ALA ALA B . n 
F 4 122 CYS 122 159 459 CYS CYS B . n 
F 4 123 ILE 123 160 460 ILE ILE B . n 
F 4 124 ARG 124 161 461 ARG ARG B . n 
F 4 125 GLY 125 162 462 GLY GLY B . n 
F 4 126 TYR 126 163 463 TYR TYR B . n 
F 4 127 ASN 127 164 464 ASN ASN B . n 
F 4 128 PRO 128 165 465 PRO PRO B . n 
F 4 129 GLY 129 166 466 GLY GLY B . n 
F 4 130 LEU 130 167 467 LEU LEU B . n 
F 4 131 LEU 131 168 468 LEU LEU B . n 
F 4 132 VAL 132 169 469 VAL VAL B . n 
F 4 133 HIS 133 170 470 HIS HIS B . n 
F 4 134 SER 134 171 471 SER SER B . n 
F 4 135 ASP 135 172 472 ASP ASP B . n 
F 4 136 LEU 136 173 473 LEU LEU B . n 
F 4 137 ALA 137 174 474 ALA ALA B . n 
F 4 138 TYR 138 175 475 TYR TYR B . n 
F 4 139 LEU 139 176 476 LEU LEU B . n 
F 4 140 GLN 140 177 477 GLN GLN B . n 
F 4 141 ALA 141 178 478 ALA ALA B . n 
F 4 142 GLU 142 179 479 GLU GLU B . n 
F 4 143 GLY 143 180 480 GLY GLY B . n 
F 4 144 GLY 144 181 481 GLY GLY B . n 
F 4 145 GLY 145 182 482 GLY GLY B . n 
F 4 146 ASP 146 183 483 ASP ASP B . n 
F 4 147 ARG 147 184 484 ARG ARG B . n 
F 4 148 GLN 148 185 485 GLN GLN B . n 
F 4 149 LEU 149 186 486 LEU LEU B . n 
F 4 150 THR 150 187 487 THR THR B . n 
F 4 151 ASP 151 188 488 ASP ASP B . n 
F 4 152 ARG 152 189 489 ARG ARG B . n 
F 4 153 GLU 153 190 490 GLU GLU B . n 
F 4 154 LYS 154 191 491 LYS LYS B . n 
F 4 155 GLU 155 192 492 GLU GLU B . n 
F 4 156 ILE 156 193 493 ILE ILE B . n 
F 4 157 ILE 157 194 494 ILE ILE B . n 
F 4 158 ARG 158 195 495 ARG ARG B . n 
F 4 159 GLN 159 196 496 GLN GLN B . n 
F 4 160 ALA 160 197 497 ALA ALA B . n 
F 4 161 ALA 161 198 498 ALA ALA B . n 
F 4 162 VAL 162 199 499 VAL VAL B . n 
F 4 163 GLN 163 200 500 GLN GLN B . n 
F 4 164 GLN 164 201 501 GLN GLN B . n 
F 4 165 THR 165 202 502 THR THR B . n 
F 4 166 LYS 166 203 503 LYS LYS B . n 
F 4 167 GLU 167 204 504 GLU GLU B . n 
F 4 168 MET 168 205 505 MET MET B . n 
F 4 169 ASP 169 206 506 ASP ASP B . n 
F 4 170 LEU 170 207 507 LEU LEU B . n 
F 4 171 SER 171 208 508 SER SER B . n 
F 4 172 VAL 172 209 509 VAL VAL B . n 
F 4 173 VAL 173 210 510 VAL VAL B . n 
F 4 174 ARG 174 211 511 ARG ARG B . n 
F 4 175 LEU 175 212 512 LEU LEU B . n 
F 4 176 MET 176 213 513 MET MET B . n 
F 4 177 PHE 177 214 514 PHE PHE B . n 
F 4 178 THR 178 215 515 THR THR B . n 
F 4 179 ALA 179 216 516 ALA ALA B . n 
F 4 180 PHE 180 217 517 PHE PHE B . n 
F 4 181 LEU 181 218 518 LEU LEU B . n 
F 4 182 PRO 182 219 519 PRO PRO B . n 
F 4 183 ASP 183 220 520 ASP ASP B . n 
F 4 184 SER 184 221 521 SER SER B . n 
F 4 185 THR 185 222 522 THR THR B . n 
F 4 186 GLY 186 223 523 GLY GLY B . n 
F 4 187 SER 187 224 524 SER SER B . n 
F 4 188 PHE 188 225 525 PHE PHE B . n 
F 4 189 THR 189 226 526 THR THR B . n 
F 4 190 ARG 190 227 527 ARG ARG B . n 
F 4 191 ARG 191 228 528 ARG ARG B . n 
F 4 192 LEU 192 229 529 LEU LEU B . n 
F 4 193 GLU 193 230 530 GLU GLU B . n 
F 4 194 PRO 194 231 531 PRO PRO B . n 
F 4 195 VAL 195 232 532 VAL VAL B . n 
F 4 196 VAL 196 233 533 VAL VAL B . n 
F 4 197 SER 197 234 534 SER SER B . n 
F 4 198 ASP 198 235 535 ASP ASP B . n 
F 4 199 ALA 199 236 536 ALA ALA B . n 
F 4 200 ILE 200 237 537 ILE ILE B . n 
F 4 201 TYR 201 238 538 TYR TYR B . n 
F 4 202 ASP 202 239 539 ASP ASP B . n 
F 4 203 SER 203 240 540 SER SER B . n 
F 4 204 LYS 204 241 541 LYS LYS B . n 
F 4 205 ALA 205 242 542 ALA ALA B . n 
F 4 206 PRO 206 243 543 PRO PRO B . n 
F 4 207 ASN 207 244 544 ASN ASN B . n 
F 4 208 ALA 208 245 545 ALA ALA B . n 
F 4 209 SER 209 246 546 SER SER B . n 
F 4 210 ASN 210 247 547 ASN ASN B . n 
F 4 211 LEU 211 248 548 LEU LEU B . n 
F 4 212 LYS 212 249 549 LYS LYS B . n 
F 4 213 ILE 213 250 550 ILE ILE B . n 
F 4 214 VAL 214 251 551 VAL VAL B . n 
F 4 215 ARG 215 252 552 ARG ARG B . n 
F 4 216 MET 216 253 553 MET MET B . n 
F 4 217 ASP 217 254 554 ASP ASP B . n 
F 4 218 ARG 218 255 555 ARG ARG B . n 
F 4 219 THR 219 256 556 THR THR B . n 
F 4 220 ALA 220 257 557 ALA ALA B . n 
F 4 221 GLY 221 258 558 GLY GLY B . n 
F 4 222 CYS 222 259 559 CYS CYS B . n 
F 4 223 VAL 223 260 560 VAL VAL B . n 
F 4 224 THR 224 261 561 THR THR B . n 
F 4 225 GLY 225 262 562 GLY GLY B . n 
F 4 226 GLY 226 263 563 GLY GLY B . n 
F 4 227 GLU 227 264 564 GLU GLU B . n 
F 4 228 GLU 228 265 565 GLU GLU B . n 
F 4 229 ILE 229 266 566 ILE ILE B . n 
F 4 230 TYR 230 267 567 TYR TYR B . n 
F 4 231 LEU 231 268 568 LEU LEU B . n 
F 4 232 LEU 232 269 569 LEU LEU B . n 
F 4 233 CYS 233 270 570 CYS CYS B . n 
F 4 234 ASP 234 271 571 ASP ASP B . n 
F 4 235 LYS 235 272 572 LYS LYS B . n 
F 4 236 VAL 236 273 573 VAL VAL B . n 
F 4 237 GLN 237 274 574 GLN GLN B . n 
F 4 238 LYS 238 275 575 LYS LYS B . n 
F 4 239 ASP 239 276 576 ASP ASP B . n 
F 4 240 ASP 240 277 577 ASP ASP B . n 
F 4 241 ILE 241 278 578 ILE ILE B . n 
F 4 242 GLN 242 279 579 GLN GLN B . n 
F 4 243 ILE 243 280 580 ILE ILE B . n 
F 4 244 ARG 244 281 581 ARG ARG B . n 
F 4 245 PHE 245 282 582 PHE PHE B . n 
F 4 246 TYR 246 283 583 TYR TYR B . n 
F 4 247 GLU 247 284 584 GLU GLU B . n 
F 4 248 GLU 248 285 585 GLU GLU B . n 
F 4 249 GLU 249 286 586 GLU GLU B . n 
F 4 250 GLU 250 287 587 GLU GLU B . n 
F 4 251 ASN 251 288 588 ASN ASN B . n 
F 4 252 GLY 252 289 589 GLY GLY B . n 
F 4 253 GLY 253 290 590 GLY GLY B . n 
F 4 254 VAL 254 291 591 VAL VAL B . n 
F 4 255 TRP 255 292 592 TRP TRP B . n 
F 4 256 GLU 256 293 593 GLU GLU B . n 
F 4 257 GLY 257 294 594 GLY GLY B . n 
F 4 258 PHE 258 295 595 PHE PHE B . n 
F 4 259 GLY 259 296 596 GLY GLY B . n 
F 4 260 ASP 260 297 597 ASP ASP B . n 
F 4 261 PHE 261 298 598 PHE PHE B . n 
F 4 262 SER 262 299 599 SER SER B . n 
F 4 263 PRO 263 300 600 PRO PRO B . n 
F 4 264 THR 264 301 601 THR THR B . n 
F 4 265 ASP 265 302 602 ASP ASP B . n 
F 4 266 VAL 266 303 603 VAL VAL B . n 
F 4 267 HIS 267 304 604 HIS HIS B . n 
F 4 268 ARG 268 305 605 ARG ARG B . n 
F 4 269 GLN 269 306 606 GLN GLN B . n 
F 4 270 PHE 270 307 607 PHE PHE B . n 
F 4 271 ALA 271 308 608 ALA ALA B . n 
F 4 272 ILE 272 309 609 ILE ILE B . n 
F 4 273 VAL 273 310 610 VAL VAL B . n 
F 4 274 PHE 274 311 611 PHE PHE B . n 
F 4 275 LYS 275 312 612 LYS LYS B . n 
F 4 276 THR 276 313 613 THR THR B . n 
F 4 277 PRO 277 314 614 PRO PRO B . n 
F 4 278 LYS 278 315 615 LYS LYS B . n 
F 4 279 TYR 279 316 616 TYR TYR B . n 
F 4 280 LYS 280 317 617 LYS LYS B . n 
F 4 281 ASP 281 318 618 ASP ASP B . n 
F 4 282 VAL 282 319 619 VAL VAL B . n 
F 4 283 ASN 283 320 620 ASN ASN B . n 
F 4 284 ILE 284 321 621 ILE ILE B . n 
F 4 285 THR 285 322 622 THR THR B . n 
F 4 286 LYS 286 323 623 LYS LYS B . n 
F 4 287 PRO 287 324 624 PRO PRO B . n 
F 4 288 ALA 288 325 625 ALA ALA B . n 
F 4 289 SER 289 326 626 SER SER B . n 
F 4 290 VAL 290 327 627 VAL VAL B . n 
F 4 291 PHE 291 328 628 PHE PHE B . n 
F 4 292 VAL 292 329 629 VAL VAL B . n 
F 4 293 GLN 293 330 630 GLN GLN B . n 
F 4 294 LEU 294 331 631 LEU LEU B . n 
F 4 295 ARG 295 332 632 ARG ARG B . n 
F 4 296 ARG 296 333 633 ARG ARG B . n 
F 4 297 LYS 297 334 634 LYS LYS B . n 
F 4 298 SER 298 335 635 SER SER B . n 
F 4 299 ASP 299 336 636 ASP ASP B . n 
F 4 300 LEU 300 337 637 LEU LEU B . n 
F 4 301 GLU 301 338 638 GLU GLU B . n 
F 4 302 THR 302 339 639 THR THR B . n 
F 4 303 SER 303 340 640 SER SER B . n 
F 4 304 GLU 304 341 641 GLU GLU B . n 
F 4 305 PRO 305 342 642 PRO PRO B . n 
F 4 306 LYS 306 343 643 LYS LYS B . n 
F 4 307 PRO 307 344 644 PRO PRO B . n 
F 4 308 PHE 308 345 645 PHE PHE B . n 
F 4 309 LEU 309 346 646 LEU LEU B . n 
F 4 310 TYR 310 347 647 TYR TYR B . n 
F 4 311 TYR 311 348 648 TYR TYR B . n 
F 4 312 PRO 312 349 649 PRO PRO B . n 
F 4 313 GLU 313 350 650 GLU GLU B . n 
G 3 1   MET 1   18  ?   ?   ?   E . n 
G 3 2   ALA 2   19  19  ALA ALA E . n 
G 3 3   TYR 3   20  20  TYR TYR E . n 
G 3 4   VAL 4   21  21  VAL VAL E . n 
G 3 5   GLU 5   22  22  GLU GLU E . n 
G 3 6   ILE 6   23  23  ILE ILE E . n 
G 3 7   ILE 7   24  24  ILE ILE E . n 
G 3 8   GLU 8   25  25  GLU GLU E . n 
G 3 9   GLN 9   26  26  GLN GLN E . n 
G 3 10  PRO 10  27  27  PRO PRO E . n 
G 3 11  LYS 11  28  28  LYS LYS E . n 
G 3 12  GLN 12  29  29  GLN GLN E . n 
G 3 13  ARG 13  30  30  ARG ARG E . n 
G 3 14  GLY 14  31  31  GLY GLY E . n 
G 3 15  MET 15  32  32  MET MET E . n 
G 3 16  ARG 16  33  33  ARG ARG E . n 
G 3 17  PHE 17  34  34  PHE PHE E . n 
G 3 18  ARG 18  35  35  ARG ARG E . n 
G 3 19  TYR 19  36  36  TYR TYR E . n 
G 3 20  LYS 20  37  37  LYS LYS E . n 
G 3 21  CYS 21  38  38  CYS CYS E . n 
G 3 22  GLU 22  39  39  GLU GLU E . n 
G 3 23  GLY 23  40  40  GLY GLY E . n 
G 3 24  ARG 24  41  41  ARG ARG E . n 
G 3 25  SER 25  42  42  SER SER E . n 
G 3 26  ALA 26  43  43  ALA ALA E . n 
G 3 27  GLY 27  44  44  GLY GLY E . n 
G 3 28  SER 28  45  45  SER SER E . n 
G 3 29  ILE 29  46  46  ILE ILE E . n 
G 3 30  PRO 30  47  47  PRO PRO E . n 
G 3 31  GLY 31  48  48  GLY GLY E . n 
G 3 32  GLU 32  49  49  GLU GLU E . n 
G 3 33  ARG 33  50  50  ARG ARG E . n 
G 3 34  SER 34  51  51  SER SER E . n 
G 3 35  THR 35  52  52  THR THR E . n 
G 3 36  ASP 36  53  53  ASP ASP E . n 
G 3 37  THR 37  54  54  THR THR E . n 
G 3 38  THR 38  55  55  THR THR E . n 
G 3 39  LYS 39  56  56  LYS LYS E . n 
G 3 40  THR 40  57  57  THR THR E . n 
G 3 41  HIS 41  58  58  HIS HIS E . n 
G 3 42  PRO 42  59  59  PRO PRO E . n 
G 3 43  THR 43  60  60  THR THR E . n 
G 3 44  ILE 44  61  61  ILE ILE E . n 
G 3 45  LYS 45  62  62  LYS LYS E . n 
G 3 46  ILE 46  63  63  ILE ILE E . n 
G 3 47  ASN 47  64  64  ASN ASN E . n 
G 3 48  GLY 48  65  65  GLY GLY E . n 
G 3 49  TYR 49  66  66  TYR TYR E . n 
G 3 50  THR 50  67  67  THR THR E . n 
G 3 51  GLY 51  68  68  GLY GLY E . n 
G 3 52  PRO 52  69  69  PRO PRO E . n 
G 3 53  GLY 53  70  70  GLY GLY E . n 
G 3 54  THR 54  71  71  THR THR E . n 
G 3 55  VAL 55  72  72  VAL VAL E . n 
G 3 56  ARG 56  73  73  ARG ARG E . n 
G 3 57  ILE 57  74  74  ILE ILE E . n 
G 3 58  SER 58  75  75  SER SER E . n 
G 3 59  LEU 59  76  76  LEU LEU E . n 
G 3 60  VAL 60  77  77  VAL VAL E . n 
G 3 61  THR 61  78  78  THR THR E . n 
G 3 62  LYS 62  79  79  LYS LYS E . n 
G 3 63  ASP 63  80  80  ASP ASP E . n 
G 3 64  PRO 64  81  81  PRO PRO E . n 
G 3 65  PRO 65  82  82  PRO PRO E . n 
G 3 66  HIS 66  83  83  HIS HIS E . n 
G 3 67  ARG 67  84  84  ARG ARG E . n 
G 3 68  PRO 68  85  85  PRO PRO E . n 
G 3 69  HIS 69  86  86  HIS HIS E . n 
G 3 70  PRO 70  87  87  PRO PRO E . n 
G 3 71  HIS 71  88  88  HIS HIS E . n 
G 3 72  GLU 72  89  89  GLU GLU E . n 
G 3 73  LEU 73  90  90  LEU LEU E . n 
G 3 74  VAL 74  91  91  VAL VAL E . n 
G 3 75  GLY 75  92  92  GLY GLY E . n 
G 3 76  LYS 76  93  93  LYS LYS E . n 
G 3 77  ASP 77  94  94  ASP ASP E . n 
G 3 78  CYS 78  95  95  CYS CYS E . n 
G 3 79  ARG 79  96  96  ARG ARG E . n 
G 3 80  ASP 80  97  97  ASP ASP E . n 
G 3 81  GLY 81  98  98  GLY GLY E . n 
G 3 82  TYR 82  99  99  TYR TYR E . n 
G 3 83  TYR 83  100 100 TYR TYR E . n 
G 3 84  GLU 84  101 101 GLU GLU E . n 
G 3 85  ALA 85  102 102 ALA ALA E . n 
G 3 86  ASP 86  103 103 ASP ASP E . n 
G 3 87  LEU 87  104 104 LEU LEU E . n 
G 3 88  CYS 88  105 105 CYS CYS E . n 
G 3 89  PRO 89  106 106 PRO PRO E . n 
G 3 90  ASP 90  107 107 ASP ASP E . n 
G 3 91  ARG 91  108 108 ARG ARG E . n 
G 3 92  SER 92  109 109 SER SER E . n 
G 3 93  ILE 93  110 110 ILE ILE E . n 
G 3 94  HIS 94  111 111 HIS HIS E . n 
G 3 95  SER 95  112 112 SER SER E . n 
G 3 96  PHE 96  113 113 PHE PHE E . n 
G 3 97  GLN 97  114 114 GLN GLN E . n 
G 3 98  ASN 98  115 115 ASN ASN E . n 
G 3 99  LEU 99  116 116 LEU LEU E . n 
G 3 100 GLY 100 117 117 GLY GLY E . n 
G 3 101 ILE 101 118 118 ILE ILE E . n 
G 3 102 GLN 102 119 119 GLN GLN E . n 
G 3 103 CYS 103 120 120 CYS CYS E . n 
G 3 104 VAL 104 121 121 VAL VAL E . n 
G 3 105 LYS 105 122 122 LYS LYS E . n 
G 3 106 LYS 106 123 123 LYS LYS E . n 
G 3 107 ARG 107 124 124 ARG ARG E . n 
G 3 108 ASP 108 125 125 ASP ASP E . n 
G 3 109 LEU 109 126 126 LEU LEU E . n 
G 3 110 GLU 110 127 127 GLU GLU E . n 
G 3 111 GLN 111 128 128 GLN GLN E . n 
G 3 112 ALA 112 129 129 ALA ALA E . n 
G 3 113 ILE 113 130 130 ILE ILE E . n 
G 3 114 SER 114 131 131 SER SER E . n 
G 3 115 GLN 115 132 132 GLN GLN E . n 
G 3 116 ARG 116 133 133 ARG ARG E . n 
G 3 117 ILE 117 134 134 ILE ILE E . n 
G 3 118 GLN 118 135 135 GLN GLN E . n 
G 3 119 THR 119 136 136 THR THR E . n 
G 3 120 ASN 120 137 137 ASN ASN E . n 
G 3 121 ASN 121 138 138 ASN ASN E . n 
G 3 122 ASN 122 139 139 ASN ASN E . n 
G 3 123 PRO 123 140 140 PRO PRO E . n 
G 3 124 PHE 124 141 141 PHE PHE E . n 
G 3 125 HIS 125 142 142 HIS HIS E . n 
G 3 126 VAL 126 143 143 VAL VAL E . n 
G 3 127 PRO 127 144 144 PRO PRO E . n 
G 3 128 ILE 128 145 145 ILE ILE E . n 
G 3 129 GLU 129 146 146 GLU GLU E . n 
G 3 130 GLU 130 147 147 GLU GLU E . n 
G 3 131 GLN 131 148 148 GLN GLN E . n 
G 3 132 ARG 132 149 149 ARG ARG E . n 
G 3 133 GLY 133 150 150 GLY GLY E . n 
G 3 134 ASP 134 151 151 ASP ASP E . n 
G 3 135 TYR 135 152 152 TYR TYR E . n 
G 3 136 ASP 136 153 153 ASP ASP E . n 
G 3 137 LEU 137 154 154 LEU LEU E . n 
G 3 138 ASN 138 155 155 ASN ASN E . n 
G 3 139 ALA 139 156 156 ALA ALA E . n 
G 3 140 VAL 140 157 157 VAL VAL E . n 
G 3 141 ARG 141 158 158 ARG ARG E . n 
G 3 142 LEU 142 159 159 LEU LEU E . n 
G 3 143 CYS 143 160 160 CYS CYS E . n 
G 3 144 PHE 144 161 161 PHE PHE E . n 
G 3 145 GLN 145 162 162 GLN GLN E . n 
G 3 146 VAL 146 163 163 VAL VAL E . n 
G 3 147 THR 147 164 164 THR THR E . n 
G 3 148 VAL 148 165 165 VAL VAL E . n 
G 3 149 ARG 149 166 166 ARG ARG E . n 
G 3 150 ASP 150 167 167 ASP ASP E . n 
G 3 151 PRO 151 168 168 PRO PRO E . n 
G 3 152 ALA 152 169 169 ALA ALA E . n 
G 3 153 GLY 153 170 170 GLY GLY E . n 
G 3 154 ARG 154 171 171 ARG ARG E . n 
G 3 155 PRO 155 172 172 PRO PRO E . n 
G 3 156 LEU 156 173 173 LEU LEU E . n 
G 3 157 LEU 157 174 174 LEU LEU E . n 
G 3 158 LEU 158 175 175 LEU LEU E . n 
G 3 159 THR 159 176 176 THR THR E . n 
G 3 160 PRO 160 177 177 PRO PRO E . n 
G 3 161 VAL 161 178 178 VAL VAL E . n 
G 3 162 LEU 162 179 179 LEU LEU E . n 
G 3 163 SER 163 180 180 SER SER E . n 
G 3 164 HIS 164 181 181 HIS HIS E . n 
G 3 165 PRO 165 182 182 PRO PRO E . n 
G 3 166 ILE 166 183 183 ILE ILE E . n 
G 3 167 PHE 167 184 184 PHE PHE E . n 
G 3 168 ASP 168 185 185 ASP ASP E . n 
G 3 169 ASN 169 186 186 ASN ASN E . n 
G 3 170 ARG 170 187 187 ARG ARG E . n 
G 3 171 ALA 171 188 188 ALA ALA E . n 
G 3 172 PRO 172 189 189 PRO PRO E . n 
G 3 173 ASN 173 190 190 ASN ASN E . n 
G 3 174 THR 174 191 191 THR THR E . n 
G 3 175 ALA 175 192 192 ALA ALA E . n 
G 3 176 GLU 176 193 193 GLU GLU E . n 
G 3 177 LEU 177 194 194 LEU LEU E . n 
G 3 178 LYS 178 195 195 LYS LYS E . n 
G 3 179 ILE 179 196 196 ILE ILE E . n 
G 3 180 CYS 180 197 197 CYS CYS E . n 
G 3 181 ARG 181 198 198 ARG ARG E . n 
G 3 182 VAL 182 199 199 VAL VAL E . n 
G 3 183 ASN 183 200 200 ASN ASN E . n 
G 3 184 ARG 184 201 201 ARG ARG E . n 
G 3 185 ASN 185 202 202 ASN ASN E . n 
G 3 186 SER 186 203 203 SER SER E . n 
G 3 187 GLY 187 204 204 GLY GLY E . n 
G 3 188 SER 188 205 205 SER SER E . n 
G 3 189 CYS 189 206 206 CYS CYS E . n 
G 3 190 LEU 190 207 207 LEU LEU E . n 
G 3 191 GLY 191 208 208 GLY GLY E . n 
G 3 192 GLY 192 209 209 GLY GLY E . n 
G 3 193 ASP 193 210 210 ASP ASP E . n 
G 3 194 GLU 194 211 211 GLU GLU E . n 
G 3 195 ILE 195 212 212 ILE ILE E . n 
G 3 196 PHE 196 213 213 PHE PHE E . n 
G 3 197 LEU 197 214 214 LEU LEU E . n 
G 3 198 LEU 198 215 215 LEU LEU E . n 
G 3 199 CYS 199 216 216 CYS CYS E . n 
G 3 200 ASP 200 217 217 ASP ASP E . n 
G 3 201 LYS 201 218 218 LYS LYS E . n 
G 3 202 VAL 202 219 219 VAL VAL E . n 
G 3 203 GLN 203 220 220 GLN GLN E . n 
G 3 204 LYS 204 221 221 LYS LYS E . n 
G 3 205 GLU 205 222 222 GLU GLU E . n 
G 3 206 ASP 206 223 223 ASP ASP E . n 
G 3 207 ILE 207 224 224 ILE ILE E . n 
G 3 208 GLU 208 225 225 GLU GLU E . n 
G 3 209 VAL 209 226 226 VAL VAL E . n 
G 3 210 TYR 210 227 227 TYR TYR E . n 
G 3 211 PHE 211 228 228 PHE PHE E . n 
G 3 212 THR 212 229 229 THR THR E . n 
G 3 213 GLY 213 230 230 GLY GLY E . n 
G 3 214 PRO 214 231 231 PRO PRO E . n 
G 3 215 GLY 215 232 232 GLY GLY E . n 
G 3 216 TRP 216 233 233 TRP TRP E . n 
G 3 217 GLU 217 234 234 GLU GLU E . n 
G 3 218 ALA 218 235 235 ALA ALA E . n 
G 3 219 ARG 219 236 236 ARG ARG E . n 
G 3 220 GLY 220 237 237 GLY GLY E . n 
G 3 221 SER 221 238 238 SER SER E . n 
G 3 222 PHE 222 239 239 PHE PHE E . n 
G 3 223 SER 223 240 240 SER SER E . n 
G 3 224 GLN 224 241 241 GLN GLN E . n 
G 3 225 ALA 225 242 242 ALA ALA E . n 
G 3 226 ASP 226 243 243 ASP ASP E . n 
G 3 227 VAL 227 244 244 VAL VAL E . n 
G 3 228 HIS 228 245 245 HIS HIS E . n 
G 3 229 ARG 229 246 246 ARG ARG E . n 
G 3 230 GLN 230 247 247 GLN GLN E . n 
G 3 231 VAL 231 248 248 VAL VAL E . n 
G 3 232 ALA 232 249 249 ALA ALA E . n 
G 3 233 ILE 233 250 250 ILE ILE E . n 
G 3 234 VAL 234 251 251 VAL VAL E . n 
G 3 235 PHE 235 252 252 PHE PHE E . n 
G 3 236 ARG 236 253 253 ARG ARG E . n 
G 3 237 THR 237 254 254 THR THR E . n 
G 3 238 PRO 238 255 255 PRO PRO E . n 
G 3 239 PRO 239 256 256 PRO PRO E . n 
G 3 240 TYR 240 257 257 TYR TYR E . n 
G 3 241 ALA 241 258 258 ALA ALA E . n 
G 3 242 ASP 242 259 259 ASP ASP E . n 
G 3 243 PRO 243 260 260 PRO PRO E . n 
G 3 244 SER 244 261 261 SER SER E . n 
G 3 245 LEU 245 262 262 LEU LEU E . n 
G 3 246 GLN 246 263 263 GLN GLN E . n 
G 3 247 ALA 247 264 264 ALA ALA E . n 
G 3 248 PRO 248 265 265 PRO PRO E . n 
G 3 249 VAL 249 266 266 VAL VAL E . n 
G 3 250 ARG 250 267 267 ARG ARG E . n 
G 3 251 VAL 251 268 268 VAL VAL E . n 
G 3 252 SER 252 269 269 SER SER E . n 
G 3 253 MET 253 270 270 MET MET E . n 
G 3 254 GLN 254 271 271 GLN GLN E . n 
G 3 255 LEU 255 272 272 LEU LEU E . n 
G 3 256 ARG 256 273 273 ARG ARG E . n 
G 3 257 ARG 257 274 274 ARG ARG E . n 
G 3 258 PRO 258 275 275 PRO PRO E . n 
G 3 259 SER 259 276 276 SER SER E . n 
G 3 260 ASP 260 277 277 ASP ASP E . n 
G 3 261 ARG 261 278 278 ARG ARG E . n 
G 3 262 GLU 262 279 279 GLU GLU E . n 
G 3 263 LEU 263 280 280 LEU LEU E . n 
G 3 264 SER 264 281 281 SER SER E . n 
G 3 265 GLU 265 282 282 GLU GLU E . n 
G 3 266 PRO 266 283 283 PRO PRO E . n 
G 3 267 MET 267 284 284 MET MET E . n 
G 3 268 GLU 268 285 285 GLU GLU E . n 
G 3 269 PHE 269 286 286 PHE PHE E . n 
G 3 270 GLN 270 287 287 GLN GLN E . n 
G 3 271 TYR 271 288 288 TYR TYR E . n 
G 3 272 LEU 272 289 289 LEU LEU E . n 
G 3 273 PRO 273 290 290 PRO PRO E . n 
G 3 274 ASP 274 291 291 ASP ASP E . n 
H 4 1   MET 1   38  ?   ?   ?   F . n 
H 4 2   GLY 2   39  339 GLY GLY F . n 
H 4 3   PRO 3   40  340 PRO PRO F . n 
H 4 4   TYR 4   41  341 TYR TYR F . n 
H 4 5   LEU 5   42  342 LEU LEU F . n 
H 4 6   GLN 6   43  343 GLN GLN F . n 
H 4 7   ILE 7   44  344 ILE ILE F . n 
H 4 8   LEU 8   45  345 LEU LEU F . n 
H 4 9   GLU 9   46  346 GLU GLU F . n 
H 4 10  GLN 10  47  347 GLN GLN F . n 
H 4 11  PRO 11  48  348 PRO PRO F . n 
H 4 12  LYS 12  49  349 LYS LYS F . n 
H 4 13  GLN 13  50  350 GLN GLN F . n 
H 4 14  ARG 14  51  351 ARG ARG F . n 
H 4 15  GLY 15  52  352 GLY GLY F . n 
H 4 16  PHE 16  53  353 PHE PHE F . n 
H 4 17  ARG 17  54  354 ARG ARG F . n 
H 4 18  PHE 18  55  355 PHE PHE F . n 
H 4 19  ARG 19  56  356 ARG ARG F . n 
H 4 20  TYR 20  57  357 TYR TYR F . n 
H 4 21  VAL 21  58  358 VAL VAL F . n 
H 4 22  CYS 22  59  359 CYS CYS F . n 
H 4 23  GLU 23  60  360 GLU GLU F . n 
H 4 24  GLY 24  61  361 GLY GLY F . n 
H 4 25  PRO 25  62  362 PRO PRO F . n 
H 4 26  SER 26  63  363 SER SER F . n 
H 4 27  HIS 27  64  364 HIS HIS F . n 
H 4 28  GLY 28  65  365 GLY GLY F . n 
H 4 29  GLY 29  66  366 GLY GLY F . n 
H 4 30  LEU 30  67  367 LEU LEU F . n 
H 4 31  PRO 31  68  368 PRO PRO F . n 
H 4 32  GLY 32  69  369 GLY GLY F . n 
H 4 33  ALA 33  70  370 ALA ALA F . n 
H 4 34  SER 34  71  371 SER SER F . n 
H 4 35  SER 35  72  372 SER SER F . n 
H 4 36  GLU 36  73  373 GLU GLU F . n 
H 4 37  LYS 37  74  374 LYS LYS F . n 
H 4 38  ASN 38  75  375 ASN ASN F . n 
H 4 39  LYS 39  76  376 LYS LYS F . n 
H 4 40  LYS 40  77  377 LYS LYS F . n 
H 4 41  SER 41  78  378 SER SER F . n 
H 4 42  TYR 42  79  379 TYR TYR F . n 
H 4 43  PRO 43  80  380 PRO PRO F . n 
H 4 44  GLN 44  81  381 GLN GLN F . n 
H 4 45  VAL 45  82  382 VAL VAL F . n 
H 4 46  LYS 46  83  383 LYS LYS F . n 
H 4 47  ILE 47  84  384 ILE ILE F . n 
H 4 48  CYS 48  85  385 CYS CYS F . n 
H 4 49  ASN 49  86  386 ASN ASN F . n 
H 4 50  TYR 50  87  387 TYR TYR F . n 
H 4 51  VAL 51  88  388 VAL VAL F . n 
H 4 52  GLY 52  89  389 GLY GLY F . n 
H 4 53  PRO 53  90  390 PRO PRO F . n 
H 4 54  ALA 54  91  391 ALA ALA F . n 
H 4 55  LYS 55  92  392 LYS LYS F . n 
H 4 56  VAL 56  93  393 VAL VAL F . n 
H 4 57  ILE 57  94  394 ILE ILE F . n 
H 4 58  VAL 58  95  395 VAL VAL F . n 
H 4 59  GLN 59  96  396 GLN GLN F . n 
H 4 60  LEU 60  97  397 LEU LEU F . n 
H 4 61  VAL 61  98  398 VAL VAL F . n 
H 4 62  THR 62  99  399 THR THR F . n 
H 4 63  ASN 63  100 400 ASN ASN F . n 
H 4 64  GLY 64  101 401 GLY GLY F . n 
H 4 65  LYS 65  102 402 LYS LYS F . n 
H 4 66  ASN 66  103 403 ASN ASN F . n 
H 4 67  ILE 67  104 404 ILE ILE F . n 
H 4 68  HIS 68  105 405 HIS HIS F . n 
H 4 69  LEU 69  106 406 LEU LEU F . n 
H 4 70  HIS 70  107 407 HIS HIS F . n 
H 4 71  ALA 71  108 408 ALA ALA F . n 
H 4 72  HIS 72  109 409 HIS HIS F . n 
H 4 73  SER 73  110 410 SER SER F . n 
H 4 74  LEU 74  111 411 LEU LEU F . n 
H 4 75  VAL 75  112 412 VAL VAL F . n 
H 4 76  GLY 76  113 413 GLY GLY F . n 
H 4 77  LYS 77  114 414 LYS LYS F . n 
H 4 78  HIS 78  115 415 HIS HIS F . n 
H 4 79  CYS 79  116 416 CYS CYS F . n 
H 4 80  GLU 80  117 417 GLU GLU F . n 
H 4 81  ASP 81  118 418 ASP ASP F . n 
H 4 82  GLY 82  119 419 GLY GLY F . n 
H 4 83  VAL 83  120 420 VAL VAL F . n 
H 4 84  CYS 84  121 421 CYS CYS F . n 
H 4 85  THR 85  122 422 THR THR F . n 
H 4 86  VAL 86  123 423 VAL VAL F . n 
H 4 87  THR 87  124 424 THR THR F . n 
H 4 88  ALA 88  125 425 ALA ALA F . n 
H 4 89  GLY 89  126 426 GLY GLY F . n 
H 4 90  PRO 90  127 427 PRO PRO F . n 
H 4 91  LYS 91  128 428 LYS LYS F . n 
H 4 92  ASP 92  129 429 ASP ASP F . n 
H 4 93  MET 93  130 430 MET MET F . n 
H 4 94  VAL 94  131 431 VAL VAL F . n 
H 4 95  VAL 95  132 432 VAL VAL F . n 
H 4 96  GLY 96  133 433 GLY GLY F . n 
H 4 97  PHE 97  134 434 PHE PHE F . n 
H 4 98  ALA 98  135 435 ALA ALA F . n 
H 4 99  ASN 99  136 436 ASN ASN F . n 
H 4 100 LEU 100 137 437 LEU LEU F . n 
H 4 101 GLY 101 138 438 GLY GLY F . n 
H 4 102 ILE 102 139 439 ILE ILE F . n 
H 4 103 LEU 103 140 440 LEU LEU F . n 
H 4 104 HIS 104 141 441 HIS HIS F . n 
H 4 105 VAL 105 142 442 VAL VAL F . n 
H 4 106 THR 106 143 443 THR THR F . n 
H 4 107 LYS 107 144 444 LYS LYS F . n 
H 4 108 LYS 108 145 445 LYS LYS F . n 
H 4 109 LYS 109 146 446 LYS LYS F . n 
H 4 110 VAL 110 147 447 VAL VAL F . n 
H 4 111 PHE 111 148 448 PHE PHE F . n 
H 4 112 GLU 112 149 449 GLU GLU F . n 
H 4 113 THR 113 150 450 THR THR F . n 
H 4 114 LEU 114 151 451 LEU LEU F . n 
H 4 115 GLU 115 152 452 GLU GLU F . n 
H 4 116 ALA 116 153 453 ALA ALA F . n 
H 4 117 ARG 117 154 454 ARG ARG F . n 
H 4 118 MET 118 155 455 MET MET F . n 
H 4 119 THR 119 156 456 THR THR F . n 
H 4 120 GLU 120 157 457 GLU GLU F . n 
H 4 121 ALA 121 158 458 ALA ALA F . n 
H 4 122 CYS 122 159 459 CYS CYS F . n 
H 4 123 ILE 123 160 460 ILE ILE F . n 
H 4 124 ARG 124 161 461 ARG ARG F . n 
H 4 125 GLY 125 162 462 GLY GLY F . n 
H 4 126 TYR 126 163 463 TYR TYR F . n 
H 4 127 ASN 127 164 464 ASN ASN F . n 
H 4 128 PRO 128 165 465 PRO PRO F . n 
H 4 129 GLY 129 166 466 GLY GLY F . n 
H 4 130 LEU 130 167 467 LEU LEU F . n 
H 4 131 LEU 131 168 468 LEU LEU F . n 
H 4 132 VAL 132 169 469 VAL VAL F . n 
H 4 133 HIS 133 170 470 HIS HIS F . n 
H 4 134 SER 134 171 471 SER SER F . n 
H 4 135 ASP 135 172 472 ASP ASP F . n 
H 4 136 LEU 136 173 473 LEU LEU F . n 
H 4 137 ALA 137 174 474 ALA ALA F . n 
H 4 138 TYR 138 175 475 TYR TYR F . n 
H 4 139 LEU 139 176 476 LEU LEU F . n 
H 4 140 GLN 140 177 477 GLN GLN F . n 
H 4 141 ALA 141 178 478 ALA ALA F . n 
H 4 142 GLU 142 179 479 GLU GLU F . n 
H 4 143 GLY 143 180 480 GLY GLY F . n 
H 4 144 GLY 144 181 481 GLY GLY F . n 
H 4 145 GLY 145 182 482 GLY GLY F . n 
H 4 146 ASP 146 183 483 ASP ASP F . n 
H 4 147 ARG 147 184 484 ARG ARG F . n 
H 4 148 GLN 148 185 485 GLN GLN F . n 
H 4 149 LEU 149 186 486 LEU LEU F . n 
H 4 150 THR 150 187 487 THR THR F . n 
H 4 151 ASP 151 188 488 ASP ASP F . n 
H 4 152 ARG 152 189 489 ARG ARG F . n 
H 4 153 GLU 153 190 490 GLU GLU F . n 
H 4 154 LYS 154 191 491 LYS LYS F . n 
H 4 155 GLU 155 192 492 GLU GLU F . n 
H 4 156 ILE 156 193 493 ILE ILE F . n 
H 4 157 ILE 157 194 494 ILE ILE F . n 
H 4 158 ARG 158 195 495 ARG ARG F . n 
H 4 159 GLN 159 196 496 GLN GLN F . n 
H 4 160 ALA 160 197 497 ALA ALA F . n 
H 4 161 ALA 161 198 498 ALA ALA F . n 
H 4 162 VAL 162 199 499 VAL VAL F . n 
H 4 163 GLN 163 200 500 GLN GLN F . n 
H 4 164 GLN 164 201 501 GLN GLN F . n 
H 4 165 THR 165 202 502 THR THR F . n 
H 4 166 LYS 166 203 503 LYS LYS F . n 
H 4 167 GLU 167 204 504 GLU GLU F . n 
H 4 168 MET 168 205 505 MET MET F . n 
H 4 169 ASP 169 206 506 ASP ASP F . n 
H 4 170 LEU 170 207 507 LEU LEU F . n 
H 4 171 SER 171 208 508 SER SER F . n 
H 4 172 VAL 172 209 509 VAL VAL F . n 
H 4 173 VAL 173 210 510 VAL VAL F . n 
H 4 174 ARG 174 211 511 ARG ARG F . n 
H 4 175 LEU 175 212 512 LEU LEU F . n 
H 4 176 MET 176 213 513 MET MET F . n 
H 4 177 PHE 177 214 514 PHE PHE F . n 
H 4 178 THR 178 215 515 THR THR F . n 
H 4 179 ALA 179 216 516 ALA ALA F . n 
H 4 180 PHE 180 217 517 PHE PHE F . n 
H 4 181 LEU 181 218 518 LEU LEU F . n 
H 4 182 PRO 182 219 519 PRO PRO F . n 
H 4 183 ASP 183 220 520 ASP ASP F . n 
H 4 184 SER 184 221 521 SER SER F . n 
H 4 185 THR 185 222 522 THR THR F . n 
H 4 186 GLY 186 223 523 GLY GLY F . n 
H 4 187 SER 187 224 524 SER SER F . n 
H 4 188 PHE 188 225 525 PHE PHE F . n 
H 4 189 THR 189 226 526 THR THR F . n 
H 4 190 ARG 190 227 527 ARG ARG F . n 
H 4 191 ARG 191 228 528 ARG ARG F . n 
H 4 192 LEU 192 229 529 LEU LEU F . n 
H 4 193 GLU 193 230 530 GLU GLU F . n 
H 4 194 PRO 194 231 531 PRO PRO F . n 
H 4 195 VAL 195 232 532 VAL VAL F . n 
H 4 196 VAL 196 233 533 VAL VAL F . n 
H 4 197 SER 197 234 534 SER SER F . n 
H 4 198 ASP 198 235 535 ASP ASP F . n 
H 4 199 ALA 199 236 536 ALA ALA F . n 
H 4 200 ILE 200 237 537 ILE ILE F . n 
H 4 201 TYR 201 238 538 TYR TYR F . n 
H 4 202 ASP 202 239 539 ASP ASP F . n 
H 4 203 SER 203 240 540 SER SER F . n 
H 4 204 LYS 204 241 541 LYS LYS F . n 
H 4 205 ALA 205 242 542 ALA ALA F . n 
H 4 206 PRO 206 243 543 PRO PRO F . n 
H 4 207 ASN 207 244 544 ASN ASN F . n 
H 4 208 ALA 208 245 545 ALA ALA F . n 
H 4 209 SER 209 246 546 SER SER F . n 
H 4 210 ASN 210 247 547 ASN ASN F . n 
H 4 211 LEU 211 248 548 LEU LEU F . n 
H 4 212 LYS 212 249 549 LYS LYS F . n 
H 4 213 ILE 213 250 550 ILE ILE F . n 
H 4 214 VAL 214 251 551 VAL VAL F . n 
H 4 215 ARG 215 252 552 ARG ARG F . n 
H 4 216 MET 216 253 553 MET MET F . n 
H 4 217 ASP 217 254 554 ASP ASP F . n 
H 4 218 ARG 218 255 555 ARG ARG F . n 
H 4 219 THR 219 256 556 THR THR F . n 
H 4 220 ALA 220 257 557 ALA ALA F . n 
H 4 221 GLY 221 258 558 GLY GLY F . n 
H 4 222 CYS 222 259 559 CYS CYS F . n 
H 4 223 VAL 223 260 560 VAL VAL F . n 
H 4 224 THR 224 261 561 THR THR F . n 
H 4 225 GLY 225 262 562 GLY GLY F . n 
H 4 226 GLY 226 263 563 GLY GLY F . n 
H 4 227 GLU 227 264 564 GLU GLU F . n 
H 4 228 GLU 228 265 565 GLU GLU F . n 
H 4 229 ILE 229 266 566 ILE ILE F . n 
H 4 230 TYR 230 267 567 TYR TYR F . n 
H 4 231 LEU 231 268 568 LEU LEU F . n 
H 4 232 LEU 232 269 569 LEU LEU F . n 
H 4 233 CYS 233 270 570 CYS CYS F . n 
H 4 234 ASP 234 271 571 ASP ASP F . n 
H 4 235 LYS 235 272 572 LYS LYS F . n 
H 4 236 VAL 236 273 573 VAL VAL F . n 
H 4 237 GLN 237 274 574 GLN GLN F . n 
H 4 238 LYS 238 275 575 LYS LYS F . n 
H 4 239 ASP 239 276 576 ASP ASP F . n 
H 4 240 ASP 240 277 577 ASP ASP F . n 
H 4 241 ILE 241 278 578 ILE ILE F . n 
H 4 242 GLN 242 279 579 GLN GLN F . n 
H 4 243 ILE 243 280 580 ILE ILE F . n 
H 4 244 ARG 244 281 581 ARG ARG F . n 
H 4 245 PHE 245 282 582 PHE PHE F . n 
H 4 246 TYR 246 283 583 TYR TYR F . n 
H 4 247 GLU 247 284 584 GLU GLU F . n 
H 4 248 GLU 248 285 585 GLU GLU F . n 
H 4 249 GLU 249 286 586 GLU GLU F . n 
H 4 250 GLU 250 287 587 GLU GLU F . n 
H 4 251 ASN 251 288 588 ASN ASN F . n 
H 4 252 GLY 252 289 589 GLY GLY F . n 
H 4 253 GLY 253 290 590 GLY GLY F . n 
H 4 254 VAL 254 291 591 VAL VAL F . n 
H 4 255 TRP 255 292 592 TRP TRP F . n 
H 4 256 GLU 256 293 593 GLU GLU F . n 
H 4 257 GLY 257 294 594 GLY GLY F . n 
H 4 258 PHE 258 295 595 PHE PHE F . n 
H 4 259 GLY 259 296 596 GLY GLY F . n 
H 4 260 ASP 260 297 597 ASP ASP F . n 
H 4 261 PHE 261 298 598 PHE PHE F . n 
H 4 262 SER 262 299 599 SER SER F . n 
H 4 263 PRO 263 300 600 PRO PRO F . n 
H 4 264 THR 264 301 601 THR THR F . n 
H 4 265 ASP 265 302 602 ASP ASP F . n 
H 4 266 VAL 266 303 603 VAL VAL F . n 
H 4 267 HIS 267 304 604 HIS HIS F . n 
H 4 268 ARG 268 305 605 ARG ARG F . n 
H 4 269 GLN 269 306 606 GLN GLN F . n 
H 4 270 PHE 270 307 607 PHE PHE F . n 
H 4 271 ALA 271 308 608 ALA ALA F . n 
H 4 272 ILE 272 309 609 ILE ILE F . n 
H 4 273 VAL 273 310 610 VAL VAL F . n 
H 4 274 PHE 274 311 611 PHE PHE F . n 
H 4 275 LYS 275 312 612 LYS LYS F . n 
H 4 276 THR 276 313 613 THR THR F . n 
H 4 277 PRO 277 314 614 PRO PRO F . n 
H 4 278 LYS 278 315 615 LYS LYS F . n 
H 4 279 TYR 279 316 616 TYR TYR F . n 
H 4 280 LYS 280 317 617 LYS LYS F . n 
H 4 281 ASP 281 318 618 ASP ASP F . n 
H 4 282 VAL 282 319 619 VAL VAL F . n 
H 4 283 ASN 283 320 620 ASN ASN F . n 
H 4 284 ILE 284 321 621 ILE ILE F . n 
H 4 285 THR 285 322 622 THR THR F . n 
H 4 286 LYS 286 323 623 LYS LYS F . n 
H 4 287 PRO 287 324 624 PRO PRO F . n 
H 4 288 ALA 288 325 625 ALA ALA F . n 
H 4 289 SER 289 326 626 SER SER F . n 
H 4 290 VAL 290 327 627 VAL VAL F . n 
H 4 291 PHE 291 328 628 PHE PHE F . n 
H 4 292 VAL 292 329 629 VAL VAL F . n 
H 4 293 GLN 293 330 630 GLN GLN F . n 
H 4 294 LEU 294 331 631 LEU LEU F . n 
H 4 295 ARG 295 332 632 ARG ARG F . n 
H 4 296 ARG 296 333 633 ARG ARG F . n 
H 4 297 LYS 297 334 634 LYS LYS F . n 
H 4 298 SER 298 335 635 SER SER F . n 
H 4 299 ASP 299 336 636 ASP ASP F . n 
H 4 300 LEU 300 337 637 LEU LEU F . n 
H 4 301 GLU 301 338 638 GLU GLU F . n 
H 4 302 THR 302 339 639 THR THR F . n 
H 4 303 SER 303 340 640 SER SER F . n 
H 4 304 GLU 304 341 641 GLU GLU F . n 
H 4 305 PRO 305 342 642 PRO PRO F . n 
H 4 306 LYS 306 343 643 LYS LYS F . n 
H 4 307 PRO 307 344 644 PRO PRO F . n 
H 4 308 PHE 308 345 645 PHE PHE F . n 
H 4 309 LEU 309 346 646 LEU LEU F . n 
H 4 310 TYR 310 347 647 TYR TYR F . n 
H 4 311 TYR 311 348 648 TYR TYR F . n 
H 4 312 PRO 312 349 649 PRO PRO F . n 
H 4 313 GLU 313 350 650 GLU GLU F . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-15 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_exptl_crystal_grow.temp' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       0.9 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ARG 96 ? ? N   A GLY 98  ? ? 2.15 
2 1 O A LYS 79 ? ? NH1 A ARG 158 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ASP 80  ? ? N  A PRO 81  ? ? CA A PRO 81  ? ? 128.86 119.30 9.56  1.50 Y 
2 1 CA A LEU 272 ? ? CB A LEU 272 ? ? CG A LEU 272 ? ? 130.03 115.30 14.73 2.30 N 
3 1 C  E ASP 80  ? ? N  E PRO 81  ? ? CA E PRO 81  ? ? 131.13 119.30 11.83 1.50 Y 
4 1 C  E ASN 139 ? ? N  E PRO 140 ? ? CA E PRO 140 ? ? 129.90 119.30 10.60 1.50 Y 
5 1 CA F CYS 116 ? ? CB F CYS 116 ? ? SG F CYS 116 ? ? 120.95 114.20 6.75  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 TYR A 20  ? ? 83.07   148.96  
2   1 PRO A 27  ? ? -45.99  165.63  
3   1 GLN A 29  ? ? -91.94  -115.67 
4   1 LYS A 37  ? ? -72.22  -72.26  
5   1 SER A 42  ? ? 51.34   10.17   
6   1 SER A 45  ? ? 162.45  -152.78 
7   1 GLU A 49  ? ? -46.22  -77.93  
8   1 SER A 51  ? ? -43.45  164.78  
9   1 LYS A 56  ? ? -80.50  -88.96  
10  1 THR A 57  ? ? 82.55   96.89   
11  1 PRO A 81  ? ? 0.97    -77.88  
12  1 HIS A 83  ? ? -65.44  83.68   
13  1 HIS A 88  ? ? -38.60  136.48  
14  1 GLU A 89  ? ? -73.20  -155.14 
15  1 LEU A 90  ? ? -168.43 37.68   
16  1 VAL A 91  ? ? -45.79  152.64  
17  1 ASP A 94  ? ? 63.85   -21.05  
18  1 ASP A 97  ? ? 37.43   -7.84   
19  1 CYS A 105 ? ? -30.96  109.91  
20  1 PRO A 106 ? ? -83.45  31.43   
21  1 SER A 109 ? ? -96.17  -88.73  
22  1 ILE A 110 ? ? -50.51  104.41  
23  1 ASN A 115 ? ? 174.08  21.83   
24  1 ARG A 124 ? ? -32.68  -75.91  
25  1 GLN A 135 ? ? -51.76  -8.21   
26  1 ASN A 137 ? ? 49.02   99.39   
27  1 ASN A 139 ? ? 176.55  63.37   
28  1 PRO A 140 ? ? -40.48  -11.37  
29  1 HIS A 142 ? ? 32.95   38.56   
30  1 GLN A 148 ? ? -81.73  31.02   
31  1 ALA A 169 ? ? -106.06 -101.75 
32  1 HIS A 181 ? ? -33.08  158.09  
33  1 PRO A 189 ? ? -55.22  1.50    
34  1 ARG A 198 ? ? 172.82  147.37  
35  1 ASN A 200 ? ? -75.33  -70.88  
36  1 LYS A 218 ? ? -37.50  127.44  
37  1 THR A 229 ? ? -84.23  -129.52 
38  1 PRO A 231 ? ? -31.90  114.86  
39  1 PHE A 239 ? ? -173.76 149.97  
40  1 ALA A 242 ? ? -44.53  -14.16  
41  1 ARG A 246 ? ? 25.47   52.44   
42  1 GLN A 247 ? ? 30.60   35.24   
43  1 VAL A 248 ? ? -142.29 20.51   
44  1 SER A 261 ? ? -149.79 59.70   
45  1 GLN A 263 ? ? -144.88 14.35   
46  1 VAL A 266 ? ? -118.92 73.50   
47  1 ARG A 267 ? ? -55.23  105.22  
48  1 SER A 276 ? ? -41.19  -80.93  
49  1 PRO B 40  ? ? -54.00  -154.42 
50  1 ILE B 44  ? ? -66.76  7.15    
51  1 LEU B 45  ? ? 19.09   -81.19  
52  1 GLN B 47  ? ? -64.91  -178.84 
53  1 GLN B 50  ? ? 70.74   -19.47  
54  1 PRO B 62  ? ? -37.96  173.60  
55  1 HIS B 64  ? ? -144.65 25.56   
56  1 LEU B 67  ? ? -49.35  107.67  
57  1 LYS B 74  ? ? 47.01   -83.48  
58  1 ASN B 75  ? ? -69.05  44.18   
59  1 LYS B 76  ? ? 153.43  112.85  
60  1 SER B 78  ? ? -128.01 -169.76 
61  1 PRO B 80  ? ? -45.91  108.83  
62  1 CYS B 85  ? ? -117.38 -71.14  
63  1 TYR B 87  ? ? -24.57  140.59  
64  1 ILE B 104 ? ? -36.94  119.72  
65  1 HIS B 109 ? ? -44.51  150.02  
66  1 LYS B 114 ? ? -93.40  -88.42  
67  1 GLU B 117 ? ? -176.15 114.84  
68  1 CYS B 121 ? ? -35.20  118.12  
69  1 ALA B 125 ? ? -49.94  109.73  
70  1 LYS B 128 ? ? 67.58   -46.98  
71  1 ALA B 135 ? ? -54.91  -147.08 
72  1 ASN B 136 ? ? -62.11  96.28   
73  1 LEU B 137 ? ? -79.42  -75.75  
74  1 ALA B 158 ? ? 73.41   -55.12  
75  1 ILE B 160 ? ? -98.30  -63.41  
76  1 ASN B 164 ? ? 60.83   114.04  
77  1 PRO B 165 ? ? -69.83  91.29   
78  1 LEU B 173 ? ? -101.40 -87.62  
79  1 ALA B 174 ? ? 65.77   -18.84  
80  1 TYR B 175 ? ? -108.01 55.71   
81  1 GLN B 177 ? ? -99.51  -64.76  
82  1 ALA B 178 ? ? -158.46 -33.94  
83  1 GLU B 179 ? ? 66.51   -50.83  
84  1 GLN B 185 ? ? -68.20  4.56    
85  1 LEU B 186 ? ? 37.67   19.32   
86  1 THR B 187 ? ? 62.13   157.69  
87  1 ARG B 189 ? ? -74.69  -72.04  
88  1 GLU B 190 ? ? -39.41  -25.66  
89  1 ASP B 220 ? ? -130.55 -159.24 
90  1 GLU B 230 ? ? -27.52  117.61  
91  1 ASP B 235 ? ? -64.82  -82.05  
92  1 ALA B 236 ? ? 169.48  119.70  
93  1 PRO B 243 ? ? -54.82  -5.84   
94  1 LYS B 272 ? ? -31.94  117.04  
95  1 LYS B 275 ? ? -24.83  -54.15  
96  1 ASP B 277 ? ? -151.93 26.45   
97  1 ASN B 288 ? ? -69.67  61.98   
98  1 VAL B 291 ? ? -100.49 -130.68 
99  1 TRP B 292 ? ? 40.86   114.79  
100 1 ARG B 305 ? ? 22.69   56.84   
101 1 GLN B 306 ? ? 54.12   14.23   
102 1 SER B 335 ? ? -59.63  -105.28 
103 1 TYR E 20  ? ? -178.03 108.88  
104 1 VAL E 21  ? ? -103.96 -165.90 
105 1 GLU E 22  ? ? 150.45  82.73   
106 1 GLN E 29  ? ? -46.99  -82.89  
107 1 MET E 32  ? ? -162.41 118.75  
108 1 PHE E 34  ? ? -69.45  -130.21 
109 1 LYS E 37  ? ? -56.78  -70.57  
110 1 CYS E 38  ? ? -45.86  -8.87   
111 1 ARG E 41  ? ? -77.82  -169.81 
112 1 SER E 42  ? ? 59.76   -45.55  
113 1 SER E 45  ? ? 167.40  113.41  
114 1 PRO E 47  ? ? -64.61  -179.22 
115 1 ARG E 50  ? ? -97.01  38.27   
116 1 THR E 52  ? ? -134.39 -125.86 
117 1 ASP E 53  ? ? -141.68 30.19   
118 1 THR E 54  ? ? -140.32 -26.69  
119 1 THR E 55  ? ? -161.53 89.28   
120 1 THR E 57  ? ? 88.57   109.63  
121 1 THR E 71  ? ? -170.07 133.13  
122 1 VAL E 77  ? ? -115.25 -153.14 
123 1 PRO E 81  ? ? -12.74  -52.61  
124 1 HIS E 83  ? ? -43.26