data_1LEI
# 
_entry.id   1LEI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LEI         
NDB   PD0310       
RCSB  RCSB015877   
WWPDB D_1000015877 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1VKX 
_pdbx_database_related.details        '1VKX contains the same protein complexed with a kB DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LEI 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen-Park, F.' 1 
'Huang, D.B.'   2 
'Ghosh, G.'     3 
# 
_citation.id                        primary 
_citation.title                     
'The kB DNA sequence from the HIV Long Terminal Repeat functions as an allosteric regulator of HIV transcription' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                24701 
_citation.page_last                 24708 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11970949 
_citation.pdbx_database_id_DOI      10.1074/jbc.M200007200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen-Park, F.E.' 1 
primary 'Huang, D.B.'     2 
primary 'Noro, B.'        3 
primary 'Thanos, D.'      4 
primary 'Ghosh, G.'       5 
# 
_cell.entry_id           1LEI 
_cell.length_a           137.131 
_cell.length_b           179.697 
_cell.length_c           97.068 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LEI 
_symmetry.space_group_name_H-M             'C 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                21 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*CP*TP*CP*AP*GP*GP*GP*AP*AP*AP*GP*TP*AP*CP*AP*GP*A)-3'"         5269.450  1  ? ? ?         'kB DNA' 
2 polymer syn "5'-D(*TP*CP*TP*GP*5ITP*AP*CP*5ITP*5ITP*5ITP*CP*CP*CP*TP*GP*AP*G)-3'" 5591.812  1  ? ? ?         'kB DNA' 
3 polymer man 'NUCLEAR FACTOR NF-KAPPA-B P65 SUBUNIT'                               31115.236 1  ? ? 'p65 RHR' ?        
4 polymer man 'NUCLEAR FACTOR NF-KAPPA-B P50 SUBUNIT'                               35056.066 1  ? ? 'p50 RHR' ?        
5 water   nat water                                                                 18.015    23 ? ? ?         ?        
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'NF-kB p65' 
4 'NF-kB p50' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DC)(DT)(DC)(DA)(DG)(DG)(DG)(DA)(DA)(DA)(DG)(DT)(DA)(DC)(DA)(DG)(DA)' CTCAGGGAAAGTACAGA C ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DT)(DG)(5IU)(DA)(DC)(5IU)(5IU)(5IU)(DC)(DC)(DC)(DT)(DG)(DA)(DG)' TCTGUACUUUCCCTGAG D ? 
3 'polypeptide(L)'        no no  
;MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRD
GYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTP
VLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPY
ADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
;
;MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRD
GYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTP
VLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPY
ADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
;
A ? 
4 'polypeptide(L)'        no no  
;MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQA
AVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD
IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
;
;MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQA
AVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD
IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DG  n 
1 6   DG  n 
1 7   DG  n 
1 8   DA  n 
1 9   DA  n 
1 10  DA  n 
1 11  DG  n 
1 12  DT  n 
1 13  DA  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DA  n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   DG  n 
2 5   5IU n 
2 6   DA  n 
2 7   DC  n 
2 8   5IU n 
2 9   5IU n 
2 10  5IU n 
2 11  DC  n 
2 12  DC  n 
2 13  DC  n 
2 14  DT  n 
2 15  DG  n 
2 16  DA  n 
2 17  DG  n 
3 1   MET n 
3 2   ALA n 
3 3   TYR n 
3 4   VAL n 
3 5   GLU n 
3 6   ILE n 
3 7   ILE n 
3 8   GLU n 
3 9   GLN n 
3 10  PRO n 
3 11  LYS n 
3 12  GLN n 
3 13  ARG n 
3 14  GLY n 
3 15  MET n 
3 16  ARG n 
3 17  PHE n 
3 18  ARG n 
3 19  TYR n 
3 20  LYS n 
3 21  CYS n 
3 22  GLU n 
3 23  GLY n 
3 24  ARG n 
3 25  SER n 
3 26  ALA n 
3 27  GLY n 
3 28  SER n 
3 29  ILE n 
3 30  PRO n 
3 31  GLY n 
3 32  GLU n 
3 33  ARG n 
3 34  SER n 
3 35  THR n 
3 36  ASP n 
3 37  THR n 
3 38  THR n 
3 39  LYS n 
3 40  THR n 
3 41  HIS n 
3 42  PRO n 
3 43  THR n 
3 44  ILE n 
3 45  LYS n 
3 46  ILE n 
3 47  ASN n 
3 48  GLY n 
3 49  TYR n 
3 50  THR n 
3 51  GLY n 
3 52  PRO n 
3 53  GLY n 
3 54  THR n 
3 55  VAL n 
3 56  ARG n 
3 57  ILE n 
3 58  SER n 
3 59  LEU n 
3 60  VAL n 
3 61  THR n 
3 62  LYS n 
3 63  ASP n 
3 64  PRO n 
3 65  PRO n 
3 66  HIS n 
3 67  ARG n 
3 68  PRO n 
3 69  HIS n 
3 70  PRO n 
3 71  HIS n 
3 72  GLU n 
3 73  LEU n 
3 74  VAL n 
3 75  GLY n 
3 76  LYS n 
3 77  ASP n 
3 78  CYS n 
3 79  ARG n 
3 80  ASP n 
3 81  GLY n 
3 82  TYR n 
3 83  TYR n 
3 84  GLU n 
3 85  ALA n 
3 86  ASP n 
3 87  LEU n 
3 88  CYS n 
3 89  PRO n 
3 90  ASP n 
3 91  ARG n 
3 92  SER n 
3 93  ILE n 
3 94  HIS n 
3 95  SER n 
3 96  PHE n 
3 97  GLN n 
3 98  ASN n 
3 99  LEU n 
3 100 GLY n 
3 101 ILE n 
3 102 GLN n 
3 103 CYS n 
3 104 VAL n 
3 105 LYS n 
3 106 LYS n 
3 107 ARG n 
3 108 ASP n 
3 109 LEU n 
3 110 GLU n 
3 111 GLN n 
3 112 ALA n 
3 113 ILE n 
3 114 SER n 
3 115 GLN n 
3 116 ARG n 
3 117 ILE n 
3 118 GLN n 
3 119 THR n 
3 120 ASN n 
3 121 ASN n 
3 122 ASN n 
3 123 PRO n 
3 124 PHE n 
3 125 HIS n 
3 126 VAL n 
3 127 PRO n 
3 128 ILE n 
3 129 GLU n 
3 130 GLU n 
3 131 GLN n 
3 132 ARG n 
3 133 GLY n 
3 134 ASP n 
3 135 TYR n 
3 136 ASP n 
3 137 LEU n 
3 138 ASN n 
3 139 ALA n 
3 140 VAL n 
3 141 ARG n 
3 142 LEU n 
3 143 CYS n 
3 144 PHE n 
3 145 GLN n 
3 146 VAL n 
3 147 THR n 
3 148 VAL n 
3 149 ARG n 
3 150 ASP n 
3 151 PRO n 
3 152 ALA n 
3 153 GLY n 
3 154 ARG n 
3 155 PRO n 
3 156 LEU n 
3 157 LEU n 
3 158 LEU n 
3 159 THR n 
3 160 PRO n 
3 161 VAL n 
3 162 LEU n 
3 163 SER n 
3 164 HIS n 
3 165 PRO n 
3 166 ILE n 
3 167 PHE n 
3 168 ASP n 
3 169 ASN n 
3 170 ARG n 
3 171 ALA n 
3 172 PRO n 
3 173 ASN n 
3 174 THR n 
3 175 ALA n 
3 176 GLU n 
3 177 LEU n 
3 178 LYS n 
3 179 ILE n 
3 180 CYS n 
3 181 ARG n 
3 182 VAL n 
3 183 ASN n 
3 184 ARG n 
3 185 ASN n 
3 186 SER n 
3 187 GLY n 
3 188 SER n 
3 189 CYS n 
3 190 LEU n 
3 191 GLY n 
3 192 GLY n 
3 193 ASP n 
3 194 GLU n 
3 195 ILE n 
3 196 PHE n 
3 197 LEU n 
3 198 LEU n 
3 199 CYS n 
3 200 ASP n 
3 201 LYS n 
3 202 VAL n 
3 203 GLN n 
3 204 LYS n 
3 205 GLU n 
3 206 ASP n 
3 207 ILE n 
3 208 GLU n 
3 209 VAL n 
3 210 TYR n 
3 211 PHE n 
3 212 THR n 
3 213 GLY n 
3 214 PRO n 
3 215 GLY n 
3 216 TRP n 
3 217 GLU n 
3 218 ALA n 
3 219 ARG n 
3 220 GLY n 
3 221 SER n 
3 222 PHE n 
3 223 SER n 
3 224 GLN n 
3 225 ALA n 
3 226 ASP n 
3 227 VAL n 
3 228 HIS n 
3 229 ARG n 
3 230 GLN n 
3 231 VAL n 
3 232 ALA n 
3 233 ILE n 
3 234 VAL n 
3 235 PHE n 
3 236 ARG n 
3 237 THR n 
3 238 PRO n 
3 239 PRO n 
3 240 TYR n 
3 241 ALA n 
3 242 ASP n 
3 243 PRO n 
3 244 SER n 
3 245 LEU n 
3 246 GLN n 
3 247 ALA n 
3 248 PRO n 
3 249 VAL n 
3 250 ARG n 
3 251 VAL n 
3 252 SER n 
3 253 MET n 
3 254 GLN n 
3 255 LEU n 
3 256 ARG n 
3 257 ARG n 
3 258 PRO n 
3 259 SER n 
3 260 ASP n 
3 261 ARG n 
3 262 GLU n 
3 263 LEU n 
3 264 SER n 
3 265 GLU n 
3 266 PRO n 
3 267 MET n 
3 268 GLU n 
3 269 PHE n 
3 270 GLN n 
3 271 TYR n 
3 272 LEU n 
3 273 PRO n 
3 274 ASP n 
4 1   MET n 
4 2   GLY n 
4 3   PRO n 
4 4   TYR n 
4 5   LEU n 
4 6   GLN n 
4 7   ILE n 
4 8   LEU n 
4 9   GLU n 
4 10  GLN n 
4 11  PRO n 
4 12  LYS n 
4 13  GLN n 
4 14  ARG n 
4 15  GLY n 
4 16  PHE n 
4 17  ARG n 
4 18  PHE n 
4 19  ARG n 
4 20  TYR n 
4 21  VAL n 
4 22  CYS n 
4 23  GLU n 
4 24  GLY n 
4 25  PRO n 
4 26  SER n 
4 27  HIS n 
4 28  GLY n 
4 29  GLY n 
4 30  LEU n 
4 31  PRO n 
4 32  GLY n 
4 33  ALA n 
4 34  SER n 
4 35  SER n 
4 36  GLU n 
4 37  LYS n 
4 38  ASN n 
4 39  LYS n 
4 40  LYS n 
4 41  SER n 
4 42  TYR n 
4 43  PRO n 
4 44  GLN n 
4 45  VAL n 
4 46  LYS n 
4 47  ILE n 
4 48  CYS n 
4 49  ASN n 
4 50  TYR n 
4 51  VAL n 
4 52  GLY n 
4 53  PRO n 
4 54  ALA n 
4 55  LYS n 
4 56  VAL n 
4 57  ILE n 
4 58  VAL n 
4 59  GLN n 
4 60  LEU n 
4 61  VAL n 
4 62  THR n 
4 63  ASN n 
4 64  GLY n 
4 65  LYS n 
4 66  ASN n 
4 67  ILE n 
4 68  HIS n 
4 69  LEU n 
4 70  HIS n 
4 71  ALA n 
4 72  HIS n 
4 73  SER n 
4 74  LEU n 
4 75  VAL n 
4 76  GLY n 
4 77  LYS n 
4 78  HIS n 
4 79  CYS n 
4 80  GLU n 
4 81  ASP n 
4 82  GLY n 
4 83  VAL n 
4 84  CYS n 
4 85  THR n 
4 86  VAL n 
4 87  THR n 
4 88  ALA n 
4 89  GLY n 
4 90  PRO n 
4 91  LYS n 
4 92  ASP n 
4 93  MET n 
4 94  VAL n 
4 95  VAL n 
4 96  GLY n 
4 97  PHE n 
4 98  ALA n 
4 99  ASN n 
4 100 LEU n 
4 101 GLY n 
4 102 ILE n 
4 103 LEU n 
4 104 HIS n 
4 105 VAL n 
4 106 THR n 
4 107 LYS n 
4 108 LYS n 
4 109 LYS n 
4 110 VAL n 
4 111 PHE n 
4 112 GLU n 
4 113 THR n 
4 114 LEU n 
4 115 GLU n 
4 116 ALA n 
4 117 ARG n 
4 118 MET n 
4 119 THR n 
4 120 GLU n 
4 121 ALA n 
4 122 CYS n 
4 123 ILE n 
4 124 ARG n 
4 125 GLY n 
4 126 TYR n 
4 127 ASN n 
4 128 PRO n 
4 129 GLY n 
4 130 LEU n 
4 131 LEU n 
4 132 VAL n 
4 133 HIS n 
4 134 SER n 
4 135 ASP n 
4 136 LEU n 
4 137 ALA n 
4 138 TYR n 
4 139 LEU n 
4 140 GLN n 
4 141 ALA n 
4 142 GLU n 
4 143 GLY n 
4 144 GLY n 
4 145 GLY n 
4 146 ASP n 
4 147 ARG n 
4 148 GLN n 
4 149 LEU n 
4 150 THR n 
4 151 ASP n 
4 152 ARG n 
4 153 GLU n 
4 154 LYS n 
4 155 GLU n 
4 156 ILE n 
4 157 ILE n 
4 158 ARG n 
4 159 GLN n 
4 160 ALA n 
4 161 ALA n 
4 162 VAL n 
4 163 GLN n 
4 164 GLN n 
4 165 THR n 
4 166 LYS n 
4 167 GLU n 
4 168 MET n 
4 169 ASP n 
4 170 LEU n 
4 171 SER n 
4 172 VAL n 
4 173 VAL n 
4 174 ARG n 
4 175 LEU n 
4 176 MET n 
4 177 PHE n 
4 178 THR n 
4 179 ALA n 
4 180 PHE n 
4 181 LEU n 
4 182 PRO n 
4 183 ASP n 
4 184 SER n 
4 185 THR n 
4 186 GLY n 
4 187 SER n 
4 188 PHE n 
4 189 THR n 
4 190 ARG n 
4 191 ARG n 
4 192 LEU n 
4 193 GLU n 
4 194 PRO n 
4 195 VAL n 
4 196 VAL n 
4 197 SER n 
4 198 ASP n 
4 199 ALA n 
4 200 ILE n 
4 201 TYR n 
4 202 ASP n 
4 203 SER n 
4 204 LYS n 
4 205 ALA n 
4 206 PRO n 
4 207 ASN n 
4 208 ALA n 
4 209 SER n 
4 210 ASN n 
4 211 LEU n 
4 212 LYS n 
4 213 ILE n 
4 214 VAL n 
4 215 ARG n 
4 216 MET n 
4 217 ASP n 
4 218 ARG n 
4 219 THR n 
4 220 ALA n 
4 221 GLY n 
4 222 CYS n 
4 223 VAL n 
4 224 THR n 
4 225 GLY n 
4 226 GLY n 
4 227 GLU n 
4 228 GLU n 
4 229 ILE n 
4 230 TYR n 
4 231 LEU n 
4 232 LEU n 
4 233 CYS n 
4 234 ASP n 
4 235 LYS n 
4 236 VAL n 
4 237 GLN n 
4 238 LYS n 
4 239 ASP n 
4 240 ASP n 
4 241 ILE n 
4 242 GLN n 
4 243 ILE n 
4 244 ARG n 
4 245 PHE n 
4 246 TYR n 
4 247 GLU n 
4 248 GLU n 
4 249 GLU n 
4 250 GLU n 
4 251 ASN n 
4 252 GLY n 
4 253 GLY n 
4 254 VAL n 
4 255 TRP n 
4 256 GLU n 
4 257 GLY n 
4 258 PHE n 
4 259 GLY n 
4 260 ASP n 
4 261 PHE n 
4 262 SER n 
4 263 PRO n 
4 264 THR n 
4 265 ASP n 
4 266 VAL n 
4 267 HIS n 
4 268 ARG n 
4 269 GLN n 
4 270 PHE n 
4 271 ALA n 
4 272 ILE n 
4 273 VAL n 
4 274 PHE n 
4 275 LYS n 
4 276 THR n 
4 277 PRO n 
4 278 LYS n 
4 279 TYR n 
4 280 LYS n 
4 281 ASP n 
4 282 VAL n 
4 283 ASN n 
4 284 ILE n 
4 285 THR n 
4 286 LYS n 
4 287 PRO n 
4 288 ALA n 
4 289 SER n 
4 290 VAL n 
4 291 PHE n 
4 292 VAL n 
4 293 GLN n 
4 294 LEU n 
4 295 ARG n 
4 296 ARG n 
4 297 LYS n 
4 298 SER n 
4 299 ASP n 
4 300 LEU n 
4 301 GLU n 
4 302 THR n 
4 303 SER n 
4 304 GLU n 
4 305 PRO n 
4 306 LYS n 
4 307 PRO n 
4 308 PHE n 
4 309 LEU n 
4 310 TYR n 
4 311 TYR n 
4 312 PRO n 
4 313 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? 'house mouse' Mus rela  ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? 't7 promoter' ? ? ? ET29b ? ? 
4 1 sample ? ? ? 'house mouse' Mus nfkb1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? 't7 promoter' ? ? ? ET29b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TF65_MOUSE 3 
;YVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGY
YEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVL
SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYAD
PSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
;
20 Q04207 ? 
2 UNP KBF1_MOUSE 4 
;GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAA
VQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDI
QIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
;
39 P25799 ? 
3 PDB 1LEI       1 ? ?  1LEI   ? 
4 PDB 1LEI       2 ? ?  1LEI   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LEI A 3 ? 274 ? Q04207 20 ? 291 ? 20 291 
2 2 1LEI B 2 ? 313 ? P25799 39 ? 350 ? 39 350 
3 3 1LEI C 1 ? 17  ? 1LEI   1  ? 17  ? 1  17  
4 4 1LEI D 1 ? 17  ? 1LEI   1  ? 17  ? 1  17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LEI MET A 1 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 18 1 
1 1LEI ALA A 2 ? UNP Q04207 ? ? 'CLONING ARTIFACT' 19 2 
2 1LEI MET B 1 ? UNP P25799 ? ? 'INITIATING MET'   38 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5IU 'DNA linking'       n "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 I N2 O8 P' 434.078 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1LEI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.13 
_exptl_crystal.density_Matthews      3.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'SMALL TUBES' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, CaCl2, sodium spermine, pH 6.5, SMALL TUBES, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 3350'        ? ? ? 
1 2 1 CaCl2             ? ? ? 
1 3 1 'sodium spermine' ? ? ? 
1 4 2 CaCl2             ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-08-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1LEI 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   33470 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   89 
_reflns_shell.Rmerge_I_obs           0.31 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LEI 
_refine.ls_number_reflns_obs                     29985 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    87.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25 
_refine.ls_R_factor_R_free                       0.284 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1525 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VKX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4630 
_refine_hist.pdbx_number_atoms_nucleic_acid   691 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               5344 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.33  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LEI 
_struct.title                     'The kB DNA sequence from the HLV-LTR functions as an allosteric regulator of HIV transcription' 
_struct.pdbx_descriptor           'NUCLEAR FACTOR NF-KAPPA-B P65 SUBUNIT/NUCLEAR FACTOR NF-KAPPA-B P50 SUBUNIT/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LEI 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'transcription factor, NF-kB-DNA complex, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS C 105 ? ARG C 107 ? LYS A 122 ARG A 124 5 ? 3  
HELX_P HELX_P2 2 ASP C 108 ? GLN C 118 ? ASP A 125 GLN A 135 1 ? 11 
HELX_P HELX_P3 3 PRO C 127 ? GLN C 131 ? PRO A 144 GLN A 148 5 ? 5  
HELX_P HELX_P4 4 GLN C 203 ? ILE C 207 ? GLN A 220 ILE A 224 5 ? 5  
HELX_P HELX_P5 5 SER C 223 ? ALA C 225 ? SER A 240 ALA A 242 5 ? 3  
HELX_P HELX_P6 6 LYS D 108 ? GLU D 120 ? LYS B 145 GLU B 157 1 ? 13 
HELX_P HELX_P7 7 HIS D 133 ? ALA D 137 ? HIS B 170 ALA B 174 5 ? 5  
HELX_P HELX_P8 8 ARG D 152 ? LYS D 166 ? ARG B 189 LYS B 203 1 ? 15 
HELX_P HELX_P9 9 SER D 262 ? THR D 264 ? SER B 299 THR B 301 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 79 SG    ? ? ? 1_555 D CYS 84 SG ? ? B CYS 116 B CYS 121 1_555 ? ? ? ? ? ? ?            2.043 ? 
covale1  covale ? ? B DG  4  "O3'" ? ? ? 1_555 B 5IU 5  P  ? ? D DG  4   D 5IU 5   1_555 ? ? ? ? ? ? ?            1.600 ? 
covale2  covale ? ? B 5IU 5  "O3'" ? ? ? 1_555 B DA  6  P  ? ? D 5IU 5   D DA  6   1_555 ? ? ? ? ? ? ?            1.596 ? 
covale3  covale ? ? B DC  7  "O3'" ? ? ? 1_555 B 5IU 8  P  ? ? D DC  7   D 5IU 8   1_555 ? ? ? ? ? ? ?            1.615 ? 
covale4  covale ? ? B 5IU 8  "O3'" ? ? ? 1_555 B 5IU 9  P  ? ? D 5IU 8   D 5IU 9   1_555 ? ? ? ? ? ? ?            1.606 ? 
covale5  covale ? ? B 5IU 9  "O3'" ? ? ? 1_555 B 5IU 10 P  ? ? D 5IU 9   D 5IU 10  1_555 ? ? ? ? ? ? ?            1.618 ? 
covale6  covale ? ? B 5IU 10 "O3'" ? ? ? 1_555 B DC  11 P  ? ? D 5IU 10  D DC  11  1_555 ? ? ? ? ? ? ?            1.603 ? 
hydrog1  hydrog ? ? A DC  1  N3    ? ? ? 1_555 B DG  17 N1 ? ? C DC  1   D DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  1  N4    ? ? ? 1_555 B DG  17 O6 ? ? C DC  1   D DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  1  O2    ? ? ? 1_555 B DG  17 N2 ? ? C DC  1   D DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  16 N1 ? ? C DT  2   D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT  2  O4    ? ? ? 1_555 B DA  16 N6 ? ? C DT  2   D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  15 N1 ? ? C DC  3   D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  15 O6 ? ? C DC  3   D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  15 N2 ? ? C DC  3   D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  4  N1    ? ? ? 1_555 B DT  14 N3 ? ? C DA  4   D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA  4  N6    ? ? ? 1_555 B DT  14 O4 ? ? C DA  4   D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5  N1    ? ? ? 1_555 B DC  13 N3 ? ? C DG  5   D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  5  N2    ? ? ? 1_555 B DC  13 O2 ? ? C DG  5   D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  5  O6    ? ? ? 1_555 B DC  13 N4 ? ? C DG  5   D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  6  N1    ? ? ? 1_555 B DC  12 N3 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  6  N2    ? ? ? 1_555 B DC  12 O2 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  6  O6    ? ? ? 1_555 B DC  12 N4 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  7  N1    ? ? ? 1_555 B DC  11 N3 ? ? C DG  7   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  7  N2    ? ? ? 1_555 B DC  11 O2 ? ? C DG  7   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  7  O6    ? ? ? 1_555 B DC  11 N4 ? ? C DG  7   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA  8  N1    ? ? ? 1_555 B 5IU 10 N3 ? ? C DA  8   D 5IU 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA  8  N6    ? ? ? 1_555 B 5IU 10 O4 ? ? C DA  8   D 5IU 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  9  N1    ? ? ? 1_555 B 5IU 9  N3 ? ? C DA  9   D 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  9  N6    ? ? ? 1_555 B 5IU 9  O4 ? ? C DA  9   D 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA  10 N1    ? ? ? 1_555 B 5IU 8  N3 ? ? C DA  10  D 5IU 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA  10 N6    ? ? ? 1_555 B 5IU 8  O4 ? ? C DA  10  D 5IU 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  7  N3 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  7  O2 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  7  N4 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DT  12 N3    ? ? ? 1_555 B DA  6  N1 ? ? C DT  12  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT  12 O4    ? ? ? 1_555 B DA  6  N6 ? ? C DT  12  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DA  13 N1    ? ? ? 1_555 B DG  4  N1 ? ? C DA  13  D DG  4   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog32 hydrog ? ? A DA  13 N6    ? ? ? 1_555 B DG  4  O6 ? ? C DA  13  D DG  4   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog33 hydrog ? ? A DA  13 N1    ? ? ? 1_555 B 5IU 5  N3 ? ? C DA  13  D 5IU 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DA  13 N6    ? ? ? 1_555 B 5IU 5  O4 ? ? C DA  13  D 5IU 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  4  N1 ? ? C DC  14  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  4  O6 ? ? C DC  14  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  4  N2 ? ? C DC  14  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  3  N3 ? ? C DA  15  D DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  3  O4 ? ? C DA  15  D DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  2  N3 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  2  O2 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  2  N4 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DA  17 N1    ? ? ? 1_555 B DT  1  N3 ? ? C DA  17  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DA  17 N6    ? ? ? 1_555 B DT  1  O4 ? ? C DA  17  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 5 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 5 ? 
K ? 3 ? 
L ? 4 ? 
M ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 3   ? GLU C 8   ? TYR A 20  GLU A 25  
A 2 THR C 43  ? ASN C 47  ? THR A 60  ASN A 64  
A 3 ILE C 93  ? SER C 95  ? ILE A 110 SER A 112 
B 1 VAL C 161 ? PHE C 167 ? VAL A 178 PHE A 184 
B 2 ALA C 139 ? ARG C 149 ? ALA A 156 ARG A 166 
B 3 THR C 54  ? VAL C 60  ? THR A 71  VAL A 77  
B 4 TYR C 82  ? ASP C 86  ? TYR A 99  ASP A 103 
B 5 CYS C 78  ? ARG C 79  ? CYS A 95  ARG A 96  
C 1 VAL C 161 ? PHE C 167 ? VAL A 178 PHE A 184 
C 2 ALA C 139 ? ARG C 149 ? ALA A 156 ARG A 166 
C 3 PRO C 155 ? LEU C 157 ? PRO A 172 LEU A 174 
D 1 GLU C 72  ? VAL C 74  ? GLU A 89  VAL A 91  
D 2 GLY C 100 ? GLN C 102 ? GLY A 117 GLN A 119 
E 1 ILE C 179 ? VAL C 182 ? ILE A 196 VAL A 199 
E 2 GLU C 194 ? CYS C 199 ? GLU A 211 CYS A 216 
E 3 ALA C 232 ? ARG C 236 ? ALA A 249 ARG A 253 
E 4 VAL C 227 ? HIS C 228 ? VAL A 244 HIS A 245 
F 1 SER C 186 ? SER C 188 ? SER A 203 SER A 205 
F 2 MET C 267 ? LEU C 272 ? MET A 284 LEU A 289 
F 3 VAL C 249 ? ARG C 257 ? VAL A 266 ARG A 274 
F 4 GLU C 208 ? GLY C 213 ? GLU A 225 GLY A 230 
F 5 TRP C 216 ? ARG C 219 ? TRP A 233 ARG A 236 
G 1 SER C 186 ? SER C 188 ? SER A 203 SER A 205 
G 2 MET C 267 ? LEU C 272 ? MET A 284 LEU A 289 
G 3 VAL C 249 ? ARG C 257 ? VAL A 266 ARG A 274 
G 4 GLU C 262 ? LEU C 263 ? GLU A 279 LEU A 280 
H 1 LEU D 5   ? ILE D 7   ? LEU B 42  ILE B 44  
H 2 GLN D 44  ? ILE D 47  ? GLN B 81  ILE B 84  
H 3 VAL D 94  ? GLY D 96  ? VAL B 131 GLY B 133 
I 1 ARG D 19  ? TYR D 20  ? ARG B 56  TYR B 57  
I 2 ILE D 102 ? HIS D 104 ? ILE B 139 HIS B 141 
I 3 SER D 73  ? LEU D 74  ? SER B 110 LEU B 111 
J 1 ARG D 190 ? VAL D 196 ? ARG B 227 VAL B 233 
J 2 VAL D 172 ? LEU D 181 ? VAL B 209 LEU B 218 
J 3 LYS D 55  ? VAL D 61  ? LYS B 92  VAL B 98  
J 4 VAL D 83  ? THR D 87  ? VAL B 120 THR B 124 
J 5 CYS D 79  ? GLU D 80  ? CYS B 116 GLU B 117 
K 1 ARG D 190 ? VAL D 196 ? ARG B 227 VAL B 233 
K 2 VAL D 172 ? LEU D 181 ? VAL B 209 LEU B 218 
K 3 ILE D 200 ? TYR D 201 ? ILE B 237 TYR B 238 
L 1 ILE D 213 ? MET D 216 ? ILE B 250 MET B 253 
L 2 GLU D 228 ? CYS D 233 ? GLU B 265 CYS B 270 
L 3 ALA D 271 ? LYS D 275 ? ALA B 308 LYS B 312 
L 4 VAL D 266 ? HIS D 267 ? VAL B 303 HIS B 304 
M 1 ALA D 220 ? CYS D 222 ? ALA B 257 CYS B 259 
M 2 LYS D 306 ? TYR D 311 ? LYS B 343 TYR B 348 
M 3 ALA D 288 ? ARG D 295 ? ALA B 325 ARG B 332 
M 4 GLN D 242 ? GLU D 247 ? GLN B 279 GLU B 284 
M 5 TRP D 255 ? PHE D 258 ? TRP B 292 PHE B 295 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 5   ? N GLU A 22  O LYS C 45  ? O LYS A 62  
A 2 3 N ILE C 44  ? N ILE A 61  O HIS C 94  ? O HIS A 111 
B 1 2 O ILE C 166 ? O ILE A 183 N VAL C 140 ? N VAL A 157 
B 2 3 O THR C 147 ? O THR A 164 N THR C 54  ? N THR A 71  
B 3 4 N VAL C 55  ? N VAL A 72  O ALA C 85  ? O ALA A 102 
B 4 5 O TYR C 82  ? O TYR A 99  N ARG C 79  ? N ARG A 96  
C 1 2 O ILE C 166 ? O ILE A 183 N VAL C 140 ? N VAL A 157 
C 2 3 N VAL C 148 ? N VAL A 165 O LEU C 156 ? O LEU A 173 
D 1 2 N GLU C 72  ? N GLU A 89  O GLN C 102 ? O GLN A 119 
E 1 2 N ARG C 181 ? N ARG A 198 O LEU C 198 ? O LEU A 215 
E 2 3 N ILE C 195 ? N ILE A 212 O PHE C 235 ? O PHE A 252 
E 3 4 O ALA C 232 ? O ALA A 249 N HIS C 228 ? N HIS A 245 
F 1 2 N GLY C 187 ? N GLY A 204 O LEU C 272 ? O LEU A 289 
F 2 3 O PHE C 269 ? O PHE A 286 N VAL C 251 ? N VAL A 268 
F 3 4 O GLN C 254 ? O GLN A 271 N TYR C 210 ? N TYR A 227 
F 4 5 N GLY C 213 ? N GLY A 230 O TRP C 216 ? O TRP A 233 
G 1 2 N GLY C 187 ? N GLY A 204 O LEU C 272 ? O LEU A 289 
G 2 3 O PHE C 269 ? O PHE A 286 N VAL C 251 ? N VAL A 268 
G 3 4 N ARG C 257 ? N ARG A 274 O GLU C 262 ? O GLU A 279 
H 1 2 N GLN D 6   ? N GLN B 43  O LYS D 46  ? O LYS B 83  
H 2 3 N VAL D 45  ? N VAL B 82  O VAL D 95  ? O VAL B 132 
I 1 2 N ARG D 19  ? N ARG B 56  O HIS D 104 ? O HIS B 141 
I 2 3 O LEU D 103 ? O LEU B 140 N SER D 73  ? N SER B 110 
J 1 2 O ARG D 190 ? O ARG B 227 N LEU D 181 ? N LEU B 218 
J 2 3 O PHE D 180 ? O PHE B 217 N LYS D 55  ? N LYS B 92  
J 3 4 N VAL D 58  ? N VAL B 95  O CYS D 84  ? O CYS B 121 
J 4 5 O VAL D 83  ? O VAL B 120 N GLU D 80  ? N GLU B 117 
K 1 2 O ARG D 190 ? O ARG B 227 N LEU D 181 ? N LEU B 218 
K 2 3 N VAL D 173 ? N VAL B 210 O ILE D 200 ? O ILE B 237 
L 1 2 N ARG D 215 ? N ARG B 252 O LEU D 232 ? O LEU B 269 
L 2 3 N LEU D 231 ? N LEU B 268 O ILE D 272 ? O ILE B 309 
L 3 4 O ALA D 271 ? O ALA B 308 N HIS D 267 ? N HIS B 304 
M 1 2 N GLY D 221 ? N GLY B 258 O LEU D 309 ? O LEU B 346 
M 2 3 O LYS D 306 ? O LYS B 343 N VAL D 292 ? N VAL B 329 
M 3 4 O PHE D 291 ? O PHE B 328 N TYR D 246 ? N TYR B 283 
M 4 5 N PHE D 245 ? N PHE B 282 O GLY D 257 ? O GLY B 294 
# 
_database_PDB_matrix.entry_id          1LEI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LEI 
_atom_sites.fract_transf_matrix[1][1]   0.007292 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005565 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010302 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 67.177 1.259   4.448   1.00 116.25 ? 1   DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 66.767 -0.069  4.101   1.00 116.37 ? 1   DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 65.854 -0.709  5.123   1.00 116.38 ? 1   DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 66.531 -0.783  6.403   1.00 116.27 ? 1   DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 64.546 0.046   5.376   1.00 116.25 ? 1   DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 63.462 -0.872  5.571   1.00 116.23 ? 1   DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 64.824 0.804   6.661   1.00 116.16 ? 1   DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 65.741 -0.152  7.401   1.00 116.12 ? 1   DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 66.646 0.499   8.365   1.00 116.08 ? 1   DC  C N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 66.345 0.399   9.724   1.00 115.99 ? 1   DC  C C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 65.340 -0.237  10.064  1.00 116.19 ? 1   DC  C O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 67.153 0.995   10.629  1.00 115.88 ? 1   DC  C N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 68.227 1.672   10.221  1.00 115.66 ? 1   DC  C C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 68.994 2.244   11.158  1.00 115.64 ? 1   DC  C N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 68.562 1.791   8.839   1.00 115.53 ? 1   DC  C C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 67.752 1.192   7.952   1.00 115.79 ? 1   DC  C C6    1 
ATOM   17   P P     . DT  A 1 2   ? 61.972 -0.457  5.114   1.00 116.34 ? 2   DT  C P     1 
ATOM   18   O OP1   . DT  A 1 2   ? 61.530 -1.356  4.015   1.00 116.22 ? 2   DT  C OP1   1 
ATOM   19   O OP2   . DT  A 1 2   ? 61.966 1.015   4.900   1.00 116.40 ? 2   DT  C OP2   1 
ATOM   20   O "O5'" . DT  A 1 2   ? 61.076 -0.777  6.392   1.00 115.53 ? 2   DT  C "O5'" 1 
ATOM   21   C "C5'" . DT  A 1 2   ? 60.694 -2.112  6.692   1.00 114.29 ? 2   DT  C "C5'" 1 
ATOM   22   C "C4'" . DT  A 1 2   ? 59.850 -2.145  7.942   1.00 113.86 ? 2   DT  C "C4'" 1 
ATOM   23   O "O4'" . DT  A 1 2   ? 60.672 -1.726  9.061   1.00 113.30 ? 2   DT  C "O4'" 1 
ATOM   24   C "C3'" . DT  A 1 2   ? 58.633 -1.216  7.928   1.00 113.91 ? 2   DT  C "C3'" 1 
ATOM   25   O "O3'" . DT  A 1 2   ? 57.429 -1.894  8.322   1.00 114.44 ? 2   DT  C "O3'" 1 
ATOM   26   C "C2'" . DT  A 1 2   ? 59.014 -0.064  8.839   1.00 113.51 ? 2   DT  C "C2'" 1 
ATOM   27   C "C1'" . DT  A 1 2   ? 60.063 -0.654  9.769   1.00 113.13 ? 2   DT  C "C1'" 1 
ATOM   28   N N1    . DT  A 1 2   ? 61.119 0.323   10.124  1.00 112.57 ? 2   DT  C N1    1 
ATOM   29   C C2    . DT  A 1 2   ? 61.625 0.330   11.408  1.00 112.05 ? 2   DT  C C2    1 
ATOM   30   O O2    . DT  A 1 2   ? 61.256 -0.446  12.273  1.00 111.79 ? 2   DT  C O2    1 
ATOM   31   N N3    . DT  A 1 2   ? 62.585 1.291   11.641  1.00 111.90 ? 2   DT  C N3    1 
ATOM   32   C C4    . DT  A 1 2   ? 63.074 2.221   10.736  1.00 111.97 ? 2   DT  C C4    1 
ATOM   33   O O4    . DT  A 1 2   ? 63.932 3.028   11.081  1.00 111.61 ? 2   DT  C O4    1 
ATOM   34   C C5    . DT  A 1 2   ? 62.504 2.152   9.414   1.00 112.14 ? 2   DT  C C5    1 
ATOM   35   C C7    . DT  A 1 2   ? 62.973 3.118   8.373   1.00 112.14 ? 2   DT  C C7    1 
ATOM   36   C C6    . DT  A 1 2   ? 61.572 1.219   9.176   1.00 112.41 ? 2   DT  C C6    1 
ATOM   37   P P     . DC  A 1 3   ? 57.302 -2.555  9.786   1.00 115.19 ? 3   DC  C P     1 
ATOM   38   O OP1   . DC  A 1 3   ? 58.540 -3.338  10.039  1.00 114.87 ? 3   DC  C OP1   1 
ATOM   39   O OP2   . DC  A 1 3   ? 55.977 -3.234  9.845   1.00 115.00 ? 3   DC  C OP2   1 
ATOM   40   O "O5'" . DC  A 1 3   ? 57.281 -1.342  10.822  1.00 114.59 ? 3   DC  C "O5'" 1 
ATOM   41   C "C5'" . DC  A 1 3   ? 57.281 -1.601  12.230  1.00 113.57 ? 3   DC  C "C5'" 1 
ATOM   42   C "C4'" . DC  A 1 3   ? 56.624 -0.468  12.985  1.00 112.94 ? 3   DC  C "C4'" 1 
ATOM   43   O "O4'" . DC  A 1 3   ? 57.518 0.664   13.078  1.00 112.92 ? 3   DC  C "O4'" 1 
ATOM   44   C "C3'" . DC  A 1 3   ? 55.324 0.056   12.374  1.00 112.56 ? 3   DC  C "C3'" 1 
ATOM   45   O "O3'" . DC  A 1 3   ? 54.380 0.336   13.414  1.00 111.68 ? 3   DC  C "O3'" 1 
ATOM   46   C "C2'" . DC  A 1 3   ? 55.757 1.334   11.675  1.00 112.64 ? 3   DC  C "C2'" 1 
ATOM   47   C "C1'" . DC  A 1 3   ? 56.887 1.827   12.568  1.00 113.01 ? 3   DC  C "C1'" 1 
ATOM   48   N N1    . DC  A 1 3   ? 57.926 2.640   11.909  1.00 113.30 ? 3   DC  C N1    1 
ATOM   49   C C2    . DC  A 1 3   ? 59.018 3.068   12.676  1.00 113.39 ? 3   DC  C C2    1 
ATOM   50   O O2    . DC  A 1 3   ? 59.064 2.762   13.881  1.00 113.15 ? 3   DC  C O2    1 
ATOM   51   N N3    . DC  A 1 3   ? 59.995 3.801   12.090  1.00 113.48 ? 3   DC  C N3    1 
ATOM   52   C C4    . DC  A 1 3   ? 59.912 4.112   10.795  1.00 113.48 ? 3   DC  C C4    1 
ATOM   53   N N4    . DC  A 1 3   ? 60.910 4.835   10.267  1.00 113.33 ? 3   DC  C N4    1 
ATOM   54   C C5    . DC  A 1 3   ? 58.807 3.696   9.987   1.00 113.33 ? 3   DC  C C5    1 
ATOM   55   C C6    . DC  A 1 3   ? 57.844 2.969   10.581  1.00 113.31 ? 3   DC  C C6    1 
ATOM   56   P P     . DA  A 1 4   ? 53.538 -0.873  14.070  1.00 111.11 ? 4   DA  C P     1 
ATOM   57   O OP1   . DA  A 1 4   ? 54.177 -2.152  13.659  1.00 110.94 ? 4   DA  C OP1   1 
ATOM   58   O OP2   . DA  A 1 4   ? 52.087 -0.656  13.806  1.00 110.76 ? 4   DA  C OP2   1 
ATOM   59   O "O5'" . DA  A 1 4   ? 53.774 -0.691  15.633  1.00 109.34 ? 4   DA  C "O5'" 1 
ATOM   60   C "C5'" . DA  A 1 4   ? 53.114 0.343   16.351  1.00 106.54 ? 4   DA  C "C5'" 1 
ATOM   61   C "C4'" . DA  A 1 4   ? 54.108 1.106   17.193  1.00 104.65 ? 4   DA  C "C4'" 1 
ATOM   62   O "O4'" . DA  A 1 4   ? 55.102 1.731   16.337  1.00 103.93 ? 4   DA  C "O4'" 1 
ATOM   63   C "C3'" . DA  A 1 4   ? 53.473 2.238   17.996  1.00 103.74 ? 4   DA  C "C3'" 1 
ATOM   64   O "O3'" . DA  A 1 4   ? 54.053 2.296   19.300  1.00 102.30 ? 4   DA  C "O3'" 1 
ATOM   65   C "C2'" . DA  A 1 4   ? 53.797 3.480   17.184  1.00 103.47 ? 4   DA  C "C2'" 1 
ATOM   66   C "C1'" . DA  A 1 4   ? 55.137 3.133   16.571  1.00 103.24 ? 4   DA  C "C1'" 1 
ATOM   67   N N9    . DA  A 1 4   ? 55.402 3.804   15.299  1.00 102.64 ? 4   DA  C N9    1 
ATOM   68   C C8    . DA  A 1 4   ? 54.758 3.631   14.099  1.00 102.24 ? 4   DA  C C8    1 
ATOM   69   N N7    . DA  A 1 4   ? 55.240 4.369   13.129  1.00 102.16 ? 4   DA  C N7    1 
ATOM   70   C C5    . DA  A 1 4   ? 56.270 5.083   13.730  1.00 102.31 ? 4   DA  C C5    1 
ATOM   71   C C6    . DA  A 1 4   ? 57.180 6.049   13.235  1.00 102.22 ? 4   DA  C C6    1 
ATOM   72   N N6    . DA  A 1 4   ? 57.203 6.472   11.971  1.00 102.01 ? 4   DA  C N6    1 
ATOM   73   N N1    . DA  A 1 4   ? 58.076 6.571   14.102  1.00 102.31 ? 4   DA  C N1    1 
ATOM   74   C C2    . DA  A 1 4   ? 58.054 6.147   15.374  1.00 102.56 ? 4   DA  C C2    1 
ATOM   75   N N3    . DA  A 1 4   ? 57.256 5.247   15.955  1.00 102.67 ? 4   DA  C N3    1 
ATOM   76   C C4    . DA  A 1 4   ? 56.376 4.748   15.068  1.00 102.54 ? 4   DA  C C4    1 
ATOM   77   P P     . DG  A 1 5   ? 53.383 3.225   20.424  1.00 101.22 ? 5   DG  C P     1 
ATOM   78   O OP1   . DG  A 1 5   ? 54.085 2.966   21.707  1.00 101.51 ? 5   DG  C OP1   1 
ATOM   79   O OP2   . DG  A 1 5   ? 51.908 3.059   20.349  1.00 101.30 ? 5   DG  C OP2   1 
ATOM   80   O "O5'" . DG  A 1 5   ? 53.743 4.699   19.940  1.00 100.23 ? 5   DG  C "O5'" 1 
ATOM   81   C "C5'" . DG  A 1 5   ? 55.087 5.172   20.000  1.00 98.37  ? 5   DG  C "C5'" 1 
ATOM   82   C "C4'" . DG  A 1 5   ? 55.154 6.618   19.570  1.00 96.87  ? 5   DG  C "C4'" 1 
ATOM   83   O "O4'" . DG  A 1 5   ? 55.395 6.759   18.148  1.00 96.41  ? 5   DG  C "O4'" 1 
ATOM   84   C "C3'" . DG  A 1 5   ? 53.899 7.438   19.878  1.00 96.14  ? 5   DG  C "C3'" 1 
ATOM   85   O "O3'" . DG  A 1 5   ? 54.289 8.730   20.339  1.00 95.17  ? 5   DG  C "O3'" 1 
ATOM   86   C "C2'" . DG  A 1 5   ? 53.271 7.609   18.505  1.00 96.20  ? 5   DG  C "C2'" 1 
ATOM   87   C "C1'" . DG  A 1 5   ? 54.525 7.766   17.672  1.00 96.15  ? 5   DG  C "C1'" 1 
ATOM   88   N N9    . DG  A 1 5   ? 54.402 7.639   16.222  1.00 95.92  ? 5   DG  C N9    1 
ATOM   89   C C8    . DG  A 1 5   ? 53.596 6.785   15.507  1.00 96.24  ? 5   DG  C C8    1 
ATOM   90   N N7    . DG  A 1 5   ? 53.715 6.932   14.213  1.00 95.99  ? 5   DG  C N7    1 
ATOM   91   C C5    . DG  A 1 5   ? 54.658 7.941   14.068  1.00 95.45  ? 5   DG  C C5    1 
ATOM   92   C C6    . DG  A 1 5   ? 55.203 8.534   12.896  1.00 95.00  ? 5   DG  C C6    1 
ATOM   93   O O6    . DG  A 1 5   ? 54.954 8.275   11.711  1.00 94.47  ? 5   DG  C O6    1 
ATOM   94   N N1    . DG  A 1 5   ? 56.134 9.520   13.211  1.00 94.74  ? 5   DG  C N1    1 
ATOM   95   C C2    . DG  A 1 5   ? 56.495 9.889   14.483  1.00 94.88  ? 5   DG  C C2    1 
ATOM   96   N N2    . DG  A 1 5   ? 57.408 10.864  14.587  1.00 94.59  ? 5   DG  C N2    1 
ATOM   97   N N3    . DG  A 1 5   ? 55.998 9.344   15.577  1.00 95.07  ? 5   DG  C N3    1 
ATOM   98   C C4    . DG  A 1 5   ? 55.092 8.385   15.298  1.00 95.52  ? 5   DG  C C4    1 
ATOM   99   P P     . DG  A 1 6   ? 54.849 8.913   21.834  1.00 94.39  ? 6   DG  C P     1 
ATOM   100  O OP1   . DG  A 1 6   ? 55.826 7.829   22.122  1.00 94.47  ? 6   DG  C OP1   1 
ATOM   101  O OP2   . DG  A 1 6   ? 53.688 9.122   22.743  1.00 93.81  ? 6   DG  C OP2   1 
ATOM   102  O "O5'" . DG  A 1 6   ? 55.662 10.275  21.737  1.00 92.46  ? 6   DG  C "O5'" 1 
ATOM   103  C "C5'" . DG  A 1 6   ? 54.996 11.491  21.417  1.00 89.18  ? 6   DG  C "C5'" 1 
ATOM   104  C "C4'" . DG  A 1 6   ? 55.769 12.248  20.364  1.00 86.62  ? 6   DG  C "C4'" 1 
ATOM   105  O "O4'" . DG  A 1 6   ? 55.553 11.668  19.048  1.00 86.24  ? 6   DG  C "O4'" 1 
ATOM   106  C "C3'" . DG  A 1 6   ? 55.344 13.710  20.250  1.00 84.75  ? 6   DG  C "C3'" 1 
ATOM   107  O "O3'" . DG  A 1 6   ? 56.491 14.510  20.029  1.00 81.82  ? 6   DG  C "O3'" 1 
ATOM   108  C "C2'" . DG  A 1 6   ? 54.474 13.739  19.012  1.00 85.06  ? 6   DG  C "C2'" 1 
ATOM   109  C "C1'" . DG  A 1 6   ? 55.147 12.694  18.147  1.00 85.36  ? 6   DG  C "C1'" 1 
ATOM   110  N N9    . DG  A 1 6   ? 54.243 12.120  17.157  1.00 84.52  ? 6   DG  C N9    1 
ATOM   111  C C8    . DG  A 1 6   ? 53.129 11.356  17.399  1.00 84.33  ? 6   DG  C C8    1 
ATOM   112  N N7    . DG  A 1 6   ? 52.484 11.032  16.313  1.00 84.29  ? 6   DG  C N7    1 
ATOM   113  C C5    . DG  A 1 6   ? 53.223 11.608  15.290  1.00 84.16  ? 6   DG  C C5    1 
ATOM   114  C C6    . DG  A 1 6   ? 53.009 11.601  13.889  1.00 83.83  ? 6   DG  C C6    1 
ATOM   115  O O6    . DG  A 1 6   ? 52.095 11.070  13.253  1.00 83.39  ? 6   DG  C O6    1 
ATOM   116  N N1    . DG  A 1 6   ? 54.001 12.306  13.218  1.00 84.18  ? 6   DG  C N1    1 
ATOM   117  C C2    . DG  A 1 6   ? 55.064 12.939  13.814  1.00 84.36  ? 6   DG  C C2    1 
ATOM   118  N N2    . DG  A 1 6   ? 55.917 13.564  12.985  1.00 84.44  ? 6   DG  C N2    1 
ATOM   119  N N3    . DG  A 1 6   ? 55.273 12.955  15.122  1.00 84.22  ? 6   DG  C N3    1 
ATOM   120  C C4    . DG  A 1 6   ? 54.319 12.274  15.793  1.00 84.23  ? 6   DG  C C4    1 
ATOM   121  P P     . DG  A 1 7   ? 56.606 15.925  20.751  1.00 79.90  ? 7   DG  C P     1 
ATOM   122  O OP1   . DG  A 1 7   ? 57.667 15.815  21.780  1.00 80.26  ? 7   DG  C OP1   1 
ATOM   123  O OP2   . DG  A 1 7   ? 55.233 16.329  21.142  1.00 79.69  ? 7   DG  C OP2   1 
ATOM   124  O "O5'" . DG  A 1 7   ? 57.122 16.884  19.593  1.00 77.89  ? 7   DG  C "O5'" 1 
ATOM   125  C "C5'" . DG  A 1 7   ? 58.299 16.561  18.851  1.00 73.91  ? 7   DG  C "C5'" 1 
ATOM   126  C "C4'" . DG  A 1 7   ? 58.250 17.223  17.495  1.00 70.59  ? 7   DG  C "C4'" 1 
ATOM   127  O "O4'" . DG  A 1 7   ? 57.289 16.551  16.640  1.00 70.06  ? 7   DG  C "O4'" 1 
ATOM   128  C "C3'" . DG  A 1 7   ? 57.806 18.683  17.563  1.00 68.64  ? 7   DG  C "C3'" 1 
ATOM   129  O "O3'" . DG  A 1 7   ? 58.571 19.470  16.653  1.00 65.07  ? 7   DG  C "O3'" 1 
ATOM   130  C "C2'" . DG  A 1 7   ? 56.344 18.631  17.155  1.00 68.55  ? 7   DG  C "C2'" 1 
ATOM   131  C "C1'" . DG  A 1 7   ? 56.340 17.488  16.155  1.00 69.13  ? 7   DG  C "C1'" 1 
ATOM   132  N N9    . DG  A 1 7   ? 55.059 16.804  15.998  1.00 68.55  ? 7   DG  C N9    1 
ATOM   133  C C8    . DG  A 1 7   ? 54.192 16.422  16.992  1.00 68.24  ? 7   DG  C C8    1 
ATOM   134  N N7    . DG  A 1 7   ? 53.111 15.846  16.535  1.00 67.89  ? 7   DG  C N7    1 
ATOM   135  C C5    . DG  A 1 7   ? 53.276 15.841  15.156  1.00 67.60  ? 7   DG  C C5    1 
ATOM   136  C C6    . DG  A 1 7   ? 52.426 15.348  14.123  1.00 67.03  ? 7   DG  C C6    1 
ATOM   137  O O6    . DG  A 1 7   ? 51.323 14.792  14.224  1.00 66.73  ? 7   DG  C O6    1 
ATOM   138  N N1    . DG  A 1 7   ? 52.980 15.556  12.866  1.00 66.81  ? 7   DG  C N1    1 
ATOM   139  C C2    . DG  A 1 7   ? 54.191 16.154  12.626  1.00 67.73  ? 7   DG  C C2    1 
ATOM   140  N N2    . DG  A 1 7   ? 54.549 16.269  11.342  1.00 68.01  ? 7   DG  C N2    1 
ATOM   141  N N3    . DG  A 1 7   ? 54.993 16.610  13.575  1.00 68.12  ? 7   DG  C N3    1 
ATOM   142  C C4    . DG  A 1 7   ? 54.475 16.424  14.807  1.00 68.10  ? 7   DG  C C4    1 
ATOM   143  P P     . DA  A 1 8   ? 58.570 21.063  16.798  1.00 62.37  ? 8   DA  C P     1 
ATOM   144  O OP1   . DA  A 1 8   ? 59.963 21.539  16.971  1.00 62.40  ? 8   DA  C OP1   1 
ATOM   145  O OP2   . DA  A 1 8   ? 57.528 21.399  17.802  1.00 62.10  ? 8   DA  C OP2   1 
ATOM   146  O "O5'" . DA  A 1 8   ? 58.033 21.548  15.392  1.00 60.92  ? 8   DA  C "O5'" 1 
ATOM   147  C "C5'" . DA  A 1 8   ? 56.969 20.845  14.788  1.00 58.06  ? 8   DA  C "C5'" 1 
ATOM   148  C "C4'" . DA  A 1 8   ? 57.001 21.020  13.294  1.00 54.92  ? 8   DA  C "C4'" 1 
ATOM   149  O "O4'" . DA  A 1 8   ? 56.095 20.046  12.745  1.00 54.84  ? 8   DA  C "O4'" 1 
ATOM   150  C "C3'" . DA  A 1 8   ? 56.483 22.376  12.842  1.00 54.13  ? 8   DA  C "C3'" 1 
ATOM   151  O "O3'" . DA  A 1 8   ? 57.117 22.767  11.621  1.00 52.25  ? 8   DA  C "O3'" 1 
ATOM   152  C "C2'" . DA  A 1 8   ? 54.992 22.139  12.683  1.00 54.00  ? 8   DA  C "C2'" 1 
ATOM   153  C "C1'" . DA  A 1 8   ? 54.888 20.657  12.331  1.00 53.75  ? 8   DA  C "C1'" 1 
ATOM   154  N N9    . DA  A 1 8   ? 53.800 19.966  13.020  1.00 52.76  ? 8   DA  C N9    1 
ATOM   155  C C8    . DA  A 1 8   ? 53.615 19.846  14.373  1.00 51.73  ? 8   DA  C C8    1 
ATOM   156  N N7    . DA  A 1 8   ? 52.531 19.193  14.702  1.00 51.27  ? 8   DA  C N7    1 
ATOM   157  C C5    . DA  A 1 8   ? 51.964 18.851  13.484  1.00 51.63  ? 8   DA  C C5    1 
ATOM   158  C C6    . DA  A 1 8   ? 50.791 18.151  13.147  1.00 51.51  ? 8   DA  C C6    1 
ATOM   159  N N6    . DA  A 1 8   ? 49.937 17.649  14.042  1.00 50.56  ? 8   DA  C N6    1 
ATOM   160  N N1    . DA  A 1 8   ? 50.518 17.983  11.837  1.00 51.93  ? 8   DA  C N1    1 
ATOM   161  C C2    . DA  A 1 8   ? 51.374 18.488  10.935  1.00 52.51  ? 8   DA  C C2    1 
ATOM   162  N N3    . DA  A 1 8   ? 52.504 19.164  11.127  1.00 51.97  ? 8   DA  C N3    1 
ATOM   163  C C4    . DA  A 1 8   ? 52.743 19.314  12.438  1.00 52.05  ? 8   DA  C C4    1 
ATOM   164  P P     . DA  A 1 9   ? 56.724 24.159  10.935  1.00 49.47  ? 9   DA  C P     1 
ATOM   165  O OP1   . DA  A 1 9   ? 57.813 24.526  9.993   1.00 48.93  ? 9   DA  C OP1   1 
ATOM   166  O OP2   . DA  A 1 9   ? 56.323 25.100  12.000  1.00 49.79  ? 9   DA  C OP2   1 
ATOM   167  O "O5'" . DA  A 1 9   ? 55.394 23.802  10.140  1.00 49.46  ? 9   DA  C "O5'" 1 
ATOM   168  C "C5'" . DA  A 1 9   ? 55.365 22.726  9.202   1.00 48.41  ? 9   DA  C "C5'" 1 
ATOM   169  C "C4'" . DA  A 1 9   ? 53.978 22.582  8.618   1.00 47.24  ? 9   DA  C "C4'" 1 
ATOM   170  O "O4'" . DA  A 1 9   ? 53.101 21.847  9.510   1.00 47.83  ? 9   DA  C "O4'" 1 
ATOM   171  C "C3'" . DA  A 1 9   ? 53.282 23.914  8.346   1.00 46.44  ? 9   DA  C "C3'" 1 
ATOM   172  O "O3'" . DA  A 1 9   ? 52.569 23.835  7.114   1.00 44.91  ? 9   DA  C "O3'" 1 
ATOM   173  C "C2'" . DA  A 1 9   ? 52.293 24.019  9.492   1.00 46.89  ? 9   DA  C "C2'" 1 
ATOM   174  C "C1'" . DA  A 1 9   ? 51.893 22.572  9.659   1.00 48.03  ? 9   DA  C "C1'" 1 
ATOM   175  N N9    . DA  A 1 9   ? 51.300 22.236  10.951  1.00 49.22  ? 9   DA  C N9    1 
ATOM   176  C C8    . DA  A 1 9   ? 51.735 22.603  12.193  1.00 50.04  ? 9   DA  C C8    1 
ATOM   177  N N7    . DA  A 1 9   ? 50.978 22.168  13.169  1.00 50.82  ? 9   DA  C N7    1 
ATOM   178  C C5    . DA  A 1 9   ? 49.975 21.459  12.525  1.00 50.48  ? 9   DA  C C5    1 
ATOM   179  C C6    . DA  A 1 9   ? 48.853 20.746  13.007  1.00 50.63  ? 9   DA  C C6    1 
ATOM   180  N N6    . DA  A 1 9   ? 48.538 20.622  14.305  1.00 49.89  ? 9   DA  C N6    1 
ATOM   181  N N1    . DA  A 1 9   ? 48.056 20.152  12.098  1.00 51.22  ? 9   DA  C N1    1 
ATOM   182  C C2    . DA  A 1 9   ? 48.367 20.269  10.799  1.00 51.24  ? 9   DA  C C2    1 
ATOM   183  N N3    . DA  A 1 9   ? 49.388 20.908  10.227  1.00 50.97  ? 9   DA  C N3    1 
ATOM   184  C C4    . DA  A 1 9   ? 50.164 21.488  11.157  1.00 49.98  ? 9   DA  C C4    1 
ATOM   185  P P     . DA  A 1 10  ? 52.255 25.169  6.291   1.00 43.11  ? 10  DA  C P     1 
ATOM   186  O OP1   . DA  A 1 10  ? 53.302 25.295  5.262   1.00 42.92  ? 10  DA  C OP1   1 
ATOM   187  O OP2   . DA  A 1 10  ? 51.982 26.291  7.222   1.00 41.94  ? 10  DA  C OP2   1 
ATOM   188  O "O5'" . DA  A 1 10  ? 50.876 24.843  5.578   1.00 44.20  ? 10  DA  C "O5'" 1 
ATOM   189  C "C5'" . DA  A 1 10  ? 50.647 23.583  4.977   1.00 43.74  ? 10  DA  C "C5'" 1 
ATOM   190  C "C4'" . DA  A 1 10  ? 49.185 23.230  5.086   1.00 44.32  ? 10  DA  C "C4'" 1 
ATOM   191  O "O4'" . DA  A 1 10  ? 48.853 22.811  6.433   1.00 44.56  ? 10  DA  C "O4'" 1 
ATOM   192  C "C3'" . DA  A 1 10  ? 48.235 24.374  4.747   1.00 44.21  ? 10  DA  C "C3'" 1 
ATOM   193  O "O3'" . DA  A 1 10  ? 47.176 23.830  3.967   1.00 45.87  ? 10  DA  C "O3'" 1 
ATOM   194  C "C2'" . DA  A 1 10  ? 47.728 24.833  6.106   1.00 44.20  ? 10  DA  C "C2'" 1 
ATOM   195  C "C1'" . DA  A 1 10  ? 47.737 23.548  6.914   1.00 45.05  ? 10  DA  C "C1'" 1 
ATOM   196  N N9    . DA  A 1 10  ? 47.905 23.704  8.360   1.00 45.57  ? 10  DA  C N9    1 
ATOM   197  C C8    . DA  A 1 10  ? 49.045 24.110  8.999   1.00 45.81  ? 10  DA  C C8    1 
ATOM   198  N N7    . DA  A 1 10  ? 48.952 24.116  10.303  1.00 45.77  ? 10  DA  C N7    1 
ATOM   199  C C5    . DA  A 1 10  ? 47.654 23.698  10.548  1.00 46.25  ? 10  DA  C C5    1 
ATOM   200  C C6    . DA  A 1 10  ? 46.941 23.489  11.746  1.00 46.61  ? 10  DA  C C6    1 
ATOM   201  N N6    . DA  A 1 10  ? 47.466 23.680  12.963  1.00 47.42  ? 10  DA  C N6    1 
ATOM   202  N N1    . DA  A 1 10  ? 45.660 23.064  11.651  1.00 46.40  ? 10  DA  C N1    1 
ATOM   203  C C2    . DA  A 1 10  ? 45.146 22.859  10.427  1.00 45.99  ? 10  DA  C C2    1 
ATOM   204  N N3    . DA  A 1 10  ? 45.719 23.019  9.226   1.00 46.04  ? 10  DA  C N3    1 
ATOM   205  C C4    . DA  A 1 10  ? 46.989 23.447  9.359   1.00 45.97  ? 10  DA  C C4    1 
ATOM   206  P P     . DG  A 1 11  ? 46.230 24.793  3.110   1.00 45.59  ? 11  DG  C P     1 
ATOM   207  O OP1   . DG  A 1 11  ? 46.025 24.101  1.818   1.00 45.33  ? 11  DG  C OP1   1 
ATOM   208  O OP2   . DG  A 1 11  ? 46.740 26.184  3.129   1.00 45.27  ? 11  DG  C OP2   1 
ATOM   209  O "O5'" . DG  A 1 11  ? 44.876 24.752  3.934   1.00 46.05  ? 11  DG  C "O5'" 1 
ATOM   210  C "C5'" . DG  A 1 11  ? 44.333 23.506  4.334   1.00 46.47  ? 11  DG  C "C5'" 1 
ATOM   211  C "C4'" . DG  A 1 11  ? 43.304 23.708  5.416   1.00 47.48  ? 11  DG  C "C4'" 1 
ATOM   212  O "O4'" . DG  A 1 11  ? 43.951 23.973  6.685   1.00 47.74  ? 11  DG  C "O4'" 1 
ATOM   213  C "C3'" . DG  A 1 11  ? 42.310 24.856  5.196   1.00 48.29  ? 11  DG  C "C3'" 1 
ATOM   214  O "O3'" . DG  A 1 11  ? 40.988 24.377  5.500   1.00 49.02  ? 11  DG  C "O3'" 1 
ATOM   215  C "C2'" . DG  A 1 11  ? 42.754 25.891  6.217   1.00 47.84  ? 11  DG  C "C2'" 1 
ATOM   216  C "C1'" . DG  A 1 11  ? 43.204 24.979  7.331   1.00 48.19  ? 11  DG  C "C1'" 1 
ATOM   217  N N9    . DG  A 1 11  ? 43.999 25.556  8.413   1.00 49.02  ? 11  DG  C N9    1 
ATOM   218  C C8    . DG  A 1 11  ? 45.213 26.194  8.335   1.00 49.29  ? 11  DG  C C8    1 
ATOM   219  N N7    . DG  A 1 11  ? 45.650 26.602  9.495   1.00 49.07  ? 11  DG  C N7    1 
ATOM   220  C C5    . DG  A 1 11  ? 44.668 26.204  10.392  1.00 49.76  ? 11  DG  C C5    1 
ATOM   221  C C6    . DG  A 1 11  ? 44.586 26.358  11.801  1.00 50.10  ? 11  DG  C C6    1 
ATOM   222  O O6    . DG  A 1 11  ? 45.394 26.898  12.573  1.00 51.55  ? 11  DG  C O6    1 
ATOM   223  N N1    . DG  A 1 11  ? 43.420 25.801  12.308  1.00 49.76  ? 11  DG  C N1    1 
ATOM   224  C C2    . DG  A 1 11  ? 42.459 25.174  11.568  1.00 49.63  ? 11  DG  C C2    1 
ATOM   225  N N2    . DG  A 1 11  ? 41.405 24.699  12.243  1.00 49.12  ? 11  DG  C N2    1 
ATOM   226  N N3    . DG  A 1 11  ? 42.523 25.020  10.261  1.00 49.76  ? 11  DG  C N3    1 
ATOM   227  C C4    . DG  A 1 11  ? 43.646 25.558  9.741   1.00 49.30  ? 11  DG  C C4    1 
ATOM   228  P P     . DT  A 1 12  ? 39.742 25.398  5.580   1.00 49.53  ? 12  DT  C P     1 
ATOM   229  O OP1   . DT  A 1 12  ? 38.619 24.720  4.883   1.00 51.07  ? 12  DT  C OP1   1 
ATOM   230  O OP2   . DT  A 1 12  ? 40.139 26.766  5.165   1.00 48.82  ? 12  DT  C OP2   1 
ATOM   231  O "O5'" . DT  A 1 12  ? 39.399 25.431  7.134   1.00 49.99  ? 12  DT  C "O5'" 1 
ATOM   232  C "C5'" . DT  A 1 12  ? 39.264 24.213  7.859   1.00 52.40  ? 12  DT  C "C5'" 1 
ATOM   233  C "C4'" . DT  A 1 12  ? 38.560 24.451  9.173   1.00 53.90  ? 12  DT  C "C4'" 1 
ATOM   234  O "O4'" . DT  A 1 12  ? 39.471 25.035  10.135  1.00 54.40  ? 12  DT  C "O4'" 1 
ATOM   235  C "C3'" . DT  A 1 12  ? 37.356 25.388  9.092   1.00 55.08  ? 12  DT  C "C3'" 1 
ATOM   236  O "O3'" . DT  A 1 12  ? 36.283 24.848  9.875   1.00 56.39  ? 12  DT  C "O3'" 1 
ATOM   237  C "C2'" . DT  A 1 12  ? 37.888 26.694  9.665   1.00 55.11  ? 12  DT  C "C2'" 1 
ATOM   238  C "C1'" . DT  A 1 12  ? 38.912 26.222  10.683  1.00 55.33  ? 12  DT  C "C1'" 1 
ATOM   239  N N1    . DT  A 1 12  ? 40.020 27.171  10.942  1.00 56.67  ? 12  DT  C N1    1 
ATOM   240  C C2    . DT  A 1 12  ? 40.232 27.621  12.237  1.00 57.37  ? 12  DT  C C2    1 
ATOM   241  O O2    . DT  A 1 12  ? 39.547 27.283  13.190  1.00 57.15  ? 12  DT  C O2    1 
ATOM   242  N N3    . DT  A 1 12  ? 41.290 28.490  12.373  1.00 57.49  ? 12  DT  C N3    1 
ATOM   243  C C4    . DT  A 1 12  ? 42.136 28.943  11.376  1.00 57.33  ? 12  DT  C C4    1 
ATOM   244  O O4    . DT  A 1 12  ? 43.046 29.725  11.651  1.00 56.95  ? 12  DT  C O4    1 
ATOM   245  C C5    . DT  A 1 12  ? 41.854 28.433  10.049  1.00 57.09  ? 12  DT  C C5    1 
ATOM   246  C C7    . DT  A 1 12  ? 42.713 28.867  8.903   1.00 56.58  ? 12  DT  C C7    1 
ATOM   247  C C6    . DT  A 1 12  ? 40.826 27.588  9.903   1.00 56.94  ? 12  DT  C C6    1 
ATOM   248  P P     . DA  A 1 13  ? 34.927 25.689  10.082  1.00 57.46  ? 13  DA  C P     1 
ATOM   249  O OP1   . DA  A 1 13  ? 33.793 24.775  9.795   1.00 57.23  ? 13  DA  C OP1   1 
ATOM   250  O OP2   . DA  A 1 13  ? 35.026 26.992  9.375   1.00 56.97  ? 13  DA  C OP2   1 
ATOM   251  O "O5'" . DA  A 1 13  ? 34.947 26.011  11.641  1.00 59.99  ? 13  DA  C "O5'" 1 
ATOM   252  C "C5'" . DA  A 1 13  ? 36.128 26.520  12.243  1.00 63.67  ? 13  DA  C "C5'" 1 
ATOM   253  C "C4'" . DA  A 1 13  ? 35.845 27.019  13.636  1.00 66.38  ? 13  DA  C "C4'" 1 
ATOM   254  O "O4'" . DA  A 1 13  ? 37.024 27.737  14.070  1.00 67.62  ? 13  DA  C "O4'" 1 
ATOM   255  C "C3'" . DA  A 1 13  ? 34.699 28.024  13.716  1.00 68.13  ? 13  DA  C "C3'" 1 
ATOM   256  O "O3'" . DA  A 1 13  ? 34.067 27.932  14.994  1.00 70.45  ? 13  DA  C "O3'" 1 
ATOM   257  C "C2'" . DA  A 1 13  ? 35.400 29.362  13.573  1.00 68.45  ? 13  DA  C "C2'" 1 
ATOM   258  C "C1'" . DA  A 1 13  ? 36.732 29.117  14.256  1.00 68.59  ? 13  DA  C "C1'" 1 
ATOM   259  N N9    . DA  A 1 13  ? 37.839 29.887  13.691  1.00 68.92  ? 13  DA  C N9    1 
ATOM   260  C C8    . DA  A 1 13  ? 38.112 30.102  12.366  1.00 69.22  ? 13  DA  C C8    1 
ATOM   261  N N7    . DA  A 1 13  ? 39.180 30.828  12.157  1.00 69.75  ? 13  DA  C N7    1 
ATOM   262  C C5    . DA  A 1 13  ? 39.646 31.114  13.433  1.00 69.50  ? 13  DA  C C5    1 
ATOM   263  C C6    . DA  A 1 13  ? 40.751 31.858  13.898  1.00 69.38  ? 13  DA  C C6    1 
ATOM   264  N N6    . DA  A 1 13  ? 41.634 32.472  13.101  1.00 69.41  ? 13  DA  C N6    1 
ATOM   265  N N1    . DA  A 1 13  ? 40.923 31.950  15.231  1.00 69.69  ? 13  DA  C N1    1 
ATOM   266  C C2    . DA  A 1 13  ? 40.042 31.340  16.036  1.00 69.44  ? 13  DA  C C2    1 
ATOM   267  N N3    . DA  A 1 13  ? 38.969 30.618  15.721  1.00 69.34  ? 13  DA  C N3    1 
ATOM   268  C C4    . DA  A 1 13  ? 38.827 30.541  14.388  1.00 69.39  ? 13  DA  C C4    1 
ATOM   269  P P     . DC  A 1 14  ? 32.475 28.109  15.116  1.00 72.42  ? 14  DC  C P     1 
ATOM   270  O OP1   . DC  A 1 14  ? 31.875 26.758  15.260  1.00 72.42  ? 14  DC  C OP1   1 
ATOM   271  O OP2   . DC  A 1 14  ? 31.998 29.021  14.043  1.00 71.82  ? 14  DC  C OP2   1 
ATOM   272  O "O5'" . DC  A 1 14  ? 32.296 28.878  16.489  1.00 72.77  ? 14  DC  C "O5'" 1 
ATOM   273  C "C5'" . DC  A 1 14  ? 32.311 30.289  16.521  1.00 74.97  ? 14  DC  C "C5'" 1 
ATOM   274  C "C4'" . DC  A 1 14  ? 33.289 30.768  17.564  1.00 76.91  ? 14  DC  C "C4'" 1 
ATOM   275  O "O4'" . DC  A 1 14  ? 34.622 30.889  16.997  1.00 77.64  ? 14  DC  C "O4'" 1 
ATOM   276  C "C3'" . DC  A 1 14  ? 32.932 32.154  18.088  1.00 77.88  ? 14  DC  C "C3'" 1 
ATOM   277  O "O3'" . DC  A 1 14  ? 33.198 32.212  19.478  1.00 79.28  ? 14  DC  C "O3'" 1 
ATOM   278  C "C2'" . DC  A 1 14  ? 33.886 33.070  17.354  1.00 77.94  ? 14  DC  C "C2'" 1 
ATOM   279  C "C1'" . DC  A 1 14  ? 35.113 32.198  17.265  1.00 77.84  ? 14  DC  C "C1'" 1 
ATOM   280  N N1    . DC  A 1 14  ? 36.042 32.602  16.197  1.00 77.71  ? 14  DC  C N1    1 
ATOM   281  C C2    . DC  A 1 14  ? 37.219 33.239  16.565  1.00 77.54  ? 14  DC  C C2    1 
ATOM   282  O O2    . DC  A 1 14  ? 37.452 33.407  17.768  1.00 77.95  ? 14  DC  C O2    1 
ATOM   283  N N3    . DC  A 1 14  ? 38.073 33.660  15.612  1.00 77.54  ? 14  DC  C N3    1 
ATOM   284  C C4    . DC  A 1 14  ? 37.786 33.462  14.329  1.00 77.13  ? 14  DC  C C4    1 
ATOM   285  N N4    . DC  A 1 14  ? 38.662 33.901  13.426  1.00 77.07  ? 14  DC  C N4    1 
ATOM   286  C C5    . DC  A 1 14  ? 36.593 32.802  13.918  1.00 77.28  ? 14  DC  C C5    1 
ATOM   287  C C6    . DC  A 1 14  ? 35.757 32.388  14.878  1.00 77.36  ? 14  DC  C C6    1 
ATOM   288  P P     . DA  A 1 15  ? 32.062 32.734  20.465  1.00 80.64  ? 15  DA  C P     1 
ATOM   289  O OP1   . DA  A 1 15  ? 31.578 31.556  21.225  1.00 81.02  ? 15  DA  C OP1   1 
ATOM   290  O OP2   . DA  A 1 15  ? 31.100 33.561  19.688  1.00 80.72  ? 15  DA  C OP2   1 
ATOM   291  O "O5'" . DA  A 1 15  ? 32.852 33.692  21.453  1.00 82.11  ? 15  DA  C "O5'" 1 
ATOM   292  C "C5'" . DA  A 1 15  ? 34.047 33.263  22.101  1.00 84.30  ? 15  DA  C "C5'" 1 
ATOM   293  C "C4'" . DA  A 1 15  ? 34.926 34.461  22.357  1.00 85.80  ? 15  DA  C "C4'" 1 
ATOM   294  O "O4'" . DA  A 1 15  ? 35.730 34.759  21.191  1.00 86.39  ? 15  DA  C "O4'" 1 
ATOM   295  C "C3'" . DA  A 1 15  ? 34.098 35.715  22.624  1.00 86.74  ? 15  DA  C "C3'" 1 
ATOM   296  O "O3'" . DA  A 1 15  ? 34.794 36.561  23.529  1.00 88.18  ? 15  DA  C "O3'" 1 
ATOM   297  C "C2'" . DA  A 1 15  ? 34.062 36.381  21.262  1.00 86.85  ? 15  DA  C "C2'" 1 
ATOM   298  C "C1'" . DA  A 1 15  ? 35.466 36.090  20.775  1.00 87.03  ? 15  DA  C "C1'" 1 
ATOM   299  N N9    . DA  A 1 15  ? 35.662 36.158  19.329  1.00 87.62  ? 15  DA  C N9    1 
ATOM   300  C C8    . DA  A 1 15  ? 34.764 35.857  18.338  1.00 88.12  ? 15  DA  C C8    1 
ATOM   301  N N7    . DA  A 1 15  ? 35.253 35.976  17.127  1.00 88.11  ? 15  DA  C N7    1 
ATOM   302  C C5    . DA  A 1 15  ? 36.559 36.396  17.335  1.00 87.88  ? 15  DA  C C5    1 
ATOM   303  C C6    . DA  A 1 15  ? 37.607 36.698  16.449  1.00 87.70  ? 15  DA  C C6    1 
ATOM   304  N N6    . DA  A 1 15  ? 37.504 36.615  15.120  1.00 87.63  ? 15  DA  C N6    1 
ATOM   305  N N1    . DA  A 1 15  ? 38.784 37.092  16.981  1.00 87.99  ? 15  DA  C N1    1 
ATOM   306  C C2    . DA  A 1 15  ? 38.888 37.170  18.316  1.00 88.06  ? 15  DA  C C2    1 
ATOM   307  N N3    . DA  A 1 15  ? 37.977 36.910  19.250  1.00 87.74  ? 15  DA  C N3    1 
ATOM   308  C C4    . DA  A 1 15  ? 36.821 36.522  18.687  1.00 87.83  ? 15  DA  C C4    1 
ATOM   309  P P     . DG  A 1 16  ? 34.690 36.294  25.103  1.00 89.09  ? 16  DG  C P     1 
ATOM   310  O OP1   . DG  A 1 16  ? 35.290 34.965  25.377  1.00 89.14  ? 16  DG  C OP1   1 
ATOM   311  O OP2   . DG  A 1 16  ? 33.302 36.579  25.541  1.00 89.04  ? 16  DG  C OP2   1 
ATOM   312  O "O5'" . DG  A 1 16  ? 35.636 37.416  25.709  1.00 89.84  ? 16  DG  C "O5'" 1 
ATOM   313  C "C5'" . DG  A 1 16  ? 37.025 37.435  25.402  1.00 91.19  ? 16  DG  C "C5'" 1 
ATOM   314  C "C4'" . DG  A 1 16  ? 37.406 38.765  24.794  1.00 92.07  ? 16  DG  C "C4'" 1 
ATOM   315  O "O4'" . DG  A 1 16  ? 37.295 38.768  23.352  1.00 92.43  ? 16  DG  C "O4'" 1 
ATOM   316  C "C3'" . DG  A 1 16  ? 36.582 39.957  25.278  1.00 92.74  ? 16  DG  C "C3'" 1 
ATOM   317  O "O3'" . DG  A 1 16  ? 37.459 41.061  25.457  1.00 93.62  ? 16  DG  C "O3'" 1 
ATOM   318  C "C2'" . DG  A 1 16  ? 35.683 40.257  24.091  1.00 92.79  ? 16  DG  C "C2'" 1 
ATOM   319  C "C1'" . DG  A 1 16  ? 36.653 39.972  22.971  1.00 92.83  ? 16  DG  C "C1'" 1 
ATOM   320  N N9    . DG  A 1 16  ? 36.107 39.800  21.630  1.00 93.28  ? 16  DG  C N9    1 
ATOM   321  C C8    . DG  A 1 16  ? 34.890 39.281  21.271  1.00 93.41  ? 16  DG  C C8    1 
ATOM   322  N N7    . DG  A 1 16  ? 34.718 39.227  19.977  1.00 93.50  ? 16  DG  C N7    1 
ATOM   323  C C5    . DG  A 1 16  ? 35.890 39.755  19.453  1.00 93.54  ? 16  DG  C C5    1 
ATOM   324  C C6    . DG  A 1 16  ? 36.294 39.956  18.105  1.00 93.58  ? 16  DG  C C6    1 
ATOM   325  O O6    . DG  A 1 16  ? 35.677 39.696  17.061  1.00 93.41  ? 16  DG  C O6    1 
ATOM   326  N N1    . DG  A 1 16  ? 37.560 40.525  18.033  1.00 93.44  ? 16  DG  C N1    1 
ATOM   327  C C2    . DG  A 1 16  ? 38.341 40.861  19.111  1.00 93.48  ? 16  DG  C C2    1 
ATOM   328  N N2    . DG  A 1 16  ? 39.537 41.413  18.839  1.00 93.78  ? 16  DG  C N2    1 
ATOM   329  N N3    . DG  A 1 16  ? 37.978 40.675  20.366  1.00 93.63  ? 16  DG  C N3    1 
ATOM   330  C C4    . DG  A 1 16  ? 36.752 40.123  20.462  1.00 93.51  ? 16  DG  C C4    1 
ATOM   331  P P     . DA  A 1 17  ? 37.494 41.824  26.860  1.00 94.33  ? 17  DA  C P     1 
ATOM   332  O OP1   . DA  A 1 17  ? 38.311 41.026  27.810  1.00 93.97  ? 17  DA  C OP1   1 
ATOM   333  O OP2   . DA  A 1 17  ? 36.093 42.180  27.206  1.00 94.24  ? 17  DA  C OP2   1 
ATOM   334  O "O5'" . DA  A 1 17  ? 38.278 43.162  26.522  1.00 94.94  ? 17  DA  C "O5'" 1 
ATOM   335  C "C5'" . DA  A 1 17  ? 37.597 44.294  25.994  1.00 95.90  ? 17  DA  C "C5'" 1 
ATOM   336  C "C4'" . DA  A 1 17  ? 38.395 44.889  24.860  1.00 96.60  ? 17  DA  C "C4'" 1 
ATOM   337  O "O4'" . DA  A 1 17  ? 38.161 44.111  23.655  1.00 97.00  ? 17  DA  C "O4'" 1 
ATOM   338  C "C3'" . DA  A 1 17  ? 38.007 46.327  24.509  1.00 97.08  ? 17  DA  C "C3'" 1 
ATOM   339  O "O3'" . DA  A 1 17  ? 39.172 46.998  24.015  1.00 97.02  ? 17  DA  C "O3'" 1 
ATOM   340  C "C2'" . DA  A 1 17  ? 37.078 46.146  23.325  1.00 97.63  ? 17  DA  C "C2'" 1 
ATOM   341  C "C1'" . DA  A 1 17  ? 37.766 44.999  22.624  1.00 98.14  ? 17  DA  C "C1'" 1 
ATOM   342  N N9    . DA  A 1 17  ? 36.967 44.275  21.633  1.00 99.19  ? 17  DA  C N9    1 
ATOM   343  C C8    . DA  A 1 17  ? 35.808 43.544  21.761  1.00 99.32  ? 17  DA  C C8    1 
ATOM   344  N N7    . DA  A 1 17  ? 35.370 43.048  20.625  1.00 99.33  ? 17  DA  C N7    1 
ATOM   345  C C5    . DA  A 1 17  ? 36.307 43.479  19.691  1.00 99.97  ? 17  DA  C C5    1 
ATOM   346  C C6    . DA  A 1 17  ? 36.426 43.289  18.300  1.00 100.39 ? 17  DA  C C6    1 
ATOM   347  N N6    . DA  A 1 17  ? 35.571 42.580  17.581  1.00 100.21 ? 17  DA  C N6    1 
ATOM   348  N N1    . DA  A 1 17  ? 37.480 43.861  17.666  1.00 100.93 ? 17  DA  C N1    1 
ATOM   349  C C2    . DA  A 1 17  ? 38.353 44.568  18.395  1.00 100.76 ? 17  DA  C C2    1 
ATOM   350  N N3    . DA  A 1 17  ? 38.353 44.813  19.705  1.00 100.51 ? 17  DA  C N3    1 
ATOM   351  C C4    . DA  A 1 17  ? 37.292 44.234  20.299  1.00 99.89  ? 17  DA  C C4    1 
ATOM   352  O "O5'" . DT  B 2 1   ? 34.554 50.206  10.960  1.00 100.18 ? 1   DT  D "O5'" 1 
ATOM   353  C "C5'" . DT  B 2 1   ? 35.377 49.075  10.684  1.00 100.27 ? 1   DT  D "C5'" 1 
ATOM   354  C "C4'" . DT  B 2 1   ? 36.624 49.084  11.533  1.00 100.36 ? 1   DT  D "C4'" 1 
ATOM   355  O "O4'" . DT  B 2 1   ? 36.255 49.173  12.928  1.00 101.28 ? 1   DT  D "O4'" 1 
ATOM   356  C "C3'" . DT  B 2 1   ? 37.513 47.847  11.419  1.00 99.76  ? 1   DT  D "C3'" 1 
ATOM   357  O "O3'" . DT  B 2 1   ? 38.478 48.067  10.393  1.00 97.56  ? 1   DT  D "O3'" 1 
ATOM   358  C "C2'" . DT  B 2 1   ? 38.224 47.800  12.770  1.00 101.03 ? 1   DT  D "C2'" 1 
ATOM   359  C "C1'" . DT  B 2 1   ? 37.221 48.494  13.697  1.00 102.61 ? 1   DT  D "C1'" 1 
ATOM   360  N N1    . DT  B 2 1   ? 36.544 47.696  14.745  1.00 104.61 ? 1   DT  D N1    1 
ATOM   361  C C2    . DT  B 2 1   ? 36.285 46.343  14.561  1.00 105.51 ? 1   DT  D C2    1 
ATOM   362  O O2    . DT  B 2 1   ? 36.545 45.741  13.529  1.00 105.63 ? 1   DT  D O2    1 
ATOM   363  N N3    . DT  B 2 1   ? 35.697 45.722  15.647  1.00 105.94 ? 1   DT  D N3    1 
ATOM   364  C C4    . DT  B 2 1   ? 35.342 46.311  16.852  1.00 106.27 ? 1   DT  D C4    1 
ATOM   365  O O4    . DT  B 2 1   ? 34.802 45.638  17.735  1.00 106.71 ? 1   DT  D O4    1 
ATOM   366  C C5    . DT  B 2 1   ? 35.640 47.725  16.963  1.00 106.11 ? 1   DT  D C5    1 
ATOM   367  C C7    . DT  B 2 1   ? 35.310 48.443  18.235  1.00 106.20 ? 1   DT  D C7    1 
ATOM   368  C C6    . DT  B 2 1   ? 36.207 48.334  15.918  1.00 105.36 ? 1   DT  D C6    1 
ATOM   369  P P     . DC  B 2 2   ? 38.825 46.901  9.339   1.00 95.83  ? 2   DC  D P     1 
ATOM   370  O OP1   . DC  B 2 2   ? 40.256 47.067  8.964   1.00 95.74  ? 2   DC  D OP1   1 
ATOM   371  O OP2   . DC  B 2 2   ? 37.782 46.887  8.278   1.00 96.11  ? 2   DC  D OP2   1 
ATOM   372  O "O5'" . DC  B 2 2   ? 38.696 45.551  10.166  1.00 93.47  ? 2   DC  D "O5'" 1 
ATOM   373  C "C5'" . DC  B 2 2   ? 39.836 44.733  10.371  1.00 89.80  ? 2   DC  D "C5'" 1 
ATOM   374  C "C4'" . DC  B 2 2   ? 40.444 45.044  11.711  1.00 86.84  ? 2   DC  D "C4'" 1 
ATOM   375  O "O4'" . DC  B 2 2   ? 39.462 44.797  12.741  1.00 86.53  ? 2   DC  D "O4'" 1 
ATOM   376  C "C3'" . DC  B 2 2   ? 41.663 44.222  12.085  1.00 84.21  ? 2   DC  D "C3'" 1 
ATOM   377  O "O3'" . DC  B 2 2   ? 42.797 44.942  11.620  1.00 79.89  ? 2   DC  D "O3'" 1 
ATOM   378  C "C2'" . DC  B 2 2   ? 41.594 44.199  13.608  1.00 84.98  ? 2   DC  D "C2'" 1 
ATOM   379  C "C1'" . DC  B 2 2   ? 40.083 44.202  13.858  1.00 85.75  ? 2   DC  D "C1'" 1 
ATOM   380  N N1    . DC  B 2 2   ? 39.467 42.883  14.045  1.00 85.46  ? 2   DC  D N1    1 
ATOM   381  C C2    . DC  B 2 2   ? 39.294 42.409  15.335  1.00 85.29  ? 2   DC  D C2    1 
ATOM   382  O O2    . DC  B 2 2   ? 39.721 43.086  16.284  1.00 85.21  ? 2   DC  D O2    1 
ATOM   383  N N3    . DC  B 2 2   ? 38.668 41.229  15.524  1.00 85.47  ? 2   DC  D N3    1 
ATOM   384  C C4    . DC  B 2 2   ? 38.229 40.528  14.480  1.00 85.55  ? 2   DC  D C4    1 
ATOM   385  N N4    . DC  B 2 2   ? 37.597 39.378  14.727  1.00 85.97  ? 2   DC  D N4    1 
ATOM   386  C C5    . DC  B 2 2   ? 38.417 40.976  13.143  1.00 85.43  ? 2   DC  D C5    1 
ATOM   387  C C6    . DC  B 2 2   ? 39.041 42.148  12.973  1.00 85.46  ? 2   DC  D C6    1 
ATOM   388  P P     . DT  B 2 3   ? 44.260 44.326  11.795  1.00 76.12  ? 3   DT  D P     1 
ATOM   389  O OP1   . DT  B 2 3   ? 45.246 45.321  11.303  1.00 76.49  ? 3   DT  D OP1   1 
ATOM   390  O OP2   . DT  B 2 3   ? 44.237 42.961  11.214  1.00 76.20  ? 3   DT  D OP2   1 
ATOM   391  O "O5'" . DT  B 2 3   ? 44.424 44.208  13.369  1.00 73.00  ? 3   DT  D "O5'" 1 
ATOM   392  C "C5'" . DT  B 2 3   ? 45.236 43.194  13.937  1.00 67.99  ? 3   DT  D "C5'" 1 
ATOM   393  C "C4'" . DT  B 2 3   ? 44.619 42.698  15.212  1.00 63.98  ? 3   DT  D "C4'" 1 
ATOM   394  O "O4'" . DT  B 2 3   ? 43.283 42.235  14.963  1.00 63.35  ? 3   DT  D "O4'" 1 
ATOM   395  C "C3'" . DT  B 2 3   ? 45.318 41.517  15.850  1.00 61.67  ? 3   DT  D "C3'" 1 
ATOM   396  O "O3'" . DT  B 2 3   ? 46.305 42.089  16.689  1.00 57.77  ? 3   DT  D "O3'" 1 
ATOM   397  C "C2'" . DT  B 2 3   ? 44.212 40.880  16.690  1.00 62.54  ? 3   DT  D "C2'" 1 
ATOM   398  C "C1'" . DT  B 2 3   ? 42.945 41.273  15.930  1.00 62.85  ? 3   DT  D "C1'" 1 
ATOM   399  N N1    . DT  B 2 3   ? 42.220 40.184  15.271  1.00 63.37  ? 3   DT  D N1    1 
ATOM   400  C C2    . DT  B 2 3   ? 41.510 39.314  16.064  1.00 63.81  ? 3   DT  D C2    1 
ATOM   401  O O2    . DT  B 2 3   ? 41.509 39.375  17.281  1.00 63.89  ? 3   DT  D O2    1 
ATOM   402  N N3    . DT  B 2 3   ? 40.793 38.368  15.377  1.00 63.97  ? 3   DT  D N3    1 
ATOM   403  C C4    . DT  B 2 3   ? 40.719 38.214  14.005  1.00 63.77  ? 3   DT  D C4    1 
ATOM   404  O O4    . DT  B 2 3   ? 40.011 37.332  13.529  1.00 63.71  ? 3   DT  D O4    1 
ATOM   405  C C5    . DT  B 2 3   ? 41.512 39.150  13.237  1.00 63.79  ? 3   DT  D C5    1 
ATOM   406  C C7    . DT  B 2 3   ? 41.502 39.058  11.744  1.00 64.03  ? 3   DT  D C7    1 
ATOM   407  C C6    . DT  B 2 3   ? 42.221 40.069  13.901  1.00 63.54  ? 3   DT  D C6    1 
ATOM   408  P P     . DG  B 2 4   ? 47.400 41.164  17.379  1.00 54.53  ? 4   DG  D P     1 
ATOM   409  O OP1   . DG  B 2 4   ? 48.098 42.013  18.373  1.00 53.73  ? 4   DG  D OP1   1 
ATOM   410  O OP2   . DG  B 2 4   ? 48.157 40.497  16.299  1.00 54.57  ? 4   DG  D OP2   1 
ATOM   411  O "O5'" . DG  B 2 4   ? 46.566 40.046  18.137  1.00 52.79  ? 4   DG  D "O5'" 1 
ATOM   412  C "C5'" . DG  B 2 4   ? 46.010 40.287  19.424  1.00 50.29  ? 4   DG  D "C5'" 1 
ATOM   413  C "C4'" . DG  B 2 4   ? 45.397 39.017  19.960  1.00 48.62  ? 4   DG  D "C4'" 1 
ATOM   414  O "O4'" . DG  B 2 4   ? 44.305 38.612  19.114  1.00 48.63  ? 4   DG  D "O4'" 1 
ATOM   415  C "C3'" . DG  B 2 4   ? 46.345 37.831  20.006  1.00 47.46  ? 4   DG  D "C3'" 1 
ATOM   416  O "O3'" . DG  B 2 4   ? 46.930 37.895  21.305  1.00 45.52  ? 4   DG  D "O3'" 1 
ATOM   417  C "C2'" . DG  B 2 4   ? 45.435 36.613  19.811  1.00 47.60  ? 4   DG  D "C2'" 1 
ATOM   418  C "C1'" . DG  B 2 4   ? 44.200 37.208  19.128  1.00 48.30  ? 4   DG  D "C1'" 1 
ATOM   419  N N9    . DG  B 2 4   ? 43.820 36.758  17.793  1.00 49.11  ? 4   DG  D N9    1 
ATOM   420  C C8    . DG  B 2 4   ? 44.343 37.149  16.584  1.00 48.73  ? 4   DG  D C8    1 
ATOM   421  N N7    . DG  B 2 4   ? 43.706 36.636  15.567  1.00 49.27  ? 4   DG  D N7    1 
ATOM   422  C C5    . DG  B 2 4   ? 42.723 35.840  16.138  1.00 49.87  ? 4   DG  D C5    1 
ATOM   423  C C6    . DG  B 2 4   ? 41.713 35.032  15.538  1.00 50.43  ? 4   DG  D C6    1 
ATOM   424  O O6    . DG  B 2 4   ? 41.467 34.846  14.336  1.00 50.92  ? 4   DG  D O6    1 
ATOM   425  N N1    . DG  B 2 4   ? 40.936 34.398  16.498  1.00 51.04  ? 4   DG  D N1    1 
ATOM   426  C C2    . DG  B 2 4   ? 41.096 34.516  17.847  1.00 50.24  ? 4   DG  D C2    1 
ATOM   427  N N2    . DG  B 2 4   ? 40.244 33.814  18.598  1.00 50.36  ? 4   DG  D N2    1 
ATOM   428  N N3    . DG  B 2 4   ? 42.021 35.261  18.417  1.00 50.48  ? 4   DG  D N3    1 
ATOM   429  C C4    . DG  B 2 4   ? 42.795 35.890  17.509  1.00 49.85  ? 4   DG  D C4    1 
HETATM 430  N N1    . 5IU B 2 5   ? 44.233 32.884  18.387  1.00 50.29  ? 5   5IU D N1    1 
HETATM 431  C C2    . 5IU B 2 5   ? 43.340 32.104  17.684  1.00 51.28  ? 5   5IU D C2    1 
HETATM 432  N N3    . 5IU B 2 5   ? 43.541 32.044  16.331  1.00 52.50  ? 5   5IU D N3    1 
HETATM 433  C C4    . 5IU B 2 5   ? 44.527 32.670  15.605  1.00 53.29  ? 5   5IU D C4    1 
HETATM 434  C C5    . 5IU B 2 5   ? 45.451 33.462  16.396  1.00 53.25  ? 5   5IU D C5    1 
HETATM 435  C C6    . 5IU B 2 5   ? 45.275 33.532  17.739  1.00 51.72  ? 5   5IU D C6    1 
HETATM 436  O O2    . 5IU B 2 5   ? 42.430 31.508  18.226  1.00 52.33  ? 5   5IU D O2    1 
HETATM 437  O O4    . 5IU B 2 5   ? 44.536 32.531  14.380  1.00 54.58  ? 5   5IU D O4    1 
HETATM 438  I I5    . 5IU B 2 5   ? 46.687 34.259  15.681  1.00 52.79  ? 5   5IU D I5    1 
HETATM 439  C "C1'" . 5IU B 2 5   ? 43.977 32.996  19.833  1.00 48.02  ? 5   5IU D "C1'" 1 
HETATM 440  C "C2'" . 5IU B 2 5   ? 44.140 31.713  20.652  1.00 46.55  ? 5   5IU D "C2'" 1 
HETATM 441  C "C3'" . 5IU B 2 5   ? 45.257 32.076  21.632  1.00 45.14  ? 5   5IU D "C3'" 1 
HETATM 442  C "C4'" . 5IU B 2 5   ? 45.122 33.579  21.758  1.00 44.74  ? 5   5IU D "C4'" 1 
HETATM 443  O "O3'" . 5IU B 2 5   ? 45.011 31.512  22.916  1.00 44.64  ? 5   5IU D "O3'" 1 
HETATM 444  O "O4'" . 5IU B 2 5   ? 44.782 33.997  20.418  1.00 46.69  ? 5   5IU D "O4'" 1 
HETATM 445  C "C5'" . 5IU B 2 5   ? 46.378 34.250  22.214  1.00 44.68  ? 5   5IU D "C5'" 1 
HETATM 446  O "O5'" . 5IU B 2 5   ? 46.226 35.649  22.185  1.00 43.84  ? 5   5IU D "O5'" 1 
HETATM 447  P P     . 5IU B 2 5   ? 47.499 36.575  22.007  1.00 43.00  ? 5   5IU D P     1 
HETATM 448  O OP1   . 5IU B 2 5   ? 47.954 36.970  23.351  1.00 43.97  ? 5   5IU D OP1   1 
HETATM 449  O OP2   . 5IU B 2 5   ? 48.430 35.887  21.091  1.00 44.58  ? 5   5IU D OP2   1 
ATOM   450  P P     . DA  B 2 6   ? 46.025 30.437  23.518  1.00 44.00  ? 6   DA  D P     1 
ATOM   451  O OP1   . DA  B 2 6   ? 45.579 30.107  24.885  1.00 45.19  ? 6   DA  D OP1   1 
ATOM   452  O OP2   . DA  B 2 6   ? 47.392 30.950  23.286  1.00 45.43  ? 6   DA  D OP2   1 
ATOM   453  O "O5'" . DA  B 2 6   ? 45.836 29.158  22.599  1.00 44.96  ? 6   DA  D "O5'" 1 
ATOM   454  C "C5'" . DA  B 2 6   ? 45.023 28.066  23.014  1.00 47.33  ? 6   DA  D "C5'" 1 
ATOM   455  C "C4'" . DA  B 2 6   ? 43.756 28.022  22.202  1.00 48.05  ? 6   DA  D "C4'" 1 
ATOM   456  O "O4'" . DA  B 2 6   ? 43.862 28.941  21.105  1.00 49.20  ? 6   DA  D "O4'" 1 
ATOM   457  C "C3'" . DA  B 2 6   ? 43.428 26.688  21.560  1.00 49.47  ? 6   DA  D "C3'" 1 
ATOM   458  O "O3'" . DA  B 2 6   ? 42.664 25.939  22.494  1.00 51.99  ? 6   DA  D "O3'" 1 
ATOM   459  C "C2'" . DA  B 2 6   ? 42.547 27.090  20.379  1.00 50.05  ? 6   DA  D "C2'" 1 
ATOM   460  C "C1'" . DA  B 2 6   ? 43.018 28.514  20.063  1.00 49.43  ? 6   DA  D "C1'" 1 
ATOM   461  N N9    . DA  B 2 6   ? 43.680 28.731  18.772  1.00 49.26  ? 6   DA  D N9    1 
ATOM   462  C C8    . DA  B 2 6   ? 44.989 29.033  18.516  1.00 48.63  ? 6   DA  D C8    1 
ATOM   463  N N7    . DA  B 2 6   ? 45.252 29.205  17.244  1.00 48.70  ? 6   DA  D N7    1 
ATOM   464  C C5    . DA  B 2 6   ? 44.035 28.990  16.617  1.00 49.02  ? 6   DA  D C5    1 
ATOM   465  C C6    . DA  B 2 6   ? 43.642 29.015  15.265  1.00 49.32  ? 6   DA  D C6    1 
ATOM   466  N N6    . DA  B 2 6   ? 44.465 29.280  14.254  1.00 48.90  ? 6   DA  D N6    1 
ATOM   467  N N1    . DA  B 2 6   ? 42.350 28.752  14.982  1.00 49.96  ? 6   DA  D N1    1 
ATOM   468  C C2    . DA  B 2 6   ? 41.519 28.481  15.986  1.00 49.73  ? 6   DA  D C2    1 
ATOM   469  N N3    . DA  B 2 6   ? 41.765 28.425  17.291  1.00 49.98  ? 6   DA  D N3    1 
ATOM   470  C C4    . DA  B 2 6   ? 43.059 28.693  17.544  1.00 49.43  ? 6   DA  D C4    1 
ATOM   471  P P     . DC  B 2 7   ? 42.735 24.340  22.498  1.00 53.98  ? 7   DC  D P     1 
ATOM   472  O OP1   . DC  B 2 7   ? 42.162 23.919  23.790  1.00 54.46  ? 7   DC  D OP1   1 
ATOM   473  O OP2   . DC  B 2 7   ? 44.098 23.899  22.115  1.00 54.75  ? 7   DC  D OP2   1 
ATOM   474  O "O5'" . DC  B 2 7   ? 41.763 23.891  21.317  1.00 56.75  ? 7   DC  D "O5'" 1 
ATOM   475  C "C5'" . DC  B 2 7   ? 40.398 24.311  21.275  1.00 58.71  ? 7   DC  D "C5'" 1 
ATOM   476  C "C4'" . DC  B 2 7   ? 39.900 24.350  19.844  1.00 60.15  ? 7   DC  D "C4'" 1 
ATOM   477  O "O4'" . DC  B 2 7   ? 40.705 25.299  19.104  1.00 59.77  ? 7   DC  D "O4'" 1 
ATOM   478  C "C3'" . DC  B 2 7   ? 39.994 23.067  19.018  1.00 61.32  ? 7   DC  D "C3'" 1 
ATOM   479  O "O3'" . DC  B 2 7   ? 38.841 22.239  19.199  1.00 63.36  ? 7   DC  D "O3'" 1 
ATOM   480  C "C2'" . DC  B 2 7   ? 39.982 23.599  17.588  1.00 61.69  ? 7   DC  D "C2'" 1 
ATOM   481  C "C1'" . DC  B 2 7   ? 40.670 24.958  17.732  1.00 61.30  ? 7   DC  D "C1'" 1 
ATOM   482  N N1    . DC  B 2 7   ? 42.025 25.040  17.148  1.00 61.34  ? 7   DC  D N1    1 
ATOM   483  C C2    . DC  B 2 7   ? 42.138 25.074  15.757  1.00 61.34  ? 7   DC  D C2    1 
ATOM   484  O O2    . DC  B 2 7   ? 41.107 24.979  15.067  1.00 62.10  ? 7   DC  D O2    1 
ATOM   485  N N3    . DC  B 2 7   ? 43.354 25.211  15.198  1.00 60.74  ? 7   DC  D N3    1 
ATOM   486  C C4    . DC  B 2 7   ? 44.432 25.305  15.964  1.00 60.31  ? 7   DC  D C4    1 
ATOM   487  N N4    . DC  B 2 7   ? 45.604 25.465  15.354  1.00 60.63  ? 7   DC  D N4    1 
ATOM   488  C C5    . DC  B 2 7   ? 44.355 25.246  17.381  1.00 60.04  ? 7   DC  D C5    1 
ATOM   489  C C6    . DC  B 2 7   ? 43.142 25.108  17.928  1.00 60.84  ? 7   DC  D C6    1 
HETATM 490  N N1    . 5IU B 2 8   ? 42.094 21.585  14.515  1.00 75.86  ? 8   5IU D N1    1 
HETATM 491  C C2    . 5IU B 2 8   ? 43.026 21.842  13.533  1.00 76.46  ? 8   5IU D C2    1 
HETATM 492  N N3    . 5IU B 2 8   ? 44.315 21.987  13.968  1.00 77.02  ? 8   5IU D N3    1 
HETATM 493  C C4    . 5IU B 2 8   ? 44.781 21.901  15.260  1.00 78.13  ? 8   5IU D C4    1 
HETATM 494  C C5    . 5IU B 2 8   ? 43.766 21.610  16.256  1.00 78.69  ? 8   5IU D C5    1 
HETATM 495  C C6    . 5IU B 2 8   ? 42.479 21.460  15.849  1.00 77.34  ? 8   5IU D C6    1 
HETATM 496  O O2    . 5IU B 2 8   ? 42.723 21.941  12.357  1.00 76.39  ? 8   5IU D O2    1 
HETATM 497  O O4    . 5IU B 2 8   ? 45.985 22.082  15.459  1.00 77.95  ? 8   5IU D O4    1 
HETATM 498  I I5    . 5IU B 2 8   ? 44.169 21.443  17.859  1.00 81.70  ? 8   5IU D I5    1 
HETATM 499  C "C1'" . 5IU B 2 8   ? 40.694 21.490  14.055  1.00 74.28  ? 8   5IU D "C1'" 1 
HETATM 500  C "C2'" . 5IU B 2 8   ? 40.183 20.177  13.451  1.00 72.99  ? 8   5IU D "C2'" 1 
HETATM 501  C "C3'" . 5IU B 2 8   ? 39.031 19.790  14.384  1.00 71.64  ? 8   5IU D "C3'" 1 
HETATM 502  C "C4'" . 5IU B 2 8   ? 38.607 21.115  15.009  1.00 71.14  ? 8   5IU D "C4'" 1 
HETATM 503  O "O3'" . 5IU B 2 8   ? 37.907 19.340  13.629  1.00 71.60  ? 8   5IU D "O3'" 1 
HETATM 504  O "O4'" . 5IU B 2 8   ? 39.818 21.900  15.075  1.00 73.11  ? 8   5IU D "O4'" 1 
HETATM 505  C "C5'" . 5IU B 2 8   ? 38.046 21.026  16.407  1.00 68.83  ? 8   5IU D "C5'" 1 
HETATM 506  O "O5'" . 5IU B 2 8   ? 39.061 20.558  17.287  1.00 66.20  ? 8   5IU D "O5'" 1 
HETATM 507  P P     . 5IU B 2 8   ? 38.916 20.660  18.866  1.00 64.88  ? 8   5IU D P     1 
HETATM 508  O OP1   . 5IU B 2 8   ? 37.616 20.051  19.237  1.00 65.34  ? 8   5IU D OP1   1 
HETATM 509  O OP2   . 5IU B 2 8   ? 40.175 20.107  19.422  1.00 64.84  ? 8   5IU D OP2   1 
HETATM 510  N N1    . 5IU B 2 9   ? 43.604 18.336  11.932  1.00 76.75  ? 9   5IU D N1    1 
HETATM 511  C C2    . 5IU B 2 9   ? 44.916 18.687  11.745  1.00 77.12  ? 9   5IU D C2    1 
HETATM 512  N N3    . 5IU B 2 9   ? 45.700 18.688  12.864  1.00 77.94  ? 9   5IU D N3    1 
HETATM 513  C C4    . 5IU B 2 9   ? 45.328 18.378  14.148  1.00 79.13  ? 9   5IU D C4    1 
HETATM 514  C C5    . 5IU B 2 9   ? 43.945 17.996  14.300  1.00 79.49  ? 9   5IU D C5    1 
HETATM 515  C C6    . 5IU B 2 9   ? 43.139 17.982  13.198  1.00 78.20  ? 9   5IU D C6    1 
HETATM 516  O O2    . 5IU B 2 9   ? 45.355 18.981  10.652  1.00 76.79  ? 9   5IU D O2    1 
HETATM 517  O O4    . 5IU B 2 9   ? 46.171 18.474  15.049  1.00 79.75  ? 9   5IU D O4    1 
HETATM 518  I I5    . 5IU B 2 9   ? 43.364 17.574  15.791  1.00 81.86  ? 9   5IU D I5    1 
HETATM 519  C "C1'" . 5IU B 2 9   ? 42.774 18.396  10.711  1.00 75.67  ? 9   5IU D "C1'" 1 
HETATM 520  C "C2'" . 5IU B 2 9   ? 42.613 17.147  9.836   1.00 74.49  ? 9   5IU D "C2'" 1 
HETATM 521  C "C3'" . 5IU B 2 9   ? 41.106 16.899  9.894   1.00 73.57  ? 9   5IU D "C3'" 1 
HETATM 522  C "C4'" . 5IU B 2 9   ? 40.534 18.294  10.109  1.00 73.28  ? 9   5IU D "C4'" 1 
HETATM 523  O "O3'" . 5IU B 2 9   ? 40.539 16.276  8.725   1.00 73.26  ? 9   5IU D "O3'" 1 
HETATM 524  O "O4'" . 5IU B 2 9   ? 41.496 18.917  10.993  1.00 74.63  ? 9   5IU D "O4'" 1 
HETATM 525  C "C5'" . 5IU B 2 9   ? 39.172 18.389  10.747  1.00 72.68  ? 9   5IU D "C5'" 1 
HETATM 526  O "O5'" . 5IU B 2 9   ? 39.196 17.829  12.055  1.00 72.54  ? 9   5IU D "O5'" 1 
HETATM 527  P P     . 5IU B 2 9   ? 37.898 17.875  12.971  1.00 71.43  ? 9   5IU D P     1 
HETATM 528  O OP1   . 5IU B 2 9   ? 36.721 17.814  12.075  1.00 71.54  ? 9   5IU D OP1   1 
HETATM 529  O OP2   . 5IU B 2 9   ? 38.046 16.881  14.053  1.00 72.84  ? 9   5IU D OP2   1 
HETATM 530  N N1    . 5IU B 2 10  ? 46.524 16.787  9.166   1.00 70.56  ? 10  5IU D N1    1 
HETATM 531  C C2    . 5IU B 2 10  ? 47.774 17.146  9.623   1.00 69.68  ? 10  5IU D C2    1 
HETATM 532  N N3    . 5IU B 2 10  ? 48.073 16.726  10.895  1.00 69.50  ? 10  5IU D N3    1 
HETATM 533  C C4    . 5IU B 2 10  ? 47.267 15.991  11.744  1.00 69.74  ? 10  5IU D C4    1 
HETATM 534  C C5    . 5IU B 2 10  ? 45.984 15.628  11.188  1.00 69.89  ? 10  5IU D C5    1 
HETATM 535  C C6    . 5IU B 2 10  ? 45.674 16.023  9.944   1.00 69.87  ? 10  5IU D C6    1 
HETATM 536  O O2    . 5IU B 2 10  ? 48.561 17.786  8.951   1.00 69.21  ? 10  5IU D O2    1 
HETATM 537  O O4    . 5IU B 2 10  ? 47.688 15.710  12.872  1.00 70.03  ? 10  5IU D O4    1 
HETATM 538  I I5    . 5IU B 2 10  ? 44.907 14.770  12.057  1.00 66.57  ? 10  5IU D I5    1 
HETATM 539  C "C1'" . 5IU B 2 10  ? 46.106 17.283  7.845   1.00 71.83  ? 10  5IU D "C1'" 1 
HETATM 540  C "C2'" . 5IU B 2 10  ? 46.915 16.867  6.612   1.00 72.99  ? 10  5IU D "C2'" 1 
HETATM 541  C "C3'" . 5IU B 2 10  ? 45.958 15.923  5.884   1.00 73.94  ? 10  5IU D "C3'" 1 
HETATM 542  C "C4'" . 5IU B 2 10  ? 44.585 16.409  6.314   1.00 73.42  ? 10  5IU D "C4'" 1 
HETATM 543  O "O3'" . 5IU B 2 10  ? 46.069 16.057  4.472   1.00 75.86  ? 10  5IU D "O3'" 1 
HETATM 544  O "O4'" . 5IU B 2 10  ? 44.759 16.929  7.646   1.00 73.41  ? 10  5IU D "O4'" 1 
HETATM 545  C "C5'" . 5IU B 2 10  ? 43.491 15.360  6.312   1.00 73.19  ? 10  5IU D "C5'" 1 
HETATM 546  O "O5'" . 5IU B 2 10  ? 42.622 15.541  7.433   1.00 72.47  ? 10  5IU D "O5'" 1 
HETATM 547  P P     . 5IU B 2 10  ? 41.277 16.372  7.288   1.00 71.93  ? 10  5IU D P     1 
HETATM 548  O OP1   . 5IU B 2 10  ? 41.641 17.789  7.052   1.00 72.96  ? 10  5IU D OP1   1 
HETATM 549  O OP2   . 5IU B 2 10  ? 40.439 15.664  6.297   1.00 71.91  ? 10  5IU D OP2   1 
ATOM   550  P P     . DC  B 2 11  ? 47.167 15.203  3.675   1.00 77.80  ? 11  DC  D P     1 
ATOM   551  O OP1   . DC  B 2 11  ? 46.803 15.165  2.240   1.00 78.17  ? 11  DC  D OP1   1 
ATOM   552  O OP2   . DC  B 2 11  ? 47.377 13.938  4.413   1.00 78.13  ? 11  DC  D OP2   1 
ATOM   553  O "O5'" . DC  B 2 11  ? 48.491 16.068  3.822   1.00 79.63  ? 11  DC  D "O5'" 1 
ATOM   554  C "C5'" . DC  B 2 11  ? 49.764 15.448  3.827   1.00 82.19  ? 11  DC  D "C5'" 1 
ATOM   555  C "C4'" . DC  B 2 11  ? 50.665 16.153  4.800   1.00 84.37  ? 11  DC  D "C4'" 1 
ATOM   556  O "O4'" . DC  B 2 11  ? 50.050 16.171  6.107   1.00 84.81  ? 11  DC  D "O4'" 1 
ATOM   557  C "C3'" . DC  B 2 11  ? 52.014 15.499  5.032   1.00 85.79  ? 11  DC  D "C3'" 1 
ATOM   558  O "O3'" . DC  B 2 11  ? 52.913 15.978  4.040   1.00 88.37  ? 11  DC  D "O3'" 1 
ATOM   559  C "C2'" . DC  B 2 11  ? 52.418 16.017  6.414   1.00 85.63  ? 11  DC  D "C2'" 1 
ATOM   560  C "C1'" . DC  B 2 11  ? 51.066 16.302  7.077   1.00 85.17  ? 11  DC  D "C1'" 1 
ATOM   561  N N1    . DC  B 2 11  ? 50.713 15.528  8.280   1.00 84.75  ? 11  DC  D N1    1 
ATOM   562  C C2    . DC  B 2 11  ? 51.618 15.500  9.343   1.00 84.75  ? 11  DC  D C2    1 
ATOM   563  O O2    . DC  B 2 11  ? 52.721 16.055  9.206   1.00 84.48  ? 11  DC  D O2    1 
ATOM   564  N N3    . DC  B 2 11  ? 51.272 14.870  10.490  1.00 84.92  ? 11  DC  D N3    1 
ATOM   565  C C4    . DC  B 2 11  ? 50.082 14.275  10.593  1.00 84.49  ? 11  DC  D C4    1 
ATOM   566  N N4    . DC  B 2 11  ? 49.775 13.688  11.754  1.00 84.43  ? 11  DC  D N4    1 
ATOM   567  C C5    . DC  B 2 11  ? 49.155 14.259  9.514   1.00 84.28  ? 11  DC  D C5    1 
ATOM   568  C C6    . DC  B 2 11  ? 49.511 14.887  8.383   1.00 84.62  ? 11  DC  D C6    1 
ATOM   569  P P     . DC  B 2 12  ? 53.570 14.948  3.003   1.00 90.26  ? 12  DC  D P     1 
ATOM   570  O OP1   . DC  B 2 12  ? 54.874 15.506  2.568   1.00 90.09  ? 12  DC  D OP1   1 
ATOM   571  O OP2   . DC  B 2 12  ? 52.531 14.619  1.996   1.00 90.28  ? 12  DC  D OP2   1 
ATOM   572  O "O5'" . DC  B 2 12  ? 53.826 13.648  3.886   1.00 91.69  ? 12  DC  D "O5'" 1 
ATOM   573  C "C5'" . DC  B 2 12  ? 55.138 13.133  4.099   1.00 93.54  ? 12  DC  D "C5'" 1 
ATOM   574  C "C4'" . DC  B 2 12  ? 55.830 13.899  5.204   1.00 94.64  ? 12  DC  D "C4'" 1 
ATOM   575  O "O4'" . DC  B 2 12  ? 54.859 14.382  6.168   1.00 95.02  ? 12  DC  D "O4'" 1 
ATOM   576  C "C3'" . DC  B 2 12  ? 56.855 13.112  6.009   1.00 95.33  ? 12  DC  D "C3'" 1 
ATOM   577  O "O3'" . DC  B 2 12  ? 58.117 13.081  5.335   1.00 96.08  ? 12  DC  D "O3'" 1 
ATOM   578  C "C2'" . DC  B 2 12  ? 56.846 13.820  7.360   1.00 95.39  ? 12  DC  D "C2'" 1 
ATOM   579  C "C1'" . DC  B 2 12  ? 55.380 14.254  7.478   1.00 95.31  ? 12  DC  D "C1'" 1 
ATOM   580  N N1    . DC  B 2 12  ? 54.475 13.360  8.224   1.00 95.33  ? 12  DC  D N1    1 
ATOM   581  C C2    . DC  B 2 12  ? 54.830 12.918  9.509   1.00 95.24  ? 12  DC  D C2    1 
ATOM   582  O O2    . DC  B 2 12  ? 55.925 13.252  9.986   1.00 95.45  ? 12  DC  D O2    1 
ATOM   583  N N3    . DC  B 2 12  ? 53.964 12.136  10.196  1.00 95.07  ? 12  DC  D N3    1 
ATOM   584  C C4    . DC  B 2 12  ? 52.794 11.792  9.649   1.00 95.04  ? 12  DC  D C4    1 
ATOM   585  N N4    . DC  B 2 12  ? 51.966 11.028  10.365  1.00 94.96  ? 12  DC  D N4    1 
ATOM   586  C C5    . DC  B 2 12  ? 52.418 12.217  8.344   1.00 95.03  ? 12  DC  D C5    1 
ATOM   587  C C6    . DC  B 2 12  ? 53.281 12.987  7.673   1.00 95.15  ? 12  DC  D C6    1 
ATOM   588  P P     . DC  B 2 13  ? 59.126 14.333  5.434   1.00 96.79  ? 13  DC  D P     1 
ATOM   589  O OP1   . DC  B 2 13  ? 58.368 15.594  5.239   1.00 96.97  ? 13  DC  D OP1   1 
ATOM   590  O OP2   . DC  B 2 13  ? 60.271 14.027  4.548   1.00 96.82  ? 13  DC  D OP2   1 
ATOM   591  O "O5'" . DC  B 2 13  ? 59.665 14.323  6.929   1.00 97.88  ? 13  DC  D "O5'" 1 
ATOM   592  C "C5'" . DC  B 2 13  ? 60.162 15.519  7.514   1.00 99.84  ? 13  DC  D "C5'" 1 
ATOM   593  C "C4'" . DC  B 2 13  ? 60.402 15.315  8.985   1.00 101.31 ? 13  DC  D "C4'" 1 
ATOM   594  O "O4'" . DC  B 2 13  ? 59.193 14.774  9.567   1.00 101.46 ? 13  DC  D "O4'" 1 
ATOM   595  C "C3'" . DC  B 2 13  ? 61.485 14.310  9.341   1.00 102.04 ? 13  DC  D "C3'" 1 
ATOM   596  O "O3'" . DC  B 2 13  ? 62.735 14.989  9.397   1.00 103.52 ? 13  DC  D "O3'" 1 
ATOM   597  C "C2'" . DC  B 2 13  ? 61.052 13.835  10.723  1.00 102.03 ? 13  DC  D "C2'" 1 
ATOM   598  C "C1'" . DC  B 2 13  ? 59.526 13.883  10.611  1.00 101.75 ? 13  DC  D "C1'" 1 
ATOM   599  N N1    . DC  B 2 13  ? 58.900 12.589  10.317  1.00 101.57 ? 13  DC  D N1    1 
ATOM   600  C C2    . DC  B 2 13  ? 58.195 11.948  11.332  1.00 101.57 ? 13  DC  D C2    1 
ATOM   601  O O2    . DC  B 2 13  ? 58.137 12.483  12.449  1.00 101.11 ? 13  DC  D O2    1 
ATOM   602  N N3    . DC  B 2 13  ? 57.596 10.767  11.075  1.00 101.85 ? 13  DC  D N3    1 
ATOM   603  C C4    . DC  B 2 13  ? 57.686 10.223  9.862   1.00 102.00 ? 13  DC  D C4    1 
ATOM   604  N N4    . DC  B 2 13  ? 57.073 9.053   9.660   1.00 102.29 ? 13  DC  D N4    1 
ATOM   605  C C5    . DC  B 2 13  ? 58.407 10.852  8.807   1.00 101.84 ? 13  DC  D C5    1 
ATOM   606  C C6    . DC  B 2 13  ? 58.995 12.024  9.077   1.00 101.72 ? 13  DC  D C6    1 
ATOM   607  P P     . DT  B 2 14  ? 64.082 14.160  9.661   1.00 104.81 ? 14  DT  D P     1 
ATOM   608  O OP1   . DT  B 2 14  ? 65.250 14.982  9.247   1.00 104.50 ? 14  DT  D OP1   1 
ATOM   609  O OP2   . DT  B 2 14  ? 63.883 12.809  9.068   1.00 104.88 ? 14  DT  D OP2   1 
ATOM   610  O "O5'" . DT  B 2 14  ? 64.129 13.996  11.243  1.00 105.36 ? 14  DT  D "O5'" 1 
ATOM   611  C "C5'" . DT  B 2 14  ? 64.837 12.916  11.836  1.00 106.67 ? 14  DT  D "C5'" 1 
ATOM   612  C "C4'" . DT  B 2 14  ? 64.266 12.602  13.195  1.00 107.44 ? 14  DT  D "C4'" 1 
ATOM   613  O "O4'" . DT  B 2 14  ? 62.839 12.367  13.090  1.00 107.57 ? 14  DT  D "O4'" 1 
ATOM   614  C "C3'" . DT  B 2 14  ? 64.817 11.350  13.850  1.00 108.12 ? 14  DT  D "C3'" 1 
ATOM   615  O "O3'" . DT  B 2 14  ? 66.066 11.668  14.467  1.00 109.26 ? 14  DT  D "O3'" 1 
ATOM   616  C "C2'" . DT  B 2 14  ? 63.694 10.946  14.801  1.00 107.84 ? 14  DT  D "C2'" 1 
ATOM   617  C "C1'" . DT  B 2 14  ? 62.448 11.357  14.007  1.00 107.64 ? 14  DT  D "C1'" 1 
ATOM   618  N N1    . DT  B 2 14  ? 61.789 10.274  13.239  1.00 107.60 ? 14  DT  D N1    1 
ATOM   619  C C2    . DT  B 2 14  ? 60.811 9.510   13.854  1.00 107.52 ? 14  DT  D C2    1 
ATOM   620  O O2    . DT  B 2 14  ? 60.475 9.663   15.017  1.00 107.26 ? 14  DT  D O2    1 
ATOM   621  N N3    . DT  B 2 14  ? 60.233 8.555   13.044  1.00 107.54 ? 14  DT  D N3    1 
ATOM   622  C C4    . DT  B 2 14  ? 60.533 8.295   11.716  1.00 107.54 ? 14  DT  D C4    1 
ATOM   623  O O4    . DT  B 2 14  ? 59.924 7.412   11.112  1.00 106.96 ? 14  DT  D O4    1 
ATOM   624  C C5    . DT  B 2 14  ? 61.578 9.128   11.143  1.00 107.69 ? 14  DT  D C5    1 
ATOM   625  C C7    . DT  B 2 14  ? 61.980 8.920   9.717   1.00 107.70 ? 14  DT  D C7    1 
ATOM   626  C C6    . DT  B 2 14  ? 62.144 10.056  11.925  1.00 107.65 ? 14  DT  D C6    1 
ATOM   627  P P     . DG  B 2 15  ? 66.103 12.266  15.961  1.00 109.90 ? 15  DG  D P     1 
ATOM   628  O OP1   . DG  B 2 15  ? 65.015 13.267  16.107  1.00 109.85 ? 15  DG  D OP1   1 
ATOM   629  O OP2   . DG  B 2 15  ? 67.509 12.667  16.221  1.00 109.96 ? 15  DG  D OP2   1 
ATOM   630  O "O5'" . DG  B 2 15  ? 65.773 11.020  16.892  1.00 110.14 ? 15  DG  D "O5'" 1 
ATOM   631  C "C5'" . DG  B 2 15  ? 65.194 11.201  18.178  1.00 110.54 ? 15  DG  D "C5'" 1 
ATOM   632  C "C4'" . DG  B 2 15  ? 64.658 9.888   18.678  1.00 111.08 ? 15  DG  D "C4'" 1 
ATOM   633  O "O4'" . DG  B 2 15  ? 63.691 9.401   17.715  1.00 110.98 ? 15  DG  D "O4'" 1 
ATOM   634  C "C3'" . DG  B 2 15  ? 65.695 8.778   18.779  1.00 111.67 ? 15  DG  D "C3'" 1 
ATOM   635  O "O3'" . DG  B 2 15  ? 66.327 8.826   20.061  1.00 112.71 ? 15  DG  D "O3'" 1 
ATOM   636  C "C2'" . DG  B 2 15  ? 64.861 7.516   18.591  1.00 111.22 ? 15  DG  D "C2'" 1 
ATOM   637  C "C1'" . DG  B 2 15  ? 63.772 7.992   17.628  1.00 110.70 ? 15  DG  D "C1'" 1 
ATOM   638  N N9    . DG  B 2 15  ? 63.948 7.618   16.226  1.00 110.03 ? 15  DG  D N9    1 
ATOM   639  C C8    . DG  B 2 15  ? 64.910 8.050   15.342  1.00 109.57 ? 15  DG  D C8    1 
ATOM   640  N N7    . DG  B 2 15  ? 64.759 7.556   14.140  1.00 109.42 ? 15  DG  D N7    1 
ATOM   641  C C5    . DG  B 2 15  ? 63.638 6.740   14.243  1.00 109.38 ? 15  DG  D C5    1 
ATOM   642  C C6    . DG  B 2 15  ? 62.976 5.937   13.265  1.00 109.21 ? 15  DG  D C6    1 
ATOM   643  O O6    . DG  B 2 15  ? 63.256 5.781   12.067  1.00 109.37 ? 15  DG  D O6    1 
ATOM   644  N N1    . DG  B 2 15  ? 61.879 5.275   13.809  1.00 108.88 ? 15  DG  D N1    1 
ATOM   645  C C2    . DG  B 2 15  ? 61.467 5.366   15.116  1.00 108.92 ? 15  DG  D C2    1 
ATOM   646  N N2    . DG  B 2 15  ? 60.391 4.646   15.459  1.00 108.59 ? 15  DG  D N2    1 
ATOM   647  N N3    . DG  B 2 15  ? 62.066 6.108   16.026  1.00 109.38 ? 15  DG  D N3    1 
ATOM   648  C C4    . DG  B 2 15  ? 63.135 6.762   15.526  1.00 109.65 ? 15  DG  D C4    1 
ATOM   649  P P     . DA  B 2 16  ? 67.005 7.501   20.674  1.00 113.21 ? 16  DA  D P     1 
ATOM   650  O OP1   . DA  B 2 16  ? 67.890 7.900   21.800  1.00 113.27 ? 16  DA  D OP1   1 
ATOM   651  O OP2   . DA  B 2 16  ? 67.566 6.718   19.541  1.00 113.28 ? 16  DA  D OP2   1 
ATOM   652  O "O5'" . DA  B 2 16  ? 65.770 6.695   21.278  1.00 113.17 ? 16  DA  D "O5'" 1 
ATOM   653  C "C5'" . DA  B 2 16  ? 65.829 5.283   21.452  1.00 112.86 ? 16  DA  D "C5'" 1 
ATOM   654  C "C4'" . DA  B 2 16  ? 64.532 4.652   21.003  1.00 112.57 ? 16  DA  D "C4'" 1 
ATOM   655  O "O4'" . DA  B 2 16  ? 64.233 5.086   19.657  1.00 112.50 ? 16  DA  D "O4'" 1 
ATOM   656  C "C3'" . DA  B 2 16  ? 64.547 3.134   20.941  1.00 112.50 ? 16  DA  D "C3'" 1 
ATOM   657  O "O3'" . DA  B 2 16  ? 64.146 2.625   22.207  1.00 112.40 ? 16  DA  D "O3'" 1 
ATOM   658  C "C2'" . DA  B 2 16  ? 63.510 2.816   19.865  1.00 112.41 ? 16  DA  D "C2'" 1 
ATOM   659  C "C1'" . DA  B 2 16  ? 63.617 4.035   18.945  1.00 112.45 ? 16  DA  D "C1'" 1 
ATOM   660  N N9    . DA  B 2 16  ? 64.341 3.854   17.687  1.00 112.42 ? 16  DA  D N9    1 
ATOM   661  C C8    . DA  B 2 16  ? 65.472 4.517   17.273  1.00 112.21 ? 16  DA  D C8    1 
ATOM   662  N N7    . DA  B 2 16  ? 65.840 4.223   16.050  1.00 112.24 ? 16  DA  D N7    1 
ATOM   663  C C5    . DA  B 2 16  ? 64.904 3.285   15.637  1.00 112.46 ? 16  DA  D C5    1 
ATOM   664  C C6    . DA  B 2 16  ? 64.736 2.586   14.430  1.00 112.60 ? 16  DA  D C6    1 
ATOM   665  N N6    . DA  B 2 16  ? 65.538 2.739   13.373  1.00 112.57 ? 16  DA  D N6    1 
ATOM   666  N N1    . DA  B 2 16  ? 63.703 1.714   14.344  1.00 112.76 ? 16  DA  D N1    1 
ATOM   667  C C2    . DA  B 2 16  ? 62.899 1.567   15.407  1.00 112.65 ? 16  DA  D C2    1 
ATOM   668  N N3    . DA  B 2 16  ? 62.952 2.173   16.594  1.00 112.67 ? 16  DA  D N3    1 
ATOM   669  C C4    . DA  B 2 16  ? 63.988 3.030   16.644  1.00 112.54 ? 16  DA  D C4    1 
ATOM   670  P P     . DG  B 2 17  ? 64.862 1.318   22.799  1.00 112.54 ? 17  DG  D P     1 
ATOM   671  O OP1   . DG  B 2 17  ? 64.014 0.772   23.893  1.00 112.44 ? 17  DG  D OP1   1 
ATOM   672  O OP2   . DG  B 2 17  ? 66.280 1.676   23.074  1.00 112.45 ? 17  DG  D OP2   1 
ATOM   673  O "O5'" . DG  B 2 17  ? 64.835 0.296   21.575  1.00 112.07 ? 17  DG  D "O5'" 1 
ATOM   674  C "C5'" . DG  B 2 17  ? 63.641 -0.395  21.221  1.00 110.51 ? 17  DG  D "C5'" 1 
ATOM   675  C "C4'" . DG  B 2 17  ? 63.891 -1.295  20.032  1.00 109.66 ? 17  DG  D "C4'" 1 
ATOM   676  O "O4'" . DG  B 2 17  ? 63.982 -0.522  18.810  1.00 109.12 ? 17  DG  D "O4'" 1 
ATOM   677  C "C3'" . DG  B 2 17  ? 65.194 -2.079  20.046  1.00 109.47 ? 17  DG  D "C3'" 1 
ATOM   678  O "O3'" . DG  B 2 17  ? 65.183 -3.184  20.961  1.00 109.50 ? 17  DG  D "O3'" 1 
ATOM   679  C "C2'" . DG  B 2 17  ? 65.346 -2.471  18.578  1.00 109.03 ? 17  DG  D "C2'" 1 
ATOM   680  C "C1'" . DG  B 2 17  ? 64.745 -1.255  17.865  1.00 108.45 ? 17  DG  D "C1'" 1 
ATOM   681  N N9    . DG  B 2 17  ? 65.734 -0.373  17.250  1.00 107.57 ? 17  DG  D N9    1 
ATOM   682  C C8    . DG  B 2 17  ? 66.605 0.497   17.866  1.00 107.14 ? 17  DG  D C8    1 
ATOM   683  N N7    . DG  B 2 17  ? 67.371 1.138   17.022  1.00 106.73 ? 17  DG  D N7    1 
ATOM   684  C C5    . DG  B 2 17  ? 66.981 0.662   15.775  1.00 106.58 ? 17  DG  D C5    1 
ATOM   685  C C6    . DG  B 2 17  ? 67.448 0.988   14.464  1.00 106.05 ? 17  DG  D C6    1 
ATOM   686  O O6    . DG  B 2 17  ? 68.329 1.794   14.129  1.00 105.39 ? 17  DG  D O6    1 
ATOM   687  N N1    . DG  B 2 17  ? 66.765 0.266   13.488  1.00 106.18 ? 17  DG  D N1    1 
ATOM   688  C C2    . DG  B 2 17  ? 65.764 -0.650  13.731  1.00 106.41 ? 17  DG  D C2    1 
ATOM   689  N N2    . DG  B 2 17  ? 65.224 -1.250  12.662  1.00 106.24 ? 17  DG  D N2    1 
ATOM   690  N N3    . DG  B 2 17  ? 65.323 -0.957  14.936  1.00 106.68 ? 17  DG  D N3    1 
ATOM   691  C C4    . DG  B 2 17  ? 65.970 -0.270  15.903  1.00 107.05 ? 17  DG  D C4    1 
ATOM   692  N N     . ALA C 3 2   ? 54.773 61.509  -15.740 1.00 41.77  ? 19  ALA A N     1 
ATOM   693  C CA    . ALA C 3 2   ? 53.616 61.000  -14.938 1.00 41.57  ? 19  ALA A CA    1 
ATOM   694  C C     . ALA C 3 2   ? 53.871 59.556  -14.467 1.00 41.70  ? 19  ALA A C     1 
ATOM   695  O O     . ALA C 3 2   ? 53.632 58.592  -15.209 1.00 41.67  ? 19  ALA A O     1 
ATOM   696  C CB    . ALA C 3 2   ? 52.329 61.074  -15.785 1.00 40.56  ? 19  ALA A CB    1 
ATOM   697  N N     . TYR C 3 3   ? 54.351 59.407  -13.231 1.00 41.27  ? 20  TYR A N     1 
ATOM   698  C CA    . TYR C 3 3   ? 54.634 58.076  -12.688 1.00 40.53  ? 20  TYR A CA    1 
ATOM   699  C C     . TYR C 3 3   ? 54.242 57.881  -11.215 1.00 39.81  ? 20  TYR A C     1 
ATOM   700  O O     . TYR C 3 3   ? 54.239 58.825  -10.423 1.00 39.68  ? 20  TYR A O     1 
ATOM   701  C CB    . TYR C 3 3   ? 56.112 57.767  -12.845 1.00 40.54  ? 20  TYR A CB    1 
ATOM   702  C CG    . TYR C 3 3   ? 56.994 58.622  -11.975 1.00 41.54  ? 20  TYR A CG    1 
ATOM   703  C CD1   . TYR C 3 3   ? 57.309 59.928  -12.333 1.00 41.45  ? 20  TYR A CD1   1 
ATOM   704  C CD2   . TYR C 3 3   ? 57.521 58.117  -10.787 1.00 42.27  ? 20  TYR A CD2   1 
ATOM   705  C CE1   . TYR C 3 3   ? 58.137 60.714  -11.527 1.00 42.45  ? 20  TYR A CE1   1 
ATOM   706  C CE2   . TYR C 3 3   ? 58.346 58.890  -9.974  1.00 42.77  ? 20  TYR A CE2   1 
ATOM   707  C CZ    . TYR C 3 3   ? 58.652 60.186  -10.350 1.00 42.89  ? 20  TYR A CZ    1 
ATOM   708  O OH    . TYR C 3 3   ? 59.475 60.940  -9.548  1.00 42.47  ? 20  TYR A OH    1 
ATOM   709  N N     . VAL C 3 4   ? 53.940 56.638  -10.853 1.00 38.70  ? 21  VAL A N     1 
ATOM   710  C CA    . VAL C 3 4   ? 53.537 56.296  -9.491  1.00 37.58  ? 21  VAL A CA    1 
ATOM   711  C C     . VAL C 3 4   ? 54.723 56.047  -8.559  1.00 37.41  ? 21  VAL A C     1 
ATOM   712  O O     . VAL C 3 4   ? 55.590 55.227  -8.847  1.00 36.62  ? 21  VAL A O     1 
ATOM   713  C CB    . VAL C 3 4   ? 52.655 55.044  -9.490  1.00 37.24  ? 21  VAL A CB    1 
ATOM   714  C CG1   . VAL C 3 4   ? 52.222 54.720  -8.080  1.00 37.56  ? 21  VAL A CG1   1 
ATOM   715  C CG2   . VAL C 3 4   ? 51.457 55.260  -10.386 1.00 36.80  ? 21  VAL A CG2   1 
ATOM   716  N N     . GLU C 3 5   ? 54.735 56.751  -7.429  1.00 37.50  ? 22  GLU A N     1 
ATOM   717  C CA    . GLU C 3 5   ? 55.807 56.636  -6.443  1.00 37.65  ? 22  GLU A CA    1 
ATOM   718  C C     . GLU C 3 5   ? 55.283 56.218  -5.081  1.00 37.33  ? 22  GLU A C     1 
ATOM   719  O O     . GLU C 3 5   ? 54.385 56.853  -4.528  1.00 36.54  ? 22  GLU A O     1 
ATOM   720  C CB    . GLU C 3 5   ? 56.532 57.968  -6.286  1.00 38.73  ? 22  GLU A CB    1 
ATOM   721  C CG    . GLU C 3 5   ? 57.642 57.945  -5.251  1.00 40.91  ? 22  GLU A CG    1 
ATOM   722  C CD    . GLU C 3 5   ? 58.219 59.329  -4.954  1.00 42.24  ? 22  GLU A CD    1 
ATOM   723  O OE1   . GLU C 3 5   ? 58.548 60.066  -5.910  1.00 42.57  ? 22  GLU A OE1   1 
ATOM   724  O OE2   . GLU C 3 5   ? 58.353 59.673  -3.759  1.00 43.55  ? 22  GLU A OE2   1 
ATOM   725  N N     . ILE C 3 6   ? 55.858 55.150  -4.537  1.00 36.79  ? 23  ILE A N     1 
ATOM   726  C CA    . ILE C 3 6   ? 55.450 54.658  -3.232  1.00 36.15  ? 23  ILE A CA    1 
ATOM   727  C C     . ILE C 3 6   ? 56.157 55.451  -2.130  1.00 36.46  ? 23  ILE A C     1 
ATOM   728  O O     . ILE C 3 6   ? 57.386 55.398  -1.997  1.00 35.81  ? 23  ILE A O     1 
ATOM   729  C CB    . ILE C 3 6   ? 55.769 53.149  -3.076  1.00 35.03  ? 23  ILE A CB    1 
ATOM   730  C CG1   . ILE C 3 6   ? 54.954 52.338  -4.082  1.00 33.88  ? 23  ILE A CG1   1 
ATOM   731  C CG2   . ILE C 3 6   ? 55.441 52.685  -1.662  1.00 34.84  ? 23  ILE A CG2   1 
ATOM   732  C CD1   . ILE C 3 6   ? 55.154 50.850  -3.953  1.00 33.12  ? 23  ILE A CD1   1 
ATOM   733  N N     . ILE C 3 7   ? 55.369 56.187  -1.346  1.00 36.29  ? 24  ILE A N     1 
ATOM   734  C CA    . ILE C 3 7   ? 55.914 56.992  -0.259  1.00 36.56  ? 24  ILE A CA    1 
ATOM   735  C C     . ILE C 3 7   ? 55.703 56.366  1.119   1.00 35.98  ? 24  ILE A C     1 
ATOM   736  O O     . ILE C 3 7   ? 56.059 56.970  2.129   1.00 36.06  ? 24  ILE A O     1 
ATOM   737  C CB    . ILE C 3 7   ? 55.294 58.384  -0.249  1.00 37.84  ? 24  ILE A CB    1 
ATOM   738  C CG1   . ILE C 3 7   ? 53.805 58.278  0.066   1.00 39.42  ? 24  ILE A CG1   1 
ATOM   739  C CG2   . ILE C 3 7   ? 55.494 59.050  -1.601  1.00 37.89  ? 24  ILE A CG2   1 
ATOM   740  C CD1   . ILE C 3 7   ? 53.079 59.610  0.013   1.00 41.52  ? 24  ILE A CD1   1 
ATOM   741  N N     . GLU C 3 8   ? 55.125 55.164  1.154   1.00 34.68  ? 25  GLU A N     1 
ATOM   742  C CA    . GLU C 3 8   ? 54.886 54.444  2.400   1.00 33.16  ? 25  GLU A CA    1 
ATOM   743  C C     . GLU C 3 8   ? 54.612 52.977  2.077   1.00 32.37  ? 25  GLU A C     1 
ATOM   744  O O     . GLU C 3 8   ? 53.478 52.578  1.798   1.00 31.79  ? 25  GLU A O     1 
ATOM   745  C CB    . GLU C 3 8   ? 53.702 55.052  3.140   1.00 33.71  ? 25  GLU A CB    1 
ATOM   746  C CG    . GLU C 3 8   ? 53.419 54.443  4.499   1.00 35.19  ? 25  GLU A CG    1 
ATOM   747  C CD    . GLU C 3 8   ? 54.608 54.508  5.441   1.00 37.18  ? 25  GLU A CD    1 
ATOM   748  O OE1   . GLU C 3 8   ? 55.299 55.553  5.476   1.00 37.62  ? 25  GLU A OE1   1 
ATOM   749  O OE2   . GLU C 3 8   ? 54.841 53.514  6.164   1.00 37.67  ? 25  GLU A OE2   1 
ATOM   750  N N     . GLN C 3 9   ? 55.673 52.183  2.109   1.00 30.97  ? 26  GLN A N     1 
ATOM   751  C CA    . GLN C 3 9   ? 55.600 50.761  1.812   1.00 29.92  ? 26  GLN A CA    1 
ATOM   752  C C     . GLN C 3 9   ? 54.732 50.003  2.795   1.00 28.89  ? 26  GLN A C     1 
ATOM   753  O O     . GLN C 3 9   ? 54.335 50.536  3.824   1.00 29.64  ? 26  GLN A O     1 
ATOM   754  C CB    . GLN C 3 9   ? 56.999 50.141  1.874   1.00 30.44  ? 26  GLN A CB    1 
ATOM   755  C CG    . GLN C 3 9   ? 57.982 50.601  0.836   1.00 31.28  ? 26  GLN A CG    1 
ATOM   756  C CD    . GLN C 3 9   ? 57.706 50.019  -0.523  1.00 32.01  ? 26  GLN A CD    1 
ATOM   757  O OE1   . GLN C 3 9   ? 57.199 48.907  -0.644  1.00 32.81  ? 26  GLN A OE1   1 
ATOM   758  N NE2   . GLN C 3 9   ? 58.066 50.757  -1.560  1.00 32.10  ? 26  GLN A NE2   1 
ATOM   759  N N     . PRO C 3 10  ? 54.421 48.736  2.478   1.00 27.68  ? 27  PRO A N     1 
ATOM   760  C CA    . PRO C 3 10  ? 53.609 47.873  3.346   1.00 27.15  ? 27  PRO A CA    1 
ATOM   761  C C     . PRO C 3 10  ? 54.606 47.276  4.355   1.00 26.41  ? 27  PRO A C     1 
ATOM   762  O O     . PRO C 3 10  ? 55.756 47.042  4.010   1.00 25.90  ? 27  PRO A O     1 
ATOM   763  C CB    . PRO C 3 10  ? 53.099 46.783  2.401   1.00 26.74  ? 27  PRO A CB    1 
ATOM   764  C CG    . PRO C 3 10  ? 53.291 47.355  1.033   1.00 27.91  ? 27  PRO A CG    1 
ATOM   765  C CD    . PRO C 3 10  ? 54.557 48.138  1.142   1.00 27.24  ? 27  PRO A CD    1 
ATOM   766  N N     . LYS C 3 11  ? 54.190 47.048  5.594   1.00 26.01  ? 28  LYS A N     1 
ATOM   767  C CA    . LYS C 3 11  ? 55.097 46.459  6.558   1.00 25.57  ? 28  LYS A CA    1 
ATOM   768  C C     . LYS C 3 11  ? 55.282 45.095  5.920   1.00 25.93  ? 28  LYS A C     1 
ATOM   769  O O     . LYS C 3 11  ? 54.316 44.521  5.397   1.00 26.66  ? 28  LYS A O     1 
ATOM   770  C CB    . LYS C 3 11  ? 54.418 46.318  7.917   1.00 26.06  ? 28  LYS A CB    1 
ATOM   771  C CG    . LYS C 3 11  ? 55.365 46.165  9.092   1.00 27.14  ? 28  LYS A CG    1 
ATOM   772  C CD    . LYS C 3 11  ? 54.594 46.074  10.398  1.00 29.05  ? 28  LYS A CD    1 
ATOM   773  C CE    . LYS C 3 11  ? 55.351 46.709  11.563  1.00 30.40  ? 28  LYS A CE    1 
ATOM   774  N NZ    . LYS C 3 11  ? 56.592 45.984  11.978  1.00 31.17  ? 28  LYS A NZ    1 
ATOM   775  N N     . GLN C 3 12  ? 56.498 44.568  5.938   1.00 24.39  ? 29  GLN A N     1 
ATOM   776  C CA    . GLN C 3 12  ? 56.720 43.285  5.311   1.00 23.92  ? 29  GLN A CA    1 
ATOM   777  C C     . GLN C 3 12  ? 56.363 42.064  6.147   1.00 23.39  ? 29  GLN A C     1 
ATOM   778  O O     . GLN C 3 12  ? 55.981 41.029  5.604   1.00 22.87  ? 29  GLN A O     1 
ATOM   779  C CB    . GLN C 3 12  ? 58.165 43.197  4.841   1.00 24.26  ? 29  GLN A CB    1 
ATOM   780  C CG    . GLN C 3 12  ? 58.478 44.170  3.744   1.00 26.12  ? 29  GLN A CG    1 
ATOM   781  C CD    . GLN C 3 12  ? 59.898 44.042  3.250   1.00 27.62  ? 29  GLN A CD    1 
ATOM   782  O OE1   . GLN C 3 12  ? 60.812 44.660  3.785   1.00 28.11  ? 29  GLN A OE1   1 
ATOM   783  N NE2   . GLN C 3 12  ? 60.093 43.231  2.223   1.00 29.48  ? 29  GLN A NE2   1 
ATOM   784  N N     . ARG C 3 13  ? 56.474 42.184  7.464   1.00 23.69  ? 30  ARG A N     1 
ATOM   785  C CA    . ARG C 3 13  ? 56.189 41.057  8.346   1.00 23.33  ? 30  ARG A CA    1 
ATOM   786  C C     . ARG C 3 13  ? 55.279 41.399  9.527   1.00 23.73  ? 30  ARG A C     1 
ATOM   787  O O     . ARG C 3 13  ? 55.087 42.568  9.876   1.00 23.00  ? 30  ARG A O     1 
ATOM   788  C CB    . ARG C 3 13  ? 57.502 40.470  8.873   1.00 22.70  ? 30  ARG A CB    1 
ATOM   789  C CG    . ARG C 3 13  ? 58.533 40.183  7.795   1.00 24.17  ? 30  ARG A CG    1 
ATOM   790  C CD    . ARG C 3 13  ? 59.335 38.931  8.127   1.00 24.99  ? 30  ARG A CD    1 
ATOM   791  N NE    . ARG C 3 13  ? 59.847 38.233  6.943   1.00 24.12  ? 30  ARG A NE    1 
ATOM   792  C CZ    . ARG C 3 13  ? 60.873 38.653  6.217   1.00 23.92  ? 30  ARG A CZ    1 
ATOM   793  N NH1   . ARG C 3 13  ? 61.497 39.773  6.551   1.00 23.05  ? 30  ARG A NH1   1 
ATOM   794  N NH2   . ARG C 3 13  ? 61.277 37.949  5.171   1.00 23.72  ? 30  ARG A NH2   1 
ATOM   795  N N     . GLY C 3 14  ? 54.730 40.353  10.142  1.00 24.28  ? 31  GLY A N     1 
ATOM   796  C CA    . GLY C 3 14  ? 53.854 40.532  11.279  1.00 25.02  ? 31  GLY A CA    1 
ATOM   797  C C     . GLY C 3 14  ? 52.420 40.116  11.017  1.00 26.01  ? 31  GLY A C     1 
ATOM   798  O O     . GLY C 3 14  ? 51.792 39.492  11.879  1.00 27.05  ? 31  GLY A O     1 
ATOM   799  N N     . MET C 3 15  ? 51.888 40.468  9.846   1.00 26.37  ? 32  MET A N     1 
ATOM   800  C CA    . MET C 3 15  ? 50.512 40.115  9.509   1.00 26.34  ? 32  MET A CA    1 
ATOM   801  C C     . MET C 3 15  ? 50.422 38.760  8.875   1.00 26.04  ? 32  MET A C     1 
ATOM   802  O O     . MET C 3 15  ? 51.213 38.424  8.009   1.00 25.97  ? 32  MET A O     1 
ATOM   803  C CB    . MET C 3 15  ? 49.891 41.108  8.544   1.00 27.33  ? 32  MET A CB    1 
ATOM   804  C CG    . MET C 3 15  ? 48.549 40.626  8.054   1.00 28.63  ? 32  MET A CG    1 
ATOM   805  S SD    . MET C 3 15  ? 47.956 41.501  6.639   1.00 32.74  ? 32  MET A SD    1 
ATOM   806  C CE    . MET C 3 15  ? 47.371 42.953  7.444   1.00 31.89  ? 32  MET A CE    1 
ATOM   807  N N     . ARG C 3 16  ? 49.443 37.979  9.301   1.00 26.72  ? 33  ARG A N     1 
ATOM   808  C CA    . ARG C 3 16  ? 49.285 36.659  8.739   1.00 27.71  ? 33  ARG A CA    1 
ATOM   809  C C     . ARG C 3 16  ? 48.266 36.683  7.618   1.00 28.91  ? 33  ARG A C     1 
ATOM   810  O O     . ARG C 3 16  ? 47.371 37.521  7.589   1.00 29.20  ? 33  ARG A O     1 
ATOM   811  C CB    . ARG C 3 16  ? 48.865 35.666  9.829   1.00 27.35  ? 33  ARG A CB    1 
ATOM   812  C CG    . ARG C 3 16  ? 47.862 36.205  10.838  1.00 27.65  ? 33  ARG A CG    1 
ATOM   813  C CD    . ARG C 3 16  ? 47.835 35.362  12.131  1.00 26.87  ? 33  ARG A CD    1 
ATOM   814  N NE    . ARG C 3 16  ? 47.457 33.970  11.900  1.00 26.91  ? 33  ARG A NE    1 
ATOM   815  C CZ    . ARG C 3 16  ? 48.141 32.927  12.362  1.00 27.75  ? 33  ARG A CZ    1 
ATOM   816  N NH1   . ARG C 3 16  ? 49.237 33.117  13.077  1.00 27.70  ? 33  ARG A NH1   1 
ATOM   817  N NH2   . ARG C 3 16  ? 47.737 31.692  12.105  1.00 28.74  ? 33  ARG A NH2   1 
ATOM   818  N N     . PHE C 3 17  ? 48.433 35.787  6.660   1.00 29.57  ? 34  PHE A N     1 
ATOM   819  C CA    . PHE C 3 17  ? 47.484 35.701  5.574   1.00 30.42  ? 34  PHE A CA    1 
ATOM   820  C C     . PHE C 3 17  ? 46.288 34.981  6.213   1.00 32.00  ? 34  PHE A C     1 
ATOM   821  O O     . PHE C 3 17  ? 46.490 34.079  7.029   1.00 32.76  ? 34  PHE A O     1 
ATOM   822  C CB    . PHE C 3 17  ? 48.073 34.851  4.439   1.00 29.24  ? 34  PHE A CB    1 
ATOM   823  C CG    . PHE C 3 17  ? 49.223 35.500  3.696   1.00 27.53  ? 34  PHE A CG    1 
ATOM   824  C CD1   . PHE C 3 17  ? 49.918 34.783  2.726   1.00 27.02  ? 34  PHE A CD1   1 
ATOM   825  C CD2   . PHE C 3 17  ? 49.599 36.818  3.941   1.00 26.82  ? 34  PHE A CD2   1 
ATOM   826  C CE1   . PHE C 3 17  ? 50.959 35.367  2.012   1.00 25.77  ? 34  PHE A CE1   1 
ATOM   827  C CE2   . PHE C 3 17  ? 50.643 37.407  3.230   1.00 25.23  ? 34  PHE A CE2   1 
ATOM   828  C CZ    . PHE C 3 17  ? 51.321 36.680  2.270   1.00 25.50  ? 34  PHE A CZ    1 
ATOM   829  N N     . ARG C 3 18  ? 45.057 35.369  5.877   1.00 33.35  ? 35  ARG A N     1 
ATOM   830  C CA    . ARG C 3 18  ? 43.882 34.686  6.444   1.00 34.14  ? 35  ARG A CA    1 
ATOM   831  C C     . ARG C 3 18  ? 43.167 33.847  5.381   1.00 34.54  ? 35  ARG A C     1 
ATOM   832  O O     . ARG C 3 18  ? 43.231 34.158  4.194   1.00 34.19  ? 35  ARG A O     1 
ATOM   833  C CB    . ARG C 3 18  ? 42.875 35.685  7.026   1.00 33.88  ? 35  ARG A CB    1 
ATOM   834  C CG    . ARG C 3 18  ? 43.453 36.878  7.786   1.00 33.92  ? 35  ARG A CG    1 
ATOM   835  C CD    . ARG C 3 18  ? 44.198 36.521  9.080   1.00 34.61  ? 35  ARG A CD    1 
ATOM   836  N NE    . ARG C 3 18  ? 43.342 35.982  10.136  1.00 34.67  ? 35  ARG A NE    1 
ATOM   837  C CZ    . ARG C 3 18  ? 43.347 36.393  11.410  1.00 34.27  ? 35  ARG A CZ    1 
ATOM   838  N NH1   . ARG C 3 18  ? 44.157 37.365  11.825  1.00 31.34  ? 35  ARG A NH1   1 
ATOM   839  N NH2   . ARG C 3 18  ? 42.537 35.811  12.279  1.00 33.84  ? 35  ARG A NH2   1 
ATOM   840  N N     . TYR C 3 19  ? 42.500 32.778  5.813   1.00 36.50  ? 36  TYR A N     1 
ATOM   841  C CA    . TYR C 3 19  ? 41.734 31.911  4.910   1.00 38.61  ? 36  TYR A CA    1 
ATOM   842  C C     . TYR C 3 19  ? 40.281 32.375  4.909   1.00 40.75  ? 36  TYR A C     1 
ATOM   843  O O     . TYR C 3 19  ? 39.870 33.161  5.772   1.00 41.18  ? 36  TYR A O     1 
ATOM   844  C CB    . TYR C 3 19  ? 41.766 30.455  5.361   1.00 37.65  ? 36  TYR A CB    1 
ATOM   845  C CG    . TYR C 3 19  ? 43.087 29.777  5.158   1.00 37.57  ? 36  TYR A CG    1 
ATOM   846  C CD1   . TYR C 3 19  ? 44.194 30.148  5.906   1.00 37.64  ? 36  TYR A CD1   1 
ATOM   847  C CD2   . TYR C 3 19  ? 43.237 28.764  4.210   1.00 36.98  ? 36  TYR A CD2   1 
ATOM   848  C CE1   . TYR C 3 19  ? 45.423 29.533  5.719   1.00 37.75  ? 36  TYR A CE1   1 
ATOM   849  C CE2   . TYR C 3 19  ? 44.469 28.138  4.015   1.00 37.56  ? 36  TYR A CE2   1 
ATOM   850  C CZ    . TYR C 3 19  ? 45.558 28.534  4.776   1.00 37.13  ? 36  TYR A CZ    1 
ATOM   851  O OH    . TYR C 3 19  ? 46.790 27.966  4.593   1.00 36.13  ? 36  TYR A OH    1 
ATOM   852  N N     . LYS C 3 20  ? 39.501 31.893  3.944   1.00 42.65  ? 37  LYS A N     1 
ATOM   853  C CA    . LYS C 3 20  ? 38.103 32.292  3.858   1.00 44.06  ? 37  LYS A CA    1 
ATOM   854  C C     . LYS C 3 20  ? 37.346 31.883  5.099   1.00 45.18  ? 37  LYS A C     1 
ATOM   855  O O     . LYS C 3 20  ? 36.540 32.659  5.630   1.00 45.22  ? 37  LYS A O     1 
ATOM   856  C CB    . LYS C 3 20  ? 37.441 31.664  2.641   1.00 44.20  ? 37  LYS A CB    1 
ATOM   857  C CG    . LYS C 3 20  ? 37.525 32.531  1.421   1.00 45.29  ? 37  LYS A CG    1 
ATOM   858  C CD    . LYS C 3 20  ? 36.611 33.733  1.551   1.00 46.02  ? 37  LYS A CD    1 
ATOM   859  C CE    . LYS C 3 20  ? 35.161 33.356  1.264   1.00 46.45  ? 37  LYS A CE    1 
ATOM   860  N NZ    . LYS C 3 20  ? 34.943 32.904  -0.145  1.00 46.00  ? 37  LYS A NZ    1 
ATOM   861  N N     . CYS C 3 21  ? 37.621 30.667  5.566   1.00 46.15  ? 38  CYS A N     1 
ATOM   862  C CA    . CYS C 3 21  ? 36.949 30.126  6.737   1.00 46.96  ? 38  CYS A CA    1 
ATOM   863  C C     . CYS C 3 21  ? 37.018 30.972  7.996   1.00 47.49  ? 38  CYS A C     1 
ATOM   864  O O     . CYS C 3 21  ? 36.244 30.755  8.924   1.00 48.27  ? 38  CYS A O     1 
ATOM   865  C CB    . CYS C 3 21  ? 37.457 28.713  7.024   1.00 47.34  ? 38  CYS A CB    1 
ATOM   866  S SG    . CYS C 3 21  ? 39.230 28.494  6.877   1.00 48.58  ? 38  CYS A SG    1 
ATOM   867  N N     . GLU C 3 22  ? 37.928 31.933  8.048   1.00 48.34  ? 39  GLU A N     1 
ATOM   868  C CA    . GLU C 3 22  ? 38.016 32.786  9.229   1.00 49.78  ? 39  GLU A CA    1 
ATOM   869  C C     . GLU C 3 22  ? 37.050 33.940  9.057   1.00 50.50  ? 39  GLU A C     1 
ATOM   870  O O     . GLU C 3 22  ? 36.176 33.887  8.197   1.00 50.63  ? 39  GLU A O     1 
ATOM   871  C CB    . GLU C 3 22  ? 39.435 33.315  9.402   1.00 50.15  ? 39  GLU A CB    1 
ATOM   872  C CG    . GLU C 3 22  ? 40.471 32.210  9.325   1.00 51.49  ? 39  GLU A CG    1 
ATOM   873  C CD    . GLU C 3 22  ? 41.863 32.658  9.713   1.00 51.76  ? 39  GLU A CD    1 
ATOM   874  O OE1   . GLU C 3 22  ? 42.816 32.110  9.124   1.00 52.44  ? 39  GLU A OE1   1 
ATOM   875  O OE2   . GLU C 3 22  ? 42.006 33.531  10.604  1.00 51.43  ? 39  GLU A OE2   1 
ATOM   876  N N     . GLY C 3 23  ? 37.212 34.985  9.860   1.00 51.80  ? 40  GLY A N     1 
ATOM   877  C CA    . GLY C 3 23  ? 36.328 36.138  9.761   1.00 53.30  ? 40  GLY A CA    1 
ATOM   878  C C     . GLY C 3 23  ? 36.184 36.749  8.371   1.00 54.08  ? 40  GLY A C     1 
ATOM   879  O O     . GLY C 3 23  ? 37.144 36.819  7.608   1.00 54.74  ? 40  GLY A O     1 
ATOM   880  N N     . ARG C 3 24  ? 34.973 37.184  8.039   1.00 55.07  ? 41  ARG A N     1 
ATOM   881  C CA    . ARG C 3 24  ? 34.695 37.815  6.749   1.00 55.94  ? 41  ARG A CA    1 
ATOM   882  C C     . ARG C 3 24  ? 35.622 38.999  6.560   1.00 55.61  ? 41  ARG A C     1 
ATOM   883  O O     . ARG C 3 24  ? 36.095 39.261  5.456   1.00 55.93  ? 41  ARG A O     1 
ATOM   884  C CB    . ARG C 3 24  ? 33.255 38.329  6.703   1.00 57.52  ? 41  ARG A CB    1 
ATOM   885  C CG    . ARG C 3 24  ? 32.958 39.333  5.576   1.00 58.62  ? 41  ARG A CG    1 
ATOM   886  C CD    . ARG C 3 24  ? 31.685 40.112  5.887   1.00 59.56  ? 41  ARG A CD    1 
ATOM   887  N NE    . ARG C 3 24  ? 30.715 39.255  6.564   1.00 61.10  ? 41  ARG A NE    1 
ATOM   888  C CZ    . ARG C 3 24  ? 29.586 39.678  7.123   1.00 61.56  ? 41  ARG A CZ    1 
ATOM   889  N NH1   . ARG C 3 24  ? 29.268 40.965  7.082   1.00 61.86  ? 41  ARG A NH1   1 
ATOM   890  N NH2   . ARG C 3 24  ? 28.791 38.815  7.751   1.00 61.30  ? 41  ARG A NH2   1 
ATOM   891  N N     . SER C 3 25  ? 35.849 39.727  7.647   1.00 54.74  ? 42  SER A N     1 
ATOM   892  C CA    . SER C 3 25  ? 36.717 40.885  7.615   1.00 54.52  ? 42  SER A CA    1 
ATOM   893  C C     . SER C 3 25  ? 38.121 40.467  8.034   1.00 53.87  ? 42  SER A C     1 
ATOM   894  O O     . SER C 3 25  ? 38.411 40.345  9.232   1.00 53.99  ? 42  SER A O     1 
ATOM   895  C CB    . SER C 3 25  ? 36.188 41.965  8.561   1.00 55.47  ? 42  SER A CB    1 
ATOM   896  O OG    . SER C 3 25  ? 37.085 43.061  8.645   1.00 57.04  ? 42  SER A OG    1 
ATOM   897  N N     . ALA C 3 26  ? 38.984 40.239  7.044   1.00 52.51  ? 43  ALA A N     1 
ATOM   898  C CA    . ALA C 3 26  ? 40.362 39.837  7.306   1.00 50.83  ? 43  ALA A CA    1 
ATOM   899  C C     . ALA C 3 26  ? 41.162 41.016  7.843   1.00 49.40  ? 43  ALA A C     1 
ATOM   900  O O     . ALA C 3 26  ? 40.598 42.041  8.243   1.00 49.48  ? 43  ALA A O     1 
ATOM   901  C CB    . ALA C 3 26  ? 41.012 39.305  6.036   1.00 50.91  ? 43  ALA A CB    1 
ATOM   902  N N     . GLY C 3 27  ? 42.481 40.866  7.842   1.00 47.37  ? 44  GLY A N     1 
ATOM   903  C CA    . GLY C 3 27  ? 43.338 41.923  8.341   1.00 45.09  ? 44  GLY A CA    1 
ATOM   904  C C     . GLY C 3 27  ? 43.407 43.166  7.469   1.00 42.95  ? 44  GLY A C     1 
ATOM   905  O O     . GLY C 3 27  ? 42.715 43.304  6.470   1.00 41.92  ? 44  GLY A O     1 
ATOM   906  N N     . SER C 3 28  ? 44.272 44.083  7.863   1.00 41.39  ? 45  SER A N     1 
ATOM   907  C CA    . SER C 3 28  ? 44.440 45.313  7.127   1.00 39.75  ? 45  SER A CA    1 
ATOM   908  C C     . SER C 3 28  ? 45.935 45.627  7.161   1.00 38.97  ? 45  SER A C     1 
ATOM   909  O O     . SER C 3 28  ? 46.484 45.934  8.219   1.00 39.75  ? 45  SER A O     1 
ATOM   910  C CB    . SER C 3 28  ? 43.614 46.405  7.802   1.00 38.89  ? 45  SER A CB    1 
ATOM   911  O OG    . SER C 3 28  ? 43.592 47.576  7.025   1.00 37.83  ? 45  SER A OG    1 
ATOM   912  N N     . ILE C 3 29  ? 46.581 45.520  6.002   1.00 37.39  ? 46  ILE A N     1 
ATOM   913  C CA    . ILE C 3 29  ? 48.014 45.748  5.852   1.00 35.79  ? 46  ILE A CA    1 
ATOM   914  C C     . ILE C 3 29  ? 48.528 47.055  6.434   1.00 35.96  ? 46  ILE A C     1 
ATOM   915  O O     . ILE C 3 29  ? 48.270 48.126  5.910   1.00 35.63  ? 46  ILE A O     1 
ATOM   916  C CB    . ILE C 3 29  ? 48.416 45.685  4.371   1.00 35.10  ? 46  ILE A CB    1 
ATOM   917  C CG1   . ILE C 3 29  ? 48.185 44.276  3.832   1.00 34.88  ? 46  ILE A CG1   1 
ATOM   918  C CG2   . ILE C 3 29  ? 49.865 46.073  4.198   1.00 34.39  ? 46  ILE A CG2   1 
ATOM   919  C CD1   . ILE C 3 29  ? 48.419 44.163  2.344   1.00 34.09  ? 46  ILE A CD1   1 
ATOM   920  N N     . PRO C 3 30  ? 49.285 46.973  7.529   1.00 36.57  ? 47  PRO A N     1 
ATOM   921  C CA    . PRO C 3 30  ? 49.838 48.161  8.178   1.00 37.72  ? 47  PRO A CA    1 
ATOM   922  C C     . PRO C 3 30  ? 50.850 48.851  7.280   1.00 39.21  ? 47  PRO A C     1 
ATOM   923  O O     . PRO C 3 30  ? 51.336 48.271  6.310   1.00 38.07  ? 47  PRO A O     1 
ATOM   924  C CB    . PRO C 3 30  ? 50.500 47.594  9.427   1.00 36.81  ? 47  PRO A CB    1 
ATOM   925  C CG    . PRO C 3 30  ? 49.731 46.353  9.691   1.00 36.65  ? 47  PRO A CG    1 
ATOM   926  C CD    . PRO C 3 30  ? 49.567 45.771  8.324   1.00 36.26  ? 47  PRO A CD    1 
ATOM   927  N N     . GLY C 3 31  ? 51.172 50.089  7.633   1.00 41.45  ? 48  GLY A N     1 
ATOM   928  C CA    . GLY C 3 31  ? 52.130 50.859  6.869   1.00 44.97  ? 48  GLY A CA    1 
ATOM   929  C C     . GLY C 3 31  ? 53.500 50.220  6.859   1.00 47.35  ? 48  GLY A C     1 
ATOM   930  O O     . GLY C 3 31  ? 53.692 49.188  6.242   1.00 48.38  ? 48  GLY A O     1 
ATOM   931  N N     . GLU C 3 32  ? 54.454 50.836  7.541   1.00 49.17  ? 49  GLU A N     1 
ATOM   932  C CA    . GLU C 3 32  ? 55.818 50.329  7.608   1.00 51.12  ? 49  GLU A CA    1 
ATOM   933  C C     . GLU C 3 32  ? 56.487 51.107  8.722   1.00 52.76  ? 49  GLU A C     1 
ATOM   934  O O     . GLU C 3 32  ? 57.471 50.669  9.322   1.00 52.97  ? 49  GLU A O     1 
ATOM   935  C CB    . GLU C 3 32  ? 56.555 50.591  6.300   1.00 51.12  ? 49  GLU A CB    1 
ATOM   936  C CG    . GLU C 3 32  ? 58.054 50.363  6.394   1.00 51.82  ? 49  GLU A CG    1 
ATOM   937  C CD    . GLU C 3 32  ? 58.796 50.874  5.177   1.00 52.27  ? 49  GLU A CD    1 
ATOM   938  O OE1   . GLU C 3 32  ? 58.659 52.076  4.861   1.00 53.27  ? 49  GLU A OE1   1 
ATOM   939  O OE2   . GLU C 3 32  ? 59.514 50.078  4.536   1.00 51.82  ? 49  GLU A OE2   1 
ATOM   940  N N     . ARG C 3 33  ? 55.939 52.286  8.976   1.00 54.16  ? 50  ARG A N     1 
ATOM   941  C CA    . ARG C 3 33  ? 56.430 53.152  10.025  1.00 55.30  ? 50  ARG A CA    1 
ATOM   942  C C     . ARG C 3 33  ? 55.299 53.306  11.029  1.00 55.83  ? 50  ARG A C     1 
ATOM   943  O O     . ARG C 3 33  ? 55.396 54.065  11.987  1.00 55.87  ? 50  ARG A O     1 
ATOM   944  C CB    . ARG C 3 33  ? 56.827 54.510  9.449   1.00 55.68  ? 50  ARG A CB    1 
ATOM   945  C CG    . ARG C 3 33  ? 58.103 54.494  8.629   1.00 56.50  ? 50  ARG A CG    1 
ATOM   946  C CD    . ARG C 3 33  ? 58.579 55.920  8.377   1.00 58.12  ? 50  ARG A CD    1 
ATOM   947  N NE    . ARG C 3 33  ? 57.836 56.572  7.306   1.00 59.23  ? 50  ARG A NE    1 
ATOM   948  C CZ    . ARG C 3 33  ? 58.167 56.482  6.023   1.00 60.01  ? 50  ARG A CZ    1 
ATOM   949  N NH1   . ARG C 3 33  ? 59.232 55.771  5.671   1.00 60.50  ? 50  ARG A NH1   1 
ATOM   950  N NH2   . ARG C 3 33  ? 57.437 57.091  5.096   1.00 59.73  ? 50  ARG A NH2   1 
ATOM   951  N N     . SER C 3 34  ? 54.218 52.575  10.795  1.00 56.68  ? 51  SER A N     1 
ATOM   952  C CA    . SER C 3 34  ? 53.077 52.625  11.688  1.00 58.34  ? 51  SER A CA    1 
ATOM   953  C C     . SER C 3 34  ? 53.496 52.082  13.039  1.00 59.33  ? 51  SER A C     1 
ATOM   954  O O     . SER C 3 34  ? 54.043 50.983  13.137  1.00 59.20  ? 51  SER A O     1 
ATOM   955  C CB    . SER C 3 34  ? 51.915 51.811  11.118  1.00 58.16  ? 51  SER A CB    1 
ATOM   956  O OG    . SER C 3 34  ? 52.396 50.799  10.257  1.00 59.29  ? 51  SER A OG    1 
ATOM   957  N N     . THR C 3 35  ? 53.246 52.876  14.076  1.00 60.71  ? 52  THR A N     1 
ATOM   958  C CA    . THR C 3 35  ? 53.596 52.512  15.442  1.00 61.77  ? 52  THR A CA    1 
ATOM   959  C C     . THR C 3 35  ? 52.338 52.118  16.209  1.00 62.41  ? 52  THR A C     1 
ATOM   960  O O     . THR C 3 35  ? 51.235 52.560  15.873  1.00 61.91  ? 52  THR A O     1 
ATOM   961  C CB    . THR C 3 35  ? 54.286 53.692  16.167  1.00 61.75  ? 52  THR A CB    1 
ATOM   962  O OG1   . THR C 3 35  ? 53.322 54.710  16.465  1.00 62.74  ? 52  THR A OG1   1 
ATOM   963  C CG2   . THR C 3 35  ? 55.366 54.297  15.280  1.00 61.65  ? 52  THR A CG2   1 
ATOM   964  N N     . ASP C 3 36  ? 52.515 51.282  17.232  1.00 63.37  ? 53  ASP A N     1 
ATOM   965  C CA    . ASP C 3 36  ? 51.413 50.803  18.068  1.00 64.05  ? 53  ASP A CA    1 
ATOM   966  C C     . ASP C 3 36  ? 50.425 51.928  18.396  1.00 63.57  ? 53  ASP A C     1 
ATOM   967  O O     . ASP C 3 36  ? 49.217 51.702  18.495  1.00 63.11  ? 53  ASP A O     1 
ATOM   968  C CB    . ASP C 3 36  ? 51.971 50.203  19.366  1.00 65.55  ? 53  ASP A CB    1 
ATOM   969  C CG    . ASP C 3 36  ? 51.555 48.748  19.572  1.00 67.36  ? 53  ASP A CG    1 
ATOM   970  O OD1   . ASP C 3 36  ? 50.334 48.471  19.642  1.00 68.25  ? 53  ASP A OD1   1 
ATOM   971  O OD2   . ASP C 3 36  ? 52.453 47.881  19.670  1.00 67.83  ? 53  ASP A OD2   1 
ATOM   972  N N     . THR C 3 37  ? 50.953 53.136  18.568  1.00 63.08  ? 54  THR A N     1 
ATOM   973  C CA    . THR C 3 37  ? 50.132 54.303  18.867  1.00 62.28  ? 54  THR A CA    1 
ATOM   974  C C     . THR C 3 37  ? 49.635 54.939  17.583  1.00 61.73  ? 54  THR A C     1 
ATOM   975  O O     . THR C 3 37  ? 48.434 54.956  17.309  1.00 61.85  ? 54  THR A O     1 
ATOM   976  C CB    . THR C 3 37  ? 50.921 55.372  19.657  1.00 62.40  ? 54  THR A CB    1 
ATOM   977  O OG1   . THR C 3 37  ? 50.393 56.671  19.355  1.00 61.95  ? 54  THR A OG1   1 
ATOM   978  C CG2   . THR C 3 37  ? 52.405 55.324  19.304  1.00 62.19  ? 54  THR A CG2   1 
ATOM   979  N N     . THR C 3 38  ? 50.574 55.458  16.800  1.00 61.20  ? 55  THR A N     1 
ATOM   980  C CA    . THR C 3 38  ? 50.265 56.109  15.531  1.00 60.99  ? 55  THR A CA    1 
ATOM   981  C C     . THR C 3 38  ? 50.419 55.179  14.312  1.00 60.48  ? 55  THR A C     1 
ATOM   982  O O     . THR C 3 38  ? 51.537 54.902  13.868  1.00 60.56  ? 55  THR A O     1 
ATOM   983  C CB    . THR C 3 38  ? 51.161 57.360  15.346  1.00 61.07  ? 55  THR A CB    1 
ATOM   984  O OG1   . THR C 3 38  ? 52.463 57.094  15.883  1.00 60.70  ? 55  THR A OG1   1 
ATOM   985  C CG2   . THR C 3 38  ? 50.560 58.562  16.058  1.00 60.76  ? 55  THR A CG2   1 
ATOM   986  N N     . LYS C 3 39  ? 49.291 54.715  13.769  1.00 59.26  ? 56  LYS A N     1 
ATOM   987  C CA    . LYS C 3 39  ? 49.305 53.824  12.607  1.00 57.86  ? 56  LYS A CA    1 
ATOM   988  C C     . LYS C 3 39  ? 49.287 54.519  11.241  1.00 56.29  ? 56  LYS A C     1 
ATOM   989  O O     . LYS C 3 39  ? 48.625 55.542  11.061  1.00 56.51  ? 56  LYS A O     1 
ATOM   990  C CB    . LYS C 3 39  ? 48.127 52.840  12.671  1.00 58.49  ? 56  LYS A CB    1 
ATOM   991  C CG    . LYS C 3 39  ? 48.011 51.987  11.401  1.00 59.66  ? 56  LYS A CG    1 
ATOM   992  C CD    . LYS C 3 39  ? 47.304 50.648  11.623  1.00 60.30  ? 56  LYS A CD    1 
ATOM   993  C CE    . LYS C 3 39  ? 47.492 49.734  10.401  1.00 60.55  ? 56  LYS A CE    1 
ATOM   994  N NZ    . LYS C 3 39  ? 46.880 48.379  10.562  1.00 60.15  ? 56  LYS A NZ    1 
ATOM   995  N N     . THR C 3 40  ? 50.009 53.945  10.279  1.00 53.92  ? 57  THR A N     1 
ATOM   996  C CA    . THR C 3 40  ? 50.068 54.483  8.919   1.00 51.70  ? 57  THR A CA    1 
ATOM   997  C C     . THR C 3 40  ? 49.673 53.361  7.961   1.00 50.26  ? 57  THR A C     1 
ATOM   998  O O     . THR C 3 40  ? 49.529 52.222  8.388   1.00 50.80  ? 57  THR A O     1 
ATOM   999  C CB    . THR C 3 40  ? 51.478 54.956  8.569   1.00 51.31  ? 57  THR A CB    1 
ATOM   1000 O OG1   . THR C 3 40  ? 52.333 53.821  8.410   1.00 51.16  ? 57  THR A OG1   1 
ATOM   1001 C CG2   . THR C 3 40  ? 52.025 55.833  9.674   1.00 50.60  ? 57  THR A CG2   1 
ATOM   1002 N N     . HIS C 3 41  ? 49.488 53.668  6.679   1.00 48.33  ? 58  HIS A N     1 
ATOM   1003 C CA    . HIS C 3 41  ? 49.102 52.636  5.711   1.00 46.50  ? 58  HIS A CA    1 
ATOM   1004 C C     . HIS C 3 41  ? 49.783 52.812  4.363   1.00 44.89  ? 58  HIS A C     1 
ATOM   1005 O O     . HIS C 3 41  ? 50.340 53.872  4.078   1.00 45.53  ? 58  HIS A O     1 
ATOM   1006 C CB    . HIS C 3 41  ? 47.593 52.645  5.460   1.00 46.98  ? 58  HIS A CB    1 
ATOM   1007 C CG    . HIS C 3 41  ? 46.768 52.833  6.688   1.00 46.72  ? 58  HIS A CG    1 
ATOM   1008 N ND1   . HIS C 3 41  ? 46.622 54.057  7.302   1.00 46.96  ? 58  HIS A ND1   1 
ATOM   1009 C CD2   . HIS C 3 41  ? 46.026 51.958  7.406   1.00 47.08  ? 58  HIS A CD2   1 
ATOM   1010 C CE1   . HIS C 3 41  ? 45.823 53.929  8.346   1.00 47.83  ? 58  HIS A CE1   1 
ATOM   1011 N NE2   . HIS C 3 41  ? 45.448 52.664  8.431   1.00 47.46  ? 58  HIS A NE2   1 
ATOM   1012 N N     . PRO C 3 42  ? 49.733 51.775  3.509   1.00 42.76  ? 59  PRO A N     1 
ATOM   1013 C CA    . PRO C 3 42  ? 50.343 51.812  2.176   1.00 41.69  ? 59  PRO A CA    1 
ATOM   1014 C C     . PRO C 3 42  ? 50.009 53.129  1.503   1.00 41.09  ? 59  PRO A C     1 
ATOM   1015 O O     . PRO C 3 42  ? 48.842 53.472  1.363   1.00 41.22  ? 59  PRO A O     1 
ATOM   1016 C CB    . PRO C 3 42  ? 49.693 50.631  1.482   1.00 41.67  ? 59  PRO A CB    1 
ATOM   1017 C CG    . PRO C 3 42  ? 49.573 49.647  2.591   1.00 41.45  ? 59  PRO A CG    1 
ATOM   1018 C CD    . PRO C 3 42  ? 49.080 50.477  3.748   1.00 41.71  ? 59  PRO A CD    1 
ATOM   1019 N N     . THR C 3 43  ? 51.022 53.870  1.076   1.00 40.68  ? 60  THR A N     1 
ATOM   1020 C CA    . THR C 3 43  ? 50.763 55.165  0.463   1.00 39.94  ? 60  THR A CA    1 
ATOM   1021 C C     . THR C 3 43  ? 51.593 55.512  -0.764  1.00 40.29  ? 60  THR A C     1 
ATOM   1022 O O     . THR C 3 43  ? 52.823 55.487  -0.724  1.00 40.06  ? 60  THR A O     1 
ATOM   1023 C CB    . THR C 3 43  ? 50.962 56.275  1.499   1.00 39.36  ? 60  THR A CB    1 
ATOM   1024 O OG1   . THR C 3 43  ? 50.119 56.020  2.627   1.00 38.10  ? 60  THR A OG1   1 
ATOM   1025 C CG2   . THR C 3 43  ? 50.625 57.628  0.907   1.00 38.63  ? 60  THR A CG2   1 
ATOM   1026 N N     . ILE C 3 44  ? 50.904 55.852  -1.850  1.00 41.07  ? 61  ILE A N     1 
ATOM   1027 C CA    . ILE C 3 44  ? 51.564 56.247  -3.089  1.00 42.38  ? 61  ILE A CA    1 
ATOM   1028 C C     . ILE C 3 44  ? 51.327 57.726  -3.394  1.00 43.16  ? 61  ILE A C     1 
ATOM   1029 O O     . ILE C 3 44  ? 50.452 58.358  -2.825  1.00 42.46  ? 61  ILE A O     1 
ATOM   1030 C CB    . ILE C 3 44  ? 51.045 55.451  -4.299  1.00 42.16  ? 61  ILE A CB    1 
ATOM   1031 C CG1   . ILE C 3 44  ? 49.550 55.707  -4.487  1.00 42.30  ? 61  ILE A CG1   1 
ATOM   1032 C CG2   . ILE C 3 44  ? 51.325 53.972  -4.113  1.00 43.44  ? 61  ILE A CG2   1 
ATOM   1033 C CD1   . ILE C 3 44  ? 48.964 55.045  -5.716  1.00 42.04  ? 61  ILE A CD1   1 
ATOM   1034 N N     . LYS C 3 45  ? 52.128 58.266  -4.301  1.00 44.94  ? 62  LYS A N     1 
ATOM   1035 C CA    . LYS C 3 45  ? 51.998 59.651  -4.735  1.00 46.41  ? 62  LYS A CA    1 
ATOM   1036 C C     . LYS C 3 45  ? 52.108 59.633  -6.252  1.00 47.32  ? 62  LYS A C     1 
ATOM   1037 O O     . LYS C 3 45  ? 52.943 58.916  -6.801  1.00 47.66  ? 62  LYS A O     1 
ATOM   1038 C CB    . LYS C 3 45  ? 53.127 60.507  -4.172  1.00 46.73  ? 62  LYS A CB    1 
ATOM   1039 C CG    . LYS C 3 45  ? 53.090 61.953  -4.643  1.00 47.20  ? 62  LYS A CG    1 
ATOM   1040 C CD    . LYS C 3 45  ? 54.486 62.554  -4.622  1.00 48.12  ? 62  LYS A CD    1 
ATOM   1041 C CE    . LYS C 3 45  ? 54.446 64.053  -4.836  1.00 48.53  ? 62  LYS A CE    1 
ATOM   1042 N NZ    . LYS C 3 45  ? 53.706 64.728  -3.731  1.00 49.36  ? 62  LYS A NZ    1 
ATOM   1043 N N     . ILE C 3 46  ? 51.273 60.405  -6.936  1.00 48.21  ? 63  ILE A N     1 
ATOM   1044 C CA    . ILE C 3 46  ? 51.341 60.446  -8.390  1.00 49.19  ? 63  ILE A CA    1 
ATOM   1045 C C     . ILE C 3 46  ? 52.184 61.645  -8.822  1.00 50.72  ? 63  ILE A C     1 
ATOM   1046 O O     . ILE C 3 46  ? 51.715 62.775  -8.778  1.00 51.06  ? 63  ILE A O     1 
ATOM   1047 C CB    . ILE C 3 46  ? 49.950 60.588  -9.006  1.00 48.21  ? 63  ILE A CB    1 
ATOM   1048 C CG1   . ILE C 3 46  ? 48.986 59.585  -8.375  1.00 47.53  ? 63  ILE A CG1   1 
ATOM   1049 C CG2   . ILE C 3 46  ? 50.037 60.370  -10.501 1.00 48.37  ? 63  ILE A CG2   1 
ATOM   1050 C CD1   . ILE C 3 46  ? 49.368 58.143  -8.582  1.00 47.32  ? 63  ILE A CD1   1 
ATOM   1051 N N     . ASN C 3 47  ? 53.428 61.403  -9.227  1.00 52.55  ? 64  ASN A N     1 
ATOM   1052 C CA    . ASN C 3 47  ? 54.303 62.490  -9.656  1.00 54.65  ? 64  ASN A CA    1 
ATOM   1053 C C     . ASN C 3 47  ? 54.017 62.902  -11.089 1.00 55.31  ? 64  ASN A C     1 
ATOM   1054 O O     . ASN C 3 47  ? 53.697 62.066  -11.940 1.00 55.40  ? 64  ASN A O     1 
ATOM   1055 C CB    . ASN C 3 47  ? 55.783 62.095  -9.541  1.00 56.43  ? 64  ASN A CB    1 
ATOM   1056 C CG    . ASN C 3 47  ? 56.248 61.946  -8.094  1.00 58.36  ? 64  ASN A CG    1 
ATOM   1057 O OD1   . ASN C 3 47  ? 56.124 62.870  -7.283  1.00 59.32  ? 64  ASN A OD1   1 
ATOM   1058 N ND2   . ASN C 3 47  ? 56.796 60.778  -7.768  1.00 59.10  ? 64  ASN A ND2   1 
ATOM   1059 N N     . GLY C 3 48  ? 54.139 64.199  -11.352 1.00 55.83  ? 65  GLY A N     1 
ATOM   1060 C CA    . GLY C 3 48  ? 53.895 64.704  -12.687 1.00 56.74  ? 65  GLY A CA    1 
ATOM   1061 C C     . GLY C 3 48  ? 52.427 64.735  -13.076 1.00 57.37  ? 65  GLY A C     1 
ATOM   1062 O O     . GLY C 3 48  ? 52.099 64.947  -14.249 1.00 57.85  ? 65  GLY A O     1 
ATOM   1063 N N     . TYR C 3 49  ? 51.539 64.523  -12.105 1.00 57.31  ? 66  TYR A N     1 
ATOM   1064 C CA    . TYR C 3 49  ? 50.105 64.543  -12.377 1.00 57.07  ? 66  TYR A CA    1 
ATOM   1065 C C     . TYR C 3 49  ? 49.264 64.748  -11.129 1.00 57.03  ? 66  TYR A C     1 
ATOM   1066 O O     . TYR C 3 49  ? 49.702 64.486  -10.008 1.00 57.11  ? 66  TYR A O     1 
ATOM   1067 C CB    . TYR C 3 49  ? 49.679 63.245  -13.068 1.00 57.21  ? 66  TYR A CB    1 
ATOM   1068 C CG    . TYR C 3 49  ? 48.206 63.164  -13.426 1.00 57.37  ? 66  TYR A CG    1 
ATOM   1069 C CD1   . TYR C 3 49  ? 47.250 62.816  -12.475 1.00 57.31  ? 66  TYR A CD1   1 
ATOM   1070 C CD2   . TYR C 3 49  ? 47.769 63.438  -14.724 1.00 57.97  ? 66  TYR A CD2   1 
ATOM   1071 C CE1   . TYR C 3 49  ? 45.899 62.741  -12.808 1.00 57.55  ? 66  TYR A CE1   1 
ATOM   1072 C CE2   . TYR C 3 49  ? 46.422 63.367  -15.067 1.00 57.51  ? 66  TYR A CE2   1 
ATOM   1073 C CZ    . TYR C 3 49  ? 45.495 63.017  -14.106 1.00 57.73  ? 66  TYR A CZ    1 
ATOM   1074 O OH    . TYR C 3 49  ? 44.168 62.926  -14.447 1.00 57.73  ? 66  TYR A OH    1 
ATOM   1075 N N     . THR C 3 50  ? 48.048 65.234  -11.345 1.00 56.86  ? 67  THR A N     1 
ATOM   1076 C CA    . THR C 3 50  ? 47.091 65.469  -10.271 1.00 56.33  ? 67  THR A CA    1 
ATOM   1077 C C     . THR C 3 50  ? 45.747 65.821  -10.904 1.00 55.57  ? 67  THR A C     1 
ATOM   1078 O O     . THR C 3 50  ? 45.625 66.814  -11.631 1.00 55.73  ? 67  THR A O     1 
ATOM   1079 C CB    . THR C 3 50  ? 47.560 66.605  -9.334  1.00 56.32  ? 67  THR A CB    1 
ATOM   1080 O OG1   . THR C 3 50  ? 46.642 66.734  -8.241  1.00 56.22  ? 67  THR A OG1   1 
ATOM   1081 C CG2   . THR C 3 50  ? 47.660 67.920  -10.092 1.00 57.18  ? 67  THR A CG2   1 
ATOM   1082 N N     . GLY C 3 51  ? 44.746 64.984  -10.647 1.00 54.29  ? 68  GLY A N     1 
ATOM   1083 C CA    . GLY C 3 51  ? 43.434 65.218  -11.215 1.00 52.69  ? 68  GLY A CA    1 
ATOM   1084 C C     . GLY C 3 51  ? 42.539 63.995  -11.219 1.00 51.64  ? 68  GLY A C     1 
ATOM   1085 O O     . GLY C 3 51  ? 42.499 63.236  -10.252 1.00 52.51  ? 68  GLY A O     1 
ATOM   1086 N N     . PRO C 3 52  ? 41.799 63.775  -12.307 1.00 50.06  ? 69  PRO A N     1 
ATOM   1087 C CA    . PRO C 3 52  ? 40.903 62.623  -12.393 1.00 48.80  ? 69  PRO A CA    1 
ATOM   1088 C C     . PRO C 3 52  ? 41.587 61.393  -12.943 1.00 47.56  ? 69  PRO A C     1 
ATOM   1089 O O     . PRO C 3 52  ? 42.520 61.487  -13.744 1.00 46.68  ? 69  PRO A O     1 
ATOM   1090 C CB    . PRO C 3 52  ? 39.790 63.103  -13.331 1.00 49.41  ? 69  PRO A CB    1 
ATOM   1091 C CG    . PRO C 3 52  ? 40.012 64.609  -13.447 1.00 50.38  ? 69  PRO A CG    1 
ATOM   1092 C CD    . PRO C 3 52  ? 41.496 64.743  -13.365 1.00 50.21  ? 69  PRO A CD    1 
ATOM   1093 N N     . GLY C 3 53  ? 41.087 60.237  -12.521 1.00 46.43  ? 70  GLY A N     1 
ATOM   1094 C CA    . GLY C 3 53  ? 41.639 58.973  -12.970 1.00 44.63  ? 70  GLY A CA    1 
ATOM   1095 C C     . GLY C 3 53  ? 41.215 57.862  -12.035 1.00 43.12  ? 70  GLY A C     1 
ATOM   1096 O O     . GLY C 3 53  ? 40.304 58.038  -11.223 1.00 43.68  ? 70  GLY A O     1 
ATOM   1097 N N     . THR C 3 54  ? 41.870 56.714  -12.137 1.00 40.77  ? 71  THR A N     1 
ATOM   1098 C CA    . THR C 3 54  ? 41.532 55.596  -11.275 1.00 38.93  ? 71  THR A CA    1 
ATOM   1099 C C     . THR C 3 54  ? 42.793 54.815  -10.874 1.00 38.23  ? 71  THR A C     1 
ATOM   1100 O O     . THR C 3 54  ? 43.848 54.962  -11.499 1.00 38.74  ? 71  THR A O     1 
ATOM   1101 C CB    . THR C 3 54  ? 40.477 54.676  -11.979 1.00 38.54  ? 71  THR A CB    1 
ATOM   1102 O OG1   . THR C 3 54  ? 40.490 53.365  -11.399 1.00 37.83  ? 71  THR A OG1   1 
ATOM   1103 C CG2   . THR C 3 54  ? 40.749 54.585  -13.466 1.00 37.93  ? 71  THR A CG2   1 
ATOM   1104 N N     . VAL C 3 55  ? 42.692 54.019  -9.807  1.00 36.24  ? 72  VAL A N     1 
ATOM   1105 C CA    . VAL C 3 55  ? 43.809 53.200  -9.337  1.00 33.60  ? 72  VAL A CA    1 
ATOM   1106 C C     . VAL C 3 55  ? 43.383 51.779  -8.980  1.00 31.95  ? 72  VAL A C     1 
ATOM   1107 O O     . VAL C 3 55  ? 42.354 51.554  -8.336  1.00 31.54  ? 72  VAL A O     1 
ATOM   1108 C CB    . VAL C 3 55  ? 44.518 53.818  -8.100  1.00 33.78  ? 72  VAL A CB    1 
ATOM   1109 C CG1   . VAL C 3 55  ? 43.526 54.073  -6.978  1.00 33.64  ? 72  VAL A CG1   1 
ATOM   1110 C CG2   . VAL C 3 55  ? 45.598 52.874  -7.613  1.00 33.46  ? 72  VAL A CG2   1 
ATOM   1111 N N     . ARG C 3 56  ? 44.184 50.816  -9.417  1.00 30.14  ? 73  ARG A N     1 
ATOM   1112 C CA    . ARG C 3 56  ? 43.916 49.412  -9.136  1.00 28.14  ? 73  ARG A CA    1 
ATOM   1113 C C     . ARG C 3 56  ? 45.125 48.781  -8.434  1.00 26.60  ? 73  ARG A C     1 
ATOM   1114 O O     . ARG C 3 56  ? 46.269 49.091  -8.755  1.00 26.64  ? 73  ARG A O     1 
ATOM   1115 C CB    . ARG C 3 56  ? 43.615 48.643  -10.428 1.00 27.18  ? 73  ARG A CB    1 
ATOM   1116 C CG    . ARG C 3 56  ? 43.595 47.138  -10.208 1.00 27.73  ? 73  ARG A CG    1 
ATOM   1117 C CD    . ARG C 3 56  ? 43.438 46.337  -11.475 1.00 26.75  ? 73  ARG A CD    1 
ATOM   1118 N NE    . ARG C 3 56  ? 42.119 46.495  -12.074 1.00 27.89  ? 73  ARG A NE    1 
ATOM   1119 C CZ    . ARG C 3 56  ? 41.626 45.688  -13.008 1.00 27.52  ? 73  ARG A CZ    1 
ATOM   1120 N NH1   . ARG C 3 56  ? 42.337 44.659  -13.449 1.00 27.91  ? 73  ARG A NH1   1 
ATOM   1121 N NH2   . ARG C 3 56  ? 40.425 45.909  -13.505 1.00 27.05  ? 73  ARG A NH2   1 
ATOM   1122 N N     . ILE C 3 57  ? 44.868 47.906  -7.472  1.00 24.60  ? 74  ILE A N     1 
ATOM   1123 C CA    . ILE C 3 57  ? 45.939 47.238  -6.756  1.00 23.29  ? 74  ILE A CA    1 
ATOM   1124 C C     . ILE C 3 57  ? 45.686 45.738  -6.767  1.00 22.70  ? 74  ILE A C     1 
ATOM   1125 O O     . ILE C 3 57  ? 44.645 45.281  -6.306  1.00 22.38  ? 74  ILE A O     1 
ATOM   1126 C CB    . ILE C 3 57  ? 46.028 47.711  -5.283  1.00 23.95  ? 74  ILE A CB    1 
ATOM   1127 C CG1   . ILE C 3 57  ? 46.199 49.229  -5.210  1.00 24.00  ? 74  ILE A CG1   1 
ATOM   1128 C CG2   . ILE C 3 57  ? 47.223 47.073  -4.606  1.00 23.82  ? 74  ILE A CG2   1 
ATOM   1129 C CD1   . ILE C 3 57  ? 46.246 49.770  -3.782  1.00 23.39  ? 74  ILE A CD1   1 
ATOM   1130 N N     . SER C 3 58  ? 46.634 44.973  -7.306  1.00 22.33  ? 75  SER A N     1 
ATOM   1131 C CA    . SER C 3 58  ? 46.504 43.516  -7.340  1.00 20.84  ? 75  SER A CA    1 
ATOM   1132 C C     . SER C 3 58  ? 47.727 42.892  -6.694  1.00 19.86  ? 75  SER A C     1 
ATOM   1133 O O     . SER C 3 58  ? 48.616 43.594  -6.222  1.00 19.36  ? 75  SER A O     1 
ATOM   1134 C CB    . SER C 3 58  ? 46.382 43.015  -8.773  1.00 21.37  ? 75  SER A CB    1 
ATOM   1135 O OG    . SER C 3 58  ? 47.550 43.333  -9.506  1.00 22.48  ? 75  SER A OG    1 
ATOM   1136 N N     . LEU C 3 59  ? 47.763 41.564  -6.684  1.00 19.28  ? 76  LEU A N     1 
ATOM   1137 C CA    . LEU C 3 59  ? 48.866 40.824  -6.088  1.00 17.88  ? 76  LEU A CA    1 
ATOM   1138 C C     . LEU C 3 59  ? 49.709 40.058  -7.105  1.00 18.42  ? 76  LEU A C     1 
ATOM   1139 O O     . LEU C 3 59  ? 49.193 39.250  -7.865  1.00 19.26  ? 76  LEU A O     1 
ATOM   1140 C CB    . LEU C 3 59  ? 48.330 39.824  -5.053  1.00 16.21  ? 76  LEU A CB    1 
ATOM   1141 C CG    . LEU C 3 59  ? 47.549 40.291  -3.820  1.00 15.01  ? 76  LEU A CG    1 
ATOM   1142 C CD1   . LEU C 3 59  ? 47.215 39.109  -2.941  1.00 14.74  ? 76  LEU A CD1   1 
ATOM   1143 C CD2   . LEU C 3 59  ? 48.371 41.273  -3.033  1.00 16.79  ? 76  LEU A CD2   1 
ATOM   1144 N N     . VAL C 3 60  ? 51.012 40.305  -7.124  1.00 18.90  ? 77  VAL A N     1 
ATOM   1145 C CA    . VAL C 3 60  ? 51.887 39.562  -8.033  1.00 17.76  ? 77  VAL A CA    1 
ATOM   1146 C C     . VAL C 3 60  ? 52.904 38.818  -7.197  1.00 17.88  ? 77  VAL A C     1 
ATOM   1147 O O     . VAL C 3 60  ? 53.106 39.149  -6.028  1.00 18.03  ? 77  VAL A O     1 
ATOM   1148 C CB    . VAL C 3 60  ? 52.637 40.481  -8.981  1.00 17.36  ? 77  VAL A CB    1 
ATOM   1149 C CG1   . VAL C 3 60  ? 51.692 41.021  -10.015 1.00 17.55  ? 77  VAL A CG1   1 
ATOM   1150 C CG2   . VAL C 3 60  ? 53.283 41.601  -8.199  1.00 17.13  ? 77  VAL A CG2   1 
ATOM   1151 N N     . THR C 3 61  ? 53.547 37.815  -7.777  1.00 17.25  ? 78  THR A N     1 
ATOM   1152 C CA    . THR C 3 61  ? 54.540 37.065  -7.028  1.00 17.56  ? 78  THR A CA    1 
ATOM   1153 C C     . THR C 3 61  ? 55.703 37.969  -6.602  1.00 19.74  ? 78  THR A C     1 
ATOM   1154 O O     . THR C 3 61  ? 55.791 39.142  -6.981  1.00 17.76  ? 78  THR A O     1 
ATOM   1155 C CB    . THR C 3 61  ? 55.090 35.885  -7.840  1.00 16.05  ? 78  THR A CB    1 
ATOM   1156 O OG1   . THR C 3 61  ? 55.600 36.351  -9.090  1.00 16.19  ? 78  THR A OG1   1 
ATOM   1157 C CG2   . THR C 3 61  ? 54.006 34.887  -8.124  1.00 15.74  ? 78  THR A CG2   1 
ATOM   1158 N N     . LYS C 3 62  ? 56.586 37.410  -5.787  1.00 22.54  ? 79  LYS A N     1 
ATOM   1159 C CA    . LYS C 3 62  ? 57.747 38.129  -5.283  1.00 24.07  ? 79  LYS A CA    1 
ATOM   1160 C C     . LYS C 3 62  ? 58.803 38.281  -6.374  1.00 25.06  ? 79  LYS A C     1 
ATOM   1161 O O     . LYS C 3 62  ? 59.254 39.386  -6.672  1.00 25.02  ? 79  LYS A O     1 
ATOM   1162 C CB    . LYS C 3 62  ? 58.319 37.371  -4.077  1.00 24.91  ? 79  LYS A CB    1 
ATOM   1163 C CG    . LYS C 3 62  ? 59.641 37.897  -3.512  1.00 26.40  ? 79  LYS A CG    1 
ATOM   1164 C CD    . LYS C 3 62  ? 60.104 37.036  -2.345  1.00 25.77  ? 79  LYS A CD    1 
ATOM   1165 C CE    . LYS C 3 62  ? 61.622 36.970  -2.237  1.00 28.49  ? 79  LYS A CE    1 
ATOM   1166 N NZ    . LYS C 3 62  ? 62.324 38.282  -1.995  1.00 29.66  ? 79  LYS A NZ    1 
ATOM   1167 N N     . ASP C 3 63  ? 59.165 37.173  -7.002  1.00 26.19  ? 80  ASP A N     1 
ATOM   1168 C CA    . ASP C 3 63  ? 60.195 37.211  -8.028  1.00 27.87  ? 80  ASP A CA    1 
ATOM   1169 C C     . ASP C 3 63  ? 59.841 37.677  -9.443  1.00 29.73  ? 80  ASP A C     1 
ATOM   1170 O O     . ASP C 3 63  ? 58.709 37.529  -9.895  1.00 30.42  ? 80  ASP A O     1 
ATOM   1171 C CB    . ASP C 3 63  ? 60.892 35.863  -8.054  1.00 26.90  ? 80  ASP A CB    1 
ATOM   1172 C CG    . ASP C 3 63  ? 61.744 35.648  -6.819  1.00 25.60  ? 80  ASP A CG    1 
ATOM   1173 O OD1   . ASP C 3 63  ? 62.319 34.549  -6.683  1.00 25.34  ? 80  ASP A OD1   1 
ATOM   1174 O OD2   . ASP C 3 63  ? 61.835 36.591  -5.997  1.00 22.23  ? 80  ASP A OD2   1 
ATOM   1175 N N     . PRO C 3 64  ? 60.838 38.240  -10.158 1.00 30.83  ? 81  PRO A N     1 
ATOM   1176 C CA    . PRO C 3 64  ? 60.883 38.806  -11.503 1.00 31.19  ? 81  PRO A CA    1 
ATOM   1177 C C     . PRO C 3 64  ? 59.767 38.568  -12.477 1.00 31.59  ? 81  PRO A C     1 
ATOM   1178 O O     . PRO C 3 64  ? 59.147 39.533  -12.933 1.00 34.64  ? 81  PRO A O     1 
ATOM   1179 C CB    . PRO C 3 64  ? 62.218 38.347  -12.003 1.00 31.42  ? 81  PRO A CB    1 
ATOM   1180 C CG    . PRO C 3 64  ? 63.034 38.655  -10.834 1.00 32.12  ? 81  PRO A CG    1 
ATOM   1181 C CD    . PRO C 3 64  ? 62.221 38.058  -9.689  1.00 31.51  ? 81  PRO A CD    1 
ATOM   1182 N N     . PRO C 3 65  ? 59.501 37.316  -12.868 1.00 29.68  ? 82  PRO A N     1 
ATOM   1183 C CA    . PRO C 3 65  ? 58.363 37.334  -13.813 1.00 27.91  ? 82  PRO A CA    1 
ATOM   1184 C C     . PRO C 3 65  ? 57.123 37.493  -12.925 1.00 25.94  ? 82  PRO A C     1 
ATOM   1185 O O     . PRO C 3 65  ? 56.435 36.523  -12.610 1.00 26.17  ? 82  PRO A O     1 
ATOM   1186 C CB    . PRO C 3 65  ? 58.460 35.971  -14.506 1.00 27.88  ? 82  PRO A CB    1 
ATOM   1187 C CG    . PRO C 3 65  ? 59.943 35.606  -14.348 1.00 28.41  ? 82  PRO A CG    1 
ATOM   1188 C CD    . PRO C 3 65  ? 60.238 36.048  -12.922 1.00 28.19  ? 82  PRO A CD    1 
ATOM   1189 N N     . HIS C 3 66  ? 56.888 38.723  -12.479 1.00 24.29  ? 83  HIS A N     1 
ATOM   1190 C CA    . HIS C 3 66  ? 55.781 39.018  -11.577 1.00 24.09  ? 83  HIS A CA    1 
ATOM   1191 C C     . HIS C 3 66  ? 54.445 38.665  -12.167 1.00 23.62  ? 83  HIS A C     1 
ATOM   1192 O O     . HIS C 3 66  ? 53.761 39.504  -12.746 1.00 23.54  ? 83  HIS A O     1 
ATOM   1193 C CB    . HIS C 3 66  ? 55.808 40.481  -11.165 1.00 23.36  ? 83  HIS A CB    1 
ATOM   1194 C CG    . HIS C 3 66  ? 57.133 40.919  -10.639 1.00 24.35  ? 83  HIS A CG    1 
ATOM   1195 N ND1   . HIS C 3 66  ? 58.041 41.618  -11.402 1.00 24.96  ? 83  HIS A ND1   1 
ATOM   1196 C CD2   . HIS C 3 66  ? 57.735 40.703  -9.445  1.00 25.17  ? 83  HIS A CD2   1 
ATOM   1197 C CE1   . HIS C 3 66  ? 59.145 41.812  -10.702 1.00 25.33  ? 83  HIS A CE1   1 
ATOM   1198 N NE2   . HIS C 3 66  ? 58.986 41.265  -9.511  1.00 25.05  ? 83  HIS A NE2   1 
ATOM   1199 N N     . ARG C 3 67  ? 54.080 37.401  -12.011 1.00 22.93  ? 84  ARG A N     1 
ATOM   1200 C CA    . ARG C 3 67  ? 52.840 36.925  -12.556 1.00 23.54  ? 84  ARG A CA    1 
ATOM   1201 C C     . ARG C 3 67  ? 51.706 37.071  -11.569 1.00 23.58  ? 84  ARG A C     1 
ATOM   1202 O O     . ARG C 3 67  ? 51.931 37.310  -10.395 1.00 24.97  ? 84  ARG A O     1 
ATOM   1203 C CB    . ARG C 3 67  ? 53.008 35.476  -12.997 1.00 24.13  ? 84  ARG A CB    1 
ATOM   1204 C CG    . ARG C 3 67  ? 53.641 34.607  -11.974 1.00 24.92  ? 84  ARG A CG    1 
ATOM   1205 C CD    . ARG C 3 67  ? 54.341 33.430  -12.621 1.00 25.71  ? 84  ARG A CD    1 
ATOM   1206 N NE    . ARG C 3 67  ? 55.001 32.638  -11.589 1.00 26.51  ? 84  ARG A NE    1 
ATOM   1207 C CZ    . ARG C 3 67  ? 54.769 31.352  -11.372 1.00 27.00  ? 84  ARG A CZ    1 
ATOM   1208 N NH1   . ARG C 3 67  ? 53.899 30.685  -12.123 1.00 27.90  ? 84  ARG A NH1   1 
ATOM   1209 N NH2   . ARG C 3 67  ? 55.368 30.747  -10.365 1.00 27.68  ? 84  ARG A NH2   1 
ATOM   1210 N N     . PRO C 3 68  ? 50.460 36.959  -12.043 1.00 23.29  ? 85  PRO A N     1 
ATOM   1211 C CA    . PRO C 3 68  ? 49.300 37.084  -11.166 1.00 23.02  ? 85  PRO A CA    1 
ATOM   1212 C C     . PRO C 3 68  ? 49.437 36.085  -10.029 1.00 23.05  ? 85  PRO A C     1 
ATOM   1213 O O     . PRO C 3 68  ? 49.779 34.929  -10.260 1.00 23.57  ? 85  PRO A O     1 
ATOM   1214 C CB    . PRO C 3 68  ? 48.140 36.737  -12.089 1.00 23.20  ? 85  PRO A CB    1 
ATOM   1215 C CG    . PRO C 3 68  ? 48.651 37.116  -13.434 1.00 23.59  ? 85  PRO A CG    1 
ATOM   1216 C CD    . PRO C 3 68  ? 50.041 36.598  -13.406 1.00 23.11  ? 85  PRO A CD    1 
ATOM   1217 N N     . HIS C 3 69  ? 49.171 36.526  -8.810  1.00 23.28  ? 86  HIS A N     1 
ATOM   1218 C CA    . HIS C 3 69  ? 49.285 35.653  -7.663  1.00 23.53  ? 86  HIS A CA    1 
ATOM   1219 C C     . HIS C 3 69  ? 47.928 35.046  -7.317  1.00 24.31  ? 86  HIS A C     1 
ATOM   1220 O O     . HIS C 3 69  ? 46.901 35.727  -7.373  1.00 24.55  ? 86  HIS A O     1 
ATOM   1221 C CB    . HIS C 3 69  ? 49.805 36.444  -6.466  1.00 24.11  ? 86  HIS A CB    1 
ATOM   1222 C CG    . HIS C 3 69  ? 50.289 35.583  -5.337  1.00 24.51  ? 86  HIS A CG    1 
ATOM   1223 N ND1   . HIS C 3 69  ? 49.494 34.638  -4.724  1.00 24.29  ? 86  HIS A ND1   1 
ATOM   1224 C CD2   . HIS C 3 69  ? 51.497 35.507  -4.733  1.00 23.25  ? 86  HIS A CD2   1 
ATOM   1225 C CE1   . HIS C 3 69  ? 50.196 34.015  -3.795  1.00 24.75  ? 86  HIS A CE1   1 
ATOM   1226 N NE2   . HIS C 3 69  ? 51.413 34.525  -3.780  1.00 23.52  ? 86  HIS A NE2   1 
ATOM   1227 N N     . PRO C 3 70  ? 47.908 33.755  -6.948  1.00 24.40  ? 87  PRO A N     1 
ATOM   1228 C CA    . PRO C 3 70  ? 46.653 33.086  -6.591  1.00 25.05  ? 87  PRO A CA    1 
ATOM   1229 C C     . PRO C 3 70  ? 45.890 33.756  -5.441  1.00 25.24  ? 87  PRO A C     1 
ATOM   1230 O O     . PRO C 3 70  ? 44.665 33.847  -5.480  1.00 26.44  ? 87  PRO A O     1 
ATOM   1231 C CB    . PRO C 3 70  ? 47.096 31.650  -6.262  1.00 24.58  ? 87  PRO A CB    1 
ATOM   1232 C CG    . PRO C 3 70  ? 48.567 31.786  -5.939  1.00 23.95  ? 87  PRO A CG    1 
ATOM   1233 C CD    . PRO C 3 70  ? 49.035 32.807  -6.929  1.00 23.99  ? 87  PRO A CD    1 
ATOM   1234 N N     . HIS C 3 71  ? 46.586 34.234  -4.422  1.00 24.67  ? 88  HIS A N     1 
ATOM   1235 C CA    . HIS C 3 71  ? 45.863 34.881  -3.341  1.00 25.95  ? 88  HIS A CA    1 
ATOM   1236 C C     . HIS C 3 71  ? 44.995 36.031  -3.860  1.00 27.13  ? 88  HIS A C     1 
ATOM   1237 O O     . HIS C 3 71  ? 45.163 36.486  -4.997  1.00 25.92  ? 88  HIS A O     1 
ATOM   1238 C CB    . HIS C 3 71  ? 46.820 35.407  -2.274  1.00 25.18  ? 88  HIS A CB    1 
ATOM   1239 C CG    . HIS C 3 71  ? 47.624 34.334  -1.607  1.00 25.65  ? 88  HIS A CG    1 
ATOM   1240 N ND1   . HIS C 3 71  ? 47.221 33.016  -1.571  1.00 25.04  ? 88  HIS A ND1   1 
ATOM   1241 C CD2   . HIS C 3 71  ? 48.806 34.385  -0.947  1.00 24.48  ? 88  HIS A CD2   1 
ATOM   1242 C CE1   . HIS C 3 71  ? 48.121 32.300  -0.923  1.00 24.46  ? 88  HIS A CE1   1 
ATOM   1243 N NE2   . HIS C 3 71  ? 49.092 33.107  -0.535  1.00 25.18  ? 88  HIS A NE2   1 
ATOM   1244 N N     . GLU C 3 72  ? 44.057 36.471  -3.019  1.00 28.91  ? 89  GLU A N     1 
ATOM   1245 C CA    . GLU C 3 72  ? 43.153 37.570  -3.337  1.00 30.69  ? 89  GLU A CA    1 
ATOM   1246 C C     . GLU C 3 72  ? 43.427 38.738  -2.406  1.00 31.32  ? 89  GLU A C     1 
ATOM   1247 O O     . GLU C 3 72  ? 43.811 38.549  -1.263  1.00 32.56  ? 89  GLU A O     1 
ATOM   1248 C CB    . GLU C 3 72  ? 41.700 37.156  -3.147  1.00 31.72  ? 89  GLU A CB    1 
ATOM   1249 C CG    . GLU C 3 72  ? 41.135 36.223  -4.194  1.00 32.96  ? 89  GLU A CG    1 
ATOM   1250 C CD    . GLU C 3 72  ? 39.638 35.974  -3.991  1.00 33.92  ? 89  GLU A CD    1 
ATOM   1251 O OE1   . GLU C 3 72  ? 39.147 34.929  -4.480  1.00 32.68  ? 89  GLU A OE1   1 
ATOM   1252 O OE2   . GLU C 3 72  ? 38.962 36.828  -3.352  1.00 33.50  ? 89  GLU A OE2   1 
ATOM   1253 N N     . LEU C 3 73  ? 43.208 39.948  -2.885  1.00 31.90  ? 90  LEU A N     1 
ATOM   1254 C CA    . LEU C 3 73  ? 43.431 41.129  -2.073  1.00 33.05  ? 90  LEU A CA    1 
ATOM   1255 C C     . LEU C 3 73  ? 42.060 41.615  -1.591  1.00 34.34  ? 90  LEU A C     1 
ATOM   1256 O O     . LEU C 3 73  ? 41.487 42.542  -2.156  1.00 34.74  ? 90  LEU A O     1 
ATOM   1257 C CB    . LEU C 3 73  ? 44.125 42.183  -2.930  1.00 32.56  ? 90  LEU A CB    1 
ATOM   1258 C CG    . LEU C 3 73  ? 44.439 43.555  -2.351  1.00 33.36  ? 90  LEU A CG    1 
ATOM   1259 C CD1   . LEU C 3 73  ? 45.279 43.408  -1.089  1.00 34.16  ? 90  LEU A CD1   1 
ATOM   1260 C CD2   . LEU C 3 73  ? 45.187 44.376  -3.400  1.00 33.12  ? 90  LEU A CD2   1 
ATOM   1261 N N     . VAL C 3 74  ? 41.535 40.975  -0.548  1.00 35.34  ? 91  VAL A N     1 
ATOM   1262 C CA    . VAL C 3 74  ? 40.220 41.312  0.000   1.00 35.63  ? 91  VAL A CA    1 
ATOM   1263 C C     . VAL C 3 74  ? 40.172 42.608  0.795   1.00 36.04  ? 91  VAL A C     1 
ATOM   1264 O O     . VAL C 3 74  ? 41.179 43.048  1.346   1.00 36.21  ? 91  VAL A O     1 
ATOM   1265 C CB    . VAL C 3 74  ? 39.690 40.187  0.909   1.00 36.10  ? 91  VAL A CB    1 
ATOM   1266 C CG1   . VAL C 3 74  ? 39.693 38.869  0.146   1.00 36.94  ? 91  VAL A CG1   1 
ATOM   1267 C CG2   . VAL C 3 74  ? 40.528 40.089  2.175   1.00 36.23  ? 91  VAL A CG2   1 
ATOM   1268 N N     . GLY C 3 75  ? 38.982 43.208  0.846   1.00 36.49  ? 92  GLY A N     1 
ATOM   1269 C CA    . GLY C 3 75  ? 38.791 44.457  1.563   1.00 36.60  ? 92  GLY A CA    1 
ATOM   1270 C C     . GLY C 3 75  ? 37.841 45.417  0.865   1.00 36.66  ? 92  GLY A C     1 
ATOM   1271 O O     . GLY C 3 75  ? 37.287 45.103  -0.194  1.00 36.56  ? 92  GLY A O     1 
ATOM   1272 N N     . LYS C 3 76  ? 37.647 46.593  1.459   1.00 36.44  ? 93  LYS A N     1 
ATOM   1273 C CA    . LYS C 3 76  ? 36.768 47.598  0.877   1.00 36.57  ? 93  LYS A CA    1 
ATOM   1274 C C     . LYS C 3 76  ? 37.103 47.777  -0.591  1.00 36.59  ? 93  LYS A C     1 
ATOM   1275 O O     . LYS C 3 76  ? 38.257 47.992  -0.955  1.00 36.58  ? 93  LYS A O     1 
ATOM   1276 C CB    . LYS C 3 76  ? 36.927 48.936  1.591   1.00 37.22  ? 93  LYS A CB    1 
ATOM   1277 C CG    . LYS C 3 76  ? 36.240 50.107  0.888   1.00 38.84  ? 93  LYS A CG    1 
ATOM   1278 C CD    . LYS C 3 76  ? 34.744 50.150  1.166   1.00 40.04  ? 93  LYS A CD    1 
ATOM   1279 C CE    . LYS C 3 76  ? 34.116 51.445  0.647   1.00 40.31  ? 93  LYS A CE    1 
ATOM   1280 N NZ    . LYS C 3 76  ? 32.692 51.585  1.089   1.00 40.79  ? 93  LYS A NZ    1 
ATOM   1281 N N     . ASP C 3 77  ? 36.078 47.685  -1.430  1.00 36.79  ? 94  ASP A N     1 
ATOM   1282 C CA    . ASP C 3 77  ? 36.230 47.835  -2.875  1.00 35.87  ? 94  ASP A CA    1 
ATOM   1283 C C     . ASP C 3 77  ? 37.097 46.770  -3.523  1.00 34.89  ? 94  ASP A C     1 
ATOM   1284 O O     . ASP C 3 77  ? 37.732 47.011  -4.535  1.00 35.46  ? 94  ASP A O     1 
ATOM   1285 C CB    . ASP C 3 77  ? 36.754 49.234  -3.208  1.00 35.14  ? 94  ASP A CB    1 
ATOM   1286 C CG    . ASP C 3 77  ? 35.660 50.278  -3.163  1.00 35.00  ? 94  ASP A CG    1 
ATOM   1287 O OD1   . ASP C 3 77  ? 35.969 51.489  -3.186  1.00 34.88  ? 94  ASP A OD1   1 
ATOM   1288 O OD2   . ASP C 3 77  ? 34.480 49.876  -3.120  1.00 35.39  ? 94  ASP A OD2   1 
ATOM   1289 N N     . CYS C 3 78  ? 37.109 45.584  -2.940  1.00 34.01  ? 95  CYS A N     1 
ATOM   1290 C CA    . CYS C 3 78  ? 37.887 44.499  -3.500  1.00 34.21  ? 95  CYS A CA    1 
ATOM   1291 C C     . CYS C 3 78  ? 36.936 43.446  -4.054  1.00 34.28  ? 95  CYS A C     1 
ATOM   1292 O O     . CYS C 3 78  ? 36.013 42.998  -3.363  1.00 33.99  ? 95  CYS A O     1 
ATOM   1293 C CB    . CYS C 3 78  ? 38.807 43.877  -2.436  1.00 34.12  ? 95  CYS A CB    1 
ATOM   1294 S SG    . CYS C 3 78  ? 40.141 44.964  -1.858  1.00 34.25  ? 95  CYS A SG    1 
ATOM   1295 N N     . ARG C 3 79  ? 37.185 43.051  -5.301  1.00 34.29  ? 96  ARG A N     1 
ATOM   1296 C CA    . ARG C 3 79  ? 36.374 42.063  -6.003  1.00 34.24  ? 96  ARG A CA    1 
ATOM   1297 C C     . ARG C 3 79  ? 37.292 41.249  -6.910  1.00 34.12  ? 96  ARG A C     1 
ATOM   1298 O O     . ARG C 3 79  ? 38.370 41.711  -7.279  1.00 33.48  ? 96  ARG A O     1 
ATOM   1299 C CB    . ARG C 3 79  ? 35.321 42.777  -6.863  1.00 35.12  ? 96  ARG A CB    1 
ATOM   1300 C CG    . ARG C 3 79  ? 35.874 43.363  -8.194  1.00 36.83  ? 96  ARG A CG    1 
ATOM   1301 C CD    . ARG C 3 79  ? 37.156 44.205  -8.006  1.00 36.15  ? 96  ARG A CD    1 
ATOM   1302 N NE    . ARG C 3 79  ? 36.872 45.520  -7.452  1.00 35.48  ? 96  ARG A NE    1 
ATOM   1303 C CZ    . ARG C 3 79  ? 36.290 46.484  -8.143  1.00 34.80  ? 96  ARG A CZ    1 
ATOM   1304 N NH1   . ARG C 3 79  ? 35.956 46.260  -9.400  1.00 34.80  ? 96  ARG A NH1   1 
ATOM   1305 N NH2   . ARG C 3 79  ? 36.020 47.648  -7.575  1.00 35.21  ? 96  ARG A NH2   1 
ATOM   1306 N N     . ASP C 3 80  ? 36.859 40.047  -7.275  1.00 34.26  ? 97  ASP A N     1 
ATOM   1307 C CA    . ASP C 3 80  ? 37.642 39.181  -8.146  1.00 34.52  ? 97  ASP A CA    1 
ATOM   1308 C C     . ASP C 3 80  ? 39.139 39.178  -7.835  1.00 34.40  ? 97  ASP A C     1 
ATOM   1309 O O     . ASP C 3 80  ? 39.972 39.024  -8.730  1.00 35.02  ? 97  ASP A O     1 
ATOM   1310 C CB    . ASP C 3 80  ? 37.442 39.592  -9.602  1.00 35.36  ? 97  ASP A CB    1 
ATOM   1311 C CG    . ASP C 3 80  ? 35.992 39.518  -10.041 1.00 36.86  ? 97  ASP A CG    1 
ATOM   1312 O OD1   . ASP C 3 80  ? 35.355 38.454  -9.875  1.00 36.36  ? 97  ASP A OD1   1 
ATOM   1313 O OD2   . ASP C 3 80  ? 35.490 40.531  -10.569 1.00 39.37  ? 97  ASP A OD2   1 
ATOM   1314 N N     . GLY C 3 81  ? 39.488 39.373  -6.571  1.00 34.25  ? 98  GLY A N     1 
ATOM   1315 C CA    . GLY C 3 81  ? 40.888 39.358  -6.197  1.00 33.70  ? 98  GLY A CA    1 
ATOM   1316 C C     . GLY C 3 81  ? 41.664 40.660  -6.129  1.00 32.94  ? 98  GLY A C     1 
ATOM   1317 O O     . GLY C 3 81  ? 42.765 40.680  -5.580  1.00 33.05  ? 98  GLY A O     1 
ATOM   1318 N N     . TYR C 3 82  ? 41.134 41.746  -6.672  1.00 32.02  ? 99  TYR A N     1 
ATOM   1319 C CA    . TYR C 3 82  ? 41.876 43.000  -6.614  1.00 31.47  ? 99  TYR A CA    1 
ATOM   1320 C C     . TYR C 3 82  ? 41.018 44.190  -6.220  1.00 31.99  ? 99  TYR A C     1 
ATOM   1321 O O     . TYR C 3 82  ? 39.800 44.190  -6.399  1.00 32.43  ? 99  TYR A O     1 
ATOM   1322 C CB    . TYR C 3 82  ? 42.539 43.287  -7.956  1.00 30.64  ? 99  TYR A CB    1 
ATOM   1323 C CG    . TYR C 3 82  ? 41.560 43.379  -9.097  1.00 30.15  ? 99  TYR A CG    1 
ATOM   1324 C CD1   . TYR C 3 82  ? 41.123 42.233  -9.757  1.00 29.53  ? 99  TYR A CD1   1 
ATOM   1325 C CD2   . TYR C 3 82  ? 41.007 44.610  -9.464  1.00 29.47  ? 99  TYR A CD2   1 
ATOM   1326 C CE1   . TYR C 3 82  ? 40.160 42.310  -10.749 1.00 29.84  ? 99  TYR A CE1   1 
ATOM   1327 C CE2   . TYR C 3 82  ? 40.042 44.702  -10.446 1.00 28.76  ? 99  TYR A CE2   1 
ATOM   1328 C CZ    . TYR C 3 82  ? 39.617 43.553  -11.090 1.00 30.30  ? 99  TYR A CZ    1 
ATOM   1329 O OH    . TYR C 3 82  ? 38.646 43.636  -12.073 1.00 30.27  ? 99  TYR A OH    1 
ATOM   1330 N N     . TYR C 3 83  ? 41.665 45.212  -5.685  1.00 32.28  ? 100 TYR A N     1 
ATOM   1331 C CA    . TYR C 3 83  ? 40.974 46.412  -5.260  1.00 33.73  ? 100 TYR A CA    1 
ATOM   1332 C C     . TYR C 3 83  ? 40.991 47.456  -6.375  1.00 34.88  ? 100 TYR A C     1 
ATOM   1333 O O     . TYR C 3 83  ? 41.990 47.617  -7.056  1.00 35.53  ? 100 TYR A O     1 
ATOM   1334 C CB    . TYR C 3 83  ? 41.658 46.947  -4.006  1.00 33.16  ? 100 TYR A CB    1 
ATOM   1335 C CG    . TYR C 3 83  ? 41.448 48.414  -3.737  1.00 32.29  ? 100 TYR A CG    1 
ATOM   1336 C CD1   . TYR C 3 83  ? 40.621 48.842  -2.700  1.00 32.37  ? 100 TYR A CD1   1 
ATOM   1337 C CD2   . TYR C 3 83  ? 42.119 49.375  -4.488  1.00 31.60  ? 100 TYR A CD2   1 
ATOM   1338 C CE1   . TYR C 3 83  ? 40.473 50.202  -2.413  1.00 32.10  ? 100 TYR A CE1   1 
ATOM   1339 C CE2   . TYR C 3 83  ? 41.986 50.727  -4.213  1.00 31.94  ? 100 TYR A CE2   1 
ATOM   1340 C CZ    . TYR C 3 83  ? 41.165 51.137  -3.175  1.00 32.16  ? 100 TYR A CZ    1 
ATOM   1341 O OH    . TYR C 3 83  ? 41.060 52.479  -2.894  1.00 32.22  ? 100 TYR A OH    1 
ATOM   1342 N N     . GLU C 3 84  ? 39.882 48.158  -6.575  1.00 36.41  ? 101 GLU A N     1 
ATOM   1343 C CA    . GLU C 3 84  ? 39.829 49.181  -7.611  1.00 37.51  ? 101 GLU A CA    1 
ATOM   1344 C C     . GLU C 3 84  ? 38.874 50.301  -7.237  1.00 38.14  ? 101 GLU A C     1 
ATOM   1345 O O     . GLU C 3 84  ? 37.727 50.054  -6.883  1.00 37.91  ? 101 GLU A O     1 
ATOM   1346 C CB    . GLU C 3 84  ? 39.408 48.580  -8.950  1.00 37.84  ? 101 GLU A CB    1 
ATOM   1347 C CG    . GLU C 3 84  ? 39.633 49.545  -10.110 1.00 39.64  ? 101 GLU A CG    1 
ATOM   1348 C CD    . GLU C 3 84  ? 39.379 48.941  -11.480 1.00 39.97  ? 101 GLU A CD    1 
ATOM   1349 O OE1   . GLU C 3 84  ? 39.689 49.626  -12.472 1.00 41.10  ? 101 GLU A OE1   1 
ATOM   1350 O OE2   . GLU C 3 84  ? 38.870 47.801  -11.583 1.00 40.14  ? 101 GLU A OE2   1 
ATOM   1351 N N     . ALA C 3 85  ? 39.354 51.537  -7.323  1.00 39.01  ? 102 ALA A N     1 
ATOM   1352 C CA    . ALA C 3 85  ? 38.535 52.694  -6.978  1.00 39.91  ? 102 ALA A CA    1 
ATOM   1353 C C     . ALA C 3 85  ? 39.048 53.931  -7.692  1.00 39.97  ? 102 ALA A C     1 
ATOM   1354 O O     . ALA C 3 85  ? 40.125 53.896  -8.260  1.00 39.60  ? 102 ALA A O     1 
ATOM   1355 C CB    . ALA C 3 85  ? 38.560 52.906  -5.473  1.00 39.85  ? 102 ALA A CB    1 
ATOM   1356 N N     . ASP C 3 86  ? 38.282 55.019  -7.661  1.00 40.98  ? 103 ASP A N     1 
ATOM   1357 C CA    . ASP C 3 86  ? 38.689 56.255  -8.327  1.00 42.88  ? 103 ASP A CA    1 
ATOM   1358 C C     . ASP C 3 86  ? 39.538 57.151  -7.439  1.00 43.91  ? 103 ASP A C     1 
ATOM   1359 O O     . ASP C 3 86  ? 39.294 57.268  -6.241  1.00 43.77  ? 103 ASP A O     1 
ATOM   1360 C CB    . ASP C 3 86  ? 37.466 57.052  -8.780  1.00 43.88  ? 103 ASP A CB    1 
ATOM   1361 C CG    . ASP C 3 86  ? 36.640 56.323  -9.814  1.00 45.25  ? 103 ASP A CG    1 
ATOM   1362 O OD1   . ASP C 3 86  ? 35.396 56.323  -9.681  1.00 45.50  ? 103 ASP A OD1   1 
ATOM   1363 O OD2   . ASP C 3 86  ? 37.229 55.759  -10.764 1.00 46.80  ? 103 ASP A OD2   1 
ATOM   1364 N N     . LEU C 3 87  ? 40.526 57.799  -8.042  1.00 45.62  ? 104 LEU A N     1 
ATOM   1365 C CA    . LEU C 3 87  ? 41.406 58.704  -7.317  1.00 47.83  ? 104 LEU A CA    1 
ATOM   1366 C C     . LEU C 3 87  ? 40.665 59.991  -6.960  1.00 49.67  ? 104 LEU A C     1 
ATOM   1367 O O     . LEU C 3 87  ? 39.667 60.342  -7.588  1.00 50.40  ? 104 LEU A O     1 
ATOM   1368 C CB    . LEU C 3 87  ? 42.614 59.062  -8.178  1.00 47.90  ? 104 LEU A CB    1 
ATOM   1369 C CG    . LEU C 3 87  ? 43.480 57.943  -8.754  1.00 47.83  ? 104 LEU A CG    1 
ATOM   1370 C CD1   . LEU C 3 87  ? 44.449 58.523  -9.769  1.00 47.03  ? 104 LEU A CD1   1 
ATOM   1371 C CD2   . LEU C 3 87  ? 44.225 57.252  -7.636  1.00 47.93  ? 104 LEU A CD2   1 
ATOM   1372 N N     . CYS C 3 88  ? 41.153 60.695  -5.948  1.00 51.59  ? 105 CYS A N     1 
ATOM   1373 C CA    . CYS C 3 88  ? 40.548 61.956  -5.539  1.00 53.37  ? 105 CYS A CA    1 
ATOM   1374 C C     . CYS C 3 88  ? 41.263 63.082  -6.282  1.00 54.28  ? 105 CYS A C     1 
ATOM   1375 O O     . CYS C 3 88  ? 42.440 63.353  -6.035  1.00 53.96  ? 105 CYS A O     1 
ATOM   1376 C CB    . CYS C 3 88  ? 40.697 62.159  -4.036  1.00 53.85  ? 105 CYS A CB    1 
ATOM   1377 S SG    . CYS C 3 88  ? 40.779 63.896  -3.601  1.00 55.08  ? 105 CYS A SG    1 
ATOM   1378 N N     . PRO C 3 89  ? 40.556 63.749  -7.206  1.00 55.27  ? 106 PRO A N     1 
ATOM   1379 C CA    . PRO C 3 89  ? 41.086 64.850  -8.017  1.00 56.03  ? 106 PRO A CA    1 
ATOM   1380 C C     . PRO C 3 89  ? 41.666 66.006  -7.227  1.00 56.89  ? 106 PRO A C     1 
ATOM   1381 O O     . PRO C 3 89  ? 42.381 66.837  -7.779  1.00 57.21  ? 106 PRO A O     1 
ATOM   1382 C CB    . PRO C 3 89  ? 39.880 65.282  -8.838  1.00 55.75  ? 106 PRO A CB    1 
ATOM   1383 C CG    . PRO C 3 89  ? 39.117 64.013  -8.992  1.00 56.13  ? 106 PRO A CG    1 
ATOM   1384 C CD    . PRO C 3 89  ? 39.175 63.435  -7.605  1.00 55.47  ? 106 PRO A CD    1 
ATOM   1385 N N     . ASP C 3 90  ? 41.371 66.049  -5.934  1.00 57.56  ? 107 ASP A N     1 
ATOM   1386 C CA    . ASP C 3 90  ? 41.843 67.130  -5.079  1.00 58.33  ? 107 ASP A CA    1 
ATOM   1387 C C     . ASP C 3 90  ? 43.233 66.864  -4.517  1.00 58.78  ? 107 ASP A C     1 
ATOM   1388 O O     . ASP C 3 90  ? 43.906 67.788  -4.046  1.00 59.41  ? 107 ASP A O     1 
ATOM   1389 C CB    . ASP C 3 90  ? 40.870 67.330  -3.919  1.00 59.44  ? 107 ASP A CB    1 
ATOM   1390 C CG    . ASP C 3 90  ? 39.441 66.940  -4.275  1.00 60.52  ? 107 ASP A CG    1 
ATOM   1391 O OD1   . ASP C 3 90  ? 38.573 67.010  -3.380  1.00 60.64  ? 107 ASP A OD1   1 
ATOM   1392 O OD2   . ASP C 3 90  ? 39.179 66.558  -5.439  1.00 61.21  ? 107 ASP A OD2   1 
ATOM   1393 N N     . ARG C 3 91  ? 43.662 65.603  -4.562  1.00 58.70  ? 108 ARG A N     1 
ATOM   1394 C CA    . ARG C 3 91  ? 44.972 65.219  -4.037  1.00 58.21  ? 108 ARG A CA    1 
ATOM   1395 C C     . ARG C 3 91  ? 45.799 64.337  -4.976  1.00 57.24  ? 108 ARG A C     1 
ATOM   1396 O O     . ARG C 3 91  ? 45.256 63.623  -5.819  1.00 57.40  ? 108 ARG A O     1 
ATOM   1397 C CB    . ARG C 3 91  ? 44.798 64.500  -2.695  1.00 58.96  ? 108 ARG A CB    1 
ATOM   1398 C CG    . ARG C 3 91  ? 45.385 65.235  -1.500  1.00 60.35  ? 108 ARG A CG    1 
ATOM   1399 C CD    . ARG C 3 91  ? 46.912 65.383  -1.588  1.00 61.13  ? 108 ARG A CD    1 
ATOM   1400 N NE    . ARG C 3 91  ? 47.346 66.087  -2.795  1.00 61.73  ? 108 ARG A NE    1 
ATOM   1401 C CZ    . ARG C 3 91  ? 48.580 66.542  -3.002  1.00 61.50  ? 108 ARG A CZ    1 
ATOM   1402 N NH1   . ARG C 3 91  ? 49.517 66.375  -2.077  1.00 60.82  ? 108 ARG A NH1   1 
ATOM   1403 N NH2   . ARG C 3 91  ? 48.877 67.159  -4.140  1.00 61.66  ? 108 ARG A NH2   1 
ATOM   1404 N N     . SER C 3 92  ? 47.119 64.392  -4.811  1.00 55.90  ? 109 SER A N     1 
ATOM   1405 C CA    . SER C 3 92  ? 48.044 63.599  -5.616  1.00 53.85  ? 109 SER A CA    1 
ATOM   1406 C C     . SER C 3 92  ? 48.593 62.445  -4.779  1.00 52.80  ? 109 SER A C     1 
ATOM   1407 O O     . SER C 3 92  ? 49.087 61.460  -5.320  1.00 53.20  ? 109 SER A O     1 
ATOM   1408 C CB    . SER C 3 92  ? 49.204 64.464  -6.109  1.00 53.63  ? 109 SER A CB    1 
ATOM   1409 O OG    . SER C 3 92  ? 50.079 64.800  -5.049  1.00 52.78  ? 109 SER A OG    1 
ATOM   1410 N N     . ILE C 3 93  ? 48.513 62.575  -3.457  1.00 50.82  ? 110 ILE A N     1 
ATOM   1411 C CA    . ILE C 3 93  ? 48.977 61.530  -2.548  1.00 48.76  ? 110 ILE A CA    1 
ATOM   1412 C C     . ILE C 3 93  ? 47.783 60.677  -2.126  1.00 47.00  ? 110 ILE A C     1 
ATOM   1413 O O     . ILE C 3 93  ? 46.737 61.203  -1.761  1.00 46.75  ? 110 ILE A O     1 
ATOM   1414 C CB    . ILE C 3 93  ? 49.661 62.140  -1.307  1.00 49.29  ? 110 ILE A CB    1 
ATOM   1415 C CG1   . ILE C 3 93  ? 51.015 62.734  -1.721  1.00 50.02  ? 110 ILE A CG1   1 
ATOM   1416 C CG2   . ILE C 3 93  ? 49.813 61.090  -0.217  1.00 48.38  ? 110 ILE A CG2   1 
ATOM   1417 C CD1   . ILE C 3 93  ? 51.826 63.326  -0.585  1.00 50.39  ? 110 ILE A CD1   1 
ATOM   1418 N N     . HIS C 3 94  ? 47.934 59.357  -2.198  1.00 45.33  ? 111 HIS A N     1 
ATOM   1419 C CA    . HIS C 3 94  ? 46.843 58.448  -1.862  1.00 43.57  ? 111 HIS A CA    1 
ATOM   1420 C C     . HIS C 3 94  ? 47.260 57.256  -0.999  1.00 42.91  ? 111 HIS A C     1 
ATOM   1421 O O     . HIS C 3 94  ? 48.208 56.545  -1.320  1.00 43.00  ? 111 HIS A O     1 
ATOM   1422 C CB    . HIS C 3 94  ? 46.196 57.921  -3.149  1.00 42.94  ? 111 HIS A CB    1 
ATOM   1423 C CG    . HIS C 3 94  ? 46.064 58.949  -4.230  1.00 42.76  ? 111 HIS A CG    1 
ATOM   1424 N ND1   . HIS C 3 94  ? 44.962 59.026  -5.052  1.00 42.74  ? 111 HIS A ND1   1 
ATOM   1425 C CD2   . HIS C 3 94  ? 46.901 59.934  -4.631  1.00 42.23  ? 111 HIS A CD2   1 
ATOM   1426 C CE1   . HIS C 3 94  ? 45.125 60.021  -5.907  1.00 43.33  ? 111 HIS A CE1   1 
ATOM   1427 N NE2   . HIS C 3 94  ? 46.293 60.588  -5.671  1.00 42.26  ? 111 HIS A NE2   1 
ATOM   1428 N N     . SER C 3 95  ? 46.536 57.034  0.092   1.00 41.86  ? 112 SER A N     1 
ATOM   1429 C CA    . SER C 3 95  ? 46.824 55.913  0.970   1.00 41.70  ? 112 SER A CA    1 
ATOM   1430 C C     . SER C 3 95  ? 45.591 55.026  1.074   1.00 41.14  ? 112 SER A C     1 
ATOM   1431 O O     . SER C 3 95  ? 44.476 55.514  1.002   1.00 40.63  ? 112 SER A O     1 
ATOM   1432 C CB    . SER C 3 95  ? 47.270 56.413  2.353   1.00 42.11  ? 112 SER A CB    1 
ATOM   1433 O OG    . SER C 3 95  ? 46.473 57.486  2.824   1.00 43.23  ? 112 SER A OG    1 
ATOM   1434 N N     . PHE C 3 96  ? 45.806 53.722  1.236   1.00 41.18  ? 113 PHE A N     1 
ATOM   1435 C CA    . PHE C 3 96  ? 44.726 52.737  1.319   1.00 41.35  ? 113 PHE A CA    1 
ATOM   1436 C C     . PHE C 3 96  ? 44.760 52.059  2.685   1.00 41.65  ? 113 PHE A C     1 
ATOM   1437 O O     . PHE C 3 96  ? 45.728 51.374  3.035   1.00 41.93  ? 113 PHE A O     1 
ATOM   1438 C CB    . PHE C 3 96  ? 44.898 51.713  0.197   1.00 41.70  ? 113 PHE A CB    1 
ATOM   1439 C CG    . PHE C 3 96  ? 45.310 52.330  -1.110  1.00 42.76  ? 113 PHE A CG    1 
ATOM   1440 C CD1   . PHE C 3 96  ? 46.566 52.917  -1.252  1.00 43.15  ? 113 PHE A CD1   1 
ATOM   1441 C CD2   . PHE C 3 96  ? 44.427 52.389  -2.177  1.00 43.16  ? 113 PHE A CD2   1 
ATOM   1442 C CE1   . PHE C 3 96  ? 46.933 53.558  -2.429  1.00 43.05  ? 113 PHE A CE1   1 
ATOM   1443 C CE2   . PHE C 3 96  ? 44.785 53.028  -3.360  1.00 43.62  ? 113 PHE A CE2   1 
ATOM   1444 C CZ    . PHE C 3 96  ? 46.043 53.615  -3.484  1.00 43.42  ? 113 PHE A CZ    1 
ATOM   1445 N N     . GLN C 3 97  ? 43.688 52.230  3.451   1.00 41.27  ? 114 GLN A N     1 
ATOM   1446 C CA    . GLN C 3 97  ? 43.645 51.699  4.803   1.00 40.08  ? 114 GLN A CA    1 
ATOM   1447 C C     . GLN C 3 97  ? 42.899 50.404  5.065   1.00 39.08  ? 114 GLN A C     1 
ATOM   1448 O O     . GLN C 3 97  ? 42.559 50.133  6.211   1.00 39.18  ? 114 GLN A O     1 
ATOM   1449 C CB    . GLN C 3 97  ? 43.079 52.759  5.724   1.00 41.04  ? 114 GLN A CB    1 
ATOM   1450 C CG    . GLN C 3 97  ? 43.614 54.138  5.466   1.00 43.76  ? 114 GLN A CG    1 
ATOM   1451 C CD    . GLN C 3 97  ? 42.829 55.184  6.222   1.00 46.17  ? 114 GLN A CD    1 
ATOM   1452 O OE1   . GLN C 3 97  ? 41.638 55.389  5.962   1.00 47.97  ? 114 GLN A OE1   1 
ATOM   1453 N NE2   . GLN C 3 97  ? 43.484 55.848  7.174   1.00 46.97  ? 114 GLN A NE2   1 
ATOM   1454 N N     . ASN C 3 98  ? 42.641 49.593  4.045   1.00 37.66  ? 115 ASN A N     1 
ATOM   1455 C CA    . ASN C 3 98  ? 41.930 48.346  4.301   1.00 36.38  ? 115 ASN A CA    1 
ATOM   1456 C C     . ASN C 3 98  ? 42.273 47.233  3.320   1.00 35.47  ? 115 ASN A C     1 
ATOM   1457 O O     . ASN C 3 98  ? 41.384 46.595  2.754   1.00 36.05  ? 115 ASN A O     1 
ATOM   1458 C CB    . ASN C 3 98  ? 40.425 48.598  4.293   1.00 36.98  ? 115 ASN A CB    1 
ATOM   1459 C CG    . ASN C 3 98  ? 39.623 47.356  4.652   1.00 38.50  ? 115 ASN A CG    1 
ATOM   1460 O OD1   . ASN C 3 98  ? 38.442 47.258  4.322   1.00 39.52  ? 115 ASN A OD1   1 
ATOM   1461 N ND2   . ASN C 3 98  ? 40.260 46.402  5.335   1.00 38.36  ? 115 ASN A ND2   1 
ATOM   1462 N N     . LEU C 3 99  ? 43.565 46.994  3.125   1.00 33.95  ? 116 LEU A N     1 
ATOM   1463 C CA    . LEU C 3 99  ? 44.010 45.957  2.200   1.00 32.68  ? 116 LEU A CA    1 
ATOM   1464 C C     . LEU C 3 99  ? 44.308 44.665  2.938   1.00 32.02  ? 116 LEU A C     1 
ATOM   1465 O O     . LEU C 3 99  ? 45.045 44.668  3.921   1.00 32.01  ? 116 LEU A O     1 
ATOM   1466 C CB    . LEU C 3 99  ? 45.263 46.420  1.450   1.00 32.42  ? 116 LEU A CB    1 
ATOM   1467 C CG    . LEU C 3 99  ? 45.074 47.608  0.507   1.00 31.48  ? 116 LEU A CG    1 
ATOM   1468 C CD1   . LEU C 3 99  ? 46.392 47.983  -0.149  1.00 30.45  ? 116 LEU A CD1   1 
ATOM   1469 C CD2   . LEU C 3 99  ? 44.047 47.240  -0.532  1.00 31.32  ? 116 LEU A CD2   1 
ATOM   1470 N N     . GLY C 3 100 ? 43.750 43.558  2.462   1.00 30.78  ? 117 GLY A N     1 
ATOM   1471 C CA    . GLY C 3 100 ? 43.994 42.296  3.133   1.00 29.59  ? 117 GLY A CA    1 
ATOM   1472 C C     . GLY C 3 100 ? 44.272 41.116  2.229   1.00 29.27  ? 117 GLY A C     1 
ATOM   1473 O O     . GLY C 3 100 ? 43.540 40.867  1.271   1.00 29.76  ? 117 GLY A O     1 
ATOM   1474 N N     . ILE C 3 101 ? 45.341 40.386  2.520   1.00 28.47  ? 118 ILE A N     1 
ATOM   1475 C CA    . ILE C 3 101 ? 45.672 39.217  1.731   1.00 28.58  ? 118 ILE A CA    1 
ATOM   1476 C C     . ILE C 3 101 ? 44.784 38.082  2.200   1.00 29.93  ? 118 ILE A C     1 
ATOM   1477 O O     . ILE C 3 101 ? 44.690 37.817  3.397   1.00 30.17  ? 118 ILE A O     1 
ATOM   1478 C CB    . ILE C 3 101 ? 47.129 38.770  1.934   1.00 27.64  ? 118 ILE A CB    1 
ATOM   1479 C CG1   . ILE C 3 101 ? 48.083 39.755  1.269   1.00 27.14  ? 118 ILE A CG1   1 
ATOM   1480 C CG2   . ILE C 3 101 ? 47.331 37.376  1.367   1.00 26.01  ? 118 ILE A CG2   1 
ATOM   1481 C CD1   . ILE C 3 101 ? 48.316 40.990  2.049   1.00 27.38  ? 118 ILE A CD1   1 
ATOM   1482 N N     . GLN C 3 102 ? 44.092 37.492  1.253   1.00 31.34  ? 119 GLN A N     1 
ATOM   1483 C CA    . GLN C 3 102 ? 43.279 36.313  1.500   1.00 32.80  ? 119 GLN A CA    1 
ATOM   1484 C C     . GLN C 3 102 ? 43.920 35.115  0.828   1.00 32.92  ? 119 GLN A C     1 
ATOM   1485 O O     . GLN C 3 102 ? 43.699 34.860  -0.355  1.00 32.51  ? 119 GLN A O     1 
ATOM   1486 C CB    . GLN C 3 102 ? 41.841 36.528  1.032   1.00 33.90  ? 119 GLN A CB    1 
ATOM   1487 C CG    . GLN C 3 102 ? 40.804 36.306  2.123   1.00 35.73  ? 119 GLN A CG    1 
ATOM   1488 C CD    . GLN C 3 102 ? 39.588 35.548  1.630   1.00 20.00  ? 119 GLN A CD    1 
ATOM   1489 O OE1   . GLN C 3 102 ? 38.511 35.632  2.221   1.00 20.00  ? 119 GLN A OE1   1 
ATOM   1490 N NE2   . GLN C 3 102 ? 39.532 34.751  0.569   1.00 20.00  ? 119 GLN A NE2   1 
ATOM   1491 N N     . CYS C 3 103 ? 44.651 34.306  1.646   1.00 34.08  ? 120 CYS A N     1 
ATOM   1492 C CA    . CYS C 3 103 ? 45.381 33.175  1.081   1.00 35.90  ? 120 CYS A CA    1 
ATOM   1493 C C     . CYS C 3 103 ? 44.472 32.043  0.633   1.00 36.63  ? 120 CYS A C     1 
ATOM   1494 O O     . CYS C 3 103 ? 43.528 31.693  1.338   1.00 37.32  ? 120 CYS A O     1 
ATOM   1495 C CB    . CYS C 3 103 ? 46.394 32.642  2.100   1.00 35.56  ? 120 CYS A CB    1 
ATOM   1496 S SG    . CYS C 3 103 ? 45.687 32.138  3.688   1.00 37.89  ? 120 CYS A SG    1 
ATOM   1497 N N     . VAL C 3 104 ? 44.749 31.470  -0.536  1.00 36.99  ? 121 VAL A N     1 
ATOM   1498 C CA    . VAL C 3 104 ? 43.928 30.368  -1.015  1.00 37.94  ? 121 VAL A CA    1 
ATOM   1499 C C     . VAL C 3 104 ? 44.388 29.060  -0.402  1.00 38.45  ? 121 VAL A C     1 
ATOM   1500 O O     . VAL C 3 104 ? 45.477 28.969  0.156   1.00 37.02  ? 121 VAL A O     1 
ATOM   1501 C CB    . VAL C 3 104 ? 43.982 30.196  -2.556  1.00 38.17  ? 121 VAL A CB    1 
ATOM   1502 C CG1   . VAL C 3 104 ? 43.758 31.537  -3.240  1.00 38.60  ? 121 VAL A CG1   1 
ATOM   1503 C CG2   . VAL C 3 104 ? 45.295 29.547  -2.968  1.00 37.79  ? 121 VAL A CG2   1 
ATOM   1504 N N     . LYS C 3 105 ? 43.537 28.049  -0.515  1.00 40.08  ? 122 LYS A N     1 
ATOM   1505 C CA    . LYS C 3 105 ? 43.847 26.731  -0.006  1.00 41.86  ? 122 LYS A CA    1 
ATOM   1506 C C     . LYS C 3 105 ? 44.780 26.129  -1.037  1.00 43.10  ? 122 LYS A C     1 
ATOM   1507 O O     . LYS C 3 105 ? 44.884 26.643  -2.143  1.00 44.28  ? 122 LYS A O     1 
ATOM   1508 C CB    . LYS C 3 105 ? 42.561 25.922  0.098   1.00 42.60  ? 122 LYS A CB    1 
ATOM   1509 C CG    . LYS C 3 105 ? 42.700 24.566  0.775   1.00 43.45  ? 122 LYS A CG    1 
ATOM   1510 C CD    . LYS C 3 105 ? 41.321 23.971  1.092   1.00 43.77  ? 122 LYS A CD    1 
ATOM   1511 C CE    . LYS C 3 105 ? 40.598 24.774  2.172   1.00 43.31  ? 122 LYS A CE    1 
ATOM   1512 N NZ    . LYS C 3 105 ? 40.411 26.208  1.796   1.00 42.34  ? 122 LYS A NZ    1 
ATOM   1513 N N     . LYS C 3 106 ? 45.460 25.048  -0.691  1.00 44.63  ? 123 LYS A N     1 
ATOM   1514 C CA    . LYS C 3 106 ? 46.384 24.416  -1.625  1.00 46.27  ? 123 LYS A CA    1 
ATOM   1515 C C     . LYS C 3 106 ? 45.677 23.803  -2.830  1.00 47.15  ? 123 LYS A C     1 
ATOM   1516 O O     . LYS C 3 106 ? 46.126 23.957  -3.968  1.00 46.80  ? 123 LYS A O     1 
ATOM   1517 C CB    . LYS C 3 106 ? 47.186 23.325  -0.911  1.00 47.34  ? 123 LYS A CB    1 
ATOM   1518 C CG    . LYS C 3 106 ? 48.218 22.627  -1.790  1.00 48.72  ? 123 LYS A CG    1 
ATOM   1519 C CD    . LYS C 3 106 ? 49.322 23.593  -2.206  1.00 50.23  ? 123 LYS A CD    1 
ATOM   1520 C CE    . LYS C 3 106 ? 50.365 22.939  -3.105  1.00 50.40  ? 123 LYS A CE    1 
ATOM   1521 N NZ    . LYS C 3 106 ? 51.452 23.912  -3.445  1.00 51.01  ? 123 LYS A NZ    1 
ATOM   1522 N N     . ARG C 3 107 ? 44.566 23.112  -2.578  1.00 48.56  ? 124 ARG A N     1 
ATOM   1523 C CA    . ARG C 3 107 ? 43.832 22.445  -3.647  1.00 49.74  ? 124 ARG A CA    1 
ATOM   1524 C C     . ARG C 3 107 ? 43.021 23.349  -4.572  1.00 49.41  ? 124 ARG A C     1 
ATOM   1525 O O     . ARG C 3 107 ? 42.370 22.869  -5.496  1.00 49.75  ? 124 ARG A O     1 
ATOM   1526 C CB    . ARG C 3 107 ? 42.928 21.342  -3.072  1.00 50.96  ? 124 ARG A CB    1 
ATOM   1527 C CG    . ARG C 3 107 ? 41.875 21.806  -2.074  1.00 53.93  ? 124 ARG A CG    1 
ATOM   1528 C CD    . ARG C 3 107 ? 40.680 20.846  -2.057  1.00 56.41  ? 124 ARG A CD    1 
ATOM   1529 N NE    . ARG C 3 107 ? 41.082 19.454  -1.840  1.00 59.13  ? 124 ARG A NE    1 
ATOM   1530 C CZ    . ARG C 3 107 ? 40.393 18.396  -2.272  1.00 60.14  ? 124 ARG A CZ    1 
ATOM   1531 N NH1   . ARG C 3 107 ? 39.261 18.567  -2.950  1.00 59.88  ? 124 ARG A NH1   1 
ATOM   1532 N NH2   . ARG C 3 107 ? 40.843 17.165  -2.038  1.00 60.63  ? 124 ARG A NH2   1 
ATOM   1533 N N     . ASP C 3 108 ? 43.058 24.652  -4.337  1.00 48.78  ? 125 ASP A N     1 
ATOM   1534 C CA    . ASP C 3 108 ? 42.331 25.574  -5.193  1.00 48.49  ? 125 ASP A CA    1 
ATOM   1535 C C     . ASP C 3 108 ? 43.342 26.414  -5.932  1.00 48.80  ? 125 ASP A C     1 
ATOM   1536 O O     . ASP C 3 108 ? 43.024 27.495  -6.419  1.00 48.77  ? 125 ASP A O     1 
ATOM   1537 C CB    . ASP C 3 108 ? 41.437 26.495  -4.368  1.00 48.40  ? 125 ASP A CB    1 
ATOM   1538 C CG    . ASP C 3 108 ? 40.462 25.737  -3.508  1.00 48.72  ? 125 ASP A CG    1 
ATOM   1539 O OD1   . ASP C 3 108 ? 39.694 26.381  -2.760  1.00 47.61  ? 125 ASP A OD1   1 
ATOM   1540 O OD2   . ASP C 3 108 ? 40.471 24.490  -3.583  1.00 49.22  ? 125 ASP A OD2   1 
ATOM   1541 N N     . LEU C 3 109 ? 44.571 25.922  -6.004  1.00 49.24  ? 126 LEU A N     1 
ATOM   1542 C CA    . LEU C 3 109 ? 45.625 26.665  -6.674  1.00 50.18  ? 126 LEU A CA    1 
ATOM   1543 C C     . LEU C 3 109 ? 45.324 26.892  -8.164  1.00 50.75  ? 126 LEU A C     1 
ATOM   1544 O O     . LEU C 3 109 ? 45.382 28.028  -8.652  1.00 50.16  ? 126 LEU A O     1 
ATOM   1545 C CB    . LEU C 3 109 ? 46.961 25.942  -6.489  1.00 50.06  ? 126 LEU A CB    1 
ATOM   1546 C CG    . LEU C 3 109 ? 48.217 26.661  -6.992  1.00 50.11  ? 126 LEU A CG    1 
ATOM   1547 C CD1   . LEU C 3 109 ? 48.285 28.080  -6.451  1.00 50.10  ? 126 LEU A CD1   1 
ATOM   1548 C CD2   . LEU C 3 109 ? 49.438 25.872  -6.563  1.00 50.25  ? 126 LEU A CD2   1 
ATOM   1549 N N     . GLU C 3 110 ? 44.986 25.821  -8.877  1.00 51.15  ? 127 GLU A N     1 
ATOM   1550 C CA    . GLU C 3 110 ? 44.674 25.926  -10.297 1.00 51.72  ? 127 GLU A CA    1 
ATOM   1551 C C     . GLU C 3 110 ? 43.441 26.762  -10.572 1.00 50.62  ? 127 GLU A C     1 
ATOM   1552 O O     . GLU C 3 110 ? 43.387 27.489  -11.556 1.00 50.39  ? 127 GLU A O     1 
ATOM   1553 C CB    . GLU C 3 110 ? 44.487 24.543  -10.905 1.00 53.80  ? 127 GLU A CB    1 
ATOM   1554 C CG    . GLU C 3 110 ? 45.786 23.859  -11.242 1.00 57.38  ? 127 GLU A CG    1 
ATOM   1555 C CD    . GLU C 3 110 ? 45.570 22.628  -12.096 1.00 59.83  ? 127 GLU A CD    1 
ATOM   1556 O OE1   . GLU C 3 110 ? 44.768 22.718  -13.059 1.00 60.69  ? 127 GLU A OE1   1 
ATOM   1557 O OE2   . GLU C 3 110 ? 46.203 21.582  -11.811 1.00 61.05  ? 127 GLU A OE2   1 
ATOM   1558 N N     . GLN C 3 111 ? 42.445 26.651  -9.709  1.00 49.59  ? 128 GLN A N     1 
ATOM   1559 C CA    . GLN C 3 111 ? 41.232 27.425  -9.888  1.00 49.05  ? 128 GLN A CA    1 
ATOM   1560 C C     . GLN C 3 111 ? 41.591 28.890  -9.744  1.00 47.76  ? 128 GLN A C     1 
ATOM   1561 O O     . GLN C 3 111 ? 41.176 29.722  -10.541 1.00 47.55  ? 128 GLN A O     1 
ATOM   1562 C CB    . GLN C 3 111 ? 40.191 27.044  -8.834  1.00 50.32  ? 128 GLN A CB    1 
ATOM   1563 C CG    . GLN C 3 111 ? 38.811 27.666  -9.048  1.00 51.97  ? 128 GLN A CG    1 
ATOM   1564 C CD    . GLN C 3 111 ? 37.813 27.235  -7.982  1.00 52.65  ? 128 GLN A CD    1 
ATOM   1565 O OE1   . GLN C 3 111 ? 37.755 26.059  -7.616  1.00 53.22  ? 128 GLN A OE1   1 
ATOM   1566 N NE2   . GLN C 3 111 ? 37.017 28.182  -7.486  1.00 52.30  ? 128 GLN A NE2   1 
ATOM   1567 N N     . ALA C 3 112 ? 42.380 29.193  -8.723  1.00 46.58  ? 129 ALA A N     1 
ATOM   1568 C CA    . ALA C 3 112 ? 42.797 30.560  -8.454  1.00 45.72  ? 129 ALA A CA    1 
ATOM   1569 C C     . ALA C 3 112 ? 43.475 31.211  -9.657  1.00 44.95  ? 129 ALA A C     1 
ATOM   1570 O O     . ALA C 3 112 ? 43.167 32.352  -10.010 1.00 44.49  ? 129 ALA A O     1 
ATOM   1571 C CB    . ALA C 3 112 ? 43.727 30.591  -7.251  1.00 45.84  ? 129 ALA A CB    1 
ATOM   1572 N N     . ILE C 3 113 ? 44.398 30.491  -10.285 1.00 43.92  ? 130 ILE A N     1 
ATOM   1573 C CA    . ILE C 3 113 ? 45.097 31.031  -11.439 1.00 42.59  ? 130 ILE A CA    1 
ATOM   1574 C C     . ILE C 3 113 ? 44.114 31.243  -12.574 1.00 42.50  ? 130 ILE A C     1 
ATOM   1575 O O     . ILE C 3 113 ? 44.127 32.289  -13.219 1.00 42.59  ? 130 ILE A O     1 
ATOM   1576 C CB    . ILE C 3 113 ? 46.222 30.092  -11.899 1.00 42.35  ? 130 ILE A CB    1 
ATOM   1577 C CG1   . ILE C 3 113 ? 47.243 29.919  -10.769 1.00 41.76  ? 130 ILE A CG1   1 
ATOM   1578 C CG2   . ILE C 3 113 ? 46.910 30.664  -13.139 1.00 42.08  ? 130 ILE A CG2   1 
ATOM   1579 C CD1   . ILE C 3 113 ? 47.864 31.224  -10.282 1.00 41.33  ? 130 ILE A CD1   1 
ATOM   1580 N N     . SER C 3 114 ? 43.256 30.251  -12.811 1.00 42.34  ? 131 SER A N     1 
ATOM   1581 C CA    . SER C 3 114 ? 42.242 30.340  -13.861 1.00 41.59  ? 131 SER A CA    1 
ATOM   1582 C C     . SER C 3 114 ? 41.397 31.590  -13.693 1.00 41.20  ? 131 SER A C     1 
ATOM   1583 O O     . SER C 3 114 ? 41.011 32.221  -14.668 1.00 41.41  ? 131 SER A O     1 
ATOM   1584 C CB    . SER C 3 114 ? 41.331 29.117  -13.835 1.00 41.68  ? 131 SER A CB    1 
ATOM   1585 O OG    . SER C 3 114 ? 41.959 28.009  -14.452 1.00 43.25  ? 131 SER A OG    1 
ATOM   1586 N N     . GLN C 3 115 ? 41.102 31.940  -12.450 1.00 40.92  ? 132 GLN A N     1 
ATOM   1587 C CA    . GLN C 3 115 ? 40.324 33.129  -12.176 1.00 41.42  ? 132 GLN A CA    1 
ATOM   1588 C C     . GLN C 3 115 ? 41.158 34.383  -12.427 1.00 40.69  ? 132 GLN A C     1 
ATOM   1589 O O     . GLN C 3 115 ? 40.619 35.466  -12.619 1.00 39.66  ? 132 GLN A O     1 
ATOM   1590 C CB    . GLN C 3 115 ? 39.818 33.107  -10.730 1.00 43.38  ? 132 GLN A CB    1 
ATOM   1591 C CG    . GLN C 3 115 ? 38.779 32.027  -10.451 1.00 45.86  ? 132 GLN A CG    1 
ATOM   1592 C CD    . GLN C 3 115 ? 38.305 32.031  -9.010  1.00 47.90  ? 132 GLN A CD    1 
ATOM   1593 O OE1   . GLN C 3 115 ? 39.069 31.716  -8.088  1.00 49.10  ? 132 GLN A OE1   1 
ATOM   1594 N NE2   . GLN C 3 115 ? 37.037 32.394  -8.803  1.00 48.60  ? 132 GLN A NE2   1 
ATOM   1595 N N     . ARG C 3 116 ? 42.476 34.226  -12.426 1.00 40.73  ? 133 ARG A N     1 
ATOM   1596 C CA    . ARG C 3 116 ? 43.383 35.344  -12.666 1.00 40.94  ? 133 ARG A CA    1 
ATOM   1597 C C     . ARG C 3 116 ? 43.444 35.609  -14.160 1.00 41.53  ? 133 ARG A C     1 
ATOM   1598 O O     . ARG C 3 116 ? 43.546 36.760  -14.609 1.00 41.07  ? 133 ARG A O     1 
ATOM   1599 C CB    . ARG C 3 116 ? 44.779 35.017  -12.143 1.00 40.50  ? 133 ARG A CB    1 
ATOM   1600 C CG    . ARG C 3 116 ? 44.807 34.748  -10.662 1.00 40.39  ? 133 ARG A CG    1 
ATOM   1601 C CD    . ARG C 3 116 ? 44.481 35.998  -9.865  1.00 39.69  ? 133 ARG A CD    1 
ATOM   1602 N NE    . ARG C 3 116 ? 43.978 35.635  -8.549  1.00 40.02  ? 133 ARG A NE    1 
ATOM   1603 C CZ    . ARG C 3 116 ? 42.703 35.382  -8.282  1.00 40.52  ? 133 ARG A CZ    1 
ATOM   1604 N NH1   . ARG C 3 116 ? 41.788 35.464  -9.238  1.00 40.94  ? 133 ARG A NH1   1 
ATOM   1605 N NH2   . ARG C 3 116 ? 42.343 35.027  -7.058  1.00 41.13  ? 133 ARG A NH2   1 
ATOM   1606 N N     . ILE C 3 117 ? 43.391 34.525  -14.924 1.00 41.63  ? 134 ILE A N     1 
ATOM   1607 C CA    . ILE C 3 117 ? 43.411 34.612  -16.370 1.00 42.89  ? 134 ILE A CA    1 
ATOM   1608 C C     . ILE C 3 117 ? 42.048 35.117  -16.822 1.00 43.45  ? 134 ILE A C     1 
ATOM   1609 O O     . ILE C 3 117 ? 41.911 36.220  -17.356 1.00 43.68  ? 134 ILE A O     1 
ATOM   1610 C CB    . ILE C 3 117 ? 43.633 33.235  -17.009 1.00 43.22  ? 134 ILE A CB    1 
ATOM   1611 C CG1   . ILE C 3 117 ? 44.929 32.612  -16.476 1.00 43.83  ? 134 ILE A CG1   1 
ATOM   1612 C CG2   . ILE C 3 117 ? 43.668 33.382  -18.519 1.00 42.64  ? 134 ILE A CG2   1 
ATOM   1613 C CD1   . ILE C 3 117 ? 45.140 31.153  -16.877 1.00 42.67  ? 134 ILE A CD1   1 
ATOM   1614 N N     . GLN C 3 118 ? 41.039 34.293  -16.589 1.00 43.67  ? 135 GLN A N     1 
ATOM   1615 C CA    . GLN C 3 118 ? 39.680 34.617  -16.966 1.00 44.50  ? 135 GLN A CA    1 
ATOM   1616 C C     . GLN C 3 118 ? 39.267 36.014  -16.537 1.00 43.90  ? 135 GLN A C     1 
ATOM   1617 O O     . GLN C 3 118 ? 38.287 36.557  -17.031 1.00 44.48  ? 135 GLN A O     1 
ATOM   1618 C CB    . GLN C 3 118 ? 38.733 33.577  -16.368 1.00 46.47  ? 135 GLN A CB    1 
ATOM   1619 C CG    . GLN C 3 118 ? 37.267 33.783  -16.692 1.00 49.21  ? 135 GLN A CG    1 
ATOM   1620 C CD    . GLN C 3 118 ? 36.478 32.496  -16.554 1.00 51.00  ? 135 GLN A CD    1 
ATOM   1621 O OE1   . GLN C 3 118 ? 36.615 31.783  -15.556 1.00 52.11  ? 135 GLN A OE1   1 
ATOM   1622 N NE2   . GLN C 3 118 ? 35.649 32.186  -17.557 1.00 51.29  ? 135 GLN A NE2   1 
ATOM   1623 N N     . THR C 3 119 ? 40.015 36.613  -15.627 1.00 43.51  ? 136 THR A N     1 
ATOM   1624 C CA    . THR C 3 119 ? 39.652 37.941  -15.165 1.00 42.52  ? 136 THR A CA    1 
ATOM   1625 C C     . THR C 3 119 ? 40.539 39.044  -15.730 1.00 41.17  ? 136 THR A C     1 
ATOM   1626 O O     . THR C 3 119 ? 40.346 40.221  -15.421 1.00 40.80  ? 136 THR A O     1 
ATOM   1627 C CB    . THR C 3 119 ? 39.680 38.005  -13.631 1.00 42.76  ? 136 THR A CB    1 
ATOM   1628 O OG1   . THR C 3 119 ? 39.073 39.226  -13.200 1.00 44.11  ? 136 THR A OG1   1 
ATOM   1629 C CG2   . THR C 3 119 ? 41.107 37.960  -13.123 1.00 43.17  ? 136 THR A CG2   1 
ATOM   1630 N N     . ASN C 3 120 ? 41.502 38.659  -16.564 1.00 40.00  ? 137 ASN A N     1 
ATOM   1631 C CA    . ASN C 3 120 ? 42.427 39.612  -17.165 1.00 38.79  ? 137 ASN A CA    1 
ATOM   1632 C C     . ASN C 3 120 ? 43.207 40.323  -16.083 1.00 37.54  ? 137 ASN A C     1 
ATOM   1633 O O     . ASN C 3 120 ? 43.331 41.548  -16.120 1.00 38.73  ? 137 ASN A O     1 
ATOM   1634 C CB    . ASN C 3 120 ? 41.678 40.666  -17.977 1.00 40.62  ? 137 ASN A CB    1 
ATOM   1635 C CG    . ASN C 3 120 ? 40.990 40.090  -19.192 1.00 43.18  ? 137 ASN A CG    1 
ATOM   1636 O OD1   . ASN C 3 120 ? 40.008 40.664  -19.701 1.00 43.24  ? 137 ASN A OD1   1 
ATOM   1637 N ND2   . ASN C 3 120 ? 41.502 38.952  -19.683 1.00 43.91  ? 137 ASN A ND2   1 
ATOM   1638 N N     . ASN C 3 121 ? 43.710 39.581  -15.103 1.00 35.38  ? 138 ASN A N     1 
ATOM   1639 C CA    . ASN C 3 121 ? 44.490 40.204  -14.035 1.00 33.77  ? 138 ASN A CA    1 
ATOM   1640 C C     . ASN C 3 121 ? 45.943 39.800  -14.261 1.00 32.71  ? 138 ASN A C     1 
ATOM   1641 O O     . ASN C 3 121 ? 46.409 38.796  -13.722 1.00 32.75  ? 138 ASN A O     1 
ATOM   1642 C CB    . ASN C 3 121 ? 44.007 39.734  -12.655 1.00 33.23  ? 138 ASN A CB    1 
ATOM   1643 C CG    . ASN C 3 121 ? 44.535 40.604  -11.527 1.00 32.62  ? 138 ASN A CG    1 
ATOM   1644 O OD1   . ASN C 3 121 ? 45.276 41.569  -11.756 1.00 31.88  ? 138 ASN A OD1   1 
ATOM   1645 N ND2   . ASN C 3 121 ? 44.151 40.272  -10.301 1.00 32.16  ? 138 ASN A ND2   1 
ATOM   1646 N N     . ASN C 3 122 ? 46.643 40.595  -15.068 1.00 30.40  ? 139 ASN A N     1 
ATOM   1647 C CA    . ASN C 3 122 ? 48.029 40.320  -15.426 1.00 28.09  ? 139 ASN A CA    1 
ATOM   1648 C C     . ASN C 3 122 ? 48.751 41.643  -15.695 1.00 26.71  ? 139 ASN A C     1 
ATOM   1649 O O     . ASN C 3 122 ? 48.988 42.007  -16.845 1.00 26.23  ? 139 ASN A O     1 
ATOM   1650 C CB    . ASN C 3 122 ? 48.041 39.457  -16.689 1.00 27.49  ? 139 ASN A CB    1 
ATOM   1651 C CG    . ASN C 3 122 ? 49.369 38.792  -16.938 1.00 26.38  ? 139 ASN A CG    1 
ATOM   1652 O OD1   . ASN C 3 122 ? 50.417 39.331  -16.605 1.00 26.02  ? 139 ASN A OD1   1 
ATOM   1653 N ND2   . ASN C 3 122 ? 49.330 37.621  -17.554 1.00 25.55  ? 139 ASN A ND2   1 
ATOM   1654 N N     . PRO C 3 123 ? 49.111 42.379  -14.632 1.00 25.13  ? 140 PRO A N     1 
ATOM   1655 C CA    . PRO C 3 123 ? 49.799 43.660  -14.783 1.00 23.95  ? 140 PRO A CA    1 
ATOM   1656 C C     . PRO C 3 123 ? 51.043 43.603  -15.661 1.00 23.93  ? 140 PRO A C     1 
ATOM   1657 O O     . PRO C 3 123 ? 51.370 44.578  -16.328 1.00 24.40  ? 140 PRO A O     1 
ATOM   1658 C CB    . PRO C 3 123 ? 50.125 44.051  -13.346 1.00 23.59  ? 140 PRO A CB    1 
ATOM   1659 C CG    . PRO C 3 123 ? 49.050 43.436  -12.578 1.00 23.83  ? 140 PRO A CG    1 
ATOM   1660 C CD    . PRO C 3 123 ? 48.900 42.076  -13.211 1.00 24.41  ? 140 PRO A CD    1 
ATOM   1661 N N     . PHE C 3 124 ? 51.757 42.482  -15.678 1.00 23.54  ? 141 PHE A N     1 
ATOM   1662 C CA    . PHE C 3 124 ? 52.943 42.461  -16.523 1.00 22.60  ? 141 PHE A CA    1 
ATOM   1663 C C     . PHE C 3 124 ? 52.815 41.624  -17.766 1.00 22.47  ? 141 PHE A C     1 
ATOM   1664 O O     . PHE C 3 124 ? 53.803 41.258  -18.379 1.00 23.81  ? 141 PHE A O     1 
ATOM   1665 C CB    . PHE C 3 124 ? 54.190 42.078  -15.721 1.00 20.71  ? 141 PHE A CB    1 
ATOM   1666 C CG    . PHE C 3 124 ? 54.557 43.097  -14.686 1.00 18.87  ? 141 PHE A CG    1 
ATOM   1667 C CD1   . PHE C 3 124 ? 54.034 43.022  -13.397 1.00 18.09  ? 141 PHE A CD1   1 
ATOM   1668 C CD2   . PHE C 3 124 ? 55.357 44.181  -15.021 1.00 18.74  ? 141 PHE A CD2   1 
ATOM   1669 C CE1   . PHE C 3 124 ? 54.300 44.014  -12.465 1.00 18.08  ? 141 PHE A CE1   1 
ATOM   1670 C CE2   . PHE C 3 124 ? 55.631 45.181  -14.093 1.00 18.41  ? 141 PHE A CE2   1 
ATOM   1671 C CZ    . PHE C 3 124 ? 55.102 45.100  -12.813 1.00 18.10  ? 141 PHE A CZ    1 
ATOM   1672 N N     . HIS C 3 125 ? 51.579 41.341  -18.136 1.00 22.54  ? 142 HIS A N     1 
ATOM   1673 C CA    . HIS C 3 125 ? 51.276 40.609  -19.354 1.00 23.22  ? 142 HIS A CA    1 
ATOM   1674 C C     . HIS C 3 125 ? 52.169 39.403  -19.594 1.00 23.10  ? 142 HIS A C     1 
ATOM   1675 O O     . HIS C 3 125 ? 52.645 39.147  -20.703 1.00 22.52  ? 142 HIS A O     1 
ATOM   1676 C CB    . HIS C 3 125 ? 51.333 41.616  -20.500 1.00 23.38  ? 142 HIS A CB    1 
ATOM   1677 C CG    . HIS C 3 125 ? 50.466 42.814  -20.259 1.00 24.85  ? 142 HIS A CG    1 
ATOM   1678 N ND1   . HIS C 3 125 ? 49.088 42.764  -20.348 1.00 24.69  ? 142 HIS A ND1   1 
ATOM   1679 C CD2   . HIS C 3 125 ? 50.768 44.057  -19.813 1.00 23.98  ? 142 HIS A CD2   1 
ATOM   1680 C CE1   . HIS C 3 125 ? 48.583 43.921  -19.962 1.00 24.75  ? 142 HIS A CE1   1 
ATOM   1681 N NE2   . HIS C 3 125 ? 49.581 44.723  -19.632 1.00 24.40  ? 142 HIS A NE2   1 
ATOM   1682 N N     . VAL C 3 126 ? 52.368 38.653  -18.526 1.00 23.66  ? 143 VAL A N     1 
ATOM   1683 C CA    . VAL C 3 126 ? 53.201 37.475  -18.564 1.00 25.14  ? 143 VAL A CA    1 
ATOM   1684 C C     . VAL C 3 126 ? 52.607 36.368  -19.436 1.00 26.16  ? 143 VAL A C     1 
ATOM   1685 O O     . VAL C 3 126 ? 51.408 36.127  -19.421 1.00 26.13  ? 143 VAL A O     1 
ATOM   1686 C CB    . VAL C 3 126 ? 53.438 36.954  -17.127 1.00 24.50  ? 143 VAL A CB    1 
ATOM   1687 C CG1   . VAL C 3 126 ? 54.224 35.670  -17.160 1.00 25.84  ? 143 VAL A CG1   1 
ATOM   1688 C CG2   . VAL C 3 126 ? 54.189 37.994  -16.323 1.00 22.87  ? 143 VAL A CG2   1 
ATOM   1689 N N     . PRO C 3 127 ? 53.449 35.698  -20.235 1.00 27.81  ? 144 PRO A N     1 
ATOM   1690 C CA    . PRO C 3 127 ? 52.968 34.614  -21.099 1.00 29.45  ? 144 PRO A CA    1 
ATOM   1691 C C     . PRO C 3 127 ? 52.135 33.634  -20.285 1.00 30.88  ? 144 PRO A C     1 
ATOM   1692 O O     . PRO C 3 127 ? 52.484 33.300  -19.164 1.00 32.01  ? 144 PRO A O     1 
ATOM   1693 C CB    . PRO C 3 127 ? 54.260 33.995  -21.612 1.00 29.12  ? 144 PRO A CB    1 
ATOM   1694 C CG    . PRO C 3 127 ? 55.158 35.198  -21.731 1.00 28.62  ? 144 PRO A CG    1 
ATOM   1695 C CD    . PRO C 3 127 ? 54.884 35.959  -20.461 1.00 27.76  ? 144 PRO A CD    1 
ATOM   1696 N N     . ILE C 3 128 ? 51.034 33.171  -20.847 1.00 32.85  ? 145 ILE A N     1 
ATOM   1697 C CA    . ILE C 3 128 ? 50.165 32.262  -20.124 1.00 34.82  ? 145 ILE A CA    1 
ATOM   1698 C C     . ILE C 3 128 ? 50.821 30.931  -19.795 1.00 35.79  ? 145 ILE A C     1 
ATOM   1699 O O     . ILE C 3 128 ? 50.436 30.274  -18.833 1.00 35.94  ? 145 ILE A O     1 
ATOM   1700 C CB    . ILE C 3 128 ? 48.860 32.025  -20.914 1.00 35.84  ? 145 ILE A CB    1 
ATOM   1701 C CG1   . ILE C 3 128 ? 48.171 33.376  -21.175 1.00 36.82  ? 145 ILE A CG1   1 
ATOM   1702 C CG2   . ILE C 3 128 ? 47.926 31.109  -20.141 1.00 35.78  ? 145 ILE A CG2   1 
ATOM   1703 C CD1   . ILE C 3 128 ? 47.855 34.205  -19.910 1.00 35.82  ? 145 ILE A CD1   1 
ATOM   1704 N N     . GLU C 3 129 ? 51.815 30.527  -20.577 1.00 36.80  ? 146 GLU A N     1 
ATOM   1705 C CA    . GLU C 3 129 ? 52.488 29.260  -20.319 1.00 37.93  ? 146 GLU A CA    1 
ATOM   1706 C C     . GLU C 3 129 ? 53.324 29.320  -19.050 1.00 38.37  ? 146 GLU A C     1 
ATOM   1707 O O     . GLU C 3 129 ? 53.694 28.287  -18.499 1.00 38.62  ? 146 GLU A O     1 
ATOM   1708 C CB    . GLU C 3 129 ? 53.364 28.851  -21.512 1.00 39.19  ? 146 GLU A CB    1 
ATOM   1709 C CG    . GLU C 3 129 ? 53.677 29.984  -22.489 1.00 43.75  ? 146 GLU A CG    1 
ATOM   1710 C CD    . GLU C 3 129 ? 52.465 30.436  -23.332 1.00 45.52  ? 146 GLU A CD    1 
ATOM   1711 O OE1   . GLU C 3 129 ? 52.420 31.630  -23.724 1.00 45.57  ? 146 GLU A OE1   1 
ATOM   1712 O OE2   . GLU C 3 129 ? 51.569 29.599  -23.615 1.00 46.71  ? 146 GLU A OE2   1 
ATOM   1713 N N     . GLU C 3 130 ? 53.615 30.527  -18.575 1.00 38.52  ? 147 GLU A N     1 
ATOM   1714 C CA    . GLU C 3 130 ? 54.414 30.683  -17.365 1.00 38.92  ? 147 GLU A CA    1 
ATOM   1715 C C     . GLU C 3 130 ? 53.574 30.667  -16.096 1.00 39.93  ? 147 GLU A C     1 
ATOM   1716 O O     . GLU C 3 130 ? 54.086 30.450  -14.998 1.00 40.10  ? 147 GLU A O     1 
ATOM   1717 C CB    . GLU C 3 130 ? 55.242 31.975  -17.426 1.00 37.98  ? 147 GLU A CB    1 
ATOM   1718 C CG    . GLU C 3 130 ? 56.577 31.814  -18.174 1.00 37.44  ? 147 GLU A CG    1 
ATOM   1719 C CD    . GLU C 3 130 ? 57.400 33.096  -18.259 1.00 36.45  ? 147 GLU A CD    1 
ATOM   1720 O OE1   . GLU C 3 130 ? 57.713 33.661  -17.186 1.00 35.73  ? 147 GLU A OE1   1 
ATOM   1721 O OE2   . GLU C 3 130 ? 57.738 33.523  -19.392 1.00 33.67  ? 147 GLU A OE2   1 
ATOM   1722 N N     . GLN C 3 131 ? 52.276 30.878  -16.246 1.00 40.77  ? 148 GLN A N     1 
ATOM   1723 C CA    . GLN C 3 131 ? 51.402 30.902  -15.093 1.00 41.69  ? 148 GLN A CA    1 
ATOM   1724 C C     . GLN C 3 131 ? 51.087 29.527  -14.548 1.00 42.36  ? 148 GLN A C     1 
ATOM   1725 O O     . GLN C 3 131 ? 50.081 29.340  -13.891 1.00 43.23  ? 148 GLN A O     1 
ATOM   1726 C CB    . GLN C 3 131 ? 50.122 31.656  -15.445 1.00 41.24  ? 148 GLN A CB    1 
ATOM   1727 C CG    . GLN C 3 131 ? 50.423 33.094  -15.830 1.00 42.67  ? 148 GLN A CG    1 
ATOM   1728 C CD    . GLN C 3 131 ? 49.195 33.966  -15.980 1.00 43.60  ? 148 GLN A CD    1 
ATOM   1729 O OE1   . GLN C 3 131 ? 48.367 34.072  -15.072 1.00 44.91  ? 148 GLN A OE1   1 
ATOM   1730 N NE2   . GLN C 3 131 ? 49.081 34.614  -17.129 1.00 44.39  ? 148 GLN A NE2   1 
ATOM   1731 N N     . ARG C 3 132 ? 51.972 28.572  -14.789 1.00 43.61  ? 149 ARG A N     1 
ATOM   1732 C CA    . ARG C 3 132 ? 51.755 27.207  -14.330 1.00 45.83  ? 149 ARG A CA    1 
ATOM   1733 C C     . ARG C 3 132 ? 52.781 26.772  -13.292 1.00 46.24  ? 149 ARG A C     1 
ATOM   1734 O O     . ARG C 3 132 ? 52.531 25.865  -12.491 1.00 46.87  ? 149 ARG A O     1 
ATOM   1735 C CB    . ARG C 3 132 ? 51.808 26.248  -15.525 1.00 47.90  ? 149 ARG A CB    1 
ATOM   1736 C CG    . ARG C 3 132 ? 53.144 26.280  -16.293 1.00 51.16  ? 149 ARG A CG    1 
ATOM   1737 C CD    . ARG C 3 132 ? 53.044 25.573  -17.653 1.00 53.50  ? 149 ARG A CD    1 
ATOM   1738 N NE    . ARG C 3 132 ? 53.210 24.122  -17.566 1.00 55.37  ? 149 ARG A NE    1 
ATOM   1739 C CZ    . ARG C 3 132 ? 52.590 23.255  -18.362 1.00 55.81  ? 149 ARG A CZ    1 
ATOM   1740 N NH1   . ARG C 3 132 ? 51.757 23.701  -19.298 1.00 55.19  ? 149 ARG A NH1   1 
ATOM   1741 N NH2   . ARG C 3 132 ? 52.807 21.947  -18.230 1.00 55.82  ? 149 ARG A NH2   1 
ATOM   1742 N N     . GLY C 3 133 ? 53.942 27.414  -13.316 1.00 46.34  ? 150 GLY A N     1 
ATOM   1743 C CA    . GLY C 3 133 ? 54.995 27.066  -12.381 1.00 46.00  ? 150 GLY A CA    1 
ATOM   1744 C C     . GLY C 3 133 ? 54.638 27.303  -10.926 1.00 45.42  ? 150 GLY A C     1 
ATOM   1745 O O     . GLY C 3 133 ? 53.868 28.208  -10.604 1.00 45.59  ? 150 GLY A O     1 
ATOM   1746 N N     . ASP C 3 134 ? 55.207 26.482  -10.050 1.00 44.19  ? 151 ASP A N     1 
ATOM   1747 C CA    . ASP C 3 134 ? 54.987 26.572  -8.612  1.00 43.19  ? 151 ASP A CA    1 
ATOM   1748 C C     . ASP C 3 134 ? 54.878 28.027  -8.150  1.00 41.49  ? 151 ASP A C     1 
ATOM   1749 O O     . ASP C 3 134 ? 55.522 28.911  -8.713  1.00 41.47  ? 151 ASP A O     1 
ATOM   1750 C CB    . ASP C 3 134 ? 56.156 25.908  -7.885  1.00 44.74  ? 151 ASP A CB    1 
ATOM   1751 C CG    . ASP C 3 134 ? 56.592 24.622  -8.545  1.00 46.19  ? 151 ASP A CG    1 
ATOM   1752 O OD1   . ASP C 3 134 ? 56.070 23.549  -8.173  1.00 46.95  ? 151 ASP A OD1   1 
ATOM   1753 O OD2   . ASP C 3 134 ? 57.450 24.689  -9.452  1.00 47.14  ? 151 ASP A OD2   1 
ATOM   1754 N N     . TYR C 3 135 ? 54.079 28.267  -7.114  1.00 38.60  ? 152 TYR A N     1 
ATOM   1755 C CA    . TYR C 3 135 ? 53.912 29.609  -6.583  1.00 35.98  ? 152 TYR A CA    1 
ATOM   1756 C C     . TYR C 3 135 ? 54.310 29.672  -5.120  1.00 34.58  ? 152 TYR A C     1 
ATOM   1757 O O     . TYR C 3 135 ? 53.956 28.790  -4.349  1.00 35.64  ? 152 TYR A O     1 
ATOM   1758 C CB    . TYR C 3 135 ? 52.451 30.061  -6.704  1.00 35.22  ? 152 TYR A CB    1 
ATOM   1759 C CG    . TYR C 3 135 ? 52.007 30.383  -8.106  1.00 35.89  ? 152 TYR A CG    1 
ATOM   1760 C CD1   . TYR C 3 135 ? 51.818 29.376  -9.046  1.00 37.17  ? 152 TYR A CD1   1 
ATOM   1761 C CD2   . TYR C 3 135 ? 51.799 31.701  -8.506  1.00 35.70  ? 152 TYR A CD2   1 
ATOM   1762 C CE1   . TYR C 3 135 ? 51.430 29.670  -10.365 1.00 37.18  ? 152 TYR A CE1   1 
ATOM   1763 C CE2   . TYR C 3 135 ? 51.413 32.006  -9.809  1.00 36.67  ? 152 TYR A CE2   1 
ATOM   1764 C CZ    . TYR C 3 135 ? 51.227 30.984  -10.736 1.00 37.31  ? 152 TYR A CZ    1 
ATOM   1765 O OH    . TYR C 3 135 ? 50.816 31.278  -12.020 1.00 37.58  ? 152 TYR A OH    1 
ATOM   1766 N N     . ASP C 3 136 ? 55.044 30.708  -4.725  1.00 32.19  ? 153 ASP A N     1 
ATOM   1767 C CA    . ASP C 3 136 ? 55.403 30.863  -3.320  1.00 29.48  ? 153 ASP A CA    1 
ATOM   1768 C C     . ASP C 3 136 ? 54.153 31.456  -2.682  1.00 28.11  ? 153 ASP A C     1 
ATOM   1769 O O     . ASP C 3 136 ? 53.759 32.571  -3.012  1.00 28.63  ? 153 ASP A O     1 
ATOM   1770 C CB    . ASP C 3 136 ? 56.601 31.814  -3.169  1.00 29.54  ? 153 ASP A CB    1 
ATOM   1771 C CG    . ASP C 3 136 ? 56.946 32.118  -1.704  1.00 28.79  ? 153 ASP A CG    1 
ATOM   1772 O OD1   . ASP C 3 136 ? 57.970 32.796  -1.463  1.00 28.40  ? 153 ASP A OD1   1 
ATOM   1773 O OD2   . ASP C 3 136 ? 56.200 31.695  -0.796  1.00 28.21  ? 153 ASP A OD2   1 
ATOM   1774 N N     . LEU C 3 137 ? 53.521 30.720  -1.778  1.00 26.57  ? 154 LEU A N     1 
ATOM   1775 C CA    . LEU C 3 137 ? 52.304 31.215  -1.153  1.00 25.86  ? 154 LEU A CA    1 
ATOM   1776 C C     . LEU C 3 137 ? 52.478 31.968  0.165   1.00 26.58  ? 154 LEU A C     1 
ATOM   1777 O O     . LEU C 3 137 ? 51.495 32.302  0.826   1.00 26.85  ? 154 LEU A O     1 
ATOM   1778 C CB    . LEU C 3 137 ? 51.341 30.057  -0.947  1.00 24.38  ? 154 LEU A CB    1 
ATOM   1779 C CG    . LEU C 3 137 ? 51.237 29.156  -2.170  1.00 24.06  ? 154 LEU A CG    1 
ATOM   1780 C CD1   . LEU C 3 137 ? 50.174 28.124  -1.934  1.00 23.27  ? 154 LEU A CD1   1 
ATOM   1781 C CD2   . LEU C 3 137 ? 50.917 29.978  -3.402  1.00 23.16  ? 154 LEU A CD2   1 
ATOM   1782 N N     . ASN C 3 138 ? 53.714 32.236  0.564   1.00 27.18  ? 155 ASN A N     1 
ATOM   1783 C CA    . ASN C 3 138 ? 53.918 32.961  1.813   1.00 27.71  ? 155 ASN A CA    1 
ATOM   1784 C C     . ASN C 3 138 ? 54.510 34.341  1.563   1.00 27.36  ? 155 ASN A C     1 
ATOM   1785 O O     . ASN C 3 138 ? 54.862 35.062  2.504   1.00 26.71  ? 155 ASN A O     1 
ATOM   1786 C CB    . ASN C 3 138 ? 54.804 32.161  2.777   1.00 29.31  ? 155 ASN A CB    1 
ATOM   1787 C CG    . ASN C 3 138 ? 54.140 30.875  3.251   1.00 31.13  ? 155 ASN A CG    1 
ATOM   1788 O OD1   . ASN C 3 138 ? 52.984 30.880  3.694   1.00 33.84  ? 155 ASN A OD1   1 
ATOM   1789 N ND2   . ASN C 3 138 ? 54.869 29.767  3.171   1.00 30.70  ? 155 ASN A ND2   1 
ATOM   1790 N N     . ALA C 3 139 ? 54.611 34.709  0.287   1.00 26.47  ? 156 ALA A N     1 
ATOM   1791 C CA    . ALA C 3 139 ? 55.128 36.025  -0.077  1.00 25.68  ? 156 ALA A CA    1 
ATOM   1792 C C     . ALA C 3 139 ? 54.474 36.537  -1.360  1.00 25.21  ? 156 ALA A C     1 
ATOM   1793 O O     . ALA C 3 139 ? 54.409 35.828  -2.371  1.00 25.14  ? 156 ALA A O     1 
ATOM   1794 C CB    . ALA C 3 139 ? 56.637 35.978  -0.238  1.00 25.50  ? 156 ALA A CB    1 
ATOM   1795 N N     . VAL C 3 140 ? 53.987 37.773  -1.299  1.00 24.15  ? 157 VAL A N     1 
ATOM   1796 C CA    . VAL C 3 140 ? 53.323 38.418  -2.427  1.00 23.34  ? 157 VAL A CA    1 
ATOM   1797 C C     . VAL C 3 140 ? 53.800 39.854  -2.487  1.00 23.42  ? 157 VAL A C     1 
ATOM   1798 O O     . VAL C 3 140 ? 54.380 40.345  -1.537  1.00 24.00  ? 157 VAL A O     1 
ATOM   1799 C CB    . VAL C 3 140 ? 51.767 38.446  -2.244  1.00 22.84  ? 157 VAL A CB    1 
ATOM   1800 C CG1   . VAL C 3 140 ? 51.257 37.078  -1.852  1.00 21.93  ? 157 VAL A CG1   1 
ATOM   1801 C CG2   . VAL C 3 140 ? 51.366 39.479  -1.203  1.00 21.28  ? 157 VAL A CG2   1 
ATOM   1802 N N     . ARG C 3 141 ? 53.555 40.522  -3.602  1.00 24.50  ? 158 ARG A N     1 
ATOM   1803 C CA    . ARG C 3 141 ? 53.924 41.933  -3.753  1.00 25.20  ? 158 ARG A CA    1 
ATOM   1804 C C     . ARG C 3 141 ? 52.670 42.707  -4.189  1.00 25.31  ? 158 ARG A C     1 
ATOM   1805 O O     . ARG C 3 141 ? 51.847 42.198  -4.972  1.00 23.80  ? 158 ARG A O     1 
ATOM   1806 C CB    . ARG C 3 141 ? 55.028 42.114  -4.815  1.00 24.97  ? 158 ARG A CB    1 
ATOM   1807 C CG    . ARG C 3 141 ? 56.447 41.759  -4.376  1.00 25.47  ? 158 ARG A CG    1 
ATOM   1808 C CD    . ARG C 3 141 ? 57.376 41.607  -5.595  1.00 25.09  ? 158 ARG A CD    1 
ATOM   1809 N NE    . ARG C 3 141 ? 58.795 41.520  -5.245  1.00 24.49  ? 158 ARG A NE    1 
ATOM   1810 C CZ    . ARG C 3 141 ? 59.544 42.553  -4.870  1.00 24.59  ? 158 ARG A CZ    1 
ATOM   1811 N NH1   . ARG C 3 141 ? 59.015 43.759  -4.798  1.00 24.36  ? 158 ARG A NH1   1 
ATOM   1812 N NH2   . ARG C 3 141 ? 60.823 42.379  -4.557  1.00 24.33  ? 158 ARG A NH2   1 
ATOM   1813 N N     . LEU C 3 142 ? 52.514 43.919  -3.660  1.00 25.18  ? 159 LEU A N     1 
ATOM   1814 C CA    . LEU C 3 142 ? 51.380 44.757  -4.035  1.00 25.57  ? 159 LEU A CA    1 
ATOM   1815 C C     . LEU C 3 142 ? 51.736 45.350  -5.384  1.00 26.80  ? 159 LEU A C     1 
ATOM   1816 O O     . LEU C 3 142 ? 52.907 45.625  -5.643  1.00 27.61  ? 159 LEU A O     1 
ATOM   1817 C CB    . LEU C 3 142 ? 51.180 45.904  -3.049  1.00 23.19  ? 159 LEU A CB    1 
ATOM   1818 C CG    . LEU C 3 142 ? 50.602 45.714  -1.650  1.00 21.53  ? 159 LEU A CG    1 
ATOM   1819 C CD1   . LEU C 3 142 ? 50.376 47.107  -1.056  1.00 19.30  ? 159 LEU A CD1   1 
ATOM   1820 C CD2   . LEU C 3 142 ? 49.302 44.928  -1.699  1.00 20.03  ? 159 LEU A CD2   1 
ATOM   1821 N N     . CYS C 3 143 ? 50.744 45.541  -6.246  1.00 27.94  ? 160 CYS A N     1 
ATOM   1822 C CA    . CYS C 3 143 ? 51.000 46.126  -7.560  1.00 29.58  ? 160 CYS A CA    1 
ATOM   1823 C C     . CYS C 3 143 ? 50.024 47.268  -7.816  1.00 30.76  ? 160 CYS A C     1 
ATOM   1824 O O     . CYS C 3 143 ? 48.806 47.060  -7.841  1.00 31.90  ? 160 CYS A O     1 
ATOM   1825 C CB    . CYS C 3 143 ? 50.866 45.070  -8.660  1.00 28.85  ? 160 CYS A CB    1 
ATOM   1826 S SG    . CYS C 3 143 ? 51.386 45.664  -10.279 1.00 28.13  ? 160 CYS A SG    1 
ATOM   1827 N N     . PHE C 3 144 ? 50.563 48.469  -8.008  1.00 31.17  ? 161 PHE A N     1 
ATOM   1828 C CA    . PHE C 3 144 ? 49.746 49.659  -8.239  1.00 31.31  ? 161 PHE A CA    1 
ATOM   1829 C C     . PHE C 3 144 ? 49.589 50.060  -9.703  1.00 32.49  ? 161 PHE A C     1 
ATOM   1830 O O     . PHE C 3 144 ? 50.472 50.698  -10.277 1.00 33.65  ? 161 PHE A O     1 
ATOM   1831 C CB    . PHE C 3 144 ? 50.349 50.827  -7.486  1.00 30.82  ? 161 PHE A CB    1 
ATOM   1832 C CG    . PHE C 3 144 ? 50.482 50.590  -6.021  1.00 31.94  ? 161 PHE A CG    1 
ATOM   1833 C CD1   . PHE C 3 144 ? 49.371 50.661  -5.190  1.00 31.95  ? 161 PHE A CD1   1 
ATOM   1834 C CD2   . PHE C 3 144 ? 51.722 50.284  -5.463  1.00 31.51  ? 161 PHE A CD2   1 
ATOM   1835 C CE1   . PHE C 3 144 ? 49.499 50.435  -3.824  1.00 32.25  ? 161 PHE A CE1   1 
ATOM   1836 C CE2   . PHE C 3 144 ? 51.854 50.056  -4.103  1.00 30.83  ? 161 PHE A CE2   1 
ATOM   1837 C CZ    . PHE C 3 144 ? 50.745 50.132  -3.284  1.00 31.50  ? 161 PHE A CZ    1 
ATOM   1838 N N     . GLN C 3 145 ? 48.462 49.699  -10.307 1.00 32.55  ? 162 GLN A N     1 
ATOM   1839 C CA    . GLN C 3 145 ? 48.198 50.051  -11.697 1.00 32.15  ? 162 GLN A CA    1 
ATOM   1840 C C     . GLN C 3 145 ? 47.317 51.299  -11.683 1.00 32.98  ? 162 GLN A C     1 
ATOM   1841 O O     . GLN C 3 145 ? 46.106 51.212  -11.500 1.00 33.96  ? 162 GLN A O     1 
ATOM   1842 C CB    . GLN C 3 145 ? 47.496 48.884  -12.385 1.00 30.60  ? 162 GLN A CB    1 
ATOM   1843 C CG    . GLN C 3 145 ? 48.249 47.584  -12.184 1.00 30.75  ? 162 GLN A CG    1 
ATOM   1844 C CD    . GLN C 3 145 ? 47.352 46.361  -12.097 1.00 30.77  ? 162 GLN A CD    1 
ATOM   1845 O OE1   . GLN C 3 145 ? 46.915 45.823  -13.110 1.00 30.40  ? 162 GLN A OE1   1 
ATOM   1846 N NE2   . GLN C 3 145 ? 47.072 45.921  -10.875 1.00 30.15  ? 162 GLN A NE2   1 
ATOM   1847 N N     . VAL C 3 146 ? 47.936 52.461  -11.863 1.00 33.91  ? 163 VAL A N     1 
ATOM   1848 C CA    . VAL C 3 146 ? 47.231 53.739  -11.849 1.00 35.14  ? 163 VAL A CA    1 
ATOM   1849 C C     . VAL C 3 146 ? 46.941 54.311  -13.240 1.00 36.82  ? 163 VAL A C     1 
ATOM   1850 O O     . VAL C 3 146 ? 47.834 54.404  -14.082 1.00 37.21  ? 163 VAL A O     1 
ATOM   1851 C CB    . VAL C 3 146 ? 48.043 54.773  -11.069 1.00 35.17  ? 163 VAL A CB    1 
ATOM   1852 C CG1   . VAL C 3 146 ? 47.324 56.106  -11.064 1.00 36.28  ? 163 VAL A CG1   1 
ATOM   1853 C CG2   . VAL C 3 146 ? 48.284 54.275  -9.650  1.00 35.64  ? 163 VAL A CG2   1 
ATOM   1854 N N     . THR C 3 147 ? 45.694 54.717  -13.469 1.00 38.27  ? 164 THR A N     1 
ATOM   1855 C CA    . THR C 3 147 ? 45.298 55.281  -14.757 1.00 39.98  ? 164 THR A CA    1 
ATOM   1856 C C     . THR C 3 147 ? 44.913 56.765  -14.695 1.00 41.43  ? 164 THR A C     1 
ATOM   1857 O O     . THR C 3 147 ? 43.968 57.139  -13.995 1.00 41.86  ? 164 THR A O     1 
ATOM   1858 C CB    . THR C 3 147 ? 44.103 54.528  -15.333 1.00 39.54  ? 164 THR A CB    1 
ATOM   1859 O OG1   . THR C 3 147 ? 44.380 53.128  -15.327 1.00 40.52  ? 164 THR A OG1   1 
ATOM   1860 C CG2   . THR C 3 147 ? 43.832 54.974  -16.746 1.00 39.39  ? 164 THR A CG2   1 
ATOM   1861 N N     . VAL C 3 148 ? 45.633 57.606  -15.436 1.00 42.57  ? 165 VAL A N     1 
ATOM   1862 C CA    . VAL C 3 148 ? 45.330 59.035  -15.465 1.00 43.91  ? 165 VAL A CA    1 
ATOM   1863 C C     . VAL C 3 148 ? 44.708 59.467  -16.798 1.00 45.10  ? 165 VAL A C     1 
ATOM   1864 O O     . VAL C 3 148 ? 43.977 58.700  -17.435 1.00 44.75  ? 165 VAL A O     1 
ATOM   1865 C CB    . VAL C 3 148 ? 46.584 59.891  -15.224 1.00 43.51  ? 165 VAL A CB    1 
ATOM   1866 C CG1   . VAL C 3 148 ? 47.116 59.651  -13.831 1.00 43.53  ? 165 VAL A CG1   1 
ATOM   1867 C CG2   . VAL C 3 148 ? 47.631 59.570  -16.268 1.00 43.76  ? 165 VAL A CG2   1 
ATOM   1868 N N     . ARG C 3 149 ? 45.004 60.702  -17.205 1.00 46.62  ? 166 ARG A N     1 
ATOM   1869 C CA    . ARG C 3 149 ? 44.480 61.274  -18.442 1.00 48.51  ? 166 ARG A CA    1 
ATOM   1870 C C     . ARG C 3 149 ? 45.590 62.011  -19.175 1.00 49.29  ? 166 ARG A C     1 
ATOM   1871 O O     . ARG C 3 149 ? 46.423 62.662  -18.550 1.00 49.91  ? 166 ARG A O     1 
ATOM   1872 C CB    . ARG C 3 149 ? 43.358 62.268  -18.129 1.00 49.58  ? 166 ARG A CB    1 
ATOM   1873 C CG    . ARG C 3 149 ? 42.286 61.755  -17.174 1.00 51.16  ? 166 ARG A CG    1 
ATOM   1874 C CD    . ARG C 3 149 ? 41.330 60.779  -17.848 1.00 51.75  ? 166 ARG A CD    1 
ATOM   1875 N NE    . ARG C 3 149 ? 40.761 59.849  -16.878 1.00 52.99  ? 166 ARG A NE    1 
ATOM   1876 C CZ    . ARG C 3 149 ? 39.876 58.907  -17.180 1.00 53.85  ? 166 ARG A CZ    1 
ATOM   1877 N NH1   . ARG C 3 149 ? 39.450 58.779  -18.432 1.00 54.98  ? 166 ARG A NH1   1 
ATOM   1878 N NH2   . ARG C 3 149 ? 39.439 58.073  -16.244 1.00 53.70  ? 166 ARG A NH2   1 
ATOM   1879 N N     . ASP C 3 150 ? 45.590 61.920  -20.501 1.00 50.36  ? 167 ASP A N     1 
ATOM   1880 C CA    . ASP C 3 150 ? 46.603 62.589  -21.318 1.00 51.12  ? 167 ASP A CA    1 
ATOM   1881 C C     . ASP C 3 150 ? 46.060 63.925  -21.805 1.00 51.20  ? 167 ASP A C     1 
ATOM   1882 O O     . ASP C 3 150 ? 44.904 64.249  -21.562 1.00 51.27  ? 167 ASP A O     1 
ATOM   1883 C CB    . ASP C 3 150 ? 46.960 61.719  -22.525 1.00 52.18  ? 167 ASP A CB    1 
ATOM   1884 C CG    . ASP C 3 150 ? 45.788 61.526  -23.467 1.00 53.30  ? 167 ASP A CG    1 
ATOM   1885 O OD1   . ASP C 3 150 ? 45.924 60.758  -24.449 1.00 54.28  ? 167 ASP A OD1   1 
ATOM   1886 O OD2   . ASP C 3 150 ? 44.733 62.149  -23.226 1.00 53.20  ? 167 ASP A OD2   1 
ATOM   1887 N N     . PRO C 3 151 ? 46.890 64.727  -22.485 1.00 51.49  ? 168 PRO A N     1 
ATOM   1888 C CA    . PRO C 3 151 ? 46.377 66.008  -22.962 1.00 51.70  ? 168 PRO A CA    1 
ATOM   1889 C C     . PRO C 3 151 ? 45.094 65.845  -23.768 1.00 52.00  ? 168 PRO A C     1 
ATOM   1890 O O     . PRO C 3 151 ? 44.151 66.622  -23.609 1.00 52.98  ? 168 PRO A O     1 
ATOM   1891 C CB    . PRO C 3 151 ? 47.539 66.547  -23.780 1.00 51.52  ? 168 PRO A CB    1 
ATOM   1892 C CG    . PRO C 3 151 ? 48.703 66.136  -22.936 1.00 51.58  ? 168 PRO A CG    1 
ATOM   1893 C CD    . PRO C 3 151 ? 48.359 64.684  -22.612 1.00 51.84  ? 168 PRO A CD    1 
ATOM   1894 N N     . ALA C 3 152 ? 45.043 64.831  -24.621 1.00 51.66  ? 169 ALA A N     1 
ATOM   1895 C CA    . ALA C 3 152 ? 43.842 64.606  -25.416 1.00 51.46  ? 169 ALA A CA    1 
ATOM   1896 C C     . ALA C 3 152 ? 42.684 64.233  -24.492 1.00 50.93  ? 169 ALA A C     1 
ATOM   1897 O O     . ALA C 3 152 ? 41.570 63.958  -24.940 1.00 50.91  ? 169 ALA A O     1 
ATOM   1898 C CB    . ALA C 3 152 ? 44.084 63.499  -26.436 1.00 52.11  ? 169 ALA A CB    1 
ATOM   1899 N N     . GLY C 3 153 ? 42.963 64.222  -23.197 1.00 50.15  ? 170 GLY A N     1 
ATOM   1900 C CA    . GLY C 3 153 ? 41.942 63.888  -22.235 1.00 49.81  ? 170 GLY A CA    1 
ATOM   1901 C C     . GLY C 3 153 ? 41.519 62.441  -22.310 1.00 49.79  ? 170 GLY A C     1 
ATOM   1902 O O     . GLY C 3 153 ? 40.419 62.095  -21.885 1.00 50.09  ? 170 GLY A O     1 
ATOM   1903 N N     . ARG C 3 154 ? 42.377 61.588  -22.859 1.00 50.15  ? 171 ARG A N     1 
ATOM   1904 C CA    . ARG C 3 154 ? 42.056 60.163  -22.952 1.00 50.19  ? 171 ARG A CA    1 
ATOM   1905 C C     . ARG C 3 154 ? 42.710 59.347  -21.824 1.00 48.77  ? 171 ARG A C     1 
ATOM   1906 O O     . ARG C 3 154 ? 43.647 59.814  -21.154 1.00 48.29  ? 171 ARG A O     1 
ATOM   1907 C CB    . ARG C 3 154 ? 42.470 59.603  -24.317 1.00 51.94  ? 171 ARG A CB    1 
ATOM   1908 C CG    . ARG C 3 154 ? 41.677 60.207  -25.469 1.00 54.87  ? 171 ARG A CG    1 
ATOM   1909 C CD    . ARG C 3 154 ? 41.762 59.384  -26.758 1.00 56.33  ? 171 ARG A CD    1 
ATOM   1910 N NE    . ARG C 3 154 ? 41.092 60.084  -27.855 1.00 58.16  ? 171 ARG A NE    1 
ATOM   1911 C CZ    . ARG C 3 154 ? 40.824 59.557  -29.049 1.00 59.13  ? 171 ARG A CZ    1 
ATOM   1912 N NH1   . ARG C 3 154 ? 41.165 58.300  -29.329 1.00 59.20  ? 171 ARG A NH1   1 
ATOM   1913 N NH2   . ARG C 3 154 ? 40.214 60.297  -29.969 1.00 59.36  ? 171 ARG A NH2   1 
ATOM   1914 N N     . PRO C 3 155 ? 42.202 58.124  -21.587 1.00 46.70  ? 172 PRO A N     1 
ATOM   1915 C CA    . PRO C 3 155 ? 42.704 57.217  -20.554 1.00 44.83  ? 172 PRO A CA    1 
ATOM   1916 C C     . PRO C 3 155 ? 44.163 56.875  -20.801 1.00 42.92  ? 172 PRO A C     1 
ATOM   1917 O O     . PRO C 3 155 ? 44.521 56.428  -21.892 1.00 42.91  ? 172 PRO A O     1 
ATOM   1918 C CB    . PRO C 3 155 ? 41.813 55.989  -20.713 1.00 45.39  ? 172 PRO A CB    1 
ATOM   1919 C CG    . PRO C 3 155 ? 40.555 56.550  -21.243 1.00 46.11  ? 172 PRO A CG    1 
ATOM   1920 C CD    . PRO C 3 155 ? 41.053 57.519  -22.277 1.00 46.44  ? 172 PRO A CD    1 
ATOM   1921 N N     . LEU C 3 156 ? 44.999 57.086  -19.791 1.00 40.69  ? 173 LEU A N     1 
ATOM   1922 C CA    . LEU C 3 156 ? 46.421 56.782  -19.903 1.00 38.36  ? 173 LEU A CA    1 
ATOM   1923 C C     . LEU C 3 156 ? 46.851 55.892  -18.744 1.00 36.86  ? 173 LEU A C     1 
ATOM   1924 O O     . LEU C 3 156 ? 46.954 56.346  -17.604 1.00 36.74  ? 173 LEU A O     1 
ATOM   1925 C CB    . LEU C 3 156 ? 47.235 58.071  -19.897 1.00 38.20  ? 173 LEU A CB    1 
ATOM   1926 C CG    . LEU C 3 156 ? 48.748 57.885  -19.990 1.00 38.33  ? 173 LEU A CG    1 
ATOM   1927 C CD1   . LEU C 3 156 ? 49.091 57.028  -21.206 1.00 37.62  ? 173 LEU A CD1   1 
ATOM   1928 C CD2   . LEU C 3 156 ? 49.413 59.247  -20.085 1.00 37.97  ? 173 LEU A CD2   1 
ATOM   1929 N N     . LEU C 3 157 ? 47.091 54.619  -19.041 1.00 34.99  ? 174 LEU A N     1 
ATOM   1930 C CA    . LEU C 3 157 ? 47.498 53.659  -18.016 1.00 32.83  ? 174 LEU A CA    1 
ATOM   1931 C C     . LEU C 3 157 ? 48.981 53.772  -17.714 1.00 31.68  ? 174 LEU A C     1 
ATOM   1932 O O     . LEU C 3 157 ? 49.822 53.438  -18.544 1.00 32.27  ? 174 LEU A O     1 
ATOM   1933 C CB    . LEU C 3 157 ? 47.182 52.236  -18.467 1.00 31.42  ? 174 LEU A CB    1 
ATOM   1934 C CG    . LEU C 3 157 ? 47.534 51.122  -17.487 1.00 30.55  ? 174 LEU A CG    1 
ATOM   1935 C CD1   . LEU C 3 157 ? 46.819 51.337  -16.159 1.00 29.41  ? 174 LEU A CD1   1 
ATOM   1936 C CD2   . LEU C 3 157 ? 47.145 49.793  -18.100 1.00 30.06  ? 174 LEU A CD2   1 
ATOM   1937 N N     . LEU C 3 158 ? 49.306 54.239  -16.520 1.00 30.60  ? 175 LEU A N     1 
ATOM   1938 C CA    . LEU C 3 158 ? 50.698 54.393  -16.151 1.00 29.30  ? 175 LEU A CA    1 
ATOM   1939 C C     . LEU C 3 158 ? 51.418 53.077  -15.918 1.00 28.45  ? 175 LEU A C     1 
ATOM   1940 O O     . LEU C 3 158 ? 50.793 52.037  -15.705 1.00 28.85  ? 175 LEU A O     1 
ATOM   1941 C CB    . LEU C 3 158 ? 50.800 55.291  -14.932 1.00 28.91  ? 175 LEU A CB    1 
ATOM   1942 C CG    . LEU C 3 158 ? 51.113 56.724  -15.356 1.00 29.23  ? 175 LEU A CG    1 
ATOM   1943 C CD1   . LEU C 3 158 ? 50.421 57.028  -16.659 1.00 30.07  ? 175 LEU A CD1   1 
ATOM   1944 C CD2   . LEU C 3 158 ? 50.686 57.690  -14.278 1.00 29.79  ? 175 LEU A CD2   1 
ATOM   1945 N N     . THR C 3 159 ? 52.741 53.120  -15.982 1.00 27.34  ? 176 THR A N     1 
ATOM   1946 C CA    . THR C 3 159 ? 53.533 51.918  -15.784 1.00 26.95  ? 176 THR A CA    1 
ATOM   1947 C C     . THR C 3 159 ? 53.426 51.394  -14.359 1.00 26.00  ? 176 THR A C     1 
ATOM   1948 O O     . THR C 3 159 ? 53.626 52.135  -13.393 1.00 24.43  ? 176 THR A O     1 
ATOM   1949 C CB    . THR C 3 159 ? 55.013 52.155  -16.135 1.00 27.47  ? 176 THR A CB    1 
ATOM   1950 O OG1   . THR C 3 159 ? 55.818 51.232  -15.402 1.00 27.36  ? 176 THR A OG1   1 
ATOM   1951 C CG2   . THR C 3 159 ? 55.429 53.581  -15.806 1.00 29.20  ? 176 THR A CG2   1 
ATOM   1952 N N     . PRO C 3 160 ? 53.115 50.090  -14.222 1.00 25.98  ? 177 PRO A N     1 
ATOM   1953 C CA    . PRO C 3 160 ? 52.945 49.346  -12.965 1.00 25.84  ? 177 PRO A CA    1 
ATOM   1954 C C     . PRO C 3 160 ? 54.120 49.496  -12.004 1.00 26.54  ? 177 PRO A C     1 
ATOM   1955 O O     . PRO C 3 160 ? 55.278 49.463  -12.424 1.00 26.99  ? 177 PRO A O     1 
ATOM   1956 C CB    . PRO C 3 160 ? 52.800 47.900  -13.431 1.00 25.14  ? 177 PRO A CB    1 
ATOM   1957 C CG    . PRO C 3 160 ? 52.296 48.019  -14.820 1.00 25.18  ? 177 PRO A CG    1 
ATOM   1958 C CD    . PRO C 3 160 ? 53.079 49.167  -15.371 1.00 24.83  ? 177 PRO A CD    1 
ATOM   1959 N N     . VAL C 3 161 ? 53.824 49.664  -10.717 1.00 26.62  ? 178 VAL A N     1 
ATOM   1960 C CA    . VAL C 3 161 ? 54.874 49.778  -9.709  1.00 27.07  ? 178 VAL A CA    1 
ATOM   1961 C C     . VAL C 3 161 ? 54.615 48.760  -8.603  1.00 27.06  ? 178 VAL A C     1 
ATOM   1962 O O     . VAL C 3 161 ? 53.463 48.497  -8.232  1.00 28.47  ? 178 VAL A O     1 
ATOM   1963 C CB    . VAL C 3 161 ? 54.940 51.185  -9.078  1.00 28.10  ? 178 VAL A CB    1 
ATOM   1964 C CG1   . VAL C 3 161 ? 55.127 52.252  -10.175 1.00 27.01  ? 178 VAL A CG1   1 
ATOM   1965 C CG2   . VAL C 3 161 ? 53.698 51.434  -8.270  1.00 28.77  ? 178 VAL A CG2   1 
ATOM   1966 N N     . LEU C 3 162 ? 55.689 48.184  -8.081  1.00 25.90  ? 179 LEU A N     1 
ATOM   1967 C CA    . LEU C 3 162 ? 55.575 47.181  -7.038  1.00 24.83  ? 179 LEU A CA    1 
ATOM   1968 C C     . LEU C 3 162 ? 56.082 47.692  -5.705  1.00 24.62  ? 179 LEU A C     1 
ATOM   1969 O O     . LEU C 3 162 ? 56.908 48.587  -5.654  1.00 24.74  ? 179 LEU A O     1 
ATOM   1970 C CB    . LEU C 3 162 ? 56.387 45.944  -7.418  1.00 24.01  ? 179 LEU A CB    1 
ATOM   1971 C CG    . LEU C 3 162 ? 56.140 45.334  -8.796  1.00 23.97  ? 179 LEU A CG    1 
ATOM   1972 C CD1   . LEU C 3 162 ? 57.116 44.169  -9.036  1.00 22.00  ? 179 LEU A CD1   1 
ATOM   1973 C CD2   . LEU C 3 162 ? 54.681 44.885  -8.888  1.00 23.04  ? 179 LEU A CD2   1 
ATOM   1974 N N     . SER C 3 163 ? 55.581 47.110  -4.623  1.00 24.27  ? 180 SER A N     1 
ATOM   1975 C CA    . SER C 3 163 ? 56.033 47.463  -3.287  1.00 23.77  ? 180 SER A CA    1 
ATOM   1976 C C     . SER C 3 163 ? 57.013 46.379  -2.843  1.00 23.38  ? 180 SER A C     1 
ATOM   1977 O O     . SER C 3 163 ? 57.361 45.478  -3.605  1.00 23.06  ? 180 SER A O     1 
ATOM   1978 C CB    . SER C 3 163 ? 54.867 47.459  -2.313  1.00 24.78  ? 180 SER A CB    1 
ATOM   1979 O OG    . SER C 3 163 ? 54.436 46.127  -2.062  1.00 24.10  ? 180 SER A OG    1 
ATOM   1980 N N     . HIS C 3 164 ? 57.442 46.469  -1.596  1.00 23.16  ? 181 HIS A N     1 
ATOM   1981 C CA    . HIS C 3 164 ? 58.333 45.480  -1.026  1.00 23.77  ? 181 HIS A CA    1 
ATOM   1982 C C     . HIS C 3 164 ? 57.505 44.220  -0.848  1.00 23.94  ? 181 HIS A C     1 
ATOM   1983 O O     . HIS C 3 164 ? 56.282 44.272  -0.874  1.00 24.62  ? 181 HIS A O     1 
ATOM   1984 C CB    . HIS C 3 164 ? 58.824 45.967  0.326   1.00 24.17  ? 181 HIS A CB    1 
ATOM   1985 C CG    . HIS C 3 164 ? 59.676 47.189  0.236   1.00 25.62  ? 181 HIS A CG    1 
ATOM   1986 N ND1   . HIS C 3 164 ? 60.021 47.942  1.336   1.00 26.21  ? 181 HIS A ND1   1 
ATOM   1987 C CD2   . HIS C 3 164 ? 60.279 47.773  -0.826  1.00 25.08  ? 181 HIS A CD2   1 
ATOM   1988 C CE1   . HIS C 3 164 ? 60.801 48.937  0.956   1.00 25.39  ? 181 HIS A CE1   1 
ATOM   1989 N NE2   . HIS C 3 164 ? 60.973 48.856  -0.351  1.00 25.89  ? 181 HIS A NE2   1 
ATOM   1990 N N     . PRO C 3 165 ? 58.150 43.063  -0.682  1.00 23.45  ? 182 PRO A N     1 
ATOM   1991 C CA    . PRO C 3 165 ? 57.298 41.891  -0.515  1.00 22.53  ? 182 PRO A CA    1 
ATOM   1992 C C     . PRO C 3 165 ? 56.678 41.846  0.871   1.00 21.95  ? 182 PRO A C     1 
ATOM   1993 O O     . PRO C 3 165 ? 57.237 42.374  1.834   1.00 21.20  ? 182 PRO A O     1 
ATOM   1994 C CB    . PRO C 3 165 ? 58.251 40.727  -0.785  1.00 22.79  ? 182 PRO A CB    1 
ATOM   1995 C CG    . PRO C 3 165 ? 59.549 41.247  -0.343  1.00 23.49  ? 182 PRO A CG    1 
ATOM   1996 C CD    . PRO C 3 165 ? 59.550 42.664  -0.879  1.00 23.80  ? 182 PRO A CD    1 
ATOM   1997 N N     . ILE C 3 166 ? 55.504 41.229  0.951   1.00 20.79  ? 183 ILE A N     1 
ATOM   1998 C CA    . ILE C 3 166 ? 54.781 41.087  2.194   1.00 20.10  ? 183 ILE A CA    1 
ATOM   1999 C C     . ILE C 3 166 ? 54.766 39.606  2.495   1.00 20.56  ? 183 ILE A C     1 
ATOM   2000 O O     . ILE C 3 166 ? 54.367 38.809  1.641   1.00 21.32  ? 183 ILE A O     1 
ATOM   2001 C CB    . ILE C 3 166 ? 53.364 41.580  2.015   1.00 20.50  ? 183 ILE A CB    1 
ATOM   2002 C CG1   . ILE C 3 166 ? 53.405 43.057  1.626   1.00 20.40  ? 183 ILE A CG1   1 
ATOM   2003 C CG2   . ILE C 3 166 ? 52.543 41.296  3.265   1.00 19.25  ? 183 ILE A CG2   1 
ATOM   2004 C CD1   . ILE C 3 166 ? 52.053 43.677  1.390   1.00 20.88  ? 183 ILE A CD1   1 
ATOM   2005 N N     . PHE C 3 167 ? 55.200 39.230  3.695   1.00 20.08  ? 184 PHE A N     1 
ATOM   2006 C CA    . PHE C 3 167 ? 55.244 37.820  4.061   1.00 19.79  ? 184 PHE A CA    1 
ATOM   2007 C C     . PHE C 3 167 ? 54.147 37.326  5.007   1.00 19.94  ? 184 PHE A C     1 
ATOM   2008 O O     . PHE C 3 167 ? 53.673 38.050  5.890   1.00 19.82  ? 184 PHE A O     1 
ATOM   2009 C CB    . PHE C 3 167 ? 56.615 37.470  4.661   1.00 19.50  ? 184 PHE A CB    1 
ATOM   2010 C CG    . PHE C 3 167 ? 57.774 37.773  3.757   1.00 18.87  ? 184 PHE A CG    1 
ATOM   2011 C CD1   . PHE C 3 167 ? 58.325 39.054  3.713   1.00 18.33  ? 184 PHE A CD1   1 
ATOM   2012 C CD2   . PHE C 3 167 ? 58.307 36.784  2.933   1.00 18.49  ? 184 PHE A CD2   1 
ATOM   2013 C CE1   . PHE C 3 167 ? 59.385 39.343  2.864   1.00 17.67  ? 184 PHE A CE1   1 
ATOM   2014 C CE2   . PHE C 3 167 ? 59.374 37.066  2.074   1.00 18.22  ? 184 PHE A CE2   1 
ATOM   2015 C CZ    . PHE C 3 167 ? 59.911 38.349  2.042   1.00 18.02  ? 184 PHE A CZ    1 
ATOM   2016 N N     . ASP C 3 168 ? 53.765 36.067  4.813   1.00 19.88  ? 185 ASP A N     1 
ATOM   2017 C CA    . ASP C 3 168 ? 52.745 35.408  5.627   1.00 20.15  ? 185 ASP A CA    1 
ATOM   2018 C C     . ASP C 3 168 ? 53.331 35.165  7.034   1.00 20.25  ? 185 ASP A C     1 
ATOM   2019 O O     . ASP C 3 168 ? 54.243 34.350  7.212   1.00 19.72  ? 185 ASP A O     1 
ATOM   2020 C CB    . ASP C 3 168 ? 52.354 34.080  4.946   1.00 20.62  ? 185 ASP A CB    1 
ATOM   2021 C CG    . ASP C 3 168 ? 51.179 33.375  5.626   1.00 21.54  ? 185 ASP A CG    1 
ATOM   2022 O OD1   . ASP C 3 168 ? 50.836 32.240  5.193   1.00 20.57  ? 185 ASP A OD1   1 
ATOM   2023 O OD2   . ASP C 3 168 ? 50.606 33.954  6.583   1.00 21.17  ? 185 ASP A OD2   1 
ATOM   2024 N N     . ASN C 3 169 ? 52.821 35.874  8.034   1.00 20.54  ? 186 ASN A N     1 
ATOM   2025 C CA    . ASN C 3 169 ? 53.344 35.699  9.385   1.00 21.32  ? 186 ASN A CA    1 
ATOM   2026 C C     . ASN C 3 169 ? 52.963 34.351  10.009  1.00 23.16  ? 186 ASN A C     1 
ATOM   2027 O O     . ASN C 3 169 ? 53.554 33.906  11.008  1.00 22.76  ? 186 ASN A O     1 
ATOM   2028 C CB    . ASN C 3 169 ? 52.856 36.800  10.296  1.00 19.44  ? 186 ASN A CB    1 
ATOM   2029 C CG    . ASN C 3 169 ? 53.772 37.002  11.455  1.00 19.27  ? 186 ASN A CG    1 
ATOM   2030 O OD1   . ASN C 3 169 ? 54.831 37.597  11.307  1.00 20.62  ? 186 ASN A OD1   1 
ATOM   2031 N ND2   . ASN C 3 169 ? 53.393 36.492  12.617  1.00 17.35  ? 186 ASN A ND2   1 
ATOM   2032 N N     . ARG C 3 170 ? 51.962 33.714  9.411   1.00 24.24  ? 187 ARG A N     1 
ATOM   2033 C CA    . ARG C 3 170 ? 51.475 32.421  9.847   1.00 24.49  ? 187 ARG A CA    1 
ATOM   2034 C C     . ARG C 3 170 ? 52.623 31.440  9.635   1.00 25.19  ? 187 ARG A C     1 
ATOM   2035 O O     . ARG C 3 170 ? 52.705 30.400  10.283  1.00 25.41  ? 187 ARG A O     1 
ATOM   2036 C CB    . ARG C 3 170 ? 50.265 32.038  8.982   1.00 25.02  ? 187 ARG A CB    1 
ATOM   2037 C CG    . ARG C 3 170 ? 49.605 30.723  9.338   1.00 26.45  ? 187 ARG A CG    1 
ATOM   2038 C CD    . ARG C 3 170 ? 48.560 30.323  8.297   1.00 27.59  ? 187 ARG A CD    1 
ATOM   2039 N NE    . ARG C 3 170 ? 47.417 31.226  8.296   1.00 27.92  ? 187 ARG A NE    1 
ATOM   2040 C CZ    . ARG C 3 170 ? 46.392 31.136  9.133   1.00 27.40  ? 187 ARG A CZ    1 
ATOM   2041 N NH1   . ARG C 3 170 ? 46.356 30.176  10.041  1.00 27.77  ? 187 ARG A NH1   1 
ATOM   2042 N NH2   . ARG C 3 170 ? 45.412 32.019  9.066   1.00 27.02  ? 187 ARG A NH2   1 
ATOM   2043 N N     . ALA C 3 171 ? 53.520 31.792  8.723   1.00 25.61  ? 188 ALA A N     1 
ATOM   2044 C CA    . ALA C 3 171 ? 54.653 30.940  8.403   1.00 26.89  ? 188 ALA A CA    1 
ATOM   2045 C C     . ALA C 3 171 ? 55.933 31.314  9.172   1.00 27.90  ? 188 ALA A C     1 
ATOM   2046 O O     . ALA C 3 171 ? 56.525 32.372  8.935   1.00 28.96  ? 188 ALA A O     1 
ATOM   2047 C CB    . ALA C 3 171 ? 54.908 30.984  6.895   1.00 26.55  ? 188 ALA A CB    1 
ATOM   2048 N N     . PRO C 3 172 ? 56.389 30.428  10.082  1.00 27.63  ? 189 PRO A N     1 
ATOM   2049 C CA    . PRO C 3 172 ? 57.583 30.597  10.915  1.00 27.15  ? 189 PRO A CA    1 
ATOM   2050 C C     . PRO C 3 172 ? 58.815 31.092  10.170  1.00 27.44  ? 189 PRO A C     1 
ATOM   2051 O O     . PRO C 3 172 ? 59.537 31.948  10.675  1.00 27.22  ? 189 PRO A O     1 
ATOM   2052 C CB    . PRO C 3 172 ? 57.802 29.207  11.482  1.00 27.40  ? 189 PRO A CB    1 
ATOM   2053 C CG    . PRO C 3 172 ? 56.439 28.691  11.604  1.00 27.96  ? 189 PRO A CG    1 
ATOM   2054 C CD    . PRO C 3 172 ? 55.816 29.090  10.290  1.00 27.56  ? 189 PRO A CD    1 
ATOM   2055 N N     . ASN C 3 173 ? 59.056 30.555  8.975   1.00 27.08  ? 190 ASN A N     1 
ATOM   2056 C CA    . ASN C 3 173 ? 60.220 30.958  8.186   1.00 26.52  ? 190 ASN A CA    1 
ATOM   2057 C C     . ASN C 3 173 ? 60.175 32.406  7.690   1.00 25.15  ? 190 ASN A C     1 
ATOM   2058 O O     . ASN C 3 173 ? 61.209 33.038  7.498   1.00 24.52  ? 190 ASN A O     1 
ATOM   2059 C CB    . ASN C 3 173 ? 60.394 30.025  6.992   1.00 27.71  ? 190 ASN A CB    1 
ATOM   2060 C CG    . ASN C 3 173 ? 59.216 30.072  6.049   1.00 30.76  ? 190 ASN A CG    1 
ATOM   2061 O OD1   . ASN C 3 173 ? 58.738 31.152  5.694   1.00 32.21  ? 190 ASN A OD1   1 
ATOM   2062 N ND2   . ASN C 3 173 ? 58.739 28.901  5.627   1.00 32.09  ? 190 ASN A ND2   1 
ATOM   2063 N N     . THR C 3 174 ? 58.971 32.920  7.475   1.00 24.29  ? 191 THR A N     1 
ATOM   2064 C CA    . THR C 3 174 ? 58.790 34.284  6.996   1.00 23.41  ? 191 THR A CA    1 
ATOM   2065 C C     . THR C 3 174 ? 58.172 35.155  8.072   1.00 22.74  ? 191 THR A C     1 
ATOM   2066 O O     . THR C 3 174 ? 57.903 36.326  7.846   1.00 23.31  ? 191 THR A O     1 
ATOM   2067 C CB    . THR C 3 174 ? 57.847 34.330  5.787   1.00 23.55  ? 191 THR A CB    1 
ATOM   2068 O OG1   . THR C 3 174 ? 56.705 33.513  6.053   1.00 23.39  ? 191 THR A OG1   1 
ATOM   2069 C CG2   . THR C 3 174 ? 58.542 33.829  4.542   1.00 25.25  ? 191 THR A CG2   1 
ATOM   2070 N N     . ALA C 3 175 ? 57.939 34.580  9.242   1.00 21.68  ? 192 ALA A N     1 
ATOM   2071 C CA    . ALA C 3 175 ? 57.333 35.316  10.334  1.00 20.85  ? 192 ALA A CA    1 
ATOM   2072 C C     . ALA C 3 175 ? 58.185 36.453  10.897  1.00 20.77  ? 192 ALA A C     1 
ATOM   2073 O O     . ALA C 3 175 ? 59.400 36.510  10.719  1.00 20.49  ? 192 ALA A O     1 
ATOM   2074 C CB    . ALA C 3 175 ? 56.978 34.365  11.437  1.00 20.50  ? 192 ALA A CB    1 
ATOM   2075 N N     . GLU C 3 176 ? 57.519 37.375  11.565  1.00 20.29  ? 193 GLU A N     1 
ATOM   2076 C CA    . GLU C 3 176 ? 58.205 38.474  12.209  1.00 21.04  ? 193 GLU A CA    1 
ATOM   2077 C C     . GLU C 3 176 ? 58.788 37.880  13.489  1.00 20.32  ? 193 GLU A C     1 
ATOM   2078 O O     . GLU C 3 176 ? 58.050 37.261  14.256  1.00 19.73  ? 193 GLU A O     1 
ATOM   2079 C CB    . GLU C 3 176 ? 57.212 39.583  12.565  1.00 21.99  ? 193 GLU A CB    1 
ATOM   2080 C CG    . GLU C 3 176 ? 57.799 40.650  13.473  1.00 24.51  ? 193 GLU A CG    1 
ATOM   2081 C CD    . GLU C 3 176 ? 56.840 41.800  13.723  1.00 26.53  ? 193 GLU A CD    1 
ATOM   2082 O OE1   . GLU C 3 176 ? 55.897 41.642  14.535  1.00 26.00  ? 193 GLU A OE1   1 
ATOM   2083 O OE2   . GLU C 3 176 ? 57.032 42.860  13.087  1.00 27.84  ? 193 GLU A OE2   1 
ATOM   2084 N N     . LEU C 3 177 ? 60.097 38.051  13.705  1.00 19.15  ? 194 LEU A N     1 
ATOM   2085 C CA    . LEU C 3 177 ? 60.763 37.536  14.905  1.00 18.37  ? 194 LEU A CA    1 
ATOM   2086 C C     . LEU C 3 177 ? 60.342 38.332  16.124  1.00 19.05  ? 194 LEU A C     1 
ATOM   2087 O O     . LEU C 3 177 ? 60.226 39.544  16.050  1.00 20.51  ? 194 LEU A O     1 
ATOM   2088 C CB    . LEU C 3 177 ? 62.263 37.626  14.741  1.00 17.16  ? 194 LEU A CB    1 
ATOM   2089 C CG    . LEU C 3 177 ? 62.798 36.662  13.683  1.00 17.84  ? 194 LEU A CG    1 
ATOM   2090 C CD1   . LEU C 3 177 ? 64.232 36.999  13.331  1.00 17.10  ? 194 LEU A CD1   1 
ATOM   2091 C CD2   . LEU C 3 177 ? 62.680 35.236  14.200  1.00 16.84  ? 194 LEU A CD2   1 
ATOM   2092 N N     . LYS C 3 178 ? 60.106 37.676  17.252  1.00 19.62  ? 195 LYS A N     1 
ATOM   2093 C CA    . LYS C 3 178 ? 59.685 38.433  18.416  1.00 20.67  ? 195 LYS A CA    1 
ATOM   2094 C C     . LYS C 3 178 ? 59.957 37.835  19.800  1.00 20.36  ? 195 LYS A C     1 
ATOM   2095 O O     . LYS C 3 178 ? 59.426 36.793  20.152  1.00 21.04  ? 195 LYS A O     1 
ATOM   2096 C CB    . LYS C 3 178 ? 58.203 38.735  18.269  1.00 22.08  ? 195 LYS A CB    1 
ATOM   2097 C CG    . LYS C 3 178 ? 57.648 39.747  19.244  1.00 25.75  ? 195 LYS A CG    1 
ATOM   2098 C CD    . LYS C 3 178 ? 56.255 40.106  18.772  1.00 29.73  ? 195 LYS A CD    1 
ATOM   2099 C CE    . LYS C 3 178 ? 55.561 41.145  19.649  1.00 32.67  ? 195 LYS A CE    1 
ATOM   2100 N NZ    . LYS C 3 178 ? 54.212 41.475  19.073  1.00 33.85  ? 195 LYS A NZ    1 
ATOM   2101 N N     . ILE C 3 179 ? 60.797 38.505  20.581  1.00 19.80  ? 196 ILE A N     1 
ATOM   2102 C CA    . ILE C 3 179 ? 61.102 38.065  21.941  1.00 19.39  ? 196 ILE A CA    1 
ATOM   2103 C C     . ILE C 3 179 ? 59.922 38.518  22.785  1.00 19.99  ? 196 ILE A C     1 
ATOM   2104 O O     . ILE C 3 179 ? 59.649 39.708  22.867  1.00 20.58  ? 196 ILE A O     1 
ATOM   2105 C CB    . ILE C 3 179 ? 62.355 38.766  22.512  1.00 18.79  ? 196 ILE A CB    1 
ATOM   2106 C CG1   . ILE C 3 179 ? 63.614 38.315  21.781  1.00 17.85  ? 196 ILE A CG1   1 
ATOM   2107 C CG2   . ILE C 3 179 ? 62.459 38.506  23.998  1.00 16.75  ? 196 ILE A CG2   1 
ATOM   2108 C CD1   . ILE C 3 179 ? 64.825 39.106  22.204  1.00 17.42  ? 196 ILE A CD1   1 
ATOM   2109 N N     . CYS C 3 180 ? 59.223 37.595  23.425  1.00 20.18  ? 197 CYS A N     1 
ATOM   2110 C CA    . CYS C 3 180 ? 58.081 37.996  24.228  1.00 20.15  ? 197 CYS A CA    1 
ATOM   2111 C C     . CYS C 3 180 ? 58.442 38.238  25.684  1.00 19.89  ? 197 CYS A C     1 
ATOM   2112 O O     . CYS C 3 180 ? 58.053 39.243  26.282  1.00 19.19  ? 197 CYS A O     1 
ATOM   2113 C CB    . CYS C 3 180 ? 56.983 36.936  24.142  1.00 20.15  ? 197 CYS A CB    1 
ATOM   2114 S SG    . CYS C 3 180 ? 56.188 36.842  22.520  1.00 25.05  ? 197 CYS A SG    1 
ATOM   2115 N N     . ARG C 3 181 ? 59.208 37.318  26.251  1.00 19.21  ? 198 ARG A N     1 
ATOM   2116 C CA    . ARG C 3 181 ? 59.560 37.420  27.650  1.00 18.20  ? 198 ARG A CA    1 
ATOM   2117 C C     . ARG C 3 181 ? 60.927 36.805  27.901  1.00 18.65  ? 198 ARG A C     1 
ATOM   2118 O O     . ARG C 3 181 ? 61.361 35.898  27.175  1.00 18.62  ? 198 ARG A O     1 
ATOM   2119 C CB    . ARG C 3 181 ? 58.508 36.685  28.452  1.00 17.10  ? 198 ARG A CB    1 
ATOM   2120 C CG    . ARG C 3 181 ? 58.379 37.147  29.838  1.00 19.57  ? 198 ARG A CG    1 
ATOM   2121 C CD    . ARG C 3 181 ? 57.103 36.618  30.431  1.00 21.22  ? 198 ARG A CD    1 
ATOM   2122 N NE    . ARG C 3 181 ? 56.793 37.312  31.671  1.00 22.55  ? 198 ARG A NE    1 
ATOM   2123 C CZ    . ARG C 3 181 ? 55.674 37.132  32.350  1.00 23.08  ? 198 ARG A CZ    1 
ATOM   2124 N NH1   . ARG C 3 181 ? 55.464 37.806  33.474  1.00 23.41  ? 198 ARG A NH1   1 
ATOM   2125 N NH2   . ARG C 3 181 ? 54.769 36.274  31.893  1.00 24.21  ? 198 ARG A NH2   1 
ATOM   2126 N N     . VAL C 3 182 ? 61.606 37.281  28.939  1.00 18.40  ? 199 VAL A N     1 
ATOM   2127 C CA    . VAL C 3 182 ? 62.925 36.752  29.230  1.00 18.19  ? 199 VAL A CA    1 
ATOM   2128 C C     . VAL C 3 182 ? 63.262 36.622  30.714  1.00 18.98  ? 199 VAL A C     1 
ATOM   2129 O O     . VAL C 3 182 ? 62.953 37.483  31.543  1.00 18.43  ? 199 VAL A O     1 
ATOM   2130 C CB    . VAL C 3 182 ? 64.006 37.579  28.481  1.00 17.61  ? 199 VAL A CB    1 
ATOM   2131 C CG1   . VAL C 3 182 ? 64.666 38.577  29.393  1.00 16.33  ? 199 VAL A CG1   1 
ATOM   2132 C CG2   . VAL C 3 182 ? 64.996 36.665  27.885  1.00 16.96  ? 199 VAL A CG2   1 
ATOM   2133 N N     . ASN C 3 183 ? 63.891 35.497  31.025  1.00 20.39  ? 200 ASN A N     1 
ATOM   2134 C CA    . ASN C 3 183 ? 64.313 35.132  32.379  1.00 20.02  ? 200 ASN A CA    1 
ATOM   2135 C C     . ASN C 3 183 ? 64.961 36.225  33.190  1.00 19.70  ? 200 ASN A C     1 
ATOM   2136 O O     . ASN C 3 183 ? 64.512 36.568  34.270  1.00 18.87  ? 200 ASN A O     1 
ATOM   2137 C CB    . ASN C 3 183 ? 65.301 33.975  32.300  1.00 20.05  ? 200 ASN A CB    1 
ATOM   2138 C CG    . ASN C 3 183 ? 64.877 32.841  33.144  1.00 22.38  ? 200 ASN A CG    1 
ATOM   2139 O OD1   . ASN C 3 183 ? 65.514 31.800  33.187  1.00 24.41  ? 200 ASN A OD1   1 
ATOM   2140 N ND2   . ASN C 3 183 ? 63.763 33.027  33.833  1.00 24.22  ? 200 ASN A ND2   1 
ATOM   2141 N N     . ARG C 3 184 ? 66.064 36.724  32.651  1.00 20.05  ? 201 ARG A N     1 
ATOM   2142 C CA    . ARG C 3 184 ? 66.864 37.752  33.273  1.00 21.05  ? 201 ARG A CA    1 
ATOM   2143 C C     . ARG C 3 184 ? 67.468 38.604  32.174  1.00 21.55  ? 201 ARG A C     1 
ATOM   2144 O O     . ARG C 3 184 ? 67.670 38.118  31.067  1.00 23.16  ? 201 ARG A O     1 
ATOM   2145 C CB    . ARG C 3 184 ? 67.982 37.096  34.089  1.00 22.00  ? 201 ARG A CB    1 
ATOM   2146 C CG    . ARG C 3 184 ? 68.754 36.044  33.325  1.00 22.75  ? 201 ARG A CG    1 
ATOM   2147 C CD    . ARG C 3 184 ? 70.249 36.084  33.653  1.00 24.72  ? 201 ARG A CD    1 
ATOM   2148 N NE    . ARG C 3 184 ? 70.584 35.642  35.010  1.00 25.01  ? 201 ARG A NE    1 
ATOM   2149 C CZ    . ARG C 3 184 ? 71.802 35.697  35.530  1.00 23.63  ? 201 ARG A CZ    1 
ATOM   2150 N NH1   . ARG C 3 184 ? 72.018 35.283  36.762  1.00 23.40  ? 201 ARG A NH1   1 
ATOM   2151 N NH2   . ARG C 3 184 ? 72.804 36.167  34.814  1.00 24.84  ? 201 ARG A NH2   1 
ATOM   2152 N N     . ASN C 3 185 ? 67.775 39.859  32.477  1.00 20.91  ? 202 ASN A N     1 
ATOM   2153 C CA    . ASN C 3 185 ? 68.353 40.743  31.484  1.00 20.83  ? 202 ASN A CA    1 
ATOM   2154 C C     . ASN C 3 185 ? 69.733 41.308  31.828  1.00 21.14  ? 202 ASN A C     1 
ATOM   2155 O O     . ASN C 3 185 ? 70.148 42.349  31.298  1.00 21.06  ? 202 ASN A O     1 
ATOM   2156 C CB    . ASN C 3 185 ? 67.394 41.885  31.184  1.00 21.80  ? 202 ASN A CB    1 
ATOM   2157 C CG    . ASN C 3 185 ? 66.881 42.546  32.428  1.00 22.39  ? 202 ASN A CG    1 
ATOM   2158 O OD1   . ASN C 3 185 ? 67.504 42.479  33.483  1.00 25.94  ? 202 ASN A OD1   1 
ATOM   2159 N ND2   . ASN C 3 185 ? 65.744 43.201  32.315  1.00 22.97  ? 202 ASN A ND2   1 
ATOM   2160 N N     . SER C 3 186 ? 70.445 40.629  32.716  1.00 20.89  ? 203 SER A N     1 
ATOM   2161 C CA    . SER C 3 186 ? 71.787 41.049  33.071  1.00 21.08  ? 203 SER A CA    1 
ATOM   2162 C C     . SER C 3 186 ? 72.596 39.809  33.452  1.00 21.47  ? 203 SER A C     1 
ATOM   2163 O O     . SER C 3 186 ? 72.029 38.736  33.670  1.00 21.50  ? 203 SER A O     1 
ATOM   2164 C CB    . SER C 3 186 ? 71.751 42.035  34.222  1.00 21.27  ? 203 SER A CB    1 
ATOM   2165 O OG    . SER C 3 186 ? 71.334 41.404  35.410  1.00 22.89  ? 203 SER A OG    1 
ATOM   2166 N N     . GLY C 3 187 ? 73.916 39.949  33.510  1.00 21.89  ? 204 GLY A N     1 
ATOM   2167 C CA    . GLY C 3 187 ? 74.770 38.824  33.856  1.00 22.57  ? 204 GLY A CA    1 
ATOM   2168 C C     . GLY C 3 187 ? 76.235 39.217  33.808  1.00 23.59  ? 204 GLY A C     1 
ATOM   2169 O O     . GLY C 3 187 ? 76.576 40.294  33.323  1.00 24.51  ? 204 GLY A O     1 
ATOM   2170 N N     . SER C 3 188 ? 77.113 38.354  34.302  1.00 23.90  ? 205 SER A N     1 
ATOM   2171 C CA    . SER C 3 188 ? 78.534 38.659  34.303  1.00 24.58  ? 205 SER A CA    1 
ATOM   2172 C C     . SER C 3 188 ? 79.139 38.761  32.919  1.00 24.99  ? 205 SER A C     1 
ATOM   2173 O O     . SER C 3 188 ? 78.717 38.072  32.007  1.00 26.46  ? 205 SER A O     1 
ATOM   2174 C CB    . SER C 3 188 ? 79.305 37.605  35.075  1.00 24.86  ? 205 SER A CB    1 
ATOM   2175 O OG    . SER C 3 188 ? 80.700 37.750  34.847  1.00 26.35  ? 205 SER A OG    1 
ATOM   2176 N N     . CYS C 3 189 ? 80.144 39.614  32.779  1.00 25.26  ? 206 CYS A N     1 
ATOM   2177 C CA    . CYS C 3 189 ? 80.829 39.795  31.512  1.00 26.41  ? 206 CYS A CA    1 
ATOM   2178 C C     . CYS C 3 189 ? 81.660 38.551  31.181  1.00 25.98  ? 206 CYS A C     1 
ATOM   2179 O O     . CYS C 3 189 ? 82.438 38.531  30.231  1.00 26.28  ? 206 CYS A O     1 
ATOM   2180 C CB    . CYS C 3 189 ? 81.722 41.048  31.564  1.00 27.58  ? 206 CYS A CB    1 
ATOM   2181 S SG    . CYS C 3 189 ? 82.896 41.158  32.982  1.00 31.17  ? 206 CYS A SG    1 
ATOM   2182 N N     . LEU C 3 190 ? 81.496 37.508  31.978  1.00 26.10  ? 207 LEU A N     1 
ATOM   2183 C CA    . LEU C 3 190 ? 82.217 36.264  31.726  1.00 25.09  ? 207 LEU A CA    1 
ATOM   2184 C C     . LEU C 3 190 ? 81.294 35.279  31.037  1.00 24.13  ? 207 LEU A C     1 
ATOM   2185 O O     . LEU C 3 190 ? 81.717 34.211  30.603  1.00 24.69  ? 207 LEU A O     1 
ATOM   2186 C CB    . LEU C 3 190 ? 82.739 35.666  33.034  1.00 24.61  ? 207 LEU A CB    1 
ATOM   2187 C CG    . LEU C 3 190 ? 84.160 36.065  33.453  1.00 24.50  ? 207 LEU A CG    1 
ATOM   2188 C CD1   . LEU C 3 190 ? 84.350 37.586  33.324  1.00 24.29  ? 207 LEU A CD1   1 
ATOM   2189 C CD2   . LEU C 3 190 ? 84.393 35.596  34.886  1.00 23.08  ? 207 LEU A CD2   1 
ATOM   2190 N N     . GLY C 3 191 ? 80.024 35.644  30.944  1.00 23.05  ? 208 GLY A N     1 
ATOM   2191 C CA    . GLY C 3 191 ? 79.062 34.784  30.292  1.00 23.42  ? 208 GLY A CA    1 
ATOM   2192 C C     . GLY C 3 191 ? 78.778 33.508  31.049  1.00 22.50  ? 208 GLY A C     1 
ATOM   2193 O O     . GLY C 3 191 ? 79.239 33.340  32.169  1.00 22.84  ? 208 GLY A O     1 
ATOM   2194 N N     . GLY C 3 192 ? 78.005 32.619  30.437  1.00 22.32  ? 209 GLY A N     1 
ATOM   2195 C CA    . GLY C 3 192 ? 77.679 31.358  31.070  1.00 22.81  ? 209 GLY A CA    1 
ATOM   2196 C C     . GLY C 3 192 ? 76.356 31.360  31.804  1.00 23.42  ? 209 GLY A C     1 
ATOM   2197 O O     . GLY C 3 192 ? 75.956 30.344  32.363  1.00 25.46  ? 209 GLY A O     1 
ATOM   2198 N N     . ASP C 3 193 ? 75.675 32.500  31.818  1.00 23.39  ? 210 ASP A N     1 
ATOM   2199 C CA    . ASP C 3 193 ? 74.382 32.615  32.481  1.00 21.53  ? 210 ASP A CA    1 
ATOM   2200 C C     . ASP C 3 193 ? 73.289 32.077  31.572  1.00 20.97  ? 210 ASP A C     1 
ATOM   2201 O O     . ASP C 3 193 ? 73.146 32.514  30.436  1.00 20.81  ? 210 ASP A O     1 
ATOM   2202 C CB    . ASP C 3 193 ? 74.104 34.073  32.816  1.00 21.40  ? 210 ASP A CB    1 
ATOM   2203 C CG    . ASP C 3 193 ? 75.152 34.665  33.744  1.00 22.93  ? 210 ASP A CG    1 
ATOM   2204 O OD1   . ASP C 3 193 ? 75.158 34.316  34.946  1.00 22.38  ? 210 ASP A OD1   1 
ATOM   2205 O OD2   . ASP C 3 193 ? 75.980 35.472  33.265  1.00 23.98  ? 210 ASP A OD2   1 
ATOM   2206 N N     . GLU C 3 194 ? 72.536 31.107  32.078  1.00 21.05  ? 211 GLU A N     1 
ATOM   2207 C CA    . GLU C 3 194 ? 71.437 30.487  31.340  1.00 20.11  ? 211 GLU A CA    1 
ATOM   2208 C C     . GLU C 3 194 ? 70.315 31.506  31.256  1.00 20.08  ? 211 GLU A C     1 
ATOM   2209 O O     . GLU C 3 194 ? 70.107 32.295  32.173  1.00 20.20  ? 211 GLU A O     1 
ATOM   2210 C CB    . GLU C 3 194 ? 70.938 29.231  32.077  1.00 18.96  ? 211 GLU A CB    1 
ATOM   2211 C CG    . GLU C 3 194 ? 70.043 28.319  31.260  1.00 19.73  ? 211 GLU A CG    1 
ATOM   2212 C CD    . GLU C 3 194 ? 69.542 27.111  32.043  1.00 20.77  ? 211 GLU A CD    1 
ATOM   2213 O OE1   . GLU C 3 194 ? 68.708 27.278  32.955  1.00 21.82  ? 211 GLU A OE1   1 
ATOM   2214 O OE2   . GLU C 3 194 ? 69.980 25.977  31.758  1.00 22.80  ? 211 GLU A OE2   1 
ATOM   2215 N N     . ILE C 3 195 ? 69.597 31.508  30.144  1.00 20.03  ? 212 ILE A N     1 
ATOM   2216 C CA    . ILE C 3 195 ? 68.497 32.433  30.000  1.00 19.24  ? 212 ILE A CA    1 
ATOM   2217 C C     . ILE C 3 195 ? 67.323 31.718  29.404  1.00 19.42  ? 212 ILE A C     1 
ATOM   2218 O O     . ILE C 3 195 ? 67.491 30.920  28.487  1.00 21.27  ? 212 ILE A O     1 
ATOM   2219 C CB    . ILE C 3 195 ? 68.867 33.595  29.091  1.00 19.22  ? 212 ILE A CB    1 
ATOM   2220 C CG1   . ILE C 3 195 ? 69.841 34.520  29.822  1.00 20.94  ? 212 ILE A CG1   1 
ATOM   2221 C CG2   . ILE C 3 195 ? 67.616 34.355  28.678  1.00 17.62  ? 212 ILE A CG2   1 
ATOM   2222 C CD1   . ILE C 3 195 ? 70.336 35.689  28.973  1.00 22.21  ? 212 ILE A CD1   1 
ATOM   2223 N N     . PHE C 3 196 ? 66.138 31.957  29.950  1.00 18.32  ? 213 PHE A N     1 
ATOM   2224 C CA    . PHE C 3 196 ? 64.944 31.346  29.387  1.00 17.17  ? 213 PHE A CA    1 
ATOM   2225 C C     . PHE C 3 196 ? 64.271 32.439  28.578  1.00 16.16  ? 213 PHE A C     1 
ATOM   2226 O O     . PHE C 3 196 ? 63.901 33.476  29.121  1.00 16.37  ? 213 PHE A O     1 
ATOM   2227 C CB    . PHE C 3 196 ? 63.985 30.873  30.466  1.00 16.98  ? 213 PHE A CB    1 
ATOM   2228 C CG    . PHE C 3 196 ? 64.131 29.430  30.830  1.00 16.99  ? 213 PHE A CG    1 
ATOM   2229 C CD1   . PHE C 3 196 ? 65.350 28.934  31.286  1.00 15.95  ? 213 PHE A CD1   1 
ATOM   2230 C CD2   . PHE C 3 196 ? 63.013 28.590  30.817  1.00 16.28  ? 213 PHE A CD2   1 
ATOM   2231 C CE1   . PHE C 3 196 ? 65.465 27.624  31.741  1.00 16.67  ? 213 PHE A CE1   1 
ATOM   2232 C CE2   . PHE C 3 196 ? 63.107 27.273  31.268  1.00 17.25  ? 213 PHE A CE2   1 
ATOM   2233 C CZ    . PHE C 3 196 ? 64.343 26.785  31.738  1.00 17.47  ? 213 PHE A CZ    1 
ATOM   2234 N N     . LEU C 3 197 ? 64.115 32.202  27.282  1.00 15.28  ? 214 LEU A N     1 
ATOM   2235 C CA    . LEU C 3 197 ? 63.506 33.174  26.403  1.00 14.01  ? 214 LEU A CA    1 
ATOM   2236 C C     . LEU C 3 197 ? 62.201 32.667  25.790  1.00 13.67  ? 214 LEU A C     1 
ATOM   2237 O O     . LEU C 3 197 ? 62.168 31.589  25.197  1.00 12.66  ? 214 LEU A O     1 
ATOM   2238 C CB    . LEU C 3 197 ? 64.508 33.541  25.302  1.00 14.43  ? 214 LEU A CB    1 
ATOM   2239 C CG    . LEU C 3 197 ? 64.157 34.699  24.366  1.00 15.75  ? 214 LEU A CG    1 
ATOM   2240 C CD1   . LEU C 3 197 ? 63.770 35.886  25.234  1.00 16.65  ? 214 LEU A CD1   1 
ATOM   2241 C CD2   . LEU C 3 197 ? 65.344 35.064  23.476  1.00 15.03  ? 214 LEU A CD2   1 
ATOM   2242 N N     . LEU C 3 198 ? 61.133 33.446  25.950  1.00 13.19  ? 215 LEU A N     1 
ATOM   2243 C CA    . LEU C 3 198 ? 59.831 33.097  25.385  1.00 14.35  ? 215 LEU A CA    1 
ATOM   2244 C C     . LEU C 3 198 ? 59.648 33.912  24.104  1.00 15.40  ? 215 LEU A C     1 
ATOM   2245 O O     . LEU C 3 198 ? 59.853 35.130  24.105  1.00 17.35  ? 215 LEU A O     1 
ATOM   2246 C CB    . LEU C 3 198 ? 58.705 33.396  26.388  1.00 12.98  ? 215 LEU A CB    1 
ATOM   2247 C CG    . LEU C 3 198 ? 58.794 32.649  27.730  1.00 12.92  ? 215 LEU A CG    1 
ATOM   2248 C CD1   . LEU C 3 198 ? 57.615 33.026  28.598  1.00 10.65  ? 215 LEU A CD1   1 
ATOM   2249 C CD2   . LEU C 3 198 ? 58.855 31.130  27.500  1.00 10.51  ? 215 LEU A CD2   1 
ATOM   2250 N N     . CYS C 3 199 ? 59.272 33.247  23.016  1.00 15.14  ? 216 CYS A N     1 
ATOM   2251 C CA    . CYS C 3 199 ? 59.127 33.917  21.727  1.00 16.46  ? 216 CYS A CA    1 
ATOM   2252 C C     . CYS C 3 199 ? 57.980 33.383  20.870  1.00 17.69  ? 216 CYS A C     1 
ATOM   2253 O O     . CYS C 3 199 ? 57.394 32.328  21.171  1.00 19.77  ? 216 CYS A O     1 
ATOM   2254 C CB    . CYS C 3 199 ? 60.419 33.747  20.918  1.00 15.73  ? 216 CYS A CB    1 
ATOM   2255 S SG    . CYS C 3 199 ? 60.833 31.973  20.523  1.00 16.19  ? 216 CYS A SG    1 
ATOM   2256 N N     . ASP C 3 200 ? 57.682 34.108  19.791  1.00 17.15  ? 217 ASP A N     1 
ATOM   2257 C CA    . ASP C 3 200 ? 56.660 33.686  18.843  1.00 17.33  ? 217 ASP A CA    1 
ATOM   2258 C C     . ASP C 3 200 ? 57.229 32.447  18.169  1.00 16.53  ? 217 ASP A C     1 
ATOM   2259 O O     . ASP C 3 200 ? 58.381 32.133  18.387  1.00 16.48  ? 217 ASP A O     1 
ATOM   2260 C CB    . ASP C 3 200 ? 56.414 34.770  17.805  1.00 17.94  ? 217 ASP A CB    1 
ATOM   2261 C CG    . ASP C 3 200 ? 55.347 35.735  18.225  1.00 20.50  ? 217 ASP A CG    1 
ATOM   2262 O OD1   . ASP C 3 200 ? 54.977 36.618  17.417  1.00 22.45  ? 217 ASP A OD1   1 
ATOM   2263 O OD2   . ASP C 3 200 ? 54.873 35.611  19.371  1.00 22.48  ? 217 ASP A OD2   1 
ATOM   2264 N N     . LYS C 3 201 ? 56.440 31.750  17.359  1.00 16.39  ? 218 LYS A N     1 
ATOM   2265 C CA    . LYS C 3 201 ? 56.928 30.547  16.692  1.00 17.19  ? 218 LYS A CA    1 
ATOM   2266 C C     . LYS C 3 201 ? 58.244 30.721  15.948  1.00 17.30  ? 218 LYS A C     1 
ATOM   2267 O O     . LYS C 3 201 ? 58.403 31.675  15.182  1.00 17.67  ? 218 LYS A O     1 
ATOM   2268 C CB    . LYS C 3 201 ? 55.907 30.039  15.676  1.00 19.36  ? 218 LYS A CB    1 
ATOM   2269 C CG    . LYS C 3 201 ? 54.976 28.938  16.146  1.00 21.40  ? 218 LYS A CG    1 
ATOM   2270 C CD    . LYS C 3 201 ? 53.626 29.480  16.605  1.00 23.80  ? 218 LYS A CD    1 
ATOM   2271 C CE    . LYS C 3 201 ? 53.736 30.329  17.879  1.00 23.65  ? 218 LYS A CE    1 
ATOM   2272 N NZ    . LYS C 3 201 ? 52.399 30.704  18.423  1.00 24.30  ? 218 LYS A NZ    1 
ATOM   2273 N N     . VAL C 3 202 ? 59.188 29.809  16.175  1.00 16.52  ? 219 VAL A N     1 
ATOM   2274 C CA    . VAL C 3 202 ? 60.466 29.830  15.451  1.00 16.31  ? 219 VAL A CA    1 
ATOM   2275 C C     . VAL C 3 202 ? 60.823 28.375  15.081  1.00 17.52  ? 219 VAL A C     1 
ATOM   2276 O O     . VAL C 3 202 ? 60.356 27.422  15.721  1.00 18.43  ? 219 VAL A O     1 
ATOM   2277 C CB    . VAL C 3 202 ? 61.657 30.425  16.285  1.00 15.05  ? 219 VAL A CB    1 
ATOM   2278 C CG1   . VAL C 3 202 ? 61.299 31.764  16.856  1.00 14.15  ? 219 VAL A CG1   1 
ATOM   2279 C CG2   . VAL C 3 202 ? 62.056 29.478  17.372  1.00 15.90  ? 219 VAL A CG2   1 
ATOM   2280 N N     . GLN C 3 203 ? 61.637 28.196  14.053  1.00 16.98  ? 220 GLN A N     1 
ATOM   2281 C CA    . GLN C 3 203 ? 62.052 26.859  13.671  1.00 18.06  ? 220 GLN A CA    1 
ATOM   2282 C C     . GLN C 3 203 ? 63.416 26.546  14.267  1.00 18.65  ? 220 GLN A C     1 
ATOM   2283 O O     . GLN C 3 203 ? 64.419 27.126  13.876  1.00 19.41  ? 220 GLN A O     1 
ATOM   2284 C CB    . GLN C 3 203 ? 62.104 26.731  12.152  1.00 18.29  ? 220 GLN A CB    1 
ATOM   2285 C CG    . GLN C 3 203 ? 60.736 26.712  11.516  1.00 19.41  ? 220 GLN A CG    1 
ATOM   2286 C CD    . GLN C 3 203 ? 60.786 26.756  10.009  1.00 20.55  ? 220 GLN A CD    1 
ATOM   2287 O OE1   . GLN C 3 203 ? 59.881 26.252  9.342   1.00 22.84  ? 220 GLN A OE1   1 
ATOM   2288 N NE2   . GLN C 3 203 ? 61.829 27.370  9.457   1.00 20.07  ? 220 GLN A NE2   1 
ATOM   2289 N N     . LYS C 3 204 ? 63.441 25.618  15.212  1.00 19.48  ? 221 LYS A N     1 
ATOM   2290 C CA    . LYS C 3 204 ? 64.664 25.227  15.889  1.00 20.94  ? 221 LYS A CA    1 
ATOM   2291 C C     . LYS C 3 204 ? 65.905 25.082  15.022  1.00 22.33  ? 221 LYS A C     1 
ATOM   2292 O O     . LYS C 3 204 ? 67.015 25.363  15.478  1.00 23.52  ? 221 LYS A O     1 
ATOM   2293 C CB    . LYS C 3 204 ? 64.444 23.924  16.643  1.00 21.22  ? 221 LYS A CB    1 
ATOM   2294 C CG    . LYS C 3 204 ? 63.961 22.800  15.792  1.00 19.87  ? 221 LYS A CG    1 
ATOM   2295 C CD    . LYS C 3 204 ? 64.296 21.500  16.465  1.00 21.91  ? 221 LYS A CD    1 
ATOM   2296 C CE    . LYS C 3 204 ? 63.234 20.452  16.222  1.00 22.08  ? 221 LYS A CE    1 
ATOM   2297 N NZ    . LYS C 3 204 ? 63.513 19.253  17.054  1.00 24.74  ? 221 LYS A NZ    1 
ATOM   2298 N N     . GLU C 3 205 ? 65.732 24.631  13.786  1.00 22.73  ? 222 GLU A N     1 
ATOM   2299 C CA    . GLU C 3 205 ? 66.863 24.460  12.880  1.00 23.37  ? 222 GLU A CA    1 
ATOM   2300 C C     . GLU C 3 205 ? 67.226 25.747  12.148  1.00 23.05  ? 222 GLU A C     1 
ATOM   2301 O O     . GLU C 3 205 ? 68.077 25.726  11.262  1.00 24.41  ? 222 GLU A O     1 
ATOM   2302 C CB    . GLU C 3 205 ? 66.558 23.375  11.838  1.00 25.21  ? 222 GLU A CB    1 
ATOM   2303 C CG    . GLU C 3 205 ? 65.271 23.607  11.048  1.00 29.27  ? 222 GLU A CG    1 
ATOM   2304 C CD    . GLU C 3 205 ? 64.022 23.102  11.790  1.00 33.55  ? 222 GLU A CD    1 
ATOM   2305 O OE1   . GLU C 3 205 ? 62.916 23.640  11.531  1.00 35.97  ? 222 GLU A OE1   1 
ATOM   2306 O OE2   . GLU C 3 205 ? 64.131 22.152  12.614  1.00 34.11  ? 222 GLU A OE2   1 
ATOM   2307 N N     . ASP C 3 206 ? 66.595 26.864  12.503  1.00 21.61  ? 223 ASP A N     1 
ATOM   2308 C CA    . ASP C 3 206 ? 66.879 28.133  11.832  1.00 20.72  ? 223 ASP A CA    1 
ATOM   2309 C C     . ASP C 3 206 ? 66.708 29.314  12.796  1.00 21.17  ? 223 ASP A C     1 
ATOM   2310 O O     . ASP C 3 206 ? 65.948 30.244  12.520  1.00 21.76  ? 223 ASP A O     1 
ATOM   2311 C CB    . ASP C 3 206 ? 65.942 28.274  10.630  1.00 19.53  ? 223 ASP A CB    1 
ATOM   2312 C CG    . ASP C 3 206 ? 66.370 29.371  9.653   1.00 19.90  ? 223 ASP A CG    1 
ATOM   2313 O OD1   . ASP C 3 206 ? 67.547 29.797  9.645   1.00 20.73  ? 223 ASP A OD1   1 
ATOM   2314 O OD2   . ASP C 3 206 ? 65.514 29.787  8.851   1.00 19.24  ? 223 ASP A OD2   1 
ATOM   2315 N N     . ILE C 3 207 ? 67.424 29.287  13.921  1.00 20.64  ? 224 ILE A N     1 
ATOM   2316 C CA    . ILE C 3 207 ? 67.288 30.351  14.903  1.00 19.45  ? 224 ILE A CA    1 
ATOM   2317 C C     . ILE C 3 207 ? 68.555 30.637  15.719  1.00 19.86  ? 224 ILE A C     1 
ATOM   2318 O O     . ILE C 3 207 ? 69.374 29.755  15.927  1.00 19.72  ? 224 ILE A O     1 
ATOM   2319 C CB    . ILE C 3 207 ? 66.127 30.008  15.861  1.00 19.40  ? 224 ILE A CB    1 
ATOM   2320 C CG1   . ILE C 3 207 ? 65.718 31.246  16.658  1.00 18.22  ? 224 ILE A CG1   1 
ATOM   2321 C CG2   . ILE C 3 207 ? 66.534 28.858  16.773  1.00 18.13  ? 224 ILE A CG2   1 
ATOM   2322 C CD1   . ILE C 3 207 ? 65.384 32.431  15.791  1.00 16.71  ? 224 ILE A CD1   1 
ATOM   2323 N N     . GLU C 3 208 ? 68.701 31.875  16.187  1.00 20.52  ? 225 GLU A N     1 
ATOM   2324 C CA    . GLU C 3 208 ? 69.863 32.296  16.984  1.00 20.83  ? 225 GLU A CA    1 
ATOM   2325 C C     . GLU C 3 208 ? 69.551 33.479  17.904  1.00 21.68  ? 225 GLU A C     1 
ATOM   2326 O O     . GLU C 3 208 ? 68.555 34.191  17.721  1.00 23.77  ? 225 GLU A O     1 
ATOM   2327 C CB    . GLU C 3 208 ? 71.005 32.722  16.078  1.00 20.08  ? 225 GLU A CB    1 
ATOM   2328 C CG    . GLU C 3 208 ? 71.615 31.607  15.271  1.00 21.55  ? 225 GLU A CG    1 
ATOM   2329 C CD    . GLU C 3 208 ? 72.732 32.099  14.362  1.00 21.94  ? 225 GLU A CD    1 
ATOM   2330 O OE1   . GLU C 3 208 ? 73.596 31.275  13.995  1.00 22.10  ? 225 GLU A OE1   1 
ATOM   2331 O OE2   . GLU C 3 208 ? 72.738 33.304  14.010  1.00 21.65  ? 225 GLU A OE2   1 
ATOM   2332 N N     . VAL C 3 209 ? 70.398 33.686  18.904  1.00 20.90  ? 226 VAL A N     1 
ATOM   2333 C CA    . VAL C 3 209 ? 70.235 34.818  19.809  1.00 19.40  ? 226 VAL A CA    1 
ATOM   2334 C C     . VAL C 3 209 ? 71.491 35.637  19.503  1.00 20.33  ? 226 VAL A C     1 
ATOM   2335 O O     . VAL C 3 209 ? 72.617 35.180  19.702  1.00 19.86  ? 226 VAL A O     1 
ATOM   2336 C CB    . VAL C 3 209 ? 70.195 34.377  21.287  1.00 17.51  ? 226 VAL A CB    1 
ATOM   2337 C CG1   . VAL C 3 209 ? 69.810 35.554  22.166  1.00 16.39  ? 226 VAL A CG1   1 
ATOM   2338 C CG2   . VAL C 3 209 ? 69.183 33.253  21.469  1.00 16.72  ? 226 VAL A CG2   1 
ATOM   2339 N N     . TYR C 3 210 ? 71.302 36.843  18.989  1.00 20.89  ? 227 TYR A N     1 
ATOM   2340 C CA    . TYR C 3 210 ? 72.435 37.663  18.590  1.00 21.44  ? 227 TYR A CA    1 
ATOM   2341 C C     . TYR C 3 210 ? 72.698 38.813  19.554  1.00 21.40  ? 227 TYR A C     1 
ATOM   2342 O O     . TYR C 3 210 ? 71.876 39.725  19.693  1.00 22.39  ? 227 TYR A O     1 
ATOM   2343 C CB    . TYR C 3 210 ? 72.160 38.150  17.159  1.00 22.50  ? 227 TYR A CB    1 
ATOM   2344 C CG    . TYR C 3 210 ? 73.201 39.031  16.508  1.00 23.70  ? 227 TYR A CG    1 
ATOM   2345 C CD1   . TYR C 3 210 ? 74.509 38.591  16.298  1.00 23.81  ? 227 TYR A CD1   1 
ATOM   2346 C CD2   . TYR C 3 210 ? 72.853 40.298  16.046  1.00 24.22  ? 227 TYR A CD2   1 
ATOM   2347 C CE1   . TYR C 3 210 ? 75.442 39.406  15.628  1.00 24.05  ? 227 TYR A CE1   1 
ATOM   2348 C CE2   . TYR C 3 210 ? 73.771 41.111  15.393  1.00 24.40  ? 227 TYR A CE2   1 
ATOM   2349 C CZ    . TYR C 3 210 ? 75.059 40.665  15.183  1.00 24.55  ? 227 TYR A CZ    1 
ATOM   2350 O OH    . TYR C 3 210 ? 75.942 41.495  14.524  1.00 25.55  ? 227 TYR A OH    1 
ATOM   2351 N N     . PHE C 3 211 ? 73.833 38.740  20.249  1.00 20.70  ? 228 PHE A N     1 
ATOM   2352 C CA    . PHE C 3 211 ? 74.221 39.789  21.185  1.00 20.33  ? 228 PHE A CA    1 
ATOM   2353 C C     . PHE C 3 211 ? 75.015 40.843  20.432  1.00 20.92  ? 228 PHE A C     1 
ATOM   2354 O O     . PHE C 3 211 ? 75.970 40.533  19.723  1.00 21.88  ? 228 PHE A O     1 
ATOM   2355 C CB    . PHE C 3 211 ? 75.032 39.211  22.345  1.00 18.56  ? 228 PHE A CB    1 
ATOM   2356 C CG    . PHE C 3 211 ? 74.181 38.588  23.391  1.00 17.35  ? 228 PHE A CG    1 
ATOM   2357 C CD1   . PHE C 3 211 ? 73.519 37.396  23.143  1.00 16.29  ? 228 PHE A CD1   1 
ATOM   2358 C CD2   . PHE C 3 211 ? 73.939 39.247  24.587  1.00 16.45  ? 228 PHE A CD2   1 
ATOM   2359 C CE1   . PHE C 3 211 ? 72.622 36.873  24.072  1.00 15.75  ? 228 PHE A CE1   1 
ATOM   2360 C CE2   . PHE C 3 211 ? 73.039 38.732  25.522  1.00 15.25  ? 228 PHE A CE2   1 
ATOM   2361 C CZ    . PHE C 3 211 ? 72.379 37.548  25.262  1.00 15.55  ? 228 PHE A CZ    1 
ATOM   2362 N N     . THR C 3 212 ? 74.627 42.098  20.573  1.00 21.44  ? 229 THR A N     1 
ATOM   2363 C CA    . THR C 3 212 ? 75.324 43.115  19.822  1.00 22.64  ? 229 THR A CA    1 
ATOM   2364 C C     . THR C 3 212 ? 75.690 44.366  20.588  1.00 23.10  ? 229 THR A C     1 
ATOM   2365 O O     . THR C 3 212 ? 74.959 44.828  21.462  1.00 24.51  ? 229 THR A O     1 
ATOM   2366 C CB    . THR C 3 212 ? 74.502 43.494  18.587  1.00 23.24  ? 229 THR A CB    1 
ATOM   2367 O OG1   . THR C 3 212 ? 75.380 43.643  17.478  1.00 25.32  ? 229 THR A OG1   1 
ATOM   2368 C CG2   . THR C 3 212 ? 73.741 44.785  18.799  1.00 23.39  ? 229 THR A CG2   1 
ATOM   2369 N N     . GLY C 3 213 ? 76.846 44.904  20.245  1.00 23.06  ? 230 GLY A N     1 
ATOM   2370 C CA    . GLY C 3 213 ? 77.335 46.112  20.874  1.00 21.74  ? 230 GLY A CA    1 
ATOM   2371 C C     . GLY C 3 213 ? 78.390 46.640  19.940  1.00 21.40  ? 230 GLY A C     1 
ATOM   2372 O O     . GLY C 3 213 ? 78.912 45.881  19.129  1.00 21.54  ? 230 GLY A O     1 
ATOM   2373 N N     . PRO C 3 214 ? 78.734 47.924  20.024  1.00 21.78  ? 231 PRO A N     1 
ATOM   2374 C CA    . PRO C 3 214 ? 79.752 48.517  19.150  1.00 21.56  ? 231 PRO A CA    1 
ATOM   2375 C C     . PRO C 3 214 ? 81.067 47.758  19.277  1.00 21.18  ? 231 PRO A C     1 
ATOM   2376 O O     . PRO C 3 214 ? 81.604 47.582  20.379  1.00 20.32  ? 231 PRO A O     1 
ATOM   2377 C CB    . PRO C 3 214 ? 79.875 49.943  19.671  1.00 21.54  ? 231 PRO A CB    1 
ATOM   2378 C CG    . PRO C 3 214 ? 78.566 50.186  20.370  1.00 22.37  ? 231 PRO A CG    1 
ATOM   2379 C CD    . PRO C 3 214 ? 78.319 48.878  21.059  1.00 22.74  ? 231 PRO A CD    1 
ATOM   2380 N N     . GLY C 3 215 ? 81.577 47.299  18.147  1.00 20.92  ? 232 GLY A N     1 
ATOM   2381 C CA    . GLY C 3 215 ? 82.825 46.574  18.181  1.00 21.01  ? 232 GLY A CA    1 
ATOM   2382 C C     . GLY C 3 215 ? 82.722 45.216  18.839  1.00 21.34  ? 232 GLY A C     1 
ATOM   2383 O O     . GLY C 3 215 ? 83.747 44.600  19.116  1.00 22.15  ? 232 GLY A O     1 
ATOM   2384 N N     . TRP C 3 216 ? 81.502 44.740  19.085  1.00 20.85  ? 233 TRP A N     1 
ATOM   2385 C CA    . TRP C 3 216 ? 81.320 43.428  19.706  1.00 20.75  ? 233 TRP A CA    1 
ATOM   2386 C C     . TRP C 3 216 ? 80.083 42.670  19.221  1.00 20.00  ? 233 TRP A C     1 
ATOM   2387 O O     . TRP C 3 216 ? 78.953 43.138  19.356  1.00 19.77  ? 233 TRP A O     1 
ATOM   2388 C CB    . TRP C 3 216 ? 81.249 43.561  21.221  1.00 20.29  ? 233 TRP A CB    1 
ATOM   2389 C CG    . TRP C 3 216 ? 81.043 42.260  21.898  1.00 19.34  ? 233 TRP A CG    1 
ATOM   2390 C CD1   . TRP C 3 216 ? 81.950 41.260  22.036  1.00 19.63  ? 233 TRP A CD1   1 
ATOM   2391 C CD2   . TRP C 3 216 ? 79.844 41.810  22.538  1.00 18.78  ? 233 TRP A CD2   1 
ATOM   2392 N NE1   . TRP C 3 216 ? 81.395 40.201  22.734  1.00 18.76  ? 233 TRP A NE1   1 
ATOM   2393 C CE2   . TRP C 3 216 ? 80.101 40.515  23.048  1.00 18.07  ? 233 TRP A CE2   1 
ATOM   2394 C CE3   . TRP C 3 216 ? 78.578 42.373  22.727  1.00 18.36  ? 233 TRP A CE3   1 
ATOM   2395 C CZ2   . TRP C 3 216 ? 79.145 39.780  23.735  1.00 17.39  ? 233 TRP A CZ2   1 
ATOM   2396 C CZ3   . TRP C 3 216 ? 77.624 41.640  23.413  1.00 18.68  ? 233 TRP A CZ3   1 
ATOM   2397 C CH2   . TRP C 3 216 ? 77.916 40.353  23.908  1.00 18.74  ? 233 TRP A CH2   1 
ATOM   2398 N N     . GLU C 3 217 ? 80.313 41.482  18.678  1.00 19.12  ? 234 GLU A N     1 
ATOM   2399 C CA    . GLU C 3 217 ? 79.238 40.646  18.165  1.00 19.07  ? 234 GLU A CA    1 
ATOM   2400 C C     . GLU C 3 217 ? 79.473 39.213  18.631  1.00 19.32  ? 234 GLU A C     1 
ATOM   2401 O O     . GLU C 3 217 ? 80.576 38.699  18.507  1.00 20.04  ? 234 GLU A O     1 
ATOM   2402 C CB    . GLU C 3 217 ? 79.207 40.722  16.625  1.00 18.20  ? 234 GLU A CB    1 
ATOM   2403 C CG    . GLU C 3 217 ? 78.795 42.107  16.089  1.00 16.83  ? 234 GLU A CG    1 
ATOM   2404 C CD    . GLU C 3 217 ? 78.907 42.255  14.586  1.00 16.35  ? 234 GLU A CD    1 
ATOM   2405 O OE1   . GLU C 3 217 ? 78.404 43.272  14.066  1.00 17.27  ? 234 GLU A OE1   1 
ATOM   2406 O OE2   . GLU C 3 217 ? 79.508 41.386  13.925  1.00 14.24  ? 234 GLU A OE2   1 
ATOM   2407 N N     . ALA C 3 218 ? 78.449 38.579  19.195  1.00 18.92  ? 235 ALA A N     1 
ATOM   2408 C CA    . ALA C 3 218 ? 78.581 37.206  19.661  1.00 18.30  ? 235 ALA A CA    1 
ATOM   2409 C C     . ALA C 3 218 ? 77.230 36.524  19.644  1.00 18.61  ? 235 ALA A C     1 
ATOM   2410 O O     . ALA C 3 218 ? 76.233 37.154  19.341  1.00 18.42  ? 235 ALA A O     1 
ATOM   2411 C CB    . ALA C 3 218 ? 79.165 37.177  21.062  1.00 17.52  ? 235 ALA A CB    1 
ATOM   2412 N N     . ARG C 3 219 ? 77.192 35.239  19.978  1.00 19.50  ? 236 ARG A N     1 
ATOM   2413 C CA    . ARG C 3 219 ? 75.931 34.517  19.969  1.00 20.26  ? 236 ARG A CA    1 
ATOM   2414 C C     . ARG C 3 219 ? 75.642 33.741  21.233  1.00 20.56  ? 236 ARG A C     1 
ATOM   2415 O O     . ARG C 3 219 ? 76.557 33.314  21.927  1.00 21.43  ? 236 ARG A O     1 
ATOM   2416 C CB    . ARG C 3 219 ? 75.882 33.558  18.779  1.00 21.18  ? 236 ARG A CB    1 
ATOM   2417 C CG    . ARG C 3 219 ? 75.989 34.246  17.446  1.00 23.47  ? 236 ARG A CG    1 
ATOM   2418 C CD    . ARG C 3 219 ? 75.261 33.472  16.395  1.00 26.05  ? 236 ARG A CD    1 
ATOM   2419 N NE    . ARG C 3 219 ? 75.857 32.170  16.151  1.00 29.74  ? 236 ARG A NE    1 
ATOM   2420 C CZ    . ARG C 3 219 ? 77.058 31.979  15.615  1.00 31.39  ? 236 ARG A CZ    1 
ATOM   2421 N NH1   . ARG C 3 219 ? 77.504 30.748  15.434  1.00 32.05  ? 236 ARG A NH1   1 
ATOM   2422 N NH2   . ARG C 3 219 ? 77.813 33.013  15.266  1.00 32.35  ? 236 ARG A NH2   1 
ATOM   2423 N N     . GLY C 3 220 ? 74.356 33.568  21.536  1.00 20.59  ? 237 GLY A N     1 
ATOM   2424 C CA    . GLY C 3 220 ? 73.980 32.796  22.702  1.00 20.49  ? 237 GLY A CA    1 
ATOM   2425 C C     . GLY C 3 220 ? 74.235 31.337  22.361  1.00 20.59  ? 237 GLY A C     1 
ATOM   2426 O O     . GLY C 3 220 ? 74.029 30.937  21.219  1.00 21.51  ? 237 GLY A O     1 
ATOM   2427 N N     . SER C 3 221 ? 74.685 30.536  23.319  1.00 19.74  ? 238 SER A N     1 
ATOM   2428 C CA    . SER C 3 221 ? 74.958 29.134  23.031  1.00 19.41  ? 238 SER A CA    1 
ATOM   2429 C C     . SER C 3 221 ? 73.783 28.235  23.359  1.00 18.38  ? 238 SER A C     1 
ATOM   2430 O O     . SER C 3 221 ? 73.163 28.374  24.410  1.00 17.92  ? 238 SER A O     1 
ATOM   2431 C CB    . SER C 3 221 ? 76.157 28.646  23.844  1.00 21.38  ? 238 SER A CB    1 
ATOM   2432 O OG    . SER C 3 221 ? 77.176 29.626  23.916  1.00 25.48  ? 238 SER A OG    1 
ATOM   2433 N N     . PHE C 3 222 ? 73.481 27.310  22.460  1.00 17.28  ? 239 PHE A N     1 
ATOM   2434 C CA    . PHE C 3 222 ? 72.403 26.351  22.690  1.00 16.45  ? 239 PHE A CA    1 
ATOM   2435 C C     . PHE C 3 222 ? 72.266 25.414  21.511  1.00 16.56  ? 239 PHE A C     1 
ATOM   2436 O O     . PHE C 3 222 ? 72.779 25.680  20.433  1.00 16.59  ? 239 PHE A O     1 
ATOM   2437 C CB    . PHE C 3 222 ? 71.058 27.039  22.943  1.00 14.95  ? 239 PHE A CB    1 
ATOM   2438 C CG    . PHE C 3 222 ? 70.504 27.755  21.753  1.00 12.48  ? 239 PHE A CG    1 
ATOM   2439 C CD1   . PHE C 3 222 ? 70.746 29.104  21.564  1.00 11.72  ? 239 PHE A CD1   1 
ATOM   2440 C CD2   . PHE C 3 222 ? 69.705 27.091  20.842  1.00 12.26  ? 239 PHE A CD2   1 
ATOM   2441 C CE1   . PHE C 3 222 ? 70.194 29.783  20.484  1.00 11.33  ? 239 PHE A CE1   1 
ATOM   2442 C CE2   . PHE C 3 222 ? 69.143 27.767  19.750  1.00 12.60  ? 239 PHE A CE2   1 
ATOM   2443 C CZ    . PHE C 3 222 ? 69.388 29.115  19.576  1.00 11.46  ? 239 PHE A CZ    1 
ATOM   2444 N N     . SER C 3 223 ? 71.568 24.310  21.732  1.00 17.10  ? 240 SER A N     1 
ATOM   2445 C CA    . SER C 3 223 ? 71.356 23.322  20.693  1.00 18.12  ? 240 SER A CA    1 
ATOM   2446 C C     . SER C 3 223 ? 69.876 23.196  20.390  1.00 18.39  ? 240 SER A C     1 
ATOM   2447 O O     . SER C 3 223 ? 69.035 23.584  21.190  1.00 18.89  ? 240 SER A O     1 
ATOM   2448 C CB    . SER C 3 223 ? 71.911 21.973  21.138  1.00 17.81  ? 240 SER A CB    1 
ATOM   2449 O OG    . SER C 3 223 ? 71.290 21.559  22.340  1.00 20.42  ? 240 SER A OG    1 
ATOM   2450 N N     . GLN C 3 224 ? 69.552 22.649  19.231  1.00 19.14  ? 241 GLN A N     1 
ATOM   2451 C CA    . GLN C 3 224 ? 68.157 22.498  18.866  1.00 20.11  ? 241 GLN A CA    1 
ATOM   2452 C C     . GLN C 3 224 ? 67.346 21.851  19.981  1.00 20.18  ? 241 GLN A C     1 
ATOM   2453 O O     . GLN C 3 224 ? 66.192 22.196  20.183  1.00 20.95  ? 241 GLN A O     1 
ATOM   2454 C CB    . GLN C 3 224 ? 68.029 21.709  17.555  1.00 20.38  ? 241 GLN A CB    1 
ATOM   2455 C CG    . GLN C 3 224 ? 68.461 22.523  16.333  1.00 21.74  ? 241 GLN A CG    1 
ATOM   2456 C CD    . GLN C 3 224 ? 68.347 21.765  15.022  1.00 21.87  ? 241 GLN A CD    1 
ATOM   2457 O OE1   . GLN C 3 224 ? 67.291 21.219  14.685  1.00 21.75  ? 241 GLN A OE1   1 
ATOM   2458 N NE2   . GLN C 3 224 ? 69.438 21.737  14.271  1.00 21.53  ? 241 GLN A NE2   1 
ATOM   2459 N N     . ALA C 3 225 ? 67.943 20.931  20.724  1.00 20.16  ? 242 ALA A N     1 
ATOM   2460 C CA    . ALA C 3 225 ? 67.199 20.291  21.802  1.00 20.13  ? 242 ALA A CA    1 
ATOM   2461 C C     . ALA C 3 225 ? 66.716 21.333  22.807  1.00 20.15  ? 242 ALA A C     1 
ATOM   2462 O O     . ALA C 3 225 ? 65.720 21.125  23.498  1.00 20.30  ? 242 ALA A O     1 
ATOM   2463 C CB    . ALA C 3 225 ? 68.072 19.255  22.506  1.00 19.52  ? 242 ALA A CB    1 
ATOM   2464 N N     . ASP C 3 226 ? 67.418 22.460  22.876  1.00 19.54  ? 243 ASP A N     1 
ATOM   2465 C CA    . ASP C 3 226 ? 67.067 23.505  23.812  1.00 19.26  ? 243 ASP A CA    1 
ATOM   2466 C C     . ASP C 3 226 ? 65.872 24.358  23.392  1.00 18.86  ? 243 ASP A C     1 
ATOM   2467 O O     . ASP C 3 226 ? 65.347 25.127  24.190  1.00 19.01  ? 243 ASP A O     1 
ATOM   2468 C CB    . ASP C 3 226 ? 68.286 24.384  24.082  1.00 21.40  ? 243 ASP A CB    1 
ATOM   2469 C CG    . ASP C 3 226 ? 69.458 23.599  24.684  1.00 23.62  ? 243 ASP A CG    1 
ATOM   2470 O OD1   . ASP C 3 226 ? 69.235 22.829  25.648  1.00 23.54  ? 243 ASP A OD1   1 
ATOM   2471 O OD2   . ASP C 3 226 ? 70.605 23.761  24.201  1.00 24.13  ? 243 ASP A OD2   1 
ATOM   2472 N N     . VAL C 3 227 ? 65.419 24.208  22.159  1.00 18.33  ? 244 VAL A N     1 
ATOM   2473 C CA    . VAL C 3 227 ? 64.280 24.979  21.685  1.00 18.95  ? 244 VAL A CA    1 
ATOM   2474 C C     . VAL C 3 227 ? 62.987 24.250  22.027  1.00 19.81  ? 244 VAL A C     1 
ATOM   2475 O O     . VAL C 3 227 ? 62.652 23.268  21.375  1.00 20.31  ? 244 VAL A O     1 
ATOM   2476 C CB    . VAL C 3 227 ? 64.356 25.168  20.162  1.00 19.41  ? 244 VAL A CB    1 
ATOM   2477 C CG1   . VAL C 3 227 ? 63.444 26.294  19.723  1.00 19.62  ? 244 VAL A CG1   1 
ATOM   2478 C CG2   . VAL C 3 227 ? 65.782 25.468  19.756  1.00 20.57  ? 244 VAL A CG2   1 
ATOM   2479 N N     . HIS C 3 228 ? 62.248 24.731  23.029  1.00 20.69  ? 245 HIS A N     1 
ATOM   2480 C CA    . HIS C 3 228 ? 60.998 24.083  23.434  1.00 20.91  ? 245 HIS A CA    1 
ATOM   2481 C C     . HIS C 3 228 ? 59.761 24.420  22.590  1.00 21.18  ? 245 HIS A C     1 
ATOM   2482 O O     . HIS C 3 228 ? 59.275 25.546  22.594  1.00 21.09  ? 245 HIS A O     1 
ATOM   2483 C CB    . HIS C 3 228 ? 60.693 24.369  24.907  1.00 21.01  ? 245 HIS A CB    1 
ATOM   2484 C CG    . HIS C 3 228 ? 59.424 23.727  25.397  1.00 22.79  ? 245 HIS A CG    1 
ATOM   2485 N ND1   . HIS C 3 228 ? 59.201 22.365  25.332  1.00 22.76  ? 245 HIS A ND1   1 
ATOM   2486 C CD2   . HIS C 3 228 ? 58.306 24.261  25.947  1.00 22.86  ? 245 HIS A CD2   1 
ATOM   2487 C CE1   . HIS C 3 228 ? 58.001 22.091  25.816  1.00 22.12  ? 245 HIS A CE1   1 
ATOM   2488 N NE2   . HIS C 3 228 ? 57.437 23.224  26.197  1.00 22.24  ? 245 HIS A NE2   1 
ATOM   2489 N N     . ARG C 3 229 ? 59.261 23.410  21.880  1.00 21.81  ? 246 ARG A N     1 
ATOM   2490 C CA    . ARG C 3 229 ? 58.085 23.516  21.023  1.00 22.87  ? 246 ARG A CA    1 
ATOM   2491 C C     . ARG C 3 229 ? 58.005 24.812  20.231  1.00 22.83  ? 246 ARG A C     1 
ATOM   2492 O O     . ARG C 3 229 ? 56.967 25.459  20.199  1.00 23.02  ? 246 ARG A O     1 
ATOM   2493 C CB    . ARG C 3 229 ? 56.806 23.346  21.854  1.00 24.92  ? 246 ARG A CB    1 
ATOM   2494 C CG    . ARG C 3 229 ? 56.669 22.002  22.580  1.00 26.80  ? 246 ARG A CG    1 
ATOM   2495 C CD    . ARG C 3 229 ? 56.979 20.835  21.664  1.00 29.10  ? 246 ARG A CD    1 
ATOM   2496 N NE    . ARG C 3 229 ? 56.156 20.863  20.457  1.00 32.69  ? 246 ARG A NE    1 
ATOM   2497 C CZ    . ARG C 3 229 ? 54.913 20.396  20.380  1.00 33.29  ? 246 ARG A CZ    1 
ATOM   2498 N NH1   . ARG C 3 229 ? 54.342 19.852  21.450  1.00 33.59  ? 246 ARG A NH1   1 
ATOM   2499 N NH2   . ARG C 3 229 ? 54.246 20.479  19.234  1.00 32.91  ? 246 ARG A NH2   1 
ATOM   2500 N N     . GLN C 3 230 ? 59.111 25.187  19.600  1.00 23.21  ? 247 GLN A N     1 
ATOM   2501 C CA    . GLN C 3 230 ? 59.191 26.396  18.782  1.00 23.51  ? 247 GLN A CA    1 
ATOM   2502 C C     . GLN C 3 230 ? 58.950 27.739  19.466  1.00 23.21  ? 247 GLN A C     1 
ATOM   2503 O O     . GLN C 3 230 ? 59.168 28.780  18.839  1.00 24.30  ? 247 GLN A O     1 
ATOM   2504 C CB    . GLN C 3 230 ? 58.219 26.309  17.602  1.00 23.86  ? 247 GLN A CB    1 
ATOM   2505 C CG    . GLN C 3 230 ? 58.463 25.170  16.661  1.00 24.06  ? 247 GLN A CG    1 
ATOM   2506 C CD    . GLN C 3 230 ? 57.732 25.349  15.349  1.00 25.47  ? 247 GLN A CD    1 
ATOM   2507 O OE1   . GLN C 3 230 ? 56.496 25.435  15.305  1.00 24.49  ? 247 GLN A OE1   1 
ATOM   2508 N NE2   . GLN C 3 230 ? 58.495 25.407  14.262  1.00 25.12  ? 247 GLN A NE2   1 
ATOM   2509 N N     . VAL C 3 231 ? 58.524 27.742  20.725  1.00 21.71  ? 248 VAL A N     1 
ATOM   2510 C CA    . VAL C 3 231 ? 58.234 29.018  21.384  1.00 21.16  ? 248 VAL A CA    1 
ATOM   2511 C C     . VAL C 3 231 ? 59.045 29.435  22.631  1.00 20.84  ? 248 VAL A C     1 
ATOM   2512 O O     . VAL C 3 231 ? 58.722 30.437  23.287  1.00 20.41  ? 248 VAL A O     1 
ATOM   2513 C CB    . VAL C 3 231 ? 56.736 29.093  21.727  1.00 20.51  ? 248 VAL A CB    1 
ATOM   2514 C CG1   . VAL C 3 231 ? 55.928 28.828  20.491  1.00 17.61  ? 248 VAL A CG1   1 
ATOM   2515 C CG2   . VAL C 3 231 ? 56.399 28.090  22.830  1.00 19.74  ? 248 VAL A CG2   1 
ATOM   2516 N N     . ALA C 3 232 ? 60.085 28.677  22.956  1.00 19.59  ? 249 ALA A N     1 
ATOM   2517 C CA    . ALA C 3 232 ? 60.930 28.999  24.100  1.00 18.60  ? 249 ALA A CA    1 
ATOM   2518 C C     . ALA C 3 232 ? 62.347 28.502  23.847  1.00 18.00  ? 249 ALA A C     1 
ATOM   2519 O O     . ALA C 3 232 ? 62.543 27.390  23.359  1.00 17.62  ? 249 ALA A O     1 
ATOM   2520 C CB    . ALA C 3 232 ? 60.361 28.368  25.372  1.00 18.80  ? 249 ALA A CB    1 
ATOM   2521 N N     . ILE C 3 233 ? 63.330 29.337  24.161  1.00 17.75  ? 250 ILE A N     1 
ATOM   2522 C CA    . ILE C 3 233 ? 64.726 28.966  23.958  1.00 16.82  ? 250 ILE A CA    1 
ATOM   2523 C C     . ILE C 3 233 ? 65.528 29.122  25.232  1.00 17.62  ? 250 ILE A C     1 
ATOM   2524 O O     . ILE C 3 233 ? 65.536 30.189  25.844  1.00 17.77  ? 250 ILE A O     1 
ATOM   2525 C CB    . ILE C 3 233 ? 65.394 29.828  22.878  1.00 15.38  ? 250 ILE A CB    1 
ATOM   2526 C CG1   . ILE C 3 233 ? 64.472 29.938  21.669  1.00 13.84  ? 250 ILE A CG1   1 
ATOM   2527 C CG2   . ILE C 3 233 ? 66.708 29.188  22.433  1.00 15.19  ? 250 ILE A CG2   1 
ATOM   2528 C CD1   . ILE C 3 233 ? 65.087 30.661  20.503  1.00 11.44  ? 250 ILE A CD1   1 
ATOM   2529 N N     . VAL C 3 234 ? 66.192 28.043  25.632  1.00 17.33  ? 251 VAL A N     1 
ATOM   2530 C CA    . VAL C 3 234 ? 67.018 28.045  26.826  1.00 17.16  ? 251 VAL A CA    1 
ATOM   2531 C C     . VAL C 3 234 ? 68.451 28.063  26.321  1.00 18.08  ? 251 VAL A C     1 
ATOM   2532 O O     . VAL C 3 234 ? 68.895 27.124  25.665  1.00 18.37  ? 251 VAL A O     1 
ATOM   2533 C CB    . VAL C 3 234 ? 66.745 26.786  27.665  1.00 16.11  ? 251 VAL A CB    1 
ATOM   2534 C CG1   . VAL C 3 234 ? 67.596 26.776  28.916  1.00 16.24  ? 251 VAL A CG1   1 
ATOM   2535 C CG2   . VAL C 3 234 ? 65.285 26.734  28.029  1.00 15.54  ? 251 VAL A CG2   1 
ATOM   2536 N N     . PHE C 3 235 ? 69.168 29.142  26.608  1.00 19.11  ? 252 PHE A N     1 
ATOM   2537 C CA    . PHE C 3 235 ? 70.543 29.288  26.139  1.00 20.30  ? 252 PHE A CA    1 
ATOM   2538 C C     . PHE C 3 235 ? 71.471 29.856  27.193  1.00 21.63  ? 252 PHE A C     1 
ATOM   2539 O O     . PHE C 3 235 ? 71.026 30.246  28.282  1.00 22.69  ? 252 PHE A O     1 
ATOM   2540 C CB    . PHE C 3 235 ? 70.577 30.199  24.905  1.00 20.32  ? 252 PHE A CB    1 
ATOM   2541 C CG    . PHE C 3 235 ? 70.280 31.665  25.198  1.00 19.69  ? 252 PHE A CG    1 
ATOM   2542 C CD1   . PHE C 3 235 ? 71.317 32.575  25.406  1.00 19.56  ? 252 PHE A CD1   1 
ATOM   2543 C CD2   . PHE C 3 235 ? 68.968 32.142  25.194  1.00 18.93  ? 252 PHE A CD2   1 
ATOM   2544 C CE1   . PHE C 3 235 ? 71.050 33.946  25.595  1.00 20.16  ? 252 PHE A CE1   1 
ATOM   2545 C CE2   . PHE C 3 235 ? 68.689 33.499  25.383  1.00 18.53  ? 252 PHE A CE2   1 
ATOM   2546 C CZ    . PHE C 3 235 ? 69.725 34.406  25.580  1.00 18.98  ? 252 PHE A CZ    1 
ATOM   2547 N N     . ARG C 3 236 ? 72.758 29.906  26.858  1.00 22.06  ? 253 ARG A N     1 
ATOM   2548 C CA    . ARG C 3 236 ? 73.791 30.430  27.755  1.00 23.33  ? 253 ARG A CA    1 
ATOM   2549 C C     . ARG C 3 236 ? 74.335 31.706  27.148  1.00 23.18  ? 253 ARG A C     1 
ATOM   2550 O O     . ARG C 3 236 ? 74.524 31.779  25.944  1.00 23.35  ? 253 ARG A O     1 
ATOM   2551 C CB    . ARG C 3 236 ? 74.954 29.431  27.909  1.00 25.01  ? 253 ARG A CB    1 
ATOM   2552 C CG    . ARG C 3 236 ? 74.629 28.127  28.625  1.00 27.00  ? 253 ARG A CG    1 
ATOM   2553 C CD    . ARG C 3 236 ? 74.566 28.296  30.131  1.00 30.38  ? 253 ARG A CD    1 
ATOM   2554 N NE    . ARG C 3 236 ? 74.020 27.098  30.770  1.00 34.59  ? 253 ARG A NE    1 
ATOM   2555 C CZ    . ARG C 3 236 ? 74.200 26.760  32.049  1.00 36.15  ? 253 ARG A CZ    1 
ATOM   2556 N NH1   . ARG C 3 236 ? 73.647 25.645  32.521  1.00 36.63  ? 253 ARG A NH1   1 
ATOM   2557 N NH2   . ARG C 3 236 ? 74.943 27.521  32.850  1.00 36.29  ? 253 ARG A NH2   1 
ATOM   2558 N N     . THR C 3 237 ? 74.604 32.703  27.978  1.00 23.35  ? 254 THR A N     1 
ATOM   2559 C CA    . THR C 3 237 ? 75.133 33.967  27.484  1.00 23.35  ? 254 THR A CA    1 
ATOM   2560 C C     . THR C 3 237 ? 76.574 33.924  27.018  1.00 23.68  ? 254 THR A C     1 
ATOM   2561 O O     . THR C 3 237 ? 77.401 33.262  27.606  1.00 23.21  ? 254 THR A O     1 
ATOM   2562 C CB    . THR C 3 237 ? 75.066 35.060  28.545  1.00 23.89  ? 254 THR A CB    1 
ATOM   2563 O OG1   . THR C 3 237 ? 75.561 34.544  29.787  1.00 23.24  ? 254 THR A OG1   1 
ATOM   2564 C CG2   . THR C 3 237 ? 73.658 35.567  28.706  1.00 24.07  ? 254 THR A CG2   1 
ATOM   2565 N N     . PRO C 3 238 ? 76.886 34.659  25.945  1.00 25.05  ? 255 PRO A N     1 
ATOM   2566 C CA    . PRO C 3 238 ? 78.243 34.724  25.392  1.00 25.47  ? 255 PRO A CA    1 
ATOM   2567 C C     . PRO C 3 238 ? 79.110 35.601  26.288  1.00 26.84  ? 255 PRO A C     1 
ATOM   2568 O O     . PRO C 3 238 ? 78.597 36.434  27.027  1.00 26.91  ? 255 PRO A O     1 
ATOM   2569 C CB    . PRO C 3 238 ? 78.026 35.391  24.043  1.00 25.59  ? 255 PRO A CB    1 
ATOM   2570 C CG    . PRO C 3 238 ? 76.905 36.351  24.347  1.00 25.48  ? 255 PRO A CG    1 
ATOM   2571 C CD    . PRO C 3 238 ? 75.956 35.478  25.142  1.00 24.72  ? 255 PRO A CD    1 
ATOM   2572 N N     . PRO C 3 239 ? 80.435 35.413  26.245  1.00 27.88  ? 256 PRO A N     1 
ATOM   2573 C CA    . PRO C 3 239 ? 81.347 36.220  27.062  1.00 27.41  ? 256 PRO A CA    1 
ATOM   2574 C C     . PRO C 3 239 ? 81.464 37.605  26.448  1.00 27.42  ? 256 PRO A C     1 
ATOM   2575 O O     . PRO C 3 239 ? 81.685 37.715  25.246  1.00 28.11  ? 256 PRO A O     1 
ATOM   2576 C CB    . PRO C 3 239 ? 82.672 35.474  26.945  1.00 26.97  ? 256 PRO A CB    1 
ATOM   2577 C CG    . PRO C 3 239 ? 82.263 34.067  26.688  1.00 28.19  ? 256 PRO A CG    1 
ATOM   2578 C CD    . PRO C 3 239 ? 81.144 34.251  25.689  1.00 28.60  ? 256 PRO A CD    1 
ATOM   2579 N N     . TYR C 3 240 ? 81.302 38.657  27.244  1.00 27.15  ? 257 TYR A N     1 
ATOM   2580 C CA    . TYR C 3 240 ? 81.452 40.004  26.704  1.00 27.34  ? 257 TYR A CA    1 
ATOM   2581 C C     . TYR C 3 240 ? 82.925 40.223  26.366  1.00 27.56  ? 257 TYR A C     1 
ATOM   2582 O O     . TYR C 3 240 ? 83.790 39.503  26.857  1.00 27.33  ? 257 TYR A O     1 
ATOM   2583 C CB    . TYR C 3 240 ? 81.015 41.056  27.709  1.00 27.41  ? 257 TYR A CB    1 
ATOM   2584 C CG    . TYR C 3 240 ? 81.036 42.447  27.124  1.00 28.26  ? 257 TYR A CG    1 
ATOM   2585 C CD1   . TYR C 3 240 ? 81.737 43.483  27.741  1.00 28.29  ? 257 TYR A CD1   1 
ATOM   2586 C CD2   . TYR C 3 240 ? 80.355 42.725  25.947  1.00 28.50  ? 257 TYR A CD2   1 
ATOM   2587 C CE1   . TYR C 3 240 ? 81.758 44.759  27.194  1.00 29.42  ? 257 TYR A CE1   1 
ATOM   2588 C CE2   . TYR C 3 240 ? 80.367 43.990  25.392  1.00 29.74  ? 257 TYR A CE2   1 
ATOM   2589 C CZ    . TYR C 3 240 ? 81.069 45.007  26.012  1.00 30.08  ? 257 TYR A CZ    1 
ATOM   2590 O OH    . TYR C 3 240 ? 81.085 46.261  25.430  1.00 30.75  ? 257 TYR A OH    1 
ATOM   2591 N N     . ALA C 3 241 ? 83.207 41.222  25.536  1.00 28.82  ? 258 ALA A N     1 
ATOM   2592 C CA    . ALA C 3 241 ? 84.576 41.527  25.111  1.00 29.84  ? 258 ALA A CA    1 
ATOM   2593 C C     . ALA C 3 241 ? 85.514 41.859  26.258  1.00 31.09  ? 258 ALA A C     1 
ATOM   2594 O O     . ALA C 3 241 ? 86.570 41.249  26.379  1.00 31.63  ? 258 ALA A O     1 
ATOM   2595 C CB    . ALA C 3 241 ? 84.561 42.663  24.132  1.00 29.77  ? 258 ALA A CB    1 
ATOM   2596 N N     . ASP C 3 242 ? 85.141 42.838  27.080  1.00 32.34  ? 259 ASP A N     1 
ATOM   2597 C CA    . ASP C 3 242 ? 85.946 43.236  28.234  1.00 33.97  ? 259 ASP A CA    1 
ATOM   2598 C C     . ASP C 3 242 ? 85.671 42.240  29.363  1.00 34.49  ? 259 ASP A C     1 
ATOM   2599 O O     . ASP C 3 242 ? 84.584 42.217  29.927  1.00 34.85  ? 259 ASP A O     1 
ATOM   2600 C CB    . ASP C 3 242 ? 85.562 44.644  28.689  1.00 35.03  ? 259 ASP A CB    1 
ATOM   2601 C CG    . ASP C 3 242 ? 86.489 45.187  29.768  1.00 36.13  ? 259 ASP A CG    1 
ATOM   2602 O OD1   . ASP C 3 242 ? 86.823 44.445  30.727  1.00 36.55  ? 259 ASP A OD1   1 
ATOM   2603 O OD2   . ASP C 3 242 ? 86.876 46.369  29.657  1.00 36.39  ? 259 ASP A OD2   1 
ATOM   2604 N N     . PRO C 3 243 ? 86.664 41.415  29.714  1.00 35.06  ? 260 PRO A N     1 
ATOM   2605 C CA    . PRO C 3 243 ? 86.573 40.392  30.765  1.00 35.64  ? 260 PRO A CA    1 
ATOM   2606 C C     . PRO C 3 243 ? 86.693 40.928  32.177  1.00 36.58  ? 260 PRO A C     1 
ATOM   2607 O O     . PRO C 3 243 ? 86.673 40.161  33.146  1.00 36.56  ? 260 PRO A O     1 
ATOM   2608 C CB    . PRO C 3 243 ? 87.734 39.446  30.444  1.00 35.03  ? 260 PRO A CB    1 
ATOM   2609 C CG    . PRO C 3 243 ? 88.134 39.803  29.018  1.00 35.78  ? 260 PRO A CG    1 
ATOM   2610 C CD    . PRO C 3 243 ? 87.928 41.284  28.981  1.00 35.42  ? 260 PRO A CD    1 
ATOM   2611 N N     . SER C 3 244 ? 86.833 42.238  32.302  1.00 37.31  ? 261 SER A N     1 
ATOM   2612 C CA    . SER C 3 244 ? 86.985 42.832  33.618  1.00 38.66  ? 261 SER A CA    1 
ATOM   2613 C C     . SER C 3 244 ? 86.244 44.150  33.703  1.00 39.79  ? 261 SER A C     1 
ATOM   2614 O O     . SER C 3 244 ? 86.803 45.194  34.023  1.00 40.45  ? 261 SER A O     1 
ATOM   2615 C CB    . SER C 3 244 ? 88.468 43.026  33.917  1.00 37.96  ? 261 SER A CB    1 
ATOM   2616 O OG    . SER C 3 244 ? 89.112 43.613  32.803  1.00 38.28  ? 261 SER A OG    1 
ATOM   2617 N N     . LEU C 3 245 ? 84.963 44.089  33.405  1.00 41.12  ? 262 LEU A N     1 
ATOM   2618 C CA    . LEU C 3 245 ? 84.135 45.267  33.455  1.00 42.12  ? 262 LEU A CA    1 
ATOM   2619 C C     . LEU C 3 245 ? 84.205 45.813  34.871  1.00 43.28  ? 262 LEU A C     1 
ATOM   2620 O O     . LEU C 3 245 ? 84.478 45.073  35.820  1.00 43.23  ? 262 LEU A O     1 
ATOM   2621 C CB    . LEU C 3 245 ? 82.701 44.883  33.103  1.00 40.80  ? 262 LEU A CB    1 
ATOM   2622 C CG    . LEU C 3 245 ? 82.015 45.647  31.981  1.00 39.52  ? 262 LEU A CG    1 
ATOM   2623 C CD1   . LEU C 3 245 ? 82.967 45.903  30.837  1.00 39.41  ? 262 LEU A CD1   1 
ATOM   2624 C CD2   . LEU C 3 245 ? 80.844 44.825  31.519  1.00 39.42  ? 262 LEU A CD2   1 
ATOM   2625 N N     . GLN C 3 246 ? 83.969 47.113  35.002  1.00 44.55  ? 263 GLN A N     1 
ATOM   2626 C CA    . GLN C 3 246 ? 83.972 47.770  36.300  1.00 45.46  ? 263 GLN A CA    1 
ATOM   2627 C C     . GLN C 3 246 ? 82.822 48.763  36.331  1.00 45.33  ? 263 GLN A C     1 
ATOM   2628 O O     . GLN C 3 246 ? 82.875 49.786  37.007  1.00 45.69  ? 263 GLN A O     1 
ATOM   2629 C CB    . GLN C 3 246 ? 85.302 48.479  36.532  1.00 46.94  ? 263 GLN A CB    1 
ATOM   2630 C CG    . GLN C 3 246 ? 86.474 47.529  36.603  1.00 49.33  ? 263 GLN A CG    1 
ATOM   2631 C CD    . GLN C 3 246 ? 87.703 48.109  35.943  1.00 51.40  ? 263 GLN A CD    1 
ATOM   2632 O OE1   . GLN C 3 246 ? 87.628 48.656  34.835  1.00 52.43  ? 263 GLN A OE1   1 
ATOM   2633 N NE2   . GLN C 3 246 ? 88.848 47.987  36.608  1.00 52.75  ? 263 GLN A NE2   1 
ATOM   2634 N N     . ALA C 3 247 ? 81.783 48.444  35.570  1.00 45.24  ? 264 ALA A N     1 
ATOM   2635 C CA    . ALA C 3 247 ? 80.572 49.252  35.482  1.00 44.43  ? 264 ALA A CA    1 
ATOM   2636 C C     . ALA C 3 247 ? 79.679 48.592  34.456  1.00 44.10  ? 264 ALA A C     1 
ATOM   2637 O O     . ALA C 3 247 ? 80.154 48.040  33.461  1.00 43.56  ? 264 ALA A O     1 
ATOM   2638 C CB    . ALA C 3 247 ? 80.888 50.670  35.052  1.00 44.46  ? 264 ALA A CB    1 
ATOM   2639 N N     . PRO C 3 248 ? 78.366 48.627  34.690  1.00 43.63  ? 265 PRO A N     1 
ATOM   2640 C CA    . PRO C 3 248 ? 77.411 48.021  33.766  1.00 42.76  ? 265 PRO A CA    1 
ATOM   2641 C C     . PRO C 3 248 ? 77.582 48.602  32.377  1.00 41.92  ? 265 PRO A C     1 
ATOM   2642 O O     . PRO C 3 248 ? 77.806 49.807  32.232  1.00 41.84  ? 265 PRO A O     1 
ATOM   2643 C CB    . PRO C 3 248 ? 76.065 48.402  34.369  1.00 43.27  ? 265 PRO A CB    1 
ATOM   2644 C CG    . PRO C 3 248 ? 76.368 48.491  35.826  1.00 43.40  ? 265 PRO A CG    1 
ATOM   2645 C CD    . PRO C 3 248 ? 77.670 49.236  35.832  1.00 43.57  ? 265 PRO A CD    1 
ATOM   2646 N N     . VAL C 3 249 ? 77.492 47.736  31.370  1.00 40.57  ? 266 VAL A N     1 
ATOM   2647 C CA    . VAL C 3 249 ? 77.585 48.137  29.970  1.00 39.01  ? 266 VAL A CA    1 
ATOM   2648 C C     . VAL C 3 249 ? 76.358 47.551  29.307  1.00 38.65  ? 266 VAL A C     1 
ATOM   2649 O O     . VAL C 3 249 ? 76.144 46.343  29.361  1.00 38.96  ? 266 VAL A O     1 
ATOM   2650 C CB    . VAL C 3 249 ? 78.821 47.548  29.272  1.00 38.76  ? 266 VAL A CB    1 
ATOM   2651 C CG1   . VAL C 3 249 ? 78.851 46.059  29.462  1.00 38.93  ? 266 VAL A CG1   1 
ATOM   2652 C CG2   . VAL C 3 249 ? 78.777 47.852  27.789  1.00 37.75  ? 266 VAL A CG2   1 
ATOM   2653 N N     . ARG C 3 250 ? 75.540 48.401  28.703  1.00 37.75  ? 267 ARG A N     1 
ATOM   2654 C CA    . ARG C 3 250 ? 74.344 47.930  28.031  1.00 36.50  ? 267 ARG A CA    1 
ATOM   2655 C C     . ARG C 3 250 ? 74.697 47.437  26.644  1.00 35.24  ? 267 ARG A C     1 
ATOM   2656 O O     . ARG C 3 250 ? 75.594 47.979  26.003  1.00 35.73  ? 267 ARG A O     1 
ATOM   2657 C CB    . ARG C 3 250 ? 73.320 49.053  27.929  1.00 38.43  ? 267 ARG A CB    1 
ATOM   2658 C CG    . ARG C 3 250 ? 72.341 49.087  29.076  1.00 41.89  ? 267 ARG A CG    1 
ATOM   2659 C CD    . ARG C 3 250 ? 71.339 50.223  28.922  1.00 45.84  ? 267 ARG A CD    1 
ATOM   2660 N NE    . ARG C 3 250 ? 71.826 51.476  29.499  1.00 50.16  ? 267 ARG A NE    1 
ATOM   2661 C CZ    . ARG C 3 250 ? 72.148 51.635  30.787  1.00 51.91  ? 267 ARG A CZ    1 
ATOM   2662 N NH1   . ARG C 3 250 ? 72.588 52.816  31.230  1.00 52.12  ? 267 ARG A NH1   1 
ATOM   2663 N NH2   . ARG C 3 250 ? 72.030 50.616  31.639  1.00 52.09  ? 267 ARG A NH2   1 
ATOM   2664 N N     . VAL C 3 251 ? 74.001 46.396  26.195  1.00 33.19  ? 268 VAL A N     1 
ATOM   2665 C CA    . VAL C 3 251 ? 74.205 45.821  24.864  1.00 30.28  ? 268 VAL A CA    1 
ATOM   2666 C C     . VAL C 3 251 ? 72.858 45.347  24.357  1.00 29.88  ? 268 VAL A C     1 
ATOM   2667 O O     . VAL C 3 251 ? 71.879 45.332  25.103  1.00 30.02  ? 268 VAL A O     1 
ATOM   2668 C CB    . VAL C 3 251 ? 75.159 44.606  24.876  1.00 29.04  ? 268 VAL A CB    1 
ATOM   2669 C CG1   . VAL C 3 251 ? 76.510 45.015  25.383  1.00 28.30  ? 268 VAL A CG1   1 
ATOM   2670 C CG2   . VAL C 3 251 ? 74.591 43.499  25.728  1.00 27.83  ? 268 VAL A CG2   1 
ATOM   2671 N N     . SER C 3 252 ? 72.804 44.955  23.092  1.00 28.87  ? 269 SER A N     1 
ATOM   2672 C CA    . SER C 3 252 ? 71.559 44.479  22.516  1.00 28.29  ? 269 SER A CA    1 
ATOM   2673 C C     . SER C 3 252 ? 71.483 42.971  22.399  1.00 27.76  ? 269 SER A C     1 
ATOM   2674 O O     . SER C 3 252 ? 72.484 42.299  22.168  1.00 28.40  ? 269 SER A O     1 
ATOM   2675 C CB    . SER C 3 252 ? 71.338 45.098  21.141  1.00 27.63  ? 269 SER A CB    1 
ATOM   2676 O OG    . SER C 3 252 ? 70.589 46.291  21.265  1.00 27.58  ? 269 SER A OG    1 
ATOM   2677 N N     . MET C 3 253 ? 70.271 42.454  22.559  1.00 26.76  ? 270 MET A N     1 
ATOM   2678 C CA    . MET C 3 253 ? 70.002 41.024  22.466  1.00 25.84  ? 270 MET A CA    1 
ATOM   2679 C C     . MET C 3 253 ? 68.801 40.850  21.542  1.00 25.14  ? 270 MET A C     1 
ATOM   2680 O O     . MET C 3 253 ? 67.739 41.423  21.770  1.00 24.86  ? 270 MET A O     1 
ATOM   2681 C CB    . MET C 3 253 ? 69.688 40.466  23.851  1.00 25.49  ? 270 MET A CB    1 
ATOM   2682 C CG    . MET C 3 253 ? 69.317 39.009  23.877  1.00 26.24  ? 270 MET A CG    1 
ATOM   2683 S SD    . MET C 3 253 ? 68.884 38.471  25.543  1.00 28.54  ? 270 MET A SD    1 
ATOM   2684 C CE    . MET C 3 253 ? 67.237 39.144  25.720  1.00 28.13  ? 270 MET A CE    1 
ATOM   2685 N N     . GLN C 3 254 ? 68.957 40.073  20.484  1.00 24.30  ? 271 GLN A N     1 
ATOM   2686 C CA    . GLN C 3 254 ? 67.838 39.894  19.584  1.00 23.39  ? 271 GLN A CA    1 
ATOM   2687 C C     . GLN C 3 254 ? 67.863 38.554  18.877  1.00 22.57  ? 271 GLN A C     1 
ATOM   2688 O O     . GLN C 3 254 ? 68.903 37.900  18.784  1.00 22.32  ? 271 GLN A O     1 
ATOM   2689 C CB    . GLN C 3 254 ? 67.810 41.033  18.570  1.00 23.48  ? 271 GLN A CB    1 
ATOM   2690 C CG    . GLN C 3 254 ? 69.046 41.124  17.744  1.00 25.22  ? 271 GLN A CG    1 
ATOM   2691 C CD    . GLN C 3 254 ? 69.183 42.458  17.045  1.00 25.87  ? 271 GLN A CD    1 
ATOM   2692 O OE1   . GLN C 3 254 ? 68.245 42.950  16.421  1.00 26.37  ? 271 GLN A OE1   1 
ATOM   2693 N NE2   . GLN C 3 254 ? 70.363 43.045  17.137  1.00 26.22  ? 271 GLN A NE2   1 
ATOM   2694 N N     . LEU C 3 255 ? 66.695 38.142  18.398  1.00 21.09  ? 272 LEU A N     1 
ATOM   2695 C CA    . LEU C 3 255 ? 66.563 36.877  17.702  1.00 19.80  ? 272 LEU A CA    1 
ATOM   2696 C C     . LEU C 3 255 ? 67.082 37.055  16.290  1.00 19.20  ? 272 LEU A C     1 
ATOM   2697 O O     . LEU C 3 255 ? 66.861 38.103  15.681  1.00 19.95  ? 272 LEU A O     1 
ATOM   2698 C CB    . LEU C 3 255 ? 65.092 36.444  17.676  1.00 18.66  ? 272 LEU A CB    1 
ATOM   2699 C CG    . LEU C 3 255 ? 64.474 35.996  19.004  1.00 18.44  ? 272 LEU A CG    1 
ATOM   2700 C CD1   . LEU C 3 255 ? 62.980 35.877  18.831  1.00 19.24  ? 272 LEU A CD1   1 
ATOM   2701 C CD2   . LEU C 3 255 ? 65.052 34.665  19.440  1.00 16.92  ? 272 LEU A CD2   1 
ATOM   2702 N N     . ARG C 3 256 ? 67.786 36.055  15.769  1.00 17.41  ? 273 ARG A N     1 
ATOM   2703 C CA    . ARG C 3 256 ? 68.284 36.164  14.411  1.00 16.78  ? 273 ARG A CA    1 
ATOM   2704 C C     . ARG C 3 256 ? 67.930 34.934  13.608  1.00 16.93  ? 273 ARG A C     1 
ATOM   2705 O O     . ARG C 3 256 ? 68.053 33.822  14.105  1.00 17.59  ? 273 ARG A O     1 
ATOM   2706 C CB    . ARG C 3 256 ? 69.795 36.333  14.394  1.00 17.32  ? 273 ARG A CB    1 
ATOM   2707 C CG    . ARG C 3 256 ? 70.303 36.724  13.030  1.00 17.01  ? 273 ARG A CG    1 
ATOM   2708 C CD    . ARG C 3 256 ? 71.811 36.664  12.882  1.00 16.82  ? 273 ARG A CD    1 
ATOM   2709 N NE    . ARG C 3 256 ? 72.129 36.621  11.457  1.00 17.10  ? 273 ARG A NE    1 
ATOM   2710 C CZ    . ARG C 3 256 ? 72.465 35.521  10.803  1.00 16.44  ? 273 ARG A CZ    1 
ATOM   2711 N NH1   . ARG C 3 256 ? 72.723 35.580  9.499   1.00 15.92  ? 273 ARG A NH1   1 
ATOM   2712 N NH2   . ARG C 3 256 ? 72.569 34.373  11.466  1.00 16.23  ? 273 ARG A NH2   1 
ATOM   2713 N N     . ARG C 3 257 ? 67.481 35.128  12.371  1.00 16.01  ? 274 ARG A N     1 
ATOM   2714 C CA    . ARG C 3 257 ? 67.145 33.996  11.527  1.00 15.89  ? 274 ARG A CA    1 
ATOM   2715 C C     . ARG C 3 257 ? 68.163 33.965  10.415  1.00 15.96  ? 274 ARG A C     1 
ATOM   2716 O O     . ARG C 3 257 ? 68.182 34.833  9.550   1.00 15.87  ? 274 ARG A O     1 
ATOM   2717 C CB    . ARG C 3 257 ? 65.734 34.134  10.952  1.00 17.17  ? 274 ARG A CB    1 
ATOM   2718 C CG    . ARG C 3 257 ? 65.227 32.912  10.181  1.00 16.16  ? 274 ARG A CG    1 
ATOM   2719 C CD    . ARG C 3 257 ? 63.720 33.007  9.944   1.00 16.88  ? 274 ARG A CD    1 
ATOM   2720 N NE    . ARG C 3 257 ? 63.355 34.227  9.232   1.00 17.49  ? 274 ARG A NE    1 
ATOM   2721 C CZ    . ARG C 3 257 ? 62.239 34.921  9.439   1.00 17.94  ? 274 ARG A CZ    1 
ATOM   2722 N NH1   . ARG C 3 257 ? 62.008 36.022  8.735   1.00 17.71  ? 274 ARG A NH1   1 
ATOM   2723 N NH2   . ARG C 3 257 ? 61.360 34.524  10.351  1.00 17.57  ? 274 ARG A NH2   1 
ATOM   2724 N N     . PRO C 3 258 ? 69.039 32.956  10.429  1.00 15.75  ? 275 PRO A N     1 
ATOM   2725 C CA    . PRO C 3 258 ? 70.082 32.803  9.424   1.00 15.11  ? 275 PRO A CA    1 
ATOM   2726 C C     . PRO C 3 258 ? 69.596 32.621  7.989   1.00 15.36  ? 275 PRO A C     1 
ATOM   2727 O O     . PRO C 3 258 ? 70.201 33.142  7.069   1.00 15.87  ? 275 PRO A O     1 
ATOM   2728 C CB    . PRO C 3 258 ? 70.857 31.601  9.935   1.00 14.82  ? 275 PRO A CB    1 
ATOM   2729 C CG    . PRO C 3 258 ? 70.686 31.699  11.404  1.00 14.70  ? 275 PRO A CG    1 
ATOM   2730 C CD    . PRO C 3 258 ? 69.231 31.977  11.511  1.00 15.53  ? 275 PRO A CD    1 
ATOM   2731 N N     . SER C 3 259 ? 68.511 31.893  7.779   1.00 16.53  ? 276 SER A N     1 
ATOM   2732 C CA    . SER C 3 259 ? 68.041 31.675  6.413   1.00 17.60  ? 276 SER A CA    1 
ATOM   2733 C C     . SER C 3 259 ? 67.919 32.980  5.619   1.00 18.72  ? 276 SER A C     1 
ATOM   2734 O O     . SER C 3 259 ? 68.449 33.081  4.506   1.00 19.65  ? 276 SER A O     1 
ATOM   2735 C CB    . SER C 3 259 ? 66.695 30.971  6.431   1.00 17.50  ? 276 SER A CB    1 
ATOM   2736 O OG    . SER C 3 259 ? 65.671 31.868  6.851   1.00 19.86  ? 276 SER A OG    1 
ATOM   2737 N N     . ASP C 3 260 ? 67.223 33.968  6.185   1.00 19.41  ? 277 ASP A N     1 
ATOM   2738 C CA    . ASP C 3 260 ? 67.035 35.266  5.532   1.00 20.69  ? 277 ASP A CA    1 
ATOM   2739 C C     . ASP C 3 260 ? 67.634 36.396  6.366   1.00 22.56  ? 277 ASP A C     1 
ATOM   2740 O O     . ASP C 3 260 ? 67.228 37.563  6.252   1.00 22.29  ? 277 ASP A O     1 
ATOM   2741 C CB    . ASP C 3 260 ? 65.549 35.549  5.320   1.00 19.75  ? 277 ASP A CB    1 
ATOM   2742 C CG    . ASP C 3 260 ? 64.774 35.638  6.621   1.00 20.87  ? 277 ASP A CG    1 
ATOM   2743 O OD1   . ASP C 3 260 ? 65.387 35.711  7.707   1.00 20.00  ? 277 ASP A OD1   1 
ATOM   2744 O OD2   . ASP C 3 260 ? 63.530 35.650  6.561   1.00 22.54  ? 277 ASP A OD2   1 
ATOM   2745 N N     . ARG C 3 261 ? 68.597 36.033  7.207   1.00 23.72  ? 278 ARG A N     1 
ATOM   2746 C CA    . ARG C 3 261 ? 69.269 36.967  8.093   1.00 25.98  ? 278 ARG A CA    1 
ATOM   2747 C C     . ARG C 3 261 ? 68.385 38.044  8.742   1.00 25.82  ? 278 ARG A C     1 
ATOM   2748 O O     . ARG C 3 261 ? 68.816 39.167  8.994   1.00 26.55  ? 278 ARG A O     1 
ATOM   2749 C CB    . ARG C 3 261 ? 70.497 37.583  7.392   1.00 28.02  ? 278 ARG A CB    1 
ATOM   2750 C CG    . ARG C 3 261 ? 70.259 38.260  6.070   1.00 31.34  ? 278 ARG A CG    1 
ATOM   2751 C CD    . ARG C 3 261 ? 71.525 38.188  5.224   1.00 34.11  ? 278 ARG A CD    1 
ATOM   2752 N NE    . ARG C 3 261 ? 71.914 36.799  4.982   1.00 38.65  ? 278 ARG A NE    1 
ATOM   2753 C CZ    . ARG C 3 261 ? 71.313 35.971  4.118   1.00 40.48  ? 278 ARG A CZ    1 
ATOM   2754 N NH1   . ARG C 3 261 ? 71.754 34.718  3.988   1.00 40.20  ? 278 ARG A NH1   1 
ATOM   2755 N NH2   . ARG C 3 261 ? 70.288 36.391  3.367   1.00 39.76  ? 278 ARG A NH2   1 
ATOM   2756 N N     . GLU C 3 262 ? 67.153 37.668  9.050   1.00 25.73  ? 279 GLU A N     1 
ATOM   2757 C CA    . GLU C 3 262 ? 66.212 38.557  9.706   1.00 25.97  ? 279 GLU A CA    1 
ATOM   2758 C C     . GLU C 3 262 ? 66.580 38.771  11.182  1.00 24.75  ? 279 GLU A C     1 
ATOM   2759 O O     . GLU C 3 262 ? 67.252 37.936  11.779  1.00 24.47  ? 279 GLU A O     1 
ATOM   2760 C CB    . GLU C 3 262 ? 64.804 37.961  9.609   1.00 28.62  ? 279 GLU A CB    1 
ATOM   2761 C CG    . GLU C 3 262 ? 63.860 38.744  8.707   1.00 32.46  ? 279 GLU A CG    1 
ATOM   2762 C CD    . GLU C 3 262 ? 63.552 40.120  9.258   1.00 34.20  ? 279 GLU A CD    1 
ATOM   2763 O OE1   . GLU C 3 262 ? 62.937 40.922  8.525   1.00 35.98  ? 279 GLU A OE1   1 
ATOM   2764 O OE2   . GLU C 3 262 ? 63.922 40.394  10.425  1.00 35.86  ? 279 GLU A OE2   1 
ATOM   2765 N N     . LEU C 3 263 ? 66.124 39.878  11.766  1.00 23.22  ? 280 LEU A N     1 
ATOM   2766 C CA    . LEU C 3 263 ? 66.404 40.184  13.168  1.00 22.68  ? 280 LEU A CA    1 
ATOM   2767 C C     . LEU C 3 263 ? 65.162 40.680  13.895  1.00 23.41  ? 280 LEU A C     1 
ATOM   2768 O O     . LEU C 3 263 ? 64.303 41.321  13.303  1.00 24.64  ? 280 LEU A O     1 
ATOM   2769 C CB    . LEU C 3 263 ? 67.492 41.254  13.283  1.00 20.77  ? 280 LEU A CB    1 
ATOM   2770 C CG    . LEU C 3 263 ? 68.928 40.945  12.854  1.00 19.62  ? 280 LEU A CG    1 
ATOM   2771 C CD1   . LEU C 3 263 ? 69.703 42.225  12.792  1.00 17.18  ? 280 LEU A CD1   1 
ATOM   2772 C CD2   . LEU C 3 263 ? 69.586 39.960  13.819  1.00 19.08  ? 280 LEU A CD2   1 
ATOM   2773 N N     . SER C 3 264 ? 65.059 40.385  15.180  1.00 23.26  ? 281 SER A N     1 
ATOM   2774 C CA    . SER C 3 264 ? 63.915 40.847  15.953  1.00 24.38  ? 281 SER A CA    1 
ATOM   2775 C C     . SER C 3 264 ? 64.261 42.194  16.582  1.00 25.13  ? 281 SER A C     1 
ATOM   2776 O O     . SER C 3 264 ? 65.425 42.557  16.672  1.00 25.85  ? 281 SER A O     1 
ATOM   2777 C CB    . SER C 3 264 ? 63.583 39.848  17.064  1.00 24.80  ? 281 SER A CB    1 
ATOM   2778 O OG    . SER C 3 264 ? 64.563 39.860  18.092  1.00 24.25  ? 281 SER A OG    1 
ATOM   2779 N N     . GLU C 3 265 ? 63.265 42.949  17.015  1.00 26.48  ? 282 GLU A N     1 
ATOM   2780 C CA    . GLU C 3 265 ? 63.579 44.222  17.641  1.00 28.01  ? 282 GLU A CA    1 
ATOM   2781 C C     . GLU C 3 265 ? 64.501 43.898  18.800  1.00 27.40  ? 282 GLU A C     1 
ATOM   2782 O O     . GLU C 3 265 ? 64.364 42.862  19.451  1.00 27.10  ? 282 GLU A O     1 
ATOM   2783 C CB    . GLU C 3 265 ? 62.315 44.915  18.126  1.00 30.40  ? 282 GLU A CB    1 
ATOM   2784 C CG    . GLU C 3 265 ? 61.411 45.310  16.976  1.00 35.32  ? 282 GLU A CG    1 
ATOM   2785 C CD    . GLU C 3 265 ? 60.941 46.747  17.086  1.00 38.71  ? 282 GLU A CD    1 
ATOM   2786 O OE1   . GLU C 3 265 ? 59.909 46.981  17.772  1.00 38.67  ? 282 GLU A OE1   1 
ATOM   2787 O OE2   . GLU C 3 265 ? 61.623 47.632  16.501  1.00 39.25  ? 282 GLU A OE2   1 
ATOM   2788 N N     . PRO C 3 266 ? 65.452 44.785  19.078  1.00 26.66  ? 283 PRO A N     1 
ATOM   2789 C CA    . PRO C 3 266 ? 66.421 44.596  20.154  1.00 26.89  ? 283 PRO A CA    1 
ATOM   2790 C C     . PRO C 3 266 ? 65.899 44.665  21.575  1.00 27.19  ? 283 PRO A C     1 
ATOM   2791 O O     . PRO C 3 266 ? 65.090 45.514  21.913  1.00 27.33  ? 283 PRO A O     1 
ATOM   2792 C CB    . PRO C 3 266 ? 67.436 45.688  19.877  1.00 26.42  ? 283 PRO A CB    1 
ATOM   2793 C CG    . PRO C 3 266 ? 66.552 46.799  19.406  1.00 26.46  ? 283 PRO A CG    1 
ATOM   2794 C CD    . PRO C 3 266 ? 65.619 46.101  18.447  1.00 26.29  ? 283 PRO A CD    1 
ATOM   2795 N N     . MET C 3 267 ? 66.376 43.753  22.406  1.00 27.77  ? 284 MET A N     1 
ATOM   2796 C CA    . MET C 3 267 ? 66.017 43.748  23.807  1.00 28.03  ? 284 MET A CA    1 
ATOM   2797 C C     . MET C 3 267 ? 67.280 44.239  24.485  1.00 27.22  ? 284 MET A C     1 
ATOM   2798 O O     . MET C 3 267 ? 68.375 43.997  24.004  1.00 27.07  ? 284 MET A O     1 
ATOM   2799 C CB    . MET C 3 267 ? 65.696 42.349  24.287  1.00 30.31  ? 284 MET A CB    1 
ATOM   2800 C CG    . MET C 3 267 ? 65.511 42.300  25.773  1.00 33.36  ? 284 MET A CG    1 
ATOM   2801 S SD    . MET C 3 267 ? 64.110 41.301  26.228  1.00 39.52  ? 284 MET A SD    1 
ATOM   2802 C CE    . MET C 3 267 ? 62.829 41.926  25.087  1.00 36.87  ? 284 MET A CE    1 
ATOM   2803 N N     . GLU C 3 268 ? 67.141 44.932  25.598  1.00 27.03  ? 285 GLU A N     1 
ATOM   2804 C CA    . GLU C 3 268 ? 68.310 45.453  26.266  1.00 27.21  ? 285 GLU A CA    1 
ATOM   2805 C C     . GLU C 3 268 ? 68.874 44.444  27.227  1.00 26.35  ? 285 GLU A C     1 
ATOM   2806 O O     . GLU C 3 268 ? 68.136 43.834  27.987  1.00 26.93  ? 285 GLU A O     1 
ATOM   2807 C CB    . GLU C 3 268 ? 67.949 46.720  27.025  1.00 28.61  ? 285 GLU A CB    1 
ATOM   2808 C CG    . GLU C 3 268 ? 69.136 47.561  27.444  1.00 31.14  ? 285 GLU A CG    1 
ATOM   2809 C CD    . GLU C 3 268 ? 68.715 48.732  28.325  1.00 33.47  ? 285 GLU A CD    1 
ATOM   2810 O OE1   . GLU C 3 268 ? 68.701 48.559  29.572  1.00 34.47  ? 285 GLU A OE1   1 
ATOM   2811 O OE2   . GLU C 3 268 ? 68.381 49.810  27.767  1.00 32.96  ? 285 GLU A OE2   1 
ATOM   2812 N N     . PHE C 3 269 ? 70.186 44.254  27.182  1.00 25.50  ? 286 PHE A N     1 
ATOM   2813 C CA    . PHE C 3 269 ? 70.843 43.339  28.103  1.00 24.98  ? 286 PHE A CA    1 
ATOM   2814 C C     . PHE C 3 269 ? 71.981 44.101  28.727  1.00 25.74  ? 286 PHE A C     1 
ATOM   2815 O O     . PHE C 3 269 ? 72.574 44.968  28.083  1.00 25.06  ? 286 PHE A O     1 
ATOM   2816 C CB    . PHE C 3 269 ? 71.390 42.107  27.397  1.00 21.89  ? 286 PHE A CB    1 
ATOM   2817 C CG    . PHE C 3 269 ? 72.091 41.144  28.321  1.00 20.36  ? 286 PHE A CG    1 
ATOM   2818 C CD1   . PHE C 3 269 ? 73.452 41.288  28.604  1.00 19.54  ? 286 PHE A CD1   1 
ATOM   2819 C CD2   . PHE C 3 269 ? 71.381 40.111  28.940  1.00 19.11  ? 286 PHE A CD2   1 
ATOM   2820 C CE1   . PHE C 3 269 ? 74.095 40.423  29.491  1.00 18.07  ? 286 PHE A CE1   1 
ATOM   2821 C CE2   . PHE C 3 269 ? 72.007 39.244  29.826  1.00 17.82  ? 286 PHE A CE2   1 
ATOM   2822 C CZ    . PHE C 3 269 ? 73.371 39.402  30.105  1.00 18.16  ? 286 PHE A CZ    1 
ATOM   2823 N N     . GLN C 3 270 ? 72.267 43.791  29.984  1.00 26.83  ? 287 GLN A N     1 
ATOM   2824 C CA    . GLN C 3 270 ? 73.344 44.462  30.688  1.00 28.67  ? 287 GLN A CA    1 
ATOM   2825 C C     . GLN C 3 270 ? 74.398 43.513  31.220  1.00 28.96  ? 287 GLN A C     1 
ATOM   2826 O O     . GLN C 3 270 ? 74.110 42.551  31.937  1.00 28.50  ? 287 GLN A O     1 
ATOM   2827 C CB    . GLN C 3 270 ? 72.798 45.326  31.837  1.00 29.99  ? 287 GLN A CB    1 
ATOM   2828 C CG    . GLN C 3 270 ? 72.320 46.701  31.366  1.00 33.54  ? 287 GLN A CG    1 
ATOM   2829 C CD    . GLN C 3 270 ? 71.928 47.660  32.496  1.00 35.60  ? 287 GLN A CD    1 
ATOM   2830 O OE1   . GLN C 3 270 ? 72.577 47.712  33.561  1.00 36.06  ? 287 GLN A OE1   1 
ATOM   2831 N NE2   . GLN C 3 270 ? 70.877 48.447  32.254  1.00 34.51  ? 287 GLN A NE2   1 
ATOM   2832 N N     . TYR C 3 271 ? 75.635 43.783  30.834  1.00 29.46  ? 288 TYR A N     1 
ATOM   2833 C CA    . TYR C 3 271 ? 76.737 42.985  31.307  1.00 29.72  ? 288 TYR A CA    1 
ATOM   2834 C C     . TYR C 3 271 ? 77.240 43.676  32.558  1.00 30.31  ? 288 TYR A C     1 
ATOM   2835 O O     . TYR C 3 271 ? 77.377 44.900  32.596  1.00 29.56  ? 288 TYR A O     1 
ATOM   2836 C CB    . TYR C 3 271 ? 77.824 42.884  30.238  1.00 29.37  ? 288 TYR A CB    1 
ATOM   2837 C CG    . TYR C 3 271 ? 77.589 41.733  29.279  1.00 28.53  ? 288 TYR A CG    1 
ATOM   2838 C CD1   . TYR C 3 271 ? 76.940 41.921  28.049  1.00 27.24  ? 288 TYR A CD1   1 
ATOM   2839 C CD2   . TYR C 3 271 ? 77.989 40.445  29.623  1.00 27.48  ? 288 TYR A CD2   1 
ATOM   2840 C CE1   . TYR C 3 271 ? 76.702 40.850  27.192  1.00 25.51  ? 288 TYR A CE1   1 
ATOM   2841 C CE2   . TYR C 3 271 ? 77.754 39.377  28.784  1.00 26.95  ? 288 TYR A CE2   1 
ATOM   2842 C CZ    . TYR C 3 271 ? 77.114 39.578  27.570  1.00 26.41  ? 288 TYR A CZ    1 
ATOM   2843 O OH    . TYR C 3 271 ? 76.918 38.482  26.756  1.00 25.75  ? 288 TYR A OH    1 
ATOM   2844 N N     . LEU C 3 272 ? 77.481 42.876  33.589  1.00 31.80  ? 289 LEU A N     1 
ATOM   2845 C CA    . LEU C 3 272 ? 77.939 43.374  34.873  1.00 32.66  ? 289 LEU A CA    1 
ATOM   2846 C C     . LEU C 3 272 ? 79.327 42.871  35.212  1.00 34.36  ? 289 LEU A C     1 
ATOM   2847 O O     . LEU C 3 272 ? 79.853 41.969  34.558  1.00 34.87  ? 289 LEU A O     1 
ATOM   2848 C CB    . LEU C 3 272 ? 76.980 42.929  35.957  1.00 31.64  ? 289 LEU A CB    1 
ATOM   2849 C CG    . LEU C 3 272 ? 75.534 43.278  35.657  1.00 31.95  ? 289 LEU A CG    1 
ATOM   2850 C CD1   . LEU C 3 272 ? 74.656 42.602  36.681  1.00 32.70  ? 289 LEU A CD1   1 
ATOM   2851 C CD2   . LEU C 3 272 ? 75.335 44.787  35.665  1.00 32.35  ? 289 LEU A CD2   1 
ATOM   2852 N N     . PRO C 3 273 ? 79.940 43.446  36.255  1.00 35.46  ? 290 PRO A N     1 
ATOM   2853 C CA    . PRO C 3 273 ? 81.280 43.027  36.653  1.00 35.94  ? 290 PRO A CA    1 
ATOM   2854 C C     . PRO C 3 273 ? 81.472 41.639  37.274  1.00 36.83  ? 290 PRO A C     1 
ATOM   2855 O O     . PRO C 3 273 ? 80.647 41.152  38.043  1.00 35.44  ? 290 PRO A O     1 
ATOM   2856 C CB    . PRO C 3 273 ? 81.711 44.147  37.592  1.00 35.88  ? 290 PRO A CB    1 
ATOM   2857 C CG    . PRO C 3 273 ? 81.012 45.347  37.021  1.00 35.36  ? 290 PRO A CG    1 
ATOM   2858 C CD    . PRO C 3 273 ? 79.640 44.791  36.784  1.00 35.51  ? 290 PRO A CD    1 
ATOM   2859 N N     . ASP C 3 274 ? 82.605 41.045  36.892  1.00 39.36  ? 291 ASP A N     1 
ATOM   2860 C CA    . ASP C 3 274 ? 83.137 39.743  37.325  1.00 41.27  ? 291 ASP A CA    1 
ATOM   2861 C C     . ASP C 3 274 ? 82.204 38.695  37.913  1.00 41.45  ? 291 ASP A C     1 
ATOM   2862 O O     . ASP C 3 274 ? 82.271 37.533  37.440  1.00 40.45  ? 291 ASP A O     1 
ATOM   2863 C CB    . ASP C 3 274 ? 84.276 39.983  38.321  1.00 43.77  ? 291 ASP A CB    1 
ATOM   2864 C CG    . ASP C 3 274 ? 83.767 40.416  39.692  1.00 46.28  ? 291 ASP A CG    1 
ATOM   2865 O OD1   . ASP C 3 274 ? 82.790 41.201  39.743  1.00 47.11  ? 291 ASP A OD1   1 
ATOM   2866 O OD2   . ASP C 3 274 ? 84.344 39.975  40.716  1.00 47.43  ? 291 ASP A OD2   1 
ATOM   2867 O OXT   . ASP C 3 274 ? 81.465 39.041  38.868  1.00 42.44  ? 291 ASP A OXT   1 
ATOM   2868 N N     . GLY D 4 2   ? 23.437 -17.068 37.069  1.00 91.30  ? 39  GLY B N     1 
ATOM   2869 C CA    . GLY D 4 2   ? 23.171 -17.086 35.598  1.00 91.60  ? 39  GLY B CA    1 
ATOM   2870 C C     . GLY D 4 2   ? 24.417 -16.835 34.767  1.00 91.65  ? 39  GLY B C     1 
ATOM   2871 O O     . GLY D 4 2   ? 25.491 -16.610 35.326  1.00 91.86  ? 39  GLY B O     1 
ATOM   2872 N N     . PRO D 4 3   ? 24.313 -16.876 33.426  1.00 91.59  ? 40  PRO B N     1 
ATOM   2873 C CA    . PRO D 4 3   ? 25.449 -16.647 32.528  1.00 91.50  ? 40  PRO B CA    1 
ATOM   2874 C C     . PRO D 4 3   ? 25.585 -15.171 32.158  1.00 91.43  ? 40  PRO B C     1 
ATOM   2875 O O     . PRO D 4 3   ? 24.699 -14.597 31.522  1.00 91.72  ? 40  PRO B O     1 
ATOM   2876 C CB    . PRO D 4 3   ? 25.095 -17.505 31.325  1.00 91.46  ? 40  PRO B CB    1 
ATOM   2877 C CG    . PRO D 4 3   ? 23.623 -17.272 31.218  1.00 91.42  ? 40  PRO B CG    1 
ATOM   2878 C CD    . PRO D 4 3   ? 23.149 -17.371 32.666  1.00 91.62  ? 40  PRO B CD    1 
ATOM   2879 N N     . TYR D 4 4   ? 26.691 -14.555 32.555  1.00 91.09  ? 41  TYR B N     1 
ATOM   2880 C CA    . TYR D 4 4   ? 26.904 -13.147 32.253  1.00 90.71  ? 41  TYR B CA    1 
ATOM   2881 C C     . TYR D 4 4   ? 28.334 -12.868 31.826  1.00 89.94  ? 41  TYR B C     1 
ATOM   2882 O O     . TYR D 4 4   ? 29.227 -13.696 32.010  1.00 89.56  ? 41  TYR B O     1 
ATOM   2883 C CB    . TYR D 4 4   ? 26.564 -12.279 33.468  1.00 91.60  ? 41  TYR B CB    1 
ATOM   2884 C CG    . TYR D 4 4   ? 27.435 -12.546 34.677  1.00 92.51  ? 41  TYR B CG    1 
ATOM   2885 C CD1   . TYR D 4 4   ? 27.202 -13.651 35.500  1.00 92.85  ? 41  TYR B CD1   1 
ATOM   2886 C CD2   . TYR D 4 4   ? 28.508 -11.707 34.988  1.00 92.72  ? 41  TYR B CD2   1 
ATOM   2887 C CE1   . TYR D 4 4   ? 28.017 -13.914 36.604  1.00 92.97  ? 41  TYR B CE1   1 
ATOM   2888 C CE2   . TYR D 4 4   ? 29.330 -11.962 36.088  1.00 93.01  ? 41  TYR B CE2   1 
ATOM   2889 C CZ    . TYR D 4 4   ? 29.078 -13.067 36.891  1.00 93.11  ? 41  TYR B CZ    1 
ATOM   2890 O OH    . TYR D 4 4   ? 29.890 -13.330 37.972  1.00 93.07  ? 41  TYR B OH    1 
ATOM   2891 N N     . LEU D 4 5   ? 28.542 -11.685 31.262  1.00 89.12  ? 42  LEU B N     1 
ATOM   2892 C CA    . LEU D 4 5   ? 29.860 -11.281 30.805  1.00 88.48  ? 42  LEU B CA    1 
ATOM   2893 C C     . LEU D 4 5   ? 30.557 -10.444 31.866  1.00 88.03  ? 42  LEU B C     1 
ATOM   2894 O O     . LEU D 4 5   ? 29.921 -9.940  32.788  1.00 88.17  ? 42  LEU B O     1 
ATOM   2895 C CB    . LEU D 4 5   ? 29.739 -10.467 29.516  1.00 88.44  ? 42  LEU B CB    1 
ATOM   2896 C CG    . LEU D 4 5   ? 31.053 -10.082 28.831  1.00 88.14  ? 42  LEU B CG    1 
ATOM   2897 C CD1   . LEU D 4 5   ? 31.821 -11.348 28.473  1.00 88.14  ? 42  LEU B CD1   1 
ATOM   2898 C CD2   . LEU D 4 5   ? 30.767 -9.255  27.589  1.00 87.66  ? 42  LEU B CD2   1 
ATOM   2899 N N     . GLN D 4 6   ? 31.869 -10.299 31.728  1.00 87.44  ? 43  GLN B N     1 
ATOM   2900 C CA    . GLN D 4 6   ? 32.651 -9.504  32.662  1.00 86.84  ? 43  GLN B CA    1 
ATOM   2901 C C     . GLN D 4 6   ? 33.987 -9.116  32.041  1.00 86.46  ? 43  GLN B C     1 
ATOM   2902 O O     . GLN D 4 6   ? 34.540 -9.858  31.227  1.00 86.50  ? 43  GLN B O     1 
ATOM   2903 C CB    . GLN D 4 6   ? 32.892 -10.277 33.954  1.00 86.93  ? 43  GLN B CB    1 
ATOM   2904 C CG    . GLN D 4 6   ? 33.764 -9.525  34.941  1.00 87.37  ? 43  GLN B CG    1 
ATOM   2905 C CD    . GLN D 4 6   ? 34.038 -10.318 36.195  1.00 87.82  ? 43  GLN B CD    1 
ATOM   2906 O OE1   . GLN D 4 6   ? 33.132 -10.585 36.986  1.00 87.93  ? 43  GLN B OE1   1 
ATOM   2907 N NE2   . GLN D 4 6   ? 35.295 -10.705 36.384  1.00 87.96  ? 43  GLN B NE2   1 
ATOM   2908 N N     . ILE D 4 7   ? 34.500 -7.952  32.436  1.00 85.72  ? 44  ILE B N     1 
ATOM   2909 C CA    . ILE D 4 7   ? 35.769 -7.446  31.918  1.00 84.68  ? 44  ILE B CA    1 
ATOM   2910 C C     . ILE D 4 7   ? 36.921 -7.697  32.889  1.00 84.01  ? 44  ILE B C     1 
ATOM   2911 O O     . ILE D 4 7   ? 36.785 -7.485  34.090  1.00 83.75  ? 44  ILE B O     1 
ATOM   2912 C CB    . ILE D 4 7   ? 35.661 -5.935  31.607  1.00 84.35  ? 44  ILE B CB    1 
ATOM   2913 C CG1   . ILE D 4 7   ? 37.005 -5.410  31.108  1.00 83.99  ? 44  ILE B CG1   1 
ATOM   2914 C CG2   . ILE D 4 7   ? 35.175 -5.186  32.833  1.00 84.02  ? 44  ILE B CG2   1 
ATOM   2915 C CD1   . ILE D 4 7   ? 36.927 -4.043  30.487  1.00 83.88  ? 44  ILE B CD1   1 
ATOM   2916 N N     . LEU D 4 8   ? 38.055 -8.144  32.357  1.00 83.57  ? 45  LEU B N     1 
ATOM   2917 C CA    . LEU D 4 8   ? 39.222 -8.452  33.181  1.00 83.35  ? 45  LEU B CA    1 
ATOM   2918 C C     . LEU D 4 8   ? 40.336 -7.403  33.176  1.00 82.97  ? 45  LEU B C     1 
ATOM   2919 O O     . LEU D 4 8   ? 41.193 -7.417  34.065  1.00 82.95  ? 45  LEU B O     1 
ATOM   2920 C CB    . LEU D 4 8   ? 39.807 -9.805  32.768  1.00 83.63  ? 45  LEU B CB    1 
ATOM   2921 C CG    . LEU D 4 8   ? 38.835 -10.990 32.748  1.00 83.85  ? 45  LEU B CG    1 
ATOM   2922 C CD1   . LEU D 4 8   ? 39.589 -12.251 32.341  1.00 83.75  ? 45  LEU B CD1   1 
ATOM   2923 C CD2   . LEU D 4 8   ? 38.187 -11.167 34.119  1.00 83.71  ? 45  LEU B CD2   1 
ATOM   2924 N N     . GLU D 4 9   ? 40.341 -6.516  32.177  1.00 82.17  ? 46  GLU B N     1 
ATOM   2925 C CA    . GLU D 4 9   ? 41.351 -5.454  32.093  1.00 80.98  ? 46  GLU B CA    1 
ATOM   2926 C C     . GLU D 4 9   ? 40.903 -4.223  31.303  1.00 80.47  ? 46  GLU B C     1 
ATOM   2927 O O     . GLU D 4 9   ? 41.204 -4.090  30.116  1.00 80.49  ? 46  GLU B O     1 
ATOM   2928 C CB    . GLU D 4 9   ? 42.655 -5.980  31.495  1.00 80.24  ? 46  GLU B CB    1 
ATOM   2929 C CG    . GLU D 4 9   ? 43.700 -4.890  31.316  1.00 79.64  ? 46  GLU B CG    1 
ATOM   2930 C CD    . GLU D 4 9   ? 45.073 -5.440  31.017  1.00 79.51  ? 46  GLU B CD    1 
ATOM   2931 O OE1   . GLU D 4 9   ? 45.656 -6.088  31.909  1.00 79.62  ? 46  GLU B OE1   1 
ATOM   2932 O OE2   . GLU D 4 9   ? 45.573 -5.227  29.894  1.00 79.23  ? 46  GLU B OE2   1 
ATOM   2933 N N     . GLN D 4 10  ? 40.197 -3.322  31.984  1.00 79.74  ? 47  GLN B N     1 
ATOM   2934 C CA    . GLN D 4 10  ? 39.690 -2.087  31.391  1.00 78.57  ? 47  GLN B CA    1 
ATOM   2935 C C     . GLN D 4 10  ? 40.695 -1.399  30.466  1.00 78.40  ? 47  GLN B C     1 
ATOM   2936 O O     . GLN D 4 10  ? 41.908 -1.506  30.651  1.00 78.24  ? 47  GLN B O     1 
ATOM   2937 C CB    . GLN D 4 10  ? 39.268 -1.127  32.504  1.00 77.81  ? 47  GLN B CB    1 
ATOM   2938 C CG    . GLN D 4 10  ? 37.988 -1.539  33.200  1.00 76.87  ? 47  GLN B CG    1 
ATOM   2939 C CD    . GLN D 4 10  ? 36.761 -1.031  32.476  1.00 77.05  ? 47  GLN B CD    1 
ATOM   2940 O OE1   . GLN D 4 10  ? 36.786 -0.837  31.261  1.00 77.07  ? 47  GLN B OE1   1 
ATOM   2941 N NE2   . GLN D 4 10  ? 35.674 -0.818  33.214  1.00 76.37  ? 47  GLN B NE2   1 
ATOM   2942 N N     . PRO D 4 11  ? 40.191 -0.687  29.447  1.00 77.98  ? 48  PRO B N     1 
ATOM   2943 C CA    . PRO D 4 11  ? 41.007 0.035   28.468  1.00 77.76  ? 48  PRO B CA    1 
ATOM   2944 C C     . PRO D 4 11  ? 41.691 1.219   29.134  1.00 77.77  ? 48  PRO B C     1 
ATOM   2945 O O     . PRO D 4 11  ? 41.045 1.964   29.873  1.00 78.21  ? 48  PRO B O     1 
ATOM   2946 C CB    . PRO D 4 11  ? 39.979 0.505   27.442  1.00 77.67  ? 48  PRO B CB    1 
ATOM   2947 C CG    . PRO D 4 11  ? 38.830 -0.433  27.625  1.00 77.84  ? 48  PRO B CG    1 
ATOM   2948 C CD    . PRO D 4 11  ? 38.766 -0.584  29.105  1.00 77.79  ? 48  PRO B CD    1 
ATOM   2949 N N     . LYS D 4 12  ? 42.984 1.404   28.881  1.00 77.29  ? 49  LYS B N     1 
ATOM   2950 C CA    . LYS D 4 12  ? 43.698 2.533   29.478  1.00 76.56  ? 49  LYS B CA    1 
ATOM   2951 C C     . LYS D 4 12  ? 42.996 3.816   29.031  1.00 75.89  ? 49  LYS B C     1 
ATOM   2952 O O     . LYS D 4 12  ? 42.926 4.104   27.834  1.00 75.87  ? 49  LYS B O     1 
ATOM   2953 C CB    . LYS D 4 12  ? 45.157 2.548   29.020  1.00 76.85  ? 49  LYS B CB    1 
ATOM   2954 C CG    . LYS D 4 12  ? 46.040 3.516   29.796  1.00 77.13  ? 49  LYS B CG    1 
ATOM   2955 C CD    . LYS D 4 12  ? 47.460 3.553   29.237  1.00 77.97  ? 49  LYS B CD    1 
ATOM   2956 C CE    . LYS D 4 12  ? 48.150 2.190   29.307  1.00 78.36  ? 49  LYS B CE    1 
ATOM   2957 N NZ    . LYS D 4 12  ? 49.540 2.228   28.751  1.00 78.17  ? 49  LYS B NZ    1 
ATOM   2958 N N     . GLN D 4 13  ? 42.478 4.576   29.995  1.00 74.71  ? 50  GLN B N     1 
ATOM   2959 C CA    . GLN D 4 13  ? 41.751 5.818   29.719  1.00 73.60  ? 50  GLN B CA    1 
ATOM   2960 C C     . GLN D 4 13  ? 42.525 6.959   29.050  1.00 73.16  ? 50  GLN B C     1 
ATOM   2961 O O     . GLN D 4 13  ? 41.923 7.781   28.354  1.00 72.67  ? 50  GLN B O     1 
ATOM   2962 C CB    . GLN D 4 13  ? 41.123 6.355   31.009  1.00 73.04  ? 50  GLN B CB    1 
ATOM   2963 C CG    . GLN D 4 13  ? 39.906 5.586   31.502  1.00 72.36  ? 50  GLN B CG    1 
ATOM   2964 C CD    . GLN D 4 13  ? 39.277 6.213   32.744  1.00 71.96  ? 50  GLN B CD    1 
ATOM   2965 O OE1   . GLN D 4 13  ? 39.798 6.082   33.854  1.00 71.46  ? 50  GLN B OE1   1 
ATOM   2966 N NE2   . GLN D 4 13  ? 38.156 6.908   32.557  1.00 71.43  ? 50  GLN B NE2   1 
ATOM   2967 N N     . ARG D 4 14  ? 43.843 7.016   29.249  1.00 72.67  ? 51  ARG B N     1 
ATOM   2968 C CA    . ARG D 4 14  ? 44.644 8.100   28.671  1.00 72.19  ? 51  ARG B CA    1 
ATOM   2969 C C     . ARG D 4 14  ? 46.010 7.703   28.103  1.00 72.15  ? 51  ARG B C     1 
ATOM   2970 O O     . ARG D 4 14  ? 46.612 6.712   28.516  1.00 71.83  ? 51  ARG B O     1 
ATOM   2971 C CB    . ARG D 4 14  ? 44.830 9.203   29.720  1.00 71.26  ? 51  ARG B CB    1 
ATOM   2972 C CG    . ARG D 4 14  ? 43.526 9.730   30.277  1.00 70.00  ? 51  ARG B CG    1 
ATOM   2973 C CD    . ARG D 4 14  ? 43.737 10.480  31.565  1.00 69.56  ? 51  ARG B CD    1 
ATOM   2974 N NE    . ARG D 4 14  ? 42.472 10.885  32.173  1.00 69.70  ? 51  ARG B NE    1 
ATOM   2975 C CZ    . ARG D 4 14  ? 41.611 11.733  31.617  1.00 69.81  ? 51  ARG B CZ    1 
ATOM   2976 N NH1   . ARG D 4 14  ? 41.878 12.269  30.433  1.00 69.42  ? 51  ARG B NH1   1 
ATOM   2977 N NH2   . ARG D 4 14  ? 40.486 12.054  32.245  1.00 69.44  ? 51  ARG B NH2   1 
ATOM   2978 N N     . GLY D 4 15  ? 46.489 8.502   27.150  1.00 72.24  ? 52  GLY B N     1 
ATOM   2979 C CA    . GLY D 4 15  ? 47.774 8.246   26.528  1.00 72.49  ? 52  GLY B CA    1 
ATOM   2980 C C     . GLY D 4 15  ? 47.665 7.634   25.142  1.00 72.68  ? 52  GLY B C     1 
ATOM   2981 O O     . GLY D 4 15  ? 48.634 7.059   24.631  1.00 72.79  ? 52  GLY B O     1 
ATOM   2982 N N     . PHE D 4 16  ? 46.489 7.750   24.530  1.00 72.46  ? 53  PHE B N     1 
ATOM   2983 C CA    . PHE D 4 16  ? 46.266 7.195   23.195  1.00 71.96  ? 53  PHE B CA    1 
ATOM   2984 C C     . PHE D 4 16  ? 45.595 8.223   22.305  1.00 71.07  ? 53  PHE B C     1 
ATOM   2985 O O     . PHE D 4 16  ? 44.641 8.869   22.722  1.00 71.03  ? 53  PHE B O     1 
ATOM   2986 C CB    . PHE D 4 16  ? 45.377 5.958   23.274  1.00 72.58  ? 53  PHE B CB    1 
ATOM   2987 C CG    . PHE D 4 16  ? 45.337 5.162   22.002  1.00 73.13  ? 53  PHE B CG    1 
ATOM   2988 C CD1   . PHE D 4 16  ? 46.450 4.435   21.590  1.00 73.59  ? 53  PHE B CD1   1 
ATOM   2989 C CD2   . PHE D 4 16  ? 44.189 5.131   21.218  1.00 73.48  ? 53  PHE B CD2   1 
ATOM   2990 C CE1   . PHE D 4 16  ? 46.422 3.688   20.417  1.00 73.72  ? 53  PHE B CE1   1 
ATOM   2991 C CE2   . PHE D 4 16  ? 44.149 4.386   20.039  1.00 73.81  ? 53  PHE B CE2   1 
ATOM   2992 C CZ    . PHE D 4 16  ? 45.268 3.662   19.639  1.00 73.75  ? 53  PHE B CZ    1 
ATOM   2993 N N     . ARG D 4 17  ? 46.083 8.367   21.079  1.00 70.00  ? 54  ARG B N     1 
ATOM   2994 C CA    . ARG D 4 17  ? 45.507 9.336   20.161  1.00 68.92  ? 54  ARG B CA    1 
ATOM   2995 C C     . ARG D 4 17  ? 44.636 8.687   19.098  1.00 68.16  ? 54  ARG B C     1 
ATOM   2996 O O     . ARG D 4 17  ? 45.044 7.718   18.461  1.00 68.02  ? 54  ARG B O     1 
ATOM   2997 C CB    . ARG D 4 17  ? 46.612 10.141  19.489  1.00 69.31  ? 54  ARG B CB    1 
ATOM   2998 C CG    . ARG D 4 17  ? 46.107 11.361  18.736  1.00 70.36  ? 54  ARG B CG    1 
ATOM   2999 C CD    . ARG D 4 17  ? 47.251 12.323  18.421  1.00 71.32  ? 54  ARG B CD    1 
ATOM   3000 N NE    . ARG D 4 17  ? 47.784 12.170  17.070  1.00 72.06  ? 54  ARG B NE    1 
ATOM   3001 C CZ    . ARG D 4 17  ? 48.946 12.677  16.668  1.00 72.58  ? 54  ARG B CZ    1 
ATOM   3002 N NH1   . ARG D 4 17  ? 49.700 13.365  17.518  1.00 72.72  ? 54  ARG B NH1   1 
ATOM   3003 N NH2   . ARG D 4 17  ? 49.348 12.513  15.415  1.00 72.93  ? 54  ARG B NH2   1 
ATOM   3004 N N     . PHE D 4 18  ? 43.432 9.227   18.916  1.00 67.19  ? 55  PHE B N     1 
ATOM   3005 C CA    . PHE D 4 18  ? 42.495 8.712   17.918  1.00 65.87  ? 55  PHE B CA    1 
ATOM   3006 C C     . PHE D 4 18  ? 42.990 9.142   16.539  1.00 65.41  ? 55  PHE B C     1 
ATOM   3007 O O     . PHE D 4 18  ? 42.984 10.329  16.210  1.00 65.56  ? 55  PHE B O     1 
ATOM   3008 C CB    . PHE D 4 18  ? 41.081 9.273   18.138  1.00 64.75  ? 55  PHE B CB    1 
ATOM   3009 C CG    . PHE D 4 18  ? 40.518 9.021   19.508  1.00 63.34  ? 55  PHE B CG    1 
ATOM   3010 C CD1   . PHE D 4 18  ? 41.105 8.101   20.371  1.00 63.26  ? 55  PHE B CD1   1 
ATOM   3011 C CD2   . PHE D 4 18  ? 39.386 9.707   19.932  1.00 62.81  ? 55  PHE B CD2   1 
ATOM   3012 C CE1   . PHE D 4 18  ? 40.572 7.876   21.641  1.00 63.28  ? 55  PHE B CE1   1 
ATOM   3013 C CE2   . PHE D 4 18  ? 38.847 9.489   21.194  1.00 62.69  ? 55  PHE B CE2   1 
ATOM   3014 C CZ    . PHE D 4 18  ? 39.439 8.572   22.051  1.00 62.88  ? 55  PHE B CZ    1 
ATOM   3015 N N     . ARG D 4 19  ? 43.415 8.173   15.738  1.00 64.52  ? 56  ARG B N     1 
ATOM   3016 C CA    . ARG D 4 19  ? 43.930 8.457   14.408  1.00 63.81  ? 56  ARG B CA    1 
ATOM   3017 C C     . ARG D 4 19  ? 42.853 8.708   13.365  1.00 63.24  ? 56  ARG B C     1 
ATOM   3018 O O     . ARG D 4 19  ? 41.888 7.955   13.262  1.00 63.20  ? 56  ARG B O     1 
ATOM   3019 C CB    . ARG D 4 19  ? 44.826 7.306   13.942  1.00 63.80  ? 56  ARG B CB    1 
ATOM   3020 C CG    . ARG D 4 19  ? 46.301 7.476   14.266  1.00 63.75  ? 56  ARG B CG    1 
ATOM   3021 C CD    . ARG D 4 19  ? 46.553 7.706   15.742  1.00 63.72  ? 56  ARG B CD    1 
ATOM   3022 N NE    . ARG D 4 19  ? 47.971 7.928   16.012  1.00 64.46  ? 56  ARG B NE    1 
ATOM   3023 C CZ    . ARG D 4 19  ? 48.689 8.921   15.490  1.00 64.92  ? 56  ARG B CZ    1 
ATOM   3024 N NH1   . ARG D 4 19  ? 48.124 9.794   14.665  1.00 64.95  ? 56  ARG B NH1   1 
ATOM   3025 N NH2   . ARG D 4 19  ? 49.976 9.039   15.786  1.00 64.96  ? 56  ARG B NH2   1 
ATOM   3026 N N     . TYR D 4 20  ? 43.026 9.780   12.597  1.00 62.82  ? 57  TYR B N     1 
ATOM   3027 C CA    . TYR D 4 20  ? 42.098 10.124  11.522  1.00 62.01  ? 57  TYR B CA    1 
ATOM   3028 C C     . TYR D 4 20  ? 42.455 9.198   10.372  1.00 62.24  ? 57  TYR B C     1 
ATOM   3029 O O     . TYR D 4 20  ? 43.485 8.529   10.416  1.00 62.59  ? 57  TYR B O     1 
ATOM   3030 C CB    . TYR D 4 20  ? 42.307 11.568  11.057  1.00 60.27  ? 57  TYR B CB    1 
ATOM   3031 C CG    . TYR D 4 20  ? 41.676 12.640  11.916  1.00 58.49  ? 57  TYR B CG    1 
ATOM   3032 C CD1   . TYR D 4 20  ? 40.655 13.444  11.407  1.00 57.50  ? 57  TYR B CD1   1 
ATOM   3033 C CD2   . TYR D 4 20  ? 42.127 12.886  13.213  1.00 57.56  ? 57  TYR B CD2   1 
ATOM   3034 C CE1   . TYR D 4 20  ? 40.101 14.469  12.157  1.00 56.37  ? 57  TYR B CE1   1 
ATOM   3035 C CE2   . TYR D 4 20  ? 41.577 13.911  13.973  1.00 56.71  ? 57  TYR B CE2   1 
ATOM   3036 C CZ    . TYR D 4 20  ? 40.566 14.698  13.434  1.00 56.63  ? 57  TYR B CZ    1 
ATOM   3037 O OH    . TYR D 4 20  ? 40.031 15.728  14.160  1.00 55.76  ? 57  TYR B OH    1 
ATOM   3038 N N     . VAL D 4 21  ? 41.624 9.163   9.338   1.00 62.69  ? 58  VAL B N     1 
ATOM   3039 C CA    . VAL D 4 21  ? 41.920 8.310   8.197   1.00 63.16  ? 58  VAL B CA    1 
ATOM   3040 C C     . VAL D 4 21  ? 43.235 8.762   7.572   1.00 64.14  ? 58  VAL B C     1 
ATOM   3041 O O     . VAL D 4 21  ? 44.181 7.980   7.448   1.00 64.13  ? 58  VAL B O     1 
ATOM   3042 C CB    . VAL D 4 21  ? 40.820 8.391   7.134   1.00 62.63  ? 58  VAL B CB    1 
ATOM   3043 C CG1   . VAL D 4 21  ? 41.159 7.483   5.970   1.00 62.10  ? 58  VAL B CG1   1 
ATOM   3044 C CG2   . VAL D 4 21  ? 39.493 8.006   7.741   1.00 62.07  ? 58  VAL B CG2   1 
ATOM   3045 N N     . CYS D 4 22  ? 43.283 10.034  7.190   1.00 65.31  ? 59  CYS B N     1 
ATOM   3046 C CA    . CYS D 4 22  ? 44.470 10.625  6.581   1.00 66.94  ? 59  CYS B CA    1 
ATOM   3047 C C     . CYS D 4 22  ? 45.735 10.345  7.386   1.00 68.26  ? 59  CYS B C     1 
ATOM   3048 O O     . CYS D 4 22  ? 46.825 10.230  6.822   1.00 68.26  ? 59  CYS B O     1 
ATOM   3049 C CB    . CYS D 4 22  ? 44.287 12.133  6.443   1.00 66.52  ? 59  CYS B CB    1 
ATOM   3050 S SG    . CYS D 4 22  ? 43.978 12.952  8.007   1.00 67.49  ? 59  CYS B SG    1 
ATOM   3051 N N     . GLU D 4 23  ? 45.590 10.247  8.703   1.00 70.00  ? 60  GLU B N     1 
ATOM   3052 C CA    . GLU D 4 23  ? 46.725 9.969   9.571   1.00 72.00  ? 60  GLU B CA    1 
ATOM   3053 C C     . GLU D 4 23  ? 47.542 8.801   9.008   1.00 73.70  ? 60  GLU B C     1 
ATOM   3054 O O     . GLU D 4 23  ? 48.774 8.860   8.968   1.00 73.75  ? 60  GLU B O     1 
ATOM   3055 C CB    . GLU D 4 23  ? 46.242 9.647   10.993  1.00 71.83  ? 60  GLU B CB    1 
ATOM   3056 C CG    . GLU D 4 23  ? 45.605 10.826  11.748  1.00 70.95  ? 60  GLU B CG    1 
ATOM   3057 C CD    . GLU D 4 23  ? 46.579 11.966  12.034  1.00 70.13  ? 60  GLU B CD    1 
ATOM   3058 O OE1   . GLU D 4 23  ? 47.040 12.632  11.085  1.00 68.94  ? 60  GLU B OE1   1 
ATOM   3059 O OE2   . GLU D 4 23  ? 46.882 12.200  13.219  1.00 70.02  ? 60  GLU B OE2   1 
ATOM   3060 N N     . GLY D 4 24  ? 46.852 7.750   8.566   1.00 75.55  ? 61  GLY B N     1 
ATOM   3061 C CA    . GLY D 4 24  ? 47.536 6.596   7.998   1.00 78.09  ? 61  GLY B CA    1 
ATOM   3062 C C     . GLY D 4 24  ? 47.511 5.361   8.884   1.00 79.89  ? 61  GLY B C     1 
ATOM   3063 O O     . GLY D 4 24  ? 47.056 5.442   10.024  1.00 80.58  ? 61  GLY B O     1 
ATOM   3064 N N     . PRO D 4 25  ? 47.984 4.199   8.391   1.00 81.01  ? 62  PRO B N     1 
ATOM   3065 C CA    . PRO D 4 25  ? 48.004 2.951   9.166   1.00 81.76  ? 62  PRO B CA    1 
ATOM   3066 C C     . PRO D 4 25  ? 49.137 2.899   10.187  1.00 82.59  ? 62  PRO B C     1 
ATOM   3067 O O     . PRO D 4 25  ? 50.021 3.757   10.200  1.00 82.77  ? 62  PRO B O     1 
ATOM   3068 C CB    . PRO D 4 25  ? 48.184 1.871   8.096   1.00 81.48  ? 62  PRO B CB    1 
ATOM   3069 C CG    . PRO D 4 25  ? 47.715 2.530   6.834   1.00 81.57  ? 62  PRO B CG    1 
ATOM   3070 C CD    . PRO D 4 25  ? 48.262 3.920   6.974   1.00 81.41  ? 62  PRO B CD    1 
ATOM   3071 N N     . SER D 4 26  ? 49.098 1.869   11.027  1.00 83.54  ? 63  SER B N     1 
ATOM   3072 C CA    . SER D 4 26  ? 50.099 1.626   12.067  1.00 84.27  ? 63  SER B CA    1 
ATOM   3073 C C     . SER D 4 26  ? 50.609 2.863   12.805  1.00 84.48  ? 63  SER B C     1 
ATOM   3074 O O     . SER D 4 26  ? 51.574 3.504   12.384  1.00 84.84  ? 63  SER B O     1 
ATOM   3075 C CB    . SER D 4 26  ? 51.288 0.848   11.478  1.00 84.89  ? 63  SER B CB    1 
ATOM   3076 O OG    . SER D 4 26  ? 51.961 1.580   10.462  1.00 85.58  ? 63  SER B OG    1 
ATOM   3077 N N     . HIS D 4 27  ? 49.953 3.183   13.916  1.00 84.64  ? 64  HIS B N     1 
ATOM   3078 C CA    . HIS D 4 27  ? 50.323 4.325   14.749  1.00 84.55  ? 64  HIS B CA    1 
ATOM   3079 C C     . HIS D 4 27  ? 50.404 3.868   16.193  1.00 84.65  ? 64  HIS B C     1 
ATOM   3080 O O     . HIS D 4 27  ? 51.131 4.442   17.004  1.00 84.64  ? 64  HIS B O     1 
ATOM   3081 C CB    . HIS D 4 27  ? 49.284 5.445   14.631  1.00 83.89  ? 64  HIS B CB    1 
ATOM   3082 C CG    . HIS D 4 27  ? 49.616 6.467   13.593  1.00 82.96  ? 64  HIS B CG    1 
ATOM   3083 N ND1   . HIS D 4 27  ? 50.714 7.294   13.690  1.00 82.66  ? 64  HIS B ND1   1 
ATOM   3084 C CD2   . HIS D 4 27  ? 49.004 6.790   12.430  1.00 82.86  ? 64  HIS B CD2   1 
ATOM   3085 C CE1   . HIS D 4 27  ? 50.764 8.082   12.632  1.00 82.73  ? 64  HIS B CE1   1 
ATOM   3086 N NE2   . HIS D 4 27  ? 49.738 7.796   11.851  1.00 82.70  ? 64  HIS B NE2   1 
ATOM   3087 N N     . GLY D 4 28  ? 49.641 2.825   16.500  1.00 84.76  ? 65  GLY B N     1 
ATOM   3088 C CA    . GLY D 4 28  ? 49.617 2.285   17.842  1.00 84.71  ? 65  GLY B CA    1 
ATOM   3089 C C     . GLY D 4 28  ? 48.509 1.263   17.986  1.00 84.79  ? 65  GLY B C     1 
ATOM   3090 O O     . GLY D 4 28  ? 48.339 0.387   17.132  1.00 84.91  ? 65  GLY B O     1 
ATOM   3091 N N     . GLY D 4 29  ? 47.751 1.384   19.072  1.00 84.85  ? 66  GLY B N     1 
ATOM   3092 C CA    . GLY D 4 29  ? 46.656 0.468   19.335  1.00 84.63  ? 66  GLY B CA    1 
ATOM   3093 C C     . GLY D 4 29  ? 46.285 0.485   20.804  1.00 84.42  ? 66  GLY B C     1 
ATOM   3094 O O     . GLY D 4 29  ? 47.086 0.098   21.653  1.00 84.41  ? 66  GLY B O     1 
ATOM   3095 N N     . LEU D 4 30  ? 45.073 0.941   21.101  1.00 84.30  ? 67  LEU B N     1 
ATOM   3096 C CA    . LEU D 4 30  ? 44.581 1.018   22.473  1.00 84.34  ? 67  LEU B CA    1 
ATOM   3097 C C     . LEU D 4 30  ? 45.295 0.033   23.392  1.00 84.58  ? 67  LEU B C     1 
ATOM   3098 O O     . LEU D 4 30  ? 45.181 -1.175  23.218  1.00 84.40  ? 67  LEU B O     1 
ATOM   3099 C CB    . LEU D 4 30  ? 43.078 0.748   22.498  1.00 83.90  ? 67  LEU B CB    1 
ATOM   3100 C CG    . LEU D 4 30  ? 42.366 0.890   23.842  1.00 83.59  ? 67  LEU B CG    1 
ATOM   3101 C CD1   . LEU D 4 30  ? 42.569 2.289   24.415  1.00 83.55  ? 67  LEU B CD1   1 
ATOM   3102 C CD2   . LEU D 4 30  ? 40.895 0.606   23.637  1.00 83.57  ? 67  LEU B CD2   1 
ATOM   3103 N N     . PRO D 4 31  ? 46.056 0.546   24.375  1.00 84.96  ? 68  PRO B N     1 
ATOM   3104 C CA    . PRO D 4 31  ? 46.813 -0.253  25.349  1.00 85.28  ? 68  PRO B CA    1 
ATOM   3105 C C     . PRO D 4 31  ? 45.981 -0.779  26.519  1.00 85.58  ? 68  PRO B C     1 
ATOM   3106 O O     . PRO D 4 31  ? 44.917 -0.242  26.842  1.00 85.59  ? 68  PRO B O     1 
ATOM   3107 C CB    . PRO D 4 31  ? 47.889 0.719   25.842  1.00 85.31  ? 68  PRO B CB    1 
ATOM   3108 C CG    . PRO D 4 31  ? 47.937 1.791   24.782  1.00 85.27  ? 68  PRO B CG    1 
ATOM   3109 C CD    . PRO D 4 31  ? 46.495 1.948   24.420  1.00 85.00  ? 68  PRO B CD    1 
ATOM   3110 N N     . GLY D 4 32  ? 46.478 -1.832  27.156  1.00 85.82  ? 69  GLY B N     1 
ATOM   3111 C CA    . GLY D 4 32  ? 45.781 -2.380  28.299  1.00 86.13  ? 69  GLY B CA    1 
ATOM   3112 C C     . GLY D 4 32  ? 46.079 -1.476  29.477  1.00 86.46  ? 69  GLY B C     1 
ATOM   3113 O O     . GLY D 4 32  ? 47.226 -1.061  29.659  1.00 86.44  ? 69  GLY B O     1 
ATOM   3114 N N     . ALA D 4 33  ? 45.054 -1.161  30.265  1.00 86.80  ? 70  ALA B N     1 
ATOM   3115 C CA    . ALA D 4 33  ? 45.201 -0.292  31.433  1.00 87.25  ? 70  ALA B CA    1 
ATOM   3116 C C     . ALA D 4 33  ? 46.468 -0.587  32.237  1.00 87.64  ? 70  ALA B C     1 
ATOM   3117 O O     . ALA D 4 33  ? 47.232 0.325   32.573  1.00 87.50  ? 70  ALA B O     1 
ATOM   3118 C CB    . ALA D 4 33  ? 43.976 -0.420  32.332  1.00 87.03  ? 70  ALA B CB    1 
ATOM   3119 N N     . SER D 4 34  ? 46.691 -1.862  32.544  1.00 87.97  ? 71  SER B N     1 
ATOM   3120 C CA    . SER D 4 34  ? 47.866 -2.256  33.306  1.00 88.39  ? 71  SER B CA    1 
ATOM   3121 C C     . SER D 4 34  ? 49.034 -2.644  32.402  1.00 89.01  ? 71  SER B C     1 
ATOM   3122 O O     . SER D 4 34  ? 49.444 -3.806  32.368  1.00 89.20  ? 71  SER B O     1 
ATOM   3123 C CB    . SER D 4 34  ? 47.532 -3.418  34.251  1.00 87.99  ? 71  SER B CB    1 
ATOM   3124 O OG    . SER D 4 34  ? 47.320 -4.628  33.547  1.00 87.71  ? 71  SER B OG    1 
ATOM   3125 N N     . SER D 4 35  ? 49.557 -1.668  31.664  1.00 89.70  ? 72  SER B N     1 
ATOM   3126 C CA    . SER D 4 35  ? 50.698 -1.901  30.783  1.00 90.69  ? 72  SER B CA    1 
ATOM   3127 C C     . SER D 4 35  ? 51.881 -1.174  31.415  1.00 91.66  ? 72  SER B C     1 
ATOM   3128 O O     . SER D 4 35  ? 52.688 -0.546  30.729  1.00 91.67  ? 72  SER B O     1 
ATOM   3129 C CB    . SER D 4 35  ? 50.423 -1.356  29.376  1.00 90.24  ? 72  SER B CB    1 
ATOM   3130 O OG    . SER D 4 35  ? 51.385 -1.833  28.446  1.00 89.26  ? 72  SER B OG    1 
ATOM   3131 N N     . GLU D 4 36  ? 51.956 -1.276  32.741  1.00 93.00  ? 73  GLU B N     1 
ATOM   3132 C CA    . GLU D 4 36  ? 52.998 -0.653  33.557  1.00 94.28  ? 73  GLU B CA    1 
ATOM   3133 C C     . GLU D 4 36  ? 54.375 -0.539  32.909  1.00 94.76  ? 73  GLU B C     1 
ATOM   3134 O O     . GLU D 4 36  ? 55.089 0.437   33.135  1.00 94.78  ? 73  GLU B O     1 
ATOM   3135 C CB    . GLU D 4 36  ? 53.121 -1.403  34.887  1.00 94.93  ? 73  GLU B CB    1 
ATOM   3136 C CG    . GLU D 4 36  ? 51.971 -1.151  35.850  1.00 96.08  ? 73  GLU B CG    1 
ATOM   3137 C CD    . GLU D 4 36  ? 52.009 0.248   36.453  1.00 96.83  ? 73  GLU B CD    1 
ATOM   3138 O OE1   . GLU D 4 36  ? 52.104 1.232   35.687  1.00 97.28  ? 73  GLU B OE1   1 
ATOM   3139 O OE2   . GLU D 4 36  ? 51.940 0.365   37.696  1.00 97.16  ? 73  GLU B OE2   1 
ATOM   3140 N N     . LYS D 4 37  ? 54.748 -1.538  32.118  1.00 95.32  ? 74  LYS B N     1 
ATOM   3141 C CA    . LYS D 4 37  ? 56.042 -1.544  31.439  1.00 95.87  ? 74  LYS B CA    1 
ATOM   3142 C C     . LYS D 4 37  ? 55.840 -1.963  29.999  1.00 95.99  ? 74  LYS B C     1 
ATOM   3143 O O     . LYS D 4 37  ? 54.760 -1.799  29.430  1.00 95.80  ? 74  LYS B O     1 
ATOM   3144 C CB    . LYS D 4 37  ? 56.996 -2.549  32.103  1.00 96.38  ? 74  LYS B CB    1 
ATOM   3145 C CG    . LYS D 4 37  ? 57.593 -2.125  33.435  1.00 96.65  ? 74  LYS B CG    1 
ATOM   3146 C CD    . LYS D 4 37  ? 58.881 -1.333  33.250  1.00 96.64  ? 74  LYS B CD    1 
ATOM   3147 C CE    . LYS D 4 37  ? 59.509 -1.005  34.595  1.00 96.61  ? 74  LYS B CE    1 
ATOM   3148 N NZ    . LYS D 4 37  ? 60.774 -0.246  34.449  1.00 96.71  ? 74  LYS B NZ    1 
ATOM   3149 N N     . ASN D 4 38  ? 56.899 -2.515  29.420  1.00 96.25  ? 75  ASN B N     1 
ATOM   3150 C CA    . ASN D 4 38  ? 56.849 -3.014  28.060  1.00 96.34  ? 75  ASN B CA    1 
ATOM   3151 C C     . ASN D 4 38  ? 56.162 -4.380  28.129  1.00 96.43  ? 75  ASN B C     1 
ATOM   3152 O O     . ASN D 4 38  ? 56.513 -5.311  27.400  1.00 96.54  ? 75  ASN B O     1 
ATOM   3153 C CB    . ASN D 4 38  ? 58.266 -3.150  27.485  1.00 96.06  ? 75  ASN B CB    1 
ATOM   3154 C CG    . ASN D 4 38  ? 59.216 -3.867  28.427  1.00 95.86  ? 75  ASN B CG    1 
ATOM   3155 O OD1   . ASN D 4 38  ? 59.589 -3.336  29.476  1.00 95.72  ? 75  ASN B OD1   1 
ATOM   3156 N ND2   . ASN D 4 38  ? 59.609 -5.081  28.059  1.00 95.46  ? 75  ASN B ND2   1 
ATOM   3157 N N     . LYS D 4 39  ? 55.186 -4.489  29.029  1.00 96.26  ? 76  LYS B N     1 
ATOM   3158 C CA    . LYS D 4 39  ? 54.433 -5.723  29.207  1.00 95.87  ? 76  LYS B CA    1 
ATOM   3159 C C     . LYS D 4 39  ? 53.263 -5.752  28.237  1.00 95.65  ? 76  LYS B C     1 
ATOM   3160 O O     . LYS D 4 39  ? 52.310 -6.515  28.418  1.00 95.55  ? 76  LYS B O     1 
ATOM   3161 C CB    . LYS D 4 39  ? 53.917 -5.842  30.642  1.00 95.89  ? 76  LYS B CB    1 
ATOM   3162 C CG    . LYS D 4 39  ? 53.135 -4.639  31.135  1.00 95.82  ? 76  LYS B CG    1 
ATOM   3163 C CD    . LYS D 4 39  ? 52.426 -4.922  32.462  1.00 95.87  ? 76  LYS B CD    1 
ATOM   3164 C CE    . LYS D 4 39  ? 53.372 -5.435  33.548  1.00 95.39  ? 76  LYS B CE    1 
ATOM   3165 N NZ    . LYS D 4 39  ? 53.799 -6.845  33.314  1.00 94.59  ? 76  LYS B NZ    1 
ATOM   3166 N N     . LYS D 4 40  ? 53.349 -4.901  27.217  1.00 95.28  ? 77  LYS B N     1 
ATOM   3167 C CA    . LYS D 4 40  ? 52.336 -4.798  26.172  1.00 94.89  ? 77  LYS B CA    1 
ATOM   3168 C C     . LYS D 4 40  ? 50.990 -5.364  26.611  1.00 94.81  ? 77  LYS B C     1 
ATOM   3169 O O     . LYS D 4 40  ? 50.572 -6.433  26.166  1.00 94.66  ? 77  LYS B O     1 
ATOM   3170 C CB    . LYS D 4 40  ? 52.843 -5.520  24.921  1.00 94.34  ? 77  LYS B CB    1 
ATOM   3171 C CG    . LYS D 4 40  ? 54.183 -4.986  24.445  1.00 93.79  ? 77  LYS B CG    1 
ATOM   3172 C CD    . LYS D 4 40  ? 54.907 -5.970  23.553  1.00 93.53  ? 77  LYS B CD    1 
ATOM   3173 C CE    . LYS D 4 40  ? 56.318 -5.482  23.254  1.00 93.75  ? 77  LYS B CE    1 
ATOM   3174 N NZ    . LYS D 4 40  ? 57.161 -6.512  22.586  1.00 93.13  ? 77  LYS B NZ    1 
ATOM   3175 N N     . SER D 4 41  ? 50.320 -4.631  27.494  1.00 94.85  ? 78  SER B N     1 
ATOM   3176 C CA    . SER D 4 41  ? 49.028 -5.045  28.017  1.00 94.80  ? 78  SER B CA    1 
ATOM   3177 C C     . SER D 4 41  ? 47.966 -5.050  26.922  1.00 94.80  ? 78  SER B C     1 
ATOM   3178 O O     . SER D 4 41  ? 48.282 -4.916  25.738  1.00 94.52  ? 78  SER B O     1 
ATOM   3179 C CB    . SER D 4 41  ? 48.607 -4.113  29.154  1.00 94.91  ? 78  SER B CB    1 
ATOM   3180 O OG    . SER D 4 41  ? 47.809 -4.795  30.102  1.00 94.58  ? 78  SER B OG    1 
ATOM   3181 N N     . TYR D 4 42  ? 46.707 -5.197  27.324  1.00 95.11  ? 79  TYR B N     1 
ATOM   3182 C CA    . TYR D 4 42  ? 45.602 -5.246  26.370  1.00 95.68  ? 79  TYR B CA    1 
ATOM   3183 C C     . TYR D 4 42  ? 44.268 -5.545  27.068  1.00 95.39  ? 79  TYR B C     1 
ATOM   3184 O O     . TYR D 4 42  ? 44.238 -6.240  28.082  1.00 95.54  ? 79  TYR B O     1 
ATOM   3185 C CB    . TYR D 4 42  ? 45.898 -6.324  25.320  1.00 96.53  ? 79  TYR B CB    1 
ATOM   3186 C CG    . TYR D 4 42  ? 46.374 -7.641  25.915  1.00 97.58  ? 79  TYR B CG    1 
ATOM   3187 C CD1   . TYR D 4 42  ? 45.550 -8.389  26.765  1.00 98.11  ? 79  TYR B CD1   1 
ATOM   3188 C CD2   . TYR D 4 42  ? 47.644 -8.146  25.622  1.00 97.64  ? 79  TYR B CD2   1 
ATOM   3189 C CE1   . TYR D 4 42  ? 45.976 -9.607  27.308  1.00 98.18  ? 79  TYR B CE1   1 
ATOM   3190 C CE2   . TYR D 4 42  ? 48.080 -9.367  26.162  1.00 97.91  ? 79  TYR B CE2   1 
ATOM   3191 C CZ    . TYR D 4 42  ? 47.238 -10.089 26.999  1.00 97.94  ? 79  TYR B CZ    1 
ATOM   3192 O OH    . TYR D 4 42  ? 47.641 -11.299 27.508  1.00 97.61  ? 79  TYR B OH    1 
ATOM   3193 N N     . PRO D 4 43  ? 43.146 -5.017  26.539  1.00 95.07  ? 80  PRO B N     1 
ATOM   3194 C CA    . PRO D 4 43  ? 41.849 -5.284  27.176  1.00 94.54  ? 80  PRO B CA    1 
ATOM   3195 C C     . PRO D 4 43  ? 41.477 -6.760  27.045  1.00 94.07  ? 80  PRO B C     1 
ATOM   3196 O O     . PRO D 4 43  ? 41.875 -7.428  26.088  1.00 94.14  ? 80  PRO B O     1 
ATOM   3197 C CB    . PRO D 4 43  ? 40.884 -4.378  26.406  1.00 94.57  ? 80  PRO B CB    1 
ATOM   3198 C CG    . PRO D 4 43  ? 41.758 -3.257  25.940  1.00 94.87  ? 80  PRO B CG    1 
ATOM   3199 C CD    . PRO D 4 43  ? 43.004 -3.992  25.490  1.00 95.02  ? 80  PRO B CD    1 
ATOM   3200 N N     . GLN D 4 44  ? 40.718 -7.271  28.006  1.00 93.34  ? 81  GLN B N     1 
ATOM   3201 C CA    . GLN D 4 44  ? 40.316 -8.666  27.957  1.00 92.68  ? 81  GLN B CA    1 
ATOM   3202 C C     . GLN D 4 44  ? 39.022 -8.922  28.708  1.00 92.34  ? 81  GLN B C     1 
ATOM   3203 O O     . GLN D 4 44  ? 38.900 -8.599  29.891  1.00 92.29  ? 81  GLN B O     1 
ATOM   3204 C CB    . GLN D 4 44  ? 41.425 -9.556  28.517  1.00 92.72  ? 81  GLN B CB    1 
ATOM   3205 C CG    . GLN D 4 44  ? 41.840 -9.239  29.936  1.00 92.24  ? 81  GLN B CG    1 
ATOM   3206 C CD    . GLN D 4 44  ? 42.859 -10.226 30.457  1.00 92.03  ? 81  GLN B CD    1 
ATOM   3207 O OE1   . GLN D 4 44  ? 43.896 -10.449 29.830  1.00 91.85  ? 81  GLN B OE1   1 
ATOM   3208 N NE2   . GLN D 4 44  ? 42.571 -10.826 31.606  1.00 91.71  ? 81  GLN B NE2   1 
ATOM   3209 N N     . VAL D 4 45  ? 38.058 -9.509  28.005  1.00 91.71  ? 82  VAL B N     1 
ATOM   3210 C CA    . VAL D 4 45  ? 36.758 -9.818  28.577  1.00 90.85  ? 82  VAL B CA    1 
ATOM   3211 C C     . VAL D 4 45  ? 36.665 -11.312 28.855  1.00 90.70  ? 82  VAL B C     1 
ATOM   3212 O O     . VAL D 4 45  ? 37.401 -12.105 28.267  1.00 90.39  ? 82  VAL B O     1 
ATOM   3213 C CB    . VAL D 4 45  ? 35.634 -9.416  27.616  1.00 90.47  ? 82  VAL B CB    1 
ATOM   3214 C CG1   . VAL D 4 45  ? 34.310 -9.433  28.337  1.00 90.45  ? 82  VAL B CG1   1 
ATOM   3215 C CG2   . VAL D 4 45  ? 35.913 -8.041  27.043  1.00 90.20  ? 82  VAL B CG2   1 
ATOM   3216 N N     . LYS D 4 46  ? 35.763 -11.692 29.754  1.00 90.61  ? 83  LYS B N     1 
ATOM   3217 C CA    . LYS D 4 46  ? 35.586 -13.093 30.108  1.00 90.66  ? 83  LYS B CA    1 
ATOM   3218 C C     . LYS D 4 46  ? 34.144 -13.458 30.426  1.00 90.83  ? 83  LYS B C     1 
ATOM   3219 O O     . LYS D 4 46  ? 33.453 -12.744 31.154  1.00 90.71  ? 83  LYS B O     1 
ATOM   3220 C CB    . LYS D 4 46  ? 36.465 -13.456 31.306  1.00 90.62  ? 83  LYS B CB    1 
ATOM   3221 C CG    . LYS D 4 46  ? 36.102 -14.788 31.949  1.00 90.75  ? 83  LYS B CG    1 
ATOM   3222 C CD    . LYS D 4 46  ? 36.980 -15.096 33.148  1.00 90.84  ? 83  LYS B CD    1 
ATOM   3223 C CE    . LYS D 4 46  ? 36.445 -16.285 33.927  1.00 90.74  ? 83  LYS B CE    1 
ATOM   3224 N NZ    . LYS D 4 46  ? 35.074 -16.010 34.449  1.00 90.61  ? 83  LYS B NZ    1 
ATOM   3225 N N     . ILE D 4 47  ? 33.707 -14.585 29.872  1.00 91.05  ? 84  ILE B N     1 
ATOM   3226 C CA    . ILE D 4 47  ? 32.361 -15.099 30.084  1.00 90.93  ? 84  ILE B CA    1 
ATOM   3227 C C     . ILE D 4 47  ? 32.432 -16.070 31.261  1.00 91.24  ? 84  ILE B C     1 
ATOM   3228 O O     . ILE D 4 47  ? 33.195 -17.034 31.228  1.00 91.47  ? 84  ILE B O     1 
ATOM   3229 C CB    . ILE D 4 47  ? 31.865 -15.837 28.836  1.00 90.38  ? 84  ILE B CB    1 
ATOM   3230 C CG1   . ILE D 4 47  ? 31.998 -14.926 27.615  1.00 89.96  ? 84  ILE B CG1   1 
ATOM   3231 C CG2   . ILE D 4 47  ? 30.424 -16.252 29.022  1.00 90.37  ? 84  ILE B CG2   1 
ATOM   3232 C CD1   . ILE D 4 47  ? 31.642 -15.591 26.310  1.00 89.73  ? 84  ILE B CD1   1 
ATOM   3233 N N     . CYS D 4 48  ? 31.642 -15.812 32.299  1.00 91.54  ? 85  CYS B N     1 
ATOM   3234 C CA    . CYS D 4 48  ? 31.645 -16.648 33.500  1.00 92.11  ? 85  CYS B CA    1 
ATOM   3235 C C     . CYS D 4 48  ? 31.129 -18.071 33.307  1.00 92.15  ? 85  CYS B C     1 
ATOM   3236 O O     . CYS D 4 48  ? 31.840 -19.036 33.585  1.00 92.24  ? 85  CYS B O     1 
ATOM   3237 C CB    . CYS D 4 48  ? 30.850 -15.960 34.613  1.00 92.43  ? 85  CYS B CB    1 
ATOM   3238 S SG    . CYS D 4 48  ? 31.549 -14.370 35.129  1.00 92.71  ? 85  CYS B SG    1 
ATOM   3239 N N     . ASN D 4 49  ? 29.892 -18.202 32.849  1.00 92.34  ? 86  ASN B N     1 
ATOM   3240 C CA    . ASN D 4 49  ? 29.308 -19.519 32.624  1.00 92.57  ? 86  ASN B CA    1 
ATOM   3241 C C     . ASN D 4 49  ? 29.859 -20.170 31.358  1.00 92.60  ? 86  ASN B C     1 
ATOM   3242 O O     . ASN D 4 49  ? 29.155 -20.297 30.356  1.00 92.25  ? 86  ASN B O     1 
ATOM   3243 C CB    . ASN D 4 49  ? 27.787 -19.403 32.542  1.00 92.50  ? 86  ASN B CB    1 
ATOM   3244 C CG    . ASN D 4 49  ? 27.160 -19.111 33.886  1.00 92.81  ? 86  ASN B CG    1 
ATOM   3245 O OD1   . ASN D 4 49  ? 27.655 -18.278 34.649  1.00 92.80  ? 86  ASN B OD1   1 
ATOM   3246 N ND2   . ASN D 4 49  ? 26.060 -19.793 34.185  1.00 92.86  ? 86  ASN B ND2   1 
ATOM   3247 N N     . TYR D 4 50  ? 31.126 -20.574 31.429  1.00 92.83  ? 87  TYR B N     1 
ATOM   3248 C CA    . TYR D 4 50  ? 31.831 -21.219 30.326  1.00 92.94  ? 87  TYR B CA    1 
ATOM   3249 C C     . TYR D 4 50  ? 30.888 -22.028 29.450  1.00 92.77  ? 87  TYR B C     1 
ATOM   3250 O O     . TYR D 4 50  ? 30.701 -23.225 29.664  1.00 93.04  ? 87  TYR B O     1 
ATOM   3251 C CB    . TYR D 4 50  ? 32.942 -22.126 30.884  1.00 93.56  ? 87  TYR B CB    1 
ATOM   3252 C CG    . TYR D 4 50  ? 33.883 -22.728 29.847  1.00 94.17  ? 87  TYR B CG    1 
ATOM   3253 C CD1   . TYR D 4 50  ? 35.251 -22.854 30.114  1.00 94.23  ? 87  TYR B CD1   1 
ATOM   3254 C CD2   . TYR D 4 50  ? 33.415 -23.164 28.605  1.00 94.24  ? 87  TYR B CD2   1 
ATOM   3255 C CE1   . TYR D 4 50  ? 36.127 -23.393 29.171  1.00 94.22  ? 87  TYR B CE1   1 
ATOM   3256 C CE2   . TYR D 4 50  ? 34.282 -23.707 27.655  1.00 94.61  ? 87  TYR B CE2   1 
ATOM   3257 C CZ    . TYR D 4 50  ? 35.636 -23.816 27.945  1.00 94.39  ? 87  TYR B CZ    1 
ATOM   3258 O OH    . TYR D 4 50  ? 36.495 -24.339 27.006  1.00 94.04  ? 87  TYR B OH    1 
ATOM   3259 N N     . VAL D 4 51  ? 30.300 -21.372 28.457  1.00 92.49  ? 88  VAL B N     1 
ATOM   3260 C CA    . VAL D 4 51  ? 29.377 -22.047 27.552  1.00 92.03  ? 88  VAL B CA    1 
ATOM   3261 C C     . VAL D 4 51  ? 30.091 -22.493 26.276  1.00 91.66  ? 88  VAL B C     1 
ATOM   3262 O O     . VAL D 4 51  ? 29.767 -22.026 25.181  1.00 91.79  ? 88  VAL B O     1 
ATOM   3263 C CB    . VAL D 4 51  ? 28.191 -21.124 27.177  1.00 91.92  ? 88  VAL B CB    1 
ATOM   3264 C CG1   . VAL D 4 51  ? 27.308 -20.884 28.390  1.00 91.47  ? 88  VAL B CG1   1 
ATOM   3265 C CG2   . VAL D 4 51  ? 28.714 -19.809 26.648  1.00 91.82  ? 88  VAL B CG2   1 
ATOM   3266 N N     . GLY D 4 52  ? 31.057 -23.399 26.427  1.00 90.92  ? 89  GLY B N     1 
ATOM   3267 C CA    . GLY D 4 52  ? 31.802 -23.894 25.282  1.00 90.19  ? 89  GLY B CA    1 
ATOM   3268 C C     . GLY D 4 52  ? 31.963 -22.844 24.197  1.00 89.80  ? 89  GLY B C     1 
ATOM   3269 O O     . GLY D 4 52  ? 32.711 -21.887 24.375  1.00 89.84  ? 89  GLY B O     1 
ATOM   3270 N N     . PRO D 4 53  ? 31.275 -22.998 23.053  1.00 89.35  ? 90  PRO B N     1 
ATOM   3271 C CA    . PRO D 4 53  ? 31.367 -22.030 21.955  1.00 88.83  ? 90  PRO B CA    1 
ATOM   3272 C C     . PRO D 4 53  ? 30.716 -20.702 22.325  1.00 88.09  ? 90  PRO B C     1 
ATOM   3273 O O     . PRO D 4 53  ? 29.591 -20.670 22.830  1.00 87.97  ? 90  PRO B O     1 
ATOM   3274 C CB    . PRO D 4 53  ? 30.629 -22.726 20.814  1.00 88.91  ? 90  PRO B CB    1 
ATOM   3275 C CG    . PRO D 4 53  ? 30.834 -24.175 21.114  1.00 89.29  ? 90  PRO B CG    1 
ATOM   3276 C CD    . PRO D 4 53  ? 30.586 -24.218 22.601  1.00 89.42  ? 90  PRO B CD    1 
ATOM   3277 N N     . ALA D 4 54  ? 31.424 -19.607 22.068  1.00 87.07  ? 91  ALA B N     1 
ATOM   3278 C CA    . ALA D 4 54  ? 30.899 -18.289 22.383  1.00 85.95  ? 91  ALA B CA    1 
ATOM   3279 C C     . ALA D 4 54  ? 31.312 -17.262 21.345  1.00 85.10  ? 91  ALA B C     1 
ATOM   3280 O O     . ALA D 4 54  ? 32.278 -17.461 20.608  1.00 84.95  ? 91  ALA B O     1 
ATOM   3281 C CB    . ALA D 4 54  ? 31.374 -17.855 23.759  1.00 86.21  ? 91  ALA B CB    1 
ATOM   3282 N N     . LYS D 4 55  ? 30.563 -16.165 21.299  1.00 83.93  ? 92  LYS B N     1 
ATOM   3283 C CA    . LYS D 4 55  ? 30.830 -15.073 20.373  1.00 82.79  ? 92  LYS B CA    1 
ATOM   3284 C C     . LYS D 4 55  ? 30.733 -13.746 21.123  1.00 82.12  ? 92  LYS B C     1 
ATOM   3285 O O     . LYS D 4 55  ? 29.684 -13.411 21.680  1.00 81.97  ? 92  LYS B O     1 
ATOM   3286 C CB    . LYS D 4 55  ? 29.821 -15.084 19.222  1.00 82.62  ? 92  LYS B CB    1 
ATOM   3287 C CG    . LYS D 4 55  ? 30.049 -13.978 18.193  1.00 82.79  ? 92  LYS B CG    1 
ATOM   3288 C CD    . LYS D 4 55  ? 28.888 -13.863 17.204  1.00 82.67  ? 92  LYS B CD    1 
ATOM   3289 C CE    . LYS D 4 55  ? 29.062 -12.670 16.267  1.00 82.01  ? 92  LYS B CE    1 
ATOM   3290 N NZ    . LYS D 4 55  ? 27.857 -12.444 15.420  1.00 81.56  ? 92  LYS B NZ    1 
ATOM   3291 N N     . VAL D 4 56  ? 31.833 -12.999 21.137  1.00 80.90  ? 93  VAL B N     1 
ATOM   3292 C CA    . VAL D 4 56  ? 31.881 -11.708 21.811  1.00 79.74  ? 93  VAL B CA    1 
ATOM   3293 C C     . VAL D 4 56  ? 32.279 -10.599 20.841  1.00 79.06  ? 93  VAL B C     1 
ATOM   3294 O O     . VAL D 4 56  ? 33.283 -10.708 20.138  1.00 79.00  ? 93  VAL B O     1 
ATOM   3295 C CB    . VAL D 4 56  ? 32.883 -11.733 22.975  1.00 79.65  ? 93  VAL B CB    1 
ATOM   3296 C CG1   . VAL D 4 56  ? 33.007 -10.353 23.582  1.00 79.71  ? 93  VAL B CG1   1 
ATOM   3297 C CG2   . VAL D 4 56  ? 32.423 -12.727 24.025  1.00 79.73  ? 93  VAL B CG2   1 
ATOM   3298 N N     . ILE D 4 57  ? 31.490 -9.531  20.813  1.00 78.07  ? 94  ILE B N     1 
ATOM   3299 C CA    . ILE D 4 57  ? 31.750 -8.402  19.925  1.00 76.97  ? 94  ILE B CA    1 
ATOM   3300 C C     . ILE D 4 57  ? 32.045 -7.110  20.696  1.00 76.19  ? 94  ILE B C     1 
ATOM   3301 O O     . ILE D 4 57  ? 32.069 -7.100  21.930  1.00 76.03  ? 94  ILE B O     1 
ATOM   3302 C CB    . ILE D 4 57  ? 30.545 -8.155  19.003  1.00 77.08  ? 94  ILE B CB    1 
ATOM   3303 C CG1   . ILE D 4 57  ? 29.362 -7.635  19.822  1.00 76.79  ? 94  ILE B CG1   1 
ATOM   3304 C CG2   . ILE D 4 57  ? 30.155 -9.455  18.311  1.00 77.14  ? 94  ILE B CG2   1 
ATOM   3305 C CD1   . ILE D 4 57  ? 28.217 -7.144  18.986  1.00 76.59  ? 94  ILE B CD1   1 
ATOM   3306 N N     . VAL D 4 58  ? 32.265 -6.021  19.963  1.00 75.07  ? 95  VAL B N     1 
ATOM   3307 C CA    . VAL D 4 58  ? 32.551 -4.733  20.592  1.00 74.06  ? 95  VAL B CA    1 
ATOM   3308 C C     . VAL D 4 58  ? 32.425 -3.552  19.638  1.00 72.96  ? 95  VAL B C     1 
ATOM   3309 O O     . VAL D 4 58  ? 33.035 -3.527  18.572  1.00 72.75  ? 95  VAL B O     1 
ATOM   3310 C CB    . VAL D 4 58  ? 33.971 -4.708  21.214  1.00 74.29  ? 95  VAL B CB    1 
ATOM   3311 C CG1   . VAL D 4 58  ? 35.017 -4.979  20.145  1.00 74.94  ? 95  VAL B CG1   1 
ATOM   3312 C CG2   . VAL D 4 58  ? 34.227 -3.363  21.874  1.00 74.15  ? 95  VAL B CG2   1 
ATOM   3313 N N     . GLN D 4 59  ? 31.628 -2.572  20.043  1.00 72.00  ? 96  GLN B N     1 
ATOM   3314 C CA    . GLN D 4 59  ? 31.410 -1.372  19.254  1.00 71.20  ? 96  GLN B CA    1 
ATOM   3315 C C     . GLN D 4 59  ? 31.630 -0.171  20.162  1.00 70.75  ? 96  GLN B C     1 
ATOM   3316 O O     . GLN D 4 59  ? 31.331 -0.227  21.354  1.00 70.70  ? 96  GLN B O     1 
ATOM   3317 C CB    . GLN D 4 59  ? 29.986 -1.369  18.696  1.00 71.45  ? 96  GLN B CB    1 
ATOM   3318 C CG    . GLN D 4 59  ? 28.892 -1.479  19.756  1.00 71.16  ? 96  GLN B CG    1 
ATOM   3319 C CD    . GLN D 4 59  ? 27.531 -1.821  19.166  1.00 70.80  ? 96  GLN B CD    1 
ATOM   3320 O OE1   . GLN D 4 59  ? 27.119 -1.251  18.155  1.00 71.01  ? 96  GLN B OE1   1 
ATOM   3321 N NE2   . GLN D 4 59  ? 26.824 -2.745  19.805  1.00 70.07  ? 96  GLN B NE2   1 
ATOM   3322 N N     . LEU D 4 60  ? 32.164 0.907   19.600  1.00 70.43  ? 97  LEU B N     1 
ATOM   3323 C CA    . LEU D 4 60  ? 32.440 2.119   20.366  1.00 70.03  ? 97  LEU B CA    1 
ATOM   3324 C C     . LEU D 4 60  ? 31.135 2.835   20.708  1.00 70.09  ? 97  LEU B C     1 
ATOM   3325 O O     . LEU D 4 60  ? 30.167 2.755   19.954  1.00 70.41  ? 97  LEU B O     1 
ATOM   3326 C CB    . LEU D 4 60  ? 33.352 3.046   19.553  1.00 69.44  ? 97  LEU B CB    1 
ATOM   3327 C CG    . LEU D 4 60  ? 34.582 2.389   18.913  1.00 69.43  ? 97  LEU B CG    1 
ATOM   3328 C CD1   . LEU D 4 60  ? 35.444 3.434   18.212  1.00 68.76  ? 97  LEU B CD1   1 
ATOM   3329 C CD2   . LEU D 4 60  ? 35.383 1.674   19.990  1.00 69.70  ? 97  LEU B CD2   1 
ATOM   3330 N N     . VAL D 4 61  ? 31.103 3.525   21.847  1.00 69.98  ? 98  VAL B N     1 
ATOM   3331 C CA    . VAL D 4 61  ? 29.904 4.255   22.263  1.00 70.01  ? 98  VAL B CA    1 
ATOM   3332 C C     . VAL D 4 61  ? 30.225 5.587   22.957  1.00 70.46  ? 98  VAL B C     1 
ATOM   3333 O O     . VAL D 4 61  ? 31.359 5.827   23.372  1.00 70.00  ? 98  VAL B O     1 
ATOM   3334 C CB    . VAL D 4 61  ? 29.018 3.390   23.198  1.00 69.48  ? 98  VAL B CB    1 
ATOM   3335 C CG1   . VAL D 4 61  ? 28.545 2.147   22.461  1.00 69.04  ? 98  VAL B CG1   1 
ATOM   3336 C CG2   . VAL D 4 61  ? 29.788 3.004   24.446  1.00 69.09  ? 98  VAL B CG2   1 
ATOM   3337 N N     . THR D 4 62  ? 29.216 6.448   23.077  1.00 71.44  ? 99  THR B N     1 
ATOM   3338 C CA    . THR D 4 62  ? 29.379 7.760   23.706  1.00 72.40  ? 99  THR B CA    1 
ATOM   3339 C C     . THR D 4 62  ? 29.693 7.651   25.193  1.00 73.24  ? 99  THR B C     1 
ATOM   3340 O O     . THR D 4 62  ? 29.576 6.578   25.785  1.00 73.42  ? 99  THR B O     1 
ATOM   3341 C CB    . THR D 4 62  ? 28.114 8.620   23.553  1.00 72.21  ? 99  THR B CB    1 
ATOM   3342 O OG1   . THR D 4 62  ? 27.113 8.163   24.470  1.00 72.08  ? 99  THR B OG1   1 
ATOM   3343 C CG2   . THR D 4 62  ? 27.578 8.528   22.132  1.00 71.55  ? 99  THR B CG2   1 
ATOM   3344 N N     . ASN D 4 63  ? 30.080 8.770   25.798  1.00 74.28  ? 100 ASN B N     1 
ATOM   3345 C CA    . ASN D 4 63  ? 30.425 8.775   27.215  1.00 75.43  ? 100 ASN B CA    1 
ATOM   3346 C C     . ASN D 4 63  ? 29.463 9.601   28.058  1.00 75.76  ? 100 ASN B C     1 
ATOM   3347 O O     . ASN D 4 63  ? 29.616 9.704   29.275  1.00 75.70  ? 100 ASN B O     1 
ATOM   3348 C CB    . ASN D 4 63  ? 31.861 9.279   27.399  1.00 75.77  ? 100 ASN B CB    1 
ATOM   3349 C CG    . ASN D 4 63  ? 32.300 9.280   28.854  1.00 76.46  ? 100 ASN B CG    1 
ATOM   3350 O OD1   . ASN D 4 63  ? 31.815 8.488   29.668  1.00 76.21  ? 100 ASN B OD1   1 
ATOM   3351 N ND2   . ASN D 4 63  ? 33.235 10.164  29.186  1.00 76.90  ? 100 ASN B ND2   1 
ATOM   3352 N N     . GLY D 4 64  ? 28.461 10.176  27.408  1.00 76.41  ? 101 GLY B N     1 
ATOM   3353 C CA    . GLY D 4 64  ? 27.494 10.979  28.129  1.00 77.30  ? 101 GLY B CA    1 
ATOM   3354 C C     . GLY D 4 64  ? 26.535 10.135  28.948  1.00 77.66  ? 101 GLY B C     1 
ATOM   3355 O O     . GLY D 4 64  ? 26.705 8.921   29.063  1.00 77.96  ? 101 GLY B O     1 
ATOM   3356 N N     . LYS D 4 65  ? 25.528 10.791  29.518  1.00 77.85  ? 102 LYS B N     1 
ATOM   3357 C CA    . LYS D 4 65  ? 24.510 10.136  30.334  1.00 77.72  ? 102 LYS B CA    1 
ATOM   3358 C C     . LYS D 4 65  ? 23.749 9.101   29.501  1.00 77.33  ? 102 LYS B C     1 
ATOM   3359 O O     . LYS D 4 65  ? 23.502 7.986   29.960  1.00 77.04  ? 102 LYS B O     1 
ATOM   3360 C CB    . LYS D 4 65  ? 23.544 11.194  30.882  1.00 78.28  ? 102 LYS B CB    1 
ATOM   3361 C CG    . LYS D 4 65  ? 22.355 10.659  31.677  1.00 78.52  ? 102 LYS B CG    1 
ATOM   3362 C CD    . LYS D 4 65  ? 21.368 11.783  31.990  1.00 78.17  ? 102 LYS B CD    1 
ATOM   3363 C CE    . LYS D 4 65  ? 20.096 11.264  32.640  1.00 77.69  ? 102 LYS B CE    1 
ATOM   3364 N NZ    . LYS D 4 65  ? 19.122 12.367  32.861  1.00 76.80  ? 102 LYS B NZ    1 
ATOM   3365 N N     . ASN D 4 66  ? 23.380 9.478   28.280  1.00 76.90  ? 103 ASN B N     1 
ATOM   3366 C CA    . ASN D 4 66  ? 22.658 8.578   27.382  1.00 76.68  ? 103 ASN B CA    1 
ATOM   3367 C C     . ASN D 4 66  ? 23.613 7.800   26.482  1.00 76.43  ? 103 ASN B C     1 
ATOM   3368 O O     . ASN D 4 66  ? 24.183 8.358   25.544  1.00 76.66  ? 103 ASN B O     1 
ATOM   3369 C CB    . ASN D 4 66  ? 21.677 9.367   26.507  1.00 76.64  ? 103 ASN B CB    1 
ATOM   3370 C CG    . ASN D 4 66  ? 20.292 9.459   27.117  1.00 76.30  ? 103 ASN B CG    1 
ATOM   3371 O OD1   . ASN D 4 66  ? 19.649 8.443   27.386  1.00 75.87  ? 103 ASN B OD1   1 
ATOM   3372 N ND2   . ASN D 4 66  ? 19.822 10.680  27.331  1.00 76.20  ? 103 ASN B ND2   1 
ATOM   3373 N N     . ILE D 4 67  ? 23.780 6.512   26.768  1.00 75.98  ? 104 ILE B N     1 
ATOM   3374 C CA    . ILE D 4 67  ? 24.666 5.657   25.982  1.00 75.55  ? 104 ILE B CA    1 
ATOM   3375 C C     . ILE D 4 67  ? 24.133 5.455   24.562  1.00 74.90  ? 104 ILE B C     1 
ATOM   3376 O O     . ILE D 4 67  ? 22.999 5.009   24.371  1.00 74.81  ? 104 ILE B O     1 
ATOM   3377 C CB    . ILE D 4 67  ? 24.838 4.266   26.640  1.00 75.93  ? 104 ILE B CB    1 
ATOM   3378 C CG1   . ILE D 4 67  ? 25.532 4.402   27.999  1.00 76.06  ? 104 ILE B CG1   1 
ATOM   3379 C CG2   . ILE D 4 67  ? 25.648 3.357   25.726  1.00 75.77  ? 104 ILE B CG2   1 
ATOM   3380 C CD1   . ILE D 4 67  ? 27.002 4.785   27.922  1.00 76.51  ? 104 ILE B CD1   1 
ATOM   3381 N N     . HIS D 4 68  ? 24.961 5.789   23.574  1.00 73.91  ? 105 HIS B N     1 
ATOM   3382 C CA    . HIS D 4 68  ? 24.592 5.647   22.170  1.00 72.77  ? 105 HIS B CA    1 
ATOM   3383 C C     . HIS D 4 68  ? 25.777 5.212   21.315  1.00 71.95  ? 105 HIS B C     1 
ATOM   3384 O O     . HIS D 4 68  ? 26.867 4.945   21.820  1.00 71.43  ? 105 HIS B O     1 
ATOM   3385 C CB    . HIS D 4 68  ? 24.036 6.963   21.617  1.00 73.14  ? 105 HIS B CB    1 
ATOM   3386 C CG    . HIS D 4 68  ? 22.788 7.429   22.299  1.00 73.86  ? 105 HIS B CG    1 
ATOM   3387 N ND1   . HIS D 4 68  ? 21.690 6.615   22.480  1.00 74.56  ? 105 HIS B ND1   1 
ATOM   3388 C CD2   . HIS D 4 68  ? 22.457 8.631   22.824  1.00 74.15  ? 105 HIS B CD2   1 
ATOM   3389 C CE1   . HIS D 4 68  ? 20.735 7.296   23.088  1.00 74.47  ? 105 HIS B CE1   1 
ATOM   3390 N NE2   . HIS D 4 68  ? 21.175 8.522   23.308  1.00 74.74  ? 105 HIS B NE2   1 
ATOM   3391 N N     . LEU D 4 69  ? 25.550 5.147   20.009  1.00 71.08  ? 106 LEU B N     1 
ATOM   3392 C CA    . LEU D 4 69  ? 26.586 4.745   19.073  1.00 70.20  ? 106 LEU B CA    1 
ATOM   3393 C C     . LEU D 4 69  ? 27.459 5.915   18.658  1.00 69.25  ? 106 LEU B C     1 
ATOM   3394 O O     . LEU D 4 69  ? 26.977 6.892   18.076  1.00 68.99  ? 106 LEU B O     1 
ATOM   3395 C CB    . LEU D 4 69  ? 25.956 4.129   17.829  1.00 70.61  ? 106 LEU B CB    1 
ATOM   3396 C CG    . LEU D 4 69  ? 25.252 2.789   18.015  1.00 70.70  ? 106 LEU B CG    1 
ATOM   3397 C CD1   . LEU D 4 69  ? 24.625 2.382   16.683  1.00 71.55  ? 106 LEU B CD1   1 
ATOM   3398 C CD2   . LEU D 4 69  ? 26.247 1.738   18.500  1.00 69.97  ? 106 LEU B CD2   1 
ATOM   3399 N N     . HIS D 4 70  ? 28.748 5.808   18.950  1.00 68.00  ? 107 HIS B N     1 
ATOM   3400 C CA    . HIS D 4 70  ? 29.672 6.867   18.593  1.00 67.01  ? 107 HIS B CA    1 
ATOM   3401 C C     . HIS D 4 70  ? 30.013 6.744   17.123  1.00 66.64  ? 107 HIS B C     1 
ATOM   3402 O O     . HIS D 4 70  ? 29.879 5.670   16.541  1.00 66.69  ? 107 HIS B O     1 
ATOM   3403 C CB    . HIS D 4 70  ? 30.953 6.771   19.408  1.00 66.16  ? 107 HIS B CB    1 
ATOM   3404 C CG    . HIS D 4 70  ? 31.788 8.009   19.350  1.00 65.02  ? 107 HIS B CG    1 
ATOM   3405 N ND1   . HIS D 4 70  ? 31.477 9.148   20.058  1.00 64.65  ? 107 HIS B ND1   1 
ATOM   3406 C CD2   . HIS D 4 70  ? 32.904 8.298   18.645  1.00 64.68  ? 107 HIS B CD2   1 
ATOM   3407 C CE1   . HIS D 4 70  ? 32.367 10.086  19.793  1.00 64.40  ? 107 HIS B CE1   1 
ATOM   3408 N NE2   . HIS D 4 70  ? 33.244 9.595   18.938  1.00 64.51  ? 107 HIS B NE2   1 
ATOM   3409 N N     . ALA D 4 71  ? 30.462 7.843   16.528  1.00 66.14  ? 108 ALA B N     1 
ATOM   3410 C CA    . ALA D 4 71  ? 30.819 7.840   15.119  1.00 65.66  ? 108 ALA B CA    1 
ATOM   3411 C C     . ALA D 4 71  ? 32.202 7.230   14.851  1.00 65.41  ? 108 ALA B C     1 
ATOM   3412 O O     . ALA D 4 71  ? 32.468 6.781   13.734  1.00 65.11  ? 108 ALA B O     1 
ATOM   3413 C CB    . ALA D 4 71  ? 30.746 9.248   14.566  1.00 65.44  ? 108 ALA B CB    1 
ATOM   3414 N N     . HIS D 4 72  ? 33.079 7.205   15.859  1.00 65.21  ? 109 HIS B N     1 
ATOM   3415 C CA    . HIS D 4 72  ? 34.412 6.619   15.670  1.00 65.27  ? 109 HIS B CA    1 
ATOM   3416 C C     . HIS D 4 72  ? 34.285 5.110   15.552  1.00 65.41  ? 109 HIS B C     1 
ATOM   3417 O O     . HIS D 4 72  ? 33.276 4.536   15.953  1.00 65.35  ? 109 HIS B O     1 
ATOM   3418 C CB    . HIS D 4 72  ? 35.360 6.950   16.828  1.00 64.69  ? 109 HIS B CB    1 
ATOM   3419 C CG    . HIS D 4 72  ? 35.739 8.397   16.916  1.00 63.74  ? 109 HIS B CG    1 
ATOM   3420 N ND1   . HIS D 4 72  ? 35.633 9.263   15.848  1.00 62.92  ? 109 HIS B ND1   1 
ATOM   3421 C CD2   . HIS D 4 72  ? 36.226 9.127   17.947  1.00 63.03  ? 109 HIS B CD2   1 
ATOM   3422 C CE1   . HIS D 4 72  ? 36.034 10.465  16.221  1.00 62.79  ? 109 HIS B CE1   1 
ATOM   3423 N NE2   . HIS D 4 72  ? 36.399 10.410  17.489  1.00 62.56  ? 109 HIS B NE2   1 
ATOM   3424 N N     . SER D 4 73  ? 35.315 4.462   15.019  1.00 65.87  ? 110 SER B N     1 
ATOM   3425 C CA    . SER D 4 73  ? 35.258 3.020   14.837  1.00 66.58  ? 110 SER B CA    1 
ATOM   3426 C C     . SER D 4 73  ? 36.543 2.264   15.143  1.00 67.23  ? 110 SER B C     1 
ATOM   3427 O O     . SER D 4 73  ? 37.645 2.756   14.896  1.00 67.01  ? 110 SER B O     1 
ATOM   3428 C CB    . SER D 4 73  ? 34.836 2.717   13.404  1.00 66.23  ? 110 SER B CB    1 
ATOM   3429 O OG    . SER D 4 73  ? 35.739 3.315   12.496  1.00 65.32  ? 110 SER B OG    1 
ATOM   3430 N N     . LEU D 4 74  ? 36.377 1.055   15.675  1.00 67.94  ? 111 LEU B N     1 
ATOM   3431 C CA    . LEU D 4 74  ? 37.496 0.170   15.997  1.00 68.87  ? 111 LEU B CA    1 
ATOM   3432 C C     . LEU D 4 74  ? 38.111 -0.350  14.690  1.00 69.52  ? 111 LEU B C     1 
ATOM   3433 O O     . LEU D 4 74  ? 37.446 -1.043  13.916  1.00 69.53  ? 111 LEU B O     1 
ATOM   3434 C CB    . LEU D 4 74  ? 36.993 -1.003  16.848  1.00 68.05  ? 111 LEU B CB    1 
ATOM   3435 C CG    . LEU D 4 74  ? 37.019 -0.844  18.368  1.00 67.22  ? 111 LEU B CG    1 
ATOM   3436 C CD1   . LEU D 4 74  ? 36.061 -1.816  19.018  1.00 66.61  ? 111 LEU B CD1   1 
ATOM   3437 C CD2   . LEU D 4 74  ? 38.438 -1.072  18.861  1.00 66.72  ? 111 LEU B CD2   1 
ATOM   3438 N N     . VAL D 4 75  ? 39.377 -0.030  14.448  1.00 70.32  ? 112 VAL B N     1 
ATOM   3439 C CA    . VAL D 4 75  ? 40.012 -0.458  13.208  1.00 71.68  ? 112 VAL B CA    1 
ATOM   3440 C C     . VAL D 4 75  ? 40.865 -1.717  13.244  1.00 72.77  ? 112 VAL B C     1 
ATOM   3441 O O     . VAL D 4 75  ? 40.710 -2.586  12.390  1.00 73.06  ? 112 VAL B O     1 
ATOM   3442 C CB    . VAL D 4 75  ? 40.862 0.671   12.606  1.00 71.26  ? 112 VAL B CB    1 
ATOM   3443 C CG1   . VAL D 4 75  ? 39.962 1.811   12.177  1.00 71.41  ? 112 VAL B CG1   1 
ATOM   3444 C CG2   . VAL D 4 75  ? 41.883 1.150   13.616  1.00 71.01  ? 112 VAL B CG2   1 
ATOM   3445 N N     . GLY D 4 76  ? 41.765 -1.821  14.213  1.00 73.97  ? 113 GLY B N     1 
ATOM   3446 C CA    . GLY D 4 76  ? 42.624 -2.991  14.285  1.00 76.01  ? 113 GLY B CA    1 
ATOM   3447 C C     . GLY D 4 76  ? 41.935 -4.346  14.154  1.00 77.59  ? 113 GLY B C     1 
ATOM   3448 O O     . GLY D 4 76  ? 40.830 -4.459  13.614  1.00 77.67  ? 113 GLY B O     1 
ATOM   3449 N N     . LYS D 4 77  ? 42.614 -5.377  14.658  1.00 78.61  ? 114 LYS B N     1 
ATOM   3450 C CA    . LYS D 4 77  ? 42.144 -6.767  14.648  1.00 79.26  ? 114 LYS B CA    1 
ATOM   3451 C C     . LYS D 4 77  ? 41.032 -7.140  13.678  1.00 79.70  ? 114 LYS B C     1 
ATOM   3452 O O     . LYS D 4 77  ? 40.857 -6.536  12.618  1.00 79.75  ? 114 LYS B O     1 
ATOM   3453 C CB    . LYS D 4 77  ? 41.717 -7.191  16.061  1.00 78.93  ? 114 LYS B CB    1 
ATOM   3454 C CG    . LYS D 4 77  ? 42.868 -7.509  17.009  1.00 78.84  ? 114 LYS B CG    1 
ATOM   3455 C CD    . LYS D 4 77  ? 43.462 -8.909  16.796  1.00 78.49  ? 114 LYS B CD    1 
ATOM   3456 C CE    . LYS D 4 77  ? 44.209 -9.067  15.470  1.00 78.37  ? 114 LYS B CE    1 
ATOM   3457 N NZ    . LYS D 4 77  ? 43.322 -9.200  14.276  1.00 77.83  ? 114 LYS B NZ    1 
ATOM   3458 N N     . HIS D 4 78  ? 40.292 -8.170  14.059  1.00 80.30  ? 115 HIS B N     1 
ATOM   3459 C CA    . HIS D 4 78  ? 39.187 -8.656  13.265  1.00 81.03  ? 115 HIS B CA    1 
ATOM   3460 C C     . HIS D 4 78  ? 38.089 -7.610  13.354  1.00 81.16  ? 115 HIS B C     1 
ATOM   3461 O O     . HIS D 4 78  ? 36.946 -7.935  13.665  1.00 81.09  ? 115 HIS B O     1 
ATOM   3462 C CB    . HIS D 4 78  ? 38.665 -9.980  13.834  1.00 81.91  ? 115 HIS B CB    1 
ATOM   3463 C CG    . HIS D 4 78  ? 39.651 -10.707 14.700  1.00 82.73  ? 115 HIS B CG    1 
ATOM   3464 N ND1   . HIS D 4 78  ? 40.797 -11.292 14.202  1.00 83.00  ? 115 HIS B ND1   1 
ATOM   3465 C CD2   . HIS D 4 78  ? 39.660 -10.942 16.035  1.00 82.78  ? 115 HIS B CD2   1 
ATOM   3466 C CE1   . HIS D 4 78  ? 41.467 -11.856 15.192  1.00 83.08  ? 115 HIS B CE1   1 
ATOM   3467 N NE2   . HIS D 4 78  ? 40.798 -11.658 16.314  1.00 83.06  ? 115 HIS B NE2   1 
ATOM   3468 N N     . CYS D 4 79  ? 38.434 -6.352  13.101  1.00 81.68  ? 116 CYS B N     1 
ATOM   3469 C CA    . CYS D 4 79  ? 37.443 -5.284  13.168  1.00 82.69  ? 116 CYS B CA    1 
ATOM   3470 C C     . CYS D 4 79  ? 36.998 -4.849  11.774  1.00 82.74  ? 116 CYS B C     1 
ATOM   3471 O O     . CYS D 4 79  ? 37.788 -4.281  11.016  1.00 83.02  ? 116 CYS B O     1 
ATOM   3472 C CB    . CYS D 4 79  ? 38.002 -4.061  13.900  1.00 83.50  ? 116 CYS B CB    1 
ATOM   3473 S SG    . CYS D 4 79  ? 38.690 -4.269  15.582  1.00 84.96  ? 116 CYS B SG    1 
ATOM   3474 N N     . GLU D 4 80  ? 35.736 -5.105  11.439  1.00 82.54  ? 117 GLU B N     1 
ATOM   3475 C CA    . GLU D 4 80  ? 35.215 -4.718  10.132  1.00 82.49  ? 117 GLU B CA    1 
ATOM   3476 C C     . GLU D 4 80  ? 33.987 -3.813  10.236  1.00 82.34  ? 117 GLU B C     1 
ATOM   3477 O O     . GLU D 4 80  ? 33.083 -4.045  11.040  1.00 82.12  ? 117 GLU B O     1 
ATOM   3478 C CB    . GLU D 4 80  ? 34.853 -5.953  9.302   1.00 82.74  ? 117 GLU B CB    1 
ATOM   3479 C CG    . GLU D 4 80  ? 33.577 -6.647  9.745   1.00 83.27  ? 117 GLU B CG    1 
ATOM   3480 C CD    . GLU D 4 80  ? 33.054 -7.627  8.710   1.00 83.65  ? 117 GLU B CD    1 
ATOM   3481 O OE1   . GLU D 4 80  ? 31.955 -8.185  8.922   1.00 83.73  ? 117 GLU B OE1   1 
ATOM   3482 O OE2   . GLU D 4 80  ? 33.742 -7.839  7.687   1.00 83.84  ? 117 GLU B OE2   1 
ATOM   3483 N N     . ASP D 4 81  ? 33.975 -2.779  9.404   1.00 82.08  ? 118 ASP B N     1 
ATOM   3484 C CA    . ASP D 4 81  ? 32.889 -1.812  9.345   1.00 81.68  ? 118 ASP B CA    1 
ATOM   3485 C C     . ASP D 4 81  ? 32.521 -1.195  10.690  1.00 81.15  ? 118 ASP B C     1 
ATOM   3486 O O     . ASP D 4 81  ? 31.343 -1.045  11.009  1.00 80.79  ? 118 ASP B O     1 
ATOM   3487 C CB    . ASP D 4 81  ? 31.654 -2.450  8.703   1.00 82.42  ? 118 ASP B CB    1 
ATOM   3488 C CG    . ASP D 4 81  ? 30.855 -1.462  7.862   1.00 83.06  ? 118 ASP B CG    1 
ATOM   3489 O OD1   . ASP D 4 81  ? 30.228 -0.545  8.440   1.00 83.43  ? 118 ASP B OD1   1 
ATOM   3490 O OD2   . ASP D 4 81  ? 30.863 -1.601  6.618   1.00 83.13  ? 118 ASP B OD2   1 
ATOM   3491 N N     . GLY D 4 82  ? 33.535 -0.850  11.480  1.00 81.05  ? 119 GLY B N     1 
ATOM   3492 C CA    . GLY D 4 82  ? 33.292 -0.200  12.758  1.00 81.30  ? 119 GLY B CA    1 
ATOM   3493 C C     . GLY D 4 82  ? 33.323 -0.995  14.050  1.00 81.53  ? 119 GLY B C     1 
ATOM   3494 O O     . GLY D 4 82  ? 33.632 -0.440  15.109  1.00 81.62  ? 119 GLY B O     1 
ATOM   3495 N N     . VAL D 4 83  ? 33.000 -2.281  13.983  1.00 81.59  ? 120 VAL B N     1 
ATOM   3496 C CA    . VAL D 4 83  ? 32.983 -3.115  15.176  1.00 81.47  ? 120 VAL B CA    1 
ATOM   3497 C C     . VAL D 4 83  ? 33.837 -4.381  15.051  1.00 82.01  ? 120 VAL B C     1 
ATOM   3498 O O     . VAL D 4 83  ? 33.977 -4.954  13.969  1.00 81.92  ? 120 VAL B O     1 
ATOM   3499 C CB    . VAL D 4 83  ? 31.520 -3.478  15.549  1.00 80.92  ? 120 VAL B CB    1 
ATOM   3500 C CG1   . VAL D 4 83  ? 30.702 -3.691  14.292  1.00 80.33  ? 120 VAL B CG1   1 
ATOM   3501 C CG2   . VAL D 4 83  ? 31.486 -4.720  16.423  1.00 80.99  ? 120 VAL B CG2   1 
ATOM   3502 N N     . CYS D 4 84  ? 34.410 -4.806  16.173  1.00 82.64  ? 121 CYS B N     1 
ATOM   3503 C CA    . CYS D 4 84  ? 35.256 -5.991  16.203  1.00 83.31  ? 121 CYS B CA    1 
ATOM   3504 C C     . CYS D 4 84  ? 34.489 -7.219  16.674  1.00 83.14  ? 121 CYS B C     1 
ATOM   3505 O O     . CYS D 4 84  ? 33.588 -7.116  17.503  1.00 82.84  ? 121 CYS B O     1 
ATOM   3506 C CB    . CYS D 4 84  ? 36.464 -5.748  17.112  1.00 83.94  ? 121 CYS B CB    1 
ATOM   3507 S SG    . CYS D 4 84  ? 38.062 -6.078  16.295  1.00 86.83  ? 121 CYS B SG    1 
ATOM   3508 N N     . THR D 4 85  ? 34.852 -8.381  16.136  1.00 83.47  ? 122 THR B N     1 
ATOM   3509 C CA    . THR D 4 85  ? 34.203 -9.644  16.492  1.00 83.75  ? 122 THR B CA    1 
ATOM   3510 C C     . THR D 4 85  ? 35.226 -10.760 16.747  1.00 83.95  ? 122 THR B C     1 
ATOM   3511 O O     . THR D 4 85  ? 36.206 -10.896 16.013  1.00 83.77  ? 122 THR B O     1 
ATOM   3512 C CB    . THR D 4 85  ? 33.235 -10.102 15.375  1.00 83.70  ? 122 THR B CB    1 
ATOM   3513 O OG1   . THR D 4 85  ? 32.240 -9.094  15.155  1.00 83.30  ? 122 THR B OG1   1 
ATOM   3514 C CG2   . THR D 4 85  ? 32.546 -11.401 15.767  1.00 83.79  ? 122 THR B CG2   1 
ATOM   3515 N N     . VAL D 4 86  ? 34.993 -11.553 17.793  1.00 84.16  ? 123 VAL B N     1 
ATOM   3516 C CA    . VAL D 4 86  ? 35.892 -12.655 18.148  1.00 84.60  ? 123 VAL B CA    1 
ATOM   3517 C C     . VAL D 4 86  ? 35.151 -13.936 18.556  1.00 84.80  ? 123 VAL B C     1 
ATOM   3518 O O     . VAL D 4 86  ? 33.919 -13.978 18.586  1.00 84.81  ? 123 VAL B O     1 
ATOM   3519 C CB    . VAL D 4 86  ? 36.851 -12.254 19.297  1.00 84.66  ? 123 VAL B CB    1 
ATOM   3520 C CG1   . VAL D 4 86  ? 37.907 -11.283 18.787  1.00 84.24  ? 123 VAL B CG1   1 
ATOM   3521 C CG2   . VAL D 4 86  ? 36.059 -11.631 20.436  1.00 84.54  ? 123 VAL B CG2   1 
ATOM   3522 N N     . THR D 4 87  ? 35.911 -14.978 18.879  1.00 84.70  ? 124 THR B N     1 
ATOM   3523 C CA    . THR D 4 87  ? 35.314 -16.249 19.259  1.00 84.68  ? 124 THR B CA    1 
ATOM   3524 C C     . THR D 4 87  ? 35.812 -16.750 20.614  1.00 84.91  ? 124 THR B C     1 
ATOM   3525 O O     . THR D 4 87  ? 36.936 -16.454 21.023  1.00 84.76  ? 124 THR B O     1 
ATOM   3526 C CB    . THR D 4 87  ? 35.598 -17.299 18.189  1.00 84.42  ? 124 THR B CB    1 
ATOM   3527 O OG1   . THR D 4 87  ? 35.627 -16.657 16.909  1.00 84.02  ? 124 THR B OG1   1 
ATOM   3528 C CG2   . THR D 4 87  ? 34.508 -18.360 18.183  1.00 84.25  ? 124 THR B CG2   1 
ATOM   3529 N N     . ALA D 4 88  ? 34.971 -17.523 21.299  1.00 85.00  ? 125 ALA B N     1 
ATOM   3530 C CA    . ALA D 4 88  ? 35.308 -18.036 22.619  1.00 85.19  ? 125 ALA B CA    1 
ATOM   3531 C C     . ALA D 4 88  ? 35.096 -19.538 22.806  1.00 85.46  ? 125 ALA B C     1 
ATOM   3532 O O     . ALA D 4 88  ? 35.145 -20.039 23.930  1.00 85.53  ? 125 ALA B O     1 
ATOM   3533 C CB    . ALA D 4 88  ? 34.516 -17.270 23.672  1.00 85.08  ? 125 ALA B CB    1 
ATOM   3534 N N     . GLY D 4 89  ? 34.871 -20.259 21.715  1.00 85.73  ? 126 GLY B N     1 
ATOM   3535 C CA    . GLY D 4 89  ? 34.657 -21.696 21.814  1.00 85.97  ? 126 GLY B CA    1 
ATOM   3536 C C     . GLY D 4 89  ? 35.776 -22.521 22.442  1.00 85.97  ? 126 GLY B C     1 
ATOM   3537 O O     . GLY D 4 89  ? 35.493 -23.454 23.196  1.00 85.46  ? 126 GLY B O     1 
ATOM   3538 N N     . PRO D 4 90  ? 37.055 -22.210 22.148  1.00 86.16  ? 127 PRO B N     1 
ATOM   3539 C CA    . PRO D 4 90  ? 38.239 -22.907 22.665  1.00 86.15  ? 127 PRO B CA    1 
ATOM   3540 C C     . PRO D 4 90  ? 38.258 -23.356 24.130  1.00 85.95  ? 127 PRO B C     1 
ATOM   3541 O O     . PRO D 4 90  ? 37.240 -23.339 24.823  1.00 86.00  ? 127 PRO B O     1 
ATOM   3542 C CB    . PRO D 4 90  ? 39.364 -21.936 22.334  1.00 86.08  ? 127 PRO B CB    1 
ATOM   3543 C CG    . PRO D 4 90  ? 38.945 -21.448 20.985  1.00 86.06  ? 127 PRO B CG    1 
ATOM   3544 C CD    . PRO D 4 90  ? 37.465 -21.158 21.194  1.00 86.14  ? 127 PRO B CD    1 
ATOM   3545 N N     . LYS D 4 91  ? 39.447 -23.759 24.574  1.00 85.79  ? 128 LYS B N     1 
ATOM   3546 C CA    . LYS D 4 91  ? 39.703 -24.268 25.927  1.00 85.55  ? 128 LYS B CA    1 
ATOM   3547 C C     . LYS D 4 91  ? 39.316 -23.355 27.103  1.00 85.25  ? 128 LYS B C     1 
ATOM   3548 O O     . LYS D 4 91  ? 39.198 -23.828 28.239  1.00 84.92  ? 128 LYS B O     1 
ATOM   3549 C CB    . LYS D 4 91  ? 41.192 -24.624 26.070  1.00 85.58  ? 128 LYS B CB    1 
ATOM   3550 C CG    . LYS D 4 91  ? 41.866 -25.180 24.811  1.00 85.74  ? 128 LYS B CG    1 
ATOM   3551 C CD    . LYS D 4 91  ? 41.216 -26.470 24.326  1.00 86.13  ? 128 LYS B CD    1 
ATOM   3552 C CE    . LYS D 4 91  ? 42.067 -27.176 23.262  1.00 86.11  ? 128 LYS B CE    1 
ATOM   3553 N NZ    . LYS D 4 91  ? 42.323 -26.352 22.046  1.00 86.08  ? 128 LYS B NZ    1 
ATOM   3554 N N     . ASP D 4 92  ? 39.123 -22.061 26.844  1.00 84.77  ? 129 ASP B N     1 
ATOM   3555 C CA    . ASP D 4 92  ? 38.784 -21.117 27.910  1.00 83.62  ? 129 ASP B CA    1 
ATOM   3556 C C     . ASP D 4 92  ? 37.639 -20.164 27.590  1.00 83.35  ? 129 ASP B C     1 
ATOM   3557 O O     . ASP D 4 92  ? 37.019 -20.251 26.532  1.00 82.91  ? 129 ASP B O     1 
ATOM   3558 C CB    . ASP D 4 92  ? 40.034 -20.313 28.296  1.00 82.80  ? 129 ASP B CB    1 
ATOM   3559 C CG    . ASP D 4 92  ? 40.703 -19.654 27.101  1.00 81.84  ? 129 ASP B CG    1 
ATOM   3560 O OD1   . ASP D 4 92  ? 41.009 -20.351 26.114  1.00 80.96  ? 129 ASP B OD1   1 
ATOM   3561 O OD2   . ASP D 4 92  ? 40.937 -18.433 27.153  1.00 81.78  ? 129 ASP B OD2   1 
ATOM   3562 N N     . MET D 4 93  ? 37.369 -19.256 28.527  1.00 83.40  ? 130 MET B N     1 
ATOM   3563 C CA    . MET D 4 93  ? 36.309 -18.256 28.380  1.00 83.35  ? 130 MET B CA    1 
ATOM   3564 C C     . MET D 4 93  ? 36.818 -16.828 28.608  1.00 83.00  ? 130 MET B C     1 
ATOM   3565 O O     . MET D 4 93  ? 36.085 -15.976 29.115  1.00 82.79  ? 130 MET B O     1 
ATOM   3566 C CB    . MET D 4 93  ? 35.172 -18.537 29.365  1.00 83.34  ? 130 MET B CB    1 
ATOM   3567 C CG    . MET D 4 93  ? 34.359 -19.766 29.041  1.00 83.57  ? 130 MET B CG    1 
ATOM   3568 S SD    . MET D 4 93  ? 33.388 -19.649 27.515  1.00 84.08  ? 130 MET B SD    1 
ATOM   3569 C CE    . MET D 4 93  ? 34.315 -20.696 26.452  1.00 83.48  ? 130 MET B CE    1 
ATOM   3570 N N     . VAL D 4 94  ? 38.067 -16.571 28.228  1.00 82.60  ? 131 VAL B N     1 
ATOM   3571 C CA    . VAL D 4 94  ? 38.661 -15.252 28.402  1.00 82.15  ? 131 VAL B CA    1 
ATOM   3572 C C     . VAL D 4 94  ? 39.232 -14.690 27.103  1.00 81.52  ? 131 VAL B C     1 
ATOM   3573 O O     . VAL D 4 94  ? 40.381 -14.945 26.755  1.00 81.14  ? 131 VAL B O     1 
ATOM   3574 C CB    . VAL D 4 94  ? 39.781 -15.289 29.475  1.00 82.43  ? 131 VAL B CB    1 
ATOM   3575 C CG1   . VAL D 4 94  ? 40.430 -13.920 29.608  1.00 82.72  ? 131 VAL B CG1   1 
ATOM   3576 C CG2   . VAL D 4 94  ? 39.202 -15.720 30.814  1.00 82.10  ? 131 VAL B CG2   1 
ATOM   3577 N N     . VAL D 4 95  ? 38.413 -13.924 26.391  1.00 81.32  ? 132 VAL B N     1 
ATOM   3578 C CA    . VAL D 4 95  ? 38.822 -13.303 25.134  1.00 81.19  ? 132 VAL B CA    1 
ATOM   3579 C C     . VAL D 4 95  ? 39.622 -12.027 25.402  1.00 81.04  ? 132 VAL B C     1 
ATOM   3580 O O     . VAL D 4 95  ? 39.405 -11.343 26.406  1.00 81.24  ? 132 VAL B O     1 
ATOM   3581 C CB    . VAL D 4 95  ? 37.587 -12.944 24.254  1.00 81.26  ? 132 VAL B CB    1 
ATOM   3582 C CG1   . VAL D 4 95  ? 37.999 -12.033 23.108  1.00 80.85  ? 132 VAL B CG1   1 
ATOM   3583 C CG2   . VAL D 4 95  ? 36.957 -14.209 23.700  1.00 81.13  ? 132 VAL B CG2   1 
ATOM   3584 N N     . GLY D 4 96  ? 40.549 -11.718 24.500  1.00 80.50  ? 133 GLY B N     1 
ATOM   3585 C CA    . GLY D 4 96  ? 41.362 -10.524 24.635  1.00 79.77  ? 133 GLY B CA    1 
ATOM   3586 C C     . GLY D 4 96  ? 41.171 -9.639  23.423  1.00 79.38  ? 133 GLY B C     1 
ATOM   3587 O O     . GLY D 4 96  ? 40.378 -9.959  22.538  1.00 79.45  ? 133 GLY B O     1 
ATOM   3588 N N     . PHE D 4 97  ? 41.893 -8.526  23.376  1.00 78.89  ? 134 PHE B N     1 
ATOM   3589 C CA    . PHE D 4 97  ? 41.789 -7.593  22.258  1.00 78.49  ? 134 PHE B CA    1 
ATOM   3590 C C     . PHE D 4 97  ? 43.118 -6.873  22.062  1.00 78.39  ? 134 PHE B C     1 
ATOM   3591 O O     . PHE D 4 97  ? 43.296 -5.742  22.512  1.00 78.23  ? 134 PHE B O     1 
ATOM   3592 C CB    . PHE D 4 97  ? 40.674 -6.578  22.531  1.00 77.97  ? 134 PHE B CB    1 
ATOM   3593 C CG    . PHE D 4 97  ? 39.293 -7.179  22.538  1.00 77.12  ? 134 PHE B CG    1 
ATOM   3594 C CD1   . PHE D 4 97  ? 38.539 -7.236  21.371  1.00 76.56  ? 134 PHE B CD1   1 
ATOM   3595 C CD2   . PHE D 4 97  ? 38.753 -7.699  23.709  1.00 76.71  ? 134 PHE B CD2   1 
ATOM   3596 C CE1   . PHE D 4 97  ? 37.271 -7.802  21.370  1.00 76.18  ? 134 PHE B CE1   1 
ATOM   3597 C CE2   . PHE D 4 97  ? 37.487 -8.267  23.716  1.00 76.31  ? 134 PHE B CE2   1 
ATOM   3598 C CZ    . PHE D 4 97  ? 36.744 -8.318  22.544  1.00 76.15  ? 134 PHE B CZ    1 
ATOM   3599 N N     . ALA D 4 98  ? 44.047 -7.540  21.385  1.00 78.57  ? 135 ALA B N     1 
ATOM   3600 C CA    . ALA D 4 98  ? 45.372 -6.980  21.140  1.00 78.67  ? 135 ALA B CA    1 
ATOM   3601 C C     . ALA D 4 98  ? 45.499 -6.279  19.789  1.00 78.66  ? 135 ALA B C     1 
ATOM   3602 O O     . ALA D 4 98  ? 45.142 -6.826  18.743  1.00 78.25  ? 135 ALA B O     1 
ATOM   3603 C CB    . ALA D 4 98  ? 46.432 -8.076  21.264  1.00 79.12  ? 135 ALA B CB    1 
ATOM   3604 N N     . ASN D 4 99  ? 46.030 -5.064  19.839  1.00 78.67  ? 136 ASN B N     1 
ATOM   3605 C CA    . ASN D 4 99  ? 46.224 -4.230  18.666  1.00 78.64  ? 136 ASN B CA    1 
ATOM   3606 C C     . ASN D 4 99  ? 44.915 -3.993  17.919  1.00 78.09  ? 136 ASN B C     1 
ATOM   3607 O O     . ASN D 4 99  ? 44.380 -4.892  17.270  1.00 78.31  ? 136 ASN B O     1 
ATOM   3608 C CB    . ASN D 4 99  ? 47.247 -4.853  17.721  1.00 79.40  ? 136 ASN B CB    1 
ATOM   3609 C CG    . ASN D 4 99  ? 47.706 -3.881  16.652  1.00 80.54  ? 136 ASN B CG    1 
ATOM   3610 O OD1   . ASN D 4 99  ? 48.335 -2.864  16.956  1.00 81.15  ? 136 ASN B OD1   1 
ATOM   3611 N ND2   . ASN D 4 99  ? 47.384 -4.179  15.396  1.00 80.54  ? 136 ASN B ND2   1 
ATOM   3612 N N     . LEU D 4 100 ? 44.408 -2.769  18.033  1.00 77.11  ? 137 LEU B N     1 
ATOM   3613 C CA    . LEU D 4 100 ? 43.172 -2.353  17.382  1.00 75.88  ? 137 LEU B CA    1 
ATOM   3614 C C     . LEU D 4 100 ? 42.925 -0.886  17.724  1.00 74.76  ? 137 LEU B C     1 
ATOM   3615 O O     . LEU D 4 100 ? 42.287 -0.567  18.726  1.00 74.69  ? 137 LEU B O     1 
ATOM   3616 C CB    . LEU D 4 100 ? 41.984 -3.214  17.843  1.00 75.81  ? 137 LEU B CB    1 
ATOM   3617 C CG    . LEU D 4 100 ? 41.562 -3.237  19.319  1.00 75.66  ? 137 LEU B CG    1 
ATOM   3618 C CD1   . LEU D 4 100 ? 40.197 -3.885  19.456  1.00 75.31  ? 137 LEU B CD1   1 
ATOM   3619 C CD2   . LEU D 4 100 ? 42.589 -3.992  20.137  1.00 75.70  ? 137 LEU B CD2   1 
ATOM   3620 N N     . GLY D 4 101 ? 43.448 0.001   16.882  1.00 73.53  ? 138 GLY B N     1 
ATOM   3621 C CA    . GLY D 4 101 ? 43.296 1.426   17.108  1.00 71.65  ? 138 GLY B CA    1 
ATOM   3622 C C     . GLY D 4 101 ? 41.879 1.960   16.999  1.00 70.50  ? 138 GLY B C     1 
ATOM   3623 O O     . GLY D 4 101 ? 40.957 1.260   16.562  1.00 70.56  ? 138 GLY B O     1 
ATOM   3624 N N     . ILE D 4 102 ? 41.711 3.215   17.410  1.00 69.10  ? 139 ILE B N     1 
ATOM   3625 C CA    . ILE D 4 102 ? 40.420 3.891   17.361  1.00 67.64  ? 139 ILE B CA    1 
ATOM   3626 C C     . ILE D 4 102 ? 40.482 4.997   16.313  1.00 66.57  ? 139 ILE B C     1 
ATOM   3627 O O     . ILE D 4 102 ? 41.160 6.003   16.504  1.00 66.50  ? 139 ILE B O     1 
ATOM   3628 C CB    . ILE D 4 102 ? 40.056 4.526   18.729  1.00 67.66  ? 139 ILE B CB    1 
ATOM   3629 C CG1   . ILE D 4 102 ? 40.014 3.449   19.821  1.00 67.58  ? 139 ILE B CG1   1 
ATOM   3630 C CG2   . ILE D 4 102 ? 38.712 5.238   18.631  1.00 67.46  ? 139 ILE B CG2   1 
ATOM   3631 C CD1   . ILE D 4 102 ? 39.563 3.955   21.187  1.00 67.08  ? 139 ILE B CD1   1 
ATOM   3632 N N     . LEU D 4 103 ? 39.778 4.800   15.204  1.00 65.41  ? 140 LEU B N     1 
ATOM   3633 C CA    . LEU D 4 103 ? 39.759 5.778   14.123  1.00 64.34  ? 140 LEU B CA    1 
ATOM   3634 C C     . LEU D 4 103 ? 38.951 7.011   14.481  1.00 63.71  ? 140 LEU B C     1 
ATOM   3635 O O     . LEU D 4 103 ? 37.820 6.902   14.957  1.00 64.06  ? 140 LEU B O     1 
ATOM   3636 C CB    . LEU D 4 103 ? 39.171 5.154   12.856  1.00 64.56  ? 140 LEU B CB    1 
ATOM   3637 C CG    . LEU D 4 103 ? 38.844 6.117   11.711  1.00 64.21  ? 140 LEU B CG    1 
ATOM   3638 C CD1   . LEU D 4 103 ? 40.108 6.828   11.251  1.00 64.71  ? 140 LEU B CD1   1 
ATOM   3639 C CD2   . LEU D 4 103 ? 38.224 5.345   10.569  1.00 63.66  ? 140 LEU B CD2   1 
ATOM   3640 N N     . HIS D 4 104 ? 39.529 8.186   14.247  1.00 62.75  ? 141 HIS B N     1 
ATOM   3641 C CA    . HIS D 4 104 ? 38.838 9.434   14.538  1.00 61.63  ? 141 HIS B CA    1 
ATOM   3642 C C     . HIS D 4 104 ? 38.161 9.878   13.257  1.00 61.37  ? 141 HIS B C     1 
ATOM   3643 O O     . HIS D 4 104 ? 38.800 9.987   12.215  1.00 60.94  ? 141 HIS B O     1 
ATOM   3644 C CB    . HIS D 4 104 ? 39.829 10.505  15.011  1.00 60.94  ? 141 HIS B CB    1 
ATOM   3645 C CG    . HIS D 4 104 ? 39.180 11.757  15.527  1.00 59.90  ? 141 HIS B CG    1 
ATOM   3646 N ND1   . HIS D 4 104 ? 39.433 12.262  16.785  1.00 59.46  ? 141 HIS B ND1   1 
ATOM   3647 C CD2   . HIS D 4 104 ? 38.308 12.617  14.948  1.00 59.43  ? 141 HIS B CD2   1 
ATOM   3648 C CE1   . HIS D 4 104 ? 38.745 13.377  16.959  1.00 59.10  ? 141 HIS B CE1   1 
ATOM   3649 N NE2   . HIS D 4 104 ? 38.054 13.614  15.858  1.00 59.32  ? 141 HIS B NE2   1 
ATOM   3650 N N     . VAL D 4 105 ? 36.858 10.110  13.337  1.00 61.52  ? 142 VAL B N     1 
ATOM   3651 C CA    . VAL D 4 105 ? 36.097 10.547  12.179  1.00 62.12  ? 142 VAL B CA    1 
ATOM   3652 C C     . VAL D 4 105 ? 36.036 12.073  12.122  1.00 62.48  ? 142 VAL B C     1 
ATOM   3653 O O     . VAL D 4 105 ? 36.040 12.747  13.149  1.00 62.06  ? 142 VAL B O     1 
ATOM   3654 C CB    . VAL D 4 105 ? 34.653 9.970   12.208  1.00 61.83  ? 142 VAL B CB    1 
ATOM   3655 C CG1   . VAL D 4 105 ? 33.976 10.328  13.511  1.00 61.78  ? 142 VAL B CG1   1 
ATOM   3656 C CG2   . VAL D 4 105 ? 33.844 10.508  11.035  1.00 61.85  ? 142 VAL B CG2   1 
ATOM   3657 N N     . THR D 4 106 ? 35.995 12.614  10.914  1.00 63.29  ? 143 THR B N     1 
ATOM   3658 C CA    . THR D 4 106 ? 35.914 14.052  10.742  1.00 64.62  ? 143 THR B CA    1 
ATOM   3659 C C     . THR D 4 106 ? 34.525 14.507  11.187  1.00 65.37  ? 143 THR B C     1 
ATOM   3660 O O     . THR D 4 106 ? 33.586 13.718  11.171  1.00 65.45  ? 143 THR B O     1 
ATOM   3661 C CB    . THR D 4 106 ? 36.137 14.434  9.271   1.00 64.83  ? 143 THR B CB    1 
ATOM   3662 O OG1   . THR D 4 106 ? 35.998 15.850  9.118   1.00 65.83  ? 143 THR B OG1   1 
ATOM   3663 C CG2   . THR D 4 106 ? 35.132 13.730  8.380   1.00 64.70  ? 143 THR B CG2   1 
ATOM   3664 N N     . LYS D 4 107 ? 34.394 15.773  11.579  1.00 66.55  ? 144 LYS B N     1 
ATOM   3665 C CA    . LYS D 4 107 ? 33.111 16.305  12.039  1.00 67.82  ? 144 LYS B CA    1 
ATOM   3666 C C     . LYS D 4 107 ? 32.014 16.314  10.989  1.00 68.57  ? 144 LYS B C     1 
ATOM   3667 O O     . LYS D 4 107 ? 30.872 15.982  11.283  1.00 68.35  ? 144 LYS B O     1 
ATOM   3668 C CB    . LYS D 4 107 ? 33.279 17.720  12.598  1.00 68.25  ? 144 LYS B CB    1 
ATOM   3669 C CG    . LYS D 4 107 ? 33.684 17.755  14.065  1.00 68.95  ? 144 LYS B CG    1 
ATOM   3670 C CD    . LYS D 4 107 ? 33.691 19.173  14.629  1.00 69.09  ? 144 LYS B CD    1 
ATOM   3671 C CE    . LYS D 4 107 ? 33.997 19.168  16.122  1.00 68.92  ? 144 LYS B CE    1 
ATOM   3672 N NZ    . LYS D 4 107 ? 35.305 18.510  16.407  1.00 68.77  ? 144 LYS B NZ    1 
ATOM   3673 N N     . LYS D 4 108 ? 32.347 16.711  9.768   1.00 69.64  ? 145 LYS B N     1 
ATOM   3674 C CA    . LYS D 4 108 ? 31.347 16.734  8.711   1.00 71.02  ? 145 LYS B CA    1 
ATOM   3675 C C     . LYS D 4 108 ? 30.806 15.325  8.503   1.00 71.47  ? 145 LYS B C     1 
ATOM   3676 O O     . LYS D 4 108 ? 29.606 15.135  8.296   1.00 71.69  ? 145 LYS B O     1 
ATOM   3677 C CB    . LYS D 4 108 ? 31.959 17.229  7.401   1.00 71.73  ? 145 LYS B CB    1 
ATOM   3678 C CG    . LYS D 4 108 ? 32.460 18.663  7.420   1.00 72.28  ? 145 LYS B CG    1 
ATOM   3679 C CD    . LYS D 4 108 ? 33.572 18.837  6.394   1.00 72.98  ? 145 LYS B CD    1 
ATOM   3680 C CE    . LYS D 4 108 ? 34.703 17.828  6.664   1.00 73.80  ? 145 LYS B CE    1 
ATOM   3681 N NZ    . LYS D 4 108 ? 35.928 18.004  5.826   1.00 73.81  ? 145 LYS B NZ    1 
ATOM   3682 N N     . LYS D 4 109 ? 31.696 14.337  8.566   1.00 71.94  ? 146 LYS B N     1 
ATOM   3683 C CA    . LYS D 4 109 ? 31.307 12.947  8.366   1.00 72.52  ? 146 LYS B CA    1 
ATOM   3684 C C     . LYS D 4 109 ? 30.740 12.221  9.582   1.00 72.93  ? 146 LYS B C     1 
ATOM   3685 O O     . LYS D 4 109 ? 30.631 10.995  9.576   1.00 72.76  ? 146 LYS B O     1 
ATOM   3686 C CB    . LYS D 4 109 ? 32.483 12.148  7.804   1.00 72.41  ? 146 LYS B CB    1 
ATOM   3687 C CG    . LYS D 4 109 ? 32.830 12.537  6.387   1.00 72.81  ? 146 LYS B CG    1 
ATOM   3688 C CD    . LYS D 4 109 ? 33.692 11.494  5.716   1.00 73.18  ? 146 LYS B CD    1 
ATOM   3689 C CE    . LYS D 4 109 ? 33.803 11.783  4.226   1.00 73.81  ? 146 LYS B CE    1 
ATOM   3690 N NZ    . LYS D 4 109 ? 32.460 11.887  3.568   1.00 74.13  ? 146 LYS B NZ    1 
ATOM   3691 N N     . VAL D 4 110 ? 30.371 12.964  10.619  1.00 73.46  ? 147 VAL B N     1 
ATOM   3692 C CA    . VAL D 4 110 ? 29.802 12.335  11.802  1.00 74.28  ? 147 VAL B CA    1 
ATOM   3693 C C     . VAL D 4 110 ? 28.391 11.829  11.479  1.00 74.92  ? 147 VAL B C     1 
ATOM   3694 O O     . VAL D 4 110 ? 28.119 10.627  11.560  1.00 74.96  ? 147 VAL B O     1 
ATOM   3695 C CB    . VAL D 4 110 ? 29.760 13.317  13.011  1.00 74.21  ? 147 VAL B CB    1 
ATOM   3696 C CG1   . VAL D 4 110 ? 29.033 14.592  12.635  1.00 74.69  ? 147 VAL B CG1   1 
ATOM   3697 C CG2   . VAL D 4 110 ? 29.077 12.655  14.195  1.00 73.92  ? 147 VAL B CG2   1 
ATOM   3698 N N     . PHE D 4 111 ? 27.503 12.741  11.094  1.00 75.56  ? 148 PHE B N     1 
ATOM   3699 C CA    . PHE D 4 111 ? 26.135 12.372  10.757  1.00 76.05  ? 148 PHE B CA    1 
ATOM   3700 C C     . PHE D 4 111 ? 26.089 11.213  9.767   1.00 76.17  ? 148 PHE B C     1 
ATOM   3701 O O     . PHE D 4 111 ? 25.308 10.279  9.932   1.00 76.20  ? 148 PHE B O     1 
ATOM   3702 C CB    . PHE D 4 111 ? 25.390 13.560  10.158  1.00 76.54  ? 148 PHE B CB    1 
ATOM   3703 C CG    . PHE D 4 111 ? 24.070 13.190  9.554   1.00 77.15  ? 148 PHE B CG    1 
ATOM   3704 C CD1   . PHE D 4 111 ? 23.050 12.673  10.349  1.00 77.37  ? 148 PHE B CD1   1 
ATOM   3705 C CD2   . PHE D 4 111 ? 23.853 13.328  8.187   1.00 77.36  ? 148 PHE B CD2   1 
ATOM   3706 C CE1   . PHE D 4 111 ? 21.830 12.299  9.790   1.00 77.38  ? 148 PHE B CE1   1 
ATOM   3707 C CE2   . PHE D 4 111 ? 22.638 12.958  7.618   1.00 77.39  ? 148 PHE B CE2   1 
ATOM   3708 C CZ    . PHE D 4 111 ? 21.624 12.441  8.422   1.00 77.50  ? 148 PHE B CZ    1 
ATOM   3709 N N     . GLU D 4 112 ? 26.918 11.286  8.731   1.00 76.36  ? 149 GLU B N     1 
ATOM   3710 C CA    . GLU D 4 112 ? 26.968 10.234  7.720   1.00 76.43  ? 149 GLU B CA    1 
ATOM   3711 C C     . GLU D 4 112 ? 27.306 8.904   8.388   1.00 76.15  ? 149 GLU B C     1 
ATOM   3712 O O     . GLU D 4 112 ? 26.456 8.024   8.499   1.00 76.14  ? 149 GLU B O     1 
ATOM   3713 C CB    . GLU D 4 112 ? 28.039 10.537  6.667   1.00 77.26  ? 149 GLU B CB    1 
ATOM   3714 C CG    . GLU D 4 112 ? 28.161 12.002  6.258   1.00 78.20  ? 149 GLU B CG    1 
ATOM   3715 C CD    . GLU D 4 112 ? 29.309 12.234  5.282   1.00 78.73  ? 149 GLU B CD    1 
ATOM   3716 O OE1   . GLU D 4 112 ? 29.708 13.406  5.095   1.00 79.01  ? 149 GLU B OE1   1 
ATOM   3717 O OE2   . GLU D 4 112 ? 29.808 11.244  4.698   1.00 78.61  ? 149 GLU B OE2   1 
ATOM   3718 N N     . THR D 4 113 ? 28.554 8.767   8.835   1.00 75.82  ? 150 THR B N     1 
ATOM   3719 C CA    . THR D 4 113 ? 29.003 7.542   9.484   1.00 75.33  ? 150 THR B CA    1 
ATOM   3720 C C     . THR D 4 113 ? 28.006 7.108   10.552  1.00 75.05  ? 150 THR B C     1 
ATOM   3721 O O     . THR D 4 113 ? 27.685 5.929   10.662  1.00 74.78  ? 150 THR B O     1 
ATOM   3722 C CB    . THR D 4 113 ? 30.408 7.713   10.136  1.00 75.36  ? 150 THR B CB    1 
ATOM   3723 O OG1   . THR D 4 113 ? 31.383 8.010   9.129   1.00 75.41  ? 150 THR B OG1   1 
ATOM   3724 C CG2   . THR D 4 113 ? 30.831 6.435   10.831  1.00 75.35  ? 150 THR B CG2   1 
ATOM   3725 N N     . LEU D 4 114 ? 27.505 8.061   11.329  1.00 74.82  ? 151 LEU B N     1 
ATOM   3726 C CA    . LEU D 4 114 ? 26.551 7.735   12.380  1.00 75.08  ? 151 LEU B CA    1 
ATOM   3727 C C     . LEU D 4 114 ? 25.339 6.967   11.855  1.00 75.58  ? 151 LEU B C     1 
ATOM   3728 O O     . LEU D 4 114 ? 25.167 5.790   12.167  1.00 75.89  ? 151 LEU B O     1 
ATOM   3729 C CB    . LEU D 4 114 ? 26.085 9.003   13.088  1.00 74.67  ? 151 LEU B CB    1 
ATOM   3730 C CG    . LEU D 4 114 ? 25.120 8.772   14.249  1.00 74.45  ? 151 LEU B CG    1 
ATOM   3731 C CD1   . LEU D 4 114 ? 25.768 7.908   15.316  1.00 74.65  ? 151 LEU B CD1   1 
ATOM   3732 C CD2   . LEU D 4 114 ? 24.728 10.107  14.829  1.00 75.02  ? 151 LEU B CD2   1 
ATOM   3733 N N     . GLU D 4 115 ? 24.499 7.626   11.061  1.00 76.12  ? 152 GLU B N     1 
ATOM   3734 C CA    . GLU D 4 115 ? 23.310 6.976   10.513  1.00 76.58  ? 152 GLU B CA    1 
ATOM   3735 C C     . GLU D 4 115 ? 23.660 5.664   9.820   1.00 76.67  ? 152 GLU B C     1 
ATOM   3736 O O     . GLU D 4 115 ? 22.871 4.720   9.828   1.00 76.44  ? 152 GLU B O     1 
ATOM   3737 C CB    . GLU D 4 115 ? 22.598 7.892   9.512   1.00 77.30  ? 152 GLU B CB    1 
ATOM   3738 C CG    . GLU D 4 115 ? 21.308 7.281   8.947   1.00 78.38  ? 152 GLU B CG    1 
ATOM   3739 C CD    . GLU D 4 115 ? 20.661 8.117   7.849   1.00 78.56  ? 152 GLU B CD    1 
ATOM   3740 O OE1   . GLU D 4 115 ? 20.377 9.310   8.094   1.00 78.76  ? 152 GLU B OE1   1 
ATOM   3741 O OE2   . GLU D 4 115 ? 20.431 7.574   6.746   1.00 78.19  ? 152 GLU B OE2   1 
ATOM   3742 N N     . ALA D 4 116 ? 24.847 5.612   9.219   1.00 76.98  ? 153 ALA B N     1 
ATOM   3743 C CA    . ALA D 4 116 ? 25.310 4.418   8.515   1.00 77.23  ? 153 ALA B CA    1 
ATOM   3744 C C     . ALA D 4 116 ? 25.722 3.298   9.475   1.00 77.32  ? 153 ALA B C     1 
ATOM   3745 O O     . ALA D 4 116 ? 25.806 2.134   9.082   1.00 77.13  ? 153 ALA B O     1 
ATOM   3746 C CB    . ALA D 4 116 ? 26.472 4.773   7.596   1.00 77.02  ? 153 ALA B CB    1 
ATOM   3747 N N     . ARG D 4 117 ? 25.992 3.650   10.729  1.00 77.49  ? 154 ARG B N     1 
ATOM   3748 C CA    . ARG D 4 117 ? 26.366 2.652   11.720  1.00 77.61  ? 154 ARG B CA    1 
ATOM   3749 C C     . ARG D 4 117 ? 25.200 2.427   12.666  1.00 78.46  ? 154 ARG B C     1 
ATOM   3750 O O     . ARG D 4 117 ? 25.292 1.658   13.619  1.00 78.78  ? 154 ARG B O     1 
ATOM   3751 C CB    . ARG D 4 117 ? 27.620 3.077   12.489  1.00 76.11  ? 154 ARG B CB    1 
ATOM   3752 C CG    . ARG D 4 117 ? 28.839 3.177   11.594  1.00 74.67  ? 154 ARG B CG    1 
ATOM   3753 C CD    . ARG D 4 117 ? 30.136 3.024   12.355  1.00 73.41  ? 154 ARG B CD    1 
ATOM   3754 N NE    . ARG D 4 117 ? 31.296 3.155   11.475  1.00 72.64  ? 154 ARG B NE    1 
ATOM   3755 C CZ    . ARG D 4 117 ? 31.515 2.408   10.393  1.00 72.18  ? 154 ARG B CZ    1 
ATOM   3756 N NH1   . ARG D 4 117 ? 30.648 1.463   10.046  1.00 71.75  ? 154 ARG B NH1   1 
ATOM   3757 N NH2   . ARG D 4 117 ? 32.604 2.604   9.658   1.00 70.97  ? 154 ARG B NH2   1 
ATOM   3758 N N     . MET D 4 118 ? 24.098 3.117   12.399  1.00 79.37  ? 155 MET B N     1 
ATOM   3759 C CA    . MET D 4 118 ? 22.900 2.945   13.198  1.00 80.47  ? 155 MET B CA    1 
ATOM   3760 C C     . MET D 4 118 ? 22.014 2.013   12.390  1.00 81.05  ? 155 MET B C     1 
ATOM   3761 O O     . MET D 4 118 ? 21.441 1.066   12.925  1.00 81.20  ? 155 MET B O     1 
ATOM   3762 C CB    . MET D 4 118 ? 22.186 4.276   13.427  1.00 80.63  ? 155 MET B CB    1 
ATOM   3763 C CG    . MET D 4 118 ? 22.942 5.248   14.305  1.00 81.13  ? 155 MET B CG    1 
ATOM   3764 S SD    . MET D 4 118 ? 21.828 6.448   15.055  1.00 82.24  ? 155 MET B SD    1 
ATOM   3765 C CE    . MET D 4 118 ? 20.936 7.011   13.621  1.00 81.92  ? 155 MET B CE    1 
ATOM   3766 N N     . THR D 4 119 ? 21.911 2.284   11.092  1.00 81.70  ? 156 THR B N     1 
ATOM   3767 C CA    . THR D 4 119 ? 21.114 1.444   10.211  1.00 82.43  ? 156 THR B CA    1 
ATOM   3768 C C     . THR D 4 119 ? 21.728 0.057   10.290  1.00 83.19  ? 156 THR B C     1 
ATOM   3769 O O     . THR D 4 119 ? 21.027 -0.934  10.497  1.00 83.32  ? 156 THR B O     1 
ATOM   3770 C CB    . THR D 4 119 ? 21.165 1.936   8.748   1.00 82.23  ? 156 THR B CB    1 
ATOM   3771 O OG1   . THR D 4 119 ? 22.527 2.022   8.314   1.00 81.78  ? 156 THR B OG1   1 
ATOM   3772 C CG2   . THR D 4 119 ? 20.512 3.300   8.623   1.00 82.18  ? 156 THR B CG2   1 
ATOM   3773 N N     . GLU D 4 120 ? 23.049 0.005   10.137  1.00 83.94  ? 157 GLU B N     1 
ATOM   3774 C CA    . GLU D 4 120 ? 23.800 -1.244  10.204  1.00 84.69  ? 157 GLU B CA    1 
ATOM   3775 C C     . GLU D 4 120 ? 23.542 -1.944  11.536  1.00 85.04  ? 157 GLU B C     1 
ATOM   3776 O O     . GLU D 4 120 ? 23.701 -3.156  11.652  1.00 84.99  ? 157 GLU B O     1 
ATOM   3777 C CB    . GLU D 4 120 ? 25.299 -0.961  10.050  1.00 84.96  ? 157 GLU B CB    1 
ATOM   3778 C CG    . GLU D 4 120 ? 25.857 -1.197  8.653   1.00 85.60  ? 157 GLU B CG    1 
ATOM   3779 C CD    . GLU D 4 120 ? 26.130 -2.668  8.371   1.00 86.31  ? 157 GLU B CD    1 
ATOM   3780 O OE1   . GLU D 4 120 ? 26.998 -3.256  9.057   1.00 86.46  ? 157 GLU B OE1   1 
ATOM   3781 O OE2   . GLU D 4 120 ? 25.478 -3.237  7.465   1.00 86.44  ? 157 GLU B OE2   1 
ATOM   3782 N N     . ALA D 4 121 ? 23.147 -1.170  12.541  1.00 85.48  ? 158 ALA B N     1 
ATOM   3783 C CA    . ALA D 4 121 ? 22.864 -1.716  13.863  1.00 85.82  ? 158 ALA B CA    1 
ATOM   3784 C C     . ALA D 4 121 ? 21.455 -2.282  13.888  1.00 86.04  ? 158 ALA B C     1 
ATOM   3785 O O     . ALA D 4 121 ? 21.018 -2.852  14.888  1.00 86.04  ? 158 ALA B O     1 
ATOM   3786 C CB    . ALA D 4 121 ? 23.006 -0.626  14.922  1.00 85.89  ? 158 ALA B CB    1 
ATOM   3787 N N     . CYS D 4 122 ? 20.748 -2.112  12.777  1.00 86.41  ? 159 CYS B N     1 
ATOM   3788 C CA    . CYS D 4 122 ? 19.383 -2.597  12.653  1.00 86.95  ? 159 CYS B CA    1 
ATOM   3789 C C     . CYS D 4 122 ? 19.294 -3.772  11.675  1.00 87.31  ? 159 CYS B C     1 
ATOM   3790 O O     . CYS D 4 122 ? 18.561 -4.734  11.918  1.00 87.10  ? 159 CYS B O     1 
ATOM   3791 C CB    . CYS D 4 122 ? 18.470 -1.450  12.215  1.00 86.93  ? 159 CYS B CB    1 
ATOM   3792 S SG    . CYS D 4 122 ? 18.381 -0.097  13.426  1.00 86.67  ? 159 CYS B SG    1 
ATOM   3793 N N     . ILE D 4 123 ? 20.040 -3.693  10.575  1.00 87.88  ? 160 ILE B N     1 
ATOM   3794 C CA    . ILE D 4 123 ? 20.050 -4.774  9.593   1.00 88.44  ? 160 ILE B CA    1 
ATOM   3795 C C     . ILE D 4 123 ? 21.170 -5.751  9.963   1.00 89.05  ? 160 ILE B C     1 
ATOM   3796 O O     . ILE D 4 123 ? 21.631 -6.537  9.133   1.00 89.12  ? 160 ILE B O     1 
ATOM   3797 C CB    . ILE D 4 123 ? 20.273 -4.256  8.135   1.00 88.23  ? 160 ILE B CB    1 
ATOM   3798 C CG1   . ILE D 4 123 ? 21.753 -3.965  7.878   1.00 88.34  ? 160 ILE B CG1   1 
ATOM   3799 C CG2   . ILE D 4 123 ? 19.466 -2.990  7.905   1.00 87.89  ? 160 ILE B CG2   1 
ATOM   3800 C CD1   . ILE D 4 123 ? 22.056 -3.583  6.435   1.00 88.21  ? 160 ILE B CD1   1 
ATOM   3801 N N     . ARG D 4 124 ? 21.601 -5.679  11.221  1.00 89.62  ? 161 ARG B N     1 
ATOM   3802 C CA    . ARG D 4 124 ? 22.649 -6.546  11.752  1.00 90.29  ? 161 ARG B CA    1 
ATOM   3803 C C     . ARG D 4 124 ? 22.302 -6.897  13.190  1.00 90.74  ? 161 ARG B C     1 
ATOM   3804 O O     . ARG D 4 124 ? 22.204 -6.025  14.053  1.00 90.70  ? 161 ARG B O     1 
ATOM   3805 C CB    . ARG D 4 124 ? 24.007 -5.849  11.706  1.00 90.49  ? 161 ARG B CB    1 
ATOM   3806 C CG    . ARG D 4 124 ? 24.961 -6.402  10.664  1.00 91.12  ? 161 ARG B CG    1 
ATOM   3807 C CD    . ARG D 4 124 ? 25.326 -7.844  10.971  1.00 91.75  ? 161 ARG B CD    1 
ATOM   3808 N NE    . ARG D 4 124 ? 26.397 -8.335  10.105  1.00 92.69  ? 161 ARG B NE    1 
ATOM   3809 C CZ    . ARG D 4 124 ? 26.984 -9.523  10.238  1.00 93.29  ? 161 ARG B CZ    1 
ATOM   3810 N NH1   . ARG D 4 124 ? 26.607 -10.349 11.208  1.00 93.74  ? 161 ARG B NH1   1 
ATOM   3811 N NH2   . ARG D 4 124 ? 27.947 -9.891  9.399   1.00 93.21  ? 161 ARG B NH2   1 
ATOM   3812 N N     . GLY D 4 125 ? 22.117 -8.185  13.440  1.00 91.36  ? 162 GLY B N     1 
ATOM   3813 C CA    . GLY D 4 125 ? 21.754 -8.635  14.768  1.00 91.95  ? 162 GLY B CA    1 
ATOM   3814 C C     . GLY D 4 125 ? 22.661 -8.214  15.908  1.00 92.40  ? 162 GLY B C     1 
ATOM   3815 O O     . GLY D 4 125 ? 22.231 -7.471  16.798  1.00 92.25  ? 162 GLY B O     1 
ATOM   3816 N N     . TYR D 4 126 ? 23.912 -8.681  15.877  1.00 92.84  ? 163 TYR B N     1 
ATOM   3817 C CA    . TYR D 4 126 ? 24.892 -8.402  16.934  1.00 92.98  ? 163 TYR B CA    1 
ATOM   3818 C C     . TYR D 4 126 ? 24.865 -7.003  17.548  1.00 92.77  ? 163 TYR B C     1 
ATOM   3819 O O     . TYR D 4 126 ? 25.439 -6.782  18.615  1.00 93.08  ? 163 TYR B O     1 
ATOM   3820 C CB    . TYR D 4 126 ? 26.318 -8.737  16.457  1.00 93.19  ? 163 TYR B CB    1 
ATOM   3821 C CG    . TYR D 4 126 ? 26.776 -8.016  15.211  1.00 93.63  ? 163 TYR B CG    1 
ATOM   3822 C CD1   . TYR D 4 126 ? 26.742 -6.625  15.132  1.00 93.58  ? 163 TYR B CD1   1 
ATOM   3823 C CD2   . TYR D 4 126 ? 27.264 -8.726  14.114  1.00 93.89  ? 163 TYR B CD2   1 
ATOM   3824 C CE1   . TYR D 4 126 ? 27.178 -5.952  13.992  1.00 93.81  ? 163 TYR B CE1   1 
ATOM   3825 C CE2   . TYR D 4 126 ? 27.706 -8.066  12.969  1.00 94.18  ? 163 TYR B CE2   1 
ATOM   3826 C CZ    . TYR D 4 126 ? 27.658 -6.677  12.912  1.00 94.27  ? 163 TYR B CZ    1 
ATOM   3827 O OH    . TYR D 4 126 ? 28.067 -6.017  11.771  1.00 94.41  ? 163 TYR B OH    1 
ATOM   3828 N N     . ASN D 4 127 ? 24.202 -6.065  16.883  1.00 92.20  ? 164 ASN B N     1 
ATOM   3829 C CA    . ASN D 4 127 ? 24.092 -4.705  17.393  1.00 91.53  ? 164 ASN B CA    1 
ATOM   3830 C C     . ASN D 4 127 ? 22.748 -4.564  18.105  1.00 90.87  ? 164 ASN B C     1 
ATOM   3831 O O     . ASN D 4 127 ? 21.709 -4.945  17.563  1.00 91.04  ? 164 ASN B O     1 
ATOM   3832 C CB    . ASN D 4 127 ? 24.190 -3.707  16.237  1.00 92.04  ? 164 ASN B CB    1 
ATOM   3833 C CG    . ASN D 4 127 ? 25.571 -3.680  15.606  1.00 92.17  ? 164 ASN B CG    1 
ATOM   3834 O OD1   . ASN D 4 127 ? 25.748 -3.223  14.476  1.00 92.21  ? 164 ASN B OD1   1 
ATOM   3835 N ND2   . ASN D 4 127 ? 26.562 -4.160  16.344  1.00 92.54  ? 164 ASN B ND2   1 
ATOM   3836 N N     . PRO D 4 128 ? 22.755 -4.036  19.341  1.00 90.07  ? 165 PRO B N     1 
ATOM   3837 C CA    . PRO D 4 128 ? 21.516 -3.859  20.104  1.00 89.63  ? 165 PRO B CA    1 
ATOM   3838 C C     . PRO D 4 128 ? 20.480 -2.972  19.415  1.00 89.40  ? 165 PRO B C     1 
ATOM   3839 O O     . PRO D 4 128 ? 20.499 -2.784  18.197  1.00 89.22  ? 165 PRO B O     1 
ATOM   3840 C CB    . PRO D 4 128 ? 22.010 -3.262  21.417  1.00 89.48  ? 165 PRO B CB    1 
ATOM   3841 C CG    . PRO D 4 128 ? 23.347 -3.928  21.588  1.00 89.30  ? 165 PRO B CG    1 
ATOM   3842 C CD    . PRO D 4 128 ? 23.930 -3.795  20.198  1.00 89.78  ? 165 PRO B CD    1 
ATOM   3843 N N     . GLY D 4 129 ? 19.565 -2.437  20.210  1.00 89.13  ? 166 GLY B N     1 
ATOM   3844 C CA    . GLY D 4 129 ? 18.536 -1.572  19.674  1.00 88.72  ? 166 GLY B CA    1 
ATOM   3845 C C     . GLY D 4 129 ? 18.252 -0.503  20.699  1.00 88.65  ? 166 GLY B C     1 
ATOM   3846 O O     . GLY D 4 129 ? 17.210 0.141   20.669  1.00 88.23  ? 166 GLY B O     1 
ATOM   3847 N N     . LEU D 4 130 ? 19.194 -0.337  21.623  1.00 88.92  ? 167 LEU B N     1 
ATOM   3848 C CA    . LEU D 4 130 ? 19.085 0.657   22.686  1.00 89.15  ? 167 LEU B CA    1 
ATOM   3849 C C     . LEU D 4 130 ? 20.174 1.708   22.486  1.00 89.23  ? 167 LEU B C     1 
ATOM   3850 O O     . LEU D 4 130 ? 20.229 2.719   23.190  1.00 88.92  ? 167 LEU B O     1 
ATOM   3851 C CB    . LEU D 4 130 ? 19.242 -0.013  24.054  1.00 89.11  ? 167 LEU B CB    1 
ATOM   3852 C CG    . LEU D 4 130 ? 18.253 -1.147  24.348  1.00 89.48  ? 167 LEU B CG    1 
ATOM   3853 C CD1   . LEU D 4 130 ? 18.507 -1.707  25.742  1.00 89.29  ? 167 LEU B CD1   1 
ATOM   3854 C CD2   . LEU D 4 130 ? 16.823 -0.631  24.228  1.00 89.42  ? 167 LEU B CD2   1 
ATOM   3855 N N     . LEU D 4 131 ? 21.039 1.448   21.510  1.00 89.43  ? 168 LEU B N     1 
ATOM   3856 C CA    . LEU D 4 131 ? 22.131 2.351   21.165  1.00 89.57  ? 168 LEU B CA    1 
ATOM   3857 C C     . LEU D 4 131 ? 21.694 3.212   19.980  1.00 89.96  ? 168 LEU B C     1 
ATOM   3858 O O     . LEU D 4 131 ? 22.301 4.242   19.683  1.00 90.00  ? 168 LEU B O     1 
ATOM   3859 C CB    . LEU D 4 131 ? 23.380 1.553   20.775  1.00 88.96  ? 168 LEU B CB    1 
ATOM   3860 C CG    . LEU D 4 131 ? 24.016 0.647   21.827  1.00 88.36  ? 168 LEU B CG    1 
ATOM   3861 C CD1   . LEU D 4 131 ? 25.194 -0.093  21.222  1.00 87.88  ? 168 LEU B CD1   1 
ATOM   3862 C CD2   . LEU D 4 131 ? 24.461 1.483   23.007  1.00 88.32  ? 168 LEU B CD2   1 
ATOM   3863 N N     . VAL D 4 132 ? 20.638 2.769   19.304  1.00 90.40  ? 169 VAL B N     1 
ATOM   3864 C CA    . VAL D 4 132 ? 20.098 3.472   18.148  1.00 90.81  ? 169 VAL B CA    1 
ATOM   3865 C C     . VAL D 4 132 ? 18.826 4.209   18.541  1.00 91.28  ? 169 VAL B C     1 
ATOM   3866 O O     . VAL D 4 132 ? 18.550 5.307   18.052  1.00 90.95  ? 169 VAL B O     1 
ATOM   3867 C CB    . VAL D 4 132 ? 19.779 2.483   17.003  1.00 90.70  ? 169 VAL B CB    1 
ATOM   3868 C CG1   . VAL D 4 132 ? 21.069 1.915   16.435  1.00 90.71  ? 169 VAL B CG1   1 
ATOM   3869 C CG2   . VAL D 4 132 ? 18.893 1.350   17.521  1.00 90.50  ? 169 VAL B CG2   1 
ATOM   3870 N N     . HIS D 4 133 ? 18.061 3.584   19.431  1.00 91.96  ? 170 HIS B N     1 
ATOM   3871 C CA    . HIS D 4 133 ? 16.809 4.131   19.935  1.00 92.91  ? 170 HIS B CA    1 
ATOM   3872 C C     . HIS D 4 133 ? 16.049 3.015   20.628  1.00 93.24  ? 170 HIS B C     1 
ATOM   3873 O O     . HIS D 4 133 ? 15.788 1.975   20.026  1.00 93.37  ? 170 HIS B O     1 
ATOM   3874 C CB    . HIS D 4 133 ? 15.947 4.675   18.800  1.00 93.57  ? 170 HIS B CB    1 
ATOM   3875 C CG    . HIS D 4 133 ? 14.880 5.618   19.261  1.00 94.73  ? 170 HIS B CG    1 
ATOM   3876 N ND1   . HIS D 4 133 ? 13.873 6.067   18.434  1.00 95.11  ? 170 HIS B ND1   1 
ATOM   3877 C CD2   . HIS D 4 133 ? 14.684 6.223   20.457  1.00 95.03  ? 170 HIS B CD2   1 
ATOM   3878 C CE1   . HIS D 4 133 ? 13.103 6.910   19.100  1.00 95.43  ? 170 HIS B CE1   1 
ATOM   3879 N NE2   . HIS D 4 133 ? 13.573 7.022   20.330  1.00 95.28  ? 170 HIS B NE2   1 
ATOM   3880 N N     . SER D 4 134 ? 15.692 3.238   21.889  1.00 93.60  ? 171 SER B N     1 
ATOM   3881 C CA    . SER D 4 134 ? 14.967 2.246   22.676  1.00 94.05  ? 171 SER B CA    1 
ATOM   3882 C C     . SER D 4 134 ? 13.726 1.710   21.959  1.00 94.34  ? 171 SER B C     1 
ATOM   3883 O O     . SER D 4 134 ? 13.457 0.506   21.979  1.00 94.44  ? 171 SER B O     1 
ATOM   3884 C CB    . SER D 4 134 ? 14.567 2.848   24.022  1.00 94.09  ? 171 SER B CB    1 
ATOM   3885 O OG    . SER D 4 134 ? 13.821 4.038   23.837  1.00 94.36  ? 171 SER B OG    1 
ATOM   3886 N N     . ASP D 4 135 ? 12.976 2.606   21.323  1.00 94.53  ? 172 ASP B N     1 
ATOM   3887 C CA    . ASP D 4 135 ? 11.761 2.232   20.601  1.00 94.64  ? 172 ASP B CA    1 
ATOM   3888 C C     . ASP D 4 135 ? 12.038 1.236   19.478  1.00 94.80  ? 172 ASP B C     1 
ATOM   3889 O O     . ASP D 4 135 ? 11.170 0.978   18.647  1.00 94.58  ? 172 ASP B O     1 
ATOM   3890 C CB    . ASP D 4 135 ? 11.102 3.482   20.014  1.00 94.72  ? 172 ASP B CB    1 
ATOM   3891 C CG    . ASP D 4 135 ? 10.664 4.470   21.081  1.00 95.15  ? 172 ASP B CG    1 
ATOM   3892 O OD1   . ASP D 4 135 ? 11.463 4.760   22.000  1.00 95.38  ? 172 ASP B OD1   1 
ATOM   3893 O OD2   . ASP D 4 135 ? 9.521  4.967   20.996  1.00 95.28  ? 172 ASP B OD2   1 
ATOM   3894 N N     . LEU D 4 136 ? 13.242 0.673   19.459  1.00 95.19  ? 173 LEU B N     1 
ATOM   3895 C CA    . LEU D 4 136 ? 13.621 -0.277  18.420  1.00 95.52  ? 173 LEU B CA    1 
ATOM   3896 C C     . LEU D 4 136 ? 14.247 -1.546  18.971  1.00 95.72  ? 173 LEU B C     1 
ATOM   3897 O O     . LEU D 4 136 ? 14.610 -2.435  18.204  1.00 95.71  ? 173 LEU B O     1 
ATOM   3898 C CB    . LEU D 4 136 ? 14.615 0.370   17.454  1.00 95.69  ? 173 LEU B CB    1 
ATOM   3899 C CG    . LEU D 4 136 ? 14.264 1.727   16.847  1.00 95.65  ? 173 LEU B CG    1 
ATOM   3900 C CD1   . LEU D 4 136 ? 15.410 2.182   15.959  1.00 95.73  ? 173 LEU B CD1   1 
ATOM   3901 C CD2   . LEU D 4 136 ? 12.976 1.621   16.052  1.00 95.73  ? 173 LEU B CD2   1 
ATOM   3902 N N     . ALA D 4 137 ? 14.388 -1.629  20.291  1.00 96.17  ? 174 ALA B N     1 
ATOM   3903 C CA    . ALA D 4 137 ? 14.985 -2.810  20.919  1.00 96.95  ? 174 ALA B CA    1 
ATOM   3904 C C     . ALA D 4 137 ? 14.478 -4.100  20.263  1.00 97.40  ? 174 ALA B C     1 
ATOM   3905 O O     . ALA D 4 137 ? 15.194 -5.105  20.195  1.00 97.32  ? 174 ALA B O     1 
ATOM   3906 C CB    . ALA D 4 137 ? 14.676 -2.822  22.420  1.00 96.67  ? 174 ALA B CB    1 
ATOM   3907 N N     . TYR D 4 138 ? 13.240 -4.052  19.776  1.00 97.95  ? 175 TYR B N     1 
ATOM   3908 C CA    . TYR D 4 138 ? 12.607 -5.189  19.117  1.00 98.18  ? 175 TYR B CA    1 
ATOM   3909 C C     . TYR D 4 138 ? 13.269 -5.454  17.768  1.00 98.07  ? 175 TYR B C     1 
ATOM   3910 O O     . TYR D 4 138 ? 12.612 -5.387  16.729  1.00 98.31  ? 175 TYR B O     1 
ATOM   3911 C CB    . TYR D 4 138 ? 11.117 -4.908  18.886  1.00 98.66  ? 175 TYR B CB    1 
ATOM   3912 C CG    . TYR D 4 138 ? 10.334 -4.507  20.121  1.00 99.50  ? 175 TYR B CG    1 
ATOM   3913 C CD1   . TYR D 4 138 ? 10.627 -3.327  20.813  1.00 99.62  ? 175 TYR B CD1   1 
ATOM   3914 C CD2   . TYR D 4 138 ? 9.268  -5.292  20.576  1.00 99.96  ? 175 TYR B CD2   1 
ATOM   3915 C CE1   . TYR D 4 138 ? 9.874  -2.935  21.925  1.00 100.12 ? 175 TYR B CE1   1 
ATOM   3916 C CE2   . TYR D 4 138 ? 8.508  -4.912  21.686  1.00 100.08 ? 175 TYR B CE2   1 
ATOM   3917 C CZ    . TYR D 4 138 ? 8.815  -3.734  22.353  1.00 100.31 ? 175 TYR B CZ    1 
ATOM   3918 O OH    . TYR D 4 138 ? 8.054  -3.353  23.436  1.00 100.56 ? 175 TYR B OH    1 
ATOM   3919 N N     . LEU D 4 139 ? 14.566 -5.744  17.784  1.00 97.80  ? 176 LEU B N     1 
ATOM   3920 C CA    . LEU D 4 139 ? 15.309 -6.017  16.557  1.00 97.74  ? 176 LEU B CA    1 
ATOM   3921 C C     . LEU D 4 139 ? 16.583 -6.784  16.886  1.00 97.80  ? 176 LEU B C     1 
ATOM   3922 O O     . LEU D 4 139 ? 17.392 -7.076  16.003  1.00 97.63  ? 176 LEU B O     1 
ATOM   3923 C CB    . LEU D 4 139 ? 15.682 -4.710  15.847  1.00 97.40  ? 176 LEU B CB    1 
ATOM   3924 C CG    . LEU D 4 139 ? 14.579 -3.792  15.314  1.00 97.41  ? 176 LEU B CG    1 
ATOM   3925 C CD1   . LEU D 4 139 ? 15.213 -2.520  14.784  1.00 97.50  ? 176 LEU B CD1   1 
ATOM   3926 C CD2   . LEU D 4 139 ? 13.785 -4.482  14.217  1.00 97.19  ? 176 LEU B CD2   1 
ATOM   3927 N N     . GLN D 4 140 ? 16.751 -7.103  18.165  1.00 97.92  ? 177 GLN B N     1 
ATOM   3928 C CA    . GLN D 4 140 ? 17.923 -7.823  18.638  1.00 98.18  ? 177 GLN B CA    1 
ATOM   3929 C C     . GLN D 4 140 ? 18.321 -8.963  17.714  1.00 98.65  ? 177 GLN B C     1 
ATOM   3930 O O     . GLN D 4 140 ? 17.524 -9.427  16.903  1.00 98.51  ? 177 GLN B O     1 
ATOM   3931 C CB    . GLN D 4 140 ? 17.663 -8.359  20.040  1.00 97.87  ? 177 GLN B CB    1 
ATOM   3932 C CG    . GLN D 4 140 ? 17.397 -7.267  21.051  1.00 97.86  ? 177 GLN B CG    1 
ATOM   3933 C CD    . GLN D 4 140 ? 16.773 -7.799  22.317  1.00 97.77  ? 177 GLN B CD    1 
ATOM   3934 O OE1   . GLN D 4 140 ? 15.691 -8.380  22.286  1.00 97.61  ? 177 GLN B OE1   1 
ATOM   3935 N NE2   . GLN D 4 140 ? 17.451 -7.606  23.440  1.00 98.08  ? 177 GLN B NE2   1 
ATOM   3936 N N     . ALA D 4 141 ? 19.566 -9.403  17.858  1.00 99.43  ? 178 ALA B N     1 
ATOM   3937 C CA    . ALA D 4 141 ? 20.146 -10.482 17.059  1.00 100.14 ? 178 ALA B CA    1 
ATOM   3938 C C     . ALA D 4 141 ? 19.161 -11.500 16.478  1.00 100.70 ? 178 ALA B C     1 
ATOM   3939 O O     . ALA D 4 141 ? 18.576 -12.310 17.205  1.00 100.41 ? 178 ALA B O     1 
ATOM   3940 C CB    . ALA D 4 141 ? 21.215 -11.208 17.881  1.00 100.00 ? 178 ALA B CB    1 
ATOM   3941 N N     . GLU D 4 142 ? 18.993 -11.453 15.157  1.00 101.48 ? 179 GLU B N     1 
ATOM   3942 C CA    . GLU D 4 142 ? 18.109 -12.375 14.452  1.00 102.12 ? 179 GLU B CA    1 
ATOM   3943 C C     . GLU D 4 142 ? 18.407 -12.397 12.945  1.00 102.54 ? 179 GLU B C     1 
ATOM   3944 O O     . GLU D 4 142 ? 18.096 -11.452 12.218  1.00 102.86 ? 179 GLU B O     1 
ATOM   3945 C CB    . GLU D 4 142 ? 16.628 -12.020 14.711  1.00 102.21 ? 179 GLU B CB    1 
ATOM   3946 C CG    . GLU D 4 142 ? 15.970 -11.015 13.751  1.00 102.49 ? 179 GLU B CG    1 
ATOM   3947 C CD    . GLU D 4 142 ? 16.341 -9.564  14.022  1.00 102.87 ? 179 GLU B CD    1 
ATOM   3948 O OE1   . GLU D 4 142 ? 17.536 -9.206  13.918  1.00 103.15 ? 179 GLU B OE1   1 
ATOM   3949 O OE2   . GLU D 4 142 ? 15.425 -8.776  14.339  1.00 102.79 ? 179 GLU B OE2   1 
ATOM   3950 N N     . GLY D 4 143 ? 19.042 -13.475 12.490  1.00 102.84 ? 180 GLY B N     1 
ATOM   3951 C CA    . GLY D 4 143 ? 19.361 -13.622 11.077  1.00 103.12 ? 180 GLY B CA    1 
ATOM   3952 C C     . GLY D 4 143 ? 20.311 -12.620 10.435  1.00 103.21 ? 180 GLY B C     1 
ATOM   3953 O O     . GLY D 4 143 ? 20.781 -11.673 11.071  1.00 103.16 ? 180 GLY B O     1 
ATOM   3954 N N     . GLY D 4 144 ? 20.589 -12.842 9.153   1.00 103.37 ? 181 GLY B N     1 
ATOM   3955 C CA    . GLY D 4 144 ? 21.484 -11.969 8.413   1.00 103.58 ? 181 GLY B CA    1 
ATOM   3956 C C     . GLY D 4 144 ? 21.218 -11.981 6.915   1.00 103.71 ? 181 GLY B C     1 
ATOM   3957 O O     . GLY D 4 144 ? 20.559 -12.885 6.397   1.00 103.77 ? 181 GLY B O     1 
ATOM   3958 N N     . GLY D 4 145 ? 21.743 -10.977 6.219   1.00 103.75 ? 182 GLY B N     1 
ATOM   3959 C CA    . GLY D 4 145 ? 21.543 -10.870 4.784   1.00 103.87 ? 182 GLY B CA    1 
ATOM   3960 C C     . GLY D 4 145 ? 20.921 -9.525  4.454   1.00 103.99 ? 182 GLY B C     1 
ATOM   3961 O O     . GLY D 4 145 ? 19.806 -9.232  4.889   1.00 103.89 ? 182 GLY B O     1 
ATOM   3962 N N     . ASP D 4 146 ? 21.637 -8.706  3.685   1.00 104.09 ? 183 ASP B N     1 
ATOM   3963 C CA    . ASP D 4 146 ? 21.158 -7.372  3.321   1.00 104.10 ? 183 ASP B CA    1 
ATOM   3964 C C     . ASP D 4 146 ? 19.732 -7.321  2.767   1.00 104.20 ? 183 ASP B C     1 
ATOM   3965 O O     . ASP D 4 146 ? 19.373 -8.056  1.843   1.00 104.20 ? 183 ASP B O     1 
ATOM   3966 C CB    . ASP D 4 146 ? 22.130 -6.703  2.333   1.00 103.64 ? 183 ASP B CB    1 
ATOM   3967 C CG    . ASP D 4 146 ? 23.003 -5.639  2.998   1.00 103.12 ? 183 ASP B CG    1 
ATOM   3968 O OD1   . ASP D 4 146 ? 23.739 -5.971  3.949   1.00 102.43 ? 183 ASP B OD1   1 
ATOM   3969 O OD2   . ASP D 4 146 ? 22.954 -4.467  2.569   1.00 102.69 ? 183 ASP B OD2   1 
ATOM   3970 N N     . ARG D 4 147 ? 18.933 -6.434  3.358   1.00 104.24 ? 184 ARG B N     1 
ATOM   3971 C CA    . ARG D 4 147 ? 17.538 -6.224  2.985   1.00 104.02 ? 184 ARG B CA    1 
ATOM   3972 C C     . ARG D 4 147 ? 17.161 -4.790  3.355   1.00 103.94 ? 184 ARG B C     1 
ATOM   3973 O O     . ARG D 4 147 ? 17.957 -4.074  3.964   1.00 103.84 ? 184 ARG B O     1 
ATOM   3974 C CB    . ARG D 4 147 ? 16.636 -7.193  3.746   1.00 104.00 ? 184 ARG B CB    1 
ATOM   3975 C CG    . ARG D 4 147 ? 16.718 -7.023  5.246   1.00 103.81 ? 184 ARG B CG    1 
ATOM   3976 C CD    . ARG D 4 147 ? 15.648 -7.821  5.946   1.00 104.10 ? 184 ARG B CD    1 
ATOM   3977 N NE    . ARG D 4 147 ? 15.619 -7.547  7.380   1.00 104.23 ? 184 ARG B NE    1 
ATOM   3978 C CZ    . ARG D 4 147 ? 15.439 -6.340  7.911   1.00 104.09 ? 184 ARG B CZ    1 
ATOM   3979 N NH1   . ARG D 4 147 ? 15.273 -5.280  7.129   1.00 103.85 ? 184 ARG B NH1   1 
ATOM   3980 N NH2   . ARG D 4 147 ? 15.415 -6.196  9.228   1.00 104.11 ? 184 ARG B NH2   1 
ATOM   3981 N N     . GLN D 4 148 ? 15.943 -4.381  3.008   1.00 103.99 ? 185 GLN B N     1 
ATOM   3982 C CA    . GLN D 4 148 ? 15.479 -3.026  3.303   1.00 103.86 ? 185 GLN B CA    1 
ATOM   3983 C C     . GLN D 4 148 ? 14.587 -2.946  4.551   1.00 103.57 ? 185 GLN B C     1 
ATOM   3984 O O     . GLN D 4 148 ? 13.577 -3.646  4.651   1.00 103.45 ? 185 GLN B O     1 
ATOM   3985 C CB    . GLN D 4 148 ? 14.725 -2.455  2.093   1.00 104.03 ? 185 GLN B CB    1 
ATOM   3986 C CG    . GLN D 4 148 ? 15.493 -2.538  0.773   1.00 103.90 ? 185 GLN B CG    1 
ATOM   3987 C CD    . GLN D 4 148 ? 14.811 -1.777  -0.356  1.00 104.04 ? 185 GLN B CD    1 
ATOM   3988 O OE1   . GLN D 4 148 ? 13.616 -1.948  -0.607  1.00 103.77 ? 185 GLN B OE1   1 
ATOM   3989 N NE2   . GLN D 4 148 ? 15.575 -0.935  -1.048  1.00 103.88 ? 185 GLN B NE2   1 
ATOM   3990 N N     . LEU D 4 149 ? 14.973 -2.087  5.494   1.00 103.22 ? 186 LEU B N     1 
ATOM   3991 C CA    . LEU D 4 149 ? 14.231 -1.880  6.740   1.00 102.59 ? 186 LEU B CA    1 
ATOM   3992 C C     . LEU D 4 149 ? 12.998 -1.028  6.459   1.00 102.31 ? 186 LEU B C     1 
ATOM   3993 O O     . LEU D 4 149 ? 13.042 -0.122  5.623   1.00 102.12 ? 186 LEU B O     1 
ATOM   3994 C CB    . LEU D 4 149 ? 15.104 -1.152  7.764   1.00 102.66 ? 186 LEU B CB    1 
ATOM   3995 C CG    . LEU D 4 149 ? 16.468 -1.745  8.120   1.00 102.54 ? 186 LEU B CG    1 
ATOM   3996 C CD1   . LEU D 4 149 ? 17.308 -0.697  8.839   1.00 102.38 ? 186 LEU B CD1   1 
ATOM   3997 C CD2   . LEU D 4 149 ? 16.281 -2.983  8.982   1.00 102.41 ? 186 LEU B CD2   1 
ATOM   3998 N N     . THR D 4 150 ? 11.909 -1.305  7.168   1.00 102.04 ? 187 THR B N     1 
ATOM   3999 C CA    . THR D 4 150 ? 10.669 -0.559  6.971   1.00 101.86 ? 187 THR B CA    1 
ATOM   4000 C C     . THR D 4 150 ? 10.920 0.939   6.835   1.00 101.70 ? 187 THR B C     1 
ATOM   4001 O O     . THR D 4 150 ? 11.602 1.544   7.659   1.00 101.46 ? 187 THR B O     1 
ATOM   4002 C CB    . THR D 4 150 ? 9.675  -0.801  8.130   1.00 101.78 ? 187 THR B CB    1 
ATOM   4003 O OG1   . THR D 4 150 ? 9.344  -2.194  8.189   1.00 101.63 ? 187 THR B OG1   1 
ATOM   4004 C CG2   . THR D 4 150 ? 8.398  0.009   7.925   1.00 101.59 ? 187 THR B CG2   1 
ATOM   4005 N N     . ASP D 4 151 ? 10.370 1.523   5.776   1.00 101.75 ? 188 ASP B N     1 
ATOM   4006 C CA    . ASP D 4 151 ? 10.523 2.947   5.514   1.00 101.96 ? 188 ASP B CA    1 
ATOM   4007 C C     . ASP D 4 151 ? 9.826  3.781   6.580   1.00 101.91 ? 188 ASP B C     1 
ATOM   4008 O O     . ASP D 4 151 ? 9.985  5.001   6.629   1.00 102.04 ? 188 ASP B O     1 
ATOM   4009 C CB    . ASP D 4 151 ? 9.966  3.289   4.131   1.00 102.17 ? 188 ASP B CB    1 
ATOM   4010 C CG    . ASP D 4 151 ? 10.797 2.693   3.011   1.00 102.48 ? 188 ASP B CG    1 
ATOM   4011 O OD1   . ASP D 4 151 ? 11.959 3.122   2.848   1.00 102.51 ? 188 ASP B OD1   1 
ATOM   4012 O OD2   . ASP D 4 151 ? 10.294 1.794   2.300   1.00 102.51 ? 188 ASP B OD2   1 
ATOM   4013 N N     . ARG D 4 152 ? 9.048  3.120   7.430   1.00 101.83 ? 189 ARG B N     1 
ATOM   4014 C CA    . ARG D 4 152 ? 8.351  3.809   8.508   1.00 101.69 ? 189 ARG B CA    1 
ATOM   4015 C C     . ARG D 4 152 ? 9.346  3.974   9.656   1.00 101.50 ? 189 ARG B C     1 
ATOM   4016 O O     . ARG D 4 152 ? 9.355  4.998   10.350  1.00 101.27 ? 189 ARG B O     1 
ATOM   4017 C CB    . ARG D 4 152 ? 7.151  2.986   8.983   1.00 101.77 ? 189 ARG B CB    1 
ATOM   4018 C CG    . ARG D 4 152 ? 6.343  3.656   10.086  1.00 102.01 ? 189 ARG B CG    1 
ATOM   4019 C CD    . ARG D 4 152 ? 5.535  2.642   10.891  1.00 102.02 ? 189 ARG B CD    1 
ATOM   4020 N NE    . ARG D 4 152 ? 6.387  1.691   11.611  1.00 102.05 ? 189 ARG B NE    1 
ATOM   4021 C CZ    . ARG D 4 152 ? 7.201  2.007   12.617  1.00 101.87 ? 189 ARG B CZ    1 
ATOM   4022 N NH1   . ARG D 4 152 ? 7.292  3.259   13.044  1.00 101.72 ? 189 ARG B NH1   1 
ATOM   4023 N NH2   . ARG D 4 152 ? 7.928  1.064   13.201  1.00 101.91 ? 189 ARG B NH2   1 
ATOM   4024 N N     . GLU D 4 153 ? 10.184 2.953   9.836   1.00 101.26 ? 190 GLU B N     1 
ATOM   4025 C CA    . GLU D 4 153 ? 11.202 2.942   10.884  1.00 100.86 ? 190 GLU B CA    1 
ATOM   4026 C C     . GLU D 4 153 ? 12.544 3.502   10.403  1.00 100.87 ? 190 GLU B C     1 
ATOM   4027 O O     . GLU D 4 153 ? 13.333 4.010   11.200  1.00 100.74 ? 190 GLU B O     1 
ATOM   4028 C CB    . GLU D 4 153 ? 11.392 1.514   11.424  1.00 100.51 ? 190 GLU B CB    1 
ATOM   4029 C CG    . GLU D 4 153 ? 11.474 0.425   10.352  1.00 99.84  ? 190 GLU B CG    1 
ATOM   4030 C CD    . GLU D 4 153 ? 11.831 -0.953  10.909  1.00 99.42  ? 190 GLU B CD    1 
ATOM   4031 O OE1   . GLU D 4 153 ? 11.212 -1.388  11.908  1.00 98.84  ? 190 GLU B OE1   1 
ATOM   4032 O OE2   . GLU D 4 153 ? 12.729 -1.608  10.335  1.00 98.93  ? 190 GLU B OE2   1 
ATOM   4033 N N     . LYS D 4 154 ? 12.799 3.412   9.100   1.00 100.82 ? 191 LYS B N     1 
ATOM   4034 C CA    . LYS D 4 154 ? 14.042 3.916   8.527   1.00 100.75 ? 191 LYS B CA    1 
ATOM   4035 C C     . LYS D 4 154 ? 14.154 5.428   8.712   1.00 101.12 ? 191 LYS B C     1 
ATOM   4036 O O     . LYS D 4 154 ? 15.255 5.968   8.802   1.00 101.21 ? 191 LYS B O     1 
ATOM   4037 C CB    . LYS D 4 154 ? 14.113 3.563   7.041   1.00 100.46 ? 191 LYS B CB    1 
ATOM   4038 C CG    . LYS D 4 154 ? 15.392 4.007   6.355   1.00 100.27 ? 191 LYS B CG    1 
ATOM   4039 C CD    . LYS D 4 154 ? 15.512 3.409   4.956   1.00 99.91  ? 191 LYS B CD    1 
ATOM   4040 C CE    . LYS D 4 154 ? 15.619 1.890   5.007   1.00 99.56  ? 191 LYS B CE    1 
ATOM   4041 N NZ    . LYS D 4 154 ? 15.816 1.284   3.662   1.00 99.14  ? 191 LYS B NZ    1 
ATOM   4042 N N     . GLU D 4 155 ? 13.010 6.105   8.771   1.00 101.71 ? 192 GLU B N     1 
ATOM   4043 C CA    . GLU D 4 155 ? 12.972 7.556   8.960   1.00 102.12 ? 192 GLU B CA    1 
ATOM   4044 C C     . GLU D 4 155 ? 13.433 7.932   10.368  1.00 102.03 ? 192 GLU B C     1 
ATOM   4045 O O     . GLU D 4 155 ? 14.266 8.821   10.535  1.00 102.26 ? 192 GLU B O     1 
ATOM   4046 C CB    . GLU D 4 155 ? 11.552 8.094   8.731   1.00 102.70 ? 192 GLU B CB    1 
ATOM   4047 C CG    . GLU D 4 155 ? 11.375 9.574   9.086   1.00 103.40 ? 192 GLU B CG    1 
ATOM   4048 C CD    . GLU D 4 155 ? 9.911  9.977   9.247   1.00 104.04 ? 192 GLU B CD    1 
ATOM   4049 O OE1   . GLU D 4 155 ? 9.194  9.323   10.037  1.00 104.17 ? 192 GLU B OE1   1 
ATOM   4050 O OE2   . GLU D 4 155 ? 9.478  10.950  8.591   1.00 104.30 ? 192 GLU B OE2   1 
ATOM   4051 N N     . ILE D 4 156 ? 12.886 7.262   11.380  1.00 101.75 ? 193 ILE B N     1 
ATOM   4052 C CA    . ILE D 4 156 ? 13.263 7.545   12.761  1.00 101.42 ? 193 ILE B CA    1 
ATOM   4053 C C     . ILE D 4 156 ? 14.755 7.276   12.944  1.00 101.18 ? 193 ILE B C     1 
ATOM   4054 O O     . ILE D 4 156 ? 15.381 7.795   13.869  1.00 101.02 ? 193 ILE B O     1 
ATOM   4055 C CB    . ILE D 4 156 ? 12.456 6.682   13.762  1.00 101.58 ? 193 ILE B CB    1 
ATOM   4056 C CG1   . ILE D 4 156 ? 12.783 5.201   13.565  1.00 101.61 ? 193 ILE B CG1   1 
ATOM   4057 C CG2   . ILE D 4 156 ? 10.960 6.932   13.576  1.00 101.72 ? 193 ILE B CG2   1 
ATOM   4058 C CD1   . ILE D 4 156 ? 11.970 4.268   14.435  1.00 101.64 ? 193 ILE B CD1   1 
ATOM   4059 N N     . ILE D 4 157 ? 15.318 6.461   12.055  1.00 100.88 ? 194 ILE B N     1 
ATOM   4060 C CA    . ILE D 4 157 ? 16.742 6.149   12.102  1.00 100.48 ? 194 ILE B CA    1 
ATOM   4061 C C     . ILE D 4 157 ? 17.505 7.399   11.681  1.00 100.13 ? 194 ILE B C     1 
ATOM   4062 O O     . ILE D 4 157 ? 18.446 7.817   12.350  1.00 100.19 ? 194 ILE B O     1 
ATOM   4063 C CB    . ILE D 4 157 ? 17.110 4.999   11.136  1.00 100.65 ? 194 ILE B CB    1 
ATOM   4064 C CG1   . ILE D 4 157 ? 16.419 3.701   11.571  1.00 100.78 ? 194 ILE B CG1   1 
ATOM   4065 C CG2   . ILE D 4 157 ? 18.624 4.820   11.094  1.00 100.48 ? 194 ILE B CG2   1 
ATOM   4066 C CD1   . ILE D 4 157 ? 16.853 3.183   12.927  1.00 100.53 ? 194 ILE B CD1   1 
ATOM   4067 N N     . ARG D 4 158 ? 17.088 7.995   10.568  1.00 99.73  ? 195 ARG B N     1 
ATOM   4068 C CA    . ARG D 4 158 ? 17.724 9.208   10.070  1.00 99.31  ? 195 ARG B CA    1 
ATOM   4069 C C     . ARG D 4 158 ? 17.378 10.366  11.006  1.00 98.70  ? 195 ARG B C     1 
ATOM   4070 O O     . ARG D 4 158 ? 17.922 11.460  10.882  1.00 98.73  ? 195 ARG B O     1 
ATOM   4071 C CB    . ARG D 4 158 ? 17.244 9.522   8.645   1.00 99.69  ? 195 ARG B CB    1 
ATOM   4072 C CG    . ARG D 4 158 ? 17.979 10.684  7.972   1.00 100.08 ? 195 ARG B CG    1 
ATOM   4073 C CD    . ARG D 4 158 ? 17.376 11.048  6.616   1.00 100.13 ? 195 ARG B CD    1 
ATOM   4074 N NE    . ARG D 4 158 ? 15.996 11.517  6.739   1.00 100.59 ? 195 ARG B NE    1 
ATOM   4075 C CZ    . ARG D 4 158 ? 15.624 12.572  7.460   1.00 100.90 ? 195 ARG B CZ    1 
ATOM   4076 N NH1   . ARG D 4 158 ? 16.529 13.275  8.128   1.00 101.20 ? 195 ARG B NH1   1 
ATOM   4077 N NH2   . ARG D 4 158 ? 14.345 12.923  7.522   1.00 100.90 ? 195 ARG B NH2   1 
ATOM   4078 N N     . GLN D 4 159 ? 16.468 10.118  11.941  1.00 98.10  ? 196 GLN B N     1 
ATOM   4079 C CA    . GLN D 4 159 ? 16.065 11.142  12.897  1.00 97.63  ? 196 GLN B CA    1 
ATOM   4080 C C     . GLN D 4 159 ? 16.912 11.053  14.155  1.00 97.15  ? 196 GLN B C     1 
ATOM   4081 O O     . GLN D 4 159 ? 17.276 12.073  14.738  1.00 97.19  ? 196 GLN B O     1 
ATOM   4082 C CB    . GLN D 4 159 ? 14.591 10.987  13.270  1.00 98.03  ? 196 GLN B CB    1 
ATOM   4083 C CG    . GLN D 4 159 ? 13.630 11.231  12.124  1.00 98.72  ? 196 GLN B CG    1 
ATOM   4084 C CD    . GLN D 4 159 ? 12.189 11.311  12.587  1.00 98.99  ? 196 GLN B CD    1 
ATOM   4085 O OE1   . GLN D 4 159 ? 11.830 12.180  13.386  1.00 99.16  ? 196 GLN B OE1   1 
ATOM   4086 N NE2   . GLN D 4 159 ? 11.354 10.403  12.090  1.00 98.96  ? 196 GLN B NE2   1 
ATOM   4087 N N     . ALA D 4 160 ? 17.214 9.829   14.576  1.00 96.43  ? 197 ALA B N     1 
ATOM   4088 C CA    . ALA D 4 160 ? 18.033 9.617   15.762  1.00 95.66  ? 197 ALA B CA    1 
ATOM   4089 C C     . ALA D 4 160 ? 19.427 10.162  15.476  1.00 95.11  ? 197 ALA B C     1 
ATOM   4090 O O     . ALA D 4 160 ? 20.050 10.787  16.333  1.00 95.02  ? 197 ALA B O     1 
ATOM   4091 C CB    . ALA D 4 160 ? 18.104 8.132   16.093  1.00 95.70  ? 197 ALA B CB    1 
ATOM   4092 N N     . ALA D 4 161 ? 19.902 9.927   14.257  1.00 94.43  ? 198 ALA B N     1 
ATOM   4093 C CA    . ALA D 4 161 ? 21.217 10.395  13.833  1.00 93.74  ? 198 ALA B CA    1 
ATOM   4094 C C     . ALA D 4 161 ? 21.316 11.902  14.000  1.00 93.21  ? 198 ALA B C     1 
ATOM   4095 O O     . ALA D 4 161 ? 22.219 12.405  14.665  1.00 93.37  ? 198 ALA B O     1 
ATOM   4096 C CB    . ALA D 4 161 ? 21.462 10.018  12.375  1.00 93.66  ? 198 ALA B CB    1 
ATOM   4097 N N     . VAL D 4 162 ? 20.380 12.621  13.395  1.00 92.43  ? 199 VAL B N     1 
ATOM   4098 C CA    . VAL D 4 162 ? 20.368 14.074  13.479  1.00 91.72  ? 199 VAL B CA    1 
ATOM   4099 C C     . VAL D 4 162 ? 20.331 14.575  14.921  1.00 91.28  ? 199 VAL B C     1 
ATOM   4100 O O     . VAL D 4 162 ? 20.954 15.589  15.245  1.00 91.43  ? 199 VAL B O     1 
ATOM   4101 C CB    . VAL D 4 162 ? 19.160 14.665  12.718  1.00 91.64  ? 199 VAL B CB    1 
ATOM   4102 C CG1   . VAL D 4 162 ? 19.091 16.172  12.937  1.00 91.60  ? 199 VAL B CG1   1 
ATOM   4103 C CG2   . VAL D 4 162 ? 19.280 14.352  11.231  1.00 91.43  ? 199 VAL B CG2   1 
ATOM   4104 N N     . GLN D 4 163 ? 19.614 13.862  15.787  1.00 90.46  ? 200 GLN B N     1 
ATOM   4105 C CA    . GLN D 4 163 ? 19.491 14.267  17.186  1.00 89.64  ? 200 GLN B CA    1 
ATOM   4106 C C     . GLN D 4 163 ? 20.639 13.783  18.069  1.00 88.70  ? 200 GLN B C     1 
ATOM   4107 O O     . GLN D 4 163 ? 20.765 14.210  19.219  1.00 88.68  ? 200 GLN B O     1 
ATOM   4108 C CB    . GLN D 4 163 ? 18.156 13.775  17.762  1.00 90.17  ? 200 GLN B CB    1 
ATOM   4109 C CG    . GLN D 4 163 ? 16.934 14.132  16.913  1.00 90.85  ? 200 GLN B CG    1 
ATOM   4110 C CD    . GLN D 4 163 ? 16.785 15.631  16.665  1.00 91.18  ? 200 GLN B CD    1 
ATOM   4111 O OE1   . GLN D 4 163 ? 17.695 16.287  16.151  1.00 91.09  ? 200 GLN B OE1   1 
ATOM   4112 N NE2   . GLN D 4 163 ? 15.628 16.175  17.025  1.00 91.38  ? 200 GLN B NE2   1 
ATOM   4113 N N     . GLN D 4 164 ? 21.477 12.900  17.533  1.00 87.46  ? 201 GLN B N     1 
ATOM   4114 C CA    . GLN D 4 164 ? 22.608 12.369  18.291  1.00 86.26  ? 201 GLN B CA    1 
ATOM   4115 C C     . GLN D 4 164 ? 23.937 12.844  17.716  1.00 85.36  ? 201 GLN B C     1 
ATOM   4116 O O     . GLN D 4 164 ? 25.004 12.562  18.266  1.00 85.11  ? 201 GLN B O     1 
ATOM   4117 C CB    . GLN D 4 164 ? 22.570 10.838  18.300  1.00 86.13  ? 201 GLN B CB    1 
ATOM   4118 C CG    . GLN D 4 164 ? 21.286 10.252  18.865  1.00 85.61  ? 201 GLN B CG    1 
ATOM   4119 C CD    . GLN D 4 164 ? 21.299 8.741   18.870  1.00 85.43  ? 201 GLN B CD    1 
ATOM   4120 O OE1   . GLN D 4 164 ? 22.054 8.118   19.615  1.00 85.33  ? 201 GLN B OE1   1 
ATOM   4121 N NE2   . GLN D 4 164 ? 20.465 8.141   18.029  1.00 85.37  ? 201 GLN B NE2   1 
ATOM   4122 N N     . THR D 4 165 ? 23.863 13.559  16.599  1.00 84.40  ? 202 THR B N     1 
ATOM   4123 C CA    . THR D 4 165 ? 25.052 14.092  15.951  1.00 83.30  ? 202 THR B CA    1 
ATOM   4124 C C     . THR D 4 165 ? 25.344 15.442  16.592  1.00 82.75  ? 202 THR B C     1 
ATOM   4125 O O     . THR D 4 165 ? 26.500 15.799  16.836  1.00 82.92  ? 202 THR B O     1 
ATOM   4126 C CB    . THR D 4 165 ? 24.825 14.315  14.432  1.00 82.87  ? 202 THR B CB    1 
ATOM   4127 O OG1   . THR D 4 165 ? 24.463 13.080  13.805  1.00 82.84  ? 202 THR B OG1   1 
ATOM   4128 C CG2   . THR D 4 165 ? 26.085 14.840  13.776  1.00 82.61  ? 202 THR B CG2   1 
ATOM   4129 N N     . LYS D 4 166 ? 24.272 16.172  16.882  1.00 81.76  ? 203 LYS B N     1 
ATOM   4130 C CA    . LYS D 4 166 ? 24.347 17.506  17.461  1.00 80.67  ? 203 LYS B CA    1 
ATOM   4131 C C     . LYS D 4 166 ? 25.174 17.686  18.733  1.00 79.82  ? 203 LYS B C     1 
ATOM   4132 O O     . LYS D 4 166 ? 25.753 18.751  18.937  1.00 80.19  ? 203 LYS B O     1 
ATOM   4133 C CB    . LYS D 4 166 ? 22.927 18.033  17.668  1.00 80.64  ? 203 LYS B CB    1 
ATOM   4134 C CG    . LYS D 4 166 ? 22.132 18.061  16.364  1.00 80.81  ? 203 LYS B CG    1 
ATOM   4135 C CD    . LYS D 4 166 ? 20.660 18.396  16.568  1.00 80.84  ? 203 LYS B CD    1 
ATOM   4136 C CE    . LYS D 4 166 ? 20.459 19.825  17.028  1.00 80.59  ? 203 LYS B CE    1 
ATOM   4137 N NZ    . LYS D 4 166 ? 19.014 20.113  17.213  1.00 80.34  ? 203 LYS B NZ    1 
ATOM   4138 N N     . GLU D 4 167 ? 25.252 16.670  19.584  1.00 78.77  ? 204 GLU B N     1 
ATOM   4139 C CA    . GLU D 4 167 ? 26.033 16.810  20.816  1.00 77.81  ? 204 GLU B CA    1 
ATOM   4140 C C     . GLU D 4 167 ? 27.018 15.667  21.061  1.00 76.26  ? 204 GLU B C     1 
ATOM   4141 O O     . GLU D 4 167 ? 27.286 15.305  22.210  1.00 76.07  ? 204 GLU B O     1 
ATOM   4142 C CB    . GLU D 4 167 ? 25.101 16.945  22.031  1.00 78.91  ? 204 GLU B CB    1 
ATOM   4143 C CG    . GLU D 4 167 ? 24.090 18.096  21.948  1.00 80.16  ? 204 GLU B CG    1 
ATOM   4144 C CD    . GLU D 4 167 ? 24.740 19.462  21.734  1.00 80.88  ? 204 GLU B CD    1 
ATOM   4145 O OE1   . GLU D 4 167 ? 25.606 19.855  22.550  1.00 81.03  ? 204 GLU B OE1   1 
ATOM   4146 O OE2   . GLU D 4 167 ? 24.376 20.145  20.749  1.00 80.81  ? 204 GLU B OE2   1 
ATOM   4147 N N     . MET D 4 168 ? 27.559 15.104  19.984  1.00 74.43  ? 205 MET B N     1 
ATOM   4148 C CA    . MET D 4 168 ? 28.509 14.006  20.103  1.00 72.34  ? 205 MET B CA    1 
ATOM   4149 C C     . MET D 4 168 ? 29.916 14.546  20.320  1.00 71.65  ? 205 MET B C     1 
ATOM   4150 O O     . MET D 4 168 ? 30.397 15.376  19.548  1.00 71.53  ? 205 MET B O     1 
ATOM   4151 C CB    . MET D 4 168 ? 28.489 13.127  18.849  1.00 71.04  ? 205 MET B CB    1 
ATOM   4152 C CG    . MET D 4 168 ? 29.330 11.866  18.988  1.00 69.53  ? 205 MET B CG    1 
ATOM   4153 S SD    . MET D 4 168 ? 29.457 10.887  17.489  1.00 67.46  ? 205 MET B SD    1 
ATOM   4154 C CE    . MET D 4 168 ? 27.827 10.180  17.409  1.00 68.51  ? 205 MET B CE    1 
ATOM   4155 N N     . ASP D 4 169 ? 30.564 14.070  21.382  1.00 70.73  ? 206 ASP B N     1 
ATOM   4156 C CA    . ASP D 4 169 ? 31.919 14.485  21.734  1.00 69.65  ? 206 ASP B CA    1 
ATOM   4157 C C     . ASP D 4 169 ? 32.914 13.497  21.135  1.00 68.95  ? 206 ASP B C     1 
ATOM   4158 O O     . ASP D 4 169 ? 33.012 12.359  21.583  1.00 69.20  ? 206 ASP B O     1 
ATOM   4159 C CB    . ASP D 4 169 ? 32.058 14.531  23.258  1.00 69.42  ? 206 ASP B CB    1 
ATOM   4160 C CG    . ASP D 4 169 ? 33.411 15.035  23.709  1.00 69.08  ? 206 ASP B CG    1 
ATOM   4161 O OD1   . ASP D 4 169 ? 33.609 15.167  24.933  1.00 69.16  ? 206 ASP B OD1   1 
ATOM   4162 O OD2   . ASP D 4 169 ? 34.277 15.296  22.849  1.00 68.64  ? 206 ASP B OD2   1 
ATOM   4163 N N     . LEU D 4 170 ? 33.655 13.947  20.129  1.00 68.21  ? 207 LEU B N     1 
ATOM   4164 C CA    . LEU D 4 170 ? 34.619 13.106  19.424  1.00 67.87  ? 207 LEU B CA    1 
ATOM   4165 C C     . LEU D 4 170 ? 35.970 12.906  20.118  1.00 67.76  ? 207 LEU B C     1 
ATOM   4166 O O     . LEU D 4 170 ? 36.815 12.151  19.631  1.00 67.96  ? 207 LEU B O     1 
ATOM   4167 C CB    . LEU D 4 170 ? 34.853 13.680  18.025  1.00 67.80  ? 207 LEU B CB    1 
ATOM   4168 C CG    . LEU D 4 170 ? 33.611 13.956  17.170  1.00 67.49  ? 207 LEU B CG    1 
ATOM   4169 C CD1   . LEU D 4 170 ? 33.965 14.926  16.058  1.00 67.36  ? 207 LEU B CD1   1 
ATOM   4170 C CD2   . LEU D 4 170 ? 33.061 12.658  16.606  1.00 66.99  ? 207 LEU B CD2   1 
ATOM   4171 N N     . SER D 4 171 ? 36.178 13.573  21.247  1.00 67.31  ? 208 SER B N     1 
ATOM   4172 C CA    . SER D 4 171 ? 37.439 13.455  21.973  1.00 66.54  ? 208 SER B CA    1 
ATOM   4173 C C     . SER D 4 171 ? 37.440 12.273  22.937  1.00 66.01  ? 208 SER B C     1 
ATOM   4174 O O     . SER D 4 171 ? 38.493 11.858  23.420  1.00 65.55  ? 208 SER B O     1 
ATOM   4175 C CB    . SER D 4 171 ? 37.717 14.745  22.751  1.00 66.77  ? 208 SER B CB    1 
ATOM   4176 O OG    . SER D 4 171 ? 36.741 14.957  23.759  1.00 66.34  ? 208 SER B OG    1 
ATOM   4177 N N     . VAL D 4 172 ? 36.253 11.740  23.211  1.00 65.61  ? 209 VAL B N     1 
ATOM   4178 C CA    . VAL D 4 172 ? 36.102 10.614  24.126  1.00 65.32  ? 209 VAL B CA    1 
ATOM   4179 C C     . VAL D 4 172 ? 35.140 9.564   23.583  1.00 65.06  ? 209 VAL B C     1 
ATOM   4180 O O     . VAL D 4 172 ? 34.123 9.898   22.977  1.00 64.74  ? 209 VAL B O     1 
ATOM   4181 C CB    . VAL D 4 172 ? 35.590 11.091  25.519  1.00 65.39  ? 209 VAL B CB    1 
ATOM   4182 C CG1   . VAL D 4 172 ? 34.286 11.852  25.365  1.00 64.87  ? 209 VAL B CG1   1 
ATOM   4183 C CG2   . VAL D 4 172 ? 35.399 9.900   26.451  1.00 64.91  ? 209 VAL B CG2   1 
ATOM   4184 N N     . VAL D 4 173 ? 35.478 8.294   23.801  1.00 65.04  ? 210 VAL B N     1 
ATOM   4185 C CA    . VAL D 4 173 ? 34.650 7.172   23.361  1.00 64.97  ? 210 VAL B CA    1 
ATOM   4186 C C     . VAL D 4 173 ? 34.670 6.076   24.416  1.00 65.39  ? 210 VAL B C     1 
ATOM   4187 O O     . VAL D 4 173 ? 35.476 6.102   25.346  1.00 65.20  ? 210 VAL B O     1 
ATOM   4188 C CB    . VAL D 4 173 ? 35.158 6.541   22.033  1.00 64.20  ? 210 VAL B CB    1 
ATOM   4189 C CG1   . VAL D 4 173 ? 35.327 7.615   20.970  1.00 64.28  ? 210 VAL B CG1   1 
ATOM   4190 C CG2   . VAL D 4 173 ? 36.459 5.796   22.269  1.00 63.81  ? 210 VAL B CG2   1 
ATOM   4191 N N     . ARG D 4 174 ? 33.780 5.107   24.268  1.00 65.98  ? 211 ARG B N     1 
ATOM   4192 C CA    . ARG D 4 174 ? 33.735 4.001   25.204  1.00 66.46  ? 211 ARG B CA    1 
ATOM   4193 C C     . ARG D 4 174 ? 33.586 2.667   24.491  1.00 66.44  ? 211 ARG B C     1 
ATOM   4194 O O     . ARG D 4 174 ? 33.226 2.605   23.313  1.00 65.74  ? 211 ARG B O     1 
ATOM   4195 C CB    . ARG D 4 174 ? 32.600 4.193   26.208  1.00 67.06  ? 211 ARG B CB    1 
ATOM   4196 C CG    . ARG D 4 174 ? 32.836 5.349   27.148  1.00 67.70  ? 211 ARG B CG    1 
ATOM   4197 C CD    . ARG D 4 174 ? 32.491 4.966   28.571  1.00 68.71  ? 211 ARG B CD    1 
ATOM   4198 N NE    . ARG D 4 174 ? 31.059 5.027   28.840  1.00 69.58  ? 211 ARG B NE    1 
ATOM   4199 C CZ    . ARG D 4 174 ? 30.496 4.599   29.966  1.00 69.94  ? 211 ARG B CZ    1 
ATOM   4200 N NH1   . ARG D 4 174 ? 31.245 4.069   30.931  1.00 69.29  ? 211 ARG B NH1   1 
ATOM   4201 N NH2   . ARG D 4 174 ? 29.186 4.718   30.136  1.00 70.38  ? 211 ARG B NH2   1 
ATOM   4202 N N     . LEU D 4 175 ? 33.898 1.603   25.219  1.00 66.97  ? 212 LEU B N     1 
ATOM   4203 C CA    . LEU D 4 175 ? 33.800 0.257   24.692  1.00 67.47  ? 212 LEU B CA    1 
ATOM   4204 C C     . LEU D 4 175 ? 32.533 -0.401  25.216  1.00 68.13  ? 212 LEU B C     1 
ATOM   4205 O O     . LEU D 4 175 ? 32.234 -0.355  26.413  1.00 67.87  ? 212 LEU B O     1 
ATOM   4206 C CB    . LEU D 4 175 ? 35.038 -0.558  25.081  1.00 67.09  ? 212 LEU B CB    1 
ATOM   4207 C CG    . LEU D 4 175 ? 36.205 -0.515  24.082  1.00 66.91  ? 212 LEU B CG    1 
ATOM   4208 C CD1   . LEU D 4 175 ? 36.495 0.912   23.658  1.00 66.68  ? 212 LEU B CD1   1 
ATOM   4209 C CD2   . LEU D 4 175 ? 37.433 -1.152  24.704  1.00 65.91  ? 212 LEU B CD2   1 
ATOM   4210 N N     . MET D 4 176 ? 31.786 -0.991  24.288  1.00 69.03  ? 213 MET B N     1 
ATOM   4211 C CA    . MET D 4 176 ? 30.533 -1.673  24.581  1.00 69.34  ? 213 MET B CA    1 
ATOM   4212 C C     . MET D 4 176 ? 30.727 -3.157  24.282  1.00 69.57  ? 213 MET B C     1 
ATOM   4213 O O     . MET D 4 176 ? 30.562 -3.591  23.141  1.00 69.58  ? 213 MET B O     1 
ATOM   4214 C CB    . MET D 4 176 ? 29.424 -1.100  23.690  1.00 69.52  ? 213 MET B CB    1 
ATOM   4215 C CG    . MET D 4 176 ? 28.046 -1.687  23.913  1.00 69.55  ? 213 MET B CG    1 
ATOM   4216 S SD    . MET D 4 176 ? 27.339 -1.165  25.463  1.00 69.57  ? 213 MET B SD    1 
ATOM   4217 C CE    . MET D 4 176 ? 28.080 -2.334  26.564  1.00 70.36  ? 213 MET B CE    1 
ATOM   4218 N N     . PHE D 4 177 ? 31.096 -3.927  25.303  1.00 69.80  ? 214 PHE B N     1 
ATOM   4219 C CA    . PHE D 4 177 ? 31.314 -5.365  25.145  1.00 69.95  ? 214 PHE B CA    1 
ATOM   4220 C C     . PHE D 4 177 ? 29.997 -6.140  25.213  1.00 70.67  ? 214 PHE B C     1 
ATOM   4221 O O     . PHE D 4 177 ? 29.176 -5.914  26.107  1.00 70.78  ? 214 PHE B O     1 
ATOM   4222 C CB    . PHE D 4 177 ? 32.237 -5.889  26.242  1.00 69.25  ? 214 PHE B CB    1 
ATOM   4223 C CG    . PHE D 4 177 ? 33.629 -5.326  26.202  1.00 68.88  ? 214 PHE B CG    1 
ATOM   4224 C CD1   . PHE D 4 177 ? 34.376 -5.356  25.028  1.00 68.61  ? 214 PHE B CD1   1 
ATOM   4225 C CD2   . PHE D 4 177 ? 34.221 -4.827  27.362  1.00 68.32  ? 214 PHE B CD2   1 
ATOM   4226 C CE1   . PHE D 4 177 ? 35.694 -4.906  25.011  1.00 68.28  ? 214 PHE B CE1   1 
ATOM   4227 C CE2   . PHE D 4 177 ? 35.534 -4.375  27.358  1.00 67.98  ? 214 PHE B CE2   1 
ATOM   4228 C CZ    . PHE D 4 177 ? 36.273 -4.414  26.183  1.00 68.21  ? 214 PHE B CZ    1 
ATOM   4229 N N     . THR D 4 178 ? 29.798 -7.055  24.270  1.00 71.44  ? 215 THR B N     1 
ATOM   4230 C CA    . THR D 4 178 ? 28.580 -7.860  24.248  1.00 72.26  ? 215 THR B CA    1 
ATOM   4231 C C     . THR D 4 178 ? 28.870 -9.304  23.848  1.00 72.98  ? 215 THR B C     1 
ATOM   4232 O O     . THR D 4 178 ? 29.629 -9.561  22.912  1.00 73.06  ? 215 THR B O     1 
ATOM   4233 C CB    . THR D 4 178 ? 27.539 -7.277  23.278  1.00 72.21  ? 215 THR B CB    1 
ATOM   4234 O OG1   . THR D 4 178 ? 27.176 -5.957  23.701  1.00 71.77  ? 215 THR B OG1   1 
ATOM   4235 C CG2   . THR D 4 178 ? 26.295 -8.152  23.253  1.00 72.39  ? 215 THR B CG2   1 
ATOM   4236 N N     . ALA D 4 179 ? 28.258 -10.245 24.564  1.00 73.77  ? 216 ALA B N     1 
ATOM   4237 C CA    . ALA D 4 179 ? 28.454 -11.666 24.290  1.00 74.44  ? 216 ALA B CA    1 
ATOM   4238 C C     . ALA D 4 179 ? 27.170 -12.378 23.874  1.00 74.66  ? 216 ALA B C     1 
ATOM   4239 O O     . ALA D 4 179 ? 26.130 -12.253 24.522  1.00 74.50  ? 216 ALA B O     1 
ATOM   4240 C CB    . ALA D 4 179 ? 29.055 -12.357 25.513  1.00 74.62  ? 216 ALA B CB    1 
ATOM   4241 N N     . PHE D 4 180 ? 27.261 -13.130 22.782  1.00 75.23  ? 217 PHE B N     1 
ATOM   4242 C CA    . PHE D 4 180 ? 26.131 -13.888 22.258  1.00 75.41  ? 217 PHE B CA    1 
ATOM   4243 C C     . PHE D 4 180 ? 26.472 -15.374 22.348  1.00 75.49  ? 217 PHE B C     1 
ATOM   4244 O O     . PHE D 4 180 ? 27.559 -15.792 21.939  1.00 75.70  ? 217 PHE B O     1 
ATOM   4245 C CB    . PHE D 4 180 ? 25.868 -13.496 20.802  1.00 75.35  ? 217 PHE B CB    1 
ATOM   4246 C CG    . PHE D 4 180 ? 25.502 -12.047 20.618  1.00 75.64  ? 217 PHE B CG    1 
ATOM   4247 C CD1   . PHE D 4 180 ? 24.307 -11.546 21.125  1.00 75.47  ? 217 PHE B CD1   1 
ATOM   4248 C CD2   . PHE D 4 180 ? 26.351 -11.181 19.931  1.00 75.73  ? 217 PHE B CD2   1 
ATOM   4249 C CE1   . PHE D 4 180 ? 23.962 -10.204 20.949  1.00 75.42  ? 217 PHE B CE1   1 
ATOM   4250 C CE2   . PHE D 4 180 ? 26.014 -9.839  19.751  1.00 75.25  ? 217 PHE B CE2   1 
ATOM   4251 C CZ    . PHE D 4 180 ? 24.818 -9.352  20.261  1.00 75.14  ? 217 PHE B CZ    1 
ATOM   4252 N N     . LEU D 4 181 ? 25.551 -16.166 22.894  1.00 75.22  ? 218 LEU B N     1 
ATOM   4253 C CA    . LEU D 4 181 ? 25.768 -17.603 23.042  1.00 75.12  ? 218 LEU B CA    1 
ATOM   4254 C C     . LEU D 4 181 ? 25.119 -18.375 21.898  1.00 75.13  ? 218 LEU B C     1 
ATOM   4255 O O     . LEU D 4 181 ? 24.390 -17.803 21.088  1.00 75.20  ? 218 LEU B O     1 
ATOM   4256 C CB    . LEU D 4 181 ? 25.174 -18.094 24.364  1.00 74.64  ? 218 LEU B CB    1 
ATOM   4257 C CG    . LEU D 4 181 ? 25.546 -17.342 25.637  1.00 74.52  ? 218 LEU B CG    1 
ATOM   4258 C CD1   . LEU D 4 181 ? 24.986 -18.084 26.846  1.00 73.89  ? 218 LEU B CD1   1 
ATOM   4259 C CD2   . LEU D 4 181 ? 27.061 -17.212 25.726  1.00 74.54  ? 218 LEU B CD2   1 
ATOM   4260 N N     . PRO D 4 182 ? 25.391 -19.689 21.811  1.00 75.06  ? 219 PRO B N     1 
ATOM   4261 C CA    . PRO D 4 182 ? 24.816 -20.532 20.761  1.00 75.17  ? 219 PRO B CA    1 
ATOM   4262 C C     . PRO D 4 182 ? 23.318 -20.628 21.007  1.00 75.41  ? 219 PRO B C     1 
ATOM   4263 O O     . PRO D 4 182 ? 22.895 -20.767 22.151  1.00 75.57  ? 219 PRO B O     1 
ATOM   4264 C CB    . PRO D 4 182 ? 25.499 -21.875 20.989  1.00 74.98  ? 219 PRO B CB    1 
ATOM   4265 C CG    . PRO D 4 182 ? 26.814 -21.494 21.575  1.00 74.90  ? 219 PRO B CG    1 
ATOM   4266 C CD    . PRO D 4 182 ? 26.427 -20.425 22.555  1.00 75.15  ? 219 PRO B CD    1 
ATOM   4267 N N     . ASP D 4 183 ? 22.509 -20.545 19.957  1.00 75.85  ? 220 ASP B N     1 
ATOM   4268 C CA    . ASP D 4 183 ? 21.069 -20.650 20.154  1.00 76.57  ? 220 ASP B CA    1 
ATOM   4269 C C     . ASP D 4 183 ? 20.584 -22.057 19.802  1.00 76.79  ? 220 ASP B C     1 
ATOM   4270 O O     . ASP D 4 183 ? 21.299 -23.039 20.025  1.00 76.75  ? 220 ASP B O     1 
ATOM   4271 C CB    . ASP D 4 183 ? 20.315 -19.583 19.335  1.00 76.91  ? 220 ASP B CB    1 
ATOM   4272 C CG    . ASP D 4 183 ? 20.503 -19.735 17.833  1.00 77.28  ? 220 ASP B CG    1 
ATOM   4273 O OD1   . ASP D 4 183 ? 19.896 -18.944 17.076  1.00 76.77  ? 220 ASP B OD1   1 
ATOM   4274 O OD2   . ASP D 4 183 ? 21.258 -20.633 17.406  1.00 77.88  ? 220 ASP B OD2   1 
ATOM   4275 N N     . SER D 4 184 ? 19.375 -22.156 19.258  1.00 76.83  ? 221 SER B N     1 
ATOM   4276 C CA    . SER D 4 184 ? 18.816 -23.450 18.895  1.00 76.79  ? 221 SER B CA    1 
ATOM   4277 C C     . SER D 4 184 ? 19.144 -23.838 17.458  1.00 77.02  ? 221 SER B C     1 
ATOM   4278 O O     . SER D 4 184 ? 19.159 -25.022 17.120  1.00 77.22  ? 221 SER B O     1 
ATOM   4279 C CB    . SER D 4 184 ? 17.302 -23.431 19.071  1.00 76.39  ? 221 SER B CB    1 
ATOM   4280 O OG    . SER D 4 184 ? 16.710 -22.508 18.177  1.00 76.47  ? 221 SER B OG    1 
ATOM   4281 N N     . THR D 4 185 ? 19.412 -22.845 16.616  1.00 76.99  ? 222 THR B N     1 
ATOM   4282 C CA    . THR D 4 185 ? 19.719 -23.106 15.216  1.00 77.00  ? 222 THR B CA    1 
ATOM   4283 C C     . THR D 4 185 ? 21.178 -22.844 14.870  1.00 76.82  ? 222 THR B C     1 
ATOM   4284 O O     . THR D 4 185 ? 21.507 -22.531 13.728  1.00 76.47  ? 222 THR B O     1 
ATOM   4285 C CB    . THR D 4 185 ? 18.846 -22.246 14.301  1.00 77.33  ? 222 THR B CB    1 
ATOM   4286 O OG1   . THR D 4 185 ? 19.392 -20.925 14.225  1.00 78.00  ? 222 THR B OG1   1 
ATOM   4287 C CG2   . THR D 4 185 ? 17.434 -22.163 14.853  1.00 77.14  ? 222 THR B CG2   1 
ATOM   4288 N N     . GLY D 4 186 ? 22.050 -22.971 15.861  1.00 77.06  ? 223 GLY B N     1 
ATOM   4289 C CA    . GLY D 4 186 ? 23.463 -22.747 15.625  1.00 77.88  ? 223 GLY B CA    1 
ATOM   4290 C C     . GLY D 4 186 ? 23.834 -21.305 15.325  1.00 78.23  ? 223 GLY B C     1 
ATOM   4291 O O     . GLY D 4 186 ? 24.929 -21.036 14.827  1.00 78.15  ? 223 GLY B O     1 
ATOM   4292 N N     . SER D 4 187 ? 22.929 -20.378 15.629  1.00 78.49  ? 224 SER B N     1 
ATOM   4293 C CA    . SER D 4 187 ? 23.160 -18.952 15.395  1.00 78.56  ? 224 SER B CA    1 
ATOM   4294 C C     . SER D 4 187 ? 23.426 -18.217 16.708  1.00 78.68  ? 224 SER B C     1 
ATOM   4295 O O     . SER D 4 187 ? 22.513 -18.039 17.513  1.00 78.65  ? 224 SER B O     1 
ATOM   4296 C CB    . SER D 4 187 ? 21.943 -18.321 14.705  1.00 78.23  ? 224 SER B CB    1 
ATOM   4297 O OG    . SER D 4 187 ? 21.695 -18.914 13.441  1.00 78.15  ? 224 SER B OG    1 
ATOM   4298 N N     . PHE D 4 188 ? 24.671 -17.787 16.912  1.00 78.69  ? 225 PHE B N     1 
ATOM   4299 C CA    . PHE D 4 188 ? 25.066 -17.068 18.127  1.00 78.71  ? 225 PHE B CA    1 
ATOM   4300 C C     . PHE D 4 188 ? 24.212 -15.826 18.397  1.00 78.48  ? 225 PHE B C     1 
ATOM   4301 O O     . PHE D 4 188 ? 24.654 -14.705 18.161  1.00 78.40  ? 225 PHE B O     1 
ATOM   4302 C CB    . PHE D 4 188 ? 26.532 -16.643 18.025  1.00 79.04  ? 225 PHE B CB    1 
ATOM   4303 C CG    . PHE D 4 188 ? 27.505 -17.789 18.013  1.00 79.36  ? 225 PHE B CG    1 
ATOM   4304 C CD1   . PHE D 4 188 ? 28.368 -17.972 16.935  1.00 79.54  ? 225 PHE B CD1   1 
ATOM   4305 C CD2   . PHE D 4 188 ? 27.600 -18.654 19.102  1.00 79.57  ? 225 PHE B CD2   1 
ATOM   4306 C CE1   . PHE D 4 188 ? 29.319 -18.998 16.941  1.00 79.57  ? 225 PHE B CE1   1 
ATOM   4307 C CE2   . PHE D 4 188 ? 28.546 -19.684 19.120  1.00 79.65  ? 225 PHE B CE2   1 
ATOM   4308 C CZ    . PHE D 4 188 ? 29.408 -19.854 18.036  1.00 79.67  ? 225 PHE B CZ    1 
ATOM   4309 N N     . THR D 4 189 ? 23.000 -16.022 18.908  1.00 78.56  ? 226 THR B N     1 
ATOM   4310 C CA    . THR D 4 189 ? 22.112 -14.900 19.182  1.00 78.77  ? 226 THR B CA    1 
ATOM   4311 C C     . THR D 4 189 ? 21.565 -14.857 20.597  1.00 78.88  ? 226 THR B C     1 
ATOM   4312 O O     . THR D 4 189 ? 20.625 -14.112 20.874  1.00 78.15  ? 226 THR B O     1 
ATOM   4313 C CB    . THR D 4 189 ? 20.916 -14.878 18.210  1.00 79.04  ? 226 THR B CB    1 
ATOM   4314 O OG1   . THR D 4 189 ? 20.299 -16.171 18.177  1.00 79.20  ? 226 THR B OG1   1 
ATOM   4315 C CG2   . THR D 4 189 ? 21.371 -14.487 16.811  1.00 78.98  ? 226 THR B CG2   1 
ATOM   4316 N N     . ARG D 4 190 ? 22.138 -15.660 21.489  1.00 79.55  ? 227 ARG B N     1 
ATOM   4317 C CA    . ARG D 4 190 ? 21.700 -15.660 22.884  1.00 80.48  ? 227 ARG B CA    1 
ATOM   4318 C C     . ARG D 4 190 ? 22.481 -14.523 23.565  1.00 80.57  ? 227 ARG B C     1 
ATOM   4319 O O     . ARG D 4 190 ? 23.596 -14.716 24.061  1.00 80.56  ? 227 ARG B O     1 
ATOM   4320 C CB    . ARG D 4 190 ? 22.005 -17.010 23.554  1.00 81.27  ? 227 ARG B CB    1 
ATOM   4321 C CG    . ARG D 4 190 ? 21.086 -17.350 24.731  1.00 82.47  ? 227 ARG B CG    1 
ATOM   4322 C CD    . ARG D 4 190 ? 20.953 -16.163 25.702  1.00 83.89  ? 227 ARG B CD    1 
ATOM   4323 N NE    . ARG D 4 190 ? 19.976 -16.384 26.774  1.00 84.45  ? 227 ARG B NE    1 
ATOM   4324 C CZ    . ARG D 4 190 ? 19.506 -15.422 27.569  1.00 84.53  ? 227 ARG B CZ    1 
ATOM   4325 N NH1   . ARG D 4 190 ? 19.918 -14.166 27.420  1.00 84.26  ? 227 ARG B NH1   1 
ATOM   4326 N NH2   . ARG D 4 190 ? 18.622 -15.714 28.515  1.00 84.41  ? 227 ARG B NH2   1 
ATOM   4327 N N     . ARG D 4 191 ? 21.875 -13.337 23.567  1.00 80.47  ? 228 ARG B N     1 
ATOM   4328 C CA    . ARG D 4 191 ? 22.468 -12.119 24.125  1.00 80.10  ? 228 ARG B CA    1 
ATOM   4329 C C     . ARG D 4 191 ? 22.575 -12.066 25.646  1.00 79.71  ? 228 ARG B C     1 
ATOM   4330 O O     . ARG D 4 191 ? 21.606 -12.311 26.366  1.00 79.39  ? 228 ARG B O     1 
ATOM   4331 C CB    . ARG D 4 191 ? 21.670 -10.902 23.636  1.00 80.34  ? 228 ARG B CB    1 
ATOM   4332 C CG    . ARG D 4 191 ? 22.223 -9.541  24.041  1.00 80.62  ? 228 ARG B CG    1 
ATOM   4333 C CD    . ARG D 4 191 ? 21.261 -8.433  23.622  1.00 81.06  ? 228 ARG B CD    1 
ATOM   4334 N NE    . ARG D 4 191 ? 21.764 -7.097  23.931  1.00 81.86  ? 228 ARG B NE    1 
ATOM   4335 C CZ    . ARG D 4 191 ? 21.068 -5.973  23.758  1.00 82.55  ? 228 ARG B CZ    1 
ATOM   4336 N NH1   . ARG D 4 191 ? 19.830 -6.021  23.276  1.00 82.53  ? 228 ARG B NH1   1 
ATOM   4337 N NH2   . ARG D 4 191 ? 21.607 -4.797  24.067  1.00 82.45  ? 228 ARG B NH2   1 
ATOM   4338 N N     . LEU D 4 192 ? 23.770 -11.728 26.117  1.00 79.42  ? 229 LEU B N     1 
ATOM   4339 C CA    . LEU D 4 192 ? 24.043 -11.596 27.542  1.00 79.09  ? 229 LEU B CA    1 
ATOM   4340 C C     . LEU D 4 192 ? 24.192 -10.113 27.855  1.00 78.85  ? 229 LEU B C     1 
ATOM   4341 O O     . LEU D 4 192 ? 24.726 -9.353  27.046  1.00 78.79  ? 229 LEU B O     1 
ATOM   4342 C CB    . LEU D 4 192 ? 25.341 -12.316 27.918  1.00 79.07  ? 229 LEU B CB    1 
ATOM   4343 C CG    . LEU D 4 192 ? 25.433 -13.833 27.771  1.00 78.74  ? 229 LEU B CG    1 
ATOM   4344 C CD1   . LEU D 4 192 ? 26.813 -14.284 28.229  1.00 78.43  ? 229 LEU B CD1   1 
ATOM   4345 C CD2   . LEU D 4 192 ? 24.344 -14.509 28.594  1.00 78.60  ? 229 LEU B CD2   1 
ATOM   4346 N N     . GLU D 4 193 ? 23.723 -9.708  29.031  1.00 78.59  ? 230 GLU B N     1 
ATOM   4347 C CA    . GLU D 4 193 ? 23.800 -8.316  29.457  1.00 78.12  ? 230 GLU B CA    1 
ATOM   4348 C C     . GLU D 4 193 ? 25.138 -7.698  29.039  1.00 77.23  ? 230 GLU B C     1 
ATOM   4349 O O     . GLU D 4 193 ? 26.201 -8.183  29.438  1.00 77.13  ? 230 GLU B O     1 
ATOM   4350 C CB    . GLU D 4 193 ? 23.644 -8.238  30.978  1.00 78.92  ? 230 GLU B CB    1 
ATOM   4351 C CG    . GLU D 4 193 ? 23.368 -6.844  31.501  1.00 80.61  ? 230 GLU B CG    1 
ATOM   4352 C CD    . GLU D 4 193 ? 22.011 -6.317  31.060  1.00 81.78  ? 230 GLU B CD    1 
ATOM   4353 O OE1   . GLU D 4 193 ? 20.981 -6.773  31.608  1.00 82.16  ? 230 GLU B OE1   1 
ATOM   4354 O OE2   . GLU D 4 193 ? 21.974 -5.450  30.157  1.00 82.61  ? 230 GLU B OE2   1 
ATOM   4355 N N     . PRO D 4 194 ? 25.101 -6.635  28.207  1.00 76.26  ? 231 PRO B N     1 
ATOM   4356 C CA    . PRO D 4 194 ? 26.306 -5.941  27.727  1.00 75.18  ? 231 PRO B CA    1 
ATOM   4357 C C     . PRO D 4 194 ? 26.989 -5.151  28.844  1.00 74.39  ? 231 PRO B C     1 
ATOM   4358 O O     . PRO D 4 194 ? 26.355 -4.800  29.845  1.00 74.41  ? 231 PRO B O     1 
ATOM   4359 C CB    . PRO D 4 194 ? 25.767 -5.019  26.634  1.00 75.07  ? 231 PRO B CB    1 
ATOM   4360 C CG    . PRO D 4 194 ? 24.532 -5.715  26.166  1.00 75.41  ? 231 PRO B CG    1 
ATOM   4361 C CD    . PRO D 4 194 ? 23.916 -6.183  27.458  1.00 75.85  ? 231 PRO B CD    1 
ATOM   4362 N N     . VAL D 4 195 ? 28.276 -4.864  28.672  1.00 73.31  ? 232 VAL B N     1 
ATOM   4363 C CA    . VAL D 4 195 ? 29.029 -4.116  29.679  1.00 72.23  ? 232 VAL B CA    1 
ATOM   4364 C C     . VAL D 4 195 ? 29.953 -3.053  29.074  1.00 71.69  ? 232 VAL B C     1 
ATOM   4365 O O     . VAL D 4 195 ? 30.863 -3.370  28.305  1.00 71.45  ? 232 VAL B O     1 
ATOM   4366 C CB    . VAL D 4 195 ? 29.873 -5.071  30.564  1.00 71.90  ? 232 VAL B CB    1 
ATOM   4367 C CG1   . VAL D 4 195 ? 28.956 -6.035  31.298  1.00 71.38  ? 232 VAL B CG1   1 
ATOM   4368 C CG2   . VAL D 4 195 ? 30.870 -5.840  29.713  1.00 71.51  ? 232 VAL B CG2   1 
ATOM   4369 N N     . VAL D 4 196 ? 29.707 -1.791  29.429  1.00 70.98  ? 233 VAL B N     1 
ATOM   4370 C CA    . VAL D 4 196 ? 30.504 -0.663  28.941  1.00 69.66  ? 233 VAL B CA    1 
ATOM   4371 C C     . VAL D 4 196 ? 31.792 -0.509  29.747  1.00 68.86  ? 233 VAL B C     1 
ATOM   4372 O O     . VAL D 4 196 ? 31.832 -0.826  30.936  1.00 68.54  ? 233 VAL B O     1 
ATOM   4373 C CB    . VAL D 4 196 ? 29.718 0.657   29.034  1.00 69.67  ? 233 VAL B CB    1 
ATOM   4374 C CG1   . VAL D 4 196 ? 28.489 0.590   28.143  1.00 70.10  ? 233 VAL B CG1   1 
ATOM   4375 C CG2   . VAL D 4 196 ? 29.319 0.925   30.482  1.00 69.35  ? 233 VAL B CG2   1 
ATOM   4376 N N     . SER D 4 197 ? 32.839 -0.010  29.098  1.00 67.80  ? 234 SER B N     1 
ATOM   4377 C CA    . SER D 4 197 ? 34.128 0.166   29.753  1.00 66.82  ? 234 SER B CA    1 
ATOM   4378 C C     . SER D 4 197 ? 34.341 1.570   30.317  1.00 66.73  ? 234 SER B C     1 
ATOM   4379 O O     . SER D 4 197 ? 33.411 2.378   30.402  1.00 66.09  ? 234 SER B O     1 
ATOM   4380 C CB    . SER D 4 197 ? 35.256 -0.151  28.769  1.00 66.20  ? 234 SER B CB    1 
ATOM   4381 O OG    . SER D 4 197 ? 35.275 0.777   27.702  1.00 65.01  ? 234 SER B OG    1 
ATOM   4382 N N     . ASP D 4 198 ? 35.585 1.835   30.715  1.00 66.90  ? 235 ASP B N     1 
ATOM   4383 C CA    . ASP D 4 198 ? 35.993 3.131   31.256  1.00 66.46  ? 235 ASP B CA    1 
ATOM   4384 C C     . ASP D 4 198 ? 36.207 4.057   30.068  1.00 65.99  ? 235 ASP B C     1 
ATOM   4385 O O     . ASP D 4 198 ? 36.748 3.645   29.048  1.00 65.97  ? 235 ASP B O     1 
ATOM   4386 C CB    . ASP D 4 198 ? 37.301 2.989   32.039  1.00 66.31  ? 235 ASP B CB    1 
ATOM   4387 C CG    . ASP D 4 198 ? 37.109 2.319   33.389  1.00 66.16  ? 235 ASP B CG    1 
ATOM   4388 O OD1   . ASP D 4 198 ? 38.126 1.934   34.008  1.00 65.90  ? 235 ASP B OD1   1 
ATOM   4389 O OD2   . ASP D 4 198 ? 35.948 2.188   33.836  1.00 65.98  ? 235 ASP B OD2   1 
ATOM   4390 N N     . ALA D 4 199 ? 35.788 5.307   30.198  1.00 65.58  ? 236 ALA B N     1 
ATOM   4391 C CA    . ALA D 4 199 ? 35.929 6.254   29.101  1.00 65.35  ? 236 ALA B CA    1 
ATOM   4392 C C     . ALA D 4 199 ? 37.365 6.417   28.595  1.00 65.23  ? 236 ALA B C     1 
ATOM   4393 O O     . ALA D 4 199 ? 38.283 6.684   29.371  1.00 65.10  ? 236 ALA B O     1 
ATOM   4394 C CB    . ALA D 4 199 ? 35.367 7.605   29.518  1.00 65.12  ? 236 ALA B CB    1 
ATOM   4395 N N     . ILE D 4 200 ? 37.554 6.246   27.288  1.00 65.04  ? 237 ILE B N     1 
ATOM   4396 C CA    . ILE D 4 200 ? 38.871 6.409   26.677  1.00 64.86  ? 237 ILE B CA    1 
ATOM   4397 C C     . ILE D 4 200 ? 38.979 7.836   26.151  1.00 64.78  ? 237 ILE B C     1 
ATOM   4398 O O     . ILE D 4 200 ? 38.103 8.308   25.418  1.00 64.09  ? 237 ILE B O     1 
ATOM   4399 C CB    . ILE D 4 200 ? 39.088 5.443   25.491  1.00 65.09  ? 237 ILE B CB    1 
ATOM   4400 C CG1   . ILE D 4 200 ? 39.107 4.000   25.986  1.00 65.44  ? 237 ILE B CG1   1 
ATOM   4401 C CG2   . ILE D 4 200 ? 40.407 5.757   24.792  1.00 64.66  ? 237 ILE B CG2   1 
ATOM   4402 C CD1   . ILE D 4 200 ? 39.247 2.989   24.875  1.00 65.42  ? 237 ILE B CD1   1 
ATOM   4403 N N     . TYR D 4 201 ? 40.056 8.521   26.528  1.00 64.73  ? 238 TYR B N     1 
ATOM   4404 C CA    . TYR D 4 201 ? 40.259 9.894   26.089  1.00 64.66  ? 238 TYR B CA    1 
ATOM   4405 C C     . TYR D 4 201 ? 41.396 10.014  25.082  1.00 64.66  ? 238 TYR B C     1 
ATOM   4406 O O     . TYR D 4 201 ? 42.495 9.487   25.291  1.00 64.52  ? 238 TYR B O     1 
ATOM   4407 C CB    . TYR D 4 201 ? 40.524 10.804  27.290  1.00 64.63  ? 238 TYR B CB    1 
ATOM   4408 C CG    . TYR D 4 201 ? 39.447 10.738  28.350  1.00 64.42  ? 238 TYR B CG    1 
ATOM   4409 C CD1   . TYR D 4 201 ? 39.449 9.728   29.317  1.00 64.33  ? 238 TYR B CD1   1 
ATOM   4410 C CD2   . TYR D 4 201 ? 38.400 11.656  28.359  1.00 64.23  ? 238 TYR B CD2   1 
ATOM   4411 C CE1   . TYR D 4 201 ? 38.429 9.634   30.263  1.00 64.08  ? 238 TYR B CE1   1 
ATOM   4412 C CE2   . TYR D 4 201 ? 37.376 11.571  29.297  1.00 64.15  ? 238 TYR B CE2   1 
ATOM   4413 C CZ    . TYR D 4 201 ? 37.391 10.559  30.244  1.00 64.07  ? 238 TYR B CZ    1 
ATOM   4414 O OH    . TYR D 4 201 ? 36.350 10.463  31.143  1.00 63.49  ? 238 TYR B OH    1 
ATOM   4415 N N     . ASP D 4 202 ? 41.109 10.718  23.990  1.00 64.61  ? 239 ASP B N     1 
ATOM   4416 C CA    . ASP D 4 202 ? 42.064 10.941  22.909  1.00 64.71  ? 239 ASP B CA    1 
ATOM   4417 C C     . ASP D 4 202 ? 43.241 11.801  23.349  1.00 64.67  ? 239 ASP B C     1 
ATOM   4418 O O     . ASP D 4 202 ? 43.061 12.942  23.773  1.00 64.48  ? 239 ASP B O     1 
ATOM   4419 C CB    . ASP D 4 202 ? 41.351 11.606  21.722  1.00 64.82  ? 239 ASP B CB    1 
ATOM   4420 C CG    . ASP D 4 202 ? 42.264 11.813  20.527  1.00 64.50  ? 239 ASP B CG    1 
ATOM   4421 O OD1   . ASP D 4 202 ? 43.290 11.113  20.432  1.00 64.52  ? 239 ASP B OD1   1 
ATOM   4422 O OD2   . ASP D 4 202 ? 41.948 12.666  19.671  1.00 64.86  ? 239 ASP B OD2   1 
ATOM   4423 N N     . SER D 4 203 ? 44.446 11.249  23.243  1.00 64.74  ? 240 SER B N     1 
ATOM   4424 C CA    . SER D 4 203 ? 45.644 11.979  23.624  1.00 65.10  ? 240 SER B CA    1 
ATOM   4425 C C     . SER D 4 203 ? 45.987 13.038  22.569  1.00 65.47  ? 240 SER B C     1 
ATOM   4426 O O     . SER D 4 203 ? 47.068 13.019  21.970  1.00 65.60  ? 240 SER B O     1 
ATOM   4427 C CB    . SER D 4 203 ? 46.830 11.015  23.831  1.00 65.28  ? 240 SER B CB    1 
ATOM   4428 O OG    . SER D 4 203 ? 47.340 10.494  22.615  1.00 64.88  ? 240 SER B OG    1 
ATOM   4429 N N     . LYS D 4 204 ? 45.052 13.956  22.341  1.00 65.16  ? 241 LYS B N     1 
ATOM   4430 C CA    . LYS D 4 204 ? 45.259 15.033  21.387  1.00 65.04  ? 241 LYS B CA    1 
ATOM   4431 C C     . LYS D 4 204 ? 44.414 16.234  21.796  1.00 65.27  ? 241 LYS B C     1 
ATOM   4432 O O     . LYS D 4 204 ? 44.760 17.378  21.513  1.00 65.48  ? 241 LYS B O     1 
ATOM   4433 C CB    . LYS D 4 204 ? 44.892 14.581  19.979  1.00 64.93  ? 241 LYS B CB    1 
ATOM   4434 C CG    . LYS D 4 204 ? 45.674 15.305  18.898  1.00 64.69  ? 241 LYS B CG    1 
ATOM   4435 C CD    . LYS D 4 204 ? 45.211 14.891  17.514  1.00 64.76  ? 241 LYS B CD    1 
ATOM   4436 C CE    . LYS D 4 204 ? 46.100 15.479  16.428  1.00 64.54  ? 241 LYS B CE    1 
ATOM   4437 N NZ    . LYS D 4 204 ? 45.533 15.248  15.078  1.00 62.92  ? 241 LYS B NZ    1 
ATOM   4438 N N     . ALA D 4 205 ? 43.301 15.971  22.468  1.00 65.39  ? 242 ALA B N     1 
ATOM   4439 C CA    . ALA D 4 205 ? 42.448 17.049  22.934  1.00 65.64  ? 242 ALA B CA    1 
ATOM   4440 C C     . ALA D 4 205 ? 43.103 17.626  24.184  1.00 66.05  ? 242 ALA B C     1 
ATOM   4441 O O     . ALA D 4 205 ? 43.081 17.007  25.249  1.00 66.23  ? 242 ALA B O     1 
ATOM   4442 C CB    . ALA D 4 205 ? 41.067 16.526  23.265  1.00 65.61  ? 242 ALA B CB    1 
ATOM   4443 N N     . PRO D 4 206 ? 43.702 18.820  24.064  1.00 65.99  ? 243 PRO B N     1 
ATOM   4444 C CA    . PRO D 4 206 ? 44.387 19.549  25.137  1.00 65.80  ? 243 PRO B CA    1 
ATOM   4445 C C     . PRO D 4 206 ? 43.832 19.352  26.554  1.00 65.38  ? 243 PRO B C     1 
ATOM   4446 O O     . PRO D 4 206 ? 44.537 19.585  27.539  1.00 66.07  ? 243 PRO B O     1 
ATOM   4447 C CB    . PRO D 4 206 ? 44.278 20.996  24.676  1.00 66.17  ? 243 PRO B CB    1 
ATOM   4448 C CG    . PRO D 4 206 ? 44.455 20.863  23.191  1.00 66.56  ? 243 PRO B CG    1 
ATOM   4449 C CD    . PRO D 4 206 ? 43.607 19.650  22.846  1.00 66.31  ? 243 PRO B CD    1 
ATOM   4450 N N     . ASN D 4 207 ? 42.577 18.924  26.654  1.00 64.02  ? 244 ASN B N     1 
ATOM   4451 C CA    . ASN D 4 207 ? 41.932 18.707  27.945  1.00 62.70  ? 244 ASN B CA    1 
ATOM   4452 C C     . ASN D 4 207 ? 41.868 17.233  28.344  1.00 61.50  ? 244 ASN B C     1 
ATOM   4453 O O     . ASN D 4 207 ? 40.983 16.825  29.095  1.00 61.57  ? 244 ASN B O     1 
ATOM   4454 C CB    . ASN D 4 207 ? 40.516 19.265  27.905  1.00 63.55  ? 244 ASN B CB    1 
ATOM   4455 C CG    . ASN D 4 207 ? 39.714 18.709  26.747  1.00 64.45  ? 244 ASN B CG    1 
ATOM   4456 O OD1   . ASN D 4 207 ? 39.950 19.052  25.582  1.00 65.19  ? 244 ASN B OD1   1 
ATOM   4457 N ND2   . ASN D 4 207 ? 38.772 17.831  27.057  1.00 64.72  ? 244 ASN B ND2   1 
ATOM   4458 N N     . ALA D 4 208 ? 42.804 16.435  27.850  1.00 59.91  ? 245 ALA B N     1 
ATOM   4459 C CA    . ALA D 4 208 ? 42.822 15.016  28.165  1.00 58.62  ? 245 ALA B CA    1 
ATOM   4460 C C     . ALA D 4 208 ? 44.168 14.428  27.785  1.00 57.72  ? 245 ALA B C     1 
ATOM   4461 O O     . ALA D 4 208 ? 44.367 13.213  27.803  1.00 57.11  ? 245 ALA B O     1 
ATOM   4462 C CB    . ALA D 4 208 ? 41.715 14.311  27.410  1.00 59.23  ? 245 ALA B CB    1 
ATOM   4463 N N     . SER D 4 209 ? 45.082 15.311  27.412  1.00 57.02  ? 246 SER B N     1 
ATOM   4464 C CA    . SER D 4 209 ? 46.427 14.920  27.028  1.00 55.81  ? 246 SER B CA    1 
ATOM   4465 C C     . SER D 4 209 ? 47.209 14.703  28.305  1.00 54.96  ? 246 SER B C     1 
ATOM   4466 O O     . SER D 4 209 ? 46.865 15.262  29.346  1.00 55.49  ? 246 SER B O     1 
ATOM   4467 C CB    . SER D 4 209 ? 47.064 16.032  26.199  1.00 56.26  ? 246 SER B CB    1 
ATOM   4468 O OG    . SER D 4 209 ? 46.718 17.304  26.723  1.00 56.69  ? 246 SER B OG    1 
ATOM   4469 N N     . ASN D 4 210 ? 48.254 13.890  28.250  1.00 53.57  ? 247 ASN B N     1 
ATOM   4470 C CA    . ASN D 4 210 ? 49.031 13.657  29.460  1.00 51.90  ? 247 ASN B CA    1 
ATOM   4471 C C     . ASN D 4 210 ? 49.866 14.892  29.774  1.00 49.20  ? 247 ASN B C     1 
ATOM   4472 O O     . ASN D 4 210 ? 50.615 15.386  28.926  1.00 48.63  ? 247 ASN B O     1 
ATOM   4473 C CB    . ASN D 4 210 ? 49.928 12.426  29.295  1.00 53.86  ? 247 ASN B CB    1 
ATOM   4474 C CG    . ASN D 4 210 ? 50.891 12.559  28.133  1.00 55.43  ? 247 ASN B CG    1 
ATOM   4475 O OD1   . ASN D 4 210 ? 51.891 13.296  28.206  1.00 55.84  ? 247 ASN B OD1   1 
ATOM   4476 N ND2   . ASN D 4 210 ? 50.590 11.854  27.041  1.00 55.59  ? 247 ASN B ND2   1 
ATOM   4477 N N     . LEU D 4 211 ? 49.714 15.389  30.997  1.00 46.29  ? 248 LEU B N     1 
ATOM   4478 C CA    . LEU D 4 211 ? 50.431 16.574  31.454  1.00 43.30  ? 248 LEU B CA    1 
ATOM   4479 C C     . LEU D 4 211 ? 51.890 16.270  31.746  1.00 40.86  ? 248 LEU B C     1 
ATOM   4480 O O     . LEU D 4 211 ? 52.233 15.152  32.111  1.00 41.53  ? 248 LEU B O     1 
ATOM   4481 C CB    . LEU D 4 211 ? 49.753 17.139  32.697  1.00 42.87  ? 248 LEU B CB    1 
ATOM   4482 C CG    . LEU D 4 211 ? 48.290 17.529  32.477  1.00 43.20  ? 248 LEU B CG    1 
ATOM   4483 C CD1   . LEU D 4 211 ? 47.806 18.291  33.689  1.00 43.85  ? 248 LEU B CD1   1 
ATOM   4484 C CD2   . LEU D 4 211 ? 48.135 18.385  31.219  1.00 42.76  ? 248 LEU B CD2   1 
ATOM   4485 N N     . LYS D 4 212 ? 52.752 17.265  31.582  1.00 37.91  ? 249 LYS B N     1 
ATOM   4486 C CA    . LYS D 4 212 ? 54.168 17.050  31.821  1.00 34.35  ? 249 LYS B CA    1 
ATOM   4487 C C     . LYS D 4 212 ? 55.032 18.308  31.905  1.00 33.21  ? 249 LYS B C     1 
ATOM   4488 O O     . LYS D 4 212 ? 54.933 19.213  31.072  1.00 32.84  ? 249 LYS B O     1 
ATOM   4489 C CB    . LYS D 4 212 ? 54.720 16.134  30.738  1.00 33.21  ? 249 LYS B CB    1 
ATOM   4490 C CG    . LYS D 4 212 ? 56.215 16.014  30.737  1.00 31.85  ? 249 LYS B CG    1 
ATOM   4491 C CD    . LYS D 4 212 ? 56.666 15.121  29.618  1.00 31.05  ? 249 LYS B CD    1 
ATOM   4492 C CE    . LYS D 4 212 ? 58.110 14.744  29.804  1.00 31.23  ? 249 LYS B CE    1 
ATOM   4493 N NZ    . LYS D 4 212 ? 58.495 13.614  28.920  1.00 31.84  ? 249 LYS B NZ    1 
ATOM   4494 N N     . ILE D 4 213 ? 55.875 18.348  32.933  1.00 31.53  ? 250 ILE B N     1 
ATOM   4495 C CA    . ILE D 4 213 ? 56.805 19.448  33.146  1.00 29.30  ? 250 ILE B CA    1 
ATOM   4496 C C     . ILE D 4 213 ? 58.025 19.000  32.382  1.00 28.34  ? 250 ILE B C     1 
ATOM   4497 O O     . ILE D 4 213 ? 58.555 17.926  32.649  1.00 28.63  ? 250 ILE B O     1 
ATOM   4498 C CB    . ILE D 4 213 ? 57.181 19.594  34.632  1.00 28.89  ? 250 ILE B CB    1 
ATOM   4499 C CG1   . ILE D 4 213 ? 55.947 19.966  35.445  1.00 28.16  ? 250 ILE B CG1   1 
ATOM   4500 C CG2   . ILE D 4 213 ? 58.253 20.651  34.804  1.00 28.77  ? 250 ILE B CG2   1 
ATOM   4501 C CD1   . ILE D 4 213 ? 56.233 20.147  36.895  1.00 28.54  ? 250 ILE B CD1   1 
ATOM   4502 N N     . VAL D 4 214 ? 58.463 19.799  31.417  1.00 27.17  ? 251 VAL B N     1 
ATOM   4503 C CA    . VAL D 4 214 ? 59.621 19.429  30.620  1.00 26.12  ? 251 VAL B CA    1 
ATOM   4504 C C     . VAL D 4 214 ? 60.872 19.947  31.278  1.00 25.69  ? 251 VAL B C     1 
ATOM   4505 O O     . VAL D 4 214 ? 61.912 19.297  31.237  1.00 24.89  ? 251 VAL B O     1 
ATOM   4506 C CB    . VAL D 4 214 ? 59.521 19.978  29.189  1.00 25.83  ? 251 VAL B CB    1 
ATOM   4507 C CG1   . VAL D 4 214 ? 60.647 19.421  28.340  1.00 25.34  ? 251 VAL B CG1   1 
ATOM   4508 C CG2   . VAL D 4 214 ? 58.183 19.607  28.606  1.00 24.88  ? 251 VAL B CG2   1 
ATOM   4509 N N     . ARG D 4 215 ? 60.769 21.128  31.879  1.00 26.43  ? 252 ARG B N     1 
ATOM   4510 C CA    . ARG D 4 215 ? 61.899 21.732  32.591  1.00 26.63  ? 252 ARG B CA    1 
ATOM   4511 C C     . ARG D 4 215 ? 61.543 23.077  33.205  1.00 26.57  ? 252 ARG B C     1 
ATOM   4512 O O     . ARG D 4 215 ? 60.626 23.773  32.751  1.00 26.67  ? 252 ARG B O     1 
ATOM   4513 C CB    . ARG D 4 215 ? 63.121 21.883  31.666  1.00 25.93  ? 252 ARG B CB    1 
ATOM   4514 C CG    . ARG D 4 215 ? 63.224 23.187  30.931  1.00 25.91  ? 252 ARG B CG    1 
ATOM   4515 C CD    . ARG D 4 215 ? 64.381 23.178  29.931  1.00 25.67  ? 252 ARG B CD    1 
ATOM   4516 N NE    . ARG D 4 215 ? 65.714 23.292  30.520  1.00 25.07  ? 252 ARG B NE    1 
ATOM   4517 C CZ    . ARG D 4 215 ? 66.836 23.279  29.800  1.00 25.35  ? 252 ARG B CZ    1 
ATOM   4518 N NH1   . ARG D 4 215 ? 68.017 23.387  30.392  1.00 26.36  ? 252 ARG B NH1   1 
ATOM   4519 N NH2   . ARG D 4 215 ? 66.780 23.152  28.482  1.00 24.18  ? 252 ARG B NH2   1 
ATOM   4520 N N     . MET D 4 216 ? 62.272 23.420  34.258  1.00 26.24  ? 253 MET B N     1 
ATOM   4521 C CA    . MET D 4 216 ? 62.071 24.677  34.961  1.00 25.76  ? 253 MET B CA    1 
ATOM   4522 C C     . MET D 4 216 ? 63.421 25.383  35.028  1.00 25.85  ? 253 MET B C     1 
ATOM   4523 O O     . MET D 4 216 ? 64.466 24.731  35.093  1.00 27.10  ? 253 MET B O     1 
ATOM   4524 C CB    . MET D 4 216 ? 61.535 24.396  36.362  1.00 25.43  ? 253 MET B CB    1 
ATOM   4525 C CG    . MET D 4 216 ? 60.206 23.646  36.353  1.00 25.84  ? 253 MET B CG    1 
ATOM   4526 S SD    . MET D 4 216 ? 59.704 23.005  37.963  1.00 26.60  ? 253 MET B SD    1 
ATOM   4527 C CE    . MET D 4 216 ? 58.657 24.322  38.592  1.00 25.50  ? 253 MET B CE    1 
ATOM   4528 N N     . ASP D 4 217 ? 63.418 26.706  34.991  1.00 24.85  ? 254 ASP B N     1 
ATOM   4529 C CA    . ASP D 4 217 ? 64.678 27.423  35.051  1.00 24.52  ? 254 ASP B CA    1 
ATOM   4530 C C     . ASP D 4 217 ? 65.203 27.350  36.473  1.00 24.85  ? 254 ASP B C     1 
ATOM   4531 O O     . ASP D 4 217 ? 66.375 27.565  36.718  1.00 25.73  ? 254 ASP B O     1 
ATOM   4532 C CB    . ASP D 4 217 ? 64.474 28.876  34.635  1.00 24.64  ? 254 ASP B CB    1 
ATOM   4533 C CG    . ASP D 4 217 ? 63.448 29.588  35.495  1.00 24.57  ? 254 ASP B CG    1 
ATOM   4534 O OD1   . ASP D 4 217 ? 62.758 28.906  36.282  1.00 24.33  ? 254 ASP B OD1   1 
ATOM   4535 O OD2   . ASP D 4 217 ? 63.323 30.823  35.379  1.00 23.70  ? 254 ASP B OD2   1 
ATOM   4536 N N     . ARG D 4 218 ? 64.322 27.038  37.414  1.00 25.31  ? 255 ARG B N     1 
ATOM   4537 C CA    . ARG D 4 218 ? 64.699 26.936  38.818  1.00 25.14  ? 255 ARG B CA    1 
ATOM   4538 C C     . ARG D 4 218 ? 63.931 25.834  39.549  1.00 24.23  ? 255 ARG B C     1 
ATOM   4539 O O     . ARG D 4 218 ? 62.712 25.710  39.413  1.00 23.81  ? 255 ARG B O     1 
ATOM   4540 C CB    . ARG D 4 218 ? 64.492 28.289  39.517  1.00 26.60  ? 255 ARG B CB    1 
ATOM   4541 C CG    . ARG D 4 218 ? 65.702 29.216  39.412  1.00 30.86  ? 255 ARG B CG    1 
ATOM   4542 C CD    . ARG D 4 218 ? 65.308 30.695  39.537  1.00 34.13  ? 255 ARG B CD    1 
ATOM   4543 N NE    . ARG D 4 218 ? 65.265 31.237  40.905  1.00 37.59  ? 255 ARG B NE    1 
ATOM   4544 C CZ    . ARG D 4 218 ? 66.297 31.818  41.538  1.00 38.50  ? 255 ARG B CZ    1 
ATOM   4545 N NH1   . ARG D 4 218 ? 67.493 31.941  40.943  1.00 37.18  ? 255 ARG B NH1   1 
ATOM   4546 N NH2   . ARG D 4 218 ? 66.121 32.319  42.763  1.00 37.42  ? 255 ARG B NH2   1 
ATOM   4547 N N     . THR D 4 219 ? 64.657 25.035  40.329  1.00 23.17  ? 256 THR B N     1 
ATOM   4548 C CA    . THR D 4 219 ? 64.052 23.945  41.074  1.00 21.74  ? 256 THR B CA    1 
ATOM   4549 C C     . THR D 4 219 ? 64.126 24.133  42.582  1.00 21.35  ? 256 THR B C     1 
ATOM   4550 O O     . THR D 4 219 ? 63.863 23.208  43.348  1.00 22.53  ? 256 THR B O     1 
ATOM   4551 C CB    . THR D 4 219 ? 64.699 22.607  40.701  1.00 21.31  ? 256 THR B CB    1 
ATOM   4552 O OG1   . THR D 4 219 ? 66.121 22.706  40.833  1.00 21.73  ? 256 THR B OG1   1 
ATOM   4553 C CG2   . THR D 4 219 ? 64.358 22.242  39.276  1.00 19.95  ? 256 THR B CG2   1 
ATOM   4554 N N     . ALA D 4 220 ? 64.478 25.333  43.010  1.00 20.13  ? 257 ALA B N     1 
ATOM   4555 C CA    . ALA D 4 220 ? 64.558 25.632  44.431  1.00 19.26  ? 257 ALA B CA    1 
ATOM   4556 C C     . ALA D 4 220 ? 64.179 27.088  44.639  1.00 19.34  ? 257 ALA B C     1 
ATOM   4557 O O     . ALA D 4 220 ? 64.337 27.918  43.742  1.00 17.90  ? 257 ALA B O     1 
ATOM   4558 C CB    . ALA D 4 220 ? 65.947 25.385  44.947  1.00 18.81  ? 257 ALA B CB    1 
ATOM   4559 N N     . GLY D 4 221 ? 63.663 27.388  45.823  1.00 19.30  ? 258 GLY B N     1 
ATOM   4560 C CA    . GLY D 4 221 ? 63.272 28.745  46.119  1.00 19.68  ? 258 GLY B CA    1 
ATOM   4561 C C     . GLY D 4 221 ? 63.200 28.979  47.608  1.00 20.28  ? 258 GLY B C     1 
ATOM   4562 O O     . GLY D 4 221 ? 63.285 28.046  48.407  1.00 20.25  ? 258 GLY B O     1 
ATOM   4563 N N     . CYS D 4 222 ? 63.033 30.239  47.988  1.00 20.50  ? 259 CYS B N     1 
ATOM   4564 C CA    . CYS D 4 222 ? 62.954 30.590  49.389  1.00 20.71  ? 259 CYS B CA    1 
ATOM   4565 C C     . CYS D 4 222 ? 61.562 30.285  49.952  1.00 20.76  ? 259 CYS B C     1 
ATOM   4566 O O     . CYS D 4 222 ? 60.552 30.453  49.268  1.00 20.72  ? 259 CYS B O     1 
ATOM   4567 C CB    . CYS D 4 222 ? 63.280 32.062  49.560  1.00 19.95  ? 259 CYS B CB    1 
ATOM   4568 S SG    . CYS D 4 222 ? 63.421 32.500  51.266  1.00 24.12  ? 259 CYS B SG    1 
ATOM   4569 N N     . VAL D 4 223 ? 61.516 29.831  51.201  1.00 20.88  ? 260 VAL B N     1 
ATOM   4570 C CA    . VAL D 4 223 ? 60.250 29.499  51.837  1.00 20.74  ? 260 VAL B CA    1 
ATOM   4571 C C     . VAL D 4 223 ? 59.296 30.676  51.870  1.00 21.37  ? 260 VAL B C     1 
ATOM   4572 O O     . VAL D 4 223 ? 58.103 30.502  52.065  1.00 21.28  ? 260 VAL B O     1 
ATOM   4573 C CB    . VAL D 4 223 ? 60.455 29.037  53.271  1.00 20.86  ? 260 VAL B CB    1 
ATOM   4574 C CG1   . VAL D 4 223 ? 61.448 27.890  53.308  1.00 20.38  ? 260 VAL B CG1   1 
ATOM   4575 C CG2   . VAL D 4 223 ? 60.916 30.204  54.123  1.00 20.50  ? 260 VAL B CG2   1 
ATOM   4576 N N     . THR D 4 224 ? 59.831 31.875  51.676  1.00 22.20  ? 261 THR B N     1 
ATOM   4577 C CA    . THR D 4 224 ? 59.033 33.091  51.683  1.00 22.78  ? 261 THR B CA    1 
ATOM   4578 C C     . THR D 4 224 ? 58.092 33.144  50.485  1.00 22.50  ? 261 THR B C     1 
ATOM   4579 O O     . THR D 4 224 ? 57.005 33.721  50.558  1.00 22.80  ? 261 THR B O     1 
ATOM   4580 C CB    . THR D 4 224 ? 59.930 34.329  51.642  1.00 23.73  ? 261 THR B CB    1 
ATOM   4581 O OG1   . THR D 4 224 ? 60.877 34.268  52.716  1.00 25.41  ? 261 THR B OG1   1 
ATOM   4582 C CG2   . THR D 4 224 ? 59.094 35.586  51.793  1.00 23.93  ? 261 THR B CG2   1 
ATOM   4583 N N     . GLY D 4 225 ? 58.525 32.551  49.380  1.00 21.81  ? 262 GLY B N     1 
ATOM   4584 C CA    . GLY D 4 225 ? 57.708 32.532  48.183  1.00 21.38  ? 262 GLY B CA    1 
ATOM   4585 C C     . GLY D 4 225 ? 57.682 33.854  47.444  1.00 21.05  ? 262 GLY B C     1 
ATOM   4586 O O     . GLY D 4 225 ? 58.371 34.792  47.827  1.00 21.03  ? 262 GLY B O     1 
ATOM   4587 N N     . GLY D 4 226 ? 56.881 33.926  46.384  1.00 20.43  ? 263 GLY B N     1 
ATOM   4588 C CA    . GLY D 4 226 ? 56.775 35.149  45.617  1.00 20.08  ? 263 GLY B CA    1 
ATOM   4589 C C     . GLY D 4 226 ? 57.914 35.277  44.622  1.00 21.01  ? 263 GLY B C     1 
ATOM   4590 O O     . GLY D 4 226 ? 58.215 36.382  44.136  1.00 21.10  ? 263 GLY B O     1 
ATOM   4591 N N     . GLU D 4 227 ? 58.545 34.148  44.306  1.00 19.78  ? 264 GLU B N     1 
ATOM   4592 C CA    . GLU D 4 227 ? 59.641 34.147  43.366  1.00 19.10  ? 264 GLU B CA    1 
ATOM   4593 C C     . GLU D 4 227 ? 59.204 33.676  41.996  1.00 18.90  ? 264 GLU B C     1 
ATOM   4594 O O     . GLU D 4 227 ? 58.530 32.667  41.870  1.00 18.33  ? 264 GLU B O     1 
ATOM   4595 C CB    . GLU D 4 227 ? 60.760 33.283  43.907  1.00 19.05  ? 264 GLU B CB    1 
ATOM   4596 C CG    . GLU D 4 227 ? 61.220 33.767  45.253  1.00 20.64  ? 264 GLU B CG    1 
ATOM   4597 C CD    . GLU D 4 227 ? 62.481 33.088  45.724  1.00 21.77  ? 264 GLU B CD    1 
ATOM   4598 O OE1   . GLU D 4 227 ? 62.479 31.842  45.852  1.00 24.28  ? 264 GLU B OE1   1 
ATOM   4599 O OE2   . GLU D 4 227 ? 63.472 33.797  45.974  1.00 20.77  ? 264 GLU B OE2   1 
ATOM   4600 N N     . GLU D 4 228 ? 59.593 34.424  40.969  1.00 19.01  ? 265 GLU B N     1 
ATOM   4601 C CA    . GLU D 4 228 ? 59.222 34.087  39.606  1.00 19.70  ? 265 GLU B CA    1 
ATOM   4602 C C     . GLU D 4 228 ? 59.938 32.845  39.068  1.00 19.50  ? 265 GLU B C     1 
ATOM   4603 O O     . GLU D 4 228 ? 61.132 32.672  39.257  1.00 19.71  ? 265 GLU B O     1 
ATOM   4604 C CB    . GLU D 4 228 ? 59.492 35.271  38.684  1.00 19.98  ? 265 GLU B CB    1 
ATOM   4605 C CG    . GLU D 4 228 ? 58.545 35.341  37.505  1.00 21.71  ? 265 GLU B CG    1 
ATOM   4606 C CD    . GLU D 4 228 ? 58.875 36.490  36.592  1.00 22.92  ? 265 GLU B CD    1 
ATOM   4607 O OE1   . GLU D 4 228 ? 60.006 36.494  36.060  1.00 23.73  ? 265 GLU B OE1   1 
ATOM   4608 O OE2   . GLU D 4 228 ? 58.013 37.385  36.413  1.00 24.34  ? 265 GLU B OE2   1 
ATOM   4609 N N     . ILE D 4 229 ? 59.190 31.978  38.393  1.00 19.72  ? 266 ILE B N     1 
ATOM   4610 C CA    . ILE D 4 229 ? 59.751 30.761  37.837  1.00 18.70  ? 266 ILE B CA    1 
ATOM   4611 C C     . ILE D 4 229 ? 59.186 30.494  36.456  1.00 18.91  ? 266 ILE B C     1 
ATOM   4612 O O     . ILE D 4 229 ? 57.971 30.609  36.230  1.00 19.16  ? 266 ILE B O     1 
ATOM   4613 C CB    . ILE D 4 229 ? 59.446 29.552  38.747  1.00 18.63  ? 266 ILE B CB    1 
ATOM   4614 C CG1   . ILE D 4 229 ? 60.206 29.703  40.067  1.00 19.21  ? 266 ILE B CG1   1 
ATOM   4615 C CG2   . ILE D 4 229 ? 59.847 28.250  38.064  1.00 18.63  ? 266 ILE B CG2   1 
ATOM   4616 C CD1   . ILE D 4 229 ? 60.235 28.464  40.907  1.00 18.10  ? 266 ILE B CD1   1 
ATOM   4617 N N     . TYR D 4 230 ? 60.082 30.161  35.530  1.00 18.44  ? 267 TYR B N     1 
ATOM   4618 C CA    . TYR D 4 230 ? 59.705 29.828  34.161  1.00 18.16  ? 267 TYR B CA    1 
ATOM   4619 C C     . TYR D 4 230 ? 59.615 28.305  34.052  1.00 18.32  ? 267 TYR B C     1 
ATOM   4620 O O     . TYR D 4 230 ? 60.585 27.592  34.305  1.00 17.05  ? 267 TYR B O     1 
ATOM   4621 C CB    . TYR D 4 230 ? 60.747 30.354  33.179  1.00 17.21  ? 267 TYR B CB    1 
ATOM   4622 C CG    . TYR D 4 230 ? 60.552 31.791  32.781  1.00 17.52  ? 267 TYR B CG    1 
ATOM   4623 C CD1   . TYR D 4 230 ? 60.311 32.776  33.741  1.00 16.56  ? 267 TYR B CD1   1 
ATOM   4624 C CD2   . TYR D 4 230 ? 60.643 32.181  31.440  1.00 16.82  ? 267 TYR B CD2   1 
ATOM   4625 C CE1   . TYR D 4 230 ? 60.171 34.105  33.376  1.00 15.56  ? 267 TYR B CE1   1 
ATOM   4626 C CE2   . TYR D 4 230 ? 60.503 33.513  31.068  1.00 15.54  ? 267 TYR B CE2   1 
ATOM   4627 C CZ    . TYR D 4 230 ? 60.268 34.463  32.039  1.00 15.35  ? 267 TYR B CZ    1 
ATOM   4628 O OH    . TYR D 4 230 ? 60.123 35.773  31.678  1.00 14.19  ? 267 TYR B OH    1 
ATOM   4629 N N     . LEU D 4 231 ? 58.435 27.816  33.687  1.00 20.11  ? 268 LEU B N     1 
ATOM   4630 C CA    . LEU D 4 231 ? 58.197 26.378  33.550  1.00 21.48  ? 268 LEU B CA    1 
ATOM   4631 C C     . LEU D 4 231 ? 57.747 26.026  32.129  1.00 22.37  ? 268 LEU B C     1 
ATOM   4632 O O     . LEU D 4 231 ? 56.826 26.644  31.579  1.00 22.66  ? 268 LEU B O     1 
ATOM   4633 C CB    . LEU D 4 231 ? 57.167 25.948  34.609  1.00 21.66  ? 268 LEU B CB    1 
ATOM   4634 C CG    . LEU D 4 231 ? 56.292 24.685  34.622  1.00 22.91  ? 268 LEU B CG    1 
ATOM   4635 C CD1   . LEU D 4 231 ? 56.887 23.557  33.807  1.00 24.32  ? 268 LEU B CD1   1 
ATOM   4636 C CD2   . LEU D 4 231 ? 56.106 24.257  36.072  1.00 21.98  ? 268 LEU B CD2   1 
ATOM   4637 N N     . LEU D 4 232 ? 58.441 25.058  31.530  1.00 22.69  ? 269 LEU B N     1 
ATOM   4638 C CA    . LEU D 4 232 ? 58.135 24.589  30.178  1.00 23.14  ? 269 LEU B CA    1 
ATOM   4639 C C     . LEU D 4 232 ? 57.387 23.262  30.284  1.00 23.98  ? 269 LEU B C     1 
ATOM   4640 O O     . LEU D 4 232 ? 57.820 22.363  30.994  1.00 24.69  ? 269 LEU B O     1 
ATOM   4641 C CB    . LEU D 4 232 ? 59.424 24.398  29.372  1.00 21.81  ? 269 LEU B CB    1 
ATOM   4642 C CG    . LEU D 4 232 ? 60.378 25.594  29.350  1.00 21.48  ? 269 LEU B CG    1 
ATOM   4643 C CD1   . LEU D 4 232 ? 61.457 25.376  28.310  1.00 19.91  ? 269 LEU B CD1   1 
ATOM   4644 C CD2   . LEU D 4 232 ? 59.608 26.873  29.041  1.00 21.52  ? 269 LEU B CD2   1 
ATOM   4645 N N     . CYS D 4 233 ? 56.279 23.140  29.564  1.00 24.92  ? 270 CYS B N     1 
ATOM   4646 C CA    . CYS D 4 233 ? 55.459 21.940  29.616  1.00 25.74  ? 270 CYS B CA    1 
ATOM   4647 C C     . CYS D 4 233 ? 54.918 21.523  28.253  1.00 26.92  ? 270 CYS B C     1 
ATOM   4648 O O     . CYS D 4 233 ? 55.261 22.115  27.227  1.00 27.32  ? 270 CYS B O     1 
ATOM   4649 C CB    . CYS D 4 233 ? 54.287 22.218  30.520  1.00 25.04  ? 270 CYS B CB    1 
ATOM   4650 S SG    . CYS D 4 233 ? 53.378 23.648  29.925  1.00 26.68  ? 270 CYS B SG    1 
ATOM   4651 N N     . ASP D 4 234 ? 54.071 20.493  28.259  1.00 28.03  ? 271 ASP B N     1 
ATOM   4652 C CA    . ASP D 4 234 ? 53.428 20.001  27.048  1.00 29.27  ? 271 ASP B CA    1 
ATOM   4653 C C     . ASP D 4 234 ? 52.108 20.741  26.906  1.00 29.31  ? 271 ASP B C     1 
ATOM   4654 O O     . ASP D 4 234 ? 51.716 21.468  27.814  1.00 28.93  ? 271 ASP B O     1 
ATOM   4655 C CB    . ASP D 4 234 ? 53.171 18.499  27.121  1.00 31.52  ? 271 ASP B CB    1 
ATOM   4656 C CG    . ASP D 4 234 ? 54.392 17.685  26.743  1.00 34.26  ? 271 ASP B CG    1 
ATOM   4657 O OD1   . ASP D 4 234 ? 55.358 18.278  26.204  1.00 36.06  ? 271 ASP B OD1   1 
ATOM   4658 O OD2   . ASP D 4 234 ? 54.386 16.452  26.975  1.00 36.08  ? 271 ASP B OD2   1 
ATOM   4659 N N     . LYS D 4 235 ? 51.426 20.558  25.776  1.00 29.78  ? 272 LYS B N     1 
ATOM   4660 C CA    . LYS D 4 235 ? 50.174 21.264  25.520  1.00 30.37  ? 272 LYS B CA    1 
ATOM   4661 C C     . LYS D 4 235 ? 49.267 21.267  26.734  1.00 31.05  ? 272 LYS B C     1 
ATOM   4662 O O     . LYS D 4 235 ? 48.976 20.223  27.319  1.00 31.09  ? 272 LYS B O     1 
ATOM   4663 C CB    . LYS D 4 235 ? 49.436 20.660  24.318  1.00 31.29  ? 272 LYS B CB    1 
ATOM   4664 C CG    . LYS D 4 235 ? 48.089 21.323  24.009  1.00 31.96  ? 272 LYS B CG    1 
ATOM   4665 C CD    . LYS D 4 235 ? 48.247 22.633  23.241  1.00 33.60  ? 272 LYS B CD    1 
ATOM   4666 C CE    . LYS D 4 235 ? 48.125 22.431  21.710  1.00 34.33  ? 272 LYS B CE    1 
ATOM   4667 N NZ    . LYS D 4 235 ? 49.128 21.479  21.134  1.00 33.72  ? 272 LYS B NZ    1 
ATOM   4668 N N     . VAL D 4 236 ? 48.829 22.460  27.109  1.00 31.59  ? 273 VAL B N     1 
ATOM   4669 C CA    . VAL D 4 236 ? 47.954 22.642  28.258  1.00 31.87  ? 273 VAL B CA    1 
ATOM   4670 C C     . VAL D 4 236 ? 46.994 23.764  27.911  1.00 32.38  ? 273 VAL B C     1 
ATOM   4671 O O     . VAL D 4 236 ? 47.205 24.466  26.927  1.00 32.84  ? 273 VAL B O     1 
ATOM   4672 C CB    . VAL D 4 236 ? 48.767 23.045  29.501  1.00 31.85  ? 273 VAL B CB    1 
ATOM   4673 C CG1   . VAL D 4 236 ? 49.790 21.959  29.834  1.00 31.27  ? 273 VAL B CG1   1 
ATOM   4674 C CG2   . VAL D 4 236 ? 49.465 24.359  29.256  1.00 31.48  ? 273 VAL B CG2   1 
ATOM   4675 N N     . GLN D 4 237 ? 45.949 23.956  28.702  1.00 32.72  ? 274 GLN B N     1 
ATOM   4676 C CA    . GLN D 4 237 ? 45.016 25.031  28.392  1.00 33.56  ? 274 GLN B CA    1 
ATOM   4677 C C     . GLN D 4 237 ? 45.014 26.107  29.465  1.00 33.75  ? 274 GLN B C     1 
ATOM   4678 O O     . GLN D 4 237 ? 44.652 25.864  30.616  1.00 32.57  ? 274 GLN B O     1 
ATOM   4679 C CB    . GLN D 4 237 ? 43.613 24.471  28.181  1.00 34.62  ? 274 GLN B CB    1 
ATOM   4680 C CG    . GLN D 4 237 ? 43.568 23.319  27.186  1.00 36.47  ? 274 GLN B CG    1 
ATOM   4681 C CD    . GLN D 4 237 ? 42.162 22.802  26.970  1.00 38.51  ? 274 GLN B CD    1 
ATOM   4682 O OE1   . GLN D 4 237 ? 41.345 22.783  27.896  1.00 39.85  ? 274 GLN B OE1   1 
ATOM   4683 N NE2   . GLN D 4 237 ? 41.872 22.361  25.753  1.00 38.64  ? 274 GLN B NE2   1 
ATOM   4684 N N     . LYS D 4 238 ? 45.421 27.306  29.052  1.00 34.92  ? 275 LYS B N     1 
ATOM   4685 C CA    . LYS D 4 238 ? 45.528 28.475  29.921  1.00 35.92  ? 275 LYS B CA    1 
ATOM   4686 C C     . LYS D 4 238 ? 44.394 28.727  30.897  1.00 36.53  ? 275 LYS B C     1 
ATOM   4687 O O     . LYS D 4 238 ? 44.523 29.551  31.802  1.00 36.56  ? 275 LYS B O     1 
ATOM   4688 C CB    . LYS D 4 238 ? 45.741 29.731  29.082  1.00 35.64  ? 275 LYS B CB    1 
ATOM   4689 C CG    . LYS D 4 238 ? 44.803 29.861  27.914  1.00 36.67  ? 275 LYS B CG    1 
ATOM   4690 C CD    . LYS D 4 238 ? 44.990 31.202  27.220  1.00 36.74  ? 275 LYS B CD    1 
ATOM   4691 C CE    . LYS D 4 238 ? 44.789 32.351  28.188  1.00 37.14  ? 275 LYS B CE    1 
ATOM   4692 N NZ    . LYS D 4 238 ? 45.082 33.672  27.553  1.00 37.96  ? 275 LYS B NZ    1 
ATOM   4693 N N     . ASP D 4 239 ? 43.278 28.040  30.724  1.00 37.57  ? 276 ASP B N     1 
ATOM   4694 C CA    . ASP D 4 239 ? 42.173 28.239  31.648  1.00 38.22  ? 276 ASP B CA    1 
ATOM   4695 C C     . ASP D 4 239 ? 41.908 27.041  32.522  1.00 37.37  ? 276 ASP B C     1 
ATOM   4696 O O     . ASP D 4 239 ? 41.216 27.151  33.521  1.00 37.85  ? 276 ASP B O     1 
ATOM   4697 C CB    . ASP D 4 239 ? 40.900 28.616  30.898  1.00 40.13  ? 276 ASP B CB    1 
ATOM   4698 C CG    . ASP D 4 239 ? 40.855 30.081  30.558  1.00 41.67  ? 276 ASP B CG    1 
ATOM   4699 O OD1   . ASP D 4 239 ? 41.103 30.892  31.481  1.00 41.22  ? 276 ASP B OD1   1 
ATOM   4700 O OD2   . ASP D 4 239 ? 40.576 30.413  29.381  1.00 42.82  ? 276 ASP B OD2   1 
ATOM   4701 N N     . ASP D 4 240 ? 42.473 25.900  32.162  1.00 36.47  ? 277 ASP B N     1 
ATOM   4702 C CA    . ASP D 4 240 ? 42.249 24.705  32.940  1.00 36.21  ? 277 ASP B CA    1 
ATOM   4703 C C     . ASP D 4 240 ? 43.564 24.109  33.415  1.00 36.58  ? 277 ASP B C     1 
ATOM   4704 O O     . ASP D 4 240 ? 43.831 22.917  33.225  1.00 37.19  ? 277 ASP B O     1 
ATOM   4705 C CB    . ASP D 4 240 ? 41.480 23.697  32.095  1.00 36.43  ? 277 ASP B CB    1 
ATOM   4706 C CG    . ASP D 4 240 ? 41.101 22.455  32.872  1.00 36.88  ? 277 ASP B CG    1 
ATOM   4707 O OD1   . ASP D 4 240 ? 41.442 21.348  32.397  1.00 35.91  ? 277 ASP B OD1   1 
ATOM   4708 O OD2   . ASP D 4 240 ? 40.466 22.591  33.946  1.00 35.63  ? 277 ASP B OD2   1 
ATOM   4709 N N     . ILE D 4 241 ? 44.391 24.937  34.043  1.00 36.25  ? 278 ILE B N     1 
ATOM   4710 C CA    . ILE D 4 241 ? 45.680 24.456  34.522  1.00 35.73  ? 278 ILE B CA    1 
ATOM   4711 C C     . ILE D 4 241 ? 46.117 25.196  35.773  1.00 36.03  ? 278 ILE B C     1 
ATOM   4712 O O     . ILE D 4 241 ? 45.725 26.344  36.001  1.00 36.70  ? 278 ILE B O     1 
ATOM   4713 C CB    . ILE D 4 241 ? 46.770 24.617  33.431  1.00 35.17  ? 278 ILE B CB    1 
ATOM   4714 C CG1   . ILE D 4 241 ? 47.956 23.708  33.742  1.00 34.39  ? 278 ILE B CG1   1 
ATOM   4715 C CG2   . ILE D 4 241 ? 47.218 26.075  33.332  1.00 34.48  ? 278 ILE B CG2   1 
ATOM   4716 C CD1   . ILE D 4 241 ? 47.570 22.269  33.863  1.00 33.98  ? 278 ILE B CD1   1 
ATOM   4717 N N     . GLN D 4 242 ? 46.911 24.517  36.591  1.00 35.60  ? 279 GLN B N     1 
ATOM   4718 C CA    . GLN D 4 242 ? 47.440 25.092  37.819  1.00 35.76  ? 279 GLN B CA    1 
ATOM   4719 C C     . GLN D 4 242 ? 48.671 24.313  38.247  1.00 35.74  ? 279 GLN B C     1 
ATOM   4720 O O     . GLN D 4 242 ? 48.810 23.123  37.960  1.00 34.69  ? 279 GLN B O     1 
ATOM   4721 C CB    . GLN D 4 242 ? 46.398 25.057  38.922  1.00 35.78  ? 279 GLN B CB    1 
ATOM   4722 C CG    . GLN D 4 242 ? 45.701 23.729  39.044  1.00 36.27  ? 279 GLN B CG    1 
ATOM   4723 C CD    . GLN D 4 242 ? 44.728 23.717  40.186  1.00 36.65  ? 279 GLN B CD    1 
ATOM   4724 O OE1   . GLN D 4 242 ? 44.067 24.728  40.458  1.00 36.41  ? 279 GLN B OE1   1 
ATOM   4725 N NE2   . GLN D 4 242 ? 44.614 22.571  40.861  1.00 36.18  ? 279 GLN B NE2   1 
ATOM   4726 N N     . ILE D 4 243 ? 49.580 24.997  38.921  1.00 36.50  ? 280 ILE B N     1 
ATOM   4727 C CA    . ILE D 4 243 ? 50.800 24.352  39.365  1.00 37.16  ? 280 ILE B CA    1 
ATOM   4728 C C     . ILE D 4 243 ? 50.693 24.126  40.858  1.00 37.83  ? 280 ILE B C     1 
ATOM   4729 O O     . ILE D 4 243 ? 50.580 25.075  41.636  1.00 37.79  ? 280 ILE B O     1 
ATOM   4730 C CB    . ILE D 4 243 ? 52.023 25.225  39.047  1.00 36.99  ? 280 ILE B CB    1 
ATOM   4731 C CG1   . ILE D 4 243 ? 52.032 25.565  37.555  1.00 35.66  ? 280 ILE B CG1   1 
ATOM   4732 C CG2   . ILE D 4 243 ? 53.295 24.498  39.443  1.00 37.14  ? 280 ILE B CG2   1 
ATOM   4733 C CD1   . ILE D 4 243 ? 53.236 26.342  37.115  1.00 34.37  ? 280 ILE B CD1   1 
ATOM   4734 N N     . ARG D 4 244 ? 50.721 22.864  41.260  1.00 38.64  ? 281 ARG B N     1 
ATOM   4735 C CA    . ARG D 4 244 ? 50.595 22.546  42.666  1.00 39.86  ? 281 ARG B CA    1 
ATOM   4736 C C     . ARG D 4 244 ? 51.880 22.000  43.264  1.00 40.48  ? 281 ARG B C     1 
ATOM   4737 O O     . ARG D 4 244 ? 52.547 21.155  42.661  1.00 40.32  ? 281 ARG B O     1 
ATOM   4738 C CB    . ARG D 4 244 ? 49.469 21.529  42.872  1.00 40.32  ? 281 ARG B CB    1 
ATOM   4739 C CG    . ARG D 4 244 ? 49.037 21.363  44.324  1.00 40.89  ? 281 ARG B CG    1 
ATOM   4740 C CD    . ARG D 4 244 ? 47.949 20.313  44.491  1.00 40.64  ? 281 ARG B CD    1 
ATOM   4741 N NE    . ARG D 4 244 ? 48.490 18.955  44.588  1.00 40.80  ? 281 ARG B NE    1 
ATOM   4742 C CZ    . ARG D 4 244 ? 48.370 18.186  45.668  1.00 40.15  ? 281 ARG B CZ    1 
ATOM   4743 N NH1   . ARG D 4 244 ? 47.727 18.646  46.737  1.00 38.61  ? 281 ARG B NH1   1 
ATOM   4744 N NH2   . ARG D 4 244 ? 48.891 16.963  45.683  1.00 38.55  ? 281 ARG B NH2   1 
ATOM   4745 N N     . PHE D 4 245 ? 52.219 22.514  44.445  1.00 41.10  ? 282 PHE B N     1 
ATOM   4746 C CA    . PHE D 4 245 ? 53.389 22.075  45.198  1.00 42.26  ? 282 PHE B CA    1 
ATOM   4747 C C     . PHE D 4 245 ? 52.821 21.273  46.365  1.00 43.60  ? 282 PHE B C     1 
ATOM   4748 O O     . PHE D 4 245 ? 51.833 21.676  46.981  1.00 43.10  ? 282 PHE B O     1 
ATOM   4749 C CB    . PHE D 4 245 ? 54.171 23.261  45.773  1.00 42.01  ? 282 PHE B CB    1 
ATOM   4750 C CG    . PHE D 4 245 ? 54.935 24.051  44.758  1.00 41.34  ? 282 PHE B CG    1 
ATOM   4751 C CD1   . PHE D 4 245 ? 54.300 24.999  43.969  1.00 41.62  ? 282 PHE B CD1   1 
ATOM   4752 C CD2   . PHE D 4 245 ? 56.301 23.860  44.607  1.00 41.03  ? 282 PHE B CD2   1 
ATOM   4753 C CE1   . PHE D 4 245 ? 55.016 25.745  43.045  1.00 41.14  ? 282 PHE B CE1   1 
ATOM   4754 C CE2   . PHE D 4 245 ? 57.027 24.598  43.691  1.00 40.78  ? 282 PHE B CE2   1 
ATOM   4755 C CZ    . PHE D 4 245 ? 56.385 25.544  42.906  1.00 41.30  ? 282 PHE B CZ    1 
ATOM   4756 N N     . TYR D 4 246 ? 53.430 20.143  46.685  1.00 45.61  ? 283 TYR B N     1 
ATOM   4757 C CA    . TYR D 4 246 ? 52.905 19.364  47.792  1.00 48.35  ? 283 TYR B CA    1 
ATOM   4758 C C     . TYR D 4 246 ? 53.976 18.629  48.605  1.00 50.41  ? 283 TYR B C     1 
ATOM   4759 O O     . TYR D 4 246 ? 55.111 18.423  48.151  1.00 50.43  ? 283 TYR B O     1 
ATOM   4760 C CB    . TYR D 4 246 ? 51.837 18.384  47.270  1.00 47.88  ? 283 TYR B CB    1 
ATOM   4761 C CG    . TYR D 4 246 ? 52.371 17.169  46.536  1.00 47.53  ? 283 TYR B CG    1 
ATOM   4762 C CD1   . TYR D 4 246 ? 52.863 16.066  47.237  1.00 47.58  ? 283 TYR B CD1   1 
ATOM   4763 C CD2   . TYR D 4 246 ? 52.398 17.126  45.147  1.00 47.62  ? 283 TYR B CD2   1 
ATOM   4764 C CE1   . TYR D 4 246 ? 53.371 14.955  46.574  1.00 48.03  ? 283 TYR B CE1   1 
ATOM   4765 C CE2   . TYR D 4 246 ? 52.902 16.019  44.471  1.00 48.15  ? 283 TYR B CE2   1 
ATOM   4766 C CZ    . TYR D 4 246 ? 53.390 14.939  45.191  1.00 48.55  ? 283 TYR B CZ    1 
ATOM   4767 O OH    . TYR D 4 246 ? 53.914 13.853  44.527  1.00 49.13  ? 283 TYR B OH    1 
ATOM   4768 N N     . GLU D 4 247 ? 53.602 18.260  49.824  1.00 52.82  ? 284 GLU B N     1 
ATOM   4769 C CA    . GLU D 4 247 ? 54.492 17.536  50.719  1.00 55.52  ? 284 GLU B CA    1 
ATOM   4770 C C     . GLU D 4 247 ? 53.697 16.508  51.527  1.00 58.33  ? 284 GLU B C     1 
ATOM   4771 O O     . GLU D 4 247 ? 52.617 16.815  52.058  1.00 57.86  ? 284 GLU B O     1 
ATOM   4772 C CB    . GLU D 4 247 ? 55.208 18.514  51.662  1.00 53.44  ? 284 GLU B CB    1 
ATOM   4773 C CG    . GLU D 4 247 ? 56.138 17.849  52.665  1.00 49.77  ? 284 GLU B CG    1 
ATOM   4774 C CD    . GLU D 4 247 ? 56.987 18.843  53.423  1.00 48.01  ? 284 GLU B CD    1 
ATOM   4775 O OE1   . GLU D 4 247 ? 56.421 19.780  54.017  1.00 46.91  ? 284 GLU B OE1   1 
ATOM   4776 O OE2   . GLU D 4 247 ? 58.224 18.685  53.427  1.00 46.30  ? 284 GLU B OE2   1 
ATOM   4777 N N     . GLU D 4 248 ? 54.244 15.294  51.606  1.00 61.74  ? 285 GLU B N     1 
ATOM   4778 C CA    . GLU D 4 248 ? 53.628 14.192  52.344  1.00 65.85  ? 285 GLU B CA    1 
ATOM   4779 C C     . GLU D 4 248 ? 54.227 14.021  53.737  1.00 67.72  ? 285 GLU B C     1 
ATOM   4780 O O     . GLU D 4 248 ? 55.208 13.305  53.906  1.00 68.06  ? 285 GLU B O     1 
ATOM   4781 C CB    . GLU D 4 248 ? 53.776 12.884  51.561  1.00 66.84  ? 285 GLU B CB    1 
ATOM   4782 C CG    . GLU D 4 248 ? 52.864 12.781  50.339  1.00 68.68  ? 285 GLU B CG    1 
ATOM   4783 C CD    . GLU D 4 248 ? 53.175 11.573  49.472  1.00 69.40  ? 285 GLU B CD    1 
ATOM   4784 O OE1   . GLU D 4 248 ? 52.400 11.304  48.530  1.00 69.52  ? 285 GLU B OE1   1 
ATOM   4785 O OE2   . GLU D 4 248 ? 54.197 10.899  49.731  1.00 70.10  ? 285 GLU B OE2   1 
ATOM   4786 N N     . GLU D 4 249 ? 53.624 14.665  54.732  1.00 70.21  ? 286 GLU B N     1 
ATOM   4787 C CA    . GLU D 4 249 ? 54.122 14.584  56.101  1.00 73.15  ? 286 GLU B CA    1 
ATOM   4788 C C     . GLU D 4 249 ? 53.837 13.258  56.805  1.00 74.38  ? 286 GLU B C     1 
ATOM   4789 O O     . GLU D 4 249 ? 53.424 12.287  56.167  1.00 74.77  ? 286 GLU B O     1 
ATOM   4790 C CB    . GLU D 4 249 ? 53.566 15.748  56.932  1.00 74.23  ? 286 GLU B CB    1 
ATOM   4791 C CG    . GLU D 4 249 ? 54.302 17.079  56.708  1.00 75.86  ? 286 GLU B CG    1 
ATOM   4792 C CD    . GLU D 4 249 ? 55.808 16.996  57.007  1.00 76.34  ? 286 GLU B CD    1 
ATOM   4793 O OE1   . GLU D 4 249 ? 56.507 18.026  56.878  1.00 76.04  ? 286 GLU B OE1   1 
ATOM   4794 O OE2   . GLU D 4 249 ? 56.295 15.902  57.372  1.00 76.75  ? 286 GLU B OE2   1 
ATOM   4795 N N     . GLU D 4 250 ? 54.078 13.220  58.119  1.00 75.40  ? 287 GLU B N     1 
ATOM   4796 C CA    . GLU D 4 250 ? 53.855 12.012  58.921  1.00 75.97  ? 287 GLU B CA    1 
ATOM   4797 C C     . GLU D 4 250 ? 52.368 11.695  59.006  1.00 75.66  ? 287 GLU B C     1 
ATOM   4798 O O     . GLU D 4 250 ? 51.943 10.567  58.733  1.00 75.85  ? 287 GLU B O     1 
ATOM   4799 C CB    . GLU D 4 250 ? 54.420 12.191  60.334  1.00 77.03  ? 287 GLU B CB    1 
ATOM   4800 C CG    . GLU D 4 250 ? 55.945 12.279  60.400  1.00 78.50  ? 287 GLU B CG    1 
ATOM   4801 C CD    . GLU D 4 250 ? 56.466 12.485  61.821  1.00 79.40  ? 287 GLU B CD    1 
ATOM   4802 O OE1   . GLU D 4 250 ? 56.267 11.585  62.670  1.00 79.83  ? 287 GLU B OE1   1 
ATOM   4803 O OE2   . GLU D 4 250 ? 57.072 13.550  62.089  1.00 79.61  ? 287 GLU B OE2   1 
ATOM   4804 N N     . ASN D 4 251 ? 51.581 12.694  59.387  1.00 74.86  ? 288 ASN B N     1 
ATOM   4805 C CA    . ASN D 4 251 ? 50.139 12.531  59.489  1.00 74.31  ? 288 ASN B CA    1 
ATOM   4806 C C     . ASN D 4 251 ? 49.513 12.603  58.089  1.00 73.52  ? 288 ASN B C     1 
ATOM   4807 O O     . ASN D 4 251 ? 48.480 13.250  57.894  1.00 74.03  ? 288 ASN B O     1 
ATOM   4808 C CB    . ASN D 4 251 ? 49.559 13.637  60.372  1.00 75.33  ? 288 ASN B CB    1 
ATOM   4809 C CG    . ASN D 4 251 ? 48.063 13.481  60.608  1.00 76.22  ? 288 ASN B CG    1 
ATOM   4810 O OD1   . ASN D 4 251 ? 47.420 14.361  61.188  1.00 76.46  ? 288 ASN B OD1   1 
ATOM   4811 N ND2   . ASN D 4 251 ? 47.503 12.353  60.166  1.00 76.36  ? 288 ASN B ND2   1 
ATOM   4812 N N     . GLY D 4 252 ? 50.138 11.945  57.114  1.00 71.78  ? 289 GLY B N     1 
ATOM   4813 C CA    . GLY D 4 252 ? 49.613 11.976  55.759  1.00 69.10  ? 289 GLY B CA    1 
ATOM   4814 C C     . GLY D 4 252 ? 49.720 13.359  55.136  1.00 67.30  ? 289 GLY B C     1 
ATOM   4815 O O     . GLY D 4 252 ? 48.910 14.247  55.428  1.00 67.47  ? 289 GLY B O     1 
ATOM   4816 N N     . GLY D 4 253 ? 50.720 13.538  54.273  1.00 65.13  ? 290 GLY B N     1 
ATOM   4817 C CA    . GLY D 4 253 ? 50.943 14.811  53.607  1.00 61.89  ? 290 GLY B CA    1 
ATOM   4818 C C     . GLY D 4 253 ? 49.722 15.552  53.088  1.00 59.75  ? 290 GLY B C     1 
ATOM   4819 O O     . GLY D 4 253 ? 49.244 15.325  51.972  1.00 59.47  ? 290 GLY B O     1 
ATOM   4820 N N     . VAL D 4 254 ? 49.235 16.469  53.914  1.00 57.15  ? 291 VAL B N     1 
ATOM   4821 C CA    . VAL D 4 254 ? 48.072 17.280  53.596  1.00 53.63  ? 291 VAL B CA    1 
ATOM   4822 C C     . VAL D 4 254 ? 48.469 18.682  53.097  1.00 50.96  ? 291 VAL B C     1 
ATOM   4823 O O     . VAL D 4 254 ? 47.606 19.445  52.653  1.00 51.63  ? 291 VAL B O     1 
ATOM   4824 C CB    . VAL D 4 254 ? 47.150 17.399  54.862  1.00 53.95  ? 291 VAL B CB    1 
ATOM   4825 C CG1   . VAL D 4 254 ? 47.995 17.807  56.080  1.00 53.89  ? 291 VAL B CG1   1 
ATOM   4826 C CG2   . VAL D 4 254 ? 46.013 18.405  54.626  1.00 52.74  ? 291 VAL B CG2   1 
ATOM   4827 N N     . TRP D 4 255 ? 49.758 19.030  53.152  1.00 47.00  ? 292 TRP B N     1 
ATOM   4828 C CA    . TRP D 4 255 ? 50.163 20.370  52.710  1.00 42.56  ? 292 TRP B CA    1 
ATOM   4829 C C     . TRP D 4 255 ? 50.352 20.558  51.210  1.00 40.04  ? 292 TRP B C     1 
ATOM   4830 O O     . TRP D 4 255 ? 50.988 19.750  50.520  1.00 38.75  ? 292 TRP B O     1 
ATOM   4831 C CB    . TRP D 4 255 ? 51.445 20.854  53.396  1.00 40.68  ? 292 TRP B CB    1 
ATOM   4832 C CG    . TRP D 4 255 ? 51.756 22.267  52.962  1.00 38.81  ? 292 TRP B CG    1 
ATOM   4833 C CD1   . TRP D 4 255 ? 51.161 23.413  53.414  1.00 38.04  ? 292 TRP B CD1   1 
ATOM   4834 C CD2   . TRP D 4 255 ? 52.625 22.665  51.895  1.00 37.89  ? 292 TRP B CD2   1 
ATOM   4835 N NE1   . TRP D 4 255 ? 51.598 24.496  52.692  1.00 37.64  ? 292 TRP B NE1   1 
ATOM   4836 C CE2   . TRP D 4 255 ? 52.500 24.068  51.755  1.00 37.71  ? 292 TRP B CE2   1 
ATOM   4837 C CE3   . TRP D 4 255 ? 53.496 21.974  51.042  1.00 37.15  ? 292 TRP B CE3   1 
ATOM   4838 C CZ2   . TRP D 4 255 ? 53.212 24.793  50.793  1.00 37.36  ? 292 TRP B CZ2   1 
ATOM   4839 C CZ3   . TRP D 4 255 ? 54.204 22.693  50.084  1.00 37.62  ? 292 TRP B CZ3   1 
ATOM   4840 C CH2   . TRP D 4 255 ? 54.057 24.092  49.970  1.00 37.77  ? 292 TRP B CH2   1 
ATOM   4841 N N     . GLU D 4 256 ? 49.819 21.672  50.730  1.00 37.26  ? 293 GLU B N     1 
ATOM   4842 C CA    . GLU D 4 256 ? 49.897 22.016  49.329  1.00 35.36  ? 293 GLU B CA    1 
ATOM   4843 C C     . GLU D 4 256 ? 49.861 23.522  49.148  1.00 34.02  ? 293 GLU B C     1 
ATOM   4844 O O     . GLU D 4 256 ? 49.328 24.258  49.984  1.00 32.81  ? 293 GLU B O     1 
ATOM   4845 C CB    . GLU D 4 256 ? 48.723 21.390  48.568  1.00 35.55  ? 293 GLU B CB    1 
ATOM   4846 C CG    . GLU D 4 256 ? 47.392 21.525  49.297  1.00 35.31  ? 293 GLU B CG    1 
ATOM   4847 C CD    . GLU D 4 256 ? 46.185 21.323  48.401  1.00 36.03  ? 293 GLU B CD    1 
ATOM   4848 O OE1   . GLU D 4 256 ? 46.166 20.326  47.630  1.00 35.67  ? 293 GLU B OE1   1 
ATOM   4849 O OE2   . GLU D 4 256 ? 45.256 22.168  48.484  1.00 34.45  ? 293 GLU B OE2   1 
ATOM   4850 N N     . GLY D 4 257 ? 50.431 23.959  48.033  1.00 32.85  ? 294 GLY B N     1 
ATOM   4851 C CA    . GLY D 4 257 ? 50.457 25.364  47.684  1.00 31.41  ? 294 GLY B CA    1 
ATOM   4852 C C     . GLY D 4 257 ? 50.401 25.442  46.175  1.00 30.81  ? 294 GLY B C     1 
ATOM   4853 O O     . GLY D 4 257 ? 50.703 24.460  45.486  1.00 29.83  ? 294 GLY B O     1 
ATOM   4854 N N     . PHE D 4 258 ? 50.026 26.597  45.644  1.00 30.50  ? 295 PHE B N     1 
ATOM   4855 C CA    . PHE D 4 258 ? 49.939 26.718  44.198  1.00 30.63  ? 295 PHE B CA    1 
ATOM   4856 C C     . PHE D 4 258 ? 50.683 27.908  43.643  1.00 30.22  ? 295 PHE B C     1 
ATOM   4857 O O     . PHE D 4 258 ? 50.740 28.962  44.276  1.00 30.46  ? 295 PHE B O     1 
ATOM   4858 C CB    . PHE D 4 258 ? 48.470 26.783  43.765  1.00 30.84  ? 295 PHE B CB    1 
ATOM   4859 C CG    . PHE D 4 258 ? 47.676 25.559  44.135  1.00 31.93  ? 295 PHE B CG    1 
ATOM   4860 C CD1   . PHE D 4 258 ? 47.390 25.273  45.473  1.00 31.85  ? 295 PHE B CD1   1 
ATOM   4861 C CD2   . PHE D 4 258 ? 47.240 24.670  43.152  1.00 31.68  ? 295 PHE B CD2   1 
ATOM   4862 C CE1   . PHE D 4 258 ? 46.685 24.117  45.827  1.00 31.62  ? 295 PHE B CE1   1 
ATOM   4863 C CE2   . PHE D 4 258 ? 46.533 23.511  43.495  1.00 32.18  ? 295 PHE B CE2   1 
ATOM   4864 C CZ    . PHE D 4 258 ? 46.256 23.234  44.837  1.00 31.73  ? 295 PHE B CZ    1 
ATOM   4865 N N     . GLY D 4 259 ? 51.253 27.730  42.453  1.00 29.92  ? 296 GLY B N     1 
ATOM   4866 C CA    . GLY D 4 259 ? 51.974 28.810  41.799  1.00 28.84  ? 296 GLY B CA    1 
ATOM   4867 C C     . GLY D 4 259 ? 50.994 29.915  41.472  1.00 28.91  ? 296 GLY B C     1 
ATOM   4868 O O     . GLY D 4 259 ? 49.869 29.653  41.047  1.00 28.49  ? 296 GLY B O     1 
ATOM   4869 N N     . ASP D 4 260 ? 51.397 31.158  41.685  1.00 29.26  ? 297 ASP B N     1 
ATOM   4870 C CA    . ASP D 4 260 ? 50.506 32.269  41.412  1.00 29.58  ? 297 ASP B CA    1 
ATOM   4871 C C     . ASP D 4 260 ? 50.685 32.777  40.001  1.00 29.71  ? 297 ASP B C     1 
ATOM   4872 O O     . ASP D 4 260 ? 51.803 33.062  39.582  1.00 30.20  ? 297 ASP B O     1 
ATOM   4873 C CB    . ASP D 4 260 ? 50.747 33.390  42.411  1.00 30.12  ? 297 ASP B CB    1 
ATOM   4874 C CG    . ASP D 4 260 ? 50.119 34.694  41.980  1.00 32.09  ? 297 ASP B CG    1 
ATOM   4875 O OD1   . ASP D 4 260 ? 48.968 34.680  41.478  1.00 31.92  ? 297 ASP B OD1   1 
ATOM   4876 O OD2   . ASP D 4 260 ? 50.786 35.738  42.150  1.00 33.78  ? 297 ASP B OD2   1 
ATOM   4877 N N     . PHE D 4 261 ? 49.580 32.878  39.266  1.00 29.88  ? 298 PHE B N     1 
ATOM   4878 C CA    . PHE D 4 261 ? 49.631 33.352  37.891  1.00 30.03  ? 298 PHE B CA    1 
ATOM   4879 C C     . PHE D 4 261 ? 48.299 33.505  37.182  1.00 31.13  ? 298 PHE B C     1 
ATOM   4880 O O     . PHE D 4 261 ? 47.350 32.742  37.406  1.00 31.84  ? 298 PHE B O     1 
ATOM   4881 C CB    . PHE D 4 261 ? 50.505 32.434  37.033  1.00 28.94  ? 298 PHE B CB    1 
ATOM   4882 C CG    . PHE D 4 261 ? 49.915 31.066  36.784  1.00 27.70  ? 298 PHE B CG    1 
ATOM   4883 C CD1   . PHE D 4 261 ? 50.250 29.993  37.596  1.00 26.67  ? 298 PHE B CD1   1 
ATOM   4884 C CD2   . PHE D 4 261 ? 49.108 30.835  35.675  1.00 27.70  ? 298 PHE B CD2   1 
ATOM   4885 C CE1   . PHE D 4 261 ? 49.809 28.711  37.303  1.00 26.57  ? 298 PHE B CE1   1 
ATOM   4886 C CE2   . PHE D 4 261 ? 48.655 29.553  35.371  1.00 27.06  ? 298 PHE B CE2   1 
ATOM   4887 C CZ    . PHE D 4 261 ? 49.009 28.488  36.183  1.00 27.53  ? 298 PHE B CZ    1 
ATOM   4888 N N     . SER D 4 262 ? 48.250 34.502  36.309  1.00 31.54  ? 299 SER B N     1 
ATOM   4889 C CA    . SER D 4 262 ? 47.067 34.759  35.507  1.00 31.99  ? 299 SER B CA    1 
ATOM   4890 C C     . SER D 4 262 ? 47.231 33.919  34.244  1.00 31.60  ? 299 SER B C     1 
ATOM   4891 O O     . SER D 4 262 ? 48.300 33.347  34.004  1.00 30.69  ? 299 SER B O     1 
ATOM   4892 C CB    . SER D 4 262 ? 46.986 36.246  35.142  1.00 32.80  ? 299 SER B CB    1 
ATOM   4893 O OG    . SER D 4 262 ? 46.359 36.426  33.878  1.00 33.71  ? 299 SER B OG    1 
ATOM   4894 N N     . PRO D 4 263 ? 46.174 33.828  33.419  1.00 31.32  ? 300 PRO B N     1 
ATOM   4895 C CA    . PRO D 4 263 ? 46.294 33.029  32.190  1.00 30.46  ? 300 PRO B CA    1 
ATOM   4896 C C     . PRO D 4 263 ? 47.184 33.673  31.118  1.00 29.23  ? 300 PRO B C     1 
ATOM   4897 O O     . PRO D 4 263 ? 47.735 32.973  30.255  1.00 29.09  ? 300 PRO B O     1 
ATOM   4898 C CB    . PRO D 4 263 ? 44.842 32.873  31.741  1.00 30.49  ? 300 PRO B CB    1 
ATOM   4899 C CG    . PRO D 4 263 ? 44.084 32.917  33.051  1.00 30.50  ? 300 PRO B CG    1 
ATOM   4900 C CD    . PRO D 4 263 ? 44.759 34.076  33.743  1.00 30.41  ? 300 PRO B CD    1 
ATOM   4901 N N     . THR D 4 264 ? 47.316 34.998  31.180  1.00 27.48  ? 301 THR B N     1 
ATOM   4902 C CA    . THR D 4 264 ? 48.145 35.730  30.236  1.00 26.68  ? 301 THR B CA    1 
ATOM   4903 C C     . THR D 4 264 ? 49.599 35.343  30.450  1.00 26.30  ? 301 THR B C     1 
ATOM   4904 O O     . THR D 4 264 ? 50.462 35.651  29.641  1.00 26.73  ? 301 THR B O     1 
ATOM   4905 C CB    . THR D 4 264 ? 48.000 37.242  30.424  1.00 26.31  ? 301 THR B CB    1 
ATOM   4906 O OG1   . THR D 4 264 ? 48.015 37.547  31.817  1.00 28.46  ? 301 THR B OG1   1 
ATOM   4907 C CG2   . THR D 4 264 ? 46.700 37.738  29.838  1.00 27.16  ? 301 THR B CG2   1 
ATOM   4908 N N     . ASP D 4 265 ? 49.861 34.656  31.551  1.00 26.04  ? 302 ASP B N     1 
ATOM   4909 C CA    . ASP D 4 265 ? 51.206 34.209  31.863  1.00 26.11  ? 302 ASP B CA    1 
ATOM   4910 C C     . ASP D 4 265 ? 51.517 32.865  31.193  1.00 25.67  ? 302 ASP B C     1 
ATOM   4911 O O     . ASP D 4 265 ? 52.630 32.342  31.300  1.00 26.05  ? 302 ASP B O     1 
ATOM   4912 C CB    . ASP D 4 265 ? 51.371 34.109  33.378  1.00 26.45  ? 302 ASP B CB    1 
ATOM   4913 C CG    . ASP D 4 265 ? 51.253 35.459  34.059  1.00 29.05  ? 302 ASP B CG    1 
ATOM   4914 O OD1   . ASP D 4 265 ? 50.634 35.530  35.148  1.00 29.45  ? 302 ASP B OD1   1 
ATOM   4915 O OD2   . ASP D 4 265 ? 51.783 36.453  33.503  1.00 29.19  ? 302 ASP B OD2   1 
ATOM   4916 N N     . VAL D 4 266 ? 50.537 32.320  30.484  1.00 24.37  ? 303 VAL B N     1 
ATOM   4917 C CA    . VAL D 4 266 ? 50.720 31.045  29.811  1.00 23.45  ? 303 VAL B CA    1 
ATOM   4918 C C     . VAL D 4 266 ? 51.064 31.318  28.368  1.00 23.38  ? 303 VAL B C     1 
ATOM   4919 O O     . VAL D 4 266 ? 50.233 31.774  27.592  1.00 23.84  ? 303 VAL B O     1 
ATOM   4920 C CB    . VAL D 4 266 ? 49.457 30.209  29.875  1.00 23.04  ? 303 VAL B CB    1 
ATOM   4921 C CG1   . VAL D 4 266 ? 49.746 28.807  29.385  1.00 22.78  ? 303 VAL B CG1   1 
ATOM   4922 C CG2   . VAL D 4 266 ? 48.941 30.190  31.298  1.00 23.72  ? 303 VAL B CG2   1 
ATOM   4923 N N     . HIS D 4 267 ? 52.302 31.022  28.009  1.00 22.63  ? 304 HIS B N     1 
ATOM   4924 C CA    . HIS D 4 267 ? 52.794 31.277  26.669  1.00 21.18  ? 304 HIS B CA    1 
ATOM   4925 C C     . HIS D 4 267 ? 52.441 30.217  25.645  1.00 21.83  ? 304 HIS B C     1 
ATOM   4926 O O     . HIS D 4 267 ? 52.868 29.073  25.761  1.00 22.73  ? 304 HIS B O     1 
ATOM   4927 C CB    . HIS D 4 267 ? 54.308 31.441  26.723  1.00 19.22  ? 304 HIS B CB    1 
ATOM   4928 C CG    . HIS D 4 267 ? 54.909 31.855  25.425  1.00 18.32  ? 304 HIS B CG    1 
ATOM   4929 N ND1   . HIS D 4 267 ? 54.642 33.071  24.841  1.00 17.53  ? 304 HIS B ND1   1 
ATOM   4930 C CD2   . HIS D 4 267 ? 55.755 31.209  24.591  1.00 18.74  ? 304 HIS B CD2   1 
ATOM   4931 C CE1   . HIS D 4 267 ? 55.300 33.157  23.701  1.00 19.05  ? 304 HIS B CE1   1 
ATOM   4932 N NE2   . HIS D 4 267 ? 55.983 32.040  23.524  1.00 18.26  ? 304 HIS B NE2   1 
ATOM   4933 N N     . ARG D 4 268 ? 51.663 30.600  24.639  1.00 21.70  ? 305 ARG B N     1 
ATOM   4934 C CA    . ARG D 4 268 ? 51.292 29.678  23.577  1.00 21.97  ? 305 ARG B CA    1 
ATOM   4935 C C     . ARG D 4 268 ? 51.089 28.243  24.044  1.00 21.49  ? 305 ARG B C     1 
ATOM   4936 O O     . ARG D 4 268 ? 51.542 27.308  23.387  1.00 20.94  ? 305 ARG B O     1 
ATOM   4937 C CB    . ARG D 4 268 ? 52.366 29.694  22.478  1.00 23.32  ? 305 ARG B CB    1 
ATOM   4938 C CG    . ARG D 4 268 ? 52.788 31.090  22.054  1.00 25.60  ? 305 ARG B CG    1 
ATOM   4939 C CD    . ARG D 4 268 ? 51.612 31.848  21.471  1.00 28.82  ? 305 ARG B CD    1 
ATOM   4940 N NE    . ARG D 4 268 ? 51.794 33.291  21.561  1.00 30.76  ? 305 ARG B NE    1 
ATOM   4941 C CZ    . ARG D 4 268 ? 52.698 33.960  20.860  1.00 33.55  ? 305 ARG B CZ    1 
ATOM   4942 N NH1   . ARG D 4 268 ? 53.490 33.297  20.015  1.00 34.62  ? 305 ARG B NH1   1 
ATOM   4943 N NH2   . ARG D 4 268 ? 52.824 35.280  21.012  1.00 34.26  ? 305 ARG B NH2   1 
ATOM   4944 N N     . GLN D 4 269 ? 50.426 28.081  25.183  1.00 22.40  ? 306 GLN B N     1 
ATOM   4945 C CA    . GLN D 4 269 ? 50.113 26.762  25.751  1.00 24.43  ? 306 GLN B CA    1 
ATOM   4946 C C     . GLN D 4 269 ? 51.297 25.851  26.124  1.00 24.81  ? 306 GLN B C     1 
ATOM   4947 O O     . GLN D 4 269 ? 51.085 24.749  26.651  1.00 24.85  ? 306 GLN B O     1 
ATOM   4948 C CB    . GLN D 4 269 ? 49.204 25.974  24.792  1.00 24.81  ? 306 GLN B CB    1 
ATOM   4949 C CG    . GLN D 4 269 ? 47.949 26.689  24.331  1.00 26.93  ? 306 GLN B CG    1 
ATOM   4950 C CD    . GLN D 4 269 ? 47.032 25.774  23.519  1.00 29.40  ? 306 GLN B CD    1 
ATOM   4951 O OE1   . GLN D 4 269 ? 46.429 24.848  24.067  1.00 30.61  ? 306 GLN B OE1   1 
ATOM   4952 N NE2   . GLN D 4 269 ? 46.928 26.025  22.204  1.00 29.05  ? 306 GLN B NE2   1 
ATOM   4953 N N     . PHE D 4 270 ? 52.526 26.293  25.860  1.00 24.46  ? 307 PHE B N     1 
ATOM   4954 C CA    . PHE D 4 270 ? 53.702 25.474  26.147  1.00 24.27  ? 307 PHE B CA    1 
ATOM   4955 C C     . PHE D 4 270 ? 54.617 25.915  27.277  1.00 23.49  ? 307 PHE B C     1 
ATOM   4956 O O     . PHE D 4 270 ? 55.605 25.239  27.568  1.00 22.71  ? 307 PHE B O     1 
ATOM   4957 C CB    . PHE D 4 270 ? 54.544 25.313  24.886  1.00 25.28  ? 307 PHE B CB    1 
ATOM   4958 C CG    . PHE D 4 270 ? 53.966 24.352  23.899  1.00 26.44  ? 307 PHE B CG    1 
ATOM   4959 C CD1   . PHE D 4 270 ? 53.760 23.017  24.256  1.00 25.85  ? 307 PHE B CD1   1 
ATOM   4960 C CD2   . PHE D 4 270 ? 53.626 24.774  22.611  1.00 26.37  ? 307 PHE B CD2   1 
ATOM   4961 C CE1   . PHE D 4 270 ? 53.222 22.113  23.345  1.00 26.43  ? 307 PHE B CE1   1 
ATOM   4962 C CE2   . PHE D 4 270 ? 53.087 23.879  21.691  1.00 25.88  ? 307 PHE B CE2   1 
ATOM   4963 C CZ    . PHE D 4 270 ? 52.884 22.546  22.057  1.00 26.13  ? 307 PHE B CZ    1 
ATOM   4964 N N     . ALA D 4 271 ? 54.296 27.038  27.910  1.00 22.67  ? 308 ALA B N     1 
ATOM   4965 C CA    . ALA D 4 271 ? 55.120 27.535  28.996  1.00 22.02  ? 308 ALA B CA    1 
ATOM   4966 C C     . ALA D 4 271 ? 54.324 28.409  29.945  1.00 22.34  ? 308 ALA B C     1 
ATOM   4967 O O     . ALA D 4 271 ? 53.386 29.111  29.542  1.00 21.94  ? 308 ALA B O     1 
ATOM   4968 C CB    . ALA D 4 271 ? 56.284 28.306  28.440  1.00 21.06  ? 308 ALA B CB    1 
ATOM   4969 N N     . ILE D 4 272 ? 54.708 28.366  31.216  1.00 22.34  ? 309 ILE B N     1 
ATOM   4970 C CA    . ILE D 4 272 ? 54.034 29.146  32.237  1.00 22.28  ? 309 ILE B CA    1 
ATOM   4971 C C     . ILE D 4 272 ? 55.052 29.839  33.105  1.00 23.37  ? 309 ILE B C     1 
ATOM   4972 O O     . ILE D 4 272 ? 56.029 29.208  33.525  1.00 24.60  ? 309 ILE B O     1 
ATOM   4973 C CB    . ILE D 4 272 ? 53.214 28.257  33.159  1.00 21.90  ? 309 ILE B CB    1 
ATOM   4974 C CG1   . ILE D 4 272 ? 52.244 27.421  32.338  1.00 23.56  ? 309 ILE B CG1   1 
ATOM   4975 C CG2   . ILE D 4 272 ? 52.448 29.103  34.148  1.00 22.23  ? 309 ILE B CG2   1 
ATOM   4976 C CD1   . ILE D 4 272 ? 51.535 26.364  33.137  1.00 24.34  ? 309 ILE B CD1   1 
ATOM   4977 N N     . VAL D 4 273 ? 54.850 31.132  33.351  1.00 22.23  ? 310 VAL B N     1 
ATOM   4978 C CA    . VAL D 4 273 ? 55.739 31.857  34.243  1.00 22.02  ? 310 VAL B CA    1 
ATOM   4979 C C     . VAL D 4 273 ? 54.857 32.211  35.446  1.00 22.82  ? 310 VAL B C     1 
ATOM   4980 O O     . VAL D 4 273 ? 53.831 32.883  35.321  1.00 24.11  ? 310 VAL B O     1 
ATOM   4981 C CB    . VAL D 4 273 ? 56.398 33.128  33.575  1.00 20.98  ? 310 VAL B CB    1 
ATOM   4982 C CG1   . VAL D 4 273 ? 55.870 33.333  32.196  1.00 23.16  ? 310 VAL B CG1   1 
ATOM   4983 C CG2   . VAL D 4 273 ? 56.183 34.367  34.421  1.00 20.25  ? 310 VAL B CG2   1 
ATOM   4984 N N     . PHE D 4 274 ? 55.251 31.729  36.616  1.00 22.27  ? 311 PHE B N     1 
ATOM   4985 C CA    . PHE D 4 274 ? 54.460 31.956  37.813  1.00 22.17  ? 311 PHE B CA    1 
ATOM   4986 C C     . PHE D 4 274 ? 55.337 32.369  38.967  1.00 22.83  ? 311 PHE B C     1 
ATOM   4987 O O     . PHE D 4 274 ? 56.550 32.490  38.809  1.00 23.94  ? 311 PHE B O     1 
ATOM   4988 C CB    . PHE D 4 274 ? 53.753 30.659  38.189  1.00 20.86  ? 311 PHE B CB    1 
ATOM   4989 C CG    . PHE D 4 274 ? 54.699 29.545  38.539  1.00 18.42  ? 311 PHE B CG    1 
ATOM   4990 C CD1   . PHE D 4 274 ? 54.929 29.202  39.865  1.00 17.91  ? 311 PHE B CD1   1 
ATOM   4991 C CD2   . PHE D 4 274 ? 55.375 28.855  37.539  1.00 17.64  ? 311 PHE B CD2   1 
ATOM   4992 C CE1   . PHE D 4 274 ? 55.817 28.182  40.189  1.00 17.73  ? 311 PHE B CE1   1 
ATOM   4993 C CE2   . PHE D 4 274 ? 56.268 27.835  37.852  1.00 17.12  ? 311 PHE B CE2   1 
ATOM   4994 C CZ    . PHE D 4 274 ? 56.490 27.494  39.173  1.00 16.63  ? 311 PHE B CZ    1 
ATOM   4995 N N     . LYS D 4 275 ? 54.709 32.579  40.124  1.00 22.46  ? 312 LYS B N     1 
ATOM   4996 C CA    . LYS D 4 275 ? 55.421 32.937  41.351  1.00 22.57  ? 312 LYS B CA    1 
ATOM   4997 C C     . LYS D 4 275 ? 55.239 31.827  42.383  1.00 22.40  ? 312 LYS B C     1 
ATOM   4998 O O     . LYS D 4 275 ? 54.134 31.344  42.600  1.00 21.99  ? 312 LYS B O     1 
ATOM   4999 C CB    . LYS D 4 275 ? 54.920 34.267  41.922  1.00 21.50  ? 312 LYS B CB    1 
ATOM   5000 C CG    . LYS D 4 275 ? 55.275 35.467  41.072  1.00 22.22  ? 312 LYS B CG    1 
ATOM   5001 C CD    . LYS D 4 275 ? 55.677 36.651  41.938  1.00 22.27  ? 312 LYS B CD    1 
ATOM   5002 C CE    . LYS D 4 275 ? 55.350 37.973  41.267  1.00 22.13  ? 312 LYS B CE    1 
ATOM   5003 N NZ    . LYS D 4 275 ? 53.865 38.134  41.090  1.00 23.25  ? 312 LYS B NZ    1 
ATOM   5004 N N     . THR D 4 276 ? 56.332 31.421  43.012  1.00 22.62  ? 313 THR B N     1 
ATOM   5005 C CA    . THR D 4 276 ? 56.273 30.361  43.998  1.00 23.78  ? 313 THR B CA    1 
ATOM   5006 C C     . THR D 4 276 ? 55.362 30.698  45.156  1.00 24.81  ? 313 THR B C     1 
ATOM   5007 O O     . THR D 4 276 ? 55.265 31.855  45.571  1.00 25.76  ? 313 THR B O     1 
ATOM   5008 C CB    . THR D 4 276 ? 57.635 30.066  44.589  1.00 23.42  ? 313 THR B CB    1 
ATOM   5009 O OG1   . THR D 4 276 ? 58.266 31.304  44.936  1.00 25.13  ? 313 THR B OG1   1 
ATOM   5010 C CG2   . THR D 4 276 ? 58.495 29.285  43.606  1.00 23.58  ? 313 THR B CG2   1 
ATOM   5011 N N     . PRO D 4 277 ? 54.657 29.686  45.681  1.00 25.21  ? 314 PRO B N     1 
ATOM   5012 C CA    . PRO D 4 277 ? 53.756 29.903  46.811  1.00 25.40  ? 314 PRO B CA    1 
ATOM   5013 C C     . PRO D 4 277 ? 54.573 29.815  48.096  1.00 26.25  ? 314 PRO B C     1 
ATOM   5014 O O     . PRO D 4 277 ? 55.537 29.056  48.167  1.00 25.39  ? 314 PRO B O     1 
ATOM   5015 C CB    . PRO D 4 277 ? 52.763 28.757  46.679  1.00 25.38  ? 314 PRO B CB    1 
ATOM   5016 C CG    . PRO D 4 277 ? 53.632 27.641  46.155  1.00 25.77  ? 314 PRO B CG    1 
ATOM   5017 C CD    . PRO D 4 277 ? 54.484 28.333  45.113  1.00 24.61  ? 314 PRO B CD    1 
ATOM   5018 N N     . LYS D 4 278 ? 54.190 30.599  49.098  1.00 27.73  ? 315 LYS B N     1 
ATOM   5019 C CA    . LYS D 4 278 ? 54.879 30.598  50.389  1.00 29.33  ? 315 LYS B CA    1 
ATOM   5020 C C     . LYS D 4 278 ? 54.808 29.205  51.002  1.00 30.00  ? 315 LYS B C     1 
ATOM   5021 O O     . LYS D 4 278 ? 53.735 28.609  51.036  1.00 30.80  ? 315 LYS B O     1 
ATOM   5022 C CB    . LYS D 4 278 ? 54.210 31.594  51.332  1.00 29.63  ? 315 LYS B CB    1 
ATOM   5023 C CG    . LYS D 4 278 ? 54.903 31.763  52.657  1.00 31.37  ? 315 LYS B CG    1 
ATOM   5024 C CD    . LYS D 4 278 ? 53.982 32.386  53.711  1.00 33.00  ? 315 LYS B CD    1 
ATOM   5025 C CE    . LYS D 4 278 ? 53.325 33.665  53.202  1.00 34.85  ? 315 LYS B CE    1 
ATOM   5026 N NZ    . LYS D 4 278 ? 54.297 34.644  52.594  1.00 36.48  ? 315 LYS B NZ    1 
ATOM   5027 N N     . TYR D 4 279 ? 55.938 28.690  51.481  1.00 30.68  ? 316 TYR B N     1 
ATOM   5028 C CA    . TYR D 4 279 ? 55.976 27.366  52.095  1.00 31.77  ? 316 TYR B CA    1 
ATOM   5029 C C     . TYR D 4 279 ? 55.256 27.393  53.453  1.00 32.79  ? 316 TYR B C     1 
ATOM   5030 O O     . TYR D 4 279 ? 55.093 28.465  54.046  1.00 32.61  ? 316 TYR B O     1 
ATOM   5031 C CB    . TYR D 4 279 ? 57.420 26.925  52.269  1.00 31.88  ? 316 TYR B CB    1 
ATOM   5032 C CG    . TYR D 4 279 ? 57.580 25.584  52.946  1.00 33.44  ? 316 TYR B CG    1 
ATOM   5033 C CD1   . TYR D 4 279 ? 56.897 24.458  52.484  1.00 34.00  ? 316 TYR B CD1   1 
ATOM   5034 C CD2   . TYR D 4 279 ? 58.469 25.423  54.005  1.00 33.55  ? 316 TYR B CD2   1 
ATOM   5035 C CE1   . TYR D 4 279 ? 57.110 23.208  53.053  1.00 34.56  ? 316 TYR B CE1   1 
ATOM   5036 C CE2   . TYR D 4 279 ? 58.684 24.182  54.583  1.00 33.67  ? 316 TYR B CE2   1 
ATOM   5037 C CZ    . TYR D 4 279 ? 58.009 23.082  54.100  1.00 34.37  ? 316 TYR B CZ    1 
ATOM   5038 O OH    . TYR D 4 279 ? 58.261 21.847  54.640  1.00 34.73  ? 316 TYR B OH    1 
ATOM   5039 N N     . LYS D 4 280 ? 54.835 26.223  53.949  1.00 33.39  ? 317 LYS B N     1 
ATOM   5040 C CA    . LYS D 4 280 ? 54.091 26.152  55.220  1.00 33.87  ? 317 LYS B CA    1 
ATOM   5041 C C     . LYS D 4 280 ? 54.785 26.751  56.431  1.00 33.29  ? 317 LYS B C     1 
ATOM   5042 O O     . LYS D 4 280 ? 54.170 27.493  57.199  1.00 33.30  ? 317 LYS B O     1 
ATOM   5043 C CB    . LYS D 4 280 ? 53.690 24.711  55.546  1.00 33.86  ? 317 LYS B CB    1 
ATOM   5044 C CG    . LYS D 4 280 ? 54.854 23.781  55.787  1.00 35.47  ? 317 LYS B CG    1 
ATOM   5045 C CD    . LYS D 4 280 ? 54.355 22.392  56.134  1.00 35.82  ? 317 LYS B CD    1 
ATOM   5046 C CE    . LYS D 4 280 ? 55.503 21.426  56.309  1.00 36.96  ? 317 LYS B CE    1 
ATOM   5047 N NZ    . LYS D 4 280 ? 54.985 20.060  56.593  1.00 38.55  ? 317 LYS B NZ    1 
ATOM   5048 N N     . ASP D 4 281 ? 56.059 26.421  56.602  1.00 33.32  ? 318 ASP B N     1 
ATOM   5049 C CA    . ASP D 4 281 ? 56.845 26.938  57.717  1.00 32.77  ? 318 ASP B CA    1 
ATOM   5050 C C     . ASP D 4 281 ? 57.983 27.821  57.193  1.00 32.15  ? 318 ASP B C     1 
ATOM   5051 O O     . ASP D 4 281 ? 59.016 27.309  56.745  1.00 31.50  ? 318 ASP B O     1 
ATOM   5052 C CB    . ASP D 4 281 ? 57.409 25.769  58.533  1.00 33.55  ? 318 ASP B CB    1 
ATOM   5053 C CG    . ASP D 4 281 ? 58.131 26.221  59.800  1.00 34.55  ? 318 ASP B CG    1 
ATOM   5054 O OD1   . ASP D 4 281 ? 57.942 27.383  60.231  1.00 34.71  ? 318 ASP B OD1   1 
ATOM   5055 O OD2   . ASP D 4 281 ? 58.877 25.398  60.379  1.00 34.49  ? 318 ASP B OD2   1 
ATOM   5056 N N     . VAL D 4 282 ? 57.775 29.138  57.231  1.00 30.34  ? 319 VAL B N     1 
ATOM   5057 C CA    . VAL D 4 282 ? 58.786 30.092  56.784  1.00 29.84  ? 319 VAL B CA    1 
ATOM   5058 C C     . VAL D 4 282 ? 59.825 30.289  57.882  1.00 29.70  ? 319 VAL B C     1 
ATOM   5059 O O     . VAL D 4 282 ? 60.550 31.289  57.906  1.00 29.75  ? 319 VAL B O     1 
ATOM   5060 C CB    . VAL D 4 282 ? 58.176 31.477  56.482  1.00 30.46  ? 319 VAL B CB    1 
ATOM   5061 C CG1   . VAL D 4 282 ? 57.121 31.358  55.394  1.00 30.35  ? 319 VAL B CG1   1 
ATOM   5062 C CG2   . VAL D 4 282 ? 57.587 32.084  57.764  1.00 29.37  ? 319 VAL B CG2   1 
ATOM   5063 N N     . ASN D 4 283 ? 59.883 29.330  58.799  1.00 29.46  ? 320 ASN B N     1 
ATOM   5064 C CA    . ASN D 4 283 ? 60.819 29.378  59.911  1.00 28.82  ? 320 ASN B CA    1 
ATOM   5065 C C     . ASN D 4 283 ? 61.777 28.199  59.959  1.00 28.75  ? 320 ASN B C     1 
ATOM   5066 O O     . ASN D 4 283 ? 62.586 28.108  60.874  1.00 28.51  ? 320 ASN B O     1 
ATOM   5067 C CB    . ASN D 4 283 ? 60.051 29.464  61.220  1.00 28.91  ? 320 ASN B CB    1 
ATOM   5068 C CG    . ASN D 4 283 ? 59.503 30.839  61.468  1.00 29.37  ? 320 ASN B CG    1 
ATOM   5069 O OD1   . ASN D 4 283 ? 58.439 30.995  62.051  1.00 30.50  ? 320 ASN B OD1   1 
ATOM   5070 N ND2   . ASN D 4 283 ? 60.232 31.856  61.030  1.00 30.44  ? 320 ASN B ND2   1 
ATOM   5071 N N     . ILE D 4 284 ? 61.698 27.306  58.974  1.00 29.09  ? 321 ILE B N     1 
ATOM   5072 C CA    . ILE D 4 284 ? 62.588 26.147  58.942  1.00 29.76  ? 321 ILE B CA    1 
ATOM   5073 C C     . ILE D 4 284 ? 64.038 26.591  58.941  1.00 30.84  ? 321 ILE B C     1 
ATOM   5074 O O     . ILE D 4 284 ? 64.369 27.695  58.507  1.00 30.18  ? 321 ILE B O     1 
ATOM   5075 C CB    . ILE D 4 284 ? 62.376 25.273  57.697  1.00 29.37  ? 321 ILE B CB    1 
ATOM   5076 C CG1   . ILE D 4 284 ? 62.622 26.097  56.439  1.00 28.88  ? 321 ILE B CG1   1 
ATOM   5077 C CG2   . ILE D 4 284 ? 60.982 24.691  57.699  1.00 29.15  ? 321 ILE B CG2   1 
ATOM   5078 C CD1   . ILE D 4 284 ? 62.890 25.253  55.231  1.00 29.66  ? 321 ILE B CD1   1 
ATOM   5079 N N     . THR D 4 285 ? 64.906 25.712  59.408  1.00 32.22  ? 322 THR B N     1 
ATOM   5080 C CA    . THR D 4 285 ? 66.323 26.033  59.481  1.00 34.09  ? 322 THR B CA    1 
ATOM   5081 C C     . THR D 4 285 ? 67.146 25.165  58.561  1.00 34.42  ? 322 THR B C     1 
ATOM   5082 O O     . THR D 4 285 ? 68.338 25.406  58.363  1.00 34.86  ? 322 THR B O     1 
ATOM   5083 C CB    . THR D 4 285 ? 66.836 25.860  60.903  1.00 35.04  ? 322 THR B CB    1 
ATOM   5084 O OG1   . THR D 4 285 ? 66.199 24.714  61.500  1.00 35.71  ? 322 THR B OG1   1 
ATOM   5085 C CG2   . THR D 4 285 ? 66.543 27.116  61.709  1.00 34.99  ? 322 THR B CG2   1 
ATOM   5086 N N     . LYS D 4 286 ? 66.512 24.136  58.013  1.00 34.45  ? 323 LYS B N     1 
ATOM   5087 C CA    . LYS D 4 286 ? 67.199 23.249  57.091  1.00 33.87  ? 323 LYS B CA    1 
ATOM   5088 C C     . LYS D 4 286 ? 66.283 23.166  55.864  1.00 32.74  ? 323 LYS B C     1 
ATOM   5089 O O     . LYS D 4 286 ? 65.059 23.251  55.996  1.00 32.40  ? 323 LYS B O     1 
ATOM   5090 C CB    . LYS D 4 286 ? 67.419 21.882  57.759  1.00 34.76  ? 323 LYS B CB    1 
ATOM   5091 C CG    . LYS D 4 286 ? 68.657 21.121  57.256  1.00 37.49  ? 323 LYS B CG    1 
ATOM   5092 C CD    . LYS D 4 286 ? 68.356 20.234  56.022  1.00 38.58  ? 323 LYS B CD    1 
ATOM   5093 C CE    . LYS D 4 286 ? 69.626 19.875  55.233  1.00 38.21  ? 323 LYS B CE    1 
ATOM   5094 N NZ    . LYS D 4 286 ? 70.692 19.270  56.080  1.00 38.61  ? 323 LYS B NZ    1 
ATOM   5095 N N     . PRO D 4 287 ? 66.862 23.040  54.657  1.00 31.60  ? 324 PRO B N     1 
ATOM   5096 C CA    . PRO D 4 287 ? 66.063 22.957  53.435  1.00 31.25  ? 324 PRO B CA    1 
ATOM   5097 C C     . PRO D 4 287 ? 64.975 21.907  53.541  1.00 31.43  ? 324 PRO B C     1 
ATOM   5098 O O     . PRO D 4 287 ? 65.129 20.902  54.228  1.00 31.06  ? 324 PRO B O     1 
ATOM   5099 C CB    . PRO D 4 287 ? 67.091 22.596  52.376  1.00 30.31  ? 324 PRO B CB    1 
ATOM   5100 C CG    . PRO D 4 287 ? 68.297 23.261  52.864  1.00 30.58  ? 324 PRO B CG    1 
ATOM   5101 C CD    . PRO D 4 287 ? 68.291 22.937  54.333  1.00 31.19  ? 324 PRO B CD    1 
ATOM   5102 N N     . ALA D 4 288 ? 63.868 22.155  52.859  1.00 31.74  ? 325 ALA B N     1 
ATOM   5103 C CA    . ALA D 4 288 ? 62.751 21.230  52.856  1.00 32.14  ? 325 ALA B CA    1 
ATOM   5104 C C     . ALA D 4 288 ? 62.470 20.831  51.421  1.00 32.74  ? 325 ALA B C     1 
ATOM   5105 O O     . ALA D 4 288 ? 62.028 21.656  50.623  1.00 33.15  ? 325 ALA B O     1 
ATOM   5106 C CB    . ALA D 4 288 ? 61.525 21.888  53.456  1.00 31.67  ? 325 ALA B CB    1 
ATOM   5107 N N     . SER D 4 289 ? 62.745 19.575  51.088  1.00 33.17  ? 326 SER B N     1 
ATOM   5108 C CA    . SER D 4 289 ? 62.483 19.081  49.744  1.00 33.06  ? 326 SER B CA    1 
ATOM   5109 C C     . SER D 4 289 ? 61.008 18.706  49.598  1.00 32.79  ? 326 SER B C     1 
ATOM   5110 O O     . SER D 4 289 ? 60.433 18.058  50.476  1.00 32.15  ? 326 SER B O     1 
ATOM   5111 C CB    . SER D 4 289 ? 63.337 17.863  49.442  1.00 32.68  ? 326 SER B CB    1 
ATOM   5112 O OG    . SER D 4 289 ? 62.973 17.348  48.176  1.00 34.76  ? 326 SER B OG    1 
ATOM   5113 N N     . VAL D 4 290 ? 60.393 19.132  48.498  1.00 32.59  ? 327 VAL B N     1 
ATOM   5114 C CA    . VAL D 4 290 ? 58.988 18.820  48.258  1.00 32.15  ? 327 VAL B CA    1 
ATOM   5115 C C     . VAL D 4 290 ? 58.781 18.538  46.787  1.00 31.81  ? 327 VAL B C     1 
ATOM   5116 O O     . VAL D 4 290 ? 59.742 18.430  46.036  1.00 31.25  ? 327 VAL B O     1 
ATOM   5117 C CB    . VAL D 4 290 ? 58.042 19.970  48.705  1.00 31.96  ? 327 VAL B CB    1 
ATOM   5118 C CG1   . VAL D 4 290 ? 58.503 20.523  50.049  1.00 31.45  ? 327 VAL B CG1   1 
ATOM   5119 C CG2   . VAL D 4 290 ? 57.988 21.065  47.649  1.00 32.47  ? 327 VAL B CG2   1 
ATOM   5120 N N     . PHE D 4 291 ? 57.523 18.407  46.382  1.00 32.80  ? 328 PHE B N     1 
ATOM   5121 C CA    . PHE D 4 291 ? 57.203 18.117  44.986  1.00 32.99  ? 328 PHE B CA    1 
ATOM   5122 C C     . PHE D 4 291 ? 56.279 19.121  44.314  1.00 33.06  ? 328 PHE B C     1 
ATOM   5123 O O     . PHE D 4 291 ? 55.373 19.690  44.943  1.00 31.83  ? 328 PHE B O     1 
ATOM   5124 C CB    . PHE D 4 291 ? 56.562 16.733  44.863  1.00 33.55  ? 328 PHE B CB    1 
ATOM   5125 C CG    . PHE D 4 291 ? 57.516 15.597  45.060  1.00 34.29  ? 328 PHE B CG    1 
ATOM   5126 C CD1   . PHE D 4 291 ? 58.564 15.393  44.174  1.00 34.78  ? 328 PHE B CD1   1 
ATOM   5127 C CD2   . PHE D 4 291 ? 57.355 14.714  46.121  1.00 34.53  ? 328 PHE B CD2   1 
ATOM   5128 C CE1   . PHE D 4 291 ? 59.441 14.322  44.339  1.00 35.54  ? 328 PHE B CE1   1 
ATOM   5129 C CE2   . PHE D 4 291 ? 58.226 13.641  46.296  1.00 34.41  ? 328 PHE B CE2   1 
ATOM   5130 C CZ    . PHE D 4 291 ? 59.270 13.443  45.405  1.00 35.01  ? 328 PHE B CZ    1 
ATOM   5131 N N     . VAL D 4 292 ? 56.527 19.310  43.019  1.00 33.11  ? 329 VAL B N     1 
ATOM   5132 C CA    . VAL D 4 292 ? 55.735 20.194  42.168  1.00 33.15  ? 329 VAL B CA    1 
ATOM   5133 C C     . VAL D 4 292 ? 55.097 19.362  41.058  1.00 33.76  ? 329 VAL B C     1 
ATOM   5134 O O     . VAL D 4 292 ? 55.730 18.466  40.495  1.00 33.52  ? 329 VAL B O     1 
ATOM   5135 C CB    . VAL D 4 292 ? 56.587 21.247  41.448  1.00 32.17  ? 329 VAL B CB    1 
ATOM   5136 C CG1   . VAL D 4 292 ? 55.830 22.559  41.378  1.00 31.19  ? 329 VAL B CG1   1 
ATOM   5137 C CG2   . VAL D 4 292 ? 57.916 21.386  42.124  1.00 32.16  ? 329 VAL B CG2   1 
ATOM   5138 N N     . GLN D 4 293 ? 53.851 19.665  40.730  1.00 34.40  ? 330 GLN B N     1 
ATOM   5139 C CA    . GLN D 4 293 ? 53.193 18.939  39.667  1.00 34.90  ? 330 GLN B CA    1 
ATOM   5140 C C     . GLN D 4 293 ? 52.165 19.787  38.957  1.00 34.87  ? 330 GLN B C     1 
ATOM   5141 O O     . GLN D 4 293 ? 51.591 20.719  39.535  1.00 34.79  ? 330 GLN B O     1 
ATOM   5142 C CB    . GLN D 4 293 ? 52.506 17.693  40.210  1.00 36.43  ? 330 GLN B CB    1 
ATOM   5143 C CG    . GLN D 4 293 ? 51.264 17.983  41.039  1.00 37.82  ? 330 GLN B CG    1 
ATOM   5144 C CD    . GLN D 4 293 ? 50.693 16.732  41.675  1.00 38.90  ? 330 GLN B CD    1 
ATOM   5145 O OE1   . GLN D 4 293 ? 49.872 16.814  42.590  1.00 40.46  ? 330 GLN B OE1   1 
ATOM   5146 N NE2   . GLN D 4 293 ? 51.124 15.565  41.193  1.00 38.56  ? 330 GLN B NE2   1 
ATOM   5147 N N     . LEU D 4 294 ? 51.955 19.446  37.691  1.00 34.53  ? 331 LEU B N     1 
ATOM   5148 C CA    . LEU D 4 294 ? 50.976 20.107  36.857  1.00 34.45  ? 331 LEU B CA    1 
ATOM   5149 C C     . LEU D 4 294 ? 49.672 19.381  37.126  1.00 34.97  ? 331 LEU B C     1 
ATOM   5150 O O     . LEU D 4 294 ? 49.632 18.147  37.127  1.00 35.41  ? 331 LEU B O     1 
ATOM   5151 C CB    . LEU D 4 294 ? 51.326 19.936  35.382  1.00 34.26  ? 331 LEU B CB    1 
ATOM   5152 C CG    . LEU D 4 294 ? 51.723 21.169  34.576  1.00 34.26  ? 331 LEU B CG    1 
ATOM   5153 C CD1   . LEU D 4 294 ? 51.279 22.433  35.307  1.00 32.69  ? 331 LEU B CD1   1 
ATOM   5154 C CD2   . LEU D 4 294 ? 53.228 21.153  34.360  1.00 34.56  ? 331 LEU B CD2   1 
ATOM   5155 N N     . ARG D 4 295 ? 48.609 20.132  37.360  1.00 34.53  ? 332 ARG B N     1 
ATOM   5156 C CA    . ARG D 4 295 ? 47.324 19.513  37.607  1.00 34.71  ? 332 ARG B CA    1 
ATOM   5157 C C     . ARG D 4 295 ? 46.220 20.222  36.844  1.00 35.42  ? 332 ARG B C     1 
ATOM   5158 O O     . ARG D 4 295 ? 46.061 21.443  36.943  1.00 33.57  ? 332 ARG B O     1 
ATOM   5159 C CB    . ARG D 4 295 ? 46.994 19.506  39.100  1.00 34.29  ? 332 ARG B CB    1 
ATOM   5160 C CG    . ARG D 4 295 ? 45.796 18.638  39.421  1.00 33.71  ? 332 ARG B CG    1 
ATOM   5161 C CD    . ARG D 4 295 ? 45.601 18.461  40.904  1.00 34.06  ? 332 ARG B CD    1 
ATOM   5162 N NE    . ARG D 4 295 ? 44.871 19.577  41.497  1.00 33.87  ? 332 ARG B NE    1 
ATOM   5163 C CZ    . ARG D 4 295 ? 44.557 19.646  42.785  1.00 32.18  ? 332 ARG B CZ    1 
ATOM   5164 N NH1   . ARG D 4 295 ? 44.918 18.658  43.595  1.00 30.46  ? 332 ARG B NH1   1 
ATOM   5165 N NH2   . ARG D 4 295 ? 43.889 20.696  43.254  1.00 31.36  ? 332 ARG B NH2   1 
ATOM   5166 N N     . ARG D 4 296 ? 45.467 19.430  36.079  1.00 37.23  ? 333 ARG B N     1 
ATOM   5167 C CA    . ARG D 4 296 ? 44.357 19.943  35.286  1.00 38.97  ? 333 ARG B CA    1 
ATOM   5168 C C     . ARG D 4 296 ? 43.234 20.281  36.256  1.00 39.51  ? 333 ARG B C     1 
ATOM   5169 O O     . ARG D 4 296 ? 42.793 19.433  37.029  1.00 39.86  ? 333 ARG B O     1 
ATOM   5170 C CB    . ARG D 4 296 ? 43.894 18.889  34.281  1.00 39.53  ? 333 ARG B CB    1 
ATOM   5171 C CG    . ARG D 4 296 ? 43.416 19.468  32.956  1.00 39.89  ? 333 ARG B CG    1 
ATOM   5172 C CD    . ARG D 4 296 ? 42.621 18.451  32.168  1.00 39.69  ? 333 ARG B CD    1 
ATOM   5173 N NE    . ARG D 4 296 ? 43.385 17.243  31.890  1.00 40.28  ? 333 ARG B NE    1 
ATOM   5174 C CZ    . ARG D 4 296 ? 44.407 17.183  31.044  1.00 41.08  ? 333 ARG B CZ    1 
ATOM   5175 N NH1   . ARG D 4 296 ? 44.794 18.274  30.391  1.00 42.20  ? 333 ARG B NH1   1 
ATOM   5176 N NH2   . ARG D 4 296 ? 45.032 16.030  30.836  1.00 41.13  ? 333 ARG B NH2   1 
ATOM   5177 N N     . LYS D 4 297 ? 42.776 21.522  36.218  1.00 40.04  ? 334 LYS B N     1 
ATOM   5178 C CA    . LYS D 4 297 ? 41.743 21.956  37.134  1.00 41.35  ? 334 LYS B CA    1 
ATOM   5179 C C     . LYS D 4 297 ? 40.389 21.293  36.871  1.00 42.63  ? 334 LYS B C     1 
ATOM   5180 O O     . LYS D 4 297 ? 39.494 21.337  37.721  1.00 43.35  ? 334 LYS B O     1 
ATOM   5181 C CB    . LYS D 4 297 ? 41.614 23.470  37.052  1.00 41.77  ? 334 LYS B CB    1 
ATOM   5182 C CG    . LYS D 4 297 ? 40.811 24.109  38.174  1.00 42.74  ? 334 LYS B CG    1 
ATOM   5183 C CD    . LYS D 4 297 ? 40.799 25.623  38.017  1.00 44.33  ? 334 LYS B CD    1 
ATOM   5184 C CE    . LYS D 4 297 ? 42.212 26.185  37.826  1.00 44.72  ? 334 LYS B CE    1 
ATOM   5185 N NZ    . LYS D 4 297 ? 42.211 27.654  37.591  1.00 45.02  ? 334 LYS B NZ    1 
ATOM   5186 N N     . SER D 4 298 ? 40.250 20.662  35.706  1.00 43.31  ? 335 SER B N     1 
ATOM   5187 C CA    . SER D 4 298 ? 39.003 20.005  35.311  1.00 42.56  ? 335 SER B CA    1 
ATOM   5188 C C     . SER D 4 298 ? 38.838 18.603  35.883  1.00 42.43  ? 335 SER B C     1 
ATOM   5189 O O     . SER D 4 298 ? 37.933 18.350  36.669  1.00 42.14  ? 335 SER B O     1 
ATOM   5190 C CB    . SER D 4 298 ? 38.917 19.918  33.785  1.00 42.43  ? 335 SER B CB    1 
ATOM   5191 O OG    . SER D 4 298 ? 39.723 18.858  33.281  1.00 41.97  ? 335 SER B OG    1 
ATOM   5192 N N     . ASP D 4 299 ? 39.703 17.692  35.464  1.00 42.55  ? 336 ASP B N     1 
ATOM   5193 C CA    . ASP D 4 299 ? 39.636 16.313  35.919  1.00 43.93  ? 336 ASP B CA    1 
ATOM   5194 C C     . ASP D 4 299 ? 40.632 16.020  37.036  1.00 44.75  ? 336 ASP B C     1 
ATOM   5195 O O     . ASP D 4 299 ? 40.924 14.847  37.311  1.00 45.11  ? 336 ASP B O     1 
ATOM   5196 C CB    . ASP D 4 299 ? 39.933 15.381  34.757  1.00 43.97  ? 336 ASP B CB    1 
ATOM   5197 C CG    . ASP D 4 299 ? 41.277 15.669  34.131  1.00 45.16  ? 336 ASP B CG    1 
ATOM   5198 O OD1   . ASP D 4 299 ? 41.729 14.881  33.270  1.00 45.07  ? 336 ASP B OD1   1 
ATOM   5199 O OD2   . ASP D 4 299 ? 41.876 16.702  34.504  1.00 44.92  ? 336 ASP B OD2   1 
ATOM   5200 N N     . LEU D 4 300 ? 41.145 17.079  37.671  1.00 45.12  ? 337 LEU B N     1 
ATOM   5201 C CA    . LEU D 4 300 ? 42.138 16.959  38.746  1.00 44.73  ? 337 LEU B CA    1 
ATOM   5202 C C     . LEU D 4 300 ? 43.184 15.898  38.426  1.00 45.17  ? 337 LEU B C     1 
ATOM   5203 O O     . LEU D 4 300 ? 43.632 15.178  39.314  1.00 45.53  ? 337 LEU B O     1 
ATOM   5204 C CB    . LEU D 4 300 ? 41.468 16.630  40.085  1.00 43.63  ? 337 LEU B CB    1 
ATOM   5205 C CG    . LEU D 4 300 ? 40.476 17.676  40.602  1.00 43.72  ? 337 LEU B CG    1 
ATOM   5206 C CD1   . LEU D 4 300 ? 39.868 17.201  41.902  1.00 43.38  ? 337 LEU B CD1   1 
ATOM   5207 C CD2   . LEU D 4 300 ? 41.175 19.008  40.807  1.00 43.48  ? 337 LEU B CD2   1 
ATOM   5208 N N     . GLU D 4 301 ? 43.561 15.801  37.154  1.00 45.32  ? 338 GLU B N     1 
ATOM   5209 C CA    . GLU D 4 301 ? 44.563 14.829  36.725  1.00 45.49  ? 338 GLU B CA    1 
ATOM   5210 C C     . GLU D 4 301 ? 45.917 15.534  36.802  1.00 44.82  ? 338 GLU B C     1 
ATOM   5211 O O     . GLU D 4 301 ? 46.033 16.720  36.462  1.00 43.72  ? 338 GLU B O     1 
ATOM   5212 C CB    . GLU D 4 301 ? 44.273 14.361  35.289  1.00 46.93  ? 338 GLU B CB    1 
ATOM   5213 C CG    . GLU D 4 301 ? 44.780 12.960  34.980  1.00 48.72  ? 338 GLU B CG    1 
ATOM   5214 C CD    . GLU D 4 301 ? 44.032 11.880  35.759  1.00 50.41  ? 338 GLU B CD    1 
ATOM   5215 O OE1   . GLU D 4 301 ? 44.530 10.729  35.796  1.00 51.44  ? 338 GLU B OE1   1 
ATOM   5216 O OE2   . GLU D 4 301 ? 42.947 12.178  36.325  1.00 50.17  ? 338 GLU B OE2   1 
ATOM   5217 N N     . THR D 4 302 ? 46.942 14.808  37.228  1.00 44.30  ? 339 THR B N     1 
ATOM   5218 C CA    . THR D 4 302 ? 48.258 15.419  37.387  1.00 44.03  ? 339 THR B CA    1 
ATOM   5219 C C     . THR D 4 302 ? 49.364 14.860  36.506  1.00 44.47  ? 339 THR B C     1 
ATOM   5220 O O     . THR D 4 302 ? 49.162 13.893  35.772  1.00 45.01  ? 339 THR B O     1 
ATOM   5221 C CB    . THR D 4 302 ? 48.741 15.290  38.840  1.00 43.20  ? 339 THR B CB    1 
ATOM   5222 O OG1   . THR D 4 302 ? 49.416 14.035  39.006  1.00 41.51  ? 339 THR B OG1   1 
ATOM   5223 C CG2   . THR D 4 302 ? 47.552 15.369  39.797  1.00 42.55  ? 339 THR B CG2   1 
ATOM   5224 N N     . SER D 4 303 ? 50.540 15.483  36.604  1.00 44.10  ? 340 SER B N     1 
ATOM   5225 C CA    . SER D 4 303 ? 51.717 15.065  35.853  1.00 43.66  ? 340 SER B CA    1 
ATOM   5226 C C     . SER D 4 303 ? 52.683 14.445  36.840  1.00 43.07  ? 340 SER B C     1 
ATOM   5227 O O     . SER D 4 303 ? 52.495 14.568  38.043  1.00 43.09  ? 340 SER B O     1 
ATOM   5228 C CB    . SER D 4 303 ? 52.402 16.264  35.205  1.00 44.40  ? 340 SER B CB    1 
ATOM   5229 O OG    . SER D 4 303 ? 53.108 17.020  36.174  1.00 44.86  ? 340 SER B OG    1 
ATOM   5230 N N     . GLU D 4 304 ? 53.719 13.792  36.327  1.00 42.83  ? 341 GLU B N     1 
ATOM   5231 C CA    . GLU D 4 304 ? 54.729 13.168  37.169  1.00 42.55  ? 341 GLU B CA    1 
ATOM   5232 C C     . GLU D 4 304 ? 55.224 14.229  38.145  1.00 41.89  ? 341 GLU B C     1 
ATOM   5233 O O     . GLU D 4 304 ? 55.694 15.288  37.733  1.00 42.83  ? 341 GLU B O     1 
ATOM   5234 C CB    . GLU D 4 304 ? 55.897 12.696  36.316  1.00 44.04  ? 341 GLU B CB    1 
ATOM   5235 C CG    . GLU D 4 304 ? 56.517 11.406  36.771  1.00 47.28  ? 341 GLU B CG    1 
ATOM   5236 C CD    . GLU D 4 304 ? 55.682 10.196  36.375  1.00 49.37  ? 341 GLU B CD    1 
ATOM   5237 O OE1   . GLU D 4 304 ? 54.498 10.110  36.792  1.00 50.25  ? 341 GLU B OE1   1 
ATOM   5238 O OE2   . GLU D 4 304 ? 56.217 9.329   35.643  1.00 50.34  ? 341 GLU B OE2   1 
ATOM   5239 N N     . PRO D 4 305 ? 55.125 13.969  39.455  1.00 40.76  ? 342 PRO B N     1 
ATOM   5240 C CA    . PRO D 4 305 ? 55.589 14.970  40.416  1.00 38.99  ? 342 PRO B CA    1 
ATOM   5241 C C     . PRO D 4 305 ? 57.047 15.308  40.191  1.00 37.11  ? 342 PRO B C     1 
ATOM   5242 O O     . PRO D 4 305 ? 57.856 14.438  39.863  1.00 37.40  ? 342 PRO B O     1 
ATOM   5243 C CB    . PRO D 4 305 ? 55.361 14.285  41.757  1.00 39.86  ? 342 PRO B CB    1 
ATOM   5244 C CG    . PRO D 4 305 ? 55.624 12.855  41.430  1.00 40.29  ? 342 PRO B CG    1 
ATOM   5245 C CD    . PRO D 4 305 ? 54.855 12.691  40.134  1.00 40.95  ? 342 PRO B CD    1 
ATOM   5246 N N     . LYS D 4 306 ? 57.381 16.580  40.349  1.00 34.83  ? 343 LYS B N     1 
ATOM   5247 C CA    . LYS D 4 306 ? 58.756 17.008  40.170  1.00 32.60  ? 343 LYS B CA    1 
ATOM   5248 C C     . LYS D 4 306 ? 59.244 17.585  41.495  1.00 30.75  ? 343 LYS B C     1 
ATOM   5249 O O     . LYS D 4 306 ? 58.528 18.332  42.163  1.00 29.62  ? 343 LYS B O     1 
ATOM   5250 C CB    . LYS D 4 306 ? 58.834 18.049  39.053  1.00 33.16  ? 343 LYS B CB    1 
ATOM   5251 C CG    . LYS D 4 306 ? 60.238 18.266  38.511  1.00 34.69  ? 343 LYS B CG    1 
ATOM   5252 C CD    . LYS D 4 306 ? 60.265 19.315  37.401  1.00 35.34  ? 343 LYS B CD    1 
ATOM   5253 C CE    . LYS D 4 306 ? 61.692 19.737  37.054  1.00 35.82  ? 343 LYS B CE    1 
ATOM   5254 N NZ    . LYS D 4 306 ? 62.542 18.589  36.605  1.00 36.38  ? 343 LYS B NZ    1 
ATOM   5255 N N     . PRO D 4 307 ? 60.455 17.206  41.914  1.00 29.46  ? 344 PRO B N     1 
ATOM   5256 C CA    . PRO D 4 307 ? 61.080 17.665  43.162  1.00 28.87  ? 344 PRO B CA    1 
ATOM   5257 C C     . PRO D 4 307 ? 61.462 19.141  43.146  1.00 27.98  ? 344 PRO B C     1 
ATOM   5258 O O     . PRO D 4 307 ? 62.088 19.614  42.200  1.00 28.31  ? 344 PRO B O     1 
ATOM   5259 C CB    . PRO D 4 307 ? 62.308 16.770  43.278  1.00 28.90  ? 344 PRO B CB    1 
ATOM   5260 C CG    . PRO D 4 307 ? 62.684 16.563  41.847  1.00 29.34  ? 344 PRO B CG    1 
ATOM   5261 C CD    . PRO D 4 307 ? 61.335 16.257  41.217  1.00 29.32  ? 344 PRO B CD    1 
ATOM   5262 N N     . PHE D 4 308 ? 61.080 19.854  44.198  1.00 27.60  ? 345 PHE B N     1 
ATOM   5263 C CA    . PHE D 4 308 ? 61.379 21.274  44.346  1.00 28.39  ? 345 PHE B CA    1 
ATOM   5264 C C     . PHE D 4 308 ? 61.870 21.510  45.770  1.00 29.20  ? 345 PHE B C     1 
ATOM   5265 O O     . PHE D 4 308 ? 61.223 21.098  46.740  1.00 29.47  ? 345 PHE B O     1 
ATOM   5266 C CB    . PHE D 4 308 ? 60.132 22.119  44.083  1.00 28.54  ? 345 PHE B CB    1 
ATOM   5267 C CG    . PHE D 4 308 ? 60.341 23.593  44.276  1.00 28.38  ? 345 PHE B CG    1 
ATOM   5268 C CD1   . PHE D 4 308 ? 60.339 24.150  45.546  1.00 28.85  ? 345 PHE B CD1   1 
ATOM   5269 C CD2   . PHE D 4 308 ? 60.541 24.424  43.188  1.00 28.35  ? 345 PHE B CD2   1 
ATOM   5270 C CE1   . PHE D 4 308 ? 60.531 25.515  45.724  1.00 29.24  ? 345 PHE B CE1   1 
ATOM   5271 C CE2   . PHE D 4 308 ? 60.733 25.789  43.357  1.00 27.85  ? 345 PHE B CE2   1 
ATOM   5272 C CZ    . PHE D 4 308 ? 60.728 26.335  44.622  1.00 28.69  ? 345 PHE B CZ    1 
ATOM   5273 N N     . LEU D 4 309 ? 63.014 22.180  45.885  1.00 29.37  ? 346 LEU B N     1 
ATOM   5274 C CA    . LEU D 4 309 ? 63.613 22.455  47.180  1.00 29.26  ? 346 LEU B CA    1 
ATOM   5275 C C     . LEU D 4 309 ? 63.340 23.852  47.761  1.00 29.11  ? 346 LEU B C     1 
ATOM   5276 O O     . LEU D 4 309 ? 63.504 24.877  47.082  1.00 29.75  ? 346 LEU B O     1 
ATOM   5277 C CB    . LEU D 4 309 ? 65.124 22.234  47.107  1.00 29.47  ? 346 LEU B CB    1 
ATOM   5278 C CG    . LEU D 4 309 ? 65.745 22.445  48.486  1.00 30.32  ? 346 LEU B CG    1 
ATOM   5279 C CD1   . LEU D 4 309 ? 65.135 21.428  49.456  1.00 30.73  ? 346 LEU B CD1   1 
ATOM   5280 C CD2   . LEU D 4 309 ? 67.245 22.318  48.418  1.00 29.92  ? 346 LEU B CD2   1 
ATOM   5281 N N     . TYR D 4 310 ? 62.939 23.863  49.031  1.00 27.89  ? 347 TYR B N     1 
ATOM   5282 C CA    . TYR D 4 310 ? 62.643 25.080  49.779  1.00 26.78  ? 347 TYR B CA    1 
ATOM   5283 C C     . TYR D 4 310 ? 63.774 25.333  50.762  1.00 26.88  ? 347 TYR B C     1 
ATOM   5284 O O     . TYR D 4 310 ? 64.108 24.460  51.571  1.00 28.15  ? 347 TYR B O     1 
ATOM   5285 C CB    . TYR D 4 310 ? 61.335 24.922  50.548  1.00 25.69  ? 347 TYR B CB    1 
ATOM   5286 C CG    . TYR D 4 310 ? 60.147 25.475  49.807  1.00 25.93  ? 347 TYR B CG    1 
ATOM   5287 C CD1   . TYR D 4 310 ? 59.017 24.689  49.568  1.00 26.00  ? 347 TYR B CD1   1 
ATOM   5288 C CD2   . TYR D 4 310 ? 60.147 26.787  49.337  1.00 24.68  ? 347 TYR B CD2   1 
ATOM   5289 C CE1   . TYR D 4 310 ? 57.917 25.201  48.878  1.00 25.05  ? 347 TYR B CE1   1 
ATOM   5290 C CE2   . TYR D 4 310 ? 59.053 27.300  48.653  1.00 24.71  ? 347 TYR B CE2   1 
ATOM   5291 C CZ    . TYR D 4 310 ? 57.944 26.501  48.427  1.00 24.82  ? 347 TYR B CZ    1 
ATOM   5292 O OH    . TYR D 4 310 ? 56.865 27.001  47.744  1.00 24.82  ? 347 TYR B OH    1 
ATOM   5293 N N     . TYR D 4 311 ? 64.373 26.520  50.699  1.00 25.69  ? 348 TYR B N     1 
ATOM   5294 C CA    . TYR D 4 311 ? 65.470 26.834  51.598  1.00 23.11  ? 348 TYR B CA    1 
ATOM   5295 C C     . TYR D 4 311 ? 65.156 28.008  52.492  1.00 23.67  ? 348 TYR B C     1 
ATOM   5296 O O     . TYR D 4 311 ? 64.395 28.905  52.127  1.00 23.44  ? 348 TYR B O     1 
ATOM   5297 C CB    . TYR D 4 311 ? 66.766 27.076  50.823  1.00 20.28  ? 348 TYR B CB    1 
ATOM   5298 C CG    . TYR D 4 311 ? 66.656 28.019  49.662  1.00 18.81  ? 348 TYR B CG    1 
ATOM   5299 C CD1   . TYR D 4 311 ? 66.788 27.560  48.352  1.00 17.77  ? 348 TYR B CD1   1 
ATOM   5300 C CD2   . TYR D 4 311 ? 66.452 29.376  49.866  1.00 18.81  ? 348 TYR B CD2   1 
ATOM   5301 C CE1   . TYR D 4 311 ? 66.726 28.431  47.266  1.00 17.79  ? 348 TYR B CE1   1 
ATOM   5302 C CE2   . TYR D 4 311 ? 66.382 30.267  48.792  1.00 18.62  ? 348 TYR B CE2   1 
ATOM   5303 C CZ    . TYR D 4 311 ? 66.520 29.788  47.489  1.00 18.69  ? 348 TYR B CZ    1 
ATOM   5304 O OH    . TYR D 4 311 ? 66.426 30.661  46.429  1.00 16.22  ? 348 TYR B OH    1 
ATOM   5305 N N     . PRO D 4 312 ? 65.734 28.002  53.701  1.00 24.01  ? 349 PRO B N     1 
ATOM   5306 C CA    . PRO D 4 312 ? 65.550 29.040  54.707  1.00 23.85  ? 349 PRO B CA    1 
ATOM   5307 C C     . PRO D 4 312 ? 65.684 30.427  54.144  1.00 24.18  ? 349 PRO B C     1 
ATOM   5308 O O     . PRO D 4 312 ? 66.469 30.674  53.233  1.00 23.58  ? 349 PRO B O     1 
ATOM   5309 C CB    . PRO D 4 312 ? 66.628 28.718  55.727  1.00 23.61  ? 349 PRO B CB    1 
ATOM   5310 C CG    . PRO D 4 312 ? 66.684 27.230  55.665  1.00 23.06  ? 349 PRO B CG    1 
ATOM   5311 C CD    . PRO D 4 312 ? 66.696 26.995  54.182  1.00 23.69  ? 349 PRO B CD    1 
ATOM   5312 N N     . GLU D 4 313 ? 64.899 31.329  54.712  1.00 25.75  ? 350 GLU B N     1 
ATOM   5313 C CA    . GLU D 4 313 ? 64.883 32.715  54.298  1.00 26.48  ? 350 GLU B CA    1 
ATOM   5314 C C     . GLU D 4 313 ? 66.104 33.447  54.855  1.00 26.72  ? 350 GLU B C     1 
ATOM   5315 O O     . GLU D 4 313 ? 66.332 34.590  54.387  1.00 27.08  ? 350 GLU B O     1 
ATOM   5316 C CB    . GLU D 4 313 ? 63.576 33.351  54.768  1.00 27.59  ? 350 GLU B CB    1 
ATOM   5317 C CG    . GLU D 4 313 ? 63.709 34.520  55.711  1.00 31.81  ? 350 GLU B CG    1 
ATOM   5318 C CD    . GLU D 4 313 ? 63.482 35.857  55.027  1.00 33.97  ? 350 GLU B CD    1 
ATOM   5319 O OE1   . GLU D 4 313 ? 63.527 36.888  55.740  1.00 35.62  ? 350 GLU B OE1   1 
ATOM   5320 O OE2   . GLU D 4 313 ? 63.260 35.881  53.790  1.00 35.16  ? 350 GLU B OE2   1 
ATOM   5321 O OXT   . GLU D 4 313 ? 66.821 32.870  55.727  1.00 24.67  ? 350 GLU B OXT   1 
HETATM 5322 O O     . HOH E 5 .   ? 50.771 29.907  3.996   1.00 7.23   ? 700 HOH A O     1 
HETATM 5323 O O     . HOH E 5 .   ? 57.109 32.995  -7.005  1.00 1.00   ? 701 HOH A O     1 
HETATM 5324 O O     . HOH E 5 .   ? 64.221 36.619  36.914  1.00 10.86  ? 702 HOH A O     1 
HETATM 5325 O O     . HOH E 5 .   ? 61.052 41.346  20.076  1.00 20.98  ? 706 HOH A O     1 
HETATM 5326 O O     . HOH E 5 .   ? 49.065 32.175  18.430  1.00 25.42  ? 707 HOH A O     1 
HETATM 5327 O O     . HOH E 5 .   ? 52.193 38.675  19.180  1.00 32.88  ? 709 HOH A O     1 
HETATM 5328 O O     . HOH E 5 .   ? 73.169 25.418  26.408  1.00 26.94  ? 711 HOH A O     1 
HETATM 5329 O O     . HOH E 5 .   ? 86.674 38.299  25.516  1.00 20.38  ? 712 HOH A O     1 
HETATM 5330 O O     . HOH E 5 .   ? 60.905 41.018  12.809  1.00 29.38  ? 714 HOH A O     1 
HETATM 5331 O O     . HOH E 5 .   ? 64.201 45.033  12.823  1.00 27.89  ? 715 HOH A O     1 
HETATM 5332 O O     . HOH E 5 .   ? 75.210 27.368  19.654  1.00 13.81  ? 716 HOH A O     1 
HETATM 5333 O O     . HOH E 5 .   ? 61.188 45.850  -3.773  1.00 32.57  ? 719 HOH A O     1 
HETATM 5334 O O     . HOH E 5 .   ? 63.716 40.358  33.329  1.00 44.96  ? 720 HOH A O     1 
HETATM 5335 O O     . HOH E 5 .   ? 59.432 33.357  0.813   1.00 25.01  ? 721 HOH A O     1 
HETATM 5336 O O     . HOH E 5 .   ? 61.510 35.162  3.953   1.00 16.23  ? 722 HOH A O     1 
HETATM 5337 O O     . HOH F 5 .   ? 45.677 30.078  38.738  1.00 9.91   ? 703 HOH B O     1 
HETATM 5338 O O     . HOH F 5 .   ? 68.190 30.307  37.955  1.00 16.16  ? 704 HOH B O     1 
HETATM 5339 O O     . HOH F 5 .   ? 55.588 36.437  37.605  1.00 21.75  ? 705 HOH B O     1 
HETATM 5340 O O     . HOH F 5 .   ? 66.849 24.086  33.665  1.00 42.63  ? 708 HOH B O     1 
HETATM 5341 O O     . HOH F 5 .   ? 66.779 23.486  37.022  1.00 26.12  ? 710 HOH B O     1 
HETATM 5342 O O     . HOH F 5 .   ? 53.323 34.960  25.573  1.00 26.04  ? 713 HOH B O     1 
HETATM 5343 O O     . HOH F 5 .   ? 59.849 38.818  32.805  1.00 38.19  ? 717 HOH B O     1 
HETATM 5344 O O     . HOH F 5 .   ? 55.312 36.302  48.739  1.00 23.55  ? 718 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   C . n 
A 1 2   DT  2   2   2   DT  T   C . n 
A 1 3   DC  3   3   3   DC  C   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DG  5   5   5   DG  G   C . n 
A 1 6   DG  6   6   6   DG  G   C . n 
A 1 7   DG  7   7   7   DG  G   C . n 
A 1 8   DA  8   8   8   DA  A   C . n 
A 1 9   DA  9   9   9   DA  A   C . n 
A 1 10  DA  10  10  10  DA  A   C . n 
A 1 11  DG  11  11  11  DG  G   C . n 
A 1 12  DT  12  12  12  DT  T   C . n 
A 1 13  DA  13  13  13  DA  A   C . n 
A 1 14  DC  14  14  14  DC  C   C . n 
A 1 15  DA  15  15  15  DA  A   C . n 
A 1 16  DG  16  16  16  DG  G   C . n 
A 1 17  DA  17  17  17  DA  A   C . n 
B 2 1   DT  1   1   1   DT  T   D . n 
B 2 2   DC  2   2   2   DC  C   D . n 
B 2 3   DT  3   3   3   DT  T   D . n 
B 2 4   DG  4   4   4   DG  G   D . n 
B 2 5   5IU 5   5   5   5IU 5IT D . n 
B 2 6   DA  6   6   6   DA  A   D . n 
B 2 7   DC  7   7   7   DC  C   D . n 
B 2 8   5IU 8   8   8   5IU 5IT D . n 
B 2 9   5IU 9   9   9   5IU 5IT D . n 
B 2 10  5IU 10  10  10  5IU 5IT D . n 
B 2 11  DC  11  11  11  DC  C   D . n 
B 2 12  DC  12  12  12  DC  C   D . n 
B 2 13  DC  13  13  13  DC  C   D . n 
B 2 14  DT  14  14  14  DT  T   D . n 
B 2 15  DG  15  15  15  DG  G   D . n 
B 2 16  DA  16  16  16  DA  A   D . n 
B 2 17  DG  17  17  17  DG  G   D . n 
C 3 1   MET 1   18  ?   ?   ?   A . n 
C 3 2   ALA 2   19  19  ALA ALA A . n 
C 3 3   TYR 3   20  20  TYR TYR A . n 
C 3 4   VAL 4   21  21  VAL VAL A . n 
C 3 5   GLU 5   22  22  GLU GLU A . n 
C 3 6   ILE 6   23  23  ILE ILE A . n 
C 3 7   ILE 7   24  24  ILE ILE A . n 
C 3 8   GLU 8   25  25  GLU GLU A . n 
C 3 9   GLN 9   26  26  GLN GLN A . n 
C 3 10  PRO 10  27  27  PRO PRO A . n 
C 3 11  LYS 11  28  28  LYS LYS A . n 
C 3 12  GLN 12  29  29  GLN GLN A . n 
C 3 13  ARG 13  30  30  ARG ARG A . n 
C 3 14  GLY 14  31  31  GLY GLY A . n 
C 3 15  MET 15  32  32  MET MET A . n 
C 3 16  ARG 16  33  33  ARG ARG A . n 
C 3 17  PHE 17  34  34  PHE PHE A . n 
C 3 18  ARG 18  35  35  ARG ARG A . n 
C 3 19  TYR 19  36  36  TYR TYR A . n 
C 3 20  LYS 20  37  37  LYS LYS A . n 
C 3 21  CYS 21  38  38  CYS CYS A . n 
C 3 22  GLU 22  39  39  GLU GLU A . n 
C 3 23  GLY 23  40  40  GLY GLY A . n 
C 3 24  ARG 24  41  41  ARG ARG A . n 
C 3 25  SER 25  42  42  SER SER A . n 
C 3 26  ALA 26  43  43  ALA ALA A . n 
C 3 27  GLY 27  44  44  GLY GLY A . n 
C 3 28  SER 28  45  45  SER SER A . n 
C 3 29  ILE 29  46  46  ILE ILE A . n 
C 3 30  PRO 30  47  47  PRO PRO A . n 
C 3 31  GLY 31  48  48  GLY GLY A . n 
C 3 32  GLU 32  49  49  GLU GLU A . n 
C 3 33  ARG 33  50  50  ARG ARG A . n 
C 3 34  SER 34  51  51  SER SER A . n 
C 3 35  THR 35  52  52  THR THR A . n 
C 3 36  ASP 36  53  53  ASP ASP A . n 
C 3 37  THR 37  54  54  THR THR A . n 
C 3 38  THR 38  55  55  THR THR A . n 
C 3 39  LYS 39  56  56  LYS LYS A . n 
C 3 40  THR 40  57  57  THR THR A . n 
C 3 41  HIS 41  58  58  HIS HIS A . n 
C 3 42  PRO 42  59  59  PRO PRO A . n 
C 3 43  THR 43  60  60  THR THR A . n 
C 3 44  ILE 44  61  61  ILE ILE A . n 
C 3 45  LYS 45  62  62  LYS LYS A . n 
C 3 46  ILE 46  63  63  ILE ILE A . n 
C 3 47  ASN 47  64  64  ASN ASN A . n 
C 3 48  GLY 48  65  65  GLY GLY A . n 
C 3 49  TYR 49  66  66  TYR TYR A . n 
C 3 50  THR 50  67  67  THR THR A . n 
C 3 51  GLY 51  68  68  GLY GLY A . n 
C 3 52  PRO 52  69  69  PRO PRO A . n 
C 3 53  GLY 53  70  70  GLY GLY A . n 
C 3 54  THR 54  71  71  THR THR A . n 
C 3 55  VAL 55  72  72  VAL VAL A . n 
C 3 56  ARG 56  73  73  ARG ARG A . n 
C 3 57  ILE 57  74  74  ILE ILE A . n 
C 3 58  SER 58  75  75  SER SER A . n 
C 3 59  LEU 59  76  76  LEU LEU A . n 
C 3 60  VAL 60  77  77  VAL VAL A . n 
C 3 61  THR 61  78  78  THR THR A . n 
C 3 62  LYS 62  79  79  LYS LYS A . n 
C 3 63  ASP 63  80  80  ASP ASP A . n 
C 3 64  PRO 64  81  81  PRO PRO A . n 
C 3 65  PRO 65  82  82  PRO PRO A . n 
C 3 66  HIS 66  83  83  HIS HIS A . n 
C 3 67  ARG 67  84  84  ARG ARG A . n 
C 3 68  PRO 68  85  85  PRO PRO A . n 
C 3 69  HIS 69  86  86  HIS HIS A . n 
C 3 70  PRO 70  87  87  PRO PRO A . n 
C 3 71  HIS 71  88  88  HIS HIS A . n 
C 3 72  GLU 72  89  89  GLU GLU A . n 
C 3 73  LEU 73  90  90  LEU LEU A . n 
C 3 74  VAL 74  91  91  VAL VAL A . n 
C 3 75  GLY 75  92  92  GLY GLY A . n 
C 3 76  LYS 76  93  93  LYS LYS A . n 
C 3 77  ASP 77  94  94  ASP ASP A . n 
C 3 78  CYS 78  95  95  CYS CYS A . n 
C 3 79  ARG 79  96  96  ARG ARG A . n 
C 3 80  ASP 80  97  97  ASP ASP A . n 
C 3 81  GLY 81  98  98  GLY GLY A . n 
C 3 82  TYR 82  99  99  TYR TYR A . n 
C 3 83  TYR 83  100 100 TYR TYR A . n 
C 3 84  GLU 84  101 101 GLU GLU A . n 
C 3 85  ALA 85  102 102 ALA ALA A . n 
C 3 86  ASP 86  103 103 ASP ASP A . n 
C 3 87  LEU 87  104 104 LEU LEU A . n 
C 3 88  CYS 88  105 105 CYS CYS A . n 
C 3 89  PRO 89  106 106 PRO PRO A . n 
C 3 90  ASP 90  107 107 ASP ASP A . n 
C 3 91  ARG 91  108 108 ARG ARG A . n 
C 3 92  SER 92  109 109 SER SER A . n 
C 3 93  ILE 93  110 110 ILE ILE A . n 
C 3 94  HIS 94  111 111 HIS HIS A . n 
C 3 95  SER 95  112 112 SER SER A . n 
C 3 96  PHE 96  113 113 PHE PHE A . n 
C 3 97  GLN 97  114 114 GLN GLN A . n 
C 3 98  ASN 98  115 115 ASN ASN A . n 
C 3 99  LEU 99  116 116 LEU LEU A . n 
C 3 100 GLY 100 117 117 GLY GLY A . n 
C 3 101 ILE 101 118 118 ILE ILE A . n 
C 3 102 GLN 102 119 119 GLN GLN A . n 
C 3 103 CYS 103 120 120 CYS CYS A . n 
C 3 104 VAL 104 121 121 VAL VAL A . n 
C 3 105 LYS 105 122 122 LYS LYS A . n 
C 3 106 LYS 106 123 123 LYS LYS A . n 
C 3 107 ARG 107 124 124 ARG ARG A . n 
C 3 108 ASP 108 125 125 ASP ASP A . n 
C 3 109 LEU 109 126 126 LEU LEU A . n 
C 3 110 GLU 110 127 127 GLU GLU A . n 
C 3 111 GLN 111 128 128 GLN GLN A . n 
C 3 112 ALA 112 129 129 ALA ALA A . n 
C 3 113 ILE 113 130 130 ILE ILE A . n 
C 3 114 SER 114 131 131 SER SER A . n 
C 3 115 GLN 115 132 132 GLN GLN A . n 
C 3 116 ARG 116 133 133 ARG ARG A . n 
C 3 117 ILE 117 134 134 ILE ILE A . n 
C 3 118 GLN 118 135 135 GLN GLN A . n 
C 3 119 THR 119 136 136 THR THR A . n 
C 3 120 ASN 120 137 137 ASN ASN A . n 
C 3 121 ASN 121 138 138 ASN ASN A . n 
C 3 122 ASN 122 139 139 ASN ASN A . n 
C 3 123 PRO 123 140 140 PRO PRO A . n 
C 3 124 PHE 124 141 141 PHE PHE A . n 
C 3 125 HIS 125 142 142 HIS HIS A . n 
C 3 126 VAL 126 143 143 VAL VAL A . n 
C 3 127 PRO 127 144 144 PRO PRO A . n 
C 3 128 ILE 128 145 145 ILE ILE A . n 
C 3 129 GLU 129 146 146 GLU GLU A . n 
C 3 130 GLU 130 147 147 GLU GLU A . n 
C 3 131 GLN 131 148 148 GLN GLN A . n 
C 3 132 ARG 132 149 149 ARG ARG A . n 
C 3 133 GLY 133 150 150 GLY GLY A . n 
C 3 134 ASP 134 151 151 ASP ASP A . n 
C 3 135 TYR 135 152 152 TYR TYR A . n 
C 3 136 ASP 136 153 153 ASP ASP A . n 
C 3 137 LEU 137 154 154 LEU LEU A . n 
C 3 138 ASN 138 155 155 ASN ASN A . n 
C 3 139 ALA 139 156 156 ALA ALA A . n 
C 3 140 VAL 140 157 157 VAL VAL A . n 
C 3 141 ARG 141 158 158 ARG ARG A . n 
C 3 142 LEU 142 159 159 LEU LEU A . n 
C 3 143 CYS 143 160 160 CYS CYS A . n 
C 3 144 PHE 144 161 161 PHE PHE A . n 
C 3 145 GLN 145 162 162 GLN GLN A . n 
C 3 146 VAL 146 163 163 VAL VAL A . n 
C 3 147 THR 147 164 164 THR THR A . n 
C 3 148 VAL 148 165 165 VAL VAL A . n 
C 3 149 ARG 149 166 166 ARG ARG A . n 
C 3 150 ASP 150 167 167 ASP ASP A . n 
C 3 151 PRO 151 168 168 PRO PRO A . n 
C 3 152 ALA 152 169 169 ALA ALA A . n 
C 3 153 GLY 153 170 170 GLY GLY A . n 
C 3 154 ARG 154 171 171 ARG ARG A . n 
C 3 155 PRO 155 172 172 PRO PRO A . n 
C 3 156 LEU 156 173 173 LEU LEU A . n 
C 3 157 LEU 157 174 174 LEU LEU A . n 
C 3 158 LEU 158 175 175 LEU LEU A . n 
C 3 159 THR 159 176 176 THR THR A . n 
C 3 160 PRO 160 177 177 PRO PRO A . n 
C 3 161 VAL 161 178 178 VAL VAL A . n 
C 3 162 LEU 162 179 179 LEU LEU A . n 
C 3 163 SER 163 180 180 SER SER A . n 
C 3 164 HIS 164 181 181 HIS HIS A . n 
C 3 165 PRO 165 182 182 PRO PRO A . n 
C 3 166 ILE 166 183 183 ILE ILE A . n 
C 3 167 PHE 167 184 184 PHE PHE A . n 
C 3 168 ASP 168 185 185 ASP ASP A . n 
C 3 169 ASN 169 186 186 ASN ASN A . n 
C 3 170 ARG 170 187 187 ARG ARG A . n 
C 3 171 ALA 171 188 188 ALA ALA A . n 
C 3 172 PRO 172 189 189 PRO PRO A . n 
C 3 173 ASN 173 190 190 ASN ASN A . n 
C 3 174 THR 174 191 191 THR THR A . n 
C 3 175 ALA 175 192 192 ALA ALA A . n 
C 3 176 GLU 176 193 193 GLU GLU A . n 
C 3 177 LEU 177 194 194 LEU LEU A . n 
C 3 178 LYS 178 195 195 LYS LYS A . n 
C 3 179 ILE 179 196 196 ILE ILE A . n 
C 3 180 CYS 180 197 197 CYS CYS A . n 
C 3 181 ARG 181 198 198 ARG ARG A . n 
C 3 182 VAL 182 199 199 VAL VAL A . n 
C 3 183 ASN 183 200 200 ASN ASN A . n 
C 3 184 ARG 184 201 201 ARG ARG A . n 
C 3 185 ASN 185 202 202 ASN ASN A . n 
C 3 186 SER 186 203 203 SER SER A . n 
C 3 187 GLY 187 204 204 GLY GLY A . n 
C 3 188 SER 188 205 205 SER SER A . n 
C 3 189 CYS 189 206 206 CYS CYS A . n 
C 3 190 LEU 190 207 207 LEU LEU A . n 
C 3 191 GLY 191 208 208 GLY GLY A . n 
C 3 192 GLY 192 209 209 GLY GLY A . n 
C 3 193 ASP 193 210 210 ASP ASP A . n 
C 3 194 GLU 194 211 211 GLU GLU A . n 
C 3 195 ILE 195 212 212 ILE ILE A . n 
C 3 196 PHE 196 213 213 PHE PHE A . n 
C 3 197 LEU 197 214 214 LEU LEU A . n 
C 3 198 LEU 198 215 215 LEU LEU A . n 
C 3 199 CYS 199 216 216 CYS CYS A . n 
C 3 200 ASP 200 217 217 ASP ASP A . n 
C 3 201 LYS 201 218 218 LYS LYS A . n 
C 3 202 VAL 202 219 219 VAL VAL A . n 
C 3 203 GLN 203 220 220 GLN GLN A . n 
C 3 204 LYS 204 221 221 LYS LYS A . n 
C 3 205 GLU 205 222 222 GLU GLU A . n 
C 3 206 ASP 206 223 223 ASP ASP A . n 
C 3 207 ILE 207 224 224 ILE ILE A . n 
C 3 208 GLU 208 225 225 GLU GLU A . n 
C 3 209 VAL 209 226 226 VAL VAL A . n 
C 3 210 TYR 210 227 227 TYR TYR A . n 
C 3 211 PHE 211 228 228 PHE PHE A . n 
C 3 212 THR 212 229 229 THR THR A . n 
C 3 213 GLY 213 230 230 GLY GLY A . n 
C 3 214 PRO 214 231 231 PRO PRO A . n 
C 3 215 GLY 215 232 232 GLY GLY A . n 
C 3 216 TRP 216 233 233 TRP TRP A . n 
C 3 217 GLU 217 234 234 GLU GLU A . n 
C 3 218 ALA 218 235 235 ALA ALA A . n 
C 3 219 ARG 219 236 236 ARG ARG A . n 
C 3 220 GLY 220 237 237 GLY GLY A . n 
C 3 221 SER 221 238 238 SER SER A . n 
C 3 222 PHE 222 239 239 PHE PHE A . n 
C 3 223 SER 223 240 240 SER SER A . n 
C 3 224 GLN 224 241 241 GLN GLN A . n 
C 3 225 ALA 225 242 242 ALA ALA A . n 
C 3 226 ASP 226 243 243 ASP ASP A . n 
C 3 227 VAL 227 244 244 VAL VAL A . n 
C 3 228 HIS 228 245 245 HIS HIS A . n 
C 3 229 ARG 229 246 246 ARG ARG A . n 
C 3 230 GLN 230 247 247 GLN GLN A . n 
C 3 231 VAL 231 248 248 VAL VAL A . n 
C 3 232 ALA 232 249 249 ALA ALA A . n 
C 3 233 ILE 233 250 250 ILE ILE A . n 
C 3 234 VAL 234 251 251 VAL VAL A . n 
C 3 235 PHE 235 252 252 PHE PHE A . n 
C 3 236 ARG 236 253 253 ARG ARG A . n 
C 3 237 THR 237 254 254 THR THR A . n 
C 3 238 PRO 238 255 255 PRO PRO A . n 
C 3 239 PRO 239 256 256 PRO PRO A . n 
C 3 240 TYR 240 257 257 TYR TYR A . n 
C 3 241 ALA 241 258 258 ALA ALA A . n 
C 3 242 ASP 242 259 259 ASP ASP A . n 
C 3 243 PRO 243 260 260 PRO PRO A . n 
C 3 244 SER 244 261 261 SER SER A . n 
C 3 245 LEU 245 262 262 LEU LEU A . n 
C 3 246 GLN 246 263 263 GLN GLN A . n 
C 3 247 ALA 247 264 264 ALA ALA A . n 
C 3 248 PRO 248 265 265 PRO PRO A . n 
C 3 249 VAL 249 266 266 VAL VAL A . n 
C 3 250 ARG 250 267 267 ARG ARG A . n 
C 3 251 VAL 251 268 268 VAL VAL A . n 
C 3 252 SER 252 269 269 SER SER A . n 
C 3 253 MET 253 270 270 MET MET A . n 
C 3 254 GLN 254 271 271 GLN GLN A . n 
C 3 255 LEU 255 272 272 LEU LEU A . n 
C 3 256 ARG 256 273 273 ARG ARG A . n 
C 3 257 ARG 257 274 274 ARG ARG A . n 
C 3 258 PRO 258 275 275 PRO PRO A . n 
C 3 259 SER 259 276 276 SER SER A . n 
C 3 260 ASP 260 277 277 ASP ASP A . n 
C 3 261 ARG 261 278 278 ARG ARG A . n 
C 3 262 GLU 262 279 279 GLU GLU A . n 
C 3 263 LEU 263 280 280 LEU LEU A . n 
C 3 264 SER 264 281 281 SER SER A . n 
C 3 265 GLU 265 282 282 GLU GLU A . n 
C 3 266 PRO 266 283 283 PRO PRO A . n 
C 3 267 MET 267 284 284 MET MET A . n 
C 3 268 GLU 268 285 285 GLU GLU A . n 
C 3 269 PHE 269 286 286 PHE PHE A . n 
C 3 270 GLN 270 287 287 GLN GLN A . n 
C 3 271 TYR 271 288 288 TYR TYR A . n 
C 3 272 LEU 272 289 289 LEU LEU A . n 
C 3 273 PRO 273 290 290 PRO PRO A . n 
C 3 274 ASP 274 291 291 ASP ASP A . n 
D 4 1   MET 1   38  ?   ?   ?   B . n 
D 4 2   GLY 2   39  339 GLY GLY B . n 
D 4 3   PRO 3   40  340 PRO PRO B . n 
D 4 4   TYR 4   41  341 TYR TYR B . n 
D 4 5   LEU 5   42  342 LEU LEU B . n 
D 4 6   GLN 6   43  343 GLN GLN B . n 
D 4 7   ILE 7   44  344 ILE ILE B . n 
D 4 8   LEU 8   45  345 LEU LEU B . n 
D 4 9   GLU 9   46  346 GLU GLU B . n 
D 4 10  GLN 10  47  347 GLN GLN B . n 
D 4 11  PRO 11  48  348 PRO PRO B . n 
D 4 12  LYS 12  49  349 LYS LYS B . n 
D 4 13  GLN 13  50  350 GLN GLN B . n 
D 4 14  ARG 14  51  351 ARG ARG B . n 
D 4 15  GLY 15  52  352 GLY GLY B . n 
D 4 16  PHE 16  53  353 PHE PHE B . n 
D 4 17  ARG 17  54  354 ARG ARG B . n 
D 4 18  PHE 18  55  355 PHE PHE B . n 
D 4 19  ARG 19  56  356 ARG ARG B . n 
D 4 20  TYR 20  57  357 TYR TYR B . n 
D 4 21  VAL 21  58  358 VAL VAL B . n 
D 4 22  CYS 22  59  359 CYS CYS B . n 
D 4 23  GLU 23  60  360 GLU GLU B . n 
D 4 24  GLY 24  61  361 GLY GLY B . n 
D 4 25  PRO 25  62  362 PRO PRO B . n 
D 4 26  SER 26  63  363 SER SER B . n 
D 4 27  HIS 27  64  364 HIS HIS B . n 
D 4 28  GLY 28  65  365 GLY GLY B . n 
D 4 29  GLY 29  66  366 GLY GLY B . n 
D 4 30  LEU 30  67  367 LEU LEU B . n 
D 4 31  PRO 31  68  368 PRO PRO B . n 
D 4 32  GLY 32  69  369 GLY GLY B . n 
D 4 33  ALA 33  70  370 ALA ALA B . n 
D 4 34  SER 34  71  371 SER SER B . n 
D 4 35  SER 35  72  372 SER SER B . n 
D 4 36  GLU 36  73  373 GLU GLU B . n 
D 4 37  LYS 37  74  374 LYS LYS B . n 
D 4 38  ASN 38  75  375 ASN ASN B . n 
D 4 39  LYS 39  76  376 LYS LYS B . n 
D 4 40  LYS 40  77  377 LYS LYS B . n 
D 4 41  SER 41  78  378 SER SER B . n 
D 4 42  TYR 42  79  379 TYR TYR B . n 
D 4 43  PRO 43  80  380 PRO PRO B . n 
D 4 44  GLN 44  81  381 GLN GLN B . n 
D 4 45  VAL 45  82  382 VAL VAL B . n 
D 4 46  LYS 46  83  383 LYS LYS B . n 
D 4 47  ILE 47  84  384 ILE ILE B . n 
D 4 48  CYS 48  85  385 CYS CYS B . n 
D 4 49  ASN 49  86  386 ASN ASN B . n 
D 4 50  TYR 50  87  387 TYR TYR B . n 
D 4 51  VAL 51  88  388 VAL VAL B . n 
D 4 52  GLY 52  89  389 GLY GLY B . n 
D 4 53  PRO 53  90  390 PRO PRO B . n 
D 4 54  ALA 54  91  391 ALA ALA B . n 
D 4 55  LYS 55  92  392 LYS LYS B . n 
D 4 56  VAL 56  93  393 VAL VAL B . n 
D 4 57  ILE 57  94  394 ILE ILE B . n 
D 4 58  VAL 58  95  395 VAL VAL B . n 
D 4 59  GLN 59  96  396 GLN GLN B . n 
D 4 60  LEU 60  97  397 LEU LEU B . n 
D 4 61  VAL 61  98  398 VAL VAL B . n 
D 4 62  THR 62  99  399 THR THR B . n 
D 4 63  ASN 63  100 400 ASN ASN B . n 
D 4 64  GLY 64  101 401 GLY GLY B . n 
D 4 65  LYS 65  102 402 LYS LYS B . n 
D 4 66  ASN 66  103 403 ASN ASN B . n 
D 4 67  ILE 67  104 404 ILE ILE B . n 
D 4 68  HIS 68  105 405 HIS HIS B . n 
D 4 69  LEU 69  106 406 LEU LEU B . n 
D 4 70  HIS 70  107 407 HIS HIS B . n 
D 4 71  ALA 71  108 408 ALA ALA B . n 
D 4 72  HIS 72  109 409 HIS HIS B . n 
D 4 73  SER 73  110 410 SER SER B . n 
D 4 74  LEU 74  111 411 LEU LEU B . n 
D 4 75  VAL 75  112 412 VAL VAL B . n 
D 4 76  GLY 76  113 413 GLY GLY B . n 
D 4 77  LYS 77  114 414 LYS LYS B . n 
D 4 78  HIS 78  115 415 HIS HIS B . n 
D 4 79  CYS 79  116 416 CYS CYS B . n 
D 4 80  GLU 80  117 417 GLU GLU B . n 
D 4 81  ASP 81  118 418 ASP ASP B . n 
D 4 82  GLY 82  119 419 GLY GLY B . n 
D 4 83  VAL 83  120 420 VAL VAL B . n 
D 4 84  CYS 84  121 421 CYS CYS B . n 
D 4 85  THR 85  122 422 THR THR B . n 
D 4 86  VAL 86  123 423 VAL VAL B . n 
D 4 87  THR 87  124 424 THR THR B . n 
D 4 88  ALA 88  125 425 ALA ALA B . n 
D 4 89  GLY 89  126 426 GLY GLY B . n 
D 4 90  PRO 90  127 427 PRO PRO B . n 
D 4 91  LYS 91  128 428 LYS LYS B . n 
D 4 92  ASP 92  129 429 ASP ASP B . n 
D 4 93  MET 93  130 430 MET MET B . n 
D 4 94  VAL 94  131 431 VAL VAL B . n 
D 4 95  VAL 95  132 432 VAL VAL B . n 
D 4 96  GLY 96  133 433 GLY GLY B . n 
D 4 97  PHE 97  134 434 PHE PHE B . n 
D 4 98  ALA 98  135 435 ALA ALA B . n 
D 4 99  ASN 99  136 436 ASN ASN B . n 
D 4 100 LEU 100 137 437 LEU LEU B . n 
D 4 101 GLY 101 138 438 GLY GLY B . n 
D 4 102 ILE 102 139 439 ILE ILE B . n 
D 4 103 LEU 103 140 440 LEU LEU B . n 
D 4 104 HIS 104 141 441 HIS HIS B . n 
D 4 105 VAL 105 142 442 VAL VAL B . n 
D 4 106 THR 106 143 443 THR THR B . n 
D 4 107 LYS 107 144 444 LYS LYS B . n 
D 4 108 LYS 108 145 445 LYS LYS B . n 
D 4 109 LYS 109 146 446 LYS LYS B . n 
D 4 110 VAL 110 147 447 VAL VAL B . n 
D 4 111 PHE 111 148 448 PHE PHE B . n 
D 4 112 GLU 112 149 449 GLU GLU B . n 
D 4 113 THR 113 150 450 THR THR B . n 
D 4 114 LEU 114 151 451 LEU LEU B . n 
D 4 115 GLU 115 152 452 GLU GLU B . n 
D 4 116 ALA 116 153 453 ALA ALA B . n 
D 4 117 ARG 117 154 454 ARG ARG B . n 
D 4 118 MET 118 155 455 MET MET B . n 
D 4 119 THR 119 156 456 THR THR B . n 
D 4 120 GLU 120 157 457 GLU GLU B . n 
D 4 121 ALA 121 158 458 ALA ALA B . n 
D 4 122 CYS 122 159 459 CYS CYS B . n 
D 4 123 ILE 123 160 460 ILE ILE B . n 
D 4 124 ARG 124 161 461 ARG ARG B . n 
D 4 125 GLY 125 162 462 GLY GLY B . n 
D 4 126 TYR 126 163 463 TYR TYR B . n 
D 4 127 ASN 127 164 464 ASN ASN B . n 
D 4 128 PRO 128 165 465 PRO PRO B . n 
D 4 129 GLY 129 166 466 GLY GLY B . n 
D 4 130 LEU 130 167 467 LEU LEU B . n 
D 4 131 LEU 131 168 468 LEU LEU B . n 
D 4 132 VAL 132 169 469 VAL VAL B . n 
D 4 133 HIS 133 170 470 HIS HIS B . n 
D 4 134 SER 134 171 471 SER SER B . n 
D 4 135 ASP 135 172 472 ASP ASP B . n 
D 4 136 LEU 136 173 473 LEU LEU B . n 
D 4 137 ALA 137 174 474 ALA ALA B . n 
D 4 138 TYR 138 175 475 TYR TYR B . n 
D 4 139 LEU 139 176 476 LEU LEU B . n 
D 4 140 GLN 140 177 477 GLN GLN B . n 
D 4 141 ALA 141 178 478 ALA ALA B . n 
D 4 142 GLU 142 179 479 GLU GLU B . n 
D 4 143 GLY 143 180 480 GLY GLY B . n 
D 4 144 GLY 144 181 481 GLY GLY B . n 
D 4 145 GLY 145 182 482 GLY GLY B . n 
D 4 146 ASP 146 183 483 ASP ASP B . n 
D 4 147 ARG 147 184 484 ARG ARG B . n 
D 4 148 GLN 148 185 485 GLN GLN B . n 
D 4 149 LEU 149 186 486 LEU LEU B . n 
D 4 150 THR 150 187 487 THR THR B . n 
D 4 151 ASP 151 188 488 ASP ASP B . n 
D 4 152 ARG 152 189 489 ARG ARG B . n 
D 4 153 GLU 153 190 490 GLU GLU B . n 
D 4 154 LYS 154 191 491 LYS LYS B . n 
D 4 155 GLU 155 192 492 GLU GLU B . n 
D 4 156 ILE 156 193 493 ILE ILE B . n 
D 4 157 ILE 157 194 494 ILE ILE B . n 
D 4 158 ARG 158 195 495 ARG ARG B . n 
D 4 159 GLN 159 196 496 GLN GLN B . n 
D 4 160 ALA 160 197 497 ALA ALA B . n 
D 4 161 ALA 161 198 498 ALA ALA B . n 
D 4 162 VAL 162 199 499 VAL VAL B . n 
D 4 163 GLN 163 200 500 GLN GLN B . n 
D 4 164 GLN 164 201 501 GLN GLN B . n 
D 4 165 THR 165 202 502 THR THR B . n 
D 4 166 LYS 166 203 503 LYS LYS B . n 
D 4 167 GLU 167 204 504 GLU GLU B . n 
D 4 168 MET 168 205 505 MET MET B . n 
D 4 169 ASP 169 206 506 ASP ASP B . n 
D 4 170 LEU 170 207 507 LEU LEU B . n 
D 4 171 SER 171 208 508 SER SER B . n 
D 4 172 VAL 172 209 509 VAL VAL B . n 
D 4 173 VAL 173 210 510 VAL VAL B . n 
D 4 174 ARG 174 211 511 ARG ARG B . n 
D 4 175 LEU 175 212 512 LEU LEU B . n 
D 4 176 MET 176 213 513 MET MET B . n 
D 4 177 PHE 177 214 514 PHE PHE B . n 
D 4 178 THR 178 215 515 THR THR B . n 
D 4 179 ALA 179 216 516 ALA ALA B . n 
D 4 180 PHE 180 217 517 PHE PHE B . n 
D 4 181 LEU 181 218 518 LEU LEU B . n 
D 4 182 PRO 182 219 519 PRO PRO B . n 
D 4 183 ASP 183 220 520 ASP ASP B . n 
D 4 184 SER 184 221 521 SER SER B . n 
D 4 185 THR 185 222 522 THR THR B . n 
D 4 186 GLY 186 223 523 GLY GLY B . n 
D 4 187 SER 187 224 524 SER SER B . n 
D 4 188 PHE 188 225 525 PHE PHE B . n 
D 4 189 THR 189 226 526 THR THR B . n 
D 4 190 ARG 190 227 527 ARG ARG B . n 
D 4 191 ARG 191 228 528 ARG ARG B . n 
D 4 192 LEU 192 229 529 LEU LEU B . n 
D 4 193 GLU 193 230 530 GLU GLU B . n 
D 4 194 PRO 194 231 531 PRO PRO B . n 
D 4 195 VAL 195 232 532 VAL VAL B . n 
D 4 196 VAL 196 233 533 VAL VAL B . n 
D 4 197 SER 197 234 534 SER SER B . n 
D 4 198 ASP 198 235 535 ASP ASP B . n 
D 4 199 ALA 199 236 536 ALA ALA B . n 
D 4 200 ILE 200 237 537 ILE ILE B . n 
D 4 201 TYR 201 238 538 TYR TYR B . n 
D 4 202 ASP 202 239 539 ASP ASP B . n 
D 4 203 SER 203 240 540 SER SER B . n 
D 4 204 LYS 204 241 541 LYS LYS B . n 
D 4 205 ALA 205 242 542 ALA ALA B . n 
D 4 206 PRO 206 243 543 PRO PRO B . n 
D 4 207 ASN 207 244 544 ASN ASN B . n 
D 4 208 ALA 208 245 545 ALA ALA B . n 
D 4 209 SER 209 246 546 SER SER B . n 
D 4 210 ASN 210 247 547 ASN ASN B . n 
D 4 211 LEU 211 248 548 LEU LEU B . n 
D 4 212 LYS 212 249 549 LYS LYS B . n 
D 4 213 ILE 213 250 550 ILE ILE B . n 
D 4 214 VAL 214 251 551 VAL VAL B . n 
D 4 215 ARG 215 252 552 ARG ARG B . n 
D 4 216 MET 216 253 553 MET MET B . n 
D 4 217 ASP 217 254 554 ASP ASP B . n 
D 4 218 ARG 218 255 555 ARG ARG B . n 
D 4 219 THR 219 256 556 THR THR B . n 
D 4 220 ALA 220 257 557 ALA ALA B . n 
D 4 221 GLY 221 258 558 GLY GLY B . n 
D 4 222 CYS 222 259 559 CYS CYS B . n 
D 4 223 VAL 223 260 560 VAL VAL B . n 
D 4 224 THR 224 261 561 THR THR B . n 
D 4 225 GLY 225 262 562 GLY GLY B . n 
D 4 226 GLY 226 263 563 GLY GLY B . n 
D 4 227 GLU 227 264 564 GLU GLU B . n 
D 4 228 GLU 228 265 565 GLU GLU B . n 
D 4 229 ILE 229 266 566 ILE ILE B . n 
D 4 230 TYR 230 267 567 TYR TYR B . n 
D 4 231 LEU 231 268 568 LEU LEU B . n 
D 4 232 LEU 232 269 569 LEU LEU B . n 
D 4 233 CYS 233 270 570 CYS CYS B . n 
D 4 234 ASP 234 271 571 ASP ASP B . n 
D 4 235 LYS 235 272 572 LYS LYS B . n 
D 4 236 VAL 236 273 573 VAL VAL B . n 
D 4 237 GLN 237 274 574 GLN GLN B . n 
D 4 238 LYS 238 275 575 LYS LYS B . n 
D 4 239 ASP 239 276 576 ASP ASP B . n 
D 4 240 ASP 240 277 577 ASP ASP B . n 
D 4 241 ILE 241 278 578 ILE ILE B . n 
D 4 242 GLN 242 279 579 GLN GLN B . n 
D 4 243 ILE 243 280 580 ILE ILE B . n 
D 4 244 ARG 244 281 581 ARG ARG B . n 
D 4 245 PHE 245 282 582 PHE PHE B . n 
D 4 246 TYR 246 283 583 TYR TYR B . n 
D 4 247 GLU 247 284 584 GLU GLU B . n 
D 4 248 GLU 248 285 585 GLU GLU B . n 
D 4 249 GLU 249 286 586 GLU GLU B . n 
D 4 250 GLU 250 287 587 GLU GLU B . n 
D 4 251 ASN 251 288 588 ASN ASN B . n 
D 4 252 GLY 252 289 589 GLY GLY B . n 
D 4 253 GLY 253 290 590 GLY GLY B . n 
D 4 254 VAL 254 291 591 VAL VAL B . n 
D 4 255 TRP 255 292 592 TRP TRP B . n 
D 4 256 GLU 256 293 593 GLU GLU B . n 
D 4 257 GLY 257 294 594 GLY GLY B . n 
D 4 258 PHE 258 295 595 PHE PHE B . n 
D 4 259 GLY 259 296 596 GLY GLY B . n 
D 4 260 ASP 260 297 597 ASP ASP B . n 
D 4 261 PHE 261 298 598 PHE PHE B . n 
D 4 262 SER 262 299 599 SER SER B . n 
D 4 263 PRO 263 300 600 PRO PRO B . n 
D 4 264 THR 264 301 601 THR THR B . n 
D 4 265 ASP 265 302 602 ASP ASP B . n 
D 4 266 VAL 266 303 603 VAL VAL B . n 
D 4 267 HIS 267 304 604 HIS HIS B . n 
D 4 268 ARG 268 305 605 ARG ARG B . n 
D 4 269 GLN 269 306 606 GLN GLN B . n 
D 4 270 PHE 270 307 607 PHE PHE B . n 
D 4 271 ALA 271 308 608 ALA ALA B . n 
D 4 272 ILE 272 309 609 ILE ILE B . n 
D 4 273 VAL 273 310 610 VAL VAL B . n 
D 4 274 PHE 274 311 611 PHE PHE B . n 
D 4 275 LYS 275 312 612 LYS LYS B . n 
D 4 276 THR 276 313 613 THR THR B . n 
D 4 277 PRO 277 314 614 PRO PRO B . n 
D 4 278 LYS 278 315 615 LYS LYS B . n 
D 4 279 TYR 279 316 616 TYR TYR B . n 
D 4 280 LYS 280 317 617 LYS LYS B . n 
D 4 281 ASP 281 318 618 ASP ASP B . n 
D 4 282 VAL 282 319 619 VAL VAL B . n 
D 4 283 ASN 283 320 620 ASN ASN B . n 
D 4 284 ILE 284 321 621 ILE ILE B . n 
D 4 285 THR 285 322 622 THR THR B . n 
D 4 286 LYS 286 323 623 LYS LYS B . n 
D 4 287 PRO 287 324 624 PRO PRO B . n 
D 4 288 ALA 288 325 625 ALA ALA B . n 
D 4 289 SER 289 326 626 SER SER B . n 
D 4 290 VAL 290 327 627 VAL VAL B . n 
D 4 291 PHE 291 328 628 PHE PHE B . n 
D 4 292 VAL 292 329 629 VAL VAL B . n 
D 4 293 GLN 293 330 630 GLN GLN B . n 
D 4 294 LEU 294 331 631 LEU LEU B . n 
D 4 295 ARG 295 332 632 ARG ARG B . n 
D 4 296 ARG 296 333 633 ARG ARG B . n 
D 4 297 LYS 297 334 634 LYS LYS B . n 
D 4 298 SER 298 335 635 SER SER B . n 
D 4 299 ASP 299 336 636 ASP ASP B . n 
D 4 300 LEU 300 337 637 LEU LEU B . n 
D 4 301 GLU 301 338 638 GLU GLU B . n 
D 4 302 THR 302 339 639 THR THR B . n 
D 4 303 SER 303 340 640 SER SER B . n 
D 4 304 GLU 304 341 641 GLU GLU B . n 
D 4 305 PRO 305 342 642 PRO PRO B . n 
D 4 306 LYS 306 343 643 LYS LYS B . n 
D 4 307 PRO 307 344 644 PRO PRO B . n 
D 4 308 PHE 308 345 645 PHE PHE B . n 
D 4 309 LEU 309 346 646 LEU LEU B . n 
D 4 310 TYR 310 347 647 TYR TYR B . n 
D 4 311 TYR 311 348 648 TYR TYR B . n 
D 4 312 PRO 312 349 649 PRO PRO B . n 
D 4 313 GLU 313 350 650 GLU GLU B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B 5IU 5  D 5IU 5  ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
2 B 5IU 8  D 5IU 8  ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
3 B 5IU 9  D 5IU 9  ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
4 B 5IU 10 D 5IU 10 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-15 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O4 
_pdbx_validate_symm_contact.auth_asym_id_1    D 
_pdbx_validate_symm_contact.auth_comp_id_1    DT 
_pdbx_validate_symm_contact.auth_seq_id_1     1 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O4 
_pdbx_validate_symm_contact.auth_asym_id_2    D 
_pdbx_validate_symm_contact.auth_comp_id_2    DT 
_pdbx_validate_symm_contact.auth_seq_id_2     1 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_555 
_pdbx_validate_symm_contact.dist              1.77 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" D DC  7  ? ? "C1'" D DC  7  ? ? N1 D DC  7  ? ? 110.32 108.30 2.02   0.30 N 
2 1 C     A ASP 80 ? ? N     A PRO 81 ? ? CA A PRO 81 ? ? 132.26 119.30 12.96  1.50 Y 
3 1 C     A PRO 81 ? ? N     A PRO 82 ? ? CA A PRO 82 ? ? 109.16 119.30 -10.14 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 25  ? ? -163.27 93.17   
2  1 ALA A 43  ? ? -72.80  -165.73 
3  1 ILE A 46  ? ? -50.90  109.57  
4  1 GLU A 49  ? ? -166.82 -24.08  
5  1 THR A 67  ? ? -171.46 117.87  
6  1 PRO A 81  ? ? -13.65  -62.24  
7  1 HIS A 83  ? ? -59.69  84.95   
8  1 ASN A 115 ? ? -151.25 50.16   
9  1 GLN A 135 ? ? -48.12  -16.24  
10 1 ASN A 139 ? ? -150.53 76.58   
11 1 GLN A 148 ? ? -76.69  25.33   
12 1 ASP A 151 ? ? -37.17  148.07  
13 1 VAL A 165 ? ? -108.19 -147.30 
14 1 ALA A 169 ? ? -65.43  1.82    
15 1 ASP A 223 ? ? -148.43 56.19   
16 1 PHE A 239 ? ? 179.80  163.71  
17 1 ARG A 246 ? ? 39.98   47.29   
18 1 GLN A 247 ? ? 61.69   -7.93   
19 1 SER A 261 ? ? -141.94 55.76   
20 1 ALA A 264 ? ? 176.67  143.93  
21 1 ARG A 278 ? ? 39.24   34.84   
22 1 GLU B 46  ? ? -155.10 84.18   
23 1 SER B 63  ? ? 39.61   91.89   
24 1 LEU B 67  ? ? -24.05  114.72  
25 1 SER B 72  ? ? -109.86 40.58   
26 1 GLU B 73  ? ? -32.91  -35.97  
27 1 LYS B 74  ? ? -134.83 -154.51 
28 1 ASN B 75  ? ? -79.15  35.83   
29 1 LYS B 77  ? ? 20.52   72.48   
30 1 SER B 78  ? ? -66.19  -169.28 
31 1 TYR B 79  ? ? 174.95  148.51  
32 1 TYR B 87  ? ? -30.74  87.84   
33 1 LYS B 114 ? ? 18.33   -153.51 
34 1 PRO B 127 ? ? -40.10  -168.52 
35 1 PHE B 134 ? ? -150.51 81.26   
36 1 ASN B 136 ? ? 57.02   107.32  
37 1 LEU B 137 ? ? -179.10 90.27   
38 1 GLU B 149 ? ? -58.17  -71.11  
39 1 TYR B 163 ? ? -38.02  -15.72  
40 1 PRO B 165 ? ? -58.81  -158.97 
41 1 HIS B 170 ? ? 165.33  124.61  
42 1 ASP B 172 ? ? -59.96  11.68   
43 1 TYR B 175 ? ? -69.71  60.29   
44 1 LEU B 176 ? ? -159.79 2.73    
45 1 GLN B 177 ? ? -42.35  161.22  
46 1 ALA B 178 ? ? -25.82  109.79  
47 1 GLU B 179 ? ? -162.89 105.77  
48 1 ASP B 220 ? ? -100.34 -145.75 
49 1 PHE B 225 ? ? -55.12  77.35   
50 1 GLU B 230 ? ? -39.37  119.41  
51 1 LYS B 241 ? ? -152.77 -28.25  
52 1 PRO B 243 ? ? -31.82  -21.17  
53 1 ALA B 245 ? ? -165.17 7.70    
54 1 LYS B 275 ? ? -43.30  -12.87  
55 1 GLU B 286 ? ? -74.47  -169.41 
56 1 ASN B 288 ? ? -78.50  43.15   
57 1 PHE B 298 ? ? -176.38 146.68  
58 1 ARG B 305 ? ? 35.18   42.53   
59 1 GLN B 306 ? ? 61.35   -2.60   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 18 ? C MET 1 
2 1 Y 1 B MET 38 ? D MET 1 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1LEI 'double helix'         
1LEI 'b-form double helix'  
1LEI 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 B DG  17 1_555 0.160  -0.035 0.426  -1.062  9.689   4.426   1  C_DC1:DG17_D  C 1  ? D 17 ? 19 1 
1 A DT 2  1_555 B DA  16 1_555 -0.137 -0.052 0.279  27.327  -25.824 -14.598 2  C_DT2:DA16_D  C 2  ? D 16 ? 20 1 
1 A DC 3  1_555 B DG  15 1_555 0.141  0.025  -0.239 19.391  -20.945 3.987   3  C_DC3:DG15_D  C 3  ? D 15 ? 19 1 
1 A DA 4  1_555 B DT  14 1_555 0.208  0.103  0.164  -3.080  -30.541 -10.994 4  C_DA4:DT14_D  C 4  ? D 14 ? 20 1 
1 A DG 5  1_555 B DC  13 1_555 -0.135 -0.137 0.318  -1.180  -21.146 1.313   5  C_DG5:DC13_D  C 5  ? D 13 ? 19 1 
1 A DG 6  1_555 B DC  12 1_555 -0.065 -0.089 1.040  18.176  6.968   -2.451  6  C_DG6:DC12_D  C 6  ? D 12 ? 19 1 
1 A DG 7  1_555 B DC  11 1_555 -0.188 0.038  0.623  21.259  -9.967  1.767   7  C_DG7:DC11_D  C 7  ? D 11 ? 19 1 
1 A DA 8  1_555 B 5IU 10 1_555 -0.119 -0.005 0.530  15.352  -16.750 3.529   8  C_DA8:5IU10_D C 8  ? D 10 ? 20 1 
1 A DA 9  1_555 B 5IU 9  1_555 -0.323 -0.033 0.780  18.427  -14.328 7.342   9  C_DA9:5IU9_D  C 9  ? D 9  ? 20 1 
1 A DA 10 1_555 B 5IU 8  1_555 -0.453 -0.120 0.763  1.120   -12.890 7.192   10 C_DA10:5IU8_D C 10 ? D 8  ? 20 1 
1 A DG 11 1_555 B DC  7  1_555 -0.105 -0.189 0.849  -3.281  -24.244 -3.067  11 C_DG11:DC7_D  C 11 ? D 7  ? 19 1 
1 A DT 12 1_555 B DA  6  1_555 -0.278 -0.094 0.852  -24.309 -16.753 -2.606  12 C_DT12:DA6_D  C 12 ? D 6  ? 20 1 
1 A DA 13 1_555 B 5IU 5  1_555 -0.145 -0.479 1.642  6.320   -5.275  6.418   13 C_DA13:5IU5_D C 13 ? D 5  ? 20 1 
1 A DC 14 1_555 B DG  4  1_555 0.136  -0.056 0.799  10.419  3.742   3.008   14 C_DC14:DG4_D  C 14 ? D 4  ? 19 1 
1 A DA 15 1_555 B DT  3  1_555 0.071  0.006  0.645  29.804  -15.934 0.282   15 C_DA15:DT3_D  C 15 ? D 3  ? 20 1 
1 A DG 16 1_555 B DC  2  1_555 0.278  -0.195 0.875  20.544  -31.684 -5.124  16 C_DG16:DC2_D  C 16 ? D 2  ? 19 1 
1 A DA 17 1_555 B DT  1  1_555 -0.614 1.246  -1.867 -35.691 -25.000 -89.263 17 C_DA17:DT1_D  C 17 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 B DG  17 1_555 A DT 2  1_555 B DA  16 1_555 -2.205 -0.360 2.688 0.222   -5.284  36.485 0.023  3.513  2.699 -8.385  
-0.352  36.853 1  CC_DC1DT2:DA16DG17_DD  C 1  ? D 17 ? C 2  ? D 16 ? 
1 A DT 2  1_555 B DA  16 1_555 A DC 3  1_555 B DG  15 1_555 0.808  0.187  3.747 8.255   5.288   31.459 -0.738 0.240  3.812 9.470   
-14.783 32.914 2  CC_DT2DC3:DG15DA16_DD  C 2  ? D 16 ? C 3  ? D 15 ? 
1 A DC 3  1_555 B DG  15 1_555 A DA 4  1_555 B DT  14 1_555 -0.885 1.377  3.849 -10.252 0.054   43.040 1.824  0.016  3.951 0.073   
13.742  44.188 3  CC_DC3DA4:DT14DG15_DD  C 3  ? D 15 ? C 4  ? D 14 ? 
1 A DA 4  1_555 B DT  14 1_555 A DG 5  1_555 B DC  13 1_555 0.653  -0.750 3.303 -5.399  9.827   25.914 -3.722 -2.540 2.661 20.722  
11.384  28.198 4  CC_DA4DG5:DC13DT14_DD  C 4  ? D 14 ? C 5  ? D 13 ? 
1 A DG 5  1_555 B DC  13 1_555 A DG 6  1_555 B DC  12 1_555 0.384  0.168  3.312 -8.427  -30.096 42.489 2.199  -0.998 2.571 -36.271 
10.155  52.314 5  CC_DG5DG6:DC12DC13_DD  C 5  ? D 13 ? C 6  ? D 12 ? 
1 A DG 6  1_555 B DC  12 1_555 A DG 7  1_555 B DC  11 1_555 -0.338 -0.414 3.536 4.201   -5.118  32.876 0.196  1.336  3.490 -8.931  
-7.330  33.518 6  CC_DG6DG7:DC11DC12_DD  C 6  ? D 12 ? C 7  ? D 11 ? 
1 A DG 7  1_555 B DC  11 1_555 A DA 8  1_555 B 5IU 10 1_555 -0.092 -1.290 3.160 -0.265  2.922   34.470 -2.598 0.117  3.044 4.921   
0.447   34.591 7  CC_DG7DA8:5IU10DC11_DD C 7  ? D 11 ? C 8  ? D 10 ? 
1 A DA 8  1_555 B 5IU 10 1_555 A DA 9  1_555 B 5IU 9  1_555 0.569  -0.804 3.025 -2.485  -8.254  31.109 -0.051 -1.443 3.079 -15.031 
4.525   32.253 8  CC_DA8DA9:5IU95IU10_DD C 8  ? D 10 ? C 9  ? D 9  ? 
1 A DA 9  1_555 B 5IU 9  1_555 A DA 10 1_555 B 5IU 8  1_555 -0.789 -0.419 3.589 -9.708  3.701   37.668 -1.129 -0.135 3.619 5.603   
14.697  39.025 9  CC_DA9DA10:5IU85IU9_DD C 9  ? D 9  ? C 10 ? D 8  ? 
1 A DA 10 1_555 B 5IU 8  1_555 A DG 11 1_555 B DC  7  1_555 -0.768 -0.979 3.384 -3.148  -5.811  34.070 -0.688 0.772  3.552 -9.803  
5.310   34.686 10 CC_DA10DG11:DC75IU8_DD C 10 ? D 8  ? C 11 ? D 7  ? 
1 A DG 11 1_555 B DC  7  1_555 A DT 12 1_555 B DA  6  1_555 -0.415 -1.385 3.775 -0.586  -8.433  39.371 -0.866 0.524  3.982 -12.344 
0.858   40.233 11 CC_DG11DT12:DA6DC7_DD  C 11 ? D 7  ? C 12 ? D 6  ? 
1 A DT 12 1_555 B DA  6  1_555 A DA 13 1_555 B 5IU 5  1_555 0.215  -0.995 2.278 -6.832  -7.078  28.788 -0.868 -1.405 2.340 -13.739 
13.261  30.389 12 CC_DT12DA13:5IU5DA6_DD C 12 ? D 6  ? C 13 ? D 5  ? 
1 A DA 13 1_555 B 5IU 5  1_555 A DC 14 1_555 B DG  4  1_555 -0.765 -0.612 3.166 2.260   -1.367  25.502 -1.007 2.340  3.115 -3.087  
-5.102  25.636 13 CC_DA13DC14:DG45IU5_DD C 13 ? D 5  ? C 14 ? D 4  ? 
1 A DC 14 1_555 B DG  4  1_555 A DA 15 1_555 B DT  3  1_555 -0.694 -0.264 2.680 -0.787  1.166   36.437 -0.554 1.019  2.685 1.864   
1.258   36.463 14 CC_DC14DA15:DT3DG4_DD  C 14 ? D 4  ? C 15 ? D 3  ? 
1 A DA 15 1_555 B DT  3  1_555 A DG 16 1_555 B DC  2  1_555 -1.408 0.066  3.489 -8.662  2.955   32.030 -0.440 0.833  3.724 5.223   
15.311  33.279 15 CC_DA15DG16:DC2DT3_DD  C 15 ? D 3  ? C 16 ? D 2  ? 
1 A DG 16 1_555 B DC  2  1_555 A DA 17 1_555 B DT  1  1_555 -1.383 -0.274 3.468 18.835  10.006  66.807 -0.603 1.894  2.974 8.859   
-16.675 69.751 16 CC_DG16DA17:DT1DC2_DD  C 16 ? D 2  ? C 17 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 HOH 1  700 700 HOH HOH A . 
E 5 HOH 2  701 701 HOH HOH A . 
E 5 HOH 3  702 702 HOH HOH A . 
E 5 HOH 4  706 706 HOH HOH A . 
E 5 HOH 5  707 707 HOH HOH A . 
E 5 HOH 6  709 709 HOH HOH A . 
E 5 HOH 7  711 711 HOH HOH A . 
E 5 HOH 8  712 712 HOH HOH A . 
E 5 HOH 9  714 714 HOH HOH A . 
E 5 HOH 10 715 715 HOH HOH A . 
E 5 HOH 11 716 716 HOH HOH A . 
E 5 HOH 12 719 719 HOH HOH A . 
E 5 HOH 13 720 720 HOH HOH A . 
E 5 HOH 14 721 721 HOH HOH A . 
E 5 HOH 15 722 722 HOH HOH A . 
F 5 HOH 1  703 703 HOH HOH B . 
F 5 HOH 2  704 704 HOH HOH B . 
F 5 HOH 3  705 705 HOH HOH B . 
F 5 HOH 4  708 708 HOH HOH B . 
F 5 HOH 5  710 710 HOH HOH B . 
F 5 HOH 6  713 713 HOH HOH B . 
F 5 HOH 7  717 717 HOH HOH B . 
F 5 HOH 8  718 718 HOH HOH B . 
#