data_1LG4
# 
_entry.id   1LG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1LG4         pdb_00001lg4 10.2210/pdb1lg4/pdb 
RCSB  RCSB015919   ?            ?                   
WWPDB D_1000015919 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1I17 
_pdbx_database_related.details        'NMR structure of the murine doppel protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LG4 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Luhrs, T.'    1 
'Riek, R.'     2 
'Guntert, P.'  3 
'Wuthrich, K.' 4 
# 
_citation.id                        primary 
_citation.title                     'NMR Structure of the Human Doppel Protein' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            326 
_citation.page_first                1549 
_citation.page_last                 1557 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12595265 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(02)01471-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Luhrs, T.'    1 ? 
primary 'Riek, R.'     2 ? 
primary 'Guntert, P.'  3 ? 
primary 'Wuthrich, K.' 4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Prion-like protein' 
_entity.formula_weight             14843.668 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'hDpl(24-152)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Doppel protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA
FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA
FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLN n 
1 3   THR n 
1 4   ARG n 
1 5   GLY n 
1 6   ILE n 
1 7   LYS n 
1 8   HIS n 
1 9   ARG n 
1 10  ILE n 
1 11  LYS n 
1 12  TRP n 
1 13  ASN n 
1 14  ARG n 
1 15  LYS n 
1 16  ALA n 
1 17  LEU n 
1 18  PRO n 
1 19  SER n 
1 20  THR n 
1 21  ALA n 
1 22  GLN n 
1 23  ILE n 
1 24  THR n 
1 25  GLU n 
1 26  ALA n 
1 27  GLN n 
1 28  VAL n 
1 29  ALA n 
1 30  GLU n 
1 31  ASN n 
1 32  ARG n 
1 33  PRO n 
1 34  GLY n 
1 35  ALA n 
1 36  PHE n 
1 37  ILE n 
1 38  LYS n 
1 39  GLN n 
1 40  GLY n 
1 41  ARG n 
1 42  LYS n 
1 43  LEU n 
1 44  ASP n 
1 45  ILE n 
1 46  ASP n 
1 47  PHE n 
1 48  GLY n 
1 49  ALA n 
1 50  GLU n 
1 51  GLY n 
1 52  ASN n 
1 53  ARG n 
1 54  TYR n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ASN n 
1 59  TYR n 
1 60  TRP n 
1 61  GLN n 
1 62  PHE n 
1 63  PRO n 
1 64  ASP n 
1 65  GLY n 
1 66  ILE n 
1 67  HIS n 
1 68  TYR n 
1 69  ASN n 
1 70  GLY n 
1 71  CYS n 
1 72  SER n 
1 73  GLU n 
1 74  ALA n 
1 75  ASN n 
1 76  VAL n 
1 77  THR n 
1 78  LYS n 
1 79  GLU n 
1 80  ALA n 
1 81  PHE n 
1 82  VAL n 
1 83  THR n 
1 84  GLY n 
1 85  CYS n 
1 86  ILE n 
1 87  ASN n 
1 88  ALA n 
1 89  THR n 
1 90  GLN n 
1 91  ALA n 
1 92  ALA n 
1 93  ASN n 
1 94  GLN n 
1 95  GLY n 
1 96  GLU n 
1 97  PHE n 
1 98  GLN n 
1 99  LYS n 
1 100 PRO n 
1 101 ASP n 
1 102 ASN n 
1 103 LYS n 
1 104 LEU n 
1 105 HIS n 
1 106 GLN n 
1 107 GLN n 
1 108 VAL n 
1 109 LEU n 
1 110 TRP n 
1 111 ARG n 
1 112 LEU n 
1 113 VAL n 
1 114 GLN n 
1 115 GLU n 
1 116 LEU n 
1 117 CYS n 
1 118 SER n 
1 119 LEU n 
1 120 LYS n 
1 121 HIS n 
1 122 CYS n 
1 123 GLU n 
1 124 PHE n 
1 125 TRP n 
1 126 LEU n 
1 127 GLU n 
1 128 ARG n 
1 129 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Prnd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21/DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pRSETA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRND_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA
FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
;
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_db_accession          Q9UKY0 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LG4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 129 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UKY0 
_struct_ref_seq.db_align_beg                  24 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  152 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       24 
_struct_ref_seq.pdbx_auth_seq_align_end       152 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
3 2 1 3D_15N-separated_NOESY 
4 3 1 '2D NOESY'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  4.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '13C,15N labeled hDpl(24-152)' '10% D2O, 90% H2O; 10 mM perdeuterated sodium acetate' 
2 '15N labeled hDpl(24-152)'     '10% D2O, 90% H2O; 10 mM perdeuterated sodium acetate' 
3 '13C,15N labeled hDpl(24-152)' '99.9999% D2O; 10 mM perdeuterated sodium acetate'     
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.field_strength    750 
# 
_pdbx_nmr_ensemble.entry_id                                      1LG4 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1LG4 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XEASY 1.5  'data analysis'      'Bartels, C., Xia, T. H., Billeter, M., Guntert, P., and Wuthrich, K.' 1 
DYANA 1.65 'structure solution' 'Guntert, P., Herrmann, T., Mumenthaler, C., and Wuthrich, K.'         2 
OPALp 1.3  refinement           'Luginbuhl, P., Guntert, P., Billeter, M., and Wuthrich, K.'           3 
# 
_exptl.entry_id          1LG4 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1LG4 
_struct.title                     'NMR structure of the human doppel protein fragment 24-152' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LG4 
_struct_keywords.pdbx_keywords   'Prion Protein' 
_struct_keywords.text            'prion, doppel, scrapie, Prion Protein' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 48  ? TYR A 59  ? GLY A 71  TYR A 82  1 ? 12 
HELX_P HELX_P2 2 TRP A 60  ? PHE A 62  ? TRP A 83  PHE A 85  5 ? 3  
HELX_P HELX_P3 3 THR A 77  ? ASN A 93  ? THR A 100 ASN A 116 1 ? 17 
HELX_P HELX_P4 4 ASN A 102 ? LEU A 119 ? ASN A 125 LEU A 142 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 94  A CYS 145 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf2 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 108 A CYS 140 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1LG4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LG4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 29  ? 1.295   -15.845 -3.872  1.00 0.00 ? 52  ALA A N    1  
ATOM 2     C CA   . ALA A 1 29  ? 1.074   -14.856 -4.913  1.00 0.00 ? 52  ALA A CA   1  
ATOM 3     C C    . ALA A 1 29  ? 1.304   -13.462 -4.341  1.00 0.00 ? 52  ALA A C    1  
ATOM 4     O O    . ALA A 1 29  ? 1.792   -12.566 -5.026  1.00 0.00 ? 52  ALA A O    1  
ATOM 5     C CB   . ALA A 1 29  ? -0.355  -14.960 -5.436  1.00 0.00 ? 52  ALA A CB   1  
ATOM 6     H H    . ALA A 1 29  ? 0.518   -16.374 -3.507  1.00 0.00 ? 52  ALA A H    1  
ATOM 7     H HA   . ALA A 1 29  ? 1.783   -15.038 -5.714  1.00 0.00 ? 52  ALA A HA   1  
ATOM 8     H HB1  . ALA A 1 29  ? -1.051  -14.944 -4.601  1.00 0.00 ? 52  ALA A HB1  1  
ATOM 9     H HB2  . ALA A 1 29  ? -0.564  -14.096 -6.065  1.00 0.00 ? 52  ALA A HB2  1  
ATOM 10    H HB3  . ALA A 1 29  ? -0.478  -15.871 -6.014  1.00 0.00 ? 52  ALA A HB3  1  
ATOM 11    N N    . GLU A 1 30  ? 0.936   -13.309 -3.073  1.00 0.00 ? 53  GLU A N    1  
ATOM 12    C CA   . GLU A 1 30  ? 0.782   -12.047 -2.385  1.00 0.00 ? 53  GLU A CA   1  
ATOM 13    C C    . GLU A 1 30  ? 2.140   -11.390 -2.100  1.00 0.00 ? 53  GLU A C    1  
ATOM 14    O O    . GLU A 1 30  ? 2.218   -10.183 -1.887  1.00 0.00 ? 53  GLU A O    1  
ATOM 15    C CB   . GLU A 1 30  ? -0.082  -12.233 -1.124  1.00 0.00 ? 53  GLU A CB   1  
ATOM 16    C CG   . GLU A 1 30  ? -1.209  -13.262 -1.344  1.00 0.00 ? 53  GLU A CG   1  
ATOM 17    C CD   . GLU A 1 30  ? -2.279  -13.261 -0.259  1.00 0.00 ? 53  GLU A CD   1  
ATOM 18    O OE1  . GLU A 1 30  ? -1.936  -13.185 0.937   1.00 0.00 ? 53  GLU A OE1  1  
ATOM 19    O OE2  . GLU A 1 30  ? -3.473  -13.354 -0.630  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 20    H H    . GLU A 1 30  ? 0.585   -14.121 -2.591  1.00 0.00 ? 53  GLU A H    1  
ATOM 21    H HA   . GLU A 1 30  ? 0.228   -11.410 -3.065  1.00 0.00 ? 53  GLU A HA   1  
ATOM 22    H HB2  . GLU A 1 30  ? 0.544   -12.560 -0.298  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 23    H HB3  . GLU A 1 30  ? -0.520  -11.269 -0.866  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 24    H HG2  . GLU A 1 30  ? -1.689  -13.047 -2.300  1.00 0.00 ? 53  GLU A HG2  1  
ATOM 25    H HG3  . GLU A 1 30  ? -0.781  -14.266 -1.398  1.00 0.00 ? 53  GLU A HG3  1  
ATOM 26    N N    . ASN A 1 31  ? 3.243   -12.134 -2.216  1.00 0.00 ? 54  ASN A N    1  
ATOM 27    C CA   . ASN A 1 31  ? 4.592   -11.574 -2.106  1.00 0.00 ? 54  ASN A CA   1  
ATOM 28    C C    . ASN A 1 31  ? 5.052   -10.890 -3.406  1.00 0.00 ? 54  ASN A C    1  
ATOM 29    O O    . ASN A 1 31  ? 6.203   -10.957 -3.837  1.00 0.00 ? 54  ASN A O    1  
ATOM 30    C CB   . ASN A 1 31  ? 5.542   -12.601 -1.483  1.00 0.00 ? 54  ASN A CB   1  
ATOM 31    C CG   . ASN A 1 31  ? 6.446   -13.394 -2.415  1.00 0.00 ? 54  ASN A CG   1  
ATOM 32    O OD1  . ASN A 1 31  ? 7.661   -13.259 -2.371  1.00 0.00 ? 54  ASN A OD1  1  
ATOM 33    N ND2  . ASN A 1 31  ? 5.909   -14.277 -3.232  1.00 0.00 ? 54  ASN A ND2  1  
ATOM 34    H H    . ASN A 1 31  ? 3.110   -13.150 -2.276  1.00 0.00 ? 54  ASN A H    1  
ATOM 35    H HA   . ASN A 1 31  ? 4.526   -10.770 -1.371  1.00 0.00 ? 54  ASN A HA   1  
ATOM 36    H HB2  . ASN A 1 31  ? 6.182   -12.040 -0.825  1.00 0.00 ? 54  ASN A HB2  1  
ATOM 37    H HB3  . ASN A 1 31  ? 4.968   -13.261 -0.842  1.00 0.00 ? 54  ASN A HB3  1  
ATOM 38    H HD21 . ASN A 1 31  ? 4.923   -14.533 -3.173  1.00 0.00 ? 54  ASN A HD21 1  
ATOM 39    H HD22 . ASN A 1 31  ? 6.539   -14.890 -3.749  1.00 0.00 ? 54  ASN A HD22 1  
ATOM 40    N N    . ARG A 1 32  ? 4.114   -10.263 -4.108  1.00 0.00 ? 55  ARG A N    1  
ATOM 41    C CA   . ARG A 1 32  ? 4.363   -9.230  -5.104  1.00 0.00 ? 55  ARG A CA   1  
ATOM 42    C C    . ARG A 1 32  ? 4.686   -7.923  -4.401  1.00 0.00 ? 55  ARG A C    1  
ATOM 43    O O    . ARG A 1 32  ? 4.227   -7.701  -3.285  1.00 0.00 ? 55  ARG A O    1  
ATOM 44    C CB   . ARG A 1 32  ? 3.088   -9.063  -5.933  1.00 0.00 ? 55  ARG A CB   1  
ATOM 45    C CG   . ARG A 1 32  ? 2.961   -10.186 -6.950  1.00 0.00 ? 55  ARG A CG   1  
ATOM 46    C CD   . ARG A 1 32  ? 1.509   -10.451 -7.373  1.00 0.00 ? 55  ARG A CD   1  
ATOM 47    N NE   . ARG A 1 32  ? 1.440   -11.261 -8.597  1.00 0.00 ? 55  ARG A NE   1  
ATOM 48    C CZ   . ARG A 1 32  ? 1.934   -12.487 -8.794  1.00 0.00 ? 55  ARG A CZ   1  
ATOM 49    N NH1  . ARG A 1 32  ? 2.454   -13.192 -7.792  1.00 0.00 ? 55  ARG A NH1  1  
ATOM 50    N NH2  . ARG A 1 32  ? 1.881   -12.995 -10.017 1.00 0.00 ? 55  ARG A NH2  1  
ATOM 51    H H    . ARG A 1 32  ? 3.198   -10.248 -3.680  1.00 0.00 ? 55  ARG A H    1  
ATOM 52    H HA   . ARG A 1 32  ? 5.207   -9.491  -5.738  1.00 0.00 ? 55  ARG A HA   1  
ATOM 53    H HB2  . ARG A 1 32  ? 2.256   -9.091  -5.259  1.00 0.00 ? 55  ARG A HB2  1  
ATOM 54    H HB3  . ARG A 1 32  ? 3.056   -8.103  -6.445  1.00 0.00 ? 55  ARG A HB3  1  
ATOM 55    H HG2  . ARG A 1 32  ? 3.561   -9.895  -7.803  1.00 0.00 ? 55  ARG A HG2  1  
ATOM 56    H HG3  . ARG A 1 32  ? 3.374   -11.097 -6.526  1.00 0.00 ? 55  ARG A HG3  1  
ATOM 57    H HD2  . ARG A 1 32  ? 0.961   -10.947 -6.571  1.00 0.00 ? 55  ARG A HD2  1  
ATOM 58    H HD3  . ARG A 1 32  ? 1.020   -9.506  -7.568  1.00 0.00 ? 55  ARG A HD3  1  
ATOM 59    H HE   . ARG A 1 32  ? 0.957   -10.835 -9.385  1.00 0.00 ? 55  ARG A HE   1  
ATOM 60    H HH11 . ARG A 1 32  ? 2.386   -12.820 -6.847  1.00 0.00 ? 55  ARG A HH11 1  
ATOM 61    H HH12 . ARG A 1 32  ? 3.035   -14.007 -7.947  1.00 0.00 ? 55  ARG A HH12 1  
ATOM 62    H HH21 . ARG A 1 32  ? 1.471   -12.411 -10.747 1.00 0.00 ? 55  ARG A HH21 1  
ATOM 63    H HH22 . ARG A 1 32  ? 1.960   -13.984 -10.225 1.00 0.00 ? 55  ARG A HH22 1  
ATOM 64    N N    . PRO A 1 33  ? 5.323   -6.979  -5.097  1.00 0.00 ? 56  PRO A N    1  
ATOM 65    C CA   . PRO A 1 33  ? 5.523   -5.621  -4.624  1.00 0.00 ? 56  PRO A CA   1  
ATOM 66    C C    . PRO A 1 33  ? 4.232   -4.775  -4.688  1.00 0.00 ? 56  PRO A C    1  
ATOM 67    O O    . PRO A 1 33  ? 4.284   -3.555  -4.799  1.00 0.00 ? 56  PRO A O    1  
ATOM 68    C CB   . PRO A 1 33  ? 6.647   -5.100  -5.514  1.00 0.00 ? 56  PRO A CB   1  
ATOM 69    C CG   . PRO A 1 33  ? 6.599   -5.900  -6.810  1.00 0.00 ? 56  PRO A CG   1  
ATOM 70    C CD   . PRO A 1 33  ? 5.813   -7.151  -6.454  1.00 0.00 ? 56  PRO A CD   1  
ATOM 71    H HA   . PRO A 1 33  ? 5.869   -5.632  -3.590  1.00 0.00 ? 56  PRO A HA   1  
ATOM 72    H HB2  . PRO A 1 33  ? 6.509   -4.057  -5.735  1.00 0.00 ? 56  PRO A HB2  1  
ATOM 73    H HB3  . PRO A 1 33  ? 7.601   -5.272  -5.017  1.00 0.00 ? 56  PRO A HB3  1  
ATOM 74    H HG2  . PRO A 1 33  ? 6.074   -5.350  -7.589  1.00 0.00 ? 56  PRO A HG2  1  
ATOM 75    H HG3  . PRO A 1 33  ? 7.606   -6.140  -7.140  1.00 0.00 ? 56  PRO A HG3  1  
ATOM 76    H HD2  . PRO A 1 33  ? 4.981   -7.261  -7.146  1.00 0.00 ? 56  PRO A HD2  1  
ATOM 77    H HD3  . PRO A 1 33  ? 6.435   -8.039  -6.502  1.00 0.00 ? 56  PRO A HD3  1  
ATOM 78    N N    . GLY A 1 34  ? 3.052   -5.386  -4.659  1.00 0.00 ? 57  GLY A N    1  
ATOM 79    C CA   . GLY A 1 34  ? 1.800   -4.684  -4.905  1.00 0.00 ? 57  GLY A CA   1  
ATOM 80    C C    . GLY A 1 34  ? 0.557   -5.557  -4.756  1.00 0.00 ? 57  GLY A C    1  
ATOM 81    O O    . GLY A 1 34  ? -0.508  -5.159  -5.219  1.00 0.00 ? 57  GLY A O    1  
ATOM 82    H H    . GLY A 1 34  ? 3.051   -6.359  -4.399  1.00 0.00 ? 57  GLY A H    1  
ATOM 83    H HA2  . GLY A 1 34  ? 1.724   -3.835  -4.226  1.00 0.00 ? 57  GLY A HA2  1  
ATOM 84    H HA3  . GLY A 1 34  ? 1.828   -4.295  -5.923  1.00 0.00 ? 57  GLY A HA3  1  
ATOM 85    N N    . ALA A 1 35  ? 0.667   -6.757  -4.186  1.00 0.00 ? 58  ALA A N    1  
ATOM 86    C CA   . ALA A 1 35  ? -0.474  -7.620  -3.939  1.00 0.00 ? 58  ALA A CA   1  
ATOM 87    C C    . ALA A 1 35  ? -1.489  -6.923  -3.044  1.00 0.00 ? 58  ALA A C    1  
ATOM 88    O O    . ALA A 1 35  ? -1.132  -6.249  -2.070  1.00 0.00 ? 58  ALA A O    1  
ATOM 89    C CB   . ALA A 1 35  ? -0.023  -8.895  -3.247  1.00 0.00 ? 58  ALA A CB   1  
ATOM 90    H H    . ALA A 1 35  ? 1.498   -6.970  -3.649  1.00 0.00 ? 58  ALA A H    1  
ATOM 91    H HA   . ALA A 1 35  ? -0.937  -7.881  -4.891  1.00 0.00 ? 58  ALA A HA   1  
ATOM 92    H HB1  . ALA A 1 35  ? 0.732   -9.408  -3.841  1.00 0.00 ? 58  ALA A HB1  1  
ATOM 93    H HB2  . ALA A 1 35  ? 0.386   -8.663  -2.263  1.00 0.00 ? 58  ALA A HB2  1  
ATOM 94    H HB3  . ALA A 1 35  ? -0.876  -9.552  -3.090  1.00 0.00 ? 58  ALA A HB3  1  
ATOM 95    N N    . PHE A 1 36  ? -2.759  -7.140  -3.368  1.00 0.00 ? 59  PHE A N    1  
ATOM 96    C CA   . PHE A 1 36  ? -3.865  -6.607  -2.605  1.00 0.00 ? 59  PHE A CA   1  
ATOM 97    C C    . PHE A 1 36  ? -4.085  -7.498  -1.372  1.00 0.00 ? 59  PHE A C    1  
ATOM 98    O O    . PHE A 1 36  ? -4.358  -8.681  -1.557  1.00 0.00 ? 59  PHE A O    1  
ATOM 99    C CB   . PHE A 1 36  ? -5.120  -6.573  -3.502  1.00 0.00 ? 59  PHE A CB   1  
ATOM 100   C CG   . PHE A 1 36  ? -5.288  -5.381  -4.440  1.00 0.00 ? 59  PHE A CG   1  
ATOM 101   C CD1  . PHE A 1 36  ? -4.306  -4.374  -4.572  1.00 0.00 ? 59  PHE A CD1  1  
ATOM 102   C CD2  . PHE A 1 36  ? -6.491  -5.259  -5.168  1.00 0.00 ? 59  PHE A CD2  1  
ATOM 103   C CE1  . PHE A 1 36  ? -4.533  -3.258  -5.391  1.00 0.00 ? 59  PHE A CE1  1  
ATOM 104   C CE2  . PHE A 1 36  ? -6.697  -4.158  -6.019  1.00 0.00 ? 59  PHE A CE2  1  
ATOM 105   C CZ   . PHE A 1 36  ? -5.706  -3.174  -6.144  1.00 0.00 ? 59  PHE A CZ   1  
ATOM 106   H H    . PHE A 1 36  ? -2.973  -7.777  -4.124  1.00 0.00 ? 59  PHE A H    1  
ATOM 107   H HA   . PHE A 1 36  ? -3.585  -5.601  -2.312  1.00 0.00 ? 59  PHE A HA   1  
ATOM 108   H HB2  . PHE A 1 36  ? -5.158  -7.486  -4.098  1.00 0.00 ? 59  PHE A HB2  1  
ATOM 109   H HB3  . PHE A 1 36  ? -5.999  -6.594  -2.858  1.00 0.00 ? 59  PHE A HB3  1  
ATOM 110   H HD1  . PHE A 1 36  ? -3.348  -4.425  -4.086  1.00 0.00 ? 59  PHE A HD1  1  
ATOM 111   H HD2  . PHE A 1 36  ? -7.260  -6.014  -5.089  1.00 0.00 ? 59  PHE A HD2  1  
ATOM 112   H HE1  . PHE A 1 36  ? -3.792  -2.478  -5.475  1.00 0.00 ? 59  PHE A HE1  1  
ATOM 113   H HE2  . PHE A 1 36  ? -7.609  -4.043  -6.594  1.00 0.00 ? 59  PHE A HE2  1  
ATOM 114   H HZ   . PHE A 1 36  ? -5.857  -2.343  -6.813  1.00 0.00 ? 59  PHE A HZ   1  
ATOM 115   N N    . ILE A 1 37  ? -4.014  -6.957  -0.144  1.00 0.00 ? 60  ILE A N    1  
ATOM 116   C CA   . ILE A 1 37  ? -4.285  -7.713  1.095   1.00 0.00 ? 60  ILE A CA   1  
ATOM 117   C C    . ILE A 1 37  ? -5.742  -8.219  1.144   1.00 0.00 ? 60  ILE A C    1  
ATOM 118   O O    . ILE A 1 37  ? -6.006  -9.359  1.513   1.00 0.00 ? 60  ILE A O    1  
ATOM 119   C CB   . ILE A 1 37  ? -3.945  -6.845  2.333   1.00 0.00 ? 60  ILE A CB   1  
ATOM 120   C CG1  . ILE A 1 37  ? -2.425  -6.621  2.480   1.00 0.00 ? 60  ILE A CG1  1  
ATOM 121   C CG2  . ILE A 1 37  ? -4.502  -7.489  3.606   1.00 0.00 ? 60  ILE A CG2  1  
ATOM 122   C CD1  . ILE A 1 37  ? -2.058  -5.694  3.646   1.00 0.00 ? 60  ILE A CD1  1  
ATOM 123   H H    . ILE A 1 37  ? -3.703  -5.996  -0.052  1.00 0.00 ? 60  ILE A H    1  
ATOM 124   H HA   . ILE A 1 37  ? -3.646  -8.598  1.108   1.00 0.00 ? 60  ILE A HA   1  
ATOM 125   H HB   . ILE A 1 37  ? -4.427  -5.876  2.212   1.00 0.00 ? 60  ILE A HB   1  
ATOM 126   H HG12 . ILE A 1 37  ? -1.930  -7.579  2.633   1.00 0.00 ? 60  ILE A HG12 1  
ATOM 127   H HG13 . ILE A 1 37  ? -2.037  -6.182  1.562   1.00 0.00 ? 60  ILE A HG13 1  
ATOM 128   H HG21 . ILE A 1 37  ? -4.065  -8.478  3.734   1.00 0.00 ? 60  ILE A HG21 1  
ATOM 129   H HG22 . ILE A 1 37  ? -4.291  -6.880  4.484   1.00 0.00 ? 60  ILE A HG22 1  
ATOM 130   H HG23 . ILE A 1 37  ? -5.581  -7.583  3.519   1.00 0.00 ? 60  ILE A HG23 1  
ATOM 131   H HD11 . ILE A 1 37  ? -1.072  -5.269  3.479   1.00 0.00 ? 60  ILE A HD11 1  
ATOM 132   H HD12 . ILE A 1 37  ? -2.782  -4.886  3.728   1.00 0.00 ? 60  ILE A HD12 1  
ATOM 133   H HD13 . ILE A 1 37  ? -2.046  -6.253  4.582   1.00 0.00 ? 60  ILE A HD13 1  
ATOM 134   N N    . LYS A 1 38  ? -6.710  -7.370  0.771   1.00 0.00 ? 61  LYS A N    1  
ATOM 135   C CA   . LYS A 1 38  ? -8.032  -7.819  0.356   1.00 0.00 ? 61  LYS A CA   1  
ATOM 136   C C    . LYS A 1 38  ? -8.845  -8.587  1.418   1.00 0.00 ? 61  LYS A C    1  
ATOM 137   O O    . LYS A 1 38  ? -9.691  -9.402  1.048   1.00 0.00 ? 61  LYS A O    1  
ATOM 138   C CB   . LYS A 1 38  ? -7.794  -8.562  -0.983  1.00 0.00 ? 61  LYS A CB   1  
ATOM 139   C CG   . LYS A 1 38  ? -8.682  -8.157  -2.153  1.00 0.00 ? 61  LYS A CG   1  
ATOM 140   C CD   . LYS A 1 38  ? -10.050 -8.781  -1.981  1.00 0.00 ? 61  LYS A CD   1  
ATOM 141   C CE   . LYS A 1 38  ? -10.815 -8.779  -3.302  1.00 0.00 ? 61  LYS A CE   1  
ATOM 142   N NZ   . LYS A 1 38  ? -11.972 -9.680  -3.207  1.00 0.00 ? 61  LYS A NZ   1  
ATOM 143   H H    . LYS A 1 38  ? -6.434  -6.490  0.386   1.00 0.00 ? 61  LYS A H    1  
ATOM 144   H HA   . LYS A 1 38  ? -8.624  -6.929  0.187   1.00 0.00 ? 61  LYS A HA   1  
ATOM 145   H HB2  . LYS A 1 38  ? -6.792  -8.350  -1.345  1.00 0.00 ? 61  LYS A HB2  1  
ATOM 146   H HB3  . LYS A 1 38  ? -7.829  -9.641  -0.823  1.00 0.00 ? 61  LYS A HB3  1  
ATOM 147   H HG2  . LYS A 1 38  ? -8.756  -7.072  -2.231  1.00 0.00 ? 61  LYS A HG2  1  
ATOM 148   H HG3  . LYS A 1 38  ? -8.225  -8.541  -3.063  1.00 0.00 ? 61  LYS A HG3  1  
ATOM 149   H HD2  . LYS A 1 38  ? -9.921  -9.820  -1.667  1.00 0.00 ? 61  LYS A HD2  1  
ATOM 150   H HD3  . LYS A 1 38  ? -10.569 -8.215  -1.205  1.00 0.00 ? 61  LYS A HD3  1  
ATOM 151   H HE2  . LYS A 1 38  ? -11.135 -7.765  -3.537  1.00 0.00 ? 61  LYS A HE2  1  
ATOM 152   H HE3  . LYS A 1 38  ? -10.161 -9.135  -4.103  1.00 0.00 ? 61  LYS A HE3  1  
ATOM 153   H HZ1  . LYS A 1 38  ? -12.556 -9.428  -2.415  1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 154   H HZ2  . LYS A 1 38  ? -12.541 -9.655  -4.047  1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 155   H HZ3  . LYS A 1 38  ? -11.656 -10.641 -3.113  1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 156   N N    . GLN A 1 39  ? -8.679  -8.271  2.713   1.00 0.00 ? 62  GLN A N    1  
ATOM 157   C CA   . GLN A 1 39  ? -9.357  -8.972  3.813   1.00 0.00 ? 62  GLN A CA   1  
ATOM 158   C C    . GLN A 1 39  ? -10.896 -8.924  3.765   1.00 0.00 ? 62  GLN A C    1  
ATOM 159   O O    . GLN A 1 39  ? -11.524 -9.732  4.448   1.00 0.00 ? 62  GLN A O    1  
ATOM 160   C CB   . GLN A 1 39  ? -8.899  -8.470  5.201   1.00 0.00 ? 62  GLN A CB   1  
ATOM 161   C CG   . GLN A 1 39  ? -7.376  -8.468  5.416   1.00 0.00 ? 62  GLN A CG   1  
ATOM 162   C CD   . GLN A 1 39  ? -6.916  -8.643  6.870   1.00 0.00 ? 62  GLN A CD   1  
ATOM 163   O OE1  . GLN A 1 39  ? -7.685  -8.543  7.823   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 164   N NE2  . GLN A 1 39  ? -5.644  -8.918  7.092   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 165   H H    . GLN A 1 39  ? -7.944  -7.627  2.953   1.00 0.00 ? 62  GLN A H    1  
ATOM 166   H HA   . GLN A 1 39  ? -9.074  -10.023 3.738   1.00 0.00 ? 62  GLN A HA   1  
ATOM 167   H HB2  . GLN A 1 39  ? -9.280  -7.460  5.366   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 168   H HB3  . GLN A 1 39  ? -9.356  -9.117  5.947   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 169   H HG2  . GLN A 1 39  ? -6.922  -9.257  4.813   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 170   H HG3  . GLN A 1 39  ? -7.018  -7.498  5.081   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 171   H HE21 . GLN A 1 39  ? -5.013  -9.158  6.321   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 172   H HE22 . GLN A 1 39  ? -5.276  -9.001  8.025   1.00 0.00 ? 62  GLN A HE22 1  
ATOM 173   N N    . GLY A 1 40  ? -11.531 -8.017  3.010   1.00 0.00 ? 63  GLY A N    1  
ATOM 174   C CA   . GLY A 1 40  ? -12.990 -7.959  2.911   1.00 0.00 ? 63  GLY A CA   1  
ATOM 175   C C    . GLY A 1 40  ? -13.567 -6.935  3.884   1.00 0.00 ? 63  GLY A C    1  
ATOM 176   O O    . GLY A 1 40  ? -14.194 -7.319  4.869   1.00 0.00 ? 63  GLY A O    1  
ATOM 177   H H    . GLY A 1 40  ? -11.001 -7.337  2.485   1.00 0.00 ? 63  GLY A H    1  
ATOM 178   H HA2  . GLY A 1 40  ? -13.284 -7.716  1.896   1.00 0.00 ? 63  GLY A HA2  1  
ATOM 179   H HA3  . GLY A 1 40  ? -13.417 -8.938  3.136   1.00 0.00 ? 63  GLY A HA3  1  
ATOM 180   N N    . ARG A 1 41  ? -13.346 -5.635  3.656   1.00 0.00 ? 64  ARG A N    1  
ATOM 181   C CA   . ARG A 1 41  ? -13.786 -4.561  4.568   1.00 0.00 ? 64  ARG A CA   1  
ATOM 182   C C    . ARG A 1 41  ? -14.201 -3.302  3.806   1.00 0.00 ? 64  ARG A C    1  
ATOM 183   O O    . ARG A 1 41  ? -14.086 -3.283  2.581   1.00 0.00 ? 64  ARG A O    1  
ATOM 184   C CB   . ARG A 1 41  ? -12.739 -4.289  5.662   1.00 0.00 ? 64  ARG A CB   1  
ATOM 185   C CG   . ARG A 1 41  ? -11.293 -4.240  5.169   1.00 0.00 ? 64  ARG A CG   1  
ATOM 186   C CD   . ARG A 1 41  ? -10.333 -4.062  6.343   1.00 0.00 ? 64  ARG A CD   1  
ATOM 187   N NE   . ARG A 1 41  ? -10.391 -5.206  7.268   1.00 0.00 ? 64  ARG A NE   1  
ATOM 188   C CZ   . ARG A 1 41  ? -9.393  -5.683  8.015   1.00 0.00 ? 64  ARG A CZ   1  
ATOM 189   N NH1  . ARG A 1 41  ? -8.185  -5.140  8.008   1.00 0.00 ? 64  ARG A NH1  1  
ATOM 190   N NH2  . ARG A 1 41  ? -9.619  -6.754  8.755   1.00 0.00 ? 64  ARG A NH2  1  
ATOM 191   H H    . ARG A 1 41  ? -12.849 -5.379  2.807   1.00 0.00 ? 64  ARG A H    1  
ATOM 192   H HA   . ARG A 1 41  ? -14.652 -4.939  5.095   1.00 0.00 ? 64  ARG A HA   1  
ATOM 193   H HB2  . ARG A 1 41  ? -12.962 -3.351  6.172   1.00 0.00 ? 64  ARG A HB2  1  
ATOM 194   H HB3  . ARG A 1 41  ? -12.826 -5.084  6.400   1.00 0.00 ? 64  ARG A HB3  1  
ATOM 195   H HG2  . ARG A 1 41  ? -11.051 -5.174  4.653   1.00 0.00 ? 64  ARG A HG2  1  
ATOM 196   H HG3  . ARG A 1 41  ? -11.171 -3.401  4.482   1.00 0.00 ? 64  ARG A HG3  1  
ATOM 197   H HD2  . ARG A 1 41  ? -9.342  -3.982  5.922   1.00 0.00 ? 64  ARG A HD2  1  
ATOM 198   H HD3  . ARG A 1 41  ? -10.557 -3.141  6.883   1.00 0.00 ? 64  ARG A HD3  1  
ATOM 199   H HE   . ARG A 1 41  ? -11.292 -5.653  7.366   1.00 0.00 ? 64  ARG A HE   1  
ATOM 200   H HH11 . ARG A 1 41  ? -7.936  -4.373  7.373   1.00 0.00 ? 64  ARG A HH11 1  
ATOM 201   H HH12 . ARG A 1 41  ? -7.430  -5.523  8.568   1.00 0.00 ? 64  ARG A HH12 1  
ATOM 202   H HH21 . ARG A 1 41  ? -10.476 -7.289  8.643   1.00 0.00 ? 64  ARG A HH21 1  
ATOM 203   H HH22 . ARG A 1 41  ? -8.842  -7.245  9.181   1.00 0.00 ? 64  ARG A HH22 1  
ATOM 204   N N    . LYS A 1 42  ? -14.678 -2.255  4.495   1.00 0.00 ? 65  LYS A N    1  
ATOM 205   C CA   . LYS A 1 42  ? -15.099 -0.979  3.894   1.00 0.00 ? 65  LYS A CA   1  
ATOM 206   C C    . LYS A 1 42  ? -14.205 0.209   4.245   1.00 0.00 ? 65  LYS A C    1  
ATOM 207   O O    . LYS A 1 42  ? -14.444 1.288   3.715   1.00 0.00 ? 65  LYS A O    1  
ATOM 208   C CB   . LYS A 1 42  ? -16.549 -0.643  4.281   1.00 0.00 ? 65  LYS A CB   1  
ATOM 209   C CG   . LYS A 1 42  ? -17.536 -1.137  3.258   1.00 0.00 ? 65  LYS A CG   1  
ATOM 210   C CD   . LYS A 1 42  ? -18.977 -0.724  3.597   1.00 0.00 ? 65  LYS A CD   1  
ATOM 211   C CE   . LYS A 1 42  ? -19.665 -1.488  4.736   1.00 0.00 ? 65  LYS A CE   1  
ATOM 212   N NZ   . LYS A 1 42  ? -19.420 -0.914  6.078   1.00 0.00 ? 65  LYS A NZ   1  
ATOM 213   H H    . LYS A 1 42  ? -14.768 -2.335  5.499   1.00 0.00 ? 65  LYS A H    1  
ATOM 214   H HA   . LYS A 1 42  ? -15.045 -1.073  2.811   1.00 0.00 ? 65  LYS A HA   1  
ATOM 215   H HB2  . LYS A 1 42  ? -16.781 -1.028  5.273   1.00 0.00 ? 65  LYS A HB2  1  
ATOM 216   H HB3  . LYS A 1 42  ? -16.705 0.425   4.248   1.00 0.00 ? 65  LYS A HB3  1  
ATOM 217   H HG2  . LYS A 1 42  ? -17.282 -0.659  2.312   1.00 0.00 ? 65  LYS A HG2  1  
ATOM 218   H HG3  . LYS A 1 42  ? -17.389 -2.202  3.164   1.00 0.00 ? 65  LYS A HG3  1  
ATOM 219   H HD2  . LYS A 1 42  ? -18.984 0.343   3.816   1.00 0.00 ? 65  LYS A HD2  1  
ATOM 220   H HD3  . LYS A 1 42  ? -19.592 -0.856  2.709   1.00 0.00 ? 65  LYS A HD3  1  
ATOM 221   H HE2  . LYS A 1 42  ? -20.740 -1.430  4.553   1.00 0.00 ? 65  LYS A HE2  1  
ATOM 222   H HE3  . LYS A 1 42  ? -19.363 -2.537  4.716   1.00 0.00 ? 65  LYS A HE3  1  
ATOM 223   H HZ1  . LYS A 1 42  ? -19.947 -1.442  6.768   1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 224   H HZ2  . LYS A 1 42  ? -18.449 -0.947  6.361   1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 225   H HZ3  . LYS A 1 42  ? -19.737 0.052   6.127   1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 226   N N    . LEU A 1 43  ? -13.188 0.025   5.085   1.00 0.00 ? 66  LEU A N    1  
ATOM 227   C CA   . LEU A 1 43  ? -12.224 1.049   5.481   1.00 0.00 ? 66  LEU A CA   1  
ATOM 228   C C    . LEU A 1 43  ? -12.876 2.379   5.914   1.00 0.00 ? 66  LEU A C    1  
ATOM 229   O O    . LEU A 1 43  ? -14.067 2.447   6.220   1.00 0.00 ? 66  LEU A O    1  
ATOM 230   C CB   . LEU A 1 43  ? -11.188 1.201   4.345   1.00 0.00 ? 66  LEU A CB   1  
ATOM 231   C CG   . LEU A 1 43  ? -10.267 -0.012  4.152   1.00 0.00 ? 66  LEU A CG   1  
ATOM 232   C CD1  . LEU A 1 43  ? -9.419  0.085   2.878   1.00 0.00 ? 66  LEU A CD1  1  
ATOM 233   C CD2  . LEU A 1 43  ? -9.309  -0.079  5.330   1.00 0.00 ? 66  LEU A CD2  1  
ATOM 234   H H    . LEU A 1 43  ? -13.056 -0.897  5.441   1.00 0.00 ? 66  LEU A H    1  
ATOM 235   H HA   . LEU A 1 43  ? -11.721 0.685   6.375   1.00 0.00 ? 66  LEU A HA   1  
ATOM 236   H HB2  . LEU A 1 43  ? -11.740 1.367   3.427   1.00 0.00 ? 66  LEU A HB2  1  
ATOM 237   H HB3  . LEU A 1 43  ? -10.552 2.060   4.536   1.00 0.00 ? 66  LEU A HB3  1  
ATOM 238   H HG   . LEU A 1 43  ? -10.864 -0.922  4.104   1.00 0.00 ? 66  LEU A HG   1  
ATOM 239   H HD11 . LEU A 1 43  ? -10.055 0.061   1.998   1.00 0.00 ? 66  LEU A HD11 1  
ATOM 240   H HD12 . LEU A 1 43  ? -8.816  0.992   2.885   1.00 0.00 ? 66  LEU A HD12 1  
ATOM 241   H HD13 . LEU A 1 43  ? -8.747  -0.771  2.820   1.00 0.00 ? 66  LEU A HD13 1  
ATOM 242   H HD21 . LEU A 1 43  ? -9.855  -0.260  6.249   1.00 0.00 ? 66  LEU A HD21 1  
ATOM 243   H HD22 . LEU A 1 43  ? -8.623  -0.915  5.193   1.00 0.00 ? 66  LEU A HD22 1  
ATOM 244   H HD23 . LEU A 1 43  ? -8.757  0.868   5.406   1.00 0.00 ? 66  LEU A HD23 1  
ATOM 245   N N    . ASP A 1 44  ? -12.061 3.424   6.029   1.00 0.00 ? 67  ASP A N    1  
ATOM 246   C CA   . ASP A 1 44  ? -12.314 4.671   6.742   1.00 0.00 ? 67  ASP A CA   1  
ATOM 247   C C    . ASP A 1 44  ? -11.809 5.876   5.929   1.00 0.00 ? 67  ASP A C    1  
ATOM 248   O O    . ASP A 1 44  ? -11.509 6.939   6.471   1.00 0.00 ? 67  ASP A O    1  
ATOM 249   C CB   . ASP A 1 44  ? -11.641 4.572   8.123   1.00 0.00 ? 67  ASP A CB   1  
ATOM 250   C CG   . ASP A 1 44  ? -10.175 4.124   8.095   1.00 0.00 ? 67  ASP A CG   1  
ATOM 251   O OD1  . ASP A 1 44  ? -9.325  4.730   7.409   1.00 0.00 ? 67  ASP A OD1  1  
ATOM 252   O OD2  . ASP A 1 44  ? -9.832  3.135   8.785   1.00 0.00 ? 67  ASP A OD2  1  
ATOM 253   H H    . ASP A 1 44  ? -11.079 3.314   5.829   1.00 0.00 ? 67  ASP A H    1  
ATOM 254   H HA   . ASP A 1 44  ? -13.386 4.802   6.896   1.00 0.00 ? 67  ASP A HA   1  
ATOM 255   H HB2  . ASP A 1 44  ? -11.696 5.535   8.617   1.00 0.00 ? 67  ASP A HB2  1  
ATOM 256   H HB3  . ASP A 1 44  ? -12.213 3.861   8.721   1.00 0.00 ? 67  ASP A HB3  1  
ATOM 257   N N    . ILE A 1 45  ? -11.655 5.704   4.616   1.00 0.00 ? 68  ILE A N    1  
ATOM 258   C CA   . ILE A 1 45  ? -11.034 6.660   3.708   1.00 0.00 ? 68  ILE A CA   1  
ATOM 259   C C    . ILE A 1 45  ? -12.149 7.534   3.088   1.00 0.00 ? 68  ILE A C    1  
ATOM 260   O O    . ILE A 1 45  ? -13.078 7.000   2.474   1.00 0.00 ? 68  ILE A O    1  
ATOM 261   C CB   . ILE A 1 45  ? -10.193 5.873   2.661   1.00 0.00 ? 68  ILE A CB   1  
ATOM 262   C CG1  . ILE A 1 45  ? -9.363  4.705   3.278   1.00 0.00 ? 68  ILE A CG1  1  
ATOM 263   C CG2  . ILE A 1 45  ? -9.304  6.810   1.824   1.00 0.00 ? 68  ILE A CG2  1  
ATOM 264   C CD1  . ILE A 1 45  ? -8.297  4.079   2.362   1.00 0.00 ? 68  ILE A CD1  1  
ATOM 265   H H    . ILE A 1 45  ? -11.997 4.847   4.213   1.00 0.00 ? 68  ILE A H    1  
ATOM 266   H HA   . ILE A 1 45  ? -10.356 7.291   4.280   1.00 0.00 ? 68  ILE A HA   1  
ATOM 267   H HB   . ILE A 1 45  ? -10.892 5.408   1.970   1.00 0.00 ? 68  ILE A HB   1  
ATOM 268   H HG12 . ILE A 1 45  ? -8.880  4.979   4.215   1.00 0.00 ? 68  ILE A HG12 1  
ATOM 269   H HG13 . ILE A 1 45  ? -10.060 3.918   3.544   1.00 0.00 ? 68  ILE A HG13 1  
ATOM 270   H HG21 . ILE A 1 45  ? -8.373  7.029   2.341   1.00 0.00 ? 68  ILE A HG21 1  
ATOM 271   H HG22 . ILE A 1 45  ? -9.070  6.336   0.868   1.00 0.00 ? 68  ILE A HG22 1  
ATOM 272   H HG23 . ILE A 1 45  ? -9.826  7.742   1.634   1.00 0.00 ? 68  ILE A HG23 1  
ATOM 273   H HD11 . ILE A 1 45  ? -7.955  3.135   2.789   1.00 0.00 ? 68  ILE A HD11 1  
ATOM 274   H HD12 . ILE A 1 45  ? -8.700  3.891   1.368   1.00 0.00 ? 68  ILE A HD12 1  
ATOM 275   H HD13 . ILE A 1 45  ? -7.446  4.746   2.276   1.00 0.00 ? 68  ILE A HD13 1  
ATOM 276   N N    . ASP A 1 46  ? -12.077 8.865   3.235   1.00 0.00 ? 69  ASP A N    1  
ATOM 277   C CA   . ASP A 1 46  ? -13.102 9.779   2.711   1.00 0.00 ? 69  ASP A CA   1  
ATOM 278   C C    . ASP A 1 46  ? -12.884 9.982   1.208   1.00 0.00 ? 69  ASP A C    1  
ATOM 279   O O    . ASP A 1 46  ? -11.943 10.669  0.805   1.00 0.00 ? 69  ASP A O    1  
ATOM 280   C CB   . ASP A 1 46  ? -13.116 11.115  3.477   1.00 0.00 ? 69  ASP A CB   1  
ATOM 281   C CG   . ASP A 1 46  ? -14.282 12.041  3.094   1.00 0.00 ? 69  ASP A CG   1  
ATOM 282   O OD1  . ASP A 1 46  ? -14.966 11.803  2.069   1.00 0.00 ? 69  ASP A OD1  1  
ATOM 283   O OD2  . ASP A 1 46  ? -14.520 13.031  3.826   1.00 0.00 ? 69  ASP A OD2  1  
ATOM 284   H H    . ASP A 1 46  ? -11.348 9.273   3.814   1.00 0.00 ? 69  ASP A H    1  
ATOM 285   H HA   . ASP A 1 46  ? -14.077 9.332   2.874   1.00 0.00 ? 69  ASP A HA   1  
ATOM 286   H HB2  . ASP A 1 46  ? -13.191 10.899  4.543   1.00 0.00 ? 69  ASP A HB2  1  
ATOM 287   H HB3  . ASP A 1 46  ? -12.176 11.639  3.314   1.00 0.00 ? 69  ASP A HB3  1  
ATOM 288   N N    . PHE A 1 47  ? -13.677 9.325   0.360   1.00 0.00 ? 70  PHE A N    1  
ATOM 289   C CA   . PHE A 1 47  ? -13.559 9.384   -1.102  1.00 0.00 ? 70  PHE A CA   1  
ATOM 290   C C    . PHE A 1 47  ? -14.263 10.579  -1.721  1.00 0.00 ? 70  PHE A C    1  
ATOM 291   O O    . PHE A 1 47  ? -13.933 10.957  -2.852  1.00 0.00 ? 70  PHE A O    1  
ATOM 292   C CB   . PHE A 1 47  ? -14.120 8.107   -1.737  1.00 0.00 ? 70  PHE A CB   1  
ATOM 293   C CG   . PHE A 1 47  ? -13.223 6.915   -1.520  1.00 0.00 ? 70  PHE A CG   1  
ATOM 294   C CD1  . PHE A 1 47  ? -12.065 6.753   -2.304  1.00 0.00 ? 70  PHE A CD1  1  
ATOM 295   C CD2  . PHE A 1 47  ? -13.498 6.014   -0.479  1.00 0.00 ? 70  PHE A CD2  1  
ATOM 296   C CE1  . PHE A 1 47  ? -11.154 5.729   -2.005  1.00 0.00 ? 70  PHE A CE1  1  
ATOM 297   C CE2  . PHE A 1 47  ? -12.573 5.015   -0.160  1.00 0.00 ? 70  PHE A CE2  1  
ATOM 298   C CZ   . PHE A 1 47  ? -11.390 4.901   -0.901  1.00 0.00 ? 70  PHE A CZ   1  
ATOM 299   H H    . PHE A 1 47  ? -14.402 8.759   0.775   1.00 0.00 ? 70  PHE A H    1  
ATOM 300   H HA   . PHE A 1 47  ? -12.513 9.466   -1.376  1.00 0.00 ? 70  PHE A HA   1  
ATOM 301   H HB2  . PHE A 1 47  ? -15.112 7.909   -1.338  1.00 0.00 ? 70  PHE A HB2  1  
ATOM 302   H HB3  . PHE A 1 47  ? -14.231 8.254   -2.812  1.00 0.00 ? 70  PHE A HB3  1  
ATOM 303   H HD1  . PHE A 1 47  ? -11.822 7.453   -3.084  1.00 0.00 ? 70  PHE A HD1  1  
ATOM 304   H HD2  . PHE A 1 47  ? -14.375 6.128   0.138   1.00 0.00 ? 70  PHE A HD2  1  
ATOM 305   H HE1  . PHE A 1 47  ? -10.249 5.599   -2.580  1.00 0.00 ? 70  PHE A HE1  1  
ATOM 306   H HE2  . PHE A 1 47  ? -12.740 4.367   0.689   1.00 0.00 ? 70  PHE A HE2  1  
ATOM 307   H HZ   . PHE A 1 47  ? -10.660 4.169   -0.609  1.00 0.00 ? 70  PHE A HZ   1  
ATOM 308   N N    . GLY A 1 48  ? -15.250 11.134  -1.033  1.00 0.00 ? 71  GLY A N    1  
ATOM 309   C CA   . GLY A 1 48  ? -16.281 11.920  -1.660  1.00 0.00 ? 71  GLY A CA   1  
ATOM 310   C C    . GLY A 1 48  ? -17.381 11.019  -2.213  1.00 0.00 ? 71  GLY A C    1  
ATOM 311   O O    . GLY A 1 48  ? -17.259 9.789   -2.226  1.00 0.00 ? 71  GLY A O    1  
ATOM 312   H H    . GLY A 1 48  ? -15.481 10.783  -0.115  1.00 0.00 ? 71  GLY A H    1  
ATOM 313   H HA2  . GLY A 1 48  ? -16.684 12.585  -0.907  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 314   H HA3  . GLY A 1 48  ? -15.859 12.512  -2.464  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 315   N N    . ALA A 1 49  ? -18.466 11.652  -2.651  1.00 0.00 ? 72  ALA A N    1  
ATOM 316   C CA   . ALA A 1 49  ? -19.783 11.082  -2.884  1.00 0.00 ? 72  ALA A CA   1  
ATOM 317   C C    . ALA A 1 49  ? -19.778 9.801   -3.714  1.00 0.00 ? 72  ALA A C    1  
ATOM 318   O O    . ALA A 1 49  ? -20.007 8.716   -3.181  1.00 0.00 ? 72  ALA A O    1  
ATOM 319   C CB   . ALA A 1 49  ? -20.656 12.146  -3.563  1.00 0.00 ? 72  ALA A CB   1  
ATOM 320   H H    . ALA A 1 49  ? -18.427 12.663  -2.576  1.00 0.00 ? 72  ALA A H    1  
ATOM 321   H HA   . ALA A 1 49  ? -20.204 10.823  -1.910  1.00 0.00 ? 72  ALA A HA   1  
ATOM 322   H HB1  . ALA A 1 49  ? -21.616 11.705  -3.831  1.00 0.00 ? 72  ALA A HB1  1  
ATOM 323   H HB2  . ALA A 1 49  ? -20.819 12.981  -2.883  1.00 0.00 ? 72  ALA A HB2  1  
ATOM 324   H HB3  . ALA A 1 49  ? -20.167 12.506  -4.472  1.00 0.00 ? 72  ALA A HB3  1  
ATOM 325   N N    . GLU A 1 50  ? -19.591 9.928   -5.030  1.00 0.00 ? 73  GLU A N    1  
ATOM 326   C CA   . GLU A 1 50  ? -19.834 8.835   -5.961  1.00 0.00 ? 73  GLU A CA   1  
ATOM 327   C C    . GLU A 1 50  ? -18.934 7.647   -5.633  1.00 0.00 ? 73  GLU A C    1  
ATOM 328   O O    . GLU A 1 50  ? -19.394 6.505   -5.626  1.00 0.00 ? 73  GLU A O    1  
ATOM 329   C CB   . GLU A 1 50  ? -19.749 9.312   -7.423  1.00 0.00 ? 73  GLU A CB   1  
ATOM 330   C CG   . GLU A 1 50  ? -18.507 10.134  -7.837  1.00 0.00 ? 73  GLU A CG   1  
ATOM 331   C CD   . GLU A 1 50  ? -18.487 10.404  -9.353  1.00 0.00 ? 73  GLU A CD   1  
ATOM 332   O OE1  . GLU A 1 50  ? -19.350 11.172  -9.843  1.00 0.00 ? 73  GLU A OE1  1  
ATOM 333   O OE2  . GLU A 1 50  ? -17.624 9.844   -10.071 1.00 0.00 ? 73  GLU A OE2  1  
ATOM 334   H H    . GLU A 1 50  ? -19.379 10.846  -5.387  1.00 0.00 ? 73  GLU A H    1  
ATOM 335   H HA   . GLU A 1 50  ? -20.852 8.487   -5.802  1.00 0.00 ? 73  GLU A HA   1  
ATOM 336   H HB2  . GLU A 1 50  ? -19.818 8.426   -8.046  1.00 0.00 ? 73  GLU A HB2  1  
ATOM 337   H HB3  . GLU A 1 50  ? -20.633 9.923   -7.610  1.00 0.00 ? 73  GLU A HB3  1  
ATOM 338   H HG2  . GLU A 1 50  ? -18.535 11.095  -7.322  1.00 0.00 ? 73  GLU A HG2  1  
ATOM 339   H HG3  . GLU A 1 50  ? -17.592 9.619   -7.538  1.00 0.00 ? 73  GLU A HG3  1  
ATOM 340   N N    . GLY A 1 51  ? -17.685 7.928   -5.264  1.00 0.00 ? 74  GLY A N    1  
ATOM 341   C CA   . GLY A 1 51  ? -16.732 6.930   -4.827  1.00 0.00 ? 74  GLY A CA   1  
ATOM 342   C C    . GLY A 1 51  ? -17.214 6.188   -3.584  1.00 0.00 ? 74  GLY A C    1  
ATOM 343   O O    . GLY A 1 51  ? -17.306 4.960   -3.619  1.00 0.00 ? 74  GLY A O    1  
ATOM 344   H H    . GLY A 1 51  ? -17.415 8.901   -5.280  1.00 0.00 ? 74  GLY A H    1  
ATOM 345   H HA2  . GLY A 1 51  ? -16.602 6.210   -5.634  1.00 0.00 ? 74  GLY A HA2  1  
ATOM 346   H HA3  . GLY A 1 51  ? -15.778 7.413   -4.620  1.00 0.00 ? 74  GLY A HA3  1  
ATOM 347   N N    . ASN A 1 52  ? -17.515 6.899   -2.490  1.00 0.00 ? 75  ASN A N    1  
ATOM 348   C CA   . ASN A 1 52  ? -17.867 6.264   -1.216  1.00 0.00 ? 75  ASN A CA   1  
ATOM 349   C C    . ASN A 1 52  ? -19.133 5.421   -1.354  1.00 0.00 ? 75  ASN A C    1  
ATOM 350   O O    . ASN A 1 52  ? -19.168 4.279   -0.893  1.00 0.00 ? 75  ASN A O    1  
ATOM 351   C CB   . ASN A 1 52  ? -17.949 7.278   -0.057  1.00 0.00 ? 75  ASN A CB   1  
ATOM 352   C CG   . ASN A 1 52  ? -19.342 7.729   0.364   1.00 0.00 ? 75  ASN A CG   1  
ATOM 353   O OD1  . ASN A 1 52  ? -20.009 7.091   1.178   1.00 0.00 ? 75  ASN A OD1  1  
ATOM 354   N ND2  . ASN A 1 52  ? -19.785 8.865   -0.134  1.00 0.00 ? 75  ASN A ND2  1  
ATOM 355   H H    . ASN A 1 52  ? -17.473 7.915   -2.529  1.00 0.00 ? 75  ASN A H    1  
ATOM 356   H HA   . ASN A 1 52  ? -17.056 5.576   -0.970  1.00 0.00 ? 75  ASN A HA   1  
ATOM 357   H HB2  . ASN A 1 52  ? -17.518 6.789   0.811   1.00 0.00 ? 75  ASN A HB2  1  
ATOM 358   H HB3  . ASN A 1 52  ? -17.333 8.152   -0.264  1.00 0.00 ? 75  ASN A HB3  1  
ATOM 359   H HD21 . ASN A 1 52  ? -19.184 9.400   -0.751  1.00 0.00 ? 75  ASN A HD21 1  
ATOM 360   H HD22 . ASN A 1 52  ? -20.662 9.258   0.202   1.00 0.00 ? 75  ASN A HD22 1  
ATOM 361   N N    . ARG A 1 53  ? -20.151 5.933   -2.052  1.00 0.00 ? 76  ARG A N    1  
ATOM 362   C CA   . ARG A 1 53  ? -21.386 5.194   -2.277  1.00 0.00 ? 76  ARG A CA   1  
ATOM 363   C C    . ARG A 1 53  ? -21.121 3.943   -3.106  1.00 0.00 ? 76  ARG A C    1  
ATOM 364   O O    . ARG A 1 53  ? -21.675 2.898   -2.762  1.00 0.00 ? 76  ARG A O    1  
ATOM 365   C CB   . ARG A 1 53  ? -22.427 6.117   -2.925  1.00 0.00 ? 76  ARG A CB   1  
ATOM 366   C CG   . ARG A 1 53  ? -23.076 7.048   -1.881  1.00 0.00 ? 76  ARG A CG   1  
ATOM 367   C CD   . ARG A 1 53  ? -24.305 6.414   -1.196  1.00 0.00 ? 76  ARG A CD   1  
ATOM 368   N NE   . ARG A 1 53  ? -25.467 6.330   -2.106  1.00 0.00 ? 76  ARG A NE   1  
ATOM 369   C CZ   . ARG A 1 53  ? -26.165 7.383   -2.562  1.00 0.00 ? 76  ARG A CZ   1  
ATOM 370   N NH1  . ARG A 1 53  ? -26.009 8.592   -2.039  1.00 0.00 ? 76  ARG A NH1  1  
ATOM 371   N NH2  . ARG A 1 53  ? -27.042 7.248   -3.547  1.00 0.00 ? 76  ARG A NH2  1  
ATOM 372   H H    . ARG A 1 53  ? -20.056 6.873   -2.430  1.00 0.00 ? 76  ARG A H    1  
ATOM 373   H HA   . ARG A 1 53  ? -21.757 4.860   -1.303  1.00 0.00 ? 76  ARG A HA   1  
ATOM 374   H HB2  . ARG A 1 53  ? -21.939 6.716   -3.697  1.00 0.00 ? 76  ARG A HB2  1  
ATOM 375   H HB3  . ARG A 1 53  ? -23.192 5.515   -3.414  1.00 0.00 ? 76  ARG A HB3  1  
ATOM 376   H HG2  . ARG A 1 53  ? -22.341 7.311   -1.117  1.00 0.00 ? 76  ARG A HG2  1  
ATOM 377   H HG3  . ARG A 1 53  ? -23.366 7.972   -2.381  1.00 0.00 ? 76  ARG A HG3  1  
ATOM 378   H HD2  . ARG A 1 53  ? -24.052 5.411   -0.843  1.00 0.00 ? 76  ARG A HD2  1  
ATOM 379   H HD3  . ARG A 1 53  ? -24.575 7.023   -0.331  1.00 0.00 ? 76  ARG A HD3  1  
ATOM 380   H HE   . ARG A 1 53  ? -25.718 5.392   -2.422  1.00 0.00 ? 76  ARG A HE   1  
ATOM 381   H HH11 . ARG A 1 53  ? -25.565 8.722   -1.134  1.00 0.00 ? 76  ARG A HH11 1  
ATOM 382   H HH12 . ARG A 1 53  ? -26.466 9.398   -2.467  1.00 0.00 ? 76  ARG A HH12 1  
ATOM 383   H HH21 . ARG A 1 53  ? -27.326 6.361   -3.955  1.00 0.00 ? 76  ARG A HH21 1  
ATOM 384   H HH22 . ARG A 1 53  ? -27.508 8.096   -3.890  1.00 0.00 ? 76  ARG A HH22 1  
ATOM 385   N N    . TYR A 1 54  ? -20.309 4.005   -4.168  1.00 0.00 ? 77  TYR A N    1  
ATOM 386   C CA   . TYR A 1 54  ? -20.004 2.806   -4.948  1.00 0.00 ? 77  TYR A CA   1  
ATOM 387   C C    . TYR A 1 54  ? -19.197 1.819   -4.110  1.00 0.00 ? 77  TYR A C    1  
ATOM 388   O O    . TYR A 1 54  ? -19.436 0.619   -4.200  1.00 0.00 ? 77  TYR A O    1  
ATOM 389   C CB   . TYR A 1 54  ? -19.281 3.160   -6.260  1.00 0.00 ? 77  TYR A CB   1  
ATOM 390   C CG   . TYR A 1 54  ? -19.515 2.196   -7.416  1.00 0.00 ? 77  TYR A CG   1  
ATOM 391   C CD1  . TYR A 1 54  ? -20.834 1.904   -7.808  1.00 0.00 ? 77  TYR A CD1  1  
ATOM 392   C CD2  . TYR A 1 54  ? -18.444 1.731   -8.209  1.00 0.00 ? 77  TYR A CD2  1  
ATOM 393   C CE1  . TYR A 1 54  ? -21.072 1.115   -8.942  1.00 0.00 ? 77  TYR A CE1  1  
ATOM 394   C CE2  . TYR A 1 54  ? -18.683 1.077   -9.434  1.00 0.00 ? 77  TYR A CE2  1  
ATOM 395   C CZ   . TYR A 1 54  ? -19.999 0.667   -9.744  1.00 0.00 ? 77  TYR A CZ   1  
ATOM 396   O OH   . TYR A 1 54  ? -20.241 -0.119  -10.824 1.00 0.00 ? 77  TYR A OH   1  
ATOM 397   H H    . TYR A 1 54  ? -19.893 4.887   -4.449  1.00 0.00 ? 77  TYR A H    1  
ATOM 398   H HA   . TYR A 1 54  ? -20.957 2.329   -5.182  1.00 0.00 ? 77  TYR A HA   1  
ATOM 399   H HB2  . TYR A 1 54  ? -19.642 4.130   -6.600  1.00 0.00 ? 77  TYR A HB2  1  
ATOM 400   H HB3  . TYR A 1 54  ? -18.213 3.267   -6.063  1.00 0.00 ? 77  TYR A HB3  1  
ATOM 401   H HD1  . TYR A 1 54  ? -21.677 2.296   -7.254  1.00 0.00 ? 77  TYR A HD1  1  
ATOM 402   H HD2  . TYR A 1 54  ? -17.426 1.950   -7.929  1.00 0.00 ? 77  TYR A HD2  1  
ATOM 403   H HE1  . TYR A 1 54  ? -22.091 0.899   -9.227  1.00 0.00 ? 77  TYR A HE1  1  
ATOM 404   H HE2  . TYR A 1 54  ? -17.886 0.945   -10.166 1.00 0.00 ? 77  TYR A HE2  1  
ATOM 405   H HH   . TYR A 1 54  ? -21.117 -0.533  -10.771 1.00 0.00 ? 77  TYR A HH   1  
ATOM 406   N N    . TYR A 1 55  ? -18.281 2.302   -3.257  1.00 0.00 ? 78  TYR A N    1  
ATOM 407   C CA   . TYR A 1 55  ? -17.511 1.451   -2.357  1.00 0.00 ? 78  TYR A CA   1  
ATOM 408   C C    . TYR A 1 55  ? -18.476 0.635   -1.501  1.00 0.00 ? 78  TYR A C    1  
ATOM 409   O O    . TYR A 1 55  ? -18.430 -0.591  -1.542  1.00 0.00 ? 78  TYR A O    1  
ATOM 410   C CB   . TYR A 1 55  ? -16.570 2.282   -1.470  1.00 0.00 ? 78  TYR A CB   1  
ATOM 411   C CG   . TYR A 1 55  ? -15.440 1.561   -0.756  1.00 0.00 ? 78  TYR A CG   1  
ATOM 412   C CD1  . TYR A 1 55  ? -15.192 0.185   -0.925  1.00 0.00 ? 78  TYR A CD1  1  
ATOM 413   C CD2  . TYR A 1 55  ? -14.679 2.282   0.179   1.00 0.00 ? 78  TYR A CD2  1  
ATOM 414   C CE1  . TYR A 1 55  ? -14.238 -0.474  -0.128  1.00 0.00 ? 78  TYR A CE1  1  
ATOM 415   C CE2  . TYR A 1 55  ? -13.707 1.629   0.951   1.00 0.00 ? 78  TYR A CE2  1  
ATOM 416   C CZ   . TYR A 1 55  ? -13.469 0.254   0.796   1.00 0.00 ? 78  TYR A CZ   1  
ATOM 417   O OH   . TYR A 1 55  ? -12.534 -0.364  1.565   1.00 0.00 ? 78  TYR A OH   1  
ATOM 418   H H    . TYR A 1 55  ? -18.126 3.308   -3.216  1.00 0.00 ? 78  TYR A H    1  
ATOM 419   H HA   . TYR A 1 55  ? -16.921 0.774   -2.973  1.00 0.00 ? 78  TYR A HA   1  
ATOM 420   H HB2  . TYR A 1 55  ? -16.135 3.094   -2.057  1.00 0.00 ? 78  TYR A HB2  1  
ATOM 421   H HB3  . TYR A 1 55  ? -17.186 2.696   -0.673  1.00 0.00 ? 78  TYR A HB3  1  
ATOM 422   H HD1  . TYR A 1 55  ? -15.768 -0.383  -1.629  1.00 0.00 ? 78  TYR A HD1  1  
ATOM 423   H HD2  . TYR A 1 55  ? -14.842 3.341   0.322   1.00 0.00 ? 78  TYR A HD2  1  
ATOM 424   H HE1  . TYR A 1 55  ? -14.128 -1.542  -0.153  1.00 0.00 ? 78  TYR A HE1  1  
ATOM 425   H HE2  . TYR A 1 55  ? -13.170 2.158   1.718   1.00 0.00 ? 78  TYR A HE2  1  
ATOM 426   H HH   . TYR A 1 55  ? -12.281 -1.247  1.240   1.00 0.00 ? 78  TYR A HH   1  
ATOM 427   N N    . GLU A 1 56  ? -19.393 1.301   -0.793  1.00 0.00 ? 79  GLU A N    1  
ATOM 428   C CA   . GLU A 1 56  ? -20.394 0.676   0.070   1.00 0.00 ? 79  GLU A CA   1  
ATOM 429   C C    . GLU A 1 56  ? -21.221 -0.381  -0.654  1.00 0.00 ? 79  GLU A C    1  
ATOM 430   O O    . GLU A 1 56  ? -21.696 -1.336  -0.031  1.00 0.00 ? 79  GLU A O    1  
ATOM 431   C CB   . GLU A 1 56  ? -21.332 1.755   0.619   1.00 0.00 ? 79  GLU A CB   1  
ATOM 432   C CG   . GLU A 1 56  ? -20.641 2.570   1.717   1.00 0.00 ? 79  GLU A CG   1  
ATOM 433   C CD   . GLU A 1 56  ? -21.372 2.413   3.053   1.00 0.00 ? 79  GLU A CD   1  
ATOM 434   O OE1  . GLU A 1 56  ? -21.234 1.332   3.670   1.00 0.00 ? 79  GLU A OE1  1  
ATOM 435   O OE2  . GLU A 1 56  ? -22.123 3.320   3.474   1.00 0.00 ? 79  GLU A OE2  1  
ATOM 436   H H    . GLU A 1 56  ? -19.383 2.318   -0.842  1.00 0.00 ? 79  GLU A H    1  
ATOM 437   H HA   . GLU A 1 56  ? -19.885 0.197   0.904   1.00 0.00 ? 79  GLU A HA   1  
ATOM 438   H HB2  . GLU A 1 56  ? -21.637 2.434   -0.185  1.00 0.00 ? 79  GLU A HB2  1  
ATOM 439   H HB3  . GLU A 1 56  ? -22.228 1.281   1.025   1.00 0.00 ? 79  GLU A HB3  1  
ATOM 440   H HG2  . GLU A 1 56  ? -19.586 2.287   1.841   1.00 0.00 ? 79  GLU A HG2  1  
ATOM 441   H HG3  . GLU A 1 56  ? -20.666 3.606   1.418   1.00 0.00 ? 79  GLU A HG3  1  
ATOM 442   N N    . ALA A 1 57  ? -21.351 -0.255  -1.972  1.00 0.00 ? 80  ALA A N    1  
ATOM 443   C CA   . ALA A 1 57  ? -22.100 -1.224  -2.736  1.00 0.00 ? 80  ALA A CA   1  
ATOM 444   C C    . ALA A 1 57  ? -21.349 -2.539  -2.964  1.00 0.00 ? 80  ALA A C    1  
ATOM 445   O O    . ALA A 1 57  ? -22.003 -3.582  -2.972  1.00 0.00 ? 80  ALA A O    1  
ATOM 446   C CB   . ALA A 1 57  ? -22.564 -0.602  -4.057  1.00 0.00 ? 80  ALA A CB   1  
ATOM 447   H H    . ALA A 1 57  ? -20.943 0.557   -2.422  1.00 0.00 ? 80  ALA A H    1  
ATOM 448   H HA   . ALA A 1 57  ? -22.961 -1.470  -2.122  1.00 0.00 ? 80  ALA A HA   1  
ATOM 449   H HB1  . ALA A 1 57  ? -23.085 0.343   -3.867  1.00 0.00 ? 80  ALA A HB1  1  
ATOM 450   H HB2  . ALA A 1 57  ? -21.701 -0.426  -4.703  1.00 0.00 ? 80  ALA A HB2  1  
ATOM 451   H HB3  . ALA A 1 57  ? -23.246 -1.290  -4.558  1.00 0.00 ? 80  ALA A HB3  1  
ATOM 452   N N    . ASN A 1 58  ? -20.019 -2.531  -3.115  1.00 0.00 ? 81  ASN A N    1  
ATOM 453   C CA   . ASN A 1 58  ? -19.234 -3.694  -3.568  1.00 0.00 ? 81  ASN A CA   1  
ATOM 454   C C    . ASN A 1 58  ? -17.802 -3.708  -3.014  1.00 0.00 ? 81  ASN A C    1  
ATOM 455   O O    . ASN A 1 58  ? -16.836 -4.006  -3.716  1.00 0.00 ? 81  ASN A O    1  
ATOM 456   C CB   . ASN A 1 58  ? -19.282 -3.796  -5.109  1.00 0.00 ? 81  ASN A CB   1  
ATOM 457   C CG   . ASN A 1 58  ? -18.965 -2.512  -5.875  1.00 0.00 ? 81  ASN A CG   1  
ATOM 458   O OD1  . ASN A 1 58  ? -19.598 -2.228  -6.888  1.00 0.00 ? 81  ASN A OD1  1  
ATOM 459   N ND2  . ASN A 1 58  ? -18.017 -1.710  -5.429  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 460   H H    . ASN A 1 58  ? -19.552 -1.632  -3.019  1.00 0.00 ? 81  ASN A H    1  
ATOM 461   H HA   . ASN A 1 58  ? -19.698 -4.599  -3.179  1.00 0.00 ? 81  ASN A HA   1  
ATOM 462   H HB2  . ASN A 1 58  ? -18.618 -4.589  -5.451  1.00 0.00 ? 81  ASN A HB2  1  
ATOM 463   H HB3  . ASN A 1 58  ? -20.288 -4.104  -5.392  1.00 0.00 ? 81  ASN A HB3  1  
ATOM 464   H HD21 . ASN A 1 58  ? -17.536 -1.903  -4.573  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 465   H HD22 . ASN A 1 58  ? -17.879 -0.817  -5.891  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 466   N N    . TYR A 1 59  ? -17.642 -3.360  -1.744  1.00 0.00 ? 82  TYR A N    1  
ATOM 467   C CA   . TYR A 1 59  ? -16.365 -3.130  -1.068  1.00 0.00 ? 82  TYR A CA   1  
ATOM 468   C C    . TYR A 1 59  ? -15.497 -4.373  -0.884  1.00 0.00 ? 82  TYR A C    1  
ATOM 469   O O    . TYR A 1 59  ? -14.269 -4.257  -0.802  1.00 0.00 ? 82  TYR A O    1  
ATOM 470   C CB   . TYR A 1 59  ? -16.674 -2.539  0.310   1.00 0.00 ? 82  TYR A CB   1  
ATOM 471   C CG   . TYR A 1 59  ? -17.732 -3.319  1.045   1.00 0.00 ? 82  TYR A CG   1  
ATOM 472   C CD1  . TYR A 1 59  ? -17.354 -4.435  1.810   1.00 0.00 ? 82  TYR A CD1  1  
ATOM 473   C CD2  . TYR A 1 59  ? -19.077 -2.917  0.959   1.00 0.00 ? 82  TYR A CD2  1  
ATOM 474   C CE1  . TYR A 1 59  ? -18.328 -5.235  2.420   1.00 0.00 ? 82  TYR A CE1  1  
ATOM 475   C CE2  . TYR A 1 59  ? -20.060 -3.712  1.573   1.00 0.00 ? 82  TYR A CE2  1  
ATOM 476   C CZ   . TYR A 1 59  ? -19.684 -4.866  2.302   1.00 0.00 ? 82  TYR A CZ   1  
ATOM 477   O OH   . TYR A 1 59  ? -20.617 -5.613  2.936   1.00 0.00 ? 82  TYR A OH   1  
ATOM 478   H H    . TYR A 1 59  ? -18.476 -3.084  -1.241  1.00 0.00 ? 82  TYR A H    1  
ATOM 479   H HA   . TYR A 1 59  ? -15.785 -2.431  -1.659  1.00 0.00 ? 82  TYR A HA   1  
ATOM 480   H HB2  . TYR A 1 59  ? -15.769 -2.521  0.911   1.00 0.00 ? 82  TYR A HB2  1  
ATOM 481   H HB3  . TYR A 1 59  ? -17.009 -1.512  0.205   1.00 0.00 ? 82  TYR A HB3  1  
ATOM 482   H HD1  . TYR A 1 59  ? -16.305 -4.655  1.933   1.00 0.00 ? 82  TYR A HD1  1  
ATOM 483   H HD2  . TYR A 1 59  ? -19.333 -1.984  0.451   1.00 0.00 ? 82  TYR A HD2  1  
ATOM 484   H HE1  . TYR A 1 59  ? -18.045 -6.127  2.969   1.00 0.00 ? 82  TYR A HE1  1  
ATOM 485   H HE2  . TYR A 1 59  ? -21.105 -3.448  1.486   1.00 0.00 ? 82  TYR A HE2  1  
ATOM 486   H HH   . TYR A 1 59  ? -20.801 -5.258  3.825   1.00 0.00 ? 82  TYR A HH   1  
ATOM 487   N N    . TRP A 1 60  ? -16.106 -5.557  -0.808  1.00 0.00 ? 83  TRP A N    1  
ATOM 488   C CA   . TRP A 1 60  ? -15.424 -6.838  -0.661  1.00 0.00 ? 83  TRP A CA   1  
ATOM 489   C C    . TRP A 1 60  ? -14.501 -7.117  -1.851  1.00 0.00 ? 83  TRP A C    1  
ATOM 490   O O    . TRP A 1 60  ? -13.634 -7.979  -1.758  1.00 0.00 ? 83  TRP A O    1  
ATOM 491   C CB   . TRP A 1 60  ? -16.464 -7.936  -0.454  1.00 0.00 ? 83  TRP A CB   1  
ATOM 492   C CG   . TRP A 1 60  ? -17.458 -8.053  -1.562  1.00 0.00 ? 83  TRP A CG   1  
ATOM 493   C CD1  . TRP A 1 60  ? -18.555 -7.286  -1.736  1.00 0.00 ? 83  TRP A CD1  1  
ATOM 494   C CD2  . TRP A 1 60  ? -17.463 -9.023  -2.640  1.00 0.00 ? 83  TRP A CD2  1  
ATOM 495   N NE1  . TRP A 1 60  ? -19.233 -7.727  -2.849  1.00 0.00 ? 83  TRP A NE1  1  
ATOM 496   C CE2  . TRP A 1 60  ? -18.600 -8.791  -3.461  1.00 0.00 ? 83  TRP A CE2  1  
ATOM 497   C CE3  . TRP A 1 60  ? -16.608 -10.080 -2.996  1.00 0.00 ? 83  TRP A CE3  1  
ATOM 498   C CZ2  . TRP A 1 60  ? -18.882 -9.563  -4.597  1.00 0.00 ? 83  TRP A CZ2  1  
ATOM 499   C CZ3  . TRP A 1 60  ? -16.904 -10.894 -4.110  1.00 0.00 ? 83  TRP A CZ3  1  
ATOM 500   C CH2  . TRP A 1 60  ? -18.035 -10.640 -4.908  1.00 0.00 ? 83  TRP A CH2  1  
ATOM 501   H H    . TRP A 1 60  ? -17.110 -5.597  -0.878  1.00 0.00 ? 83  TRP A H    1  
ATOM 502   H HA   . TRP A 1 60  ? -14.810 -6.832  0.226   1.00 0.00 ? 83  TRP A HA   1  
ATOM 503   H HB2  . TRP A 1 60  ? -15.933 -8.882  -0.338  1.00 0.00 ? 83  TRP A HB2  1  
ATOM 504   H HB3  . TRP A 1 60  ? -16.982 -7.750  0.489   1.00 0.00 ? 83  TRP A HB3  1  
ATOM 505   H HD1  . TRP A 1 60  ? -18.892 -6.494  -1.075  1.00 0.00 ? 83  TRP A HD1  1  
ATOM 506   H HE1  . TRP A 1 60  ? -20.114 -7.299  -3.122  1.00 0.00 ? 83  TRP A HE1  1  
ATOM 507   H HE3  . TRP A 1 60  ? -15.745 -10.281 -2.366  1.00 0.00 ? 83  TRP A HE3  1  
ATOM 508   H HZ2  . TRP A 1 60  ? -19.778 -9.361  -5.174  1.00 0.00 ? 83  TRP A HZ2  1  
ATOM 509   H HZ3  . TRP A 1 60  ? -16.280 -11.738 -4.362  1.00 0.00 ? 83  TRP A HZ3  1  
ATOM 510   H HH2  . TRP A 1 60  ? -18.283 -11.273 -5.751  1.00 0.00 ? 83  TRP A HH2  1  
ATOM 511   N N    . GLN A 1 61  ? -14.626 -6.351  -2.940  1.00 0.00 ? 84  GLN A N    1  
ATOM 512   C CA   . GLN A 1 61  ? -13.830 -6.506  -4.143  1.00 0.00 ? 84  GLN A CA   1  
ATOM 513   C C    . GLN A 1 61  ? -12.492 -5.742  -4.047  1.00 0.00 ? 84  GLN A C    1  
ATOM 514   O O    . GLN A 1 61  ? -11.641 -5.922  -4.910  1.00 0.00 ? 84  GLN A O    1  
ATOM 515   C CB   . GLN A 1 61  ? -14.692 -6.166  -5.375  1.00 0.00 ? 84  GLN A CB   1  
ATOM 516   C CG   . GLN A 1 61  ? -16.036 -6.951  -5.408  1.00 0.00 ? 84  GLN A CG   1  
ATOM 517   C CD   . GLN A 1 61  ? -16.210 -7.854  -6.639  1.00 0.00 ? 84  GLN A CD   1  
ATOM 518   O OE1  . GLN A 1 61  ? -15.354 -8.693  -6.932  1.00 0.00 ? 84  GLN A OE1  1  
ATOM 519   N NE2  . GLN A 1 61  ? -17.337 -7.805  -7.328  1.00 0.00 ? 84  GLN A NE2  1  
ATOM 520   H H    . GLN A 1 61  ? -15.391 -5.693  -2.978  1.00 0.00 ? 84  GLN A H    1  
ATOM 521   H HA   . GLN A 1 61  ? -13.589 -7.552  -4.255  1.00 0.00 ? 84  GLN A HA   1  
ATOM 522   H HB2  . GLN A 1 61  ? -14.909 -5.100  -5.372  1.00 0.00 ? 84  GLN A HB2  1  
ATOM 523   H HB3  . GLN A 1 61  ? -14.117 -6.383  -6.279  1.00 0.00 ? 84  GLN A HB3  1  
ATOM 524   H HG2  . GLN A 1 61  ? -16.110 -7.617  -4.556  1.00 0.00 ? 84  GLN A HG2  1  
ATOM 525   H HG3  . GLN A 1 61  ? -16.866 -6.247  -5.299  1.00 0.00 ? 84  GLN A HG3  1  
ATOM 526   H HE21 . GLN A 1 61  ? -18.147 -7.248  -7.045  1.00 0.00 ? 84  GLN A HE21 1  
ATOM 527   H HE22 . GLN A 1 61  ? -17.414 -8.322  -8.188  1.00 0.00 ? 84  GLN A HE22 1  
ATOM 528   N N    . PHE A 1 62  ? -12.256 -4.960  -2.980  1.00 0.00 ? 85  PHE A N    1  
ATOM 529   C CA   . PHE A 1 62  ? -11.136 -4.013  -2.861  1.00 0.00 ? 85  PHE A CA   1  
ATOM 530   C C    . PHE A 1 62  ? -10.115 -4.444  -1.778  1.00 0.00 ? 85  PHE A C    1  
ATOM 531   O O    . PHE A 1 62  ? -10.448 -5.295  -0.946  1.00 0.00 ? 85  PHE A O    1  
ATOM 532   C CB   . PHE A 1 62  ? -11.721 -2.624  -2.551  1.00 0.00 ? 85  PHE A CB   1  
ATOM 533   C CG   . PHE A 1 62  ? -12.497 -1.974  -3.678  1.00 0.00 ? 85  PHE A CG   1  
ATOM 534   C CD1  . PHE A 1 62  ? -13.770 -2.456  -4.045  1.00 0.00 ? 85  PHE A CD1  1  
ATOM 535   C CD2  . PHE A 1 62  ? -11.949 -0.872  -4.359  1.00 0.00 ? 85  PHE A CD2  1  
ATOM 536   C CE1  . PHE A 1 62  ? -14.491 -1.824  -5.070  1.00 0.00 ? 85  PHE A CE1  1  
ATOM 537   C CE2  . PHE A 1 62  ? -12.672 -0.247  -5.386  1.00 0.00 ? 85  PHE A CE2  1  
ATOM 538   C CZ   . PHE A 1 62  ? -13.944 -0.717  -5.735  1.00 0.00 ? 85  PHE A CZ   1  
ATOM 539   H H    . PHE A 1 62  ? -12.960 -4.923  -2.254  1.00 0.00 ? 85  PHE A H    1  
ATOM 540   H HA   . PHE A 1 62  ? -10.621 -3.953  -3.821  1.00 0.00 ? 85  PHE A HA   1  
ATOM 541   H HB2  . PHE A 1 62  ? -12.388 -2.702  -1.701  1.00 0.00 ? 85  PHE A HB2  1  
ATOM 542   H HB3  . PHE A 1 62  ? -10.924 -1.949  -2.246  1.00 0.00 ? 85  PHE A HB3  1  
ATOM 543   H HD1  . PHE A 1 62  ? -14.198 -3.324  -3.565  1.00 0.00 ? 85  PHE A HD1  1  
ATOM 544   H HD2  . PHE A 1 62  ? -10.967 -0.503  -4.107  1.00 0.00 ? 85  PHE A HD2  1  
ATOM 545   H HE1  . PHE A 1 62  ? -15.452 -2.205  -5.368  1.00 0.00 ? 85  PHE A HE1  1  
ATOM 546   H HE2  . PHE A 1 62  ? -12.247 0.587   -5.919  1.00 0.00 ? 85  PHE A HE2  1  
ATOM 547   H HZ   . PHE A 1 62  ? -14.489 -0.229  -6.527  1.00 0.00 ? 85  PHE A HZ   1  
ATOM 548   N N    . PRO A 1 63  ? -8.880  -3.893  -1.769  1.00 0.00 ? 86  PRO A N    1  
ATOM 549   C CA   . PRO A 1 63  ? -7.836  -4.213  -0.790  1.00 0.00 ? 86  PRO A CA   1  
ATOM 550   C C    . PRO A 1 63  ? -8.051  -3.598  0.602   1.00 0.00 ? 86  PRO A C    1  
ATOM 551   O O    . PRO A 1 63  ? -8.903  -2.737  0.798   1.00 0.00 ? 86  PRO A O    1  
ATOM 552   C CB   . PRO A 1 63  ? -6.514  -3.734  -1.395  1.00 0.00 ? 86  PRO A CB   1  
ATOM 553   C CG   . PRO A 1 63  ? -6.926  -2.648  -2.376  1.00 0.00 ? 86  PRO A CG   1  
ATOM 554   C CD   . PRO A 1 63  ? -8.321  -3.067  -2.829  1.00 0.00 ? 86  PRO A CD   1  
ATOM 555   H HA   . PRO A 1 63  ? -7.784  -5.290  -0.695  1.00 0.00 ? 86  PRO A HA   1  
ATOM 556   H HB2  . PRO A 1 63  ? -5.820  -3.349  -0.646  1.00 0.00 ? 86  PRO A HB2  1  
ATOM 557   H HB3  . PRO A 1 63  ? -6.052  -4.554  -1.931  1.00 0.00 ? 86  PRO A HB3  1  
ATOM 558   H HG2  . PRO A 1 63  ? -6.980  -1.697  -1.855  1.00 0.00 ? 86  PRO A HG2  1  
ATOM 559   H HG3  . PRO A 1 63  ? -6.236  -2.583  -3.214  1.00 0.00 ? 86  PRO A HG3  1  
ATOM 560   H HD2  . PRO A 1 63  ? -8.924  -2.182  -3.016  1.00 0.00 ? 86  PRO A HD2  1  
ATOM 561   H HD3  . PRO A 1 63  ? -8.245  -3.659  -3.739  1.00 0.00 ? 86  PRO A HD3  1  
ATOM 562   N N    . ASP A 1 64  ? -7.262  -4.066  1.577   1.00 0.00 ? 87  ASP A N    1  
ATOM 563   C CA   . ASP A 1 64  ? -7.130  -3.539  2.948   1.00 0.00 ? 87  ASP A CA   1  
ATOM 564   C C    . ASP A 1 64  ? -5.856  -2.697  3.069   1.00 0.00 ? 87  ASP A C    1  
ATOM 565   O O    . ASP A 1 64  ? -5.841  -1.688  3.764   1.00 0.00 ? 87  ASP A O    1  
ATOM 566   C CB   . ASP A 1 64  ? -7.058  -4.720  3.930   1.00 0.00 ? 87  ASP A CB   1  
ATOM 567   C CG   . ASP A 1 64  ? -6.500  -4.356  5.317   1.00 0.00 ? 87  ASP A CG   1  
ATOM 568   O OD1  . ASP A 1 64  ? -7.129  -3.549  6.029   1.00 0.00 ? 87  ASP A OD1  1  
ATOM 569   O OD2  . ASP A 1 64  ? -5.507  -4.979  5.748   1.00 0.00 ? 87  ASP A OD2  1  
ATOM 570   H H    . ASP A 1 64  ? -6.600  -4.783  1.347   1.00 0.00 ? 87  ASP A H    1  
ATOM 571   H HA   . ASP A 1 64  ? -7.985  -2.920  3.216   1.00 0.00 ? 87  ASP A HA   1  
ATOM 572   H HB2  . ASP A 1 64  ? -8.055  -5.149  4.049   1.00 0.00 ? 87  ASP A HB2  1  
ATOM 573   H HB3  . ASP A 1 64  ? -6.420  -5.483  3.493   1.00 0.00 ? 87  ASP A HB3  1  
ATOM 574   N N    . GLY A 1 65  ? -4.812  -3.091  2.341   1.00 0.00 ? 88  GLY A N    1  
ATOM 575   C CA   . GLY A 1 65  ? -3.476  -2.535  2.334   1.00 0.00 ? 88  GLY A CA   1  
ATOM 576   C C    . GLY A 1 65  ? -2.675  -3.267  1.255   1.00 0.00 ? 88  GLY A C    1  
ATOM 577   O O    . GLY A 1 65  ? -3.238  -4.076  0.498   1.00 0.00 ? 88  GLY A O    1  
ATOM 578   H H    . GLY A 1 65  ? -4.891  -3.905  1.758   1.00 0.00 ? 88  GLY A H    1  
ATOM 579   H HA2  . GLY A 1 65  ? -3.506  -1.466  2.131   1.00 0.00 ? 88  GLY A HA2  1  
ATOM 580   H HA3  . GLY A 1 65  ? -3.020  -2.690  3.309   1.00 0.00 ? 88  GLY A HA3  1  
ATOM 581   N N    . ILE A 1 66  ? -1.377  -2.977  1.173   1.00 0.00 ? 89  ILE A N    1  
ATOM 582   C CA   . ILE A 1 66  ? -0.429  -3.489  0.184   1.00 0.00 ? 89  ILE A CA   1  
ATOM 583   C C    . ILE A 1 66  ? 0.765   -4.101  0.951   1.00 0.00 ? 89  ILE A C    1  
ATOM 584   O O    . ILE A 1 66  ? 0.892   -3.887  2.162   1.00 0.00 ? 89  ILE A O    1  
ATOM 585   C CB   . ILE A 1 66  ? -0.085  -2.311  -0.776  1.00 0.00 ? 89  ILE A CB   1  
ATOM 586   C CG1  . ILE A 1 66  ? -1.330  -1.765  -1.519  1.00 0.00 ? 89  ILE A CG1  1  
ATOM 587   C CG2  . ILE A 1 66  ? 1.015   -2.605  -1.807  1.00 0.00 ? 89  ILE A CG2  1  
ATOM 588   C CD1  . ILE A 1 66  ? -2.000  -2.749  -2.482  1.00 0.00 ? 89  ILE A CD1  1  
ATOM 589   H H    . ILE A 1 66  ? -0.975  -2.315  1.826   1.00 0.00 ? 89  ILE A H    1  
ATOM 590   H HA   . ILE A 1 66  ? -0.901  -4.288  -0.386  1.00 0.00 ? 89  ILE A HA   1  
ATOM 591   H HB   . ILE A 1 66  ? 0.291   -1.491  -0.167  1.00 0.00 ? 89  ILE A HB   1  
ATOM 592   H HG12 . ILE A 1 66  ? -2.072  -1.426  -0.799  1.00 0.00 ? 89  ILE A HG12 1  
ATOM 593   H HG13 . ILE A 1 66  ? -1.040  -0.886  -2.092  1.00 0.00 ? 89  ILE A HG13 1  
ATOM 594   H HG21 . ILE A 1 66  ? 1.023   -1.831  -2.582  1.00 0.00 ? 89  ILE A HG21 1  
ATOM 595   H HG22 . ILE A 1 66  ? 1.989   -2.578  -1.322  1.00 0.00 ? 89  ILE A HG22 1  
ATOM 596   H HG23 . ILE A 1 66  ? 0.845   -3.577  -2.266  1.00 0.00 ? 89  ILE A HG23 1  
ATOM 597   H HD11 . ILE A 1 66  ? -2.325  -3.642  -1.954  1.00 0.00 ? 89  ILE A HD11 1  
ATOM 598   H HD12 . ILE A 1 66  ? -2.876  -2.276  -2.923  1.00 0.00 ? 89  ILE A HD12 1  
ATOM 599   H HD13 . ILE A 1 66  ? -1.311  -3.028  -3.279  1.00 0.00 ? 89  ILE A HD13 1  
ATOM 600   N N    . HIS A 1 67  ? 1.650   -4.857  0.286   1.00 0.00 ? 90  HIS A N    1  
ATOM 601   C CA   . HIS A 1 67  ? 2.850   -5.472  0.873   1.00 0.00 ? 90  HIS A CA   1  
ATOM 602   C C    . HIS A 1 67  ? 4.090   -5.051  0.055   1.00 0.00 ? 90  HIS A C    1  
ATOM 603   O O    . HIS A 1 67  ? 4.919   -5.866  -0.353  1.00 0.00 ? 90  HIS A O    1  
ATOM 604   C CB   . HIS A 1 67  ? 2.749   -7.015  1.035   1.00 0.00 ? 90  HIS A CB   1  
ATOM 605   C CG   . HIS A 1 67  ? 1.422   -7.748  1.028   1.00 0.00 ? 90  HIS A CG   1  
ATOM 606   N ND1  . HIS A 1 67  ? 0.262   -7.475  0.311   1.00 0.00 ? 90  HIS A ND1  1  
ATOM 607   C CD2  . HIS A 1 67  ? 1.285   -8.998  1.569   1.00 0.00 ? 90  HIS A CD2  1  
ATOM 608   C CE1  . HIS A 1 67  ? -0.566  -8.524  0.474   1.00 0.00 ? 90  HIS A CE1  1  
ATOM 609   N NE2  . HIS A 1 67  ? 0.009   -9.460  1.248   1.00 0.00 ? 90  HIS A NE2  1  
ATOM 610   H H    . HIS A 1 67  ? 1.541   -5.023  -0.709  1.00 0.00 ? 90  HIS A H    1  
ATOM 611   H HA   . HIS A 1 67  ? 2.988   -5.061  1.875   1.00 0.00 ? 90  HIS A HA   1  
ATOM 612   H HB2  . HIS A 1 67  ? 3.343   -7.517  0.274   1.00 0.00 ? 90  HIS A HB2  1  
ATOM 613   H HB3  . HIS A 1 67  ? 3.249   -7.242  1.975   1.00 0.00 ? 90  HIS A HB3  1  
ATOM 614   H HD1  . HIS A 1 67  ? 0.056   -6.689  -0.304  1.00 0.00 ? 90  HIS A HD1  1  
ATOM 615   H HD2  . HIS A 1 67  ? 2.058   -9.561  2.079   1.00 0.00 ? 90  HIS A HD2  1  
ATOM 616   H HE1  . HIS A 1 67  ? -1.554  -8.614  0.034   1.00 0.00 ? 90  HIS A HE1  1  
ATOM 617   N N    . TYR A 1 68  ? 4.216   -3.759  -0.246  1.00 0.00 ? 91  TYR A N    1  
ATOM 618   C CA   . TYR A 1 68  ? 5.256   -3.200  -1.110  1.00 0.00 ? 91  TYR A CA   1  
ATOM 619   C C    . TYR A 1 68  ? 6.577   -3.031  -0.329  1.00 0.00 ? 91  TYR A C    1  
ATOM 620   O O    . TYR A 1 68  ? 7.225   -1.989  -0.381  1.00 0.00 ? 91  TYR A O    1  
ATOM 621   C CB   . TYR A 1 68  ? 4.704   -1.905  -1.730  1.00 0.00 ? 91  TYR A CB   1  
ATOM 622   C CG   . TYR A 1 68  ? 5.636   -1.087  -2.602  1.00 0.00 ? 91  TYR A CG   1  
ATOM 623   C CD1  . TYR A 1 68  ? 6.369   -1.681  -3.643  1.00 0.00 ? 91  TYR A CD1  1  
ATOM 624   C CD2  . TYR A 1 68  ? 5.720   0.297   -2.391  1.00 0.00 ? 91  TYR A CD2  1  
ATOM 625   C CE1  . TYR A 1 68  ? 7.176   -0.891  -4.481  1.00 0.00 ? 91  TYR A CE1  1  
ATOM 626   C CE2  . TYR A 1 68  ? 6.531   1.096   -3.217  1.00 0.00 ? 91  TYR A CE2  1  
ATOM 627   C CZ   . TYR A 1 68  ? 7.273   0.502   -4.263  1.00 0.00 ? 91  TYR A CZ   1  
ATOM 628   O OH   . TYR A 1 68  ? 8.064   1.266   -5.067  1.00 0.00 ? 91  TYR A OH   1  
ATOM 629   H H    . TYR A 1 68  ? 3.607   -3.112  0.244   1.00 0.00 ? 91  TYR A H    1  
ATOM 630   H HA   . TYR A 1 68  ? 5.428   -3.906  -1.925  1.00 0.00 ? 91  TYR A HA   1  
ATOM 631   H HB2  . TYR A 1 68  ? 3.859   -2.168  -2.362  1.00 0.00 ? 91  TYR A HB2  1  
ATOM 632   H HB3  . TYR A 1 68  ? 4.332   -1.277  -0.920  1.00 0.00 ? 91  TYR A HB3  1  
ATOM 633   H HD1  . TYR A 1 68  ? 6.272   -2.738  -3.826  1.00 0.00 ? 91  TYR A HD1  1  
ATOM 634   H HD2  . TYR A 1 68  ? 5.093   0.727   -1.621  1.00 0.00 ? 91  TYR A HD2  1  
ATOM 635   H HE1  . TYR A 1 68  ? 7.697   -1.347  -5.309  1.00 0.00 ? 91  TYR A HE1  1  
ATOM 636   H HE2  . TYR A 1 68  ? 6.547   2.165   -3.077  1.00 0.00 ? 91  TYR A HE2  1  
ATOM 637   H HH   . TYR A 1 68  ? 8.252   2.141   -4.703  1.00 0.00 ? 91  TYR A HH   1  
ATOM 638   N N    . ASN A 1 69  ? 6.988   -4.073  0.406   1.00 0.00 ? 92  ASN A N    1  
ATOM 639   C CA   . ASN A 1 69  ? 8.214   -4.139  1.211   1.00 0.00 ? 92  ASN A CA   1  
ATOM 640   C C    . ASN A 1 69  ? 8.386   -2.930  2.146   1.00 0.00 ? 92  ASN A C    1  
ATOM 641   O O    . ASN A 1 69  ? 9.511   -2.517  2.441   1.00 0.00 ? 92  ASN A O    1  
ATOM 642   C CB   . ASN A 1 69  ? 9.436   -4.411  0.309   1.00 0.00 ? 92  ASN A CB   1  
ATOM 643   C CG   . ASN A 1 69  ? 9.341   -5.772  -0.369  1.00 0.00 ? 92  ASN A CG   1  
ATOM 644   O OD1  . ASN A 1 69  ? 9.312   -6.807  0.294   1.00 0.00 ? 92  ASN A OD1  1  
ATOM 645   N ND2  . ASN A 1 69  ? 9.218   -5.814  -1.686  1.00 0.00 ? 92  ASN A ND2  1  
ATOM 646   H H    . ASN A 1 69  ? 6.417   -4.913  0.383   1.00 0.00 ? 92  ASN A H    1  
ATOM 647   H HA   . ASN A 1 69  ? 8.118   -5.003  1.867   1.00 0.00 ? 92  ASN A HA   1  
ATOM 648   H HB2  . ASN A 1 69  ? 9.537   -3.611  -0.425  1.00 0.00 ? 92  ASN A HB2  1  
ATOM 649   H HB3  . ASN A 1 69  ? 10.339  -4.415  0.918   1.00 0.00 ? 92  ASN A HB3  1  
ATOM 650   H HD21 . ASN A 1 69  ? 9.211   -4.951  -2.226  1.00 0.00 ? 92  ASN A HD21 1  
ATOM 651   H HD22 . ASN A 1 69  ? 9.159   -6.708  -2.150  1.00 0.00 ? 92  ASN A HD22 1  
ATOM 652   N N    . GLY A 1 70  ? 7.270   -2.362  2.612   1.00 0.00 ? 93  GLY A N    1  
ATOM 653   C CA   . GLY A 1 70  ? 7.179   -1.264  3.557   1.00 0.00 ? 93  GLY A CA   1  
ATOM 654   C C    . GLY A 1 70  ? 7.511   0.076   2.920   1.00 0.00 ? 93  GLY A C    1  
ATOM 655   O O    . GLY A 1 70  ? 6.630   0.936   2.911   1.00 0.00 ? 93  GLY A O    1  
ATOM 656   H H    . GLY A 1 70  ? 6.404   -2.789  2.329   1.00 0.00 ? 93  GLY A H    1  
ATOM 657   H HA2  . GLY A 1 70  ? 6.150   -1.210  3.912   1.00 0.00 ? 93  GLY A HA2  1  
ATOM 658   H HA3  . GLY A 1 70  ? 7.842   -1.436  4.401   1.00 0.00 ? 93  GLY A HA3  1  
ATOM 659   N N    . CYS A 1 71  ? 8.726   0.225   2.390   1.00 0.00 ? 94  CYS A N    1  
ATOM 660   C CA   . CYS A 1 71  ? 9.429   1.396   1.873   1.00 0.00 ? 94  CYS A CA   1  
ATOM 661   C C    . CYS A 1 71  ? 10.762  1.488   2.591   1.00 0.00 ? 94  CYS A C    1  
ATOM 662   O O    . CYS A 1 71  ? 10.776  1.822   3.777   1.00 0.00 ? 94  CYS A O    1  
ATOM 663   C CB   . CYS A 1 71  ? 8.698   2.709   2.132   1.00 0.00 ? 94  CYS A CB   1  
ATOM 664   S SG   . CYS A 1 71  ? 9.546   4.189   1.534   1.00 0.00 ? 94  CYS A SG   1  
ATOM 665   H H    . CYS A 1 71  ? 9.296   -0.610  2.450   1.00 0.00 ? 94  CYS A H    1  
ATOM 666   H HA   . CYS A 1 71  ? 9.584   1.257   0.800   1.00 0.00 ? 94  CYS A HA   1  
ATOM 667   H HB2  . CYS A 1 71  ? 7.726   2.646   1.686   1.00 0.00 ? 94  CYS A HB2  1  
ATOM 668   H HB3  . CYS A 1 71  ? 8.548   2.806   3.209   1.00 0.00 ? 94  CYS A HB3  1  
ATOM 669   N N    . SER A 1 72  ? 11.852  1.239   1.877   1.00 0.00 ? 95  SER A N    1  
ATOM 670   C CA   . SER A 1 72  ? 13.191  1.485   2.368   1.00 0.00 ? 95  SER A CA   1  
ATOM 671   C C    . SER A 1 72  ? 13.906  2.399   1.373   1.00 0.00 ? 95  SER A C    1  
ATOM 672   O O    . SER A 1 72  ? 14.744  1.941   0.590   1.00 0.00 ? 95  SER A O    1  
ATOM 673   C CB   . SER A 1 72  ? 13.895  0.142   2.580   1.00 0.00 ? 95  SER A CB   1  
ATOM 674   O OG   . SER A 1 72  ? 13.121  -0.742  3.371   1.00 0.00 ? 95  SER A OG   1  
ATOM 675   H H    . SER A 1 72  ? 11.781  0.854   0.937   1.00 0.00 ? 95  SER A H    1  
ATOM 676   H HA   . SER A 1 72  ? 13.157  2.003   3.328   1.00 0.00 ? 95  SER A HA   1  
ATOM 677   H HB2  . SER A 1 72  ? 14.085  -0.327  1.612   1.00 0.00 ? 95  SER A HB2  1  
ATOM 678   H HB3  . SER A 1 72  ? 14.844  0.321   3.077   1.00 0.00 ? 95  SER A HB3  1  
ATOM 679   H HG   . SER A 1 72  ? 12.906  -0.291  4.218   1.00 0.00 ? 95  SER A HG   1  
ATOM 680   N N    . GLU A 1 73  ? 13.554  3.686   1.362   1.00 0.00 ? 96  GLU A N    1  
ATOM 681   C CA   . GLU A 1 73  ? 14.212  4.724   0.604   1.00 0.00 ? 96  GLU A CA   1  
ATOM 682   C C    . GLU A 1 73  ? 14.290  5.977   1.474   1.00 0.00 ? 96  GLU A C    1  
ATOM 683   O O    . GLU A 1 73  ? 13.292  6.609   1.835   1.00 0.00 ? 96  GLU A O    1  
ATOM 684   C CB   . GLU A 1 73  ? 13.470  5.046   -0.683  1.00 0.00 ? 96  GLU A CB   1  
ATOM 685   C CG   . GLU A 1 73  ? 13.457  3.896   -1.694  1.00 0.00 ? 96  GLU A CG   1  
ATOM 686   C CD   . GLU A 1 73  ? 13.188  4.394   -3.114  1.00 0.00 ? 96  GLU A CD   1  
ATOM 687   O OE1  . GLU A 1 73  ? 12.007  4.486   -3.513  1.00 0.00 ? 96  GLU A OE1  1  
ATOM 688   O OE2  . GLU A 1 73  ? 14.179  4.640   -3.845  1.00 0.00 ? 96  GLU A OE2  1  
ATOM 689   H H    . GLU A 1 73  ? 12.902  4.035   2.048   1.00 0.00 ? 96  GLU A H    1  
ATOM 690   H HA   . GLU A 1 73  ? 15.218  4.377   0.353   1.00 0.00 ? 96  GLU A HA   1  
ATOM 691   H HB2  . GLU A 1 73  ? 12.460  5.353   -0.431  1.00 0.00 ? 96  GLU A HB2  1  
ATOM 692   H HB3  . GLU A 1 73  ? 13.985  5.891   -1.123  1.00 0.00 ? 96  GLU A HB3  1  
ATOM 693   H HG2  . GLU A 1 73  ? 14.431  3.407   -1.691  1.00 0.00 ? 96  GLU A HG2  1  
ATOM 694   H HG3  . GLU A 1 73  ? 12.714  3.154   -1.402  1.00 0.00 ? 96  GLU A HG3  1  
ATOM 695   N N    . ALA A 1 74  ? 15.527  6.369   1.740   1.00 0.00 ? 97  ALA A N    1  
ATOM 696   C CA   . ALA A 1 74  ? 15.928  7.468   2.598   1.00 0.00 ? 97  ALA A CA   1  
ATOM 697   C C    . ALA A 1 74  ? 15.845  8.822   1.876   1.00 0.00 ? 97  ALA A C    1  
ATOM 698   O O    . ALA A 1 74  ? 16.381  9.829   2.348   1.00 0.00 ? 97  ALA A O    1  
ATOM 699   C CB   . ALA A 1 74  ? 17.364  7.169   2.992   1.00 0.00 ? 97  ALA A CB   1  
ATOM 700   H H    . ALA A 1 74  ? 16.256  5.949   1.193   1.00 0.00 ? 97  ALA A H    1  
ATOM 701   H HA   . ALA A 1 74  ? 15.303  7.480   3.490   1.00 0.00 ? 97  ALA A HA   1  
ATOM 702   H HB1  . ALA A 1 74  ? 17.400  6.180   3.448   1.00 0.00 ? 97  ALA A HB1  1  
ATOM 703   H HB2  . ALA A 1 74  ? 17.972  7.176   2.089   1.00 0.00 ? 97  ALA A HB2  1  
ATOM 704   H HB3  . ALA A 1 74  ? 17.724  7.920   3.693   1.00 0.00 ? 97  ALA A HB3  1  
ATOM 705   N N    . ASN A 1 75  ? 15.274  8.809   0.678   1.00 0.00 ? 98  ASN A N    1  
ATOM 706   C CA   . ASN A 1 75  ? 15.212  9.867   -0.313  1.00 0.00 ? 98  ASN A CA   1  
ATOM 707   C C    . ASN A 1 75  ? 14.176  9.490   -1.375  1.00 0.00 ? 98  ASN A C    1  
ATOM 708   O O    . ASN A 1 75  ? 14.526  9.178   -2.515  1.00 0.00 ? 98  ASN A O    1  
ATOM 709   C CB   . ASN A 1 75  ? 16.596  10.146  -0.924  1.00 0.00 ? 98  ASN A CB   1  
ATOM 710   C CG   . ASN A 1 75  ? 17.279  8.966   -1.615  1.00 0.00 ? 98  ASN A CG   1  
ATOM 711   O OD1  . ASN A 1 75  ? 17.044  7.792   -1.323  1.00 0.00 ? 98  ASN A OD1  1  
ATOM 712   N ND2  . ASN A 1 75  ? 18.205  9.243   -2.512  1.00 0.00 ? 98  ASN A ND2  1  
ATOM 713   H H    . ASN A 1 75  ? 14.971  7.892   0.393   1.00 0.00 ? 98  ASN A H    1  
ATOM 714   H HA   . ASN A 1 75  ? 14.888  10.781  0.178   1.00 0.00 ? 98  ASN A HA   1  
ATOM 715   H HB2  . ASN A 1 75  ? 16.473  10.950  -1.650  1.00 0.00 ? 98  ASN A HB2  1  
ATOM 716   H HB3  . ASN A 1 75  ? 17.250  10.510  -0.133  1.00 0.00 ? 98  ASN A HB3  1  
ATOM 717   H HD21 . ASN A 1 75  ? 18.427  10.208  -2.724  1.00 0.00 ? 98  ASN A HD21 1  
ATOM 718   H HD22 . ASN A 1 75  ? 18.770  8.484   -2.853  1.00 0.00 ? 98  ASN A HD22 1  
ATOM 719   N N    . VAL A 1 76  ? 12.893  9.503   -0.999  1.00 0.00 ? 99  VAL A N    1  
ATOM 720   C CA   . VAL A 1 76  ? 11.788  9.301   -1.926  1.00 0.00 ? 99  VAL A CA   1  
ATOM 721   C C    . VAL A 1 76  ? 10.701  10.349  -1.718  1.00 0.00 ? 99  VAL A C    1  
ATOM 722   O O    . VAL A 1 76  ? 10.338  10.703  -0.592  1.00 0.00 ? 99  VAL A O    1  
ATOM 723   C CB   . VAL A 1 76  ? 11.296  7.851   -1.823  1.00 0.00 ? 99  VAL A CB   1  
ATOM 724   C CG1  . VAL A 1 76  ? 10.602  7.508   -0.486  1.00 0.00 ? 99  VAL A CG1  1  
ATOM 725   C CG2  . VAL A 1 76  ? 10.440  7.423   -3.007  1.00 0.00 ? 99  VAL A CG2  1  
ATOM 726   H H    . VAL A 1 76  ? 12.648  9.653   -0.033  1.00 0.00 ? 99  VAL A H    1  
ATOM 727   H HA   . VAL A 1 76  ? 12.178  9.434   -2.936  1.00 0.00 ? 99  VAL A HA   1  
ATOM 728   H HB   . VAL A 1 76  ? 12.190  7.263   -1.929  1.00 0.00 ? 99  VAL A HB   1  
ATOM 729   H HG11 . VAL A 1 76  ? 9.678   8.070   -0.361  1.00 0.00 ? 99  VAL A HG11 1  
ATOM 730   H HG12 . VAL A 1 76  ? 10.347  6.449   -0.458  1.00 0.00 ? 99  VAL A HG12 1  
ATOM 731   H HG13 . VAL A 1 76  ? 11.264  7.721   0.350   1.00 0.00 ? 99  VAL A HG13 1  
ATOM 732   H HG21 . VAL A 1 76  ? 10.196  6.363   -2.915  1.00 0.00 ? 99  VAL A HG21 1  
ATOM 733   H HG22 . VAL A 1 76  ? 9.528   8.001   -3.029  1.00 0.00 ? 99  VAL A HG22 1  
ATOM 734   H HG23 . VAL A 1 76  ? 11.000  7.558   -3.931  1.00 0.00 ? 99  VAL A HG23 1  
ATOM 735   N N    . THR A 1 77  ? 10.150  10.800  -2.837  1.00 0.00 ? 100 THR A N    1  
ATOM 736   C CA   . THR A 1 77  ? 9.010   11.725  -2.852  1.00 0.00 ? 100 THR A CA   1  
ATOM 737   C C    . THR A 1 77  ? 7.722   10.910  -2.808  1.00 0.00 ? 100 THR A C    1  
ATOM 738   O O    . THR A 1 77  ? 7.755   9.697   -3.033  1.00 0.00 ? 100 THR A O    1  
ATOM 739   C CB   . THR A 1 77  ? 9.019   12.656  -4.089  1.00 0.00 ? 100 THR A CB   1  
ATOM 740   O OG1  . THR A 1 77  ? 8.521   11.991  -5.232  1.00 0.00 ? 100 THR A OG1  1  
ATOM 741   C CG2  . THR A 1 77  ? 10.391  13.207  -4.458  1.00 0.00 ? 100 THR A CG2  1  
ATOM 742   H H    . THR A 1 77  ? 10.437  10.290  -3.663  1.00 0.00 ? 100 THR A H    1  
ATOM 743   H HA   . THR A 1 77  ? 9.050   12.323  -1.937  1.00 0.00 ? 100 THR A HA   1  
ATOM 744   H HB   . THR A 1 77  ? 8.361   13.502  -3.883  1.00 0.00 ? 100 THR A HB   1  
ATOM 745   H HG1  . THR A 1 77  ? 8.866   12.420  -6.036  1.00 0.00 ? 100 THR A HG1  1  
ATOM 746   H HG21 . THR A 1 77  ? 11.038  12.407  -4.818  1.00 0.00 ? 100 THR A HG21 1  
ATOM 747   H HG22 . THR A 1 77  ? 10.278  13.952  -5.248  1.00 0.00 ? 100 THR A HG22 1  
ATOM 748   H HG23 . THR A 1 77  ? 10.845  13.674  -3.585  1.00 0.00 ? 100 THR A HG23 1  
ATOM 749   N N    . LYS A 1 78  ? 6.563   11.517  -2.545  1.00 0.00 ? 101 LYS A N    1  
ATOM 750   C CA   . LYS A 1 78  ? 5.312   10.765  -2.618  1.00 0.00 ? 101 LYS A CA   1  
ATOM 751   C C    . LYS A 1 78  ? 5.087   10.270  -4.040  1.00 0.00 ? 101 LYS A C    1  
ATOM 752   O O    . LYS A 1 78  ? 4.788   9.098   -4.261  1.00 0.00 ? 101 LYS A O    1  
ATOM 753   C CB   . LYS A 1 78  ? 4.137   11.630  -2.147  1.00 0.00 ? 101 LYS A CB   1  
ATOM 754   C CG   . LYS A 1 78  ? 3.629   11.118  -0.795  1.00 0.00 ? 101 LYS A CG   1  
ATOM 755   C CD   . LYS A 1 78  ? 2.350   11.851  -0.388  1.00 0.00 ? 101 LYS A CD   1  
ATOM 756   C CE   . LYS A 1 78  ? 1.184   11.397  -1.277  1.00 0.00 ? 101 LYS A CE   1  
ATOM 757   N NZ   . LYS A 1 78  ? 0.031   12.303  -1.192  1.00 0.00 ? 101 LYS A NZ   1  
ATOM 758   H H    . LYS A 1 78  ? 6.515   12.515  -2.386  1.00 0.00 ? 101 LYS A H    1  
ATOM 759   H HA   . LYS A 1 78  ? 5.406   9.886   -1.975  1.00 0.00 ? 101 LYS A HA   1  
ATOM 760   H HB2  . LYS A 1 78  ? 4.430   12.676  -2.041  1.00 0.00 ? 101 LYS A HB2  1  
ATOM 761   H HB3  . LYS A 1 78  ? 3.340   11.576  -2.889  1.00 0.00 ? 101 LYS A HB3  1  
ATOM 762   H HG2  . LYS A 1 78  ? 3.429   10.051  -0.861  1.00 0.00 ? 101 LYS A HG2  1  
ATOM 763   H HG3  . LYS A 1 78  ? 4.400   11.270  -0.041  1.00 0.00 ? 101 LYS A HG3  1  
ATOM 764   H HD2  . LYS A 1 78  ? 2.123   11.616  0.653   1.00 0.00 ? 101 LYS A HD2  1  
ATOM 765   H HD3  . LYS A 1 78  ? 2.511   12.926  -0.482  1.00 0.00 ? 101 LYS A HD3  1  
ATOM 766   H HE2  . LYS A 1 78  ? 1.496   11.364  -2.320  1.00 0.00 ? 101 LYS A HE2  1  
ATOM 767   H HE3  . LYS A 1 78  ? 0.884   10.391  -0.985  1.00 0.00 ? 101 LYS A HE3  1  
ATOM 768   H HZ1  . LYS A 1 78  ? -0.750  11.864  -1.676  1.00 0.00 ? 101 LYS A HZ1  1  
ATOM 769   H HZ2  . LYS A 1 78  ? -0.201  12.480  -0.219  1.00 0.00 ? 101 LYS A HZ2  1  
ATOM 770   H HZ3  . LYS A 1 78  ? 0.241   13.159  -1.691  1.00 0.00 ? 101 LYS A HZ3  1  
ATOM 771   N N    . GLU A 1 79  ? 5.281   11.152  -5.014  1.00 0.00 ? 102 GLU A N    1  
ATOM 772   C CA   . GLU A 1 79  ? 5.054   10.858  -6.422  1.00 0.00 ? 102 GLU A CA   1  
ATOM 773   C C    . GLU A 1 79  ? 6.071   9.886   -6.990  1.00 0.00 ? 102 GLU A C    1  
ATOM 774   O O    . GLU A 1 79  ? 5.914   9.431   -8.121  1.00 0.00 ? 102 GLU A O    1  
ATOM 775   C CB   . GLU A 1 79  ? 5.101   12.163  -7.213  1.00 0.00 ? 102 GLU A CB   1  
ATOM 776   C CG   . GLU A 1 79  ? 3.669   12.595  -7.584  1.00 0.00 ? 102 GLU A CG   1  
ATOM 777   C CD   . GLU A 1 79  ? 2.832   13.113  -6.413  1.00 0.00 ? 102 GLU A CD   1  
ATOM 778   O OE1  . GLU A 1 79  ? 2.350   12.306  -5.585  1.00 0.00 ? 102 GLU A OE1  1  
ATOM 779   O OE2  . GLU A 1 79  ? 2.644   14.346  -6.325  1.00 0.00 ? 102 GLU A OE2  1  
ATOM 780   H H    . GLU A 1 79  ? 5.637   12.065  -4.778  1.00 0.00 ? 102 GLU A H    1  
ATOM 781   H HA   . GLU A 1 79  ? 4.077   10.387  -6.535  1.00 0.00 ? 102 GLU A HA   1  
ATOM 782   H HB2  . GLU A 1 79  ? 5.672   12.901  -6.647  1.00 0.00 ? 102 GLU A HB2  1  
ATOM 783   H HB3  . GLU A 1 79  ? 5.668   12.032  -8.132  1.00 0.00 ? 102 GLU A HB3  1  
ATOM 784   H HG2  . GLU A 1 79  ? 3.724   13.366  -8.344  1.00 0.00 ? 102 GLU A HG2  1  
ATOM 785   H HG3  . GLU A 1 79  ? 3.142   11.754  -8.036  1.00 0.00 ? 102 GLU A HG3  1  
ATOM 786   N N    . ALA A 1 80  ? 7.113   9.582   -6.235  1.00 0.00 ? 103 ALA A N    1  
ATOM 787   C CA   . ALA A 1 80  ? 8.028   8.510   -6.485  1.00 0.00 ? 103 ALA A CA   1  
ATOM 788   C C    . ALA A 1 80  ? 7.489   7.252   -5.801  1.00 0.00 ? 103 ALA A C    1  
ATOM 789   O O    . ALA A 1 80  ? 7.139   6.302   -6.499  1.00 0.00 ? 103 ALA A O    1  
ATOM 790   C CB   . ALA A 1 80  ? 9.396   8.997   -6.012  1.00 0.00 ? 103 ALA A CB   1  
ATOM 791   H H    . ALA A 1 80  ? 7.220   10.080  -5.365  1.00 0.00 ? 103 ALA A H    1  
ATOM 792   H HA   . ALA A 1 80  ? 8.064   8.329   -7.556  1.00 0.00 ? 103 ALA A HA   1  
ATOM 793   H HB1  . ALA A 1 80  ? 10.153  8.244   -6.210  1.00 0.00 ? 103 ALA A HB1  1  
ATOM 794   H HB2  . ALA A 1 80  ? 9.630   9.909   -6.564  1.00 0.00 ? 103 ALA A HB2  1  
ATOM 795   H HB3  . ALA A 1 80  ? 9.365   9.243   -4.953  1.00 0.00 ? 103 ALA A HB3  1  
ATOM 796   N N    . PHE A 1 81  ? 7.352   7.278   -4.473  1.00 0.00 ? 104 PHE A N    1  
ATOM 797   C CA   . PHE A 1 81  ? 7.026   6.130   -3.634  1.00 0.00 ? 104 PHE A CA   1  
ATOM 798   C C    . PHE A 1 81  ? 5.718   5.461   -4.039  1.00 0.00 ? 104 PHE A C    1  
ATOM 799   O O    . PHE A 1 81  ? 5.727   4.306   -4.468  1.00 0.00 ? 104 PHE A O    1  
ATOM 800   C CB   . PHE A 1 81  ? 6.968   6.559   -2.165  1.00 0.00 ? 104 PHE A CB   1  
ATOM 801   C CG   . PHE A 1 81  ? 6.468   5.508   -1.195  1.00 0.00 ? 104 PHE A CG   1  
ATOM 802   C CD1  . PHE A 1 81  ? 6.966   4.193   -1.226  1.00 0.00 ? 104 PHE A CD1  1  
ATOM 803   C CD2  . PHE A 1 81  ? 5.523   5.872   -0.222  1.00 0.00 ? 104 PHE A CD2  1  
ATOM 804   C CE1  . PHE A 1 81  ? 6.536   3.255   -0.274  1.00 0.00 ? 104 PHE A CE1  1  
ATOM 805   C CE2  . PHE A 1 81  ? 5.154   4.963   0.779   1.00 0.00 ? 104 PHE A CE2  1  
ATOM 806   C CZ   . PHE A 1 81  ? 5.644   3.649   0.740   1.00 0.00 ? 104 PHE A CZ   1  
ATOM 807   H H    . PHE A 1 81  ? 7.536   8.165   -4.012  1.00 0.00 ? 104 PHE A H    1  
ATOM 808   H HA   . PHE A 1 81  ? 7.830   5.406   -3.763  1.00 0.00 ? 104 PHE A HA   1  
ATOM 809   H HB2  . PHE A 1 81  ? 7.962   6.866   -1.852  1.00 0.00 ? 104 PHE A HB2  1  
ATOM 810   H HB3  . PHE A 1 81  ? 6.324   7.435   -2.096  1.00 0.00 ? 104 PHE A HB3  1  
ATOM 811   H HD1  . PHE A 1 81  ? 7.673   3.898   -1.984  1.00 0.00 ? 104 PHE A HD1  1  
ATOM 812   H HD2  . PHE A 1 81  ? 5.070   6.848   -0.243  1.00 0.00 ? 104 PHE A HD2  1  
ATOM 813   H HE1  . PHE A 1 81  ? 6.883   2.221   -0.299  1.00 0.00 ? 104 PHE A HE1  1  
ATOM 814   H HE2  . PHE A 1 81  ? 4.429   5.245   1.528   1.00 0.00 ? 104 PHE A HE2  1  
ATOM 815   H HZ   . PHE A 1 81  ? 5.302   2.905   1.443   1.00 0.00 ? 104 PHE A HZ   1  
ATOM 816   N N    . VAL A 1 82  ? 4.588   6.153   -3.865  1.00 0.00 ? 105 VAL A N    1  
ATOM 817   C CA   . VAL A 1 82  ? 3.295   5.494   -3.993  1.00 0.00 ? 105 VAL A CA   1  
ATOM 818   C C    . VAL A 1 82  ? 3.061   5.100   -5.453  1.00 0.00 ? 105 VAL A C    1  
ATOM 819   O O    . VAL A 1 82  ? 2.543   4.028   -5.742  1.00 0.00 ? 105 VAL A O    1  
ATOM 820   C CB   . VAL A 1 82  ? 2.152   6.313   -3.357  1.00 0.00 ? 105 VAL A CB   1  
ATOM 821   C CG1  . VAL A 1 82  ? 2.311   7.828   -3.263  1.00 0.00 ? 105 VAL A CG1  1  
ATOM 822   C CG2  . VAL A 1 82  ? 0.773   6.024   -3.942  1.00 0.00 ? 105 VAL A CG2  1  
ATOM 823   H H    . VAL A 1 82  ? 4.632   7.136   -3.618  1.00 0.00 ? 105 VAL A H    1  
ATOM 824   H HA   . VAL A 1 82  ? 3.396   4.583   -3.398  1.00 0.00 ? 105 VAL A HA   1  
ATOM 825   H HB   . VAL A 1 82  ? 2.126   5.987   -2.342  1.00 0.00 ? 105 VAL A HB   1  
ATOM 826   H HG11 . VAL A 1 82  ? 1.421   8.265   -2.806  1.00 0.00 ? 105 VAL A HG11 1  
ATOM 827   H HG12 . VAL A 1 82  ? 3.160   8.061   -2.620  1.00 0.00 ? 105 VAL A HG12 1  
ATOM 828   H HG13 . VAL A 1 82  ? 2.450   8.232   -4.260  1.00 0.00 ? 105 VAL A HG13 1  
ATOM 829   H HG21 . VAL A 1 82  ? 0.013   6.494   -3.324  1.00 0.00 ? 105 VAL A HG21 1  
ATOM 830   H HG22 . VAL A 1 82  ? 0.712   6.431   -4.949  1.00 0.00 ? 105 VAL A HG22 1  
ATOM 831   H HG23 . VAL A 1 82  ? 0.595   4.951   -3.975  1.00 0.00 ? 105 VAL A HG23 1  
ATOM 832   N N    . THR A 1 83  ? 3.506   5.944   -6.373  1.00 0.00 ? 106 THR A N    1  
ATOM 833   C CA   . THR A 1 83  ? 3.660   5.636   -7.784  1.00 0.00 ? 106 THR A CA   1  
ATOM 834   C C    . THR A 1 83  ? 4.341   4.280   -8.005  1.00 0.00 ? 106 THR A C    1  
ATOM 835   O O    . THR A 1 83  ? 3.798   3.468   -8.746  1.00 0.00 ? 106 THR A O    1  
ATOM 836   C CB   . THR A 1 83  ? 4.441   6.779   -8.452  1.00 0.00 ? 106 THR A CB   1  
ATOM 837   O OG1  . THR A 1 83  ? 3.680   7.973   -8.444  1.00 0.00 ? 106 THR A OG1  1  
ATOM 838   C CG2  . THR A 1 83  ? 4.868   6.451   -9.881  1.00 0.00 ? 106 THR A CG2  1  
ATOM 839   H H    . THR A 1 83  ? 3.813   6.824   -6.006  1.00 0.00 ? 106 THR A H    1  
ATOM 840   H HA   . THR A 1 83  ? 2.658   5.564   -8.212  1.00 0.00 ? 106 THR A HA   1  
ATOM 841   H HB   . THR A 1 83  ? 5.350   6.974   -7.891  1.00 0.00 ? 106 THR A HB   1  
ATOM 842   H HG1  . THR A 1 83  ? 4.346   8.681   -8.541  1.00 0.00 ? 106 THR A HG1  1  
ATOM 843   H HG21 . THR A 1 83  ? 4.014   6.133   -10.471 1.00 0.00 ? 106 THR A HG21 1  
ATOM 844   H HG22 . THR A 1 83  ? 5.287   7.336   -10.346 1.00 0.00 ? 106 THR A HG22 1  
ATOM 845   H HG23 . THR A 1 83  ? 5.619   5.655   -9.862  1.00 0.00 ? 106 THR A HG23 1  
ATOM 846   N N    . GLY A 1 84  ? 5.507   4.013   -7.412  1.00 0.00 ? 107 GLY A N    1  
ATOM 847   C CA   . GLY A 1 84  ? 6.195   2.738   -7.581  1.00 0.00 ? 107 GLY A CA   1  
ATOM 848   C C    . GLY A 1 84  ? 5.313   1.585   -7.113  1.00 0.00 ? 107 GLY A C    1  
ATOM 849   O O    . GLY A 1 84  ? 5.179   0.594   -7.829  1.00 0.00 ? 107 GLY A O    1  
ATOM 850   H H    . GLY A 1 84  ? 5.920   4.677   -6.766  1.00 0.00 ? 107 GLY A H    1  
ATOM 851   H HA2  . GLY A 1 84  ? 6.438   2.594   -8.634  1.00 0.00 ? 107 GLY A HA2  1  
ATOM 852   H HA3  . GLY A 1 84  ? 7.113   2.741   -6.998  1.00 0.00 ? 107 GLY A HA3  1  
ATOM 853   N N    . CYS A 1 85  ? 4.612   1.774   -5.987  1.00 0.00 ? 108 CYS A N    1  
ATOM 854   C CA   . CYS A 1 85  ? 3.616   0.821   -5.492  1.00 0.00 ? 108 CYS A CA   1  
ATOM 855   C C    . CYS A 1 85  ? 2.552   0.565   -6.564  1.00 0.00 ? 108 CYS A C    1  
ATOM 856   O O    . CYS A 1 85  ? 2.100   -0.561  -6.728  1.00 0.00 ? 108 CYS A O    1  
ATOM 857   C CB   . CYS A 1 85  ? 2.970   1.286   -4.174  1.00 0.00 ? 108 CYS A CB   1  
ATOM 858   S SG   . CYS A 1 85  ? 1.201   0.916   -3.987  1.00 0.00 ? 108 CYS A SG   1  
ATOM 859   H H    . CYS A 1 85  ? 4.738   2.672   -5.534  1.00 0.00 ? 108 CYS A H    1  
ATOM 860   H HA   . CYS A 1 85  ? 4.123   -0.123  -5.298  1.00 0.00 ? 108 CYS A HA   1  
ATOM 861   H HB2  . CYS A 1 85  ? 3.510   0.857   -3.328  1.00 0.00 ? 108 CYS A HB2  1  
ATOM 862   H HB3  . CYS A 1 85  ? 3.095   2.356   -4.083  1.00 0.00 ? 108 CYS A HB3  1  
ATOM 863   N N    . ILE A 1 86  ? 2.109   1.589   -7.285  1.00 0.00 ? 109 ILE A N    1  
ATOM 864   C CA   . ILE A 1 86  ? 1.030   1.492   -8.258  1.00 0.00 ? 109 ILE A CA   1  
ATOM 865   C C    . ILE A 1 86  ? 1.504   0.861   -9.555  1.00 0.00 ? 109 ILE A C    1  
ATOM 866   O O    . ILE A 1 86  ? 0.786   0.057   -10.149 1.00 0.00 ? 109 ILE A O    1  
ATOM 867   C CB   . ILE A 1 86  ? 0.418   2.890   -8.413  1.00 0.00 ? 109 ILE A CB   1  
ATOM 868   C CG1  . ILE A 1 86  ? -0.657  2.990   -7.317  1.00 0.00 ? 109 ILE A CG1  1  
ATOM 869   C CG2  . ILE A 1 86  ? -0.169  3.218   -9.789  1.00 0.00 ? 109 ILE A CG2  1  
ATOM 870   C CD1  . ILE A 1 86  ? -0.777  4.415   -6.810  1.00 0.00 ? 109 ILE A CD1  1  
ATOM 871   H H    . ILE A 1 86  ? 2.473   2.508   -7.059  1.00 0.00 ? 109 ILE A H    1  
ATOM 872   H HA   . ILE A 1 86  ? 0.282   0.830   -7.839  1.00 0.00 ? 109 ILE A HA   1  
ATOM 873   H HB   . ILE A 1 86  ? 1.202   3.627   -8.233  1.00 0.00 ? 109 ILE A HB   1  
ATOM 874   H HG12 . ILE A 1 86  ? -1.622  2.641   -7.693  1.00 0.00 ? 109 ILE A HG12 1  
ATOM 875   H HG13 . ILE A 1 86  ? -0.380  2.361   -6.468  1.00 0.00 ? 109 ILE A HG13 1  
ATOM 876   H HG21 . ILE A 1 86  ? 0.622   3.215   -10.537 1.00 0.00 ? 109 ILE A HG21 1  
ATOM 877   H HG22 . ILE A 1 86  ? -0.929  2.487   -10.062 1.00 0.00 ? 109 ILE A HG22 1  
ATOM 878   H HG23 . ILE A 1 86  ? -0.597  4.220   -9.770  1.00 0.00 ? 109 ILE A HG23 1  
ATOM 879   H HD11 . ILE A 1 86  ? 0.216   4.829   -6.633  1.00 0.00 ? 109 ILE A HD11 1  
ATOM 880   H HD12 . ILE A 1 86  ? -1.302  5.026   -7.546  1.00 0.00 ? 109 ILE A HD12 1  
ATOM 881   H HD13 . ILE A 1 86  ? -1.318  4.377   -5.868  1.00 0.00 ? 109 ILE A HD13 1  
ATOM 882   N N    . ASN A 1 87  ? 2.712   1.192   -9.986  1.00 0.00 ? 110 ASN A N    1  
ATOM 883   C CA   . ASN A 1 87  ? 3.351   0.580   -11.144 1.00 0.00 ? 110 ASN A CA   1  
ATOM 884   C C    . ASN A 1 87  ? 3.607   -0.897  -10.881 1.00 0.00 ? 110 ASN A C    1  
ATOM 885   O O    . ASN A 1 87  ? 3.694   -1.691  -11.819 1.00 0.00 ? 110 ASN A O    1  
ATOM 886   C CB   . ASN A 1 87  ? 4.684   1.273   -11.444 1.00 0.00 ? 110 ASN A CB   1  
ATOM 887   C CG   . ASN A 1 87  ? 4.613   2.788   -11.591 1.00 0.00 ? 110 ASN A CG   1  
ATOM 888   O OD1  . ASN A 1 87  ? 3.581   3.390   -11.890 1.00 0.00 ? 110 ASN A OD1  1  
ATOM 889   N ND2  . ASN A 1 87  ? 5.742   3.429   -11.357 1.00 0.00 ? 110 ASN A ND2  1  
ATOM 890   H H    . ASN A 1 87  ? 3.187   1.920   -9.460  1.00 0.00 ? 110 ASN A H    1  
ATOM 891   H HA   . ASN A 1 87  ? 2.684   0.643   -12.001 1.00 0.00 ? 110 ASN A HA   1  
ATOM 892   H HB2  . ASN A 1 87  ? 5.375   1.034   -10.635 1.00 0.00 ? 110 ASN A HB2  1  
ATOM 893   H HB3  . ASN A 1 87  ? 5.095   0.857   -12.362 1.00 0.00 ? 110 ASN A HB3  1  
ATOM 894   H HD21 . ASN A 1 87  ? 6.571   2.879   -11.158 1.00 0.00 ? 110 ASN A HD21 1  
ATOM 895   H HD22 . ASN A 1 87  ? 5.790   4.422   -11.508 1.00 0.00 ? 110 ASN A HD22 1  
ATOM 896   N N    . ALA A 1 88  ? 3.731   -1.275  -9.611  1.00 0.00 ? 111 ALA A N    1  
ATOM 897   C CA   . ALA A 1 88  ? 3.790   -2.647  -9.181  1.00 0.00 ? 111 ALA A CA   1  
ATOM 898   C C    . ALA A 1 88  ? 2.374   -3.229  -9.147  1.00 0.00 ? 111 ALA A C    1  
ATOM 899   O O    . ALA A 1 88  ? 2.091   -4.186  -9.857  1.00 0.00 ? 111 ALA A O    1  
ATOM 900   C CB   . ALA A 1 88  ? 4.508   -2.679  -7.831  1.00 0.00 ? 111 ALA A CB   1  
ATOM 901   H H    . ALA A 1 88  ? 3.709   -0.571  -8.884  1.00 0.00 ? 111 ALA A H    1  
ATOM 902   H HA   . ALA A 1 88  ? 4.370   -3.217  -9.903  1.00 0.00 ? 111 ALA A HA   1  
ATOM 903   H HB1  . ALA A 1 88  ? 3.953   -2.139  -7.072  1.00 0.00 ? 111 ALA A HB1  1  
ATOM 904   H HB2  . ALA A 1 88  ? 4.623   -3.708  -7.511  1.00 0.00 ? 111 ALA A HB2  1  
ATOM 905   H HB3  . ALA A 1 88  ? 5.484   -2.196  -7.922  1.00 0.00 ? 111 ALA A HB3  1  
ATOM 906   N N    . THR A 1 89  ? 1.463   -2.643  -8.369  1.00 0.00 ? 112 THR A N    1  
ATOM 907   C CA   . THR A 1 89  ? 0.138   -3.183  -8.086  1.00 0.00 ? 112 THR A CA   1  
ATOM 908   C C    . THR A 1 89  ? -0.663  -3.417  -9.368  1.00 0.00 ? 112 THR A C    1  
ATOM 909   O O    . THR A 1 89  ? -1.351  -4.434  -9.460  1.00 0.00 ? 112 THR A O    1  
ATOM 910   C CB   . THR A 1 89  ? -0.602  -2.311  -7.049  1.00 0.00 ? 112 THR A CB   1  
ATOM 911   O OG1  . THR A 1 89  ? -1.541  -3.055  -6.315  1.00 0.00 ? 112 THR A OG1  1  
ATOM 912   C CG2  . THR A 1 89  ? -1.417  -1.180  -7.668  1.00 0.00 ? 112 THR A CG2  1  
ATOM 913   H H    . THR A 1 89  ? 1.770   -1.837  -7.838  1.00 0.00 ? 112 THR A H    1  
ATOM 914   H HA   . THR A 1 89  ? 0.311   -4.149  -7.628  1.00 0.00 ? 112 THR A HA   1  
ATOM 915   H HB   . THR A 1 89  ? 0.117   -1.904  -6.342  1.00 0.00 ? 112 THR A HB   1  
ATOM 916   H HG1  . THR A 1 89  ? -1.089  -3.787  -5.849  1.00 0.00 ? 112 THR A HG1  1  
ATOM 917   H HG21 . THR A 1 89  ? -2.358  -1.582  -8.037  1.00 0.00 ? 112 THR A HG21 1  
ATOM 918   H HG22 . THR A 1 89  ? -1.609  -0.419  -6.920  1.00 0.00 ? 112 THR A HG22 1  
ATOM 919   H HG23 . THR A 1 89  ? -0.884  -0.738  -8.500  1.00 0.00 ? 112 THR A HG23 1  
ATOM 920   N N    . GLN A 1 90  ? -0.536  -2.542  -10.378 1.00 0.00 ? 113 GLN A N    1  
ATOM 921   C CA   . GLN A 1 90  ? -1.273  -2.707  -11.631 1.00 0.00 ? 113 GLN A CA   1  
ATOM 922   C C    . GLN A 1 90  ? -0.949  -4.059  -12.274 1.00 0.00 ? 113 GLN A C    1  
ATOM 923   O O    . GLN A 1 90  ? -1.840  -4.720  -12.804 1.00 0.00 ? 113 GLN A O    1  
ATOM 924   C CB   . GLN A 1 90  ? -1.040  -1.513  -12.572 1.00 0.00 ? 113 GLN A CB   1  
ATOM 925   C CG   . GLN A 1 90  ? 0.411   -1.360  -13.058 1.00 0.00 ? 113 GLN A CG   1  
ATOM 926   C CD   . GLN A 1 90  ? 0.661   -0.044  -13.787 1.00 0.00 ? 113 GLN A CD   1  
ATOM 927   O OE1  . GLN A 1 90  ? 1.151   -0.019  -14.916 1.00 0.00 ? 113 GLN A OE1  1  
ATOM 928   N NE2  . GLN A 1 90  ? 0.419   1.078   -13.132 1.00 0.00 ? 113 GLN A NE2  1  
ATOM 929   H H    . GLN A 1 90  ? 0.048   -1.714  -10.249 1.00 0.00 ? 113 GLN A H    1  
ATOM 930   H HA   . GLN A 1 90  ? -2.335  -2.713  -11.390 1.00 0.00 ? 113 GLN A HA   1  
ATOM 931   H HB2  . GLN A 1 90  ? -1.690  -1.618  -13.441 1.00 0.00 ? 113 GLN A HB2  1  
ATOM 932   H HB3  . GLN A 1 90  ? -1.344  -0.609  -12.043 1.00 0.00 ? 113 GLN A HB3  1  
ATOM 933   H HG2  . GLN A 1 90  ? 1.084   -1.404  -12.206 1.00 0.00 ? 113 GLN A HG2  1  
ATOM 934   H HG3  . GLN A 1 90  ? 0.659   -2.183  -13.728 1.00 0.00 ? 113 GLN A HG3  1  
ATOM 935   H HE21 . GLN A 1 90  ? 0.073   1.042   -12.183 1.00 0.00 ? 113 GLN A HE21 1  
ATOM 936   H HE22 . GLN A 1 90  ? 0.603   1.967   -13.596 1.00 0.00 ? 113 GLN A HE22 1  
ATOM 937   N N    . ALA A 1 91  ? 0.307   -4.503  -12.156 1.00 0.00 ? 114 ALA A N    1  
ATOM 938   C CA   . ALA A 1 91  ? 0.781   -5.811  -12.582 1.00 0.00 ? 114 ALA A CA   1  
ATOM 939   C C    . ALA A 1 91  ? 0.669   -6.881  -11.486 1.00 0.00 ? 114 ALA A C    1  
ATOM 940   O O    . ALA A 1 91  ? 0.794   -8.068  -11.798 1.00 0.00 ? 114 ALA A O    1  
ATOM 941   C CB   . ALA A 1 91  ? 2.239   -5.661  -13.002 1.00 0.00 ? 114 ALA A CB   1  
ATOM 942   H H    . ALA A 1 91  ? 0.965   -3.932  -11.638 1.00 0.00 ? 114 ALA A H    1  
ATOM 943   H HA   . ALA A 1 91  ? 0.205   -6.149  -13.445 1.00 0.00 ? 114 ALA A HA   1  
ATOM 944   H HB1  . ALA A 1 91  ? 2.831   -5.362  -12.138 1.00 0.00 ? 114 ALA A HB1  1  
ATOM 945   H HB2  . ALA A 1 91  ? 2.604   -6.616  -13.378 1.00 0.00 ? 114 ALA A HB2  1  
ATOM 946   H HB3  . ALA A 1 91  ? 2.326   -4.904  -13.782 1.00 0.00 ? 114 ALA A HB3  1  
ATOM 947   N N    . ALA A 1 92  ? 0.441   -6.506  -10.221 1.00 0.00 ? 115 ALA A N    1  
ATOM 948   C CA   . ALA A 1 92  ? 0.233   -7.467  -9.149  1.00 0.00 ? 115 ALA A CA   1  
ATOM 949   C C    . ALA A 1 92  ? -1.103  -8.148  -9.387  1.00 0.00 ? 115 ALA A C    1  
ATOM 950   O O    . ALA A 1 92  ? -1.170  -9.358  -9.589  1.00 0.00 ? 115 ALA A O    1  
ATOM 951   C CB   . ALA A 1 92  ? 0.246   -6.817  -7.753  1.00 0.00 ? 115 ALA A CB   1  
ATOM 952   H H    . ALA A 1 92  ? 0.369   -5.515  -10.014 1.00 0.00 ? 115 ALA A H    1  
ATOM 953   H HA   . ALA A 1 92  ? 1.029   -8.209  -9.206  1.00 0.00 ? 115 ALA A HA   1  
ATOM 954   H HB1  . ALA A 1 92  ? 1.197   -6.312  -7.586  1.00 0.00 ? 115 ALA A HB1  1  
ATOM 955   H HB2  . ALA A 1 92  ? -0.587  -6.122  -7.628  1.00 0.00 ? 115 ALA A HB2  1  
ATOM 956   H HB3  . ALA A 1 92  ? 0.110   -7.575  -6.981  1.00 0.00 ? 115 ALA A HB3  1  
ATOM 957   N N    . ASN A 1 93  ? -2.168  -7.352  -9.365  1.00 0.00 ? 116 ASN A N    1  
ATOM 958   C CA   . ASN A 1 93  ? -3.539  -7.842  -9.297  1.00 0.00 ? 116 ASN A CA   1  
ATOM 959   C C    . ASN A 1 93  ? -4.278  -7.562  -10.586 1.00 0.00 ? 116 ASN A C    1  
ATOM 960   O O    . ASN A 1 93  ? -5.466  -7.290  -10.534 1.00 0.00 ? 116 ASN A O    1  
ATOM 961   C CB   . ASN A 1 93  ? -4.313  -7.317  -8.076  1.00 0.00 ? 116 ASN A CB   1  
ATOM 962   C CG   . ASN A 1 93  ? -4.487  -5.816  -8.086  1.00 0.00 ? 116 ASN A CG   1  
ATOM 963   O OD1  . ASN A 1 93  ? -5.460  -5.284  -8.587  1.00 0.00 ? 116 ASN A OD1  1  
ATOM 964   N ND2  . ASN A 1 93  ? -3.538  -5.092  -7.547  1.00 0.00 ? 116 ASN A ND2  1  
ATOM 965   H H    . ASN A 1 93  ? -1.982  -6.350  -9.365  1.00 0.00 ? 116 ASN A H    1  
ATOM 966   H HA   . ASN A 1 93  ? -3.512  -8.917  -9.185  1.00 0.00 ? 116 ASN A HA   1  
ATOM 967   H HB2  . ASN A 1 93  ? -5.309  -7.757  -8.055  1.00 0.00 ? 116 ASN A HB2  1  
ATOM 968   H HB3  . ASN A 1 93  ? -3.829  -7.632  -7.169  1.00 0.00 ? 116 ASN A HB3  1  
ATOM 969   H HD21 . ASN A 1 93  ? -2.730  -5.450  -7.070  1.00 0.00 ? 116 ASN A HD21 1  
ATOM 970   H HD22 . ASN A 1 93  ? -3.760  -4.109  -7.529  1.00 0.00 ? 116 ASN A HD22 1  
ATOM 971   N N    . GLN A 1 94  ? -3.626  -7.719  -11.736 1.00 0.00 ? 117 GLN A N    1  
ATOM 972   C CA   . GLN A 1 94  ? -4.168  -7.460  -13.067 1.00 0.00 ? 117 GLN A CA   1  
ATOM 973   C C    . GLN A 1 94  ? -5.653  -7.752  -13.236 1.00 0.00 ? 117 GLN A C    1  
ATOM 974   O O    . GLN A 1 94  ? -6.364  -6.880  -13.721 1.00 0.00 ? 117 GLN A O    1  
ATOM 975   C CB   . GLN A 1 94  ? -3.339  -8.258  -14.093 1.00 0.00 ? 117 GLN A CB   1  
ATOM 976   C CG   . GLN A 1 94  ? -2.012  -7.610  -14.472 1.00 0.00 ? 117 GLN A CG   1  
ATOM 977   C CD   . GLN A 1 94  ? -2.146  -6.711  -15.682 1.00 0.00 ? 117 GLN A CD   1  
ATOM 978   O OE1  . GLN A 1 94  ? -2.028  -7.161  -16.819 1.00 0.00 ? 117 GLN A OE1  1  
ATOM 979   N NE2  . GLN A 1 94  ? -2.318  -5.427  -15.482 1.00 0.00 ? 117 GLN A NE2  1  
ATOM 980   H H    . GLN A 1 94  ? -2.647  -7.953  -11.684 1.00 0.00 ? 117 GLN A H    1  
ATOM 981   H HA   . GLN A 1 94  ? -4.116  -6.386  -13.215 1.00 0.00 ? 117 GLN A HA   1  
ATOM 982   H HB2  . GLN A 1 94  ? -3.088  -9.224  -13.657 1.00 0.00 ? 117 GLN A HB2  1  
ATOM 983   H HB3  . GLN A 1 94  ? -3.924  -8.431  -14.997 1.00 0.00 ? 117 GLN A HB3  1  
ATOM 984   H HG2  . GLN A 1 94  ? -1.624  -7.062  -13.624 1.00 0.00 ? 117 GLN A HG2  1  
ATOM 985   H HG3  . GLN A 1 94  ? -1.295  -8.378  -14.741 1.00 0.00 ? 117 GLN A HG3  1  
ATOM 986   H HE21 . GLN A 1 94  ? -2.343  -5.039  -14.542 1.00 0.00 ? 117 GLN A HE21 1  
ATOM 987   H HE22 . GLN A 1 94  ? -2.564  -4.876  -16.281 1.00 0.00 ? 117 GLN A HE22 1  
ATOM 988   N N    . GLY A 1 95  ? -6.126  -8.917  -12.785 1.00 0.00 ? 118 GLY A N    1  
ATOM 989   C CA   . GLY A 1 95  ? -7.529  -9.295  -12.839 1.00 0.00 ? 118 GLY A CA   1  
ATOM 990   C C    . GLY A 1 95  ? -8.501  -8.283  -12.222 1.00 0.00 ? 118 GLY A C    1  
ATOM 991   O O    . GLY A 1 95  ? -9.683  -8.370  -12.557 1.00 0.00 ? 118 GLY A O    1  
ATOM 992   H H    . GLY A 1 95  ? -5.479  -9.555  -12.355 1.00 0.00 ? 118 GLY A H    1  
ATOM 993   H HA2  . GLY A 1 95  ? -7.807  -9.448  -13.882 1.00 0.00 ? 118 GLY A HA2  1  
ATOM 994   H HA3  . GLY A 1 95  ? -7.654  -10.242 -12.318 1.00 0.00 ? 118 GLY A HA3  1  
ATOM 995   N N    . GLU A 1 96  ? -8.079  -7.370  -11.331 1.00 0.00 ? 119 GLU A N    1  
ATOM 996   C CA   . GLU A 1 96  ? -8.952  -6.311  -10.845 1.00 0.00 ? 119 GLU A CA   1  
ATOM 997   C C    . GLU A 1 96  ? -8.988  -5.198  -11.879 1.00 0.00 ? 119 GLU A C    1  
ATOM 998   O O    . GLU A 1 96  ? -10.059 -4.906  -12.399 1.00 0.00 ? 119 GLU A O    1  
ATOM 999   C CB   . GLU A 1 96  ? -8.510  -5.796  -9.466  1.00 0.00 ? 119 GLU A CB   1  
ATOM 1000  C CG   . GLU A 1 96  ? -9.552  -6.043  -8.373  1.00 0.00 ? 119 GLU A CG   1  
ATOM 1001  C CD   . GLU A 1 96  ? -10.959 -5.507  -8.699  1.00 0.00 ? 119 GLU A CD   1  
ATOM 1002  O OE1  . GLU A 1 96  ? -11.247 -4.294  -8.554  1.00 0.00 ? 119 GLU A OE1  1  
ATOM 1003  O OE2  . GLU A 1 96  ? -11.800 -6.335  -9.120  1.00 0.00 ? 119 GLU A OE2  1  
ATOM 1004  H H    . GLU A 1 96  ? -7.085  -7.245  -11.100 1.00 0.00 ? 119 GLU A H    1  
ATOM 1005  H HA   . GLU A 1 96  ? -9.959  -6.707  -10.771 1.00 0.00 ? 119 GLU A HA   1  
ATOM 1006  H HB2  . GLU A 1 96  ? -7.605  -6.319  -9.163  1.00 0.00 ? 119 GLU A HB2  1  
ATOM 1007  H HB3  . GLU A 1 96  ? -8.300  -4.725  -9.511  1.00 0.00 ? 119 GLU A HB3  1  
ATOM 1008  H HG2  . GLU A 1 96  ? -9.616  -7.118  -8.189  1.00 0.00 ? 119 GLU A HG2  1  
ATOM 1009  H HG3  . GLU A 1 96  ? -9.163  -5.587  -7.473  1.00 0.00 ? 119 GLU A HG3  1  
ATOM 1010  N N    . PHE A 1 97  ? -7.838  -4.620  -12.232 1.00 0.00 ? 120 PHE A N    1  
ATOM 1011  C CA   . PHE A 1 97  ? -7.706  -3.563  -13.233 1.00 0.00 ? 120 PHE A CA   1  
ATOM 1012  C C    . PHE A 1 97  ? -7.982  -4.039  -14.682 1.00 0.00 ? 120 PHE A C    1  
ATOM 1013  O O    . PHE A 1 97  ? -7.372  -3.523  -15.621 1.00 0.00 ? 120 PHE A O    1  
ATOM 1014  C CB   . PHE A 1 97  ? -6.310  -2.930  -13.110 1.00 0.00 ? 120 PHE A CB   1  
ATOM 1015  C CG   . PHE A 1 97  ? -5.905  -2.458  -11.723 1.00 0.00 ? 120 PHE A CG   1  
ATOM 1016  C CD1  . PHE A 1 97  ? -6.415  -1.263  -11.174 1.00 0.00 ? 120 PHE A CD1  1  
ATOM 1017  C CD2  . PHE A 1 97  ? -4.952  -3.190  -10.996 1.00 0.00 ? 120 PHE A CD2  1  
ATOM 1018  C CE1  . PHE A 1 97  ? -5.920  -0.776  -9.953  1.00 0.00 ? 120 PHE A CE1  1  
ATOM 1019  C CE2  . PHE A 1 97  ? -4.449  -2.696  -9.783  1.00 0.00 ? 120 PHE A CE2  1  
ATOM 1020  C CZ   . PHE A 1 97  ? -4.923  -1.481  -9.260  1.00 0.00 ? 120 PHE A CZ   1  
ATOM 1021  H H    . PHE A 1 97  ? -6.984  -4.912  -11.775 1.00 0.00 ? 120 PHE A H    1  
ATOM 1022  H HA   . PHE A 1 97  ? -8.436  -2.788  -12.994 1.00 0.00 ? 120 PHE A HA   1  
ATOM 1023  H HB2  . PHE A 1 97  ? -5.571  -3.650  -13.467 1.00 0.00 ? 120 PHE A HB2  1  
ATOM 1024  H HB3  . PHE A 1 97  ? -6.259  -2.066  -13.774 1.00 0.00 ? 120 PHE A HB3  1  
ATOM 1025  H HD1  . PHE A 1 97  ? -7.188  -0.694  -11.665 1.00 0.00 ? 120 PHE A HD1  1  
ATOM 1026  H HD2  . PHE A 1 97  ? -4.589  -4.137  -11.361 1.00 0.00 ? 120 PHE A HD2  1  
ATOM 1027  H HE1  . PHE A 1 97  ? -6.311  0.146   -9.554  1.00 0.00 ? 120 PHE A HE1  1  
ATOM 1028  H HE2  . PHE A 1 97  ? -3.702  -3.287  -9.278  1.00 0.00 ? 120 PHE A HE2  1  
ATOM 1029  H HZ   . PHE A 1 97  ? -4.541  -1.092  -8.327  1.00 0.00 ? 120 PHE A HZ   1  
ATOM 1030  N N    . GLN A 1 98  ? -8.864  -5.024  -14.889 1.00 0.00 ? 121 GLN A N    1  
ATOM 1031  C CA   . GLN A 1 98  ? -9.456  -5.385  -16.176 1.00 0.00 ? 121 GLN A CA   1  
ATOM 1032  C C    . GLN A 1 98  ? -10.974 -5.627  -16.068 1.00 0.00 ? 121 GLN A C    1  
ATOM 1033  O O    . GLN A 1 98  ? -11.521 -6.570  -16.657 1.00 0.00 ? 121 GLN A O    1  
ATOM 1034  C CB   . GLN A 1 98  ? -8.682  -6.496  -16.893 1.00 0.00 ? 121 GLN A CB   1  
ATOM 1035  C CG   . GLN A 1 98  ? -8.675  -7.761  -16.061 1.00 0.00 ? 121 GLN A CG   1  
ATOM 1036  C CD   . GLN A 1 98  ? -8.390  -9.010  -16.882 1.00 0.00 ? 121 GLN A CD   1  
ATOM 1037  O OE1  . GLN A 1 98  ? -7.469  -9.054  -17.689 1.00 0.00 ? 121 GLN A OE1  1  
ATOM 1038  N NE2  . GLN A 1 98  ? -9.126  -10.079 -16.656 1.00 0.00 ? 121 GLN A NE2  1  
ATOM 1039  H H    . GLN A 1 98  ? -9.328  -5.377  -14.061 1.00 0.00 ? 121 GLN A H    1  
ATOM 1040  H HA   . GLN A 1 98  ? -9.338  -4.546  -16.816 1.00 0.00 ? 121 GLN A HA   1  
ATOM 1041  H HB2  . GLN A 1 98  ? -9.168  -6.699  -17.846 1.00 0.00 ? 121 GLN A HB2  1  
ATOM 1042  H HB3  . GLN A 1 98  ? -7.660  -6.176  -17.093 1.00 0.00 ? 121 GLN A HB3  1  
ATOM 1043  H HG2  . GLN A 1 98  ? -7.918  -7.678  -15.296 1.00 0.00 ? 121 GLN A HG2  1  
ATOM 1044  H HG3  . GLN A 1 98  ? -9.644  -7.805  -15.583 1.00 0.00 ? 121 GLN A HG3  1  
ATOM 1045  H HE21 . GLN A 1 98  ? -9.831  -10.096 -15.929 1.00 0.00 ? 121 GLN A HE21 1  
ATOM 1046  H HE22 . GLN A 1 98  ? -8.805  -10.942 -17.072 1.00 0.00 ? 121 GLN A HE22 1  
ATOM 1047  N N    . LYS A 1 99  ? -11.686 -4.823  -15.270 1.00 0.00 ? 122 LYS A N    1  
ATOM 1048  C CA   . LYS A 1 99  ? -13.142 -4.948  -15.186 1.00 0.00 ? 122 LYS A CA   1  
ATOM 1049  C C    . LYS A 1 99  ? -13.773 -4.649  -16.550 1.00 0.00 ? 122 LYS A C    1  
ATOM 1050  O O    . LYS A 1 99  ? -13.211 -3.885  -17.330 1.00 0.00 ? 122 LYS A O    1  
ATOM 1051  C CB   . LYS A 1 99  ? -13.723 -3.981  -14.155 1.00 0.00 ? 122 LYS A CB   1  
ATOM 1052  C CG   . LYS A 1 99  ? -13.339 -4.206  -12.690 1.00 0.00 ? 122 LYS A CG   1  
ATOM 1053  C CD   . LYS A 1 99  ? -13.744 -5.558  -12.098 1.00 0.00 ? 122 LYS A CD   1  
ATOM 1054  C CE   . LYS A 1 99  ? -12.661 -6.630  -12.280 1.00 0.00 ? 122 LYS A CE   1  
ATOM 1055  N NZ   . LYS A 1 99  ? -13.152 -7.961  -11.872 1.00 0.00 ? 122 LYS A NZ   1  
ATOM 1056  H H    . LYS A 1 99  ? -11.234 -4.001  -14.881 1.00 0.00 ? 122 LYS A H    1  
ATOM 1057  H HA   . LYS A 1 99  ? -13.380 -5.970  -14.912 1.00 0.00 ? 122 LYS A HA   1  
ATOM 1058  H HB2  . LYS A 1 99  ? -13.430 -2.968  -14.435 1.00 0.00 ? 122 LYS A HB2  1  
ATOM 1059  H HB3  . LYS A 1 99  ? -14.805 -4.041  -14.224 1.00 0.00 ? 122 LYS A HB3  1  
ATOM 1060  H HG2  . LYS A 1 99  ? -12.279 -4.057  -12.582 1.00 0.00 ? 122 LYS A HG2  1  
ATOM 1061  H HG3  . LYS A 1 99  ? -13.821 -3.432  -12.097 1.00 0.00 ? 122 LYS A HG3  1  
ATOM 1062  H HD2  . LYS A 1 99  ? -13.894 -5.412  -11.029 1.00 0.00 ? 122 LYS A HD2  1  
ATOM 1063  H HD3  . LYS A 1 99  ? -14.689 -5.871  -12.541 1.00 0.00 ? 122 LYS A HD3  1  
ATOM 1064  H HE2  . LYS A 1 99  ? -12.324 -6.664  -13.318 1.00 0.00 ? 122 LYS A HE2  1  
ATOM 1065  H HE3  . LYS A 1 99  ? -11.808 -6.357  -11.654 1.00 0.00 ? 122 LYS A HE3  1  
ATOM 1066  H HZ1  . LYS A 1 99  ? -13.530 -7.921  -10.930 1.00 0.00 ? 122 LYS A HZ1  1  
ATOM 1067  H HZ2  . LYS A 1 99  ? -13.872 -8.298  -12.504 1.00 0.00 ? 122 LYS A HZ2  1  
ATOM 1068  H HZ3  . LYS A 1 99  ? -12.403 -8.644  -11.872 1.00 0.00 ? 122 LYS A HZ3  1  
ATOM 1069  N N    . PRO A 1 100 ? -14.969 -5.182  -16.840 1.00 0.00 ? 123 PRO A N    1  
ATOM 1070  C CA   . PRO A 1 100 ? -15.648 -4.905  -18.094 1.00 0.00 ? 123 PRO A CA   1  
ATOM 1071  C C    . PRO A 1 100 ? -16.326 -3.537  -18.115 1.00 0.00 ? 123 PRO A C    1  
ATOM 1072  O O    . PRO A 1 100 ? -16.573 -3.012  -19.195 1.00 0.00 ? 123 PRO A O    1  
ATOM 1073  C CB   . PRO A 1 100 ? -16.688 -6.014  -18.224 1.00 0.00 ? 123 PRO A CB   1  
ATOM 1074  C CG   . PRO A 1 100 ? -17.065 -6.310  -16.774 1.00 0.00 ? 123 PRO A CG   1  
ATOM 1075  C CD   . PRO A 1 100 ? -15.732 -6.139  -16.055 1.00 0.00 ? 123 PRO A CD   1  
ATOM 1076  H HA   . PRO A 1 100 ? -14.944 -4.953  -18.916 1.00 0.00 ? 123 PRO A HA   1  
ATOM 1077  H HB2  . PRO A 1 100 ? -17.550 -5.701  -18.807 1.00 0.00 ? 123 PRO A HB2  1  
ATOM 1078  H HB3  . PRO A 1 100 ? -16.225 -6.890  -18.672 1.00 0.00 ? 123 PRO A HB3  1  
ATOM 1079  H HG2  . PRO A 1 100 ? -17.778 -5.571  -16.413 1.00 0.00 ? 123 PRO A HG2  1  
ATOM 1080  H HG3  . PRO A 1 100 ? -17.475 -7.309  -16.641 1.00 0.00 ? 123 PRO A HG3  1  
ATOM 1081  H HD2  . PRO A 1 100 ? -15.896 -5.801  -15.035 1.00 0.00 ? 123 PRO A HD2  1  
ATOM 1082  H HD3  . PRO A 1 100 ? -15.205 -7.087  -16.051 1.00 0.00 ? 123 PRO A HD3  1  
ATOM 1083  N N    . ASP A 1 101 ? -16.655 -2.985  -16.947 1.00 0.00 ? 124 ASP A N    1  
ATOM 1084  C CA   . ASP A 1 101 ? -17.428 -1.759  -16.778 1.00 0.00 ? 124 ASP A CA   1  
ATOM 1085  C C    . ASP A 1 101 ? -16.800 -1.065  -15.572 1.00 0.00 ? 124 ASP A C    1  
ATOM 1086  O O    . ASP A 1 101 ? -15.641 -0.642  -15.643 1.00 0.00 ? 124 ASP A O    1  
ATOM 1087  C CB   . ASP A 1 101 ? -18.925 -2.059  -16.538 1.00 0.00 ? 124 ASP A CB   1  
ATOM 1088  C CG   . ASP A 1 101 ? -19.766 -2.545  -17.708 1.00 0.00 ? 124 ASP A CG   1  
ATOM 1089  O OD1  . ASP A 1 101 ? -19.438 -2.324  -18.897 1.00 0.00 ? 124 ASP A OD1  1  
ATOM 1090  O OD2  . ASP A 1 101 ? -20.828 -3.134  -17.411 1.00 0.00 ? 124 ASP A OD2  1  
ATOM 1091  H H    . ASP A 1 101 ? -16.332 -3.440  -16.108 1.00 0.00 ? 124 ASP A H    1  
ATOM 1092  H HA   . ASP A 1 101 ? -17.322 -1.117  -17.649 1.00 0.00 ? 124 ASP A HA   1  
ATOM 1093  H HB2  . ASP A 1 101 ? -18.998 -2.805  -15.745 1.00 0.00 ? 124 ASP A HB2  1  
ATOM 1094  H HB3  . ASP A 1 101 ? -19.407 -1.145  -16.189 1.00 0.00 ? 124 ASP A HB3  1  
ATOM 1095  N N    . ASN A 1 102 ? -17.500 -1.087  -14.430 1.00 0.00 ? 125 ASN A N    1  
ATOM 1096  C CA   . ASN A 1 102 ? -17.025 -0.777  -13.094 1.00 0.00 ? 125 ASN A CA   1  
ATOM 1097  C C    . ASN A 1 102 ? -16.401 0.616   -12.976 1.00 0.00 ? 125 ASN A C    1  
ATOM 1098  O O    . ASN A 1 102 ? -15.565 0.795   -12.102 1.00 0.00 ? 125 ASN A O    1  
ATOM 1099  C CB   . ASN A 1 102 ? -16.079 -1.900  -12.630 1.00 0.00 ? 125 ASN A CB   1  
ATOM 1100  C CG   . ASN A 1 102 ? -16.799 -3.163  -12.183 1.00 0.00 ? 125 ASN A CG   1  
ATOM 1101  O OD1  . ASN A 1 102 ? -17.116 -4.053  -12.971 1.00 0.00 ? 125 ASN A OD1  1  
ATOM 1102  N ND2  . ASN A 1 102 ? -17.046 -3.277  -10.892 1.00 0.00 ? 125 ASN A ND2  1  
ATOM 1103  H H    . ASN A 1 102 ? -18.452 -1.436  -14.477 1.00 0.00 ? 125 ASN A H    1  
ATOM 1104  H HA   . ASN A 1 102 ? -17.890 -0.784  -12.431 1.00 0.00 ? 125 ASN A HA   1  
ATOM 1105  H HB2  . ASN A 1 102 ? -15.385 -2.105  -13.432 1.00 0.00 ? 125 ASN A HB2  1  
ATOM 1106  H HB3  . ASN A 1 102 ? -15.470 -1.569  -11.799 1.00 0.00 ? 125 ASN A HB3  1  
ATOM 1107  H HD21 . ASN A 1 102 ? -16.741 -2.568  -10.244 1.00 0.00 ? 125 ASN A HD21 1  
ATOM 1108  H HD22 . ASN A 1 102 ? -17.603 -4.036  -10.519 1.00 0.00 ? 125 ASN A HD22 1  
ATOM 1109  N N    . LYS A 1 103 ? -16.802 1.608   -13.781 1.00 0.00 ? 126 LYS A N    1  
ATOM 1110  C CA   . LYS A 1 103 ? -16.277 2.984   -13.794 1.00 0.00 ? 126 LYS A CA   1  
ATOM 1111  C C    . LYS A 1 103 ? -15.684 3.459   -12.470 1.00 0.00 ? 126 LYS A C    1  
ATOM 1112  O O    . LYS A 1 103 ? -14.492 3.772   -12.401 1.00 0.00 ? 126 LYS A O    1  
ATOM 1113  C CB   . LYS A 1 103 ? -17.389 3.946   -14.220 1.00 0.00 ? 126 LYS A CB   1  
ATOM 1114  C CG   . LYS A 1 103 ? -16.909 5.380   -14.532 1.00 0.00 ? 126 LYS A CG   1  
ATOM 1115  C CD   . LYS A 1 103 ? -16.937 6.355   -13.344 1.00 0.00 ? 126 LYS A CD   1  
ATOM 1116  C CE   . LYS A 1 103 ? -16.403 7.726   -13.762 1.00 0.00 ? 126 LYS A CE   1  
ATOM 1117  N NZ   . LYS A 1 103 ? -16.456 8.746   -12.690 1.00 0.00 ? 126 LYS A NZ   1  
ATOM 1118  H H    . LYS A 1 103 ? -17.428 1.355   -14.543 1.00 0.00 ? 126 LYS A H    1  
ATOM 1119  H HA   . LYS A 1 103 ? -15.502 3.011   -14.557 1.00 0.00 ? 126 LYS A HA   1  
ATOM 1120  H HB2  . LYS A 1 103 ? -17.841 3.568   -15.132 1.00 0.00 ? 126 LYS A HB2  1  
ATOM 1121  H HB3  . LYS A 1 103 ? -18.137 3.929   -13.423 1.00 0.00 ? 126 LYS A HB3  1  
ATOM 1122  H HG2  . LYS A 1 103 ? -15.901 5.336   -14.941 1.00 0.00 ? 126 LYS A HG2  1  
ATOM 1123  H HG3  . LYS A 1 103 ? -17.557 5.789   -15.308 1.00 0.00 ? 126 LYS A HG3  1  
ATOM 1124  H HD2  . LYS A 1 103 ? -17.971 6.453   -13.011 1.00 0.00 ? 126 LYS A HD2  1  
ATOM 1125  H HD3  . LYS A 1 103 ? -16.309 5.986   -12.540 1.00 0.00 ? 126 LYS A HD3  1  
ATOM 1126  H HE2  . LYS A 1 103 ? -15.376 7.620   -14.119 1.00 0.00 ? 126 LYS A HE2  1  
ATOM 1127  H HE3  . LYS A 1 103 ? -17.019 8.078   -14.588 1.00 0.00 ? 126 LYS A HE3  1  
ATOM 1128  H HZ1  . LYS A 1 103 ? -16.274 9.658   -13.101 1.00 0.00 ? 126 LYS A HZ1  1  
ATOM 1129  H HZ2  . LYS A 1 103 ? -17.387 8.813   -12.291 1.00 0.00 ? 126 LYS A HZ2  1  
ATOM 1130  H HZ3  . LYS A 1 103 ? -15.779 8.601   -11.955 1.00 0.00 ? 126 LYS A HZ3  1  
ATOM 1131  N N    . LEU A 1 104 ? -16.528 3.590   -11.435 1.00 0.00 ? 127 LEU A N    1  
ATOM 1132  C CA   . LEU A 1 104 ? -16.123 4.203   -10.172 1.00 0.00 ? 127 LEU A CA   1  
ATOM 1133  C C    . LEU A 1 104 ? -15.105 3.329   -9.450  1.00 0.00 ? 127 LEU A C    1  
ATOM 1134  O O    . LEU A 1 104 ? -14.384 3.866   -8.618  1.00 0.00 ? 127 LEU A O    1  
ATOM 1135  C CB   . LEU A 1 104 ? -17.325 4.440   -9.238  1.00 0.00 ? 127 LEU A CB   1  
ATOM 1136  C CG   . LEU A 1 104 ? -17.719 5.873   -8.884  1.00 0.00 ? 127 LEU A CG   1  
ATOM 1137  C CD1  . LEU A 1 104 ? -16.555 6.734   -8.390  1.00 0.00 ? 127 LEU A CD1  1  
ATOM 1138  C CD2  . LEU A 1 104 ? -18.403 6.574   -10.044 1.00 0.00 ? 127 LEU A CD2  1  
ATOM 1139  H H    . LEU A 1 104 ? -17.481 3.258   -11.558 1.00 0.00 ? 127 LEU A H    1  
ATOM 1140  H HA   . LEU A 1 104 ? -15.635 5.154   -10.386 1.00 0.00 ? 127 LEU A HA   1  
ATOM 1141  H HB2  . LEU A 1 104 ? -18.203 3.930   -9.630  1.00 0.00 ? 127 LEU A HB2  1  
ATOM 1142  H HB3  . LEU A 1 104 ? -17.084 3.999   -8.273  1.00 0.00 ? 127 LEU A HB3  1  
ATOM 1143  H HG   . LEU A 1 104 ? -18.440 5.785   -8.076  1.00 0.00 ? 127 LEU A HG   1  
ATOM 1144  H HD11 . LEU A 1 104 ? -15.957 7.077   -9.228  1.00 0.00 ? 127 LEU A HD11 1  
ATOM 1145  H HD12 . LEU A 1 104 ? -16.958 7.599   -7.868  1.00 0.00 ? 127 LEU A HD12 1  
ATOM 1146  H HD13 . LEU A 1 104 ? -15.928 6.163   -7.709  1.00 0.00 ? 127 LEU A HD13 1  
ATOM 1147  H HD21 . LEU A 1 104 ? -18.796 7.524   -9.698  1.00 0.00 ? 127 LEU A HD21 1  
ATOM 1148  H HD22 . LEU A 1 104 ? -17.681 6.765   -10.825 1.00 0.00 ? 127 LEU A HD22 1  
ATOM 1149  H HD23 . LEU A 1 104 ? -19.223 5.960   -10.419 1.00 0.00 ? 127 LEU A HD23 1  
ATOM 1150  N N    . HIS A 1 105 ? -15.016 2.027   -9.743  1.00 0.00 ? 128 HIS A N    1  
ATOM 1151  C CA   . HIS A 1 105 ? -13.984 1.171   -9.174  1.00 0.00 ? 128 HIS A CA   1  
ATOM 1152  C C    . HIS A 1 105 ? -12.602 1.737   -9.480  1.00 0.00 ? 128 HIS A C    1  
ATOM 1153  O O    . HIS A 1 105 ? -11.768 1.654   -8.596  1.00 0.00 ? 128 HIS A O    1  
ATOM 1154  C CB   . HIS A 1 105 ? -14.106 -0.330  -9.535  1.00 0.00 ? 128 HIS A CB   1  
ATOM 1155  C CG   . HIS A 1 105 ? -13.004 -0.922  -10.402 1.00 0.00 ? 128 HIS A CG   1  
ATOM 1156  N ND1  . HIS A 1 105 ? -12.098 -1.897  -10.020 1.00 0.00 ? 128 HIS A ND1  1  
ATOM 1157  C CD2  . HIS A 1 105 ? -12.683 -0.562  -11.687 1.00 0.00 ? 128 HIS A CD2  1  
ATOM 1158  C CE1  . HIS A 1 105 ? -11.245 -2.090  -11.037 1.00 0.00 ? 128 HIS A CE1  1  
ATOM 1159  N NE2  . HIS A 1 105 ? -11.567 -1.306  -12.081 1.00 0.00 ? 128 HIS A NE2  1  
ATOM 1160  H H    . HIS A 1 105 ? -15.583 1.662   -10.497 1.00 0.00 ? 128 HIS A H    1  
ATOM 1161  H HA   . HIS A 1 105 ? -14.135 1.239   -8.100  1.00 0.00 ? 128 HIS A HA   1  
ATOM 1162  H HB2  . HIS A 1 105 ? -14.092 -0.893  -8.604  1.00 0.00 ? 128 HIS A HB2  1  
ATOM 1163  H HB3  . HIS A 1 105 ? -15.080 -0.523  -9.971  1.00 0.00 ? 128 HIS A HB3  1  
ATOM 1164  H HD1  . HIS A 1 105 ? -12.043 -2.466  -9.173  1.00 0.00 ? 128 HIS A HD1  1  
ATOM 1165  H HD2  . HIS A 1 105 ? -13.168 0.196   -12.283 1.00 0.00 ? 128 HIS A HD2  1  
ATOM 1166  H HE1  . HIS A 1 105 ? -10.433 -2.805  -11.017 1.00 0.00 ? 128 HIS A HE1  1  
ATOM 1167  N N    . GLN A 1 106 ? -12.370 2.378   -10.636 1.00 0.00 ? 129 GLN A N    1  
ATOM 1168  C CA   . GLN A 1 106 ? -11.108 3.056   -10.907 1.00 0.00 ? 129 GLN A CA   1  
ATOM 1169  C C    . GLN A 1 106 ? -10.932 4.166   -9.881  1.00 0.00 ? 129 GLN A C    1  
ATOM 1170  O O    . GLN A 1 106 ? -10.023 4.105   -9.064  1.00 0.00 ? 129 GLN A O    1  
ATOM 1171  C CB   . GLN A 1 106 ? -11.055 3.560   -12.358 1.00 0.00 ? 129 GLN A CB   1  
ATOM 1172  C CG   . GLN A 1 106 ? -9.749  4.246   -12.746 1.00 0.00 ? 129 GLN A CG   1  
ATOM 1173  C CD   . GLN A 1 106 ? -9.692  5.750   -12.468 1.00 0.00 ? 129 GLN A CD   1  
ATOM 1174  O OE1  . GLN A 1 106 ? -9.265  6.199   -11.410 1.00 0.00 ? 129 GLN A OE1  1  
ATOM 1175  N NE2  . GLN A 1 106 ? -10.119 6.575   -13.409 1.00 0.00 ? 129 GLN A NE2  1  
ATOM 1176  H H    . GLN A 1 106 ? -13.105 2.448   -11.327 1.00 0.00 ? 129 GLN A H    1  
ATOM 1177  H HA   . GLN A 1 106 ? -10.296 2.338   -10.776 1.00 0.00 ? 129 GLN A HA   1  
ATOM 1178  H HB2  . GLN A 1 106 ? -11.184 2.694   -13.008 1.00 0.00 ? 129 GLN A HB2  1  
ATOM 1179  H HB3  . GLN A 1 106 ? -11.842 4.266   -12.579 1.00 0.00 ? 129 GLN A HB3  1  
ATOM 1180  H HG2  . GLN A 1 106 ? -8.914  3.739   -12.270 1.00 0.00 ? 129 GLN A HG2  1  
ATOM 1181  H HG3  . GLN A 1 106 ? -9.690  4.123   -13.815 1.00 0.00 ? 129 GLN A HG3  1  
ATOM 1182  H HE21 . GLN A 1 106 ? -10.409 6.241   -14.320 1.00 0.00 ? 129 GLN A HE21 1  
ATOM 1183  H HE22 . GLN A 1 106 ? -10.069 7.574   -13.238 1.00 0.00 ? 129 GLN A HE22 1  
ATOM 1184  N N    . GLN A 1 107 ? -11.824 5.157   -9.889  1.00 0.00 ? 130 GLN A N    1  
ATOM 1185  C CA   . GLN A 1 107 ? -11.663 6.333   -9.044  1.00 0.00 ? 130 GLN A CA   1  
ATOM 1186  C C    . GLN A 1 107 ? -11.666 6.003   -7.545  1.00 0.00 ? 130 GLN A C    1  
ATOM 1187  O O    . GLN A 1 107 ? -11.104 6.763   -6.756  1.00 0.00 ? 130 GLN A O    1  
ATOM 1188  C CB   . GLN A 1 107 ? -12.752 7.364   -9.359  1.00 0.00 ? 130 GLN A CB   1  
ATOM 1189  C CG   . GLN A 1 107 ? -12.453 8.149   -10.641 1.00 0.00 ? 130 GLN A CG   1  
ATOM 1190  C CD   . GLN A 1 107 ? -13.355 9.368   -10.859 1.00 0.00 ? 130 GLN A CD   1  
ATOM 1191  O OE1  . GLN A 1 107 ? -12.965 10.340  -11.500 1.00 0.00 ? 130 GLN A OE1  1  
ATOM 1192  N NE2  . GLN A 1 107 ? -14.588 9.367   -10.371 1.00 0.00 ? 130 GLN A NE2  1  
ATOM 1193  H H    . GLN A 1 107 ? -12.539 5.141   -10.597 1.00 0.00 ? 130 GLN A H    1  
ATOM 1194  H HA   . GLN A 1 107 ? -10.686 6.760   -9.279  1.00 0.00 ? 130 GLN A HA   1  
ATOM 1195  H HB2  . GLN A 1 107 ? -13.714 6.861   -9.446  1.00 0.00 ? 130 GLN A HB2  1  
ATOM 1196  H HB3  . GLN A 1 107 ? -12.808 8.069   -8.536  1.00 0.00 ? 130 GLN A HB3  1  
ATOM 1197  H HG2  . GLN A 1 107 ? -11.422 8.503   -10.602 1.00 0.00 ? 130 GLN A HG2  1  
ATOM 1198  H HG3  . GLN A 1 107 ? -12.540 7.476   -11.490 1.00 0.00 ? 130 GLN A HG3  1  
ATOM 1199  H HE21 . GLN A 1 107 ? -14.853 8.694   -9.668  1.00 0.00 ? 130 GLN A HE21 1  
ATOM 1200  H HE22 . GLN A 1 107 ? -15.113 10.238  -10.434 1.00 0.00 ? 130 GLN A HE22 1  
ATOM 1201  N N    . VAL A 1 108 ? -12.314 4.919   -7.110  1.00 0.00 ? 131 VAL A N    1  
ATOM 1202  C CA   . VAL A 1 108 ? -12.145 4.399   -5.761  1.00 0.00 ? 131 VAL A CA   1  
ATOM 1203  C C    . VAL A 1 108 ? -10.758 3.777   -5.692  1.00 0.00 ? 131 VAL A C    1  
ATOM 1204  O O    . VAL A 1 108 ? -9.917  4.315   -4.992  1.00 0.00 ? 131 VAL A O    1  
ATOM 1205  C CB   . VAL A 1 108 ? -13.266 3.421   -5.351  1.00 0.00 ? 131 VAL A CB   1  
ATOM 1206  C CG1  . VAL A 1 108 ? -13.020 2.866   -3.938  1.00 0.00 ? 131 VAL A CG1  1  
ATOM 1207  C CG2  . VAL A 1 108 ? -14.635 4.107   -5.315  1.00 0.00 ? 131 VAL A CG2  1  
ATOM 1208  H H    . VAL A 1 108 ? -12.836 4.360   -7.775  1.00 0.00 ? 131 VAL A H    1  
ATOM 1209  H HA   . VAL A 1 108 ? -12.162 5.230   -5.058  1.00 0.00 ? 131 VAL A HA   1  
ATOM 1210  H HB   . VAL A 1 108 ? -13.312 2.601   -6.067  1.00 0.00 ? 131 VAL A HB   1  
ATOM 1211  H HG11 . VAL A 1 108 ? -13.842 2.218   -3.634  1.00 0.00 ? 131 VAL A HG11 1  
ATOM 1212  H HG12 . VAL A 1 108 ? -12.096 2.288   -3.912  1.00 0.00 ? 131 VAL A HG12 1  
ATOM 1213  H HG13 . VAL A 1 108 ? -12.929 3.688   -3.222  1.00 0.00 ? 131 VAL A HG13 1  
ATOM 1214  H HG21 . VAL A 1 108 ? -15.407 3.363   -5.121  1.00 0.00 ? 131 VAL A HG21 1  
ATOM 1215  H HG22 . VAL A 1 108 ? -14.649 4.865   -4.532  1.00 0.00 ? 131 VAL A HG22 1  
ATOM 1216  H HG23 . VAL A 1 108 ? -14.850 4.581   -6.267  1.00 0.00 ? 131 VAL A HG23 1  
ATOM 1217  N N    . LEU A 1 109 ? -10.505 2.670   -6.392  1.00 0.00 ? 132 LEU A N    1  
ATOM 1218  C CA   . LEU A 1 109 ? -9.347  1.805   -6.207  1.00 0.00 ? 132 LEU A CA   1  
ATOM 1219  C C    . LEU A 1 109 ? -8.041  2.566   -6.380  1.00 0.00 ? 132 LEU A C    1  
ATOM 1220  O O    . LEU A 1 109 ? -7.145  2.392   -5.566  1.00 0.00 ? 132 LEU A O    1  
ATOM 1221  C CB   . LEU A 1 109 ? -9.419  0.595   -7.161  1.00 0.00 ? 132 LEU A CB   1  
ATOM 1222  C CG   . LEU A 1 109 ? -8.351  -0.485  -6.975  1.00 0.00 ? 132 LEU A CG   1  
ATOM 1223  C CD1  . LEU A 1 109 ? -8.422  -1.098  -5.573  1.00 0.00 ? 132 LEU A CD1  1  
ATOM 1224  C CD2  . LEU A 1 109 ? -8.598  -1.560  -8.047  1.00 0.00 ? 132 LEU A CD2  1  
ATOM 1225  H H    . LEU A 1 109 ? -11.169 2.375   -7.100  1.00 0.00 ? 132 LEU A H    1  
ATOM 1226  H HA   . LEU A 1 109 ? -9.397  1.452   -5.181  1.00 0.00 ? 132 LEU A HA   1  
ATOM 1227  H HB2  . LEU A 1 109 ? -10.393 0.119   -7.061  1.00 0.00 ? 132 LEU A HB2  1  
ATOM 1228  H HB3  . LEU A 1 109 ? -9.312  0.941   -8.186  1.00 0.00 ? 132 LEU A HB3  1  
ATOM 1229  H HG   . LEU A 1 109 ? -7.363  -0.047  -7.128  1.00 0.00 ? 132 LEU A HG   1  
ATOM 1230  H HD11 . LEU A 1 109 ? -9.324  -1.701  -5.475  1.00 0.00 ? 132 LEU A HD11 1  
ATOM 1231  H HD12 . LEU A 1 109 ? -7.551  -1.715  -5.410  1.00 0.00 ? 132 LEU A HD12 1  
ATOM 1232  H HD13 . LEU A 1 109 ? -8.389  -0.332  -4.805  1.00 0.00 ? 132 LEU A HD13 1  
ATOM 1233  H HD21 . LEU A 1 109 ? -8.664  -1.101  -9.037  1.00 0.00 ? 132 LEU A HD21 1  
ATOM 1234  H HD22 . LEU A 1 109 ? -7.783  -2.280  -8.069  1.00 0.00 ? 132 LEU A HD22 1  
ATOM 1235  H HD23 . LEU A 1 109 ? -9.538  -2.084  -7.862  1.00 0.00 ? 132 LEU A HD23 1  
ATOM 1236  N N    . TRP A 1 110 ? -7.929  3.425   -7.388  1.00 0.00 ? 133 TRP A N    1  
ATOM 1237  C CA   . TRP A 1 110 ? -6.743  4.230   -7.625  1.00 0.00 ? 133 TRP A CA   1  
ATOM 1238  C C    . TRP A 1 110 ? -6.481  5.145   -6.429  1.00 0.00 ? 133 TRP A C    1  
ATOM 1239  O O    . TRP A 1 110 ? -5.356  5.219   -5.950  1.00 0.00 ? 133 TRP A O    1  
ATOM 1240  C CB   . TRP A 1 110 ? -6.901  5.012   -8.936  1.00 0.00 ? 133 TRP A CB   1  
ATOM 1241  C CG   . TRP A 1 110 ? -5.624  5.343   -9.641  1.00 0.00 ? 133 TRP A CG   1  
ATOM 1242  C CD1  . TRP A 1 110 ? -5.139  6.582   -9.881  1.00 0.00 ? 133 TRP A CD1  1  
ATOM 1243  C CD2  . TRP A 1 110 ? -4.710  4.421   -10.307 1.00 0.00 ? 133 TRP A CD2  1  
ATOM 1244  N NE1  . TRP A 1 110 ? -3.984  6.491   -10.633 1.00 0.00 ? 133 TRP A NE1  1  
ATOM 1245  C CE2  . TRP A 1 110 ? -3.730  5.186   -11.004 1.00 0.00 ? 133 TRP A CE2  1  
ATOM 1246  C CE3  . TRP A 1 110 ? -4.639  3.015   -10.430 1.00 0.00 ? 133 TRP A CE3  1  
ATOM 1247  C CZ2  . TRP A 1 110 ? -2.789  4.588   -11.854 1.00 0.00 ? 133 TRP A CZ2  1  
ATOM 1248  C CZ3  . TRP A 1 110 ? -3.706  2.406   -11.290 1.00 0.00 ? 133 TRP A CZ3  1  
ATOM 1249  C CH2  . TRP A 1 110 ? -2.796  3.192   -12.018 1.00 0.00 ? 133 TRP A CH2  1  
ATOM 1250  H H    . TRP A 1 110 ? -8.717  3.542   -8.014  1.00 0.00 ? 133 TRP A H    1  
ATOM 1251  H HA   . TRP A 1 110 ? -5.895  3.552   -7.724  1.00 0.00 ? 133 TRP A HA   1  
ATOM 1252  H HB2  . TRP A 1 110 ? -7.475  4.408   -9.640  1.00 0.00 ? 133 TRP A HB2  1  
ATOM 1253  H HB3  . TRP A 1 110 ? -7.471  5.925   -8.758  1.00 0.00 ? 133 TRP A HB3  1  
ATOM 1254  H HD1  . TRP A 1 110 ? -5.595  7.510   -9.564  1.00 0.00 ? 133 TRP A HD1  1  
ATOM 1255  H HE1  . TRP A 1 110 ? -3.425  7.300   -10.886 1.00 0.00 ? 133 TRP A HE1  1  
ATOM 1256  H HE3  . TRP A 1 110 ? -5.321  2.394   -9.868  1.00 0.00 ? 133 TRP A HE3  1  
ATOM 1257  H HZ2  . TRP A 1 110 ? -2.069  5.189   -12.387 1.00 0.00 ? 133 TRP A HZ2  1  
ATOM 1258  H HZ3  . TRP A 1 110 ? -3.696  1.328   -11.406 1.00 0.00 ? 133 TRP A HZ3  1  
ATOM 1259  H HH2  . TRP A 1 110 ? -2.090  2.721   -12.689 1.00 0.00 ? 133 TRP A HH2  1  
ATOM 1260  N N    . ARG A 1 111 ? -7.501  5.835   -5.909  1.00 0.00 ? 134 ARG A N    1  
ATOM 1261  C CA   . ARG A 1 111 ? -7.358  6.665   -4.712  1.00 0.00 ? 134 ARG A CA   1  
ATOM 1262  C C    . ARG A 1 111 ? -7.087  5.808   -3.474  1.00 0.00 ? 134 ARG A C    1  
ATOM 1263  O O    . ARG A 1 111 ? -6.264  6.181   -2.646  1.00 0.00 ? 134 ARG A O    1  
ATOM 1264  C CB   . ARG A 1 111 ? -8.622  7.528   -4.549  1.00 0.00 ? 134 ARG A CB   1  
ATOM 1265  C CG   . ARG A 1 111 ? -8.735  8.243   -3.196  1.00 0.00 ? 134 ARG A CG   1  
ATOM 1266  C CD   . ARG A 1 111 ? -7.564  9.179   -2.862  1.00 0.00 ? 134 ARG A CD   1  
ATOM 1267  N NE   . ARG A 1 111 ? -7.644  9.622   -1.466  1.00 0.00 ? 134 ARG A NE   1  
ATOM 1268  C CZ   . ARG A 1 111 ? -6.643  9.653   -0.579  1.00 0.00 ? 134 ARG A CZ   1  
ATOM 1269  N NH1  . ARG A 1 111 ? -5.370  9.516   -0.914  1.00 0.00 ? 134 ARG A NH1  1  
ATOM 1270  N NH2  . ARG A 1 111 ? -6.917  9.823   0.698   1.00 0.00 ? 134 ARG A NH2  1  
ATOM 1271  H H    . ARG A 1 111 ? -8.426  5.714   -6.302  1.00 0.00 ? 134 ARG A H    1  
ATOM 1272  H HA   . ARG A 1 111 ? -6.500  7.325   -4.853  1.00 0.00 ? 134 ARG A HA   1  
ATOM 1273  H HB2  . ARG A 1 111 ? -8.651  8.269   -5.348  1.00 0.00 ? 134 ARG A HB2  1  
ATOM 1274  H HB3  . ARG A 1 111 ? -9.502  6.894   -4.649  1.00 0.00 ? 134 ARG A HB3  1  
ATOM 1275  H HG2  . ARG A 1 111 ? -9.668  8.808   -3.195  1.00 0.00 ? 134 ARG A HG2  1  
ATOM 1276  H HG3  . ARG A 1 111 ? -8.811  7.493   -2.410  1.00 0.00 ? 134 ARG A HG3  1  
ATOM 1277  H HD2  . ARG A 1 111 ? -6.621  8.657   -3.017  1.00 0.00 ? 134 ARG A HD2  1  
ATOM 1278  H HD3  . ARG A 1 111 ? -7.593  10.043  -3.517  1.00 0.00 ? 134 ARG A HD3  1  
ATOM 1279  H HE   . ARG A 1 111 ? -8.593  9.659   -1.093  1.00 0.00 ? 134 ARG A HE   1  
ATOM 1280  H HH11 . ARG A 1 111 ? -5.045  9.538   -1.879  1.00 0.00 ? 134 ARG A HH11 1  
ATOM 1281  H HH12 . ARG A 1 111 ? -4.683  9.466   -0.153  1.00 0.00 ? 134 ARG A HH12 1  
ATOM 1282  H HH21 . ARG A 1 111 ? -7.850  10.094  0.995   1.00 0.00 ? 134 ARG A HH21 1  
ATOM 1283  H HH22 . ARG A 1 111 ? -6.135  9.804   1.362   1.00 0.00 ? 134 ARG A HH22 1  
ATOM 1284  N N    . LEU A 1 112 ? -7.792  4.685   -3.338  1.00 0.00 ? 135 LEU A N    1  
ATOM 1285  C CA   . LEU A 1 112 ? -7.730  3.750   -2.224  1.00 0.00 ? 135 LEU A CA   1  
ATOM 1286  C C    . LEU A 1 112 ? -6.290  3.301   -2.111  1.00 0.00 ? 135 LEU A C    1  
ATOM 1287  O O    . LEU A 1 112 ? -5.631  3.665   -1.147  1.00 0.00 ? 135 LEU A O    1  
ATOM 1288  C CB   . LEU A 1 112 ? -8.740  2.603   -2.450  1.00 0.00 ? 135 LEU A CB   1  
ATOM 1289  C CG   . LEU A 1 112 ? -9.187  1.846   -1.191  1.00 0.00 ? 135 LEU A CG   1  
ATOM 1290  C CD1  . LEU A 1 112 ? -10.645 1.386   -1.305  1.00 0.00 ? 135 LEU A CD1  1  
ATOM 1291  C CD2  . LEU A 1 112 ? -8.376  0.593   -0.949  1.00 0.00 ? 135 LEU A CD2  1  
ATOM 1292  H H    . LEU A 1 112 ? -8.435  4.468   -4.087  1.00 0.00 ? 135 LEU A H    1  
ATOM 1293  H HA   . LEU A 1 112 ? -7.986  4.279   -1.304  1.00 0.00 ? 135 LEU A HA   1  
ATOM 1294  H HB2  . LEU A 1 112 ? -9.635  3.049   -2.845  1.00 0.00 ? 135 LEU A HB2  1  
ATOM 1295  H HB3  . LEU A 1 112 ? -8.380  1.914   -3.208  1.00 0.00 ? 135 LEU A HB3  1  
ATOM 1296  H HG   . LEU A 1 112 ? -9.080  2.500   -0.331  1.00 0.00 ? 135 LEU A HG   1  
ATOM 1297  H HD11 . LEU A 1 112 ? -11.310 2.246   -1.326  1.00 0.00 ? 135 LEU A HD11 1  
ATOM 1298  H HD12 . LEU A 1 112 ? -10.795 0.791   -2.201  1.00 0.00 ? 135 LEU A HD12 1  
ATOM 1299  H HD13 . LEU A 1 112 ? -10.902 0.790   -0.433  1.00 0.00 ? 135 LEU A HD13 1  
ATOM 1300  H HD21 . LEU A 1 112 ? -8.673  0.168   0.012   1.00 0.00 ? 135 LEU A HD21 1  
ATOM 1301  H HD22 . LEU A 1 112 ? -8.572  -0.132  -1.738  1.00 0.00 ? 135 LEU A HD22 1  
ATOM 1302  H HD23 . LEU A 1 112 ? -7.330  0.877   -0.929  1.00 0.00 ? 135 LEU A HD23 1  
ATOM 1303  N N    . VAL A 1 113 ? -5.783  2.599   -3.125  1.00 0.00 ? 136 VAL A N    1  
ATOM 1304  C CA   . VAL A 1 113 ? -4.420  2.098   -3.172  1.00 0.00 ? 136 VAL A CA   1  
ATOM 1305  C C    . VAL A 1 113 ? -3.412  3.250   -3.050  1.00 0.00 ? 136 VAL A C    1  
ATOM 1306  O O    . VAL A 1 113 ? -2.368  3.047   -2.437  1.00 0.00 ? 136 VAL A O    1  
ATOM 1307  C CB   . VAL A 1 113 ? -4.204  1.225   -4.431  1.00 0.00 ? 136 VAL A CB   1  
ATOM 1308  C CG1  . VAL A 1 113 ? -2.837  0.529   -4.393  1.00 0.00 ? 136 VAL A CG1  1  
ATOM 1309  C CG2  . VAL A 1 113 ? -5.230  0.085   -4.589  1.00 0.00 ? 136 VAL A CG2  1  
ATOM 1310  H H    . VAL A 1 113 ? -6.365  2.422   -3.939  1.00 0.00 ? 136 VAL A H    1  
ATOM 1311  H HA   . VAL A 1 113 ? -4.281  1.463   -2.304  1.00 0.00 ? 136 VAL A HA   1  
ATOM 1312  H HB   . VAL A 1 113 ? -4.260  1.859   -5.316  1.00 0.00 ? 136 VAL A HB   1  
ATOM 1313  H HG11 . VAL A 1 113 ? -2.813  -0.255  -5.148  1.00 0.00 ? 136 VAL A HG11 1  
ATOM 1314  H HG12 . VAL A 1 113 ? -2.045  1.247   -4.595  1.00 0.00 ? 136 VAL A HG12 1  
ATOM 1315  H HG13 . VAL A 1 113 ? -2.666  0.079   -3.411  1.00 0.00 ? 136 VAL A HG13 1  
ATOM 1316  H HG21 . VAL A 1 113 ? -5.171  -0.321  -5.605  1.00 0.00 ? 136 VAL A HG21 1  
ATOM 1317  H HG22 . VAL A 1 113 ? -5.030  -0.705  -3.868  1.00 0.00 ? 136 VAL A HG22 1  
ATOM 1318  H HG23 . VAL A 1 113 ? -6.245  0.433   -4.433  1.00 0.00 ? 136 VAL A HG23 1  
ATOM 1319  N N    . GLN A 1 114 ? -3.701  4.461   -3.548  1.00 0.00 ? 137 GLN A N    1  
ATOM 1320  C CA   . GLN A 1 114 ? -2.822  5.601   -3.304  1.00 0.00 ? 137 GLN A CA   1  
ATOM 1321  C C    . GLN A 1 114 ? -2.719  5.916   -1.817  1.00 0.00 ? 137 GLN A C    1  
ATOM 1322  O O    . GLN A 1 114 ? -1.603  6.082   -1.334  1.00 0.00 ? 137 GLN A O    1  
ATOM 1323  C CB   . GLN A 1 114 ? -3.222  6.848   -4.109  1.00 0.00 ? 137 GLN A CB   1  
ATOM 1324  C CG   . GLN A 1 114 ? -2.643  6.723   -5.518  1.00 0.00 ? 137 GLN A CG   1  
ATOM 1325  C CD   . GLN A 1 114 ? -3.052  7.855   -6.436  1.00 0.00 ? 137 GLN A CD   1  
ATOM 1326  O OE1  . GLN A 1 114 ? -2.306  8.810   -6.627  1.00 0.00 ? 137 GLN A OE1  1  
ATOM 1327  N NE2  . GLN A 1 114 ? -4.215  7.751   -7.042  1.00 0.00 ? 137 GLN A NE2  1  
ATOM 1328  H H    . GLN A 1 114 ? -4.553  4.616   -4.070  1.00 0.00 ? 137 GLN A H    1  
ATOM 1329  H HA   . GLN A 1 114 ? -1.826  5.294   -3.619  1.00 0.00 ? 137 GLN A HA   1  
ATOM 1330  H HB2  . GLN A 1 114 ? -4.305  6.960   -4.143  1.00 0.00 ? 137 GLN A HB2  1  
ATOM 1331  H HB3  . GLN A 1 114 ? -2.790  7.736   -3.641  1.00 0.00 ? 137 GLN A HB3  1  
ATOM 1332  H HG2  . GLN A 1 114 ? -1.557  6.719   -5.451  1.00 0.00 ? 137 GLN A HG2  1  
ATOM 1333  H HG3  . GLN A 1 114 ? -2.974  5.787   -5.963  1.00 0.00 ? 137 GLN A HG3  1  
ATOM 1334  H HE21 . GLN A 1 114 ? -4.766  6.920   -6.868  1.00 0.00 ? 137 GLN A HE21 1  
ATOM 1335  H HE22 . GLN A 1 114 ? -4.515  8.494   -7.661  1.00 0.00 ? 137 GLN A HE22 1  
ATOM 1336  N N    . GLU A 1 115 ? -3.824  5.973   -1.071  1.00 0.00 ? 138 GLU A N    1  
ATOM 1337  C CA   . GLU A 1 115 ? -3.734  6.177   0.369   1.00 0.00 ? 138 GLU A CA   1  
ATOM 1338  C C    . GLU A 1 115 ? -3.019  4.994   1.019   1.00 0.00 ? 138 GLU A C    1  
ATOM 1339  O O    . GLU A 1 115 ? -2.110  5.219   1.815   1.00 0.00 ? 138 GLU A O    1  
ATOM 1340  C CB   . GLU A 1 115 ? -5.108  6.413   1.010   1.00 0.00 ? 138 GLU A CB   1  
ATOM 1341  C CG   . GLU A 1 115 ? -4.963  6.973   2.441   1.00 0.00 ? 138 GLU A CG   1  
ATOM 1342  C CD   . GLU A 1 115 ? -4.167  8.286   2.490   1.00 0.00 ? 138 GLU A CD   1  
ATOM 1343  O OE1  . GLU A 1 115 ? -4.433  9.169   1.646   1.00 0.00 ? 138 GLU A OE1  1  
ATOM 1344  O OE2  . GLU A 1 115 ? -3.294  8.464   3.367   1.00 0.00 ? 138 GLU A OE2  1  
ATOM 1345  H H    . GLU A 1 115 ? -4.734  5.804   -1.492  1.00 0.00 ? 138 GLU A H    1  
ATOM 1346  H HA   . GLU A 1 115 ? -3.122  7.065   0.522   1.00 0.00 ? 138 GLU A HA   1  
ATOM 1347  H HB2  . GLU A 1 115 ? -5.684  7.111   0.405   1.00 0.00 ? 138 GLU A HB2  1  
ATOM 1348  H HB3  . GLU A 1 115 ? -5.653  5.471   1.042   1.00 0.00 ? 138 GLU A HB3  1  
ATOM 1349  H HG2  . GLU A 1 115 ? -5.961  7.156   2.841   1.00 0.00 ? 138 GLU A HG2  1  
ATOM 1350  H HG3  . GLU A 1 115 ? -4.478  6.229   3.075   1.00 0.00 ? 138 GLU A HG3  1  
ATOM 1351  N N    . LEU A 1 116 ? -3.354  3.755   0.628   1.00 0.00 ? 139 LEU A N    1  
ATOM 1352  C CA   . LEU A 1 116 ? -2.725  2.541   1.160   1.00 0.00 ? 139 LEU A CA   1  
ATOM 1353  C C    . LEU A 1 116 ? -1.202  2.584   0.999   1.00 0.00 ? 139 LEU A C    1  
ATOM 1354  O O    . LEU A 1 116 ? -0.464  2.005   1.800   1.00 0.00 ? 139 LEU A O    1  
ATOM 1355  C CB   . LEU A 1 116 ? -3.265  1.261   0.483   1.00 0.00 ? 139 LEU A CB   1  
ATOM 1356  C CG   . LEU A 1 116 ? -4.780  0.998   0.619   1.00 0.00 ? 139 LEU A CG   1  
ATOM 1357  C CD1  . LEU A 1 116 ? -5.183  -0.312  -0.072  1.00 0.00 ? 139 LEU A CD1  1  
ATOM 1358  C CD2  . LEU A 1 116 ? -5.299  1.082   2.051   1.00 0.00 ? 139 LEU A CD2  1  
ATOM 1359  H H    . LEU A 1 116 ? -4.097  3.672   -0.060  1.00 0.00 ? 139 LEU A H    1  
ATOM 1360  H HA   . LEU A 1 116 ? -2.946  2.502   2.224   1.00 0.00 ? 139 LEU A HA   1  
ATOM 1361  H HB2  . LEU A 1 116 ? -3.006  1.296   -0.573  1.00 0.00 ? 139 LEU A HB2  1  
ATOM 1362  H HB3  . LEU A 1 116 ? -2.730  0.408   0.900   1.00 0.00 ? 139 LEU A HB3  1  
ATOM 1363  H HG   . LEU A 1 116 ? -5.314  1.765   0.092   1.00 0.00 ? 139 LEU A HG   1  
ATOM 1364  H HD11 . LEU A 1 116 ? -5.252  -0.142  -1.147  1.00 0.00 ? 139 LEU A HD11 1  
ATOM 1365  H HD12 . LEU A 1 116 ? -4.472  -1.106  0.131   1.00 0.00 ? 139 LEU A HD12 1  
ATOM 1366  H HD13 . LEU A 1 116 ? -6.172  -0.620  0.263   1.00 0.00 ? 139 LEU A HD13 1  
ATOM 1367  H HD21 . LEU A 1 116 ? -4.753  0.398   2.698   1.00 0.00 ? 139 LEU A HD21 1  
ATOM 1368  H HD22 . LEU A 1 116 ? -5.178  2.105   2.416   1.00 0.00 ? 139 LEU A HD22 1  
ATOM 1369  H HD23 . LEU A 1 116 ? -6.364  0.845   2.075   1.00 0.00 ? 139 LEU A HD23 1  
ATOM 1370  N N    . CYS A 1 117 ? -0.718  3.277   -0.027  1.00 0.00 ? 140 CYS A N    1  
ATOM 1371  C CA   . CYS A 1 117 ? 0.682   3.370   -0.367  1.00 0.00 ? 140 CYS A CA   1  
ATOM 1372  C C    . CYS A 1 117 ? 1.280   4.730   -0.016  1.00 0.00 ? 140 CYS A C    1  
ATOM 1373  O O    . CYS A 1 117 ? 2.475   4.905   -0.219  1.00 0.00 ? 140 CYS A O    1  
ATOM 1374  C CB   . CYS A 1 117 ? 0.822   2.987   -1.838  1.00 0.00 ? 140 CYS A CB   1  
ATOM 1375  S SG   . CYS A 1 117 ? 0.877   1.190   -2.017  1.00 0.00 ? 140 CYS A SG   1  
ATOM 1376  H H    . CYS A 1 117 ? -1.366  3.711   -0.675  1.00 0.00 ? 140 CYS A H    1  
ATOM 1377  H HA   . CYS A 1 117 ? 1.250   2.639   0.208   1.00 0.00 ? 140 CYS A HA   1  
ATOM 1378  H HB2  . CYS A 1 117 ? 0.002   3.402   -2.420  1.00 0.00 ? 140 CYS A HB2  1  
ATOM 1379  H HB3  . CYS A 1 117 ? 1.737   3.403   -2.242  1.00 0.00 ? 140 CYS A HB3  1  
ATOM 1380  N N    . SER A 1 118 ? 0.510   5.662   0.539   1.00 0.00 ? 141 SER A N    1  
ATOM 1381  C CA   . SER A 1 118 ? 0.976   6.943   1.043   1.00 0.00 ? 141 SER A CA   1  
ATOM 1382  C C    . SER A 1 118 ? 1.044   6.842   2.561   1.00 0.00 ? 141 SER A C    1  
ATOM 1383  O O    . SER A 1 118 ? 2.135   6.862   3.129   1.00 0.00 ? 141 SER A O    1  
ATOM 1384  C CB   . SER A 1 118 ? 0.027   8.052   0.563   1.00 0.00 ? 141 SER A CB   1  
ATOM 1385  O OG   . SER A 1 118 ? 0.468   9.336   0.960   1.00 0.00 ? 141 SER A OG   1  
ATOM 1386  H H    . SER A 1 118 ? -0.468  5.444   0.683   1.00 0.00 ? 141 SER A H    1  
ATOM 1387  H HA   . SER A 1 118 ? 1.975   7.151   0.660   1.00 0.00 ? 141 SER A HA   1  
ATOM 1388  H HB2  . SER A 1 118 ? -0.016  8.030   -0.527  1.00 0.00 ? 141 SER A HB2  1  
ATOM 1389  H HB3  . SER A 1 118 ? -0.975  7.882   0.956   1.00 0.00 ? 141 SER A HB3  1  
ATOM 1390  H HG   . SER A 1 118 ? 0.402   9.409   1.923   1.00 0.00 ? 141 SER A HG   1  
ATOM 1391  N N    . LEU A 1 119 ? -0.123  6.692   3.200   1.00 0.00 ? 142 LEU A N    1  
ATOM 1392  C CA   . LEU A 1 119 ? -0.343  6.735   4.631   1.00 0.00 ? 142 LEU A CA   1  
ATOM 1393  C C    . LEU A 1 119 ? 0.365   7.912   5.318   1.00 0.00 ? 142 LEU A C    1  
ATOM 1394  O O    . LEU A 1 119 ? 0.765   8.886   4.673   1.00 0.00 ? 142 LEU A O    1  
ATOM 1395  C CB   . LEU A 1 119 ? -0.006  5.335   5.188   1.00 0.00 ? 142 LEU A CB   1  
ATOM 1396  C CG   . LEU A 1 119 ? -1.169  4.623   5.885   1.00 0.00 ? 142 LEU A CG   1  
ATOM 1397  C CD1  . LEU A 1 119 ? -1.656  5.331   7.153   1.00 0.00 ? 142 LEU A CD1  1  
ATOM 1398  C CD2  . LEU A 1 119 ? -2.342  4.357   4.946   1.00 0.00 ? 142 LEU A CD2  1  
ATOM 1399  H H    . LEU A 1 119 ? -0.954  6.407   2.695   1.00 0.00 ? 142 LEU A H    1  
ATOM 1400  H HA   . LEU A 1 119 ? -1.408  6.915   4.757   1.00 0.00 ? 142 LEU A HA   1  
ATOM 1401  H HB2  . LEU A 1 119 ? 0.308   4.689   4.371   1.00 0.00 ? 142 LEU A HB2  1  
ATOM 1402  H HB3  . LEU A 1 119 ? 0.854   5.378   5.850   1.00 0.00 ? 142 LEU A HB3  1  
ATOM 1403  H HG   . LEU A 1 119 ? -0.778  3.656   6.169   1.00 0.00 ? 142 LEU A HG   1  
ATOM 1404  H HD11 . LEU A 1 119 ? -0.829  5.511   7.830   1.00 0.00 ? 142 LEU A HD11 1  
ATOM 1405  H HD12 . LEU A 1 119 ? -2.139  6.275   6.904   1.00 0.00 ? 142 LEU A HD12 1  
ATOM 1406  H HD13 . LEU A 1 119 ? -2.382  4.701   7.667   1.00 0.00 ? 142 LEU A HD13 1  
ATOM 1407  H HD21 . LEU A 1 119 ? -1.993  3.815   4.067   1.00 0.00 ? 142 LEU A HD21 1  
ATOM 1408  H HD22 . LEU A 1 119 ? -3.066  3.740   5.468   1.00 0.00 ? 142 LEU A HD22 1  
ATOM 1409  H HD23 . LEU A 1 119 ? -2.818  5.286   4.635   1.00 0.00 ? 142 LEU A HD23 1  
ATOM 1410  N N    . LYS A 1 120 ? 0.469   7.798   6.647   1.00 0.00 ? 143 LYS A N    1  
ATOM 1411  C CA   . LYS A 1 120 ? 1.307   8.553   7.575   1.00 0.00 ? 143 LYS A CA   1  
ATOM 1412  C C    . LYS A 1 120 ? 2.593   9.042   6.904   1.00 0.00 ? 143 LYS A C    1  
ATOM 1413  O O    . LYS A 1 120 ? 2.642   10.199  6.480   1.00 0.00 ? 143 LYS A O    1  
ATOM 1414  C CB   . LYS A 1 120 ? 1.509   7.714   8.864   1.00 0.00 ? 143 LYS A CB   1  
ATOM 1415  C CG   . LYS A 1 120 ? 2.092   6.292   8.657   1.00 0.00 ? 143 LYS A CG   1  
ATOM 1416  C CD   . LYS A 1 120 ? 1.439   5.194   9.516   1.00 0.00 ? 143 LYS A CD   1  
ATOM 1417  C CE   . LYS A 1 120 ? 1.534   3.820   8.827   1.00 0.00 ? 143 LYS A CE   1  
ATOM 1418  N NZ   . LYS A 1 120 ? 0.790   2.770   9.557   1.00 0.00 ? 143 LYS A NZ   1  
ATOM 1419  H H    . LYS A 1 120 ? -0.037  7.023   7.045   1.00 0.00 ? 143 LYS A H    1  
ATOM 1420  H HA   . LYS A 1 120 ? 0.752   9.448   7.861   1.00 0.00 ? 143 LYS A HA   1  
ATOM 1421  H HB2  . LYS A 1 120 ? 2.151   8.262   9.555   1.00 0.00 ? 143 LYS A HB2  1  
ATOM 1422  H HB3  . LYS A 1 120 ? 0.534   7.632   9.345   1.00 0.00 ? 143 LYS A HB3  1  
ATOM 1423  H HG2  . LYS A 1 120 ? 1.995   6.004   7.615   1.00 0.00 ? 143 LYS A HG2  1  
ATOM 1424  H HG3  . LYS A 1 120 ? 3.158   6.314   8.871   1.00 0.00 ? 143 LYS A HG3  1  
ATOM 1425  H HD2  . LYS A 1 120 ? 1.937   5.162   10.485  1.00 0.00 ? 143 LYS A HD2  1  
ATOM 1426  H HD3  . LYS A 1 120 ? 0.389   5.428   9.673   1.00 0.00 ? 143 LYS A HD3  1  
ATOM 1427  H HE2  . LYS A 1 120 ? 1.127   3.899   7.817   1.00 0.00 ? 143 LYS A HE2  1  
ATOM 1428  H HE3  . LYS A 1 120 ? 2.586   3.536   8.760   1.00 0.00 ? 143 LYS A HE3  1  
ATOM 1429  H HZ1  . LYS A 1 120 ? 0.808   1.865   9.105   1.00 0.00 ? 143 LYS A HZ1  1  
ATOM 1430  H HZ2  . LYS A 1 120 ? 1.179   2.616   10.481  1.00 0.00 ? 143 LYS A HZ2  1  
ATOM 1431  H HZ3  . LYS A 1 120 ? -0.189  3.003   9.727   1.00 0.00 ? 143 LYS A HZ3  1  
ATOM 1432  N N    . HIS A 1 121 ? 3.611   8.190   6.779   1.00 0.00 ? 144 HIS A N    1  
ATOM 1433  C CA   . HIS A 1 121 ? 4.791   8.391   5.950   1.00 0.00 ? 144 HIS A CA   1  
ATOM 1434  C C    . HIS A 1 121 ? 5.527   7.051   5.792   1.00 0.00 ? 144 HIS A C    1  
ATOM 1435  O O    . HIS A 1 121 ? 5.117   6.036   6.372   1.00 0.00 ? 144 HIS A O    1  
ATOM 1436  C CB   . HIS A 1 121 ? 5.719   9.452   6.564   1.00 0.00 ? 144 HIS A CB   1  
ATOM 1437  C CG   . HIS A 1 121 ? 6.330   9.049   7.887   1.00 0.00 ? 144 HIS A CG   1  
ATOM 1438  N ND1  . HIS A 1 121 ? 5.766   9.184   9.133   1.00 0.00 ? 144 HIS A ND1  1  
ATOM 1439  C CD2  . HIS A 1 121 ? 7.595   8.570   8.073   1.00 0.00 ? 144 HIS A CD2  1  
ATOM 1440  C CE1  . HIS A 1 121 ? 6.665   8.751   10.035  1.00 0.00 ? 144 HIS A CE1  1  
ATOM 1441  N NE2  . HIS A 1 121 ? 7.785   8.336   9.431   1.00 0.00 ? 144 HIS A NE2  1  
ATOM 1442  H H    . HIS A 1 121 ? 3.535   7.255   7.146   1.00 0.00 ? 144 HIS A H    1  
ATOM 1443  H HA   . HIS A 1 121 ? 4.459   8.734   4.971   1.00 0.00 ? 144 HIS A HA   1  
ATOM 1444  H HB2  . HIS A 1 121 ? 6.508   9.650   5.840   1.00 0.00 ? 144 HIS A HB2  1  
ATOM 1445  H HB3  . HIS A 1 121 ? 5.190   10.396  6.690   1.00 0.00 ? 144 HIS A HB3  1  
ATOM 1446  H HD1  . HIS A 1 121 ? 4.846   9.578   9.338   1.00 0.00 ? 144 HIS A HD1  1  
ATOM 1447  H HD2  . HIS A 1 121 ? 8.339   8.451   7.310   1.00 0.00 ? 144 HIS A HD2  1  
ATOM 1448  H HE1  . HIS A 1 121 ? 6.528   8.711   11.101  1.00 0.00 ? 144 HIS A HE1  1  
ATOM 1449  N N    . CYS A 1 122 ? 6.635   7.050   5.046   1.00 0.00 ? 145 CYS A N    1  
ATOM 1450  C CA   . CYS A 1 122 ? 7.603   5.957   4.990   1.00 0.00 ? 145 CYS A CA   1  
ATOM 1451  C C    . CYS A 1 122 ? 8.618   6.155   6.124   1.00 0.00 ? 145 CYS A C    1  
ATOM 1452  O O    . CYS A 1 122 ? 8.344   5.703   7.239   1.00 0.00 ? 145 CYS A O    1  
ATOM 1453  C CB   . CYS A 1 122 ? 8.170   5.866   3.565   1.00 0.00 ? 145 CYS A CB   1  
ATOM 1454  S SG   . CYS A 1 122 ? 9.808   5.152   3.294   1.00 0.00 ? 145 CYS A SG   1  
ATOM 1455  H H    . CYS A 1 122 ? 6.898   7.927   4.615   1.00 0.00 ? 145 CYS A H    1  
ATOM 1456  H HA   . CYS A 1 122 ? 7.092   5.014   5.185   1.00 0.00 ? 145 CYS A HA   1  
ATOM 1457  H HB2  . CYS A 1 122 ? 7.457   5.293   2.972   1.00 0.00 ? 145 CYS A HB2  1  
ATOM 1458  H HB3  . CYS A 1 122 ? 8.200   6.855   3.139   1.00 0.00 ? 145 CYS A HB3  1  
ATOM 1459  N N    . GLU A 1 123 ? 9.723   6.879   5.896   1.00 0.00 ? 146 GLU A N    1  
ATOM 1460  C CA   . GLU A 1 123 ? 10.777  7.064   6.895   1.00 0.00 ? 146 GLU A CA   1  
ATOM 1461  C C    . GLU A 1 123 ? 11.419  8.448   6.845   1.00 0.00 ? 146 GLU A C    1  
ATOM 1462  O O    . GLU A 1 123 ? 11.288  9.197   7.809   1.00 0.00 ? 146 GLU A O    1  
ATOM 1463  C CB   . GLU A 1 123 ? 11.870  5.984   6.726   1.00 0.00 ? 146 GLU A CB   1  
ATOM 1464  C CG   . GLU A 1 123 ? 11.695  4.735   7.599   1.00 0.00 ? 146 GLU A CG   1  
ATOM 1465  C CD   . GLU A 1 123 ? 12.883  3.773   7.420   1.00 0.00 ? 146 GLU A CD   1  
ATOM 1466  O OE1  . GLU A 1 123 ? 12.863  2.955   6.472   1.00 0.00 ? 146 GLU A OE1  1  
ATOM 1467  O OE2  . GLU A 1 123 ? 13.836  3.787   8.233   1.00 0.00 ? 146 GLU A OE2  1  
ATOM 1468  H H    . GLU A 1 123 ? 9.904   7.218   4.964   1.00 0.00 ? 146 GLU A H    1  
ATOM 1469  H HA   . GLU A 1 123 ? 10.312  7.007   7.880   1.00 0.00 ? 146 GLU A HA   1  
ATOM 1470  H HB2  . GLU A 1 123 ? 11.910  5.686   5.678   1.00 0.00 ? 146 GLU A HB2  1  
ATOM 1471  H HB3  . GLU A 1 123 ? 12.838  6.420   6.971   1.00 0.00 ? 146 GLU A HB3  1  
ATOM 1472  H HG2  . GLU A 1 123 ? 11.630  5.040   8.645   1.00 0.00 ? 146 GLU A HG2  1  
ATOM 1473  H HG3  . GLU A 1 123 ? 10.763  4.229   7.332   1.00 0.00 ? 146 GLU A HG3  1  
ATOM 1474  N N    . PHE A 1 124 ? 12.187  8.758   5.791   1.00 0.00 ? 147 PHE A N    1  
ATOM 1475  C CA   . PHE A 1 124 ? 13.076  9.927   5.791   1.00 0.00 ? 147 PHE A CA   1  
ATOM 1476  C C    . PHE A 1 124 ? 12.277  11.224  5.934   1.00 0.00 ? 147 PHE A C    1  
ATOM 1477  O O    . PHE A 1 124 ? 12.689  12.169  6.604   1.00 0.00 ? 147 PHE A O    1  
ATOM 1478  C CB   . PHE A 1 124 ? 13.953  9.930   4.519   1.00 0.00 ? 147 PHE A CB   1  
ATOM 1479  C CG   . PHE A 1 124 ? 13.722  11.061  3.522   1.00 0.00 ? 147 PHE A CG   1  
ATOM 1480  C CD1  . PHE A 1 124 ? 14.173  12.361  3.821   1.00 0.00 ? 147 PHE A CD1  1  
ATOM 1481  C CD2  . PHE A 1 124 ? 13.053  10.824  2.306   1.00 0.00 ? 147 PHE A CD2  1  
ATOM 1482  C CE1  . PHE A 1 124 ? 13.946  13.417  2.922   1.00 0.00 ? 147 PHE A CE1  1  
ATOM 1483  C CE2  . PHE A 1 124 ? 12.823  11.885  1.412   1.00 0.00 ? 147 PHE A CE2  1  
ATOM 1484  C CZ   . PHE A 1 124 ? 13.272  13.179  1.716   1.00 0.00 ? 147 PHE A CZ   1  
ATOM 1485  H H    . PHE A 1 124 ? 12.321  8.053   5.080   1.00 0.00 ? 147 PHE A H    1  
ATOM 1486  H HA   . PHE A 1 124 ? 13.732  9.844   6.660   1.00 0.00 ? 147 PHE A HA   1  
ATOM 1487  H HB2  . PHE A 1 124 ? 14.995  9.975   4.837   1.00 0.00 ? 147 PHE A HB2  1  
ATOM 1488  H HB3  . PHE A 1 124 ? 13.823  8.982   4.000   1.00 0.00 ? 147 PHE A HB3  1  
ATOM 1489  H HD1  . PHE A 1 124 ? 14.691  12.549  4.751   1.00 0.00 ? 147 PHE A HD1  1  
ATOM 1490  H HD2  . PHE A 1 124 ? 12.720  9.826   2.053   1.00 0.00 ? 147 PHE A HD2  1  
ATOM 1491  H HE1  . PHE A 1 124 ? 14.296  14.412  3.143   1.00 0.00 ? 147 PHE A HE1  1  
ATOM 1492  H HE2  . PHE A 1 124 ? 12.315  11.725  0.476   1.00 0.00 ? 147 PHE A HE2  1  
ATOM 1493  H HZ   . PHE A 1 124 ? 13.106  13.989  1.017   1.00 0.00 ? 147 PHE A HZ   1  
ATOM 1494  N N    . TRP A 1 125 ? 11.153  11.278  5.236   1.00 0.00 ? 148 TRP A N    1  
ATOM 1495  C CA   . TRP A 1 125 ? 10.107  12.269  5.301   1.00 0.00 ? 148 TRP A CA   1  
ATOM 1496  C C    . TRP A 1 125 ? 9.136   11.755  6.352   1.00 0.00 ? 148 TRP A C    1  
ATOM 1497  O O    . TRP A 1 125 ? 8.771   10.582  6.308   1.00 0.00 ? 148 TRP A O    1  
ATOM 1498  C CB   . TRP A 1 125 ? 9.447   12.346  3.919   1.00 0.00 ? 148 TRP A CB   1  
ATOM 1499  C CG   . TRP A 1 125 ? 8.934   11.051  3.347   1.00 0.00 ? 148 TRP A CG   1  
ATOM 1500  C CD1  . TRP A 1 125 ? 9.691   9.982   2.991   1.00 0.00 ? 148 TRP A CD1  1  
ATOM 1501  C CD2  . TRP A 1 125 ? 7.546   10.637  3.133   1.00 0.00 ? 148 TRP A CD2  1  
ATOM 1502  N NE1  . TRP A 1 125 ? 8.894   9.044   2.388   1.00 0.00 ? 148 TRP A NE1  1  
ATOM 1503  C CE2  . TRP A 1 125 ? 7.561   9.345   2.540   1.00 0.00 ? 148 TRP A CE2  1  
ATOM 1504  C CE3  . TRP A 1 125 ? 6.274   11.193  3.399   1.00 0.00 ? 148 TRP A CE3  1  
ATOM 1505  C CZ2  . TRP A 1 125 ? 6.397   8.654   2.192   1.00 0.00 ? 148 TRP A CZ2  1  
ATOM 1506  C CZ3  . TRP A 1 125 ? 5.089   10.508  3.058   1.00 0.00 ? 148 TRP A CZ3  1  
ATOM 1507  C CH2  . TRP A 1 125 ? 5.147   9.240   2.447   1.00 0.00 ? 148 TRP A CH2  1  
ATOM 1508  H H    . TRP A 1 125 ? 10.872  10.423  4.789   1.00 0.00 ? 148 TRP A H    1  
ATOM 1509  H HA   . TRP A 1 125 ? 10.512  13.242  5.581   1.00 0.00 ? 148 TRP A HA   1  
ATOM 1510  H HB2  . TRP A 1 125 ? 8.619   13.052  3.967   1.00 0.00 ? 148 TRP A HB2  1  
ATOM 1511  H HB3  . TRP A 1 125 ? 10.178  12.751  3.218   1.00 0.00 ? 148 TRP A HB3  1  
ATOM 1512  H HD1  . TRP A 1 125 ? 10.760  9.864   3.106   1.00 0.00 ? 148 TRP A HD1  1  
ATOM 1513  H HE1  . TRP A 1 125 ? 9.252   8.262   1.851   1.00 0.00 ? 148 TRP A HE1  1  
ATOM 1514  H HE3  . TRP A 1 125 ? 6.214   12.154  3.889   1.00 0.00 ? 148 TRP A HE3  1  
ATOM 1515  H HZ2  . TRP A 1 125 ? 6.506   7.714   1.668   1.00 0.00 ? 148 TRP A HZ2  1  
ATOM 1516  H HZ3  . TRP A 1 125 ? 4.127   10.958  3.272   1.00 0.00 ? 148 TRP A HZ3  1  
ATOM 1517  H HH2  . TRP A 1 125 ? 4.236   8.724   2.172   1.00 0.00 ? 148 TRP A HH2  1  
ATOM 1518  N N    . LEU A 1 126 ? 8.761   12.602  7.306   1.00 0.00 ? 149 LEU A N    1  
ATOM 1519  C CA   . LEU A 1 126 ? 7.908   12.245  8.425   1.00 0.00 ? 149 LEU A CA   1  
ATOM 1520  C C    . LEU A 1 126 ? 7.061   13.437  8.849   1.00 0.00 ? 149 LEU A C    1  
ATOM 1521  O O    . LEU A 1 126 ? 7.397   14.585  8.550   1.00 0.00 ? 149 LEU A O    1  
ATOM 1522  C CB   . LEU A 1 126 ? 8.695   11.674  9.615   1.00 0.00 ? 149 LEU A CB   1  
ATOM 1523  C CG   . LEU A 1 126 ? 9.782   12.579  10.207  1.00 0.00 ? 149 LEU A CG   1  
ATOM 1524  C CD1  . LEU A 1 126 ? 9.984   12.271  11.688  1.00 0.00 ? 149 LEU A CD1  1  
ATOM 1525  C CD2  . LEU A 1 126 ? 11.096  12.368  9.456   1.00 0.00 ? 149 LEU A CD2  1  
ATOM 1526  H H    . LEU A 1 126 ? 9.047   13.569  7.249   1.00 0.00 ? 149 LEU A H    1  
ATOM 1527  H HA   . LEU A 1 126 ? 7.266   11.450  8.087   1.00 0.00 ? 149 LEU A HA   1  
ATOM 1528  H HB2  . LEU A 1 126 ? 7.976   11.422  10.391  1.00 0.00 ? 149 LEU A HB2  1  
ATOM 1529  H HB3  . LEU A 1 126 ? 9.153   10.737  9.317   1.00 0.00 ? 149 LEU A HB3  1  
ATOM 1530  H HG   . LEU A 1 126 ? 9.488   13.617  10.114  1.00 0.00 ? 149 LEU A HG   1  
ATOM 1531  H HD11 . LEU A 1 126 ? 10.878  12.762  12.064  1.00 0.00 ? 149 LEU A HD11 1  
ATOM 1532  H HD12 . LEU A 1 126 ? 9.129   12.638  12.254  1.00 0.00 ? 149 LEU A HD12 1  
ATOM 1533  H HD13 . LEU A 1 126 ? 10.064  11.196  11.840  1.00 0.00 ? 149 LEU A HD13 1  
ATOM 1534  H HD21 . LEU A 1 126 ? 11.916  12.918  9.915   1.00 0.00 ? 149 LEU A HD21 1  
ATOM 1535  H HD22 . LEU A 1 126 ? 11.332  11.306  9.408   1.00 0.00 ? 149 LEU A HD22 1  
ATOM 1536  H HD23 . LEU A 1 126 ? 10.967  12.708  8.434   1.00 0.00 ? 149 LEU A HD23 1  
ATOM 1537  N N    . GLU A 1 127 ? 5.989   13.180  9.594   1.00 0.00 ? 150 GLU A N    1  
ATOM 1538  C CA   . GLU A 1 127 ? 5.241   14.244  10.247  1.00 0.00 ? 150 GLU A CA   1  
ATOM 1539  C C    . GLU A 1 127 ? 6.187   14.931  11.233  1.00 0.00 ? 150 GLU A C    1  
ATOM 1540  O O    . GLU A 1 127 ? 6.881   14.249  11.994  1.00 0.00 ? 150 GLU A O    1  
ATOM 1541  C CB   . GLU A 1 127 ? 3.999   13.644  10.917  1.00 0.00 ? 150 GLU A CB   1  
ATOM 1542  C CG   . GLU A 1 127 ? 3.154   14.639  11.707  1.00 0.00 ? 150 GLU A CG   1  
ATOM 1543  C CD   . GLU A 1 127 ? 2.695   15.822  10.858  1.00 0.00 ? 150 GLU A CD   1  
ATOM 1544  O OE1  . GLU A 1 127 ? 1.864   15.637  9.936   1.00 0.00 ? 150 GLU A OE1  1  
ATOM 1545  O OE2  . GLU A 1 127 ? 3.160   16.947  11.114  1.00 0.00 ? 150 GLU A OE2  1  
ATOM 1546  H H    . GLU A 1 127 ? 5.821   12.235  9.907   1.00 0.00 ? 150 GLU A H    1  
ATOM 1547  H HA   . GLU A 1 127 ? 4.929   14.961  9.486   1.00 0.00 ? 150 GLU A HA   1  
ATOM 1548  H HB2  . GLU A 1 127 ? 3.370   13.216  10.141  1.00 0.00 ? 150 GLU A HB2  1  
ATOM 1549  H HB3  . GLU A 1 127 ? 4.297   12.844  11.592  1.00 0.00 ? 150 GLU A HB3  1  
ATOM 1550  H HG2  . GLU A 1 127 ? 2.281   14.110  12.088  1.00 0.00 ? 150 GLU A HG2  1  
ATOM 1551  H HG3  . GLU A 1 127 ? 3.729   14.997  12.561  1.00 0.00 ? 150 GLU A HG3  1  
ATOM 1552  N N    . ALA A 1 29  ? 2.126   -15.592 -4.261  1.00 0.00 ? 52  ALA A N    2  
ATOM 1553  C CA   . ALA A 1 29  ? 1.989   -14.371 -5.046  1.00 0.00 ? 52  ALA A CA   2  
ATOM 1554  C C    . ALA A 1 29  ? 1.363   -13.266 -4.203  1.00 0.00 ? 52  ALA A C    2  
ATOM 1555  O O    . ALA A 1 29  ? 1.135   -12.171 -4.700  1.00 0.00 ? 52  ALA A O    2  
ATOM 1556  C CB   . ALA A 1 29  ? 1.198   -14.609 -6.332  1.00 0.00 ? 52  ALA A CB   2  
ATOM 1557  H H    . ALA A 1 29  ? 1.319   -16.181 -4.099  1.00 0.00 ? 52  ALA A H    2  
ATOM 1558  H HA   . ALA A 1 29  ? 2.977   -14.029 -5.349  1.00 0.00 ? 52  ALA A HA   2  
ATOM 1559  H HB1  . ALA A 1 29  ? 0.142   -14.719 -6.105  1.00 0.00 ? 52  ALA A HB1  2  
ATOM 1560  H HB2  . ALA A 1 29  ? 1.317   -13.757 -6.998  1.00 0.00 ? 52  ALA A HB2  2  
ATOM 1561  H HB3  . ALA A 1 29  ? 1.577   -15.493 -6.841  1.00 0.00 ? 52  ALA A HB3  2  
ATOM 1562  N N    . GLU A 1 30  ? 1.108   -13.492 -2.918  1.00 0.00 ? 53  GLU A N    2  
ATOM 1563  C CA   . GLU A 1 30  ? 0.843   -12.384 -2.002  1.00 0.00 ? 53  GLU A CA   2  
ATOM 1564  C C    . GLU A 1 30  ? 2.162   -11.615 -1.804  1.00 0.00 ? 53  GLU A C    2  
ATOM 1565  O O    . GLU A 1 30  ? 2.172   -10.402 -1.671  1.00 0.00 ? 53  GLU A O    2  
ATOM 1566  C CB   . GLU A 1 30  ? 0.162   -12.878 -0.713  1.00 0.00 ? 53  GLU A CB   2  
ATOM 1567  C CG   . GLU A 1 30  ? -0.963  -13.873 -1.068  1.00 0.00 ? 53  GLU A CG   2  
ATOM 1568  C CD   . GLU A 1 30  ? -2.019  -14.156 -0.003  1.00 0.00 ? 53  GLU A CD   2  
ATOM 1569  O OE1  . GLU A 1 30  ? -2.118  -13.454 1.030   1.00 0.00 ? 53  GLU A OE1  2  
ATOM 1570  O OE2  . GLU A 1 30  ? -2.819  -15.088 -0.220  1.00 0.00 ? 53  GLU A OE2  2  
ATOM 1571  H H    . GLU A 1 30  ? 1.335   -14.391 -2.523  1.00 0.00 ? 53  GLU A H    2  
ATOM 1572  H HA   . GLU A 1 30  ? 0.138   -11.703 -2.481  1.00 0.00 ? 53  GLU A HA   2  
ATOM 1573  H HB2  . GLU A 1 30  ? 0.889   -13.347 -0.056  1.00 0.00 ? 53  GLU A HB2  2  
ATOM 1574  H HB3  . GLU A 1 30  ? -0.267  -12.017 -0.209  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 1575  H HG2  . GLU A 1 30  ? -1.497  -13.488 -1.930  1.00 0.00 ? 53  GLU A HG2  2  
ATOM 1576  H HG3  . GLU A 1 30  ? -0.518  -14.825 -1.370  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 1577  N N    . ASN A 1 31  ? 3.305   -12.277 -1.996  1.00 0.00 ? 54  ASN A N    2  
ATOM 1578  C CA   . ASN A 1 31  ? 4.627   -11.662 -2.128  1.00 0.00 ? 54  ASN A CA   2  
ATOM 1579  C C    . ASN A 1 31  ? 4.778   -10.768 -3.369  1.00 0.00 ? 54  ASN A C    2  
ATOM 1580  O O    . ASN A 1 31  ? 5.854   -10.192 -3.555  1.00 0.00 ? 54  ASN A O    2  
ATOM 1581  C CB   . ASN A 1 31  ? 5.687   -12.776 -2.179  1.00 0.00 ? 54  ASN A CB   2  
ATOM 1582  C CG   . ASN A 1 31  ? 6.226   -13.138 -0.805  1.00 0.00 ? 54  ASN A CG   2  
ATOM 1583  O OD1  . ASN A 1 31  ? 6.674   -12.260 -0.071  1.00 0.00 ? 54  ASN A OD1  2  
ATOM 1584  N ND2  . ASN A 1 31  ? 6.219   -14.403 -0.428  1.00 0.00 ? 54  ASN A ND2  2  
ATOM 1585  H H    . ASN A 1 31  ? 3.235   -13.290 -2.067  1.00 0.00 ? 54  ASN A H    2  
ATOM 1586  H HA   . ASN A 1 31  ? 4.806   -11.030 -1.256  1.00 0.00 ? 54  ASN A HA   2  
ATOM 1587  H HB2  . ASN A 1 31  ? 5.246   -13.636 -2.665  1.00 0.00 ? 54  ASN A HB2  2  
ATOM 1588  H HB3  . ASN A 1 31  ? 6.544   -12.460 -2.774  1.00 0.00 ? 54  ASN A HB3  2  
ATOM 1589  H HD21 . ASN A 1 31  ? 5.926   -15.132 -1.080  1.00 0.00 ? 54  ASN A HD21 2  
ATOM 1590  H HD22 . ASN A 1 31  ? 6.629   -14.660 0.459   1.00 0.00 ? 54  ASN A HD22 2  
ATOM 1591  N N    . ARG A 1 32  ? 3.770   -10.654 -4.248  1.00 0.00 ? 55  ARG A N    2  
ATOM 1592  C CA   . ARG A 1 32  ? 3.790   -9.702  -5.364  1.00 0.00 ? 55  ARG A CA   2  
ATOM 1593  C C    . ARG A 1 32  ? 4.091   -8.315  -4.810  1.00 0.00 ? 55  ARG A C    2  
ATOM 1594  O O    . ARG A 1 32  ? 3.537   -7.928  -3.777  1.00 0.00 ? 55  ARG A O    2  
ATOM 1595  C CB   . ARG A 1 32  ? 2.428   -9.672  -6.077  1.00 0.00 ? 55  ARG A CB   2  
ATOM 1596  C CG   . ARG A 1 32  ? 2.222   -10.714 -7.186  1.00 0.00 ? 55  ARG A CG   2  
ATOM 1597  C CD   . ARG A 1 32  ? 0.801   -10.752 -7.791  1.00 0.00 ? 55  ARG A CD   2  
ATOM 1598  N NE   . ARG A 1 32  ? -0.257  -11.039 -6.809  1.00 0.00 ? 55  ARG A NE   2  
ATOM 1599  C CZ   . ARG A 1 32  ? -1.579  -10.810 -6.885  1.00 0.00 ? 55  ARG A CZ   2  
ATOM 1600  N NH1  . ARG A 1 32  ? -2.144  -10.282 -7.962  1.00 0.00 ? 55  ARG A NH1  2  
ATOM 1601  N NH2  . ARG A 1 32  ? -2.362  -11.079 -5.853  1.00 0.00 ? 55  ARG A NH2  2  
ATOM 1602  H H    . ARG A 1 32  ? 2.892   -11.098 -4.015  1.00 0.00 ? 55  ARG A H    2  
ATOM 1603  H HA   . ARG A 1 32  ? 4.584   -9.981  -6.057  1.00 0.00 ? 55  ARG A HA   2  
ATOM 1604  H HB2  . ARG A 1 32  ? 1.713   -9.839  -5.310  1.00 0.00 ? 55  ARG A HB2  2  
ATOM 1605  H HB3  . ARG A 1 32  ? 2.193   -8.678  -6.446  1.00 0.00 ? 55  ARG A HB3  2  
ATOM 1606  H HG2  . ARG A 1 32  ? 2.922   -10.501 -7.991  1.00 0.00 ? 55  ARG A HG2  2  
ATOM 1607  H HG3  . ARG A 1 32  ? 2.461   -11.697 -6.789  1.00 0.00 ? 55  ARG A HG3  2  
ATOM 1608  H HD2  . ARG A 1 32  ? 0.595   -9.797  -8.256  1.00 0.00 ? 55  ARG A HD2  2  
ATOM 1609  H HD3  . ARG A 1 32  ? 0.791   -11.540 -8.541  1.00 0.00 ? 55  ARG A HD3  2  
ATOM 1610  H HE   . ARG A 1 32  ? 0.108   -11.459 -5.961  1.00 0.00 ? 55  ARG A HE   2  
ATOM 1611  H HH11 . ARG A 1 32  ? -1.624  -10.153 -8.824  1.00 0.00 ? 55  ARG A HH11 2  
ATOM 1612  H HH12 . ARG A 1 32  ? -3.157  -10.146 -8.039  1.00 0.00 ? 55  ARG A HH12 2  
ATOM 1613  H HH21 . ARG A 1 32  ? -2.121  -11.699 -5.076  1.00 0.00 ? 55  ARG A HH21 2  
ATOM 1614  H HH22 . ARG A 1 32  ? -3.341  -10.790 -5.842  1.00 0.00 ? 55  ARG A HH22 2  
ATOM 1615  N N    . PRO A 1 33  ? 4.808   -7.480  -5.570  1.00 0.00 ? 56  PRO A N    2  
ATOM 1616  C CA   . PRO A 1 33  ? 5.254   -6.165  -5.139  1.00 0.00 ? 56  PRO A CA   2  
ATOM 1617  C C    . PRO A 1 33  ? 4.100   -5.154  -5.069  1.00 0.00 ? 56  PRO A C    2  
ATOM 1618  O O    . PRO A 1 33  ? 4.303   -3.962  -4.908  1.00 0.00 ? 56  PRO A O    2  
ATOM 1619  C CB   . PRO A 1 33  ? 6.323   -5.790  -6.157  1.00 0.00 ? 56  PRO A CB   2  
ATOM 1620  C CG   . PRO A 1 33  ? 5.860   -6.447  -7.442  1.00 0.00 ? 56  PRO A CG   2  
ATOM 1621  C CD   . PRO A 1 33  ? 5.207   -7.732  -6.942  1.00 0.00 ? 56  PRO A CD   2  
ATOM 1622  H HA   . PRO A 1 33  ? 5.727   -6.240  -4.163  1.00 0.00 ? 56  PRO A HA   2  
ATOM 1623  H HB2  . PRO A 1 33  ? 6.438   -4.722  -6.274  1.00 0.00 ? 56  PRO A HB2  2  
ATOM 1624  H HB3  . PRO A 1 33  ? 7.266   -6.249  -5.870  1.00 0.00 ? 56  PRO A HB3  2  
ATOM 1625  H HG2  . PRO A 1 33  ? 5.119   -5.832  -7.950  1.00 0.00 ? 56  PRO A HG2  2  
ATOM 1626  H HG3  . PRO A 1 33  ? 6.717   -6.631  -8.077  1.00 0.00 ? 56  PRO A HG3  2  
ATOM 1627  H HD2  . PRO A 1 33  ? 4.343   -7.975  -7.562  1.00 0.00 ? 56  PRO A HD2  2  
ATOM 1628  H HD3  . PRO A 1 33  ? 5.900   -8.569  -6.937  1.00 0.00 ? 56  PRO A HD3  2  
ATOM 1629  N N    . GLY A 1 34  ? 2.866   -5.611  -5.202  1.00 0.00 ? 57  GLY A N    2  
ATOM 1630  C CA   . GLY A 1 34  ? 1.672   -4.811  -5.117  1.00 0.00 ? 57  GLY A CA   2  
ATOM 1631  C C    . GLY A 1 34  ? 0.445   -5.697  -4.972  1.00 0.00 ? 57  GLY A C    2  
ATOM 1632  O O    . GLY A 1 34  ? -0.632  -5.275  -5.382  1.00 0.00 ? 57  GLY A O    2  
ATOM 1633  H H    . GLY A 1 34  ? 2.779   -6.611  -5.181  1.00 0.00 ? 57  GLY A H    2  
ATOM 1634  H HA2  . GLY A 1 34  ? 1.751   -4.151  -4.258  1.00 0.00 ? 57  GLY A HA2  2  
ATOM 1635  H HA3  . GLY A 1 34  ? 1.593   -4.196  -6.010  1.00 0.00 ? 57  GLY A HA3  2  
ATOM 1636  N N    . ALA A 1 35  ? 0.586   -6.937  -4.483  1.00 0.00 ? 58  ALA A N    2  
ATOM 1637  C CA   . ALA A 1 35  ? -0.556  -7.806  -4.236  1.00 0.00 ? 58  ALA A CA   2  
ATOM 1638  C C    . ALA A 1 35  ? -1.548  -7.086  -3.329  1.00 0.00 ? 58  ALA A C    2  
ATOM 1639  O O    . ALA A 1 35  ? -1.143  -6.402  -2.382  1.00 0.00 ? 58  ALA A O    2  
ATOM 1640  C CB   . ALA A 1 35  ? -0.091  -9.114  -3.599  1.00 0.00 ? 58  ALA A CB   2  
ATOM 1641  H H    . ALA A 1 35  ? 1.473   -7.252  -4.113  1.00 0.00 ? 58  ALA A H    2  
ATOM 1642  H HA   . ALA A 1 35  ? -1.048  -8.028  -5.183  1.00 0.00 ? 58  ALA A HA   2  
ATOM 1643  H HB1  . ALA A 1 35  ? -0.756  -9.409  -2.788  1.00 0.00 ? 58  ALA A HB1  2  
ATOM 1644  H HB2  . ALA A 1 35  ? -0.104  -9.896  -4.349  1.00 0.00 ? 58  ALA A HB2  2  
ATOM 1645  H HB3  . ALA A 1 35  ? 0.925   -9.013  -3.213  1.00 0.00 ? 58  ALA A HB3  2  
ATOM 1646  N N    . PHE A 1 36  ? -2.833  -7.227  -3.635  1.00 0.00 ? 59  PHE A N    2  
ATOM 1647  C CA   . PHE A 1 36  ? -3.893  -6.630  -2.851  1.00 0.00 ? 59  PHE A CA   2  
ATOM 1648  C C    . PHE A 1 36  ? -4.161  -7.516  -1.633  1.00 0.00 ? 59  PHE A C    2  
ATOM 1649  O O    . PHE A 1 36  ? -4.422  -8.705  -1.807  1.00 0.00 ? 59  PHE A O    2  
ATOM 1650  C CB   . PHE A 1 36  ? -5.155  -6.523  -3.722  1.00 0.00 ? 59  PHE A CB   2  
ATOM 1651  C CG   . PHE A 1 36  ? -5.208  -5.392  -4.737  1.00 0.00 ? 59  PHE A CG   2  
ATOM 1652  C CD1  . PHE A 1 36  ? -4.210  -4.396  -4.828  1.00 0.00 ? 59  PHE A CD1  2  
ATOM 1653  C CD2  . PHE A 1 36  ? -6.348  -5.293  -5.554  1.00 0.00 ? 59  PHE A CD2  2  
ATOM 1654  C CE1  . PHE A 1 36  ? -4.394  -3.296  -5.681  1.00 0.00 ? 59  PHE A CE1  2  
ATOM 1655  C CE2  . PHE A 1 36  ? -6.505  -4.214  -6.441  1.00 0.00 ? 59  PHE A CE2  2  
ATOM 1656  C CZ   . PHE A 1 36  ? -5.517  -3.226  -6.507  1.00 0.00 ? 59  PHE A CZ   2  
ATOM 1657  H H    . PHE A 1 36  ? -3.110  -7.829  -4.399  1.00 0.00 ? 59  PHE A H    2  
ATOM 1658  H HA   . PHE A 1 36  ? -3.557  -5.642  -2.543  1.00 0.00 ? 59  PHE A HA   2  
ATOM 1659  H HB2  . PHE A 1 36  ? -5.305  -7.466  -4.247  1.00 0.00 ? 59  PHE A HB2  2  
ATOM 1660  H HB3  . PHE A 1 36  ? -6.016  -6.402  -3.062  1.00 0.00 ? 59  PHE A HB3  2  
ATOM 1661  H HD1  . PHE A 1 36  ? -3.300  -4.429  -4.250  1.00 0.00 ? 59  PHE A HD1  2  
ATOM 1662  H HD2  . PHE A 1 36  ? -7.124  -6.040  -5.477  1.00 0.00 ? 59  PHE A HD2  2  
ATOM 1663  H HE1  . PHE A 1 36  ? -3.683  -2.486  -5.700  1.00 0.00 ? 59  PHE A HE1  2  
ATOM 1664  H HE2  . PHE A 1 36  ? -7.403  -4.101  -7.038  1.00 0.00 ? 59  PHE A HE2  2  
ATOM 1665  H HZ   . PHE A 1 36  ? -5.644  -2.378  -7.155  1.00 0.00 ? 59  PHE A HZ   2  
ATOM 1666  N N    . ILE A 1 37  ? -4.112  -6.976  -0.408  1.00 0.00 ? 60  ILE A N    2  
ATOM 1667  C CA   . ILE A 1 37  ? -4.384  -7.779  0.794   1.00 0.00 ? 60  ILE A CA   2  
ATOM 1668  C C    . ILE A 1 37  ? -5.886  -8.092  0.943   1.00 0.00 ? 60  ILE A C    2  
ATOM 1669  O O    . ILE A 1 37  ? -6.241  -9.157  1.442   1.00 0.00 ? 60  ILE A O    2  
ATOM 1670  C CB   . ILE A 1 37  ? -3.775  -7.104  2.051   1.00 0.00 ? 60  ILE A CB   2  
ATOM 1671  C CG1  . ILE A 1 37  ? -2.233  -7.118  1.926   1.00 0.00 ? 60  ILE A CG1  2  
ATOM 1672  C CG2  . ILE A 1 37  ? -4.217  -7.847  3.324   1.00 0.00 ? 60  ILE A CG2  2  
ATOM 1673  C CD1  . ILE A 1 37  ? -1.457  -6.363  3.006   1.00 0.00 ? 60  ILE A CD1  2  
ATOM 1674  H H    . ILE A 1 37  ? -3.800  -6.018  -0.279  1.00 0.00 ? 60  ILE A H    2  
ATOM 1675  H HA   . ILE A 1 37  ? -3.884  -8.739  0.671   1.00 0.00 ? 60  ILE A HA   2  
ATOM 1676  H HB   . ILE A 1 37  ? -4.123  -6.072  2.116   1.00 0.00 ? 60  ILE A HB   2  
ATOM 1677  H HG12 . ILE A 1 37  ? -1.902  -8.154  1.956   1.00 0.00 ? 60  ILE A HG12 2  
ATOM 1678  H HG13 . ILE A 1 37  ? -1.943  -6.679  0.972   1.00 0.00 ? 60  ILE A HG13 2  
ATOM 1679  H HG21 . ILE A 1 37  ? -4.040  -8.917  3.220   1.00 0.00 ? 60  ILE A HG21 2  
ATOM 1680  H HG22 . ILE A 1 37  ? -3.670  -7.490  4.191   1.00 0.00 ? 60  ILE A HG22 2  
ATOM 1681  H HG23 . ILE A 1 37  ? -5.276  -7.666  3.507   1.00 0.00 ? 60  ILE A HG23 2  
ATOM 1682  H HD11 . ILE A 1 37  ? -1.521  -6.899  3.951   1.00 0.00 ? 60  ILE A HD11 2  
ATOM 1683  H HD12 . ILE A 1 37  ? -0.406  -6.303  2.722   1.00 0.00 ? 60  ILE A HD12 2  
ATOM 1684  H HD13 . ILE A 1 37  ? -1.850  -5.356  3.125   1.00 0.00 ? 60  ILE A HD13 2  
ATOM 1685  N N    . LYS A 1 38  ? -6.755  -7.175  0.502   1.00 0.00 ? 61  LYS A N    2  
ATOM 1686  C CA   . LYS A 1 38  ? -8.225  -7.242  0.475   1.00 0.00 ? 61  LYS A CA   2  
ATOM 1687  C C    . LYS A 1 38  ? -8.854  -8.136  1.542   1.00 0.00 ? 61  LYS A C    2  
ATOM 1688  O O    . LYS A 1 38  ? -9.446  -9.180  1.260   1.00 0.00 ? 61  LYS A O    2  
ATOM 1689  C CB   . LYS A 1 38  ? -8.765  -7.505  -0.942  1.00 0.00 ? 61  LYS A CB   2  
ATOM 1690  C CG   . LYS A 1 38  ? -8.054  -8.553  -1.787  1.00 0.00 ? 61  LYS A CG   2  
ATOM 1691  C CD   . LYS A 1 38  ? -8.481  -9.989  -1.457  1.00 0.00 ? 61  LYS A CD   2  
ATOM 1692  C CE   . LYS A 1 38  ? -8.482  -10.860 -2.715  1.00 0.00 ? 61  LYS A CE   2  
ATOM 1693  N NZ   . LYS A 1 38  ? -9.645  -11.768 -2.745  1.00 0.00 ? 61  LYS A NZ   2  
ATOM 1694  H H    . LYS A 1 38  ? -6.319  -6.385  0.061   1.00 0.00 ? 61  LYS A H    2  
ATOM 1695  H HA   . LYS A 1 38  ? -8.583  -6.248  0.726   1.00 0.00 ? 61  LYS A HA   2  
ATOM 1696  H HB2  . LYS A 1 38  ? -9.835  -7.716  -0.898  1.00 0.00 ? 61  LYS A HB2  2  
ATOM 1697  H HB3  . LYS A 1 38  ? -8.675  -6.596  -1.520  1.00 0.00 ? 61  LYS A HB3  2  
ATOM 1698  H HG2  . LYS A 1 38  ? -8.299  -8.284  -2.809  1.00 0.00 ? 61  LYS A HG2  2  
ATOM 1699  H HG3  . LYS A 1 38  ? -6.977  -8.456  -1.696  1.00 0.00 ? 61  LYS A HG3  2  
ATOM 1700  H HD2  . LYS A 1 38  ? -7.779  -10.406 -0.734  1.00 0.00 ? 61  LYS A HD2  2  
ATOM 1701  H HD3  . LYS A 1 38  ? -9.478  -9.988  -1.002  1.00 0.00 ? 61  LYS A HD3  2  
ATOM 1702  H HE2  . LYS A 1 38  ? -8.526  -10.218 -3.598  1.00 0.00 ? 61  LYS A HE2  2  
ATOM 1703  H HE3  . LYS A 1 38  ? -7.554  -11.435 -2.761  1.00 0.00 ? 61  LYS A HE3  2  
ATOM 1704  H HZ1  . LYS A 1 38  ? -9.626  -12.323 -3.596  1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 1705  H HZ2  . LYS A 1 38  ? -9.646  -12.400 -1.950  1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 1706  H HZ3  . LYS A 1 38  ? -10.509 -11.234 -2.734  1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 1707  N N    . GLN A 1 39  ? -8.785  -7.686  2.788   1.00 0.00 ? 62  GLN A N    2  
ATOM 1708  C CA   . GLN A 1 39  ? -9.634  -8.258  3.815   1.00 0.00 ? 62  GLN A CA   2  
ATOM 1709  C C    . GLN A 1 39  ? -11.078 -7.825  3.529   1.00 0.00 ? 62  GLN A C    2  
ATOM 1710  O O    . GLN A 1 39  ? -11.320 -6.713  3.055   1.00 0.00 ? 62  GLN A O    2  
ATOM 1711  C CB   . GLN A 1 39  ? -9.190  -7.775  5.196   1.00 0.00 ? 62  GLN A CB   2  
ATOM 1712  C CG   . GLN A 1 39  ? -7.693  -7.970  5.460   1.00 0.00 ? 62  GLN A CG   2  
ATOM 1713  C CD   . GLN A 1 39  ? -7.341  -7.924  6.943   1.00 0.00 ? 62  GLN A CD   2  
ATOM 1714  O OE1  . GLN A 1 39  ? -8.168  -7.680  7.816   1.00 0.00 ? 62  GLN A OE1  2  
ATOM 1715  N NE2  . GLN A 1 39  ? -6.089  -8.185  7.258   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 1716  H H    . GLN A 1 39  ? -8.333  -6.809  2.986   1.00 0.00 ? 62  GLN A H    2  
ATOM 1717  H HA   . GLN A 1 39  ? -9.553  -9.347  3.781   1.00 0.00 ? 62  GLN A HA   2  
ATOM 1718  H HB2  . GLN A 1 39  ? -9.394  -6.714  5.276   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 1719  H HB3  . GLN A 1 39  ? -9.776  -8.310  5.943   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 1720  H HG2  . GLN A 1 39  ? -7.375  -8.931  5.055   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 1721  H HG3  . GLN A 1 39  ? -7.147  -7.175  4.951   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 1722  H HE21 . GLN A 1 39  ? -5.372  -8.290  6.548   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 1723  H HE22 . GLN A 1 39  ? -5.789  -8.022  8.209   1.00 0.00 ? 62  GLN A HE22 2  
ATOM 1724  N N    . GLY A 1 40  ? -12.048 -8.679  3.850   1.00 0.00 ? 63  GLY A N    2  
ATOM 1725  C CA   . GLY A 1 40  ? -13.483 -8.388  3.787   1.00 0.00 ? 63  GLY A CA   2  
ATOM 1726  C C    . GLY A 1 40  ? -13.940 -7.347  4.821   1.00 0.00 ? 63  GLY A C    2  
ATOM 1727  O O    . GLY A 1 40  ? -14.704 -7.657  5.736   1.00 0.00 ? 63  GLY A O    2  
ATOM 1728  H H    . GLY A 1 40  ? -11.753 -9.614  4.084   1.00 0.00 ? 63  GLY A H    2  
ATOM 1729  H HA2  . GLY A 1 40  ? -13.728 -8.028  2.788   1.00 0.00 ? 63  GLY A HA2  2  
ATOM 1730  H HA3  . GLY A 1 40  ? -14.037 -9.313  3.955   1.00 0.00 ? 63  GLY A HA3  2  
ATOM 1731  N N    . ARG A 1 41  ? -13.518 -6.089  4.682   1.00 0.00 ? 64  ARG A N    2  
ATOM 1732  C CA   . ARG A 1 41  ? -13.864 -4.971  5.569   1.00 0.00 ? 64  ARG A CA   2  
ATOM 1733  C C    . ARG A 1 41  ? -14.293 -3.785  4.719   1.00 0.00 ? 64  ARG A C    2  
ATOM 1734  O O    . ARG A 1 41  ? -13.757 -3.587  3.630   1.00 0.00 ? 64  ARG A O    2  
ATOM 1735  C CB   . ARG A 1 41  ? -12.726 -4.580  6.542   1.00 0.00 ? 64  ARG A CB   2  
ATOM 1736  C CG   . ARG A 1 41  ? -11.369 -5.157  6.149   1.00 0.00 ? 64  ARG A CG   2  
ATOM 1737  C CD   . ARG A 1 41  ? -10.176 -4.562  6.900   1.00 0.00 ? 64  ARG A CD   2  
ATOM 1738  N NE   . ARG A 1 41  ? -10.041 -5.080  8.268   1.00 0.00 ? 64  ARG A NE   2  
ATOM 1739  C CZ   . ARG A 1 41  ? -8.938  -4.990  9.026   1.00 0.00 ? 64  ARG A CZ   2  
ATOM 1740  N NH1  . ARG A 1 41  ? -7.868  -4.303  8.649   1.00 0.00 ? 64  ARG A NH1  2  
ATOM 1741  N NH2  . ARG A 1 41  ? -8.901  -5.608  10.197  1.00 0.00 ? 64  ARG A NH2  2  
ATOM 1742  H H    . ARG A 1 41  ? -12.907 -5.871  3.897   1.00 0.00 ? 64  ARG A H    2  
ATOM 1743  H HA   . ARG A 1 41  ? -14.702 -5.267  6.177   1.00 0.00 ? 64  ARG A HA   2  
ATOM 1744  H HB2  . ARG A 1 41  ? -12.649 -3.493  6.590   1.00 0.00 ? 64  ARG A HB2  2  
ATOM 1745  H HB3  . ARG A 1 41  ? -12.969 -4.924  7.542   1.00 0.00 ? 64  ARG A HB3  2  
ATOM 1746  H HG2  . ARG A 1 41  ? -11.385 -6.237  6.301   1.00 0.00 ? 64  ARG A HG2  2  
ATOM 1747  H HG3  . ARG A 1 41  ? -11.245 -4.958  5.090   1.00 0.00 ? 64  ARG A HG3  2  
ATOM 1748  H HD2  . ARG A 1 41  ? -9.280  -4.845  6.358   1.00 0.00 ? 64  ARG A HD2  2  
ATOM 1749  H HD3  . ARG A 1 41  ? -10.246 -3.475  6.899   1.00 0.00 ? 64  ARG A HD3  2  
ATOM 1750  H HE   . ARG A 1 41  ? -10.816 -5.623  8.618   1.00 0.00 ? 64  ARG A HE   2  
ATOM 1751  H HH11 . ARG A 1 41  ? -7.783  -3.932  7.695   1.00 0.00 ? 64  ARG A HH11 2  
ATOM 1752  H HH12 . ARG A 1 41  ? -7.033  -4.284  9.220   1.00 0.00 ? 64  ARG A HH12 2  
ATOM 1753  H HH21 . ARG A 1 41  ? -9.655  -6.253  10.423  1.00 0.00 ? 64  ARG A HH21 2  
ATOM 1754  H HH22 . ARG A 1 41  ? -8.035  -5.622  10.724  1.00 0.00 ? 64  ARG A HH22 2  
ATOM 1755  N N    . LYS A 1 42  ? -15.251 -3.006  5.216   1.00 0.00 ? 65  LYS A N    2  
ATOM 1756  C CA   . LYS A 1 42  ? -15.553 -1.676  4.708   1.00 0.00 ? 65  LYS A CA   2  
ATOM 1757  C C    . LYS A 1 42  ? -14.794 -0.681  5.581   1.00 0.00 ? 65  LYS A C    2  
ATOM 1758  O O    . LYS A 1 42  ? -14.714 -0.898  6.793   1.00 0.00 ? 65  LYS A O    2  
ATOM 1759  C CB   . LYS A 1 42  ? -17.067 -1.434  4.782   1.00 0.00 ? 65  LYS A CB   2  
ATOM 1760  C CG   . LYS A 1 42  ? -17.441 -0.168  3.996   1.00 0.00 ? 65  LYS A CG   2  
ATOM 1761  C CD   . LYS A 1 42  ? -18.935 0.170   3.987   1.00 0.00 ? 65  LYS A CD   2  
ATOM 1762  C CE   . LYS A 1 42  ? -19.498 0.111   5.400   1.00 0.00 ? 65  LYS A CE   2  
ATOM 1763  N NZ   . LYS A 1 42  ? -20.659 0.987   5.593   1.00 0.00 ? 65  LYS A NZ   2  
ATOM 1764  H H    . LYS A 1 42  ? -15.651 -3.243  6.116   1.00 0.00 ? 65  LYS A H    2  
ATOM 1765  H HA   . LYS A 1 42  ? -15.214 -1.615  3.675   1.00 0.00 ? 65  LYS A HA   2  
ATOM 1766  H HB2  . LYS A 1 42  ? -17.600 -2.283  4.359   1.00 0.00 ? 65  LYS A HB2  2  
ATOM 1767  H HB3  . LYS A 1 42  ? -17.354 -1.336  5.832   1.00 0.00 ? 65  LYS A HB3  2  
ATOM 1768  H HG2  . LYS A 1 42  ? -16.913 0.677   4.427   1.00 0.00 ? 65  LYS A HG2  2  
ATOM 1769  H HG3  . LYS A 1 42  ? -17.109 -0.280  2.967   1.00 0.00 ? 65  LYS A HG3  2  
ATOM 1770  H HD2  . LYS A 1 42  ? -19.054 1.169   3.572   1.00 0.00 ? 65  LYS A HD2  2  
ATOM 1771  H HD3  . LYS A 1 42  ? -19.478 -0.536  3.363   1.00 0.00 ? 65  LYS A HD3  2  
ATOM 1772  H HE2  . LYS A 1 42  ? -19.786 -0.925  5.586   1.00 0.00 ? 65  LYS A HE2  2  
ATOM 1773  H HE3  . LYS A 1 42  ? -18.718 0.419   6.094   1.00 0.00 ? 65  LYS A HE3  2  
ATOM 1774  H HZ1  . LYS A 1 42  ? -21.396 0.801   4.914   1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 1775  H HZ2  . LYS A 1 42  ? -21.024 0.894   6.534   1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 1776  H HZ3  . LYS A 1 42  ? -20.443 1.971   5.425   1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 1777  N N    . LEU A 1 43  ? -14.246 0.384   4.998   1.00 0.00 ? 66  LEU A N    2  
ATOM 1778  C CA   . LEU A 1 43  ? -13.438 1.378   5.684   1.00 0.00 ? 66  LEU A CA   2  
ATOM 1779  C C    . LEU A 1 43  ? -14.125 2.734   5.576   1.00 0.00 ? 66  LEU A C    2  
ATOM 1780  O O    . LEU A 1 43  ? -15.009 2.949   4.743   1.00 0.00 ? 66  LEU A O    2  
ATOM 1781  C CB   . LEU A 1 43  ? -12.067 1.507   5.003   1.00 0.00 ? 66  LEU A CB   2  
ATOM 1782  C CG   . LEU A 1 43  ? -11.051 0.363   5.141   1.00 0.00 ? 66  LEU A CG   2  
ATOM 1783  C CD1  . LEU A 1 43  ? -10.262 0.538   6.443   1.00 0.00 ? 66  LEU A CD1  2  
ATOM 1784  C CD2  . LEU A 1 43  ? -11.613 -1.061  5.085   1.00 0.00 ? 66  LEU A CD2  2  
ATOM 1785  H H    . LEU A 1 43  ? -14.308 0.541   4.006   1.00 0.00 ? 66  LEU A H    2  
ATOM 1786  H HA   . LEU A 1 43  ? -13.307 1.114   6.735   1.00 0.00 ? 66  LEU A HA   2  
ATOM 1787  H HB2  . LEU A 1 43  ? -12.238 1.707   3.951   1.00 0.00 ? 66  LEU A HB2  2  
ATOM 1788  H HB3  . LEU A 1 43  ? -11.581 2.404   5.378   1.00 0.00 ? 66  LEU A HB3  2  
ATOM 1789  H HG   . LEU A 1 43  ? -10.381 0.477   4.297   1.00 0.00 ? 66  LEU A HG   2  
ATOM 1790  H HD11 . LEU A 1 43  ? -9.789  1.523   6.457   1.00 0.00 ? 66  LEU A HD11 2  
ATOM 1791  H HD12 . LEU A 1 43  ? -10.925 0.419   7.301   1.00 0.00 ? 66  LEU A HD12 2  
ATOM 1792  H HD13 . LEU A 1 43  ? -9.475  -0.207  6.500   1.00 0.00 ? 66  LEU A HD13 2  
ATOM 1793  H HD21 . LEU A 1 43  ? -12.185 -1.262  5.989   1.00 0.00 ? 66  LEU A HD21 2  
ATOM 1794  H HD22 . LEU A 1 43  ? -12.218 -1.187  4.186   1.00 0.00 ? 66  LEU A HD22 2  
ATOM 1795  H HD23 . LEU A 1 43  ? -10.791 -1.769  5.033   1.00 0.00 ? 66  LEU A HD23 2  
ATOM 1796  N N    . ASP A 1 44  ? -13.617 3.679   6.353   1.00 0.00 ? 67  ASP A N    2  
ATOM 1797  C CA   . ASP A 1 44  ? -13.938 5.082   6.319   1.00 0.00 ? 67  ASP A CA   2  
ATOM 1798  C C    . ASP A 1 44  ? -12.742 5.799   5.689   1.00 0.00 ? 67  ASP A C    2  
ATOM 1799  O O    . ASP A 1 44  ? -11.896 6.371   6.385   1.00 0.00 ? 67  ASP A O    2  
ATOM 1800  C CB   . ASP A 1 44  ? -14.236 5.530   7.750   1.00 0.00 ? 67  ASP A CB   2  
ATOM 1801  C CG   . ASP A 1 44  ? -15.633 5.100   8.194   1.00 0.00 ? 67  ASP A CG   2  
ATOM 1802  O OD1  . ASP A 1 44  ? -16.625 5.795   7.861   1.00 0.00 ? 67  ASP A OD1  2  
ATOM 1803  O OD2  . ASP A 1 44  ? -15.764 4.042   8.848   1.00 0.00 ? 67  ASP A OD2  2  
ATOM 1804  H H    . ASP A 1 44  ? -12.861 3.457   6.983   1.00 0.00 ? 67  ASP A H    2  
ATOM 1805  H HA   . ASP A 1 44  ? -14.825 5.257   5.711   1.00 0.00 ? 67  ASP A HA   2  
ATOM 1806  H HB2  . ASP A 1 44  ? -13.486 5.131   8.437   1.00 0.00 ? 67  ASP A HB2  2  
ATOM 1807  H HB3  . ASP A 1 44  ? -14.162 6.605   7.777   1.00 0.00 ? 67  ASP A HB3  2  
ATOM 1808  N N    . ILE A 1 45  ? -12.630 5.706   4.364   1.00 0.00 ? 68  ILE A N    2  
ATOM 1809  C CA   . ILE A 1 45  ? -11.755 6.513   3.514   1.00 0.00 ? 68  ILE A CA   2  
ATOM 1810  C C    . ILE A 1 45  ? -12.740 7.308   2.646   1.00 0.00 ? 68  ILE A C    2  
ATOM 1811  O O    . ILE A 1 45  ? -13.731 6.735   2.184   1.00 0.00 ? 68  ILE A O    2  
ATOM 1812  C CB   . ILE A 1 45  ? -10.799 5.625   2.665   1.00 0.00 ? 68  ILE A CB   2  
ATOM 1813  C CG1  . ILE A 1 45  ? -9.988  4.599   3.493   1.00 0.00 ? 68  ILE A CG1  2  
ATOM 1814  C CG2  . ILE A 1 45  ? -9.841  6.497   1.827   1.00 0.00 ? 68  ILE A CG2  2  
ATOM 1815  C CD1  . ILE A 1 45  ? -9.153  3.632   2.638   1.00 0.00 ? 68  ILE A CD1  2  
ATOM 1816  H H    . ILE A 1 45  ? -13.352 5.197   3.871   1.00 0.00 ? 68  ILE A H    2  
ATOM 1817  H HA   . ILE A 1 45  ? -11.169 7.195   4.133   1.00 0.00 ? 68  ILE A HA   2  
ATOM 1818  H HB   . ILE A 1 45  ? -11.417 5.051   1.979   1.00 0.00 ? 68  ILE A HB   2  
ATOM 1819  H HG12 . ILE A 1 45  ? -9.338  5.104   4.206   1.00 0.00 ? 68  ILE A HG12 2  
ATOM 1820  H HG13 . ILE A 1 45  ? -10.678 3.990   4.063   1.00 0.00 ? 68  ILE A HG13 2  
ATOM 1821  H HG21 . ILE A 1 45  ? -9.289  5.877   1.120   1.00 0.00 ? 68  ILE A HG21 2  
ATOM 1822  H HG22 . ILE A 1 45  ? -10.403 7.220   1.237   1.00 0.00 ? 68  ILE A HG22 2  
ATOM 1823  H HG23 . ILE A 1 45  ? -9.137  7.023   2.475   1.00 0.00 ? 68  ILE A HG23 2  
ATOM 1824  H HD11 . ILE A 1 45  ? -9.775  3.185   1.862   1.00 0.00 ? 68  ILE A HD11 2  
ATOM 1825  H HD12 . ILE A 1 45  ? -8.307  4.147   2.178   1.00 0.00 ? 68  ILE A HD12 2  
ATOM 1826  H HD13 . ILE A 1 45  ? -8.765  2.833   3.270   1.00 0.00 ? 68  ILE A HD13 2  
ATOM 1827  N N    . ASP A 1 46  ? -12.543 8.616   2.469   1.00 0.00 ? 69  ASP A N    2  
ATOM 1828  C CA   . ASP A 1 46  ? -13.431 9.430   1.633   1.00 0.00 ? 69  ASP A CA   2  
ATOM 1829  C C    . ASP A 1 46  ? -12.936 9.432   0.191   1.00 0.00 ? 69  ASP A C    2  
ATOM 1830  O O    . ASP A 1 46  ? -11.752 9.206   -0.062  1.00 0.00 ? 69  ASP A O    2  
ATOM 1831  C CB   . ASP A 1 46  ? -13.546 10.865  2.182   1.00 0.00 ? 69  ASP A CB   2  
ATOM 1832  C CG   . ASP A 1 46  ? -14.761 11.066  3.081   1.00 0.00 ? 69  ASP A CG   2  
ATOM 1833  O OD1  . ASP A 1 46  ? -15.784 10.359  2.911   1.00 0.00 ? 69  ASP A OD1  2  
ATOM 1834  O OD2  . ASP A 1 46  ? -14.695 11.924  3.992   1.00 0.00 ? 69  ASP A OD2  2  
ATOM 1835  H H    . ASP A 1 46  ? -11.695 9.048   2.806   1.00 0.00 ? 69  ASP A H    2  
ATOM 1836  H HA   . ASP A 1 46  ? -14.421 8.977   1.621   1.00 0.00 ? 69  ASP A HA   2  
ATOM 1837  H HB2  . ASP A 1 46  ? -12.646 11.117  2.742   1.00 0.00 ? 69  ASP A HB2  2  
ATOM 1838  H HB3  . ASP A 1 46  ? -13.636 11.568  1.355   1.00 0.00 ? 69  ASP A HB3  2  
ATOM 1839  N N    . PHE A 1 47  ? -13.833 9.716   -0.758  1.00 0.00 ? 70  PHE A N    2  
ATOM 1840  C CA   . PHE A 1 47  ? -13.556 9.653   -2.198  1.00 0.00 ? 70  PHE A CA   2  
ATOM 1841  C C    . PHE A 1 47  ? -14.330 10.701  -3.008  1.00 0.00 ? 70  PHE A C    2  
ATOM 1842  O O    . PHE A 1 47  ? -14.066 10.862  -4.203  1.00 0.00 ? 70  PHE A O    2  
ATOM 1843  C CB   . PHE A 1 47  ? -13.924 8.254   -2.720  1.00 0.00 ? 70  PHE A CB   2  
ATOM 1844  C CG   . PHE A 1 47  ? -13.057 7.131   -2.192  1.00 0.00 ? 70  PHE A CG   2  
ATOM 1845  C CD1  . PHE A 1 47  ? -11.856 6.807   -2.849  1.00 0.00 ? 70  PHE A CD1  2  
ATOM 1846  C CD2  . PHE A 1 47  ? -13.424 6.432   -1.028  1.00 0.00 ? 70  PHE A CD2  2  
ATOM 1847  C CE1  . PHE A 1 47  ? -11.017 5.807   -2.329  1.00 0.00 ? 70  PHE A CE1  2  
ATOM 1848  C CE2  . PHE A 1 47  ? -12.575 5.445   -0.508  1.00 0.00 ? 70  PHE A CE2  2  
ATOM 1849  C CZ   . PHE A 1 47  ? -11.367 5.130   -1.151  1.00 0.00 ? 70  PHE A CZ   2  
ATOM 1850  H H    . PHE A 1 47  ? -14.772 9.953   -0.457  1.00 0.00 ? 70  PHE A H    2  
ATOM 1851  H HA   . PHE A 1 47  ? -12.491 9.818   -2.371  1.00 0.00 ? 70  PHE A HA   2  
ATOM 1852  H HB2  . PHE A 1 47  ? -14.964 8.049   -2.472  1.00 0.00 ? 70  PHE A HB2  2  
ATOM 1853  H HB3  . PHE A 1 47  ? -13.840 8.252   -3.807  1.00 0.00 ? 70  PHE A HB3  2  
ATOM 1854  H HD1  . PHE A 1 47  ? -11.564 7.338   -3.742  1.00 0.00 ? 70  PHE A HD1  2  
ATOM 1855  H HD2  . PHE A 1 47  ? -14.331 6.664   -0.490  1.00 0.00 ? 70  PHE A HD2  2  
ATOM 1856  H HE1  . PHE A 1 47  ? -10.097 5.565   -2.831  1.00 0.00 ? 70  PHE A HE1  2  
ATOM 1857  H HE2  . PHE A 1 47  ? -12.869 4.932   0.396   1.00 0.00 ? 70  PHE A HE2  2  
ATOM 1858  H HZ   . PHE A 1 47  ? -10.714 4.372   -0.738  1.00 0.00 ? 70  PHE A HZ   2  
ATOM 1859  N N    . GLY A 1 48  ? -15.296 11.396  -2.404  1.00 0.00 ? 71  GLY A N    2  
ATOM 1860  C CA   . GLY A 1 48  ? -16.315 12.130  -3.125  1.00 0.00 ? 71  GLY A CA   2  
ATOM 1861  C C    . GLY A 1 48  ? -17.574 11.272  -3.232  1.00 0.00 ? 71  GLY A C    2  
ATOM 1862  O O    . GLY A 1 48  ? -17.614 10.109  -2.823  1.00 0.00 ? 71  GLY A O    2  
ATOM 1863  H H    . GLY A 1 48  ? -15.525 11.221  -1.433  1.00 0.00 ? 71  GLY A H    2  
ATOM 1864  H HA2  . GLY A 1 48  ? -16.542 13.044  -2.574  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 1865  H HA3  . GLY A 1 48  ? -15.967 12.393  -4.125  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 1866  N N    . ALA A 1 49  ? -18.633 11.878  -3.749  1.00 0.00 ? 72  ALA A N    2  
ATOM 1867  C CA   . ALA A 1 49  ? -19.993 11.375  -3.714  1.00 0.00 ? 72  ALA A CA   2  
ATOM 1868  C C    . ALA A 1 49  ? -20.169 9.998   -4.338  1.00 0.00 ? 72  ALA A C    2  
ATOM 1869  O O    . ALA A 1 49  ? -20.805 9.128   -3.743  1.00 0.00 ? 72  ALA A O    2  
ATOM 1870  C CB   . ALA A 1 49  ? -20.894 12.366  -4.454  1.00 0.00 ? 72  ALA A CB   2  
ATOM 1871  H H    . ALA A 1 49  ? -18.486 12.820  -4.064  1.00 0.00 ? 72  ALA A H    2  
ATOM 1872  H HA   . ALA A 1 49  ? -20.275 11.296  -2.666  1.00 0.00 ? 72  ALA A HA   2  
ATOM 1873  H HB1  . ALA A 1 49  ? -20.640 12.376  -5.516  1.00 0.00 ? 72  ALA A HB1  2  
ATOM 1874  H HB2  . ALA A 1 49  ? -21.936 12.068  -4.346  1.00 0.00 ? 72  ALA A HB2  2  
ATOM 1875  H HB3  . ALA A 1 49  ? -20.761 13.364  -4.050  1.00 0.00 ? 72  ALA A HB3  2  
ATOM 1876  N N    . GLU A 1 50  ? -19.708 9.815   -5.571  1.00 0.00 ? 73  GLU A N    2  
ATOM 1877  C CA   . GLU A 1 50  ? -19.937 8.553   -6.261  1.00 0.00 ? 73  GLU A CA   2  
ATOM 1878  C C    . GLU A 1 50  ? -18.972 7.491   -5.750  1.00 0.00 ? 73  GLU A C    2  
ATOM 1879  O O    . GLU A 1 50  ? -19.375 6.350   -5.540  1.00 0.00 ? 73  GLU A O    2  
ATOM 1880  C CB   . GLU A 1 50  ? -19.955 8.716   -7.783  1.00 0.00 ? 73  GLU A CB   2  
ATOM 1881  C CG   . GLU A 1 50  ? -18.969 9.704   -8.424  1.00 0.00 ? 73  GLU A CG   2  
ATOM 1882  C CD   . GLU A 1 50  ? -19.158 9.824   -9.941  1.00 0.00 ? 73  GLU A CD   2  
ATOM 1883  O OE1  . GLU A 1 50  ? -20.271 9.590   -10.456 1.00 0.00 ? 73  GLU A OE1  2  
ATOM 1884  O OE2  . GLU A 1 50  ? -18.211 10.236  -10.652 1.00 0.00 ? 73  GLU A OE2  2  
ATOM 1885  H H    . GLU A 1 50  ? -19.133 10.539  -5.998  1.00 0.00 ? 73  GLU A H    2  
ATOM 1886  H HA   . GLU A 1 50  ? -20.927 8.184   -6.007  1.00 0.00 ? 73  GLU A HA   2  
ATOM 1887  H HB2  . GLU A 1 50  ? -19.817 7.731   -8.213  1.00 0.00 ? 73  GLU A HB2  2  
ATOM 1888  H HB3  . GLU A 1 50  ? -20.954 9.054   -8.042  1.00 0.00 ? 73  GLU A HB3  2  
ATOM 1889  H HG2  . GLU A 1 50  ? -19.168 10.690  -8.014  1.00 0.00 ? 73  GLU A HG2  2  
ATOM 1890  H HG3  . GLU A 1 50  ? -17.944 9.416   -8.192  1.00 0.00 ? 73  GLU A HG3  2  
ATOM 1891  N N    . GLY A 1 51  ? -17.730 7.878   -5.460  1.00 0.00 ? 74  GLY A N    2  
ATOM 1892  C CA   . GLY A 1 51  ? -16.729 6.955   -4.953  1.00 0.00 ? 74  GLY A CA   2  
ATOM 1893  C C    . GLY A 1 51  ? -17.126 6.366   -3.603  1.00 0.00 ? 74  GLY A C    2  
ATOM 1894  O O    . GLY A 1 51  ? -17.107 5.149   -3.443  1.00 0.00 ? 74  GLY A O    2  
ATOM 1895  H H    . GLY A 1 51  ? -17.489 8.842   -5.640  1.00 0.00 ? 74  GLY A H    2  
ATOM 1896  H HA2  . GLY A 1 51  ? -16.635 6.134   -5.662  1.00 0.00 ? 74  GLY A HA2  2  
ATOM 1897  H HA3  . GLY A 1 51  ? -15.772 7.467   -4.867  1.00 0.00 ? 74  GLY A HA3  2  
ATOM 1898  N N    . ASN A 1 52  ? -17.508 7.209   -2.638  1.00 0.00 ? 75  ASN A N    2  
ATOM 1899  C CA   . ASN A 1 52  ? -17.828 6.766   -1.279  1.00 0.00 ? 75  ASN A CA   2  
ATOM 1900  C C    . ASN A 1 52  ? -19.027 5.812   -1.268  1.00 0.00 ? 75  ASN A C    2  
ATOM 1901  O O    . ASN A 1 52  ? -19.044 4.848   -0.500  1.00 0.00 ? 75  ASN A O    2  
ATOM 1902  C CB   . ASN A 1 52  ? -18.031 7.971   -0.337  1.00 0.00 ? 75  ASN A CB   2  
ATOM 1903  C CG   . ASN A 1 52  ? -19.470 8.448   -0.208  1.00 0.00 ? 75  ASN A CG   2  
ATOM 1904  O OD1  . ASN A 1 52  ? -20.292 7.856   0.475   1.00 0.00 ? 75  ASN A OD1  2  
ATOM 1905  N ND2  . ASN A 1 52  ? -19.793 9.532   -0.884  1.00 0.00 ? 75  ASN A ND2  2  
ATOM 1906  H H    . ASN A 1 52  ? -17.534 8.203   -2.842  1.00 0.00 ? 75  ASN A H    2  
ATOM 1907  H HA   . ASN A 1 52  ? -16.968 6.208   -0.911  1.00 0.00 ? 75  ASN A HA   2  
ATOM 1908  H HB2  . ASN A 1 52  ? -17.686 7.699   0.660   1.00 0.00 ? 75  ASN A HB2  2  
ATOM 1909  H HB3  . ASN A 1 52  ? -17.431 8.811   -0.686  1.00 0.00 ? 75  ASN A HB3  2  
ATOM 1910  H HD21 . ASN A 1 52  ? -19.099 9.962   -1.485  1.00 0.00 ? 75  ASN A HD21 2  
ATOM 1911  H HD22 . ASN A 1 52  ? -20.716 9.917   -0.778  1.00 0.00 ? 75  ASN A HD22 2  
ATOM 1912  N N    . ARG A 1 53  ? -20.009 6.054   -2.139  1.00 0.00 ? 76  ARG A N    2  
ATOM 1913  C CA   . ARG A 1 53  ? -21.197 5.218   -2.258  1.00 0.00 ? 76  ARG A CA   2  
ATOM 1914  C C    . ARG A 1 53  ? -20.898 3.917   -2.987  1.00 0.00 ? 76  ARG A C    2  
ATOM 1915  O O    . ARG A 1 53  ? -21.464 2.882   -2.639  1.00 0.00 ? 76  ARG A O    2  
ATOM 1916  C CB   . ARG A 1 53  ? -22.292 6.017   -2.968  1.00 0.00 ? 76  ARG A CB   2  
ATOM 1917  C CG   . ARG A 1 53  ? -22.980 6.971   -1.976  1.00 0.00 ? 76  ARG A CG   2  
ATOM 1918  C CD   . ARG A 1 53  ? -24.312 6.403   -1.476  1.00 0.00 ? 76  ARG A CD   2  
ATOM 1919  N NE   . ARG A 1 53  ? -25.344 6.440   -2.519  1.00 0.00 ? 76  ARG A NE   2  
ATOM 1920  C CZ   . ARG A 1 53  ? -26.065 7.512   -2.867  1.00 0.00 ? 76  ARG A CZ   2  
ATOM 1921  N NH1  . ARG A 1 53  ? -25.933 8.667   -2.214  1.00 0.00 ? 76  ARG A NH1  2  
ATOM 1922  N NH2  . ARG A 1 53  ? -26.923 7.406   -3.870  1.00 0.00 ? 76  ARG A NH2  2  
ATOM 1923  H H    . ARG A 1 53  ? -19.932 6.882   -2.716  1.00 0.00 ? 76  ARG A H    2  
ATOM 1924  H HA   . ARG A 1 53  ? -21.539 4.955   -1.255  1.00 0.00 ? 76  ARG A HA   2  
ATOM 1925  H HB2  . ARG A 1 53  ? -21.857 6.586   -3.790  1.00 0.00 ? 76  ARG A HB2  2  
ATOM 1926  H HB3  . ARG A 1 53  ? -23.019 5.329   -3.397  1.00 0.00 ? 76  ARG A HB3  2  
ATOM 1927  H HG2  . ARG A 1 53  ? -22.337 7.157   -1.116  1.00 0.00 ? 76  ARG A HG2  2  
ATOM 1928  H HG3  . ARG A 1 53  ? -23.154 7.929   -2.456  1.00 0.00 ? 76  ARG A HG3  2  
ATOM 1929  H HD2  . ARG A 1 53  ? -24.161 5.377   -1.138  1.00 0.00 ? 76  ARG A HD2  2  
ATOM 1930  H HD3  . ARG A 1 53  ? -24.652 6.991   -0.627  1.00 0.00 ? 76  ARG A HD3  2  
ATOM 1931  H HE   . ARG A 1 53  ? -25.429 5.585   -3.070  1.00 0.00 ? 76  ARG A HE   2  
ATOM 1932  H HH11 . ARG A 1 53  ? -25.282 8.756   -1.433  1.00 0.00 ? 76  ARG A HH11 2  
ATOM 1933  H HH12 . ARG A 1 53  ? -26.405 9.532   -2.479  1.00 0.00 ? 76  ARG A HH12 2  
ATOM 1934  H HH21 . ARG A 1 53  ? -27.078 6.514   -4.341  1.00 0.00 ? 76  ARG A HH21 2  
ATOM 1935  H HH22 . ARG A 1 53  ? -27.557 8.152   -4.144  1.00 0.00 ? 76  ARG A HH22 2  
ATOM 1936  N N    . TYR A 1 54  ? -20.024 3.935   -3.993  1.00 0.00 ? 77  TYR A N    2  
ATOM 1937  C CA   . TYR A 1 54  ? -19.595 2.701   -4.636  1.00 0.00 ? 77  TYR A CA   2  
ATOM 1938  C C    . TYR A 1 54  ? -18.761 1.863   -3.662  1.00 0.00 ? 77  TYR A C    2  
ATOM 1939  O O    . TYR A 1 54  ? -18.785 0.635   -3.740  1.00 0.00 ? 77  TYR A O    2  
ATOM 1940  C CB   . TYR A 1 54  ? -18.840 3.008   -5.939  1.00 0.00 ? 77  TYR A CB   2  
ATOM 1941  C CG   . TYR A 1 54  ? -19.068 2.001   -7.052  1.00 0.00 ? 77  TYR A CG   2  
ATOM 1942  C CD1  . TYR A 1 54  ? -20.379 1.787   -7.525  1.00 0.00 ? 77  TYR A CD1  2  
ATOM 1943  C CD2  . TYR A 1 54  ? -17.981 1.372   -7.693  1.00 0.00 ? 77  TYR A CD2  2  
ATOM 1944  C CE1  . TYR A 1 54  ? -20.612 0.910   -8.596  1.00 0.00 ? 77  TYR A CE1  2  
ATOM 1945  C CE2  . TYR A 1 54  ? -18.204 0.557   -8.819  1.00 0.00 ? 77  TYR A CE2  2  
ATOM 1946  C CZ   . TYR A 1 54  ? -19.522 0.281   -9.236  1.00 0.00 ? 77  TYR A CZ   2  
ATOM 1947  O OH   . TYR A 1 54  ? -19.727 -0.578  -10.265 1.00 0.00 ? 77  TYR A OH   2  
ATOM 1948  H H    . TYR A 1 54  ? -19.646 4.817   -4.324  1.00 0.00 ? 77  TYR A H    2  
ATOM 1949  H HA   . TYR A 1 54  ? -20.491 2.130   -4.881  1.00 0.00 ? 77  TYR A HA   2  
ATOM 1950  H HB2  . TYR A 1 54  ? -19.181 3.965   -6.329  1.00 0.00 ? 77  TYR A HB2  2  
ATOM 1951  H HB3  . TYR A 1 54  ? -17.775 3.111   -5.726  1.00 0.00 ? 77  TYR A HB3  2  
ATOM 1952  H HD1  . TYR A 1 54  ? -21.219 2.296   -7.069  1.00 0.00 ? 77  TYR A HD1  2  
ATOM 1953  H HD2  . TYR A 1 54  ? -16.970 1.563   -7.358  1.00 0.00 ? 77  TYR A HD2  2  
ATOM 1954  H HE1  . TYR A 1 54  ? -21.621 0.742   -8.946  1.00 0.00 ? 77  TYR A HE1  2  
ATOM 1955  H HE2  . TYR A 1 54  ? -17.387 0.144   -9.392  1.00 0.00 ? 77  TYR A HE2  2  
ATOM 1956  H HH   . TYR A 1 54  ? -20.635 -0.931  -10.255 1.00 0.00 ? 77  TYR A HH   2  
ATOM 1957  N N    . TYR A 1 55  ? -18.030 2.489   -2.732  1.00 0.00 ? 78  TYR A N    2  
ATOM 1958  C CA   . TYR A 1 55  ? -17.325 1.794   -1.661  1.00 0.00 ? 78  TYR A CA   2  
ATOM 1959  C C    . TYR A 1 55  ? -18.361 1.052   -0.811  1.00 0.00 ? 78  TYR A C    2  
ATOM 1960  O O    . TYR A 1 55  ? -18.340 -0.173  -0.794  1.00 0.00 ? 78  TYR A O    2  
ATOM 1961  C CB   . TYR A 1 55  ? -16.507 2.786   -0.818  1.00 0.00 ? 78  TYR A CB   2  
ATOM 1962  C CG   . TYR A 1 55  ? -15.324 2.194   -0.087  1.00 0.00 ? 78  TYR A CG   2  
ATOM 1963  C CD1  . TYR A 1 55  ? -15.536 1.287   0.961   1.00 0.00 ? 78  TYR A CD1  2  
ATOM 1964  C CD2  . TYR A 1 55  ? -14.014 2.585   -0.409  1.00 0.00 ? 78  TYR A CD2  2  
ATOM 1965  C CE1  . TYR A 1 55  ? -14.448 0.688   1.616   1.00 0.00 ? 78  TYR A CE1  2  
ATOM 1966  C CE2  . TYR A 1 55  ? -12.927 2.071   0.322   1.00 0.00 ? 78  TYR A CE2  2  
ATOM 1967  C CZ   . TYR A 1 55  ? -13.134 1.075   1.295   1.00 0.00 ? 78  TYR A CZ   2  
ATOM 1968  O OH   . TYR A 1 55  ? -12.075 0.462   1.877   1.00 0.00 ? 78  TYR A OH   2  
ATOM 1969  H H    . TYR A 1 55  ? -17.958 3.500   -2.768  1.00 0.00 ? 78  TYR A H    2  
ATOM 1970  H HA   . TYR A 1 55  ? -16.643 1.064   -2.117  1.00 0.00 ? 78  TYR A HA   2  
ATOM 1971  H HB2  . TYR A 1 55  ? -16.154 3.604   -1.445  1.00 0.00 ? 78  TYR A HB2  2  
ATOM 1972  H HB3  . TYR A 1 55  ? -17.157 3.199   -0.054  1.00 0.00 ? 78  TYR A HB3  2  
ATOM 1973  H HD1  . TYR A 1 55  ? -16.545 1.049   1.262   1.00 0.00 ? 78  TYR A HD1  2  
ATOM 1974  H HD2  . TYR A 1 55  ? -13.846 3.304   -1.197  1.00 0.00 ? 78  TYR A HD2  2  
ATOM 1975  H HE1  . TYR A 1 55  ? -14.619 -0.064  2.360   1.00 0.00 ? 78  TYR A HE1  2  
ATOM 1976  H HE2  . TYR A 1 55  ? -11.925 2.422   0.141   1.00 0.00 ? 78  TYR A HE2  2  
ATOM 1977  H HH   . TYR A 1 55  ? -11.816 -0.371  1.431   1.00 0.00 ? 78  TYR A HH   2  
ATOM 1978  N N    . GLU A 1 56  ? -19.297 1.780   -0.184  1.00 0.00 ? 79  GLU A N    2  
ATOM 1979  C CA   . GLU A 1 56  ? -20.417 1.277   0.627   1.00 0.00 ? 79  GLU A CA   2  
ATOM 1980  C C    . GLU A 1 56  ? -21.116 0.087   -0.028  1.00 0.00 ? 79  GLU A C    2  
ATOM 1981  O O    . GLU A 1 56  ? -21.524 -0.868  0.639   1.00 0.00 ? 79  GLU A O    2  
ATOM 1982  C CB   . GLU A 1 56  ? -21.443 2.412   0.777   1.00 0.00 ? 79  GLU A CB   2  
ATOM 1983  C CG   . GLU A 1 56  ? -21.166 3.338   1.960   1.00 0.00 ? 79  GLU A CG   2  
ATOM 1984  C CD   . GLU A 1 56  ? -21.534 2.721   3.310   1.00 0.00 ? 79  GLU A CD   2  
ATOM 1985  O OE1  . GLU A 1 56  ? -22.076 1.591   3.362   1.00 0.00 ? 79  GLU A OE1  2  
ATOM 1986  O OE2  . GLU A 1 56  ? -21.256 3.329   4.362   1.00 0.00 ? 79  GLU A OE2  2  
ATOM 1987  H H    . GLU A 1 56  ? -19.231 2.790   -0.271  1.00 0.00 ? 79  GLU A H    2  
ATOM 1988  H HA   . GLU A 1 56  ? -20.060 0.965   1.615   1.00 0.00 ? 79  GLU A HA   2  
ATOM 1989  H HB2  . GLU A 1 56  ? -21.454 3.012   -0.128  1.00 0.00 ? 79  GLU A HB2  2  
ATOM 1990  H HB3  . GLU A 1 56  ? -22.447 1.998   0.879   1.00 0.00 ? 79  GLU A HB3  2  
ATOM 1991  H HG2  . GLU A 1 56  ? -20.120 3.630   1.961   1.00 0.00 ? 79  GLU A HG2  2  
ATOM 1992  H HG3  . GLU A 1 56  ? -21.754 4.237   1.813   1.00 0.00 ? 79  GLU A HG3  2  
ATOM 1993  N N    . ALA A 1 57  ? -21.248 0.130   -1.351  1.00 0.00 ? 80  ALA A N    2  
ATOM 1994  C CA   . ALA A 1 57  ? -21.789 -0.980  -2.099  1.00 0.00 ? 80  ALA A CA   2  
ATOM 1995  C C    . ALA A 1 57  ? -20.871 -2.195  -2.113  1.00 0.00 ? 80  ALA A C    2  
ATOM 1996  O O    . ALA A 1 57  ? -21.262 -3.271  -1.654  1.00 0.00 ? 80  ALA A O    2  
ATOM 1997  C CB   . ALA A 1 57  ? -22.138 -0.527  -3.518  1.00 0.00 ? 80  ALA A CB   2  
ATOM 1998  H H    . ALA A 1 57  ? -20.991 0.990   -1.824  1.00 0.00 ? 80  ALA A H    2  
ATOM 1999  H HA   . ALA A 1 57  ? -22.679 -1.301  -1.575  1.00 0.00 ? 80  ALA A HA   2  
ATOM 2000  H HB1  . ALA A 1 57  ? -21.245 -0.187  -4.043  1.00 0.00 ? 80  ALA A HB1  2  
ATOM 2001  H HB2  . ALA A 1 57  ? -22.539 -1.378  -4.067  1.00 0.00 ? 80  ALA A HB2  2  
ATOM 2002  H HB3  . ALA A 1 57  ? -22.872 0.285   -3.486  1.00 0.00 ? 80  ALA A HB3  2  
ATOM 2003  N N    . ASN A 1 58  ? -19.685 -2.074  -2.698  1.00 0.00 ? 81  ASN A N    2  
ATOM 2004  C CA   . ASN A 1 58  ? -18.862 -3.213  -3.080  1.00 0.00 ? 81  ASN A CA   2  
ATOM 2005  C C    . ASN A 1 58  ? -17.429 -2.991  -2.609  1.00 0.00 ? 81  ASN A C    2  
ATOM 2006  O O    . ASN A 1 58  ? -16.527 -2.824  -3.415  1.00 0.00 ? 81  ASN A O    2  
ATOM 2007  C CB   . ASN A 1 58  ? -19.041 -3.536  -4.585  1.00 0.00 ? 81  ASN A CB   2  
ATOM 2008  C CG   . ASN A 1 58  ? -19.033 -2.361  -5.558  1.00 0.00 ? 81  ASN A CG   2  
ATOM 2009  O OD1  . ASN A 1 58  ? -20.005 -2.134  -6.276  1.00 0.00 ? 81  ASN A OD1  2  
ATOM 2010  N ND2  . ASN A 1 58  ? -17.954 -1.609  -5.613  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 2011  H H    . ASN A 1 58  ? -19.376 -1.140  -2.960  1.00 0.00 ? 81  ASN A H    2  
ATOM 2012  H HA   . ASN A 1 58  ? -19.197 -4.098  -2.544  1.00 0.00 ? 81  ASN A HA   2  
ATOM 2013  H HB2  . ASN A 1 58  ? -18.281 -4.247  -4.901  1.00 0.00 ? 81  ASN A HB2  2  
ATOM 2014  H HB3  . ASN A 1 58  ? -20.005 -4.026  -4.699  1.00 0.00 ? 81  ASN A HB3  2  
ATOM 2015  H HD21 . ASN A 1 58  ? -17.193 -1.808  -4.976  1.00 0.00 ? 81  ASN A HD21 2  
ATOM 2016  H HD22 . ASN A 1 58  ? -17.929 -0.812  -6.230  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 2017  N N    . TYR A 1 59  ? -17.222 -2.997  -1.291  1.00 0.00 ? 82  TYR A N    2  
ATOM 2018  C CA   . TYR A 1 59  ? -15.963 -2.620  -0.641  1.00 0.00 ? 82  TYR A CA   2  
ATOM 2019  C C    . TYR A 1 59  ? -14.948 -3.758  -0.518  1.00 0.00 ? 82  TYR A C    2  
ATOM 2020  O O    . TYR A 1 59  ? -13.750 -3.552  -0.687  1.00 0.00 ? 82  TYR A O    2  
ATOM 2021  C CB   . TYR A 1 59  ? -16.275 -2.080  0.759   1.00 0.00 ? 82  TYR A CB   2  
ATOM 2022  C CG   . TYR A 1 59  ? -17.306 -2.863  1.547   1.00 0.00 ? 82  TYR A CG   2  
ATOM 2023  C CD1  . TYR A 1 59  ? -16.894 -3.992  2.281   1.00 0.00 ? 82  TYR A CD1  2  
ATOM 2024  C CD2  . TYR A 1 59  ? -18.663 -2.465  1.557   1.00 0.00 ? 82  TYR A CD2  2  
ATOM 2025  C CE1  . TYR A 1 59  ? -17.821 -4.741  3.021   1.00 0.00 ? 82  TYR A CE1  2  
ATOM 2026  C CE2  . TYR A 1 59  ? -19.588 -3.191  2.327   1.00 0.00 ? 82  TYR A CE2  2  
ATOM 2027  C CZ   . TYR A 1 59  ? -19.169 -4.324  3.064   1.00 0.00 ? 82  TYR A CZ   2  
ATOM 2028  O OH   . TYR A 1 59  ? -20.046 -5.031  3.824   1.00 0.00 ? 82  TYR A OH   2  
ATOM 2029  H H    . TYR A 1 59  ? -18.031 -3.029  -0.686  1.00 0.00 ? 82  TYR A H    2  
ATOM 2030  H HA   . TYR A 1 59  ? -15.505 -1.822  -1.225  1.00 0.00 ? 82  TYR A HA   2  
ATOM 2031  H HB2  . TYR A 1 59  ? -15.348 -2.037  1.331   1.00 0.00 ? 82  TYR A HB2  2  
ATOM 2032  H HB3  . TYR A 1 59  ? -16.633 -1.067  0.657   1.00 0.00 ? 82  TYR A HB3  2  
ATOM 2033  H HD1  . TYR A 1 59  ? -15.849 -4.265  2.311   1.00 0.00 ? 82  TYR A HD1  2  
ATOM 2034  H HD2  . TYR A 1 59  ? -19.028 -1.595  1.008   1.00 0.00 ? 82  TYR A HD2  2  
ATOM 2035  H HE1  . TYR A 1 59  ? -17.492 -5.594  3.605   1.00 0.00 ? 82  TYR A HE1  2  
ATOM 2036  H HE2  . TYR A 1 59  ? -20.623 -2.870  2.349   1.00 0.00 ? 82  TYR A HE2  2  
ATOM 2037  H HH   . TYR A 1 59  ? -20.787 -4.463  4.129   1.00 0.00 ? 82  TYR A HH   2  
ATOM 2038  N N    . TRP A 1 60  ? -15.404 -4.983  -0.241  1.00 0.00 ? 83  TRP A N    2  
ATOM 2039  C CA   . TRP A 1 60  ? -14.577 -6.183  -0.042  1.00 0.00 ? 83  TRP A CA   2  
ATOM 2040  C C    . TRP A 1 60  ? -13.917 -6.672  -1.345  1.00 0.00 ? 83  TRP A C    2  
ATOM 2041  O O    . TRP A 1 60  ? -13.304 -7.740  -1.396  1.00 0.00 ? 83  TRP A O    2  
ATOM 2042  C CB   . TRP A 1 60  ? -15.477 -7.265  0.556   1.00 0.00 ? 83  TRP A CB   2  
ATOM 2043  C CG   . TRP A 1 60  ? -16.628 -7.694  -0.307  1.00 0.00 ? 83  TRP A CG   2  
ATOM 2044  C CD1  . TRP A 1 60  ? -17.799 -7.037  -0.467  1.00 0.00 ? 83  TRP A CD1  2  
ATOM 2045  C CD2  . TRP A 1 60  ? -16.731 -8.893  -1.129  1.00 0.00 ? 83  TRP A CD2  2  
ATOM 2046  N NE1  . TRP A 1 60  ? -18.619 -7.750  -1.313  1.00 0.00 ? 83  TRP A NE1  2  
ATOM 2047  C CE2  . TRP A 1 60  ? -18.017 -8.911  -1.745  1.00 0.00 ? 83  TRP A CE2  2  
ATOM 2048  C CE3  . TRP A 1 60  ? -15.864 -9.969  -1.409  1.00 0.00 ? 83  TRP A CE3  2  
ATOM 2049  C CZ2  . TRP A 1 60  ? -18.426 -9.956  -2.585  1.00 0.00 ? 83  TRP A CZ2  2  
ATOM 2050  C CZ3  . TRP A 1 60  ? -16.265 -11.026 -2.248  1.00 0.00 ? 83  TRP A CZ3  2  
ATOM 2051  C CH2  . TRP A 1 60  ? -17.545 -11.024 -2.828  1.00 0.00 ? 83  TRP A CH2  2  
ATOM 2052  H H    . TRP A 1 60  ? -16.395 -5.088  -0.089  1.00 0.00 ? 83  TRP A H    2  
ATOM 2053  H HA   . TRP A 1 60  ? -13.781 -5.960  0.672   1.00 0.00 ? 83  TRP A HA   2  
ATOM 2054  H HB2  . TRP A 1 60  ? -14.869 -8.143  0.779   1.00 0.00 ? 83  TRP A HB2  2  
ATOM 2055  H HB3  . TRP A 1 60  ? -15.866 -6.893  1.505   1.00 0.00 ? 83  TRP A HB3  2  
ATOM 2056  H HD1  . TRP A 1 60  ? -18.081 -6.105  -0.002  1.00 0.00 ? 83  TRP A HD1  2  
ATOM 2057  H HE1  . TRP A 1 60  ? -19.562 -7.430  -1.525  1.00 0.00 ? 83  TRP A HE1  2  
ATOM 2058  H HE3  . TRP A 1 60  ? -14.896 -9.987  -0.928  1.00 0.00 ? 83  TRP A HE3  2  
ATOM 2059  H HZ2  . TRP A 1 60  ? -19.414 -9.958  -3.019  1.00 0.00 ? 83  TRP A HZ2  2  
ATOM 2060  H HZ3  . TRP A 1 60  ? -15.602 -11.862 -2.427  1.00 0.00 ? 83  TRP A HZ3  2  
ATOM 2061  H HH2  . TRP A 1 60  ? -17.846 -11.850 -3.457  1.00 0.00 ? 83  TRP A HH2  2  
ATOM 2062  N N    . GLN A 1 61  ? -14.104 -5.894  -2.406  1.00 0.00 ? 84  GLN A N    2  
ATOM 2063  C CA   . GLN A 1 61  ? -13.695 -6.088  -3.783  1.00 0.00 ? 84  GLN A CA   2  
ATOM 2064  C C    . GLN A 1 61  ? -12.431 -5.264  -4.073  1.00 0.00 ? 84  GLN A C    2  
ATOM 2065  O O    . GLN A 1 61  ? -12.053 -5.094  -5.230  1.00 0.00 ? 84  GLN A O    2  
ATOM 2066  C CB   . GLN A 1 61  ? -14.882 -5.652  -4.645  1.00 0.00 ? 84  GLN A CB   2  
ATOM 2067  C CG   . GLN A 1 61  ? -16.082 -6.593  -4.465  1.00 0.00 ? 84  GLN A CG   2  
ATOM 2068  C CD   . GLN A 1 61  ? -16.100 -7.769  -5.437  1.00 0.00 ? 84  GLN A CD   2  
ATOM 2069  O OE1  . GLN A 1 61  ? -15.629 -7.693  -6.573  1.00 0.00 ? 84  GLN A OE1  2  
ATOM 2070  N NE2  . GLN A 1 61  ? -16.675 -8.881  -5.021  1.00 0.00 ? 84  GLN A NE2  2  
ATOM 2071  H H    . GLN A 1 61  ? -14.543 -5.005  -2.223  1.00 0.00 ? 84  GLN A H    2  
ATOM 2072  H HA   . GLN A 1 61  ? -13.505 -7.137  -3.979  1.00 0.00 ? 84  GLN A HA   2  
ATOM 2073  H HB2  . GLN A 1 61  ? -15.167 -4.643  -4.362  1.00 0.00 ? 84  GLN A HB2  2  
ATOM 2074  H HB3  . GLN A 1 61  ? -14.601 -5.630  -5.687  1.00 0.00 ? 84  GLN A HB3  2  
ATOM 2075  H HG2  . GLN A 1 61  ? -16.103 -6.972  -3.451  1.00 0.00 ? 84  GLN A HG2  2  
ATOM 2076  H HG3  . GLN A 1 61  ? -16.990 -6.022  -4.583  1.00 0.00 ? 84  GLN A HG3  2  
ATOM 2077  H HE21 . GLN A 1 61  ? -17.067 -8.998  -4.096  1.00 0.00 ? 84  GLN A HE21 2  
ATOM 2078  H HE22 . GLN A 1 61  ? -16.687 -9.683  -5.641  1.00 0.00 ? 84  GLN A HE22 2  
ATOM 2079  N N    . PHE A 1 62  ? -11.821 -4.692  -3.033  1.00 0.00 ? 85  PHE A N    2  
ATOM 2080  C CA   . PHE A 1 62  ? -10.702 -3.771  -3.062  1.00 0.00 ? 85  PHE A CA   2  
ATOM 2081  C C    . PHE A 1 62  ? -9.773  -4.135  -1.902  1.00 0.00 ? 85  PHE A C    2  
ATOM 2082  O O    . PHE A 1 62  ? -10.231 -4.750  -0.933  1.00 0.00 ? 85  PHE A O    2  
ATOM 2083  C CB   . PHE A 1 62  ? -11.215 -2.345  -2.839  1.00 0.00 ? 85  PHE A CB   2  
ATOM 2084  C CG   . PHE A 1 62  ? -12.064 -1.747  -3.935  1.00 0.00 ? 85  PHE A CG   2  
ATOM 2085  C CD1  . PHE A 1 62  ? -13.413 -2.121  -4.065  1.00 0.00 ? 85  PHE A CD1  2  
ATOM 2086  C CD2  . PHE A 1 62  ? -11.546 -0.721  -4.742  1.00 0.00 ? 85  PHE A CD2  2  
ATOM 2087  C CE1  . PHE A 1 62  ? -14.227 -1.470  -5.002  1.00 0.00 ? 85  PHE A CE1  2  
ATOM 2088  C CE2  . PHE A 1 62  ? -12.369 -0.072  -5.671  1.00 0.00 ? 85  PHE A CE2  2  
ATOM 2089  C CZ   . PHE A 1 62  ? -13.707 -0.452  -5.805  1.00 0.00 ? 85  PHE A CZ   2  
ATOM 2090  H H    . PHE A 1 62  ? -12.140 -4.890  -2.093  1.00 0.00 ? 85  PHE A H    2  
ATOM 2091  H HA   . PHE A 1 62  ? -10.180 -3.844  -4.016  1.00 0.00 ? 85  PHE A HA   2  
ATOM 2092  H HB2  . PHE A 1 62  ? -11.806 -2.336  -1.929  1.00 0.00 ? 85  PHE A HB2  2  
ATOM 2093  H HB3  . PHE A 1 62  ? -10.368 -1.689  -2.654  1.00 0.00 ? 85  PHE A HB3  2  
ATOM 2094  H HD1  . PHE A 1 62  ? -13.843 -2.863  -3.406  1.00 0.00 ? 85  PHE A HD1  2  
ATOM 2095  H HD2  . PHE A 1 62  ? -10.527 -0.394  -4.625  1.00 0.00 ? 85  PHE A HD2  2  
ATOM 2096  H HE1  . PHE A 1 62  ? -15.273 -1.699  -5.075  1.00 0.00 ? 85  PHE A HE1  2  
ATOM 2097  H HE2  . PHE A 1 62  ? -11.988 0.745   -6.253  1.00 0.00 ? 85  PHE A HE2  2  
ATOM 2098  H HZ   . PHE A 1 62  ? -14.366 0.071   -6.476  1.00 0.00 ? 85  PHE A HZ   2  
ATOM 2099  N N    . PRO A 1 63  ? -8.485  -3.757  -1.962  1.00 0.00 ? 86  PRO A N    2  
ATOM 2100  C CA   . PRO A 1 63  ? -7.527  -4.045  -0.909  1.00 0.00 ? 86  PRO A CA   2  
ATOM 2101  C C    . PRO A 1 63  ? -7.876  -3.327  0.410   1.00 0.00 ? 86  PRO A C    2  
ATOM 2102  O O    . PRO A 1 63  ? -8.748  -2.458  0.451   1.00 0.00 ? 86  PRO A O    2  
ATOM 2103  C CB   . PRO A 1 63  ? -6.158  -3.642  -1.461  1.00 0.00 ? 86  PRO A CB   2  
ATOM 2104  C CG   . PRO A 1 63  ? -6.481  -2.655  -2.577  1.00 0.00 ? 86  PRO A CG   2  
ATOM 2105  C CD   . PRO A 1 63  ? -7.844  -3.097  -3.081  1.00 0.00 ? 86  PRO A CD   2  
ATOM 2106  H HA   . PRO A 1 63  ? -7.516  -5.122  -0.775  1.00 0.00 ? 86  PRO A HA   2  
ATOM 2107  H HB2  . PRO A 1 63  ? -5.510  -3.206  -0.706  1.00 0.00 ? 86  PRO A HB2  2  
ATOM 2108  H HB3  . PRO A 1 63  ? -5.669  -4.513  -1.882  1.00 0.00 ? 86  PRO A HB3  2  
ATOM 2109  H HG2  . PRO A 1 63  ? -6.569  -1.652  -2.172  1.00 0.00 ? 86  PRO A HG2  2  
ATOM 2110  H HG3  . PRO A 1 63  ? -5.735  -2.684  -3.365  1.00 0.00 ? 86  PRO A HG3  2  
ATOM 2111  H HD2  . PRO A 1 63  ? -8.409  -2.229  -3.408  1.00 0.00 ? 86  PRO A HD2  2  
ATOM 2112  H HD3  . PRO A 1 63  ? -7.732  -3.809  -3.897  1.00 0.00 ? 86  PRO A HD3  2  
ATOM 2113  N N    . ASP A 1 64  ? -7.145  -3.678  1.475   1.00 0.00 ? 87  ASP A N    2  
ATOM 2114  C CA   . ASP A 1 64  ? -7.106  -2.970  2.767   1.00 0.00 ? 87  ASP A CA   2  
ATOM 2115  C C    . ASP A 1 64  ? -5.657  -2.644  3.185   1.00 0.00 ? 87  ASP A C    2  
ATOM 2116  O O    . ASP A 1 64  ? -5.404  -1.961  4.176   1.00 0.00 ? 87  ASP A O    2  
ATOM 2117  C CB   . ASP A 1 64  ? -7.817  -3.803  3.840   1.00 0.00 ? 87  ASP A CB   2  
ATOM 2118  C CG   . ASP A 1 64  ? -7.716  -3.179  5.238   1.00 0.00 ? 87  ASP A CG   2  
ATOM 2119  O OD1  . ASP A 1 64  ? -8.399  -2.176  5.527   1.00 0.00 ? 87  ASP A OD1  2  
ATOM 2120  O OD2  . ASP A 1 64  ? -7.050  -3.784  6.103   1.00 0.00 ? 87  ASP A OD2  2  
ATOM 2121  H H    . ASP A 1 64  ? -6.472  -4.419  1.387   1.00 0.00 ? 87  ASP A H    2  
ATOM 2122  H HA   . ASP A 1 64  ? -7.642  -2.026  2.672   1.00 0.00 ? 87  ASP A HA   2  
ATOM 2123  H HB2  . ASP A 1 64  ? -8.870  -3.909  3.575   1.00 0.00 ? 87  ASP A HB2  2  
ATOM 2124  H HB3  . ASP A 1 64  ? -7.375  -4.801  3.862   1.00 0.00 ? 87  ASP A HB3  2  
ATOM 2125  N N    . GLY A 1 65  ? -4.687  -3.091  2.388   1.00 0.00 ? 88  GLY A N    2  
ATOM 2126  C CA   . GLY A 1 65  ? -3.274  -2.797  2.494   1.00 0.00 ? 88  GLY A CA   2  
ATOM 2127  C C    . GLY A 1 65  ? -2.594  -3.368  1.252   1.00 0.00 ? 88  GLY A C    2  
ATOM 2128  O O    . GLY A 1 65  ? -3.222  -4.108  0.476   1.00 0.00 ? 88  GLY A O    2  
ATOM 2129  H H    . GLY A 1 65  ? -4.911  -3.615  1.560   1.00 0.00 ? 88  GLY A H    2  
ATOM 2130  H HA2  . GLY A 1 65  ? -3.127  -1.718  2.547   1.00 0.00 ? 88  GLY A HA2  2  
ATOM 2131  H HA3  . GLY A 1 65  ? -2.864  -3.262  3.391   1.00 0.00 ? 88  GLY A HA3  2  
ATOM 2132  N N    . ILE A 1 66  ? -1.322  -3.025  1.062   1.00 0.00 ? 89  ILE A N    2  
ATOM 2133  C CA   . ILE A 1 66  ? -0.470  -3.520  -0.010  1.00 0.00 ? 89  ILE A CA   2  
ATOM 2134  C C    . ILE A 1 66  ? 0.795   -4.092  0.630   1.00 0.00 ? 89  ILE A C    2  
ATOM 2135  O O    . ILE A 1 66  ? 1.231   -3.631  1.686   1.00 0.00 ? 89  ILE A O    2  
ATOM 2136  C CB   . ILE A 1 66  ? -0.141  -2.385  -1.010  1.00 0.00 ? 89  ILE A CB   2  
ATOM 2137  C CG1  . ILE A 1 66  ? -1.390  -1.726  -1.627  1.00 0.00 ? 89  ILE A CG1  2  
ATOM 2138  C CG2  . ILE A 1 66  ? 0.793   -2.877  -2.130  1.00 0.00 ? 89  ILE A CG2  2  
ATOM 2139  C CD1  . ILE A 1 66  ? -2.225  -2.628  -2.543  1.00 0.00 ? 89  ILE A CD1  2  
ATOM 2140  H H    . ILE A 1 66  ? -0.860  -2.446  1.755   1.00 0.00 ? 89  ILE A H    2  
ATOM 2141  H HA   . ILE A 1 66  ? -0.986  -4.323  -0.537  1.00 0.00 ? 89  ILE A HA   2  
ATOM 2142  H HB   . ILE A 1 66  ? 0.386   -1.600  -0.467  1.00 0.00 ? 89  ILE A HB   2  
ATOM 2143  H HG12 . ILE A 1 66  ? -2.033  -1.345  -0.837  1.00 0.00 ? 89  ILE A HG12 2  
ATOM 2144  H HG13 . ILE A 1 66  ? -1.051  -0.867  -2.202  1.00 0.00 ? 89  ILE A HG13 2  
ATOM 2145  H HG21 . ILE A 1 66  ? 0.862   -2.130  -2.921  1.00 0.00 ? 89  ILE A HG21 2  
ATOM 2146  H HG22 . ILE A 1 66  ? 1.806   -3.007  -1.743  1.00 0.00 ? 89  ILE A HG22 2  
ATOM 2147  H HG23 . ILE A 1 66  ? 0.417   -3.824  -2.524  1.00 0.00 ? 89  ILE A HG23 2  
ATOM 2148  H HD11 . ILE A 1 66  ? -3.123  -2.095  -2.851  1.00 0.00 ? 89  ILE A HD11 2  
ATOM 2149  H HD12 . ILE A 1 66  ? -1.653  -2.892  -3.432  1.00 0.00 ? 89  ILE A HD12 2  
ATOM 2150  H HD13 . ILE A 1 66  ? -2.524  -3.532  -2.019  1.00 0.00 ? 89  ILE A HD13 2  
ATOM 2151  N N    . HIS A 1 67  ? 1.381   -5.084  -0.037  1.00 0.00 ? 90  HIS A N    2  
ATOM 2152  C CA   . HIS A 1 67  ? 2.626   -5.721  0.352   1.00 0.00 ? 90  HIS A CA   2  
ATOM 2153  C C    . HIS A 1 67  ? 3.783   -4.796  -0.040  1.00 0.00 ? 90  HIS A C    2  
ATOM 2154  O O    . HIS A 1 67  ? 4.007   -3.788  0.629   1.00 0.00 ? 90  HIS A O    2  
ATOM 2155  C CB   . HIS A 1 67  ? 2.704   -7.114  -0.294  1.00 0.00 ? 90  HIS A CB   2  
ATOM 2156  C CG   . HIS A 1 67  ? 1.536   -7.990  0.056   1.00 0.00 ? 90  HIS A CG   2  
ATOM 2157  N ND1  . HIS A 1 67  ? 0.280   -7.931  -0.504  1.00 0.00 ? 90  HIS A ND1  2  
ATOM 2158  C CD2  . HIS A 1 67  ? 1.560   -9.057  0.909   1.00 0.00 ? 90  HIS A CD2  2  
ATOM 2159  C CE1  . HIS A 1 67  ? -0.429  -8.953  -0.013  1.00 0.00 ? 90  HIS A CE1  2  
ATOM 2160  N NE2  . HIS A 1 67  ? 0.296   -9.653  0.874   1.00 0.00 ? 90  HIS A NE2  2  
ATOM 2161  H H    . HIS A 1 67  ? 0.933   -5.411  -0.876  1.00 0.00 ? 90  HIS A H    2  
ATOM 2162  H HA   . HIS A 1 67  ? 2.627   -5.842  1.438   1.00 0.00 ? 90  HIS A HA   2  
ATOM 2163  H HB2  . HIS A 1 67  ? 2.731   -7.026  -1.380  1.00 0.00 ? 90  HIS A HB2  2  
ATOM 2164  H HB3  . HIS A 1 67  ? 3.624   -7.603  0.033   1.00 0.00 ? 90  HIS A HB3  2  
ATOM 2165  H HD1  . HIS A 1 67  ? -0.082  -7.274  -1.185  1.00 0.00 ? 90  HIS A HD1  2  
ATOM 2166  H HD2  . HIS A 1 67  ? 2.422   -9.406  1.450   1.00 0.00 ? 90  HIS A HD2  2  
ATOM 2167  H HE1  . HIS A 1 67  ? -1.459  -9.131  -0.283  1.00 0.00 ? 90  HIS A HE1  2  
ATOM 2168  N N    . TYR A 1 68  ? 4.471   -5.089  -1.155  1.00 0.00 ? 91  TYR A N    2  
ATOM 2169  C CA   . TYR A 1 68  ? 5.549   -4.311  -1.785  1.00 0.00 ? 91  TYR A CA   2  
ATOM 2170  C C    . TYR A 1 68  ? 6.883   -4.340  -1.014  1.00 0.00 ? 91  TYR A C    2  
ATOM 2171  O O    . TYR A 1 68  ? 7.910   -3.929  -1.562  1.00 0.00 ? 91  TYR A O    2  
ATOM 2172  C CB   . TYR A 1 68  ? 5.076   -2.868  -2.034  1.00 0.00 ? 91  TYR A CB   2  
ATOM 2173  C CG   . TYR A 1 68  ? 5.851   -1.977  -2.986  1.00 0.00 ? 91  TYR A CG   2  
ATOM 2174  C CD1  . TYR A 1 68  ? 6.646   -2.479  -4.038  1.00 0.00 ? 91  TYR A CD1  2  
ATOM 2175  C CD2  . TYR A 1 68  ? 5.693   -0.589  -2.835  1.00 0.00 ? 91  TYR A CD2  2  
ATOM 2176  C CE1  . TYR A 1 68  ? 7.274   -1.602  -4.935  1.00 0.00 ? 91  TYR A CE1  2  
ATOM 2177  C CE2  . TYR A 1 68  ? 6.352   0.300   -3.700  1.00 0.00 ? 91  TYR A CE2  2  
ATOM 2178  C CZ   . TYR A 1 68  ? 7.141   -0.205  -4.757  1.00 0.00 ? 91  TYR A CZ   2  
ATOM 2179  O OH   . TYR A 1 68  ? 7.744   0.660   -5.613  1.00 0.00 ? 91  TYR A OH   2  
ATOM 2180  H H    . TYR A 1 68  ? 4.228   -5.948  -1.626  1.00 0.00 ? 91  TYR A H    2  
ATOM 2181  H HA   . TYR A 1 68  ? 5.712   -4.767  -2.756  1.00 0.00 ? 91  TYR A HA   2  
ATOM 2182  H HB2  . TYR A 1 68  ? 4.048   -2.891  -2.395  1.00 0.00 ? 91  TYR A HB2  2  
ATOM 2183  H HB3  . TYR A 1 68  ? 5.087   -2.360  -1.072  1.00 0.00 ? 91  TYR A HB3  2  
ATOM 2184  H HD1  . TYR A 1 68  ? 6.753   -3.540  -4.213  1.00 0.00 ? 91  TYR A HD1  2  
ATOM 2185  H HD2  . TYR A 1 68  ? 5.038   -0.224  -2.051  1.00 0.00 ? 91  TYR A HD2  2  
ATOM 2186  H HE1  . TYR A 1 68  ? 7.843   -2.029  -5.750  1.00 0.00 ? 91  TYR A HE1  2  
ATOM 2187  H HE2  . TYR A 1 68  ? 6.247   1.368   -3.567  1.00 0.00 ? 91  TYR A HE2  2  
ATOM 2188  H HH   . TYR A 1 68  ? 7.927   0.233   -6.466  1.00 0.00 ? 91  TYR A HH   2  
ATOM 2189  N N    . ASN A 1 69  ? 6.885   -4.887  0.208   1.00 0.00 ? 92  ASN A N    2  
ATOM 2190  C CA   . ASN A 1 69  ? 7.772   -4.589  1.337   1.00 0.00 ? 92  ASN A CA   2  
ATOM 2191  C C    . ASN A 1 69  ? 7.480   -3.188  1.864   1.00 0.00 ? 92  ASN A C    2  
ATOM 2192  O O    . ASN A 1 69  ? 7.090   -2.287  1.120   1.00 0.00 ? 92  ASN A O    2  
ATOM 2193  C CB   . ASN A 1 69  ? 9.280   -4.753  1.060   1.00 0.00 ? 92  ASN A CB   2  
ATOM 2194  C CG   . ASN A 1 69  ? 9.759   -6.199  1.019   1.00 0.00 ? 92  ASN A CG   2  
ATOM 2195  O OD1  . ASN A 1 69  ? 8.997   -7.122  0.746   1.00 0.00 ? 92  ASN A OD1  2  
ATOM 2196  N ND2  . ASN A 1 69  ? 11.038  -6.433  1.259   1.00 0.00 ? 92  ASN A ND2  2  
ATOM 2197  H H    . ASN A 1 69  ? 5.992   -5.241  0.523   1.00 0.00 ? 92  ASN A H    2  
ATOM 2198  H HA   . ASN A 1 69  ? 7.521   -5.295  2.127   1.00 0.00 ? 92  ASN A HA   2  
ATOM 2199  H HB2  . ASN A 1 69  ? 9.553   -4.254  0.139   1.00 0.00 ? 92  ASN A HB2  2  
ATOM 2200  H HB3  . ASN A 1 69  ? 9.826   -4.229  1.844   1.00 0.00 ? 92  ASN A HB3  2  
ATOM 2201  H HD21 . ASN A 1 69  ? 11.670  -5.673  1.454   1.00 0.00 ? 92  ASN A HD21 2  
ATOM 2202  H HD22 . ASN A 1 69  ? 11.378  -7.393  1.238   1.00 0.00 ? 92  ASN A HD22 2  
ATOM 2203  N N    . GLY A 1 70  ? 7.737   -2.994  3.154   1.00 0.00 ? 93  GLY A N    2  
ATOM 2204  C CA   . GLY A 1 70  ? 7.735   -1.701  3.795   1.00 0.00 ? 93  GLY A CA   2  
ATOM 2205  C C    . GLY A 1 70  ? 9.099   -1.070  3.565   1.00 0.00 ? 93  GLY A C    2  
ATOM 2206  O O    . GLY A 1 70  ? 10.114  -1.650  3.972   1.00 0.00 ? 93  GLY A O    2  
ATOM 2207  H H    . GLY A 1 70  ? 8.147   -3.737  3.697   1.00 0.00 ? 93  GLY A H    2  
ATOM 2208  H HA2  . GLY A 1 70  ? 6.940   -1.080  3.381   1.00 0.00 ? 93  GLY A HA2  2  
ATOM 2209  H HA3  . GLY A 1 70  ? 7.570   -1.824  4.865   1.00 0.00 ? 93  GLY A HA3  2  
ATOM 2210  N N    . CYS A 1 71  ? 9.094   0.097   2.929   1.00 0.00 ? 94  CYS A N    2  
ATOM 2211  C CA   . CYS A 1 71  ? 10.173  1.001   2.626   1.00 0.00 ? 94  CYS A CA   2  
ATOM 2212  C C    . CYS A 1 71  ? 11.072  0.466   1.521   1.00 0.00 ? 94  CYS A C    2  
ATOM 2213  O O    . CYS A 1 71  ? 10.956  -0.682  1.081   1.00 0.00 ? 94  CYS A O    2  
ATOM 2214  C CB   . CYS A 1 71  ? 10.918  1.455   3.889   1.00 0.00 ? 94  CYS A CB   2  
ATOM 2215  S SG   . CYS A 1 71  ? 11.331  3.217   3.833   1.00 0.00 ? 94  CYS A SG   2  
ATOM 2216  H H    . CYS A 1 71  ? 8.244   0.406   2.486   1.00 0.00 ? 94  CYS A H    2  
ATOM 2217  H HA   . CYS A 1 71  ? 9.679   1.882   2.218   1.00 0.00 ? 94  CYS A HA   2  
ATOM 2218  H HB2  . CYS A 1 71  ? 10.299  1.284   4.770   1.00 0.00 ? 94  CYS A HB2  2  
ATOM 2219  H HB3  . CYS A 1 71  ? 11.831  0.869   3.995   1.00 0.00 ? 94  CYS A HB3  2  
ATOM 2220  N N    . SER A 1 72  ? 11.897  1.372   1.023   1.00 0.00 ? 95  SER A N    2  
ATOM 2221  C CA   . SER A 1 72  ? 12.837  1.175   -0.081  1.00 0.00 ? 95  SER A CA   2  
ATOM 2222  C C    . SER A 1 72  ? 13.896  2.279   -0.179  1.00 0.00 ? 95  SER A C    2  
ATOM 2223  O O    . SER A 1 72  ? 15.023  2.012   -0.603  1.00 0.00 ? 95  SER A O    2  
ATOM 2224  C CB   . SER A 1 72  ? 12.056  1.110   -1.401  1.00 0.00 ? 95  SER A CB   2  
ATOM 2225  O OG   . SER A 1 72  ? 11.056  2.117   -1.470  1.00 0.00 ? 95  SER A OG   2  
ATOM 2226  H H    . SER A 1 72  ? 11.687  2.287   1.392   1.00 0.00 ? 95  SER A H    2  
ATOM 2227  H HA   . SER A 1 72  ? 13.354  0.225   0.061   1.00 0.00 ? 95  SER A HA   2  
ATOM 2228  H HB2  . SER A 1 72  ? 12.740  1.201   -2.246  1.00 0.00 ? 95  SER A HB2  2  
ATOM 2229  H HB3  . SER A 1 72  ? 11.572  0.137   -1.464  1.00 0.00 ? 95  SER A HB3  2  
ATOM 2230  H HG   . SER A 1 72  ? 10.317  1.711   -1.980  1.00 0.00 ? 95  SER A HG   2  
ATOM 2231  N N    . GLU A 1 73  ? 13.579  3.511   0.224   1.00 0.00 ? 96  GLU A N    2  
ATOM 2232  C CA   . GLU A 1 73  ? 14.389  4.706   -0.001  1.00 0.00 ? 96  GLU A CA   2  
ATOM 2233  C C    . GLU A 1 73  ? 14.388  5.578   1.243   1.00 0.00 ? 96  GLU A C    2  
ATOM 2234  O O    . GLU A 1 73  ? 13.578  5.396   2.152   1.00 0.00 ? 96  GLU A O    2  
ATOM 2235  C CB   . GLU A 1 73  ? 13.797  5.504   -1.188  1.00 0.00 ? 96  GLU A CB   2  
ATOM 2236  C CG   . GLU A 1 73  ? 14.600  5.394   -2.493  1.00 0.00 ? 96  GLU A CG   2  
ATOM 2237  C CD   . GLU A 1 73  ? 15.808  6.337   -2.526  1.00 0.00 ? 96  GLU A CD   2  
ATOM 2238  O OE1  . GLU A 1 73  ? 16.425  6.594   -1.460  1.00 0.00 ? 96  GLU A OE1  2  
ATOM 2239  O OE2  . GLU A 1 73  ? 16.183  6.809   -3.622  1.00 0.00 ? 96  GLU A OE2  2  
ATOM 2240  H H    . GLU A 1 73  ? 12.670  3.691   0.627   1.00 0.00 ? 96  GLU A H    2  
ATOM 2241  H HA   . GLU A 1 73  ? 15.431  4.441   -0.189  1.00 0.00 ? 96  GLU A HA   2  
ATOM 2242  H HB2  . GLU A 1 73  ? 12.783  5.153   -1.362  1.00 0.00 ? 96  GLU A HB2  2  
ATOM 2243  H HB3  . GLU A 1 73  ? 13.712  6.565   -0.939  1.00 0.00 ? 96  GLU A HB3  2  
ATOM 2244  H HG2  . GLU A 1 73  ? 14.929  4.367   -2.651  1.00 0.00 ? 96  GLU A HG2  2  
ATOM 2245  H HG3  . GLU A 1 73  ? 13.942  5.655   -3.322  1.00 0.00 ? 96  GLU A HG3  2  
ATOM 2246  N N    . ALA A 1 74  ? 15.244  6.592   1.206   1.00 0.00 ? 97  ALA A N    2  
ATOM 2247  C CA   . ALA A 1 74  ? 15.260  7.704   2.140   1.00 0.00 ? 97  ALA A CA   2  
ATOM 2248  C C    . ALA A 1 74  ? 15.094  9.046   1.422   1.00 0.00 ? 97  ALA A C    2  
ATOM 2249  O O    . ALA A 1 74  ? 14.889  10.070  2.068   1.00 0.00 ? 97  ALA A O    2  
ATOM 2250  C CB   . ALA A 1 74  ? 16.564  7.624   2.917   1.00 0.00 ? 97  ALA A CB   2  
ATOM 2251  H H    . ALA A 1 74  ? 15.878  6.634   0.413   1.00 0.00 ? 97  ALA A H    2  
ATOM 2252  H HA   . ALA A 1 74  ? 14.434  7.602   2.842   1.00 0.00 ? 97  ALA A HA   2  
ATOM 2253  H HB1  . ALA A 1 74  ? 16.630  6.636   3.372   1.00 0.00 ? 97  ALA A HB1  2  
ATOM 2254  H HB2  . ALA A 1 74  ? 17.396  7.770   2.231   1.00 0.00 ? 97  ALA A HB2  2  
ATOM 2255  H HB3  . ALA A 1 74  ? 16.583  8.392   3.688   1.00 0.00 ? 97  ALA A HB3  2  
ATOM 2256  N N    . ASN A 1 75  ? 15.134  9.059   0.087   1.00 0.00 ? 98  ASN A N    2  
ATOM 2257  C CA   . ASN A 1 75  ? 14.879  10.232  -0.739  1.00 0.00 ? 98  ASN A CA   2  
ATOM 2258  C C    . ASN A 1 75  ? 13.797  9.839   -1.726  1.00 0.00 ? 98  ASN A C    2  
ATOM 2259  O O    . ASN A 1 75  ? 14.086  9.378   -2.834  1.00 0.00 ? 98  ASN A O    2  
ATOM 2260  C CB   . ASN A 1 75  ? 16.157  10.724  -1.429  1.00 0.00 ? 98  ASN A CB   2  
ATOM 2261  C CG   . ASN A 1 75  ? 17.042  11.441  -0.429  1.00 0.00 ? 98  ASN A CG   2  
ATOM 2262  O OD1  . ASN A 1 75  ? 16.868  12.624  -0.160  1.00 0.00 ? 98  ASN A OD1  2  
ATOM 2263  N ND2  . ASN A 1 75  ? 17.960  10.744  0.210   1.00 0.00 ? 98  ASN A ND2  2  
ATOM 2264  H H    . ASN A 1 75  ? 15.276  8.180   -0.390  1.00 0.00 ? 98  ASN A H    2  
ATOM 2265  H HA   . ASN A 1 75  ? 14.500  11.053  -0.124  1.00 0.00 ? 98  ASN A HA   2  
ATOM 2266  H HB2  . ASN A 1 75  ? 16.684  9.893   -1.902  1.00 0.00 ? 98  ASN A HB2  2  
ATOM 2267  H HB3  . ASN A 1 75  ? 15.873  11.437  -2.204  1.00 0.00 ? 98  ASN A HB3  2  
ATOM 2268  H HD21 . ASN A 1 75  ? 18.068  9.749   0.030   1.00 0.00 ? 98  ASN A HD21 2  
ATOM 2269  H HD22 . ASN A 1 75  ? 18.514  11.190  0.934   1.00 0.00 ? 98  ASN A HD22 2  
ATOM 2270  N N    . VAL A 1 76  ? 12.547  9.915   -1.279  1.00 0.00 ? 99  VAL A N    2  
ATOM 2271  C CA   . VAL A 1 76  ? 11.371  9.612   -2.066  1.00 0.00 ? 99  VAL A CA   2  
ATOM 2272  C C    . VAL A 1 76  ? 10.208  10.405  -1.474  1.00 0.00 ? 99  VAL A C    2  
ATOM 2273  O O    . VAL A 1 76  ? 10.298  10.934  -0.367  1.00 0.00 ? 99  VAL A O    2  
ATOM 2274  C CB   . VAL A 1 76  ? 11.157  8.091   -2.039  1.00 0.00 ? 99  VAL A CB   2  
ATOM 2275  C CG1  . VAL A 1 76  ? 10.756  7.604   -0.642  1.00 0.00 ? 99  VAL A CG1  2  
ATOM 2276  C CG2  . VAL A 1 76  ? 10.167  7.609   -3.093  1.00 0.00 ? 99  VAL A CG2  2  
ATOM 2277  H H    . VAL A 1 76  ? 12.329  10.288  -0.362  1.00 0.00 ? 99  VAL A H    2  
ATOM 2278  H HA   . VAL A 1 76  ? 11.552  9.939   -3.091  1.00 0.00 ? 99  VAL A HA   2  
ATOM 2279  H HB   . VAL A 1 76  ? 12.099  7.631   -2.308  1.00 0.00 ? 99  VAL A HB   2  
ATOM 2280  H HG11 . VAL A 1 76  ? 9.752   7.942   -0.386  1.00 0.00 ? 99  VAL A HG11 2  
ATOM 2281  H HG12 . VAL A 1 76  ? 10.783  6.516   -0.612  1.00 0.00 ? 99  VAL A HG12 2  
ATOM 2282  H HG13 . VAL A 1 76  ? 11.447  8.010   0.102   1.00 0.00 ? 99  VAL A HG13 2  
ATOM 2283  H HG21 . VAL A 1 76  ? 9.163   7.924   -2.828  1.00 0.00 ? 99  VAL A HG21 2  
ATOM 2284  H HG22 . VAL A 1 76  ? 10.453  8.018   -4.060  1.00 0.00 ? 99  VAL A HG22 2  
ATOM 2285  H HG23 . VAL A 1 76  ? 10.211  6.521   -3.152  1.00 0.00 ? 99  VAL A HG23 2  
ATOM 2286  N N    . THR A 1 77  ? 9.094   10.462  -2.187  1.00 0.00 ? 100 THR A N    2  
ATOM 2287  C CA   . THR A 1 77  ? 7.961   11.305  -1.841  1.00 0.00 ? 100 THR A CA   2  
ATOM 2288  C C    . THR A 1 77  ? 6.662   10.517  -1.876  1.00 0.00 ? 100 THR A C    2  
ATOM 2289  O O    . THR A 1 77  ? 6.597   9.401   -2.403  1.00 0.00 ? 100 THR A O    2  
ATOM 2290  C CB   . THR A 1 77  ? 7.941   12.515  -2.800  1.00 0.00 ? 100 THR A CB   2  
ATOM 2291  O OG1  . THR A 1 77  ? 8.002   12.115  -4.160  1.00 0.00 ? 100 THR A OG1  2  
ATOM 2292  C CG2  . THR A 1 77  ? 9.089   13.483  -2.518  1.00 0.00 ? 100 THR A CG2  2  
ATOM 2293  H H    . THR A 1 77  ? 9.057   9.937   -3.045  1.00 0.00 ? 100 THR A H    2  
ATOM 2294  H HA   . THR A 1 77  ? 8.057   11.645  -0.804  1.00 0.00 ? 100 THR A HA   2  
ATOM 2295  H HB   . THR A 1 77  ? 7.008   13.052  -2.671  1.00 0.00 ? 100 THR A HB   2  
ATOM 2296  H HG1  . THR A 1 77  ? 8.043   12.924  -4.696  1.00 0.00 ? 100 THR A HG1  2  
ATOM 2297  H HG21 . THR A 1 77  ? 10.054  13.005  -2.683  1.00 0.00 ? 100 THR A HG21 2  
ATOM 2298  H HG22 . THR A 1 77  ? 9.012   14.352  -3.171  1.00 0.00 ? 100 THR A HG22 2  
ATOM 2299  H HG23 . THR A 1 77  ? 9.039   13.820  -1.481  1.00 0.00 ? 100 THR A HG23 2  
ATOM 2300  N N    . LYS A 1 78  ? 5.600   11.123  -1.339  1.00 0.00 ? 101 LYS A N    2  
ATOM 2301  C CA   . LYS A 1 78  ? 4.266   10.555  -1.358  1.00 0.00 ? 101 LYS A CA   2  
ATOM 2302  C C    . LYS A 1 78  ? 3.685   10.476  -2.765  1.00 0.00 ? 101 LYS A C    2  
ATOM 2303  O O    . LYS A 1 78  ? 2.685   9.790   -2.958  1.00 0.00 ? 101 LYS A O    2  
ATOM 2304  C CB   . LYS A 1 78  ? 3.336   11.424  -0.502  1.00 0.00 ? 101 LYS A CB   2  
ATOM 2305  C CG   . LYS A 1 78  ? 2.719   10.547  0.570   1.00 0.00 ? 101 LYS A CG   2  
ATOM 2306  C CD   . LYS A 1 78  ? 1.587   11.273  1.301   1.00 0.00 ? 101 LYS A CD   2  
ATOM 2307  C CE   . LYS A 1 78  ? 0.298   11.244  0.473   1.00 0.00 ? 101 LYS A CE   2  
ATOM 2308  N NZ   . LYS A 1 78  ? -0.651  12.289  0.902   1.00 0.00 ? 101 LYS A NZ   2  
ATOM 2309  H H    . LYS A 1 78  ? 5.692   12.039  -0.918  1.00 0.00 ? 101 LYS A H    2  
ATOM 2310  H HA   . LYS A 1 78  ? 4.355   9.537   -0.952  1.00 0.00 ? 101 LYS A HA   2  
ATOM 2311  H HB2  . LYS A 1 78  ? 3.883   12.234  -0.018  1.00 0.00 ? 101 LYS A HB2  2  
ATOM 2312  H HB3  . LYS A 1 78  ? 2.551   11.861  -1.121  1.00 0.00 ? 101 LYS A HB3  2  
ATOM 2313  H HG2  . LYS A 1 78  ? 2.356   9.633   0.111   1.00 0.00 ? 101 LYS A HG2  2  
ATOM 2314  H HG3  . LYS A 1 78  ? 3.523   10.295  1.251   1.00 0.00 ? 101 LYS A HG3  2  
ATOM 2315  H HD2  . LYS A 1 78  ? 1.404   10.791  2.261   1.00 0.00 ? 101 LYS A HD2  2  
ATOM 2316  H HD3  . LYS A 1 78  ? 1.894   12.302  1.480   1.00 0.00 ? 101 LYS A HD3  2  
ATOM 2317  H HE2  . LYS A 1 78  ? 0.534   11.400  -0.582  1.00 0.00 ? 101 LYS A HE2  2  
ATOM 2318  H HE3  . LYS A 1 78  ? -0.165  10.262  0.574   1.00 0.00 ? 101 LYS A HE3  2  
ATOM 2319  H HZ1  . LYS A 1 78  ? -0.788  12.293  1.910   1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 2320  H HZ2  . LYS A 1 78  ? -0.294  13.202  0.647   1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 2321  H HZ3  . LYS A 1 78  ? -1.544  12.188  0.431   1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 2322  N N    . GLU A 1 79  ? 4.252   11.206  -3.722  1.00 0.00 ? 102 GLU A N    2  
ATOM 2323  C CA   . GLU A 1 79  ? 4.054   10.907  -5.118  1.00 0.00 ? 102 GLU A CA   2  
ATOM 2324  C C    . GLU A 1 79  ? 4.910   9.683   -5.437  1.00 0.00 ? 102 GLU A C    2  
ATOM 2325  O O    . GLU A 1 79  ? 4.363   8.604   -5.633  1.00 0.00 ? 102 GLU A O    2  
ATOM 2326  C CB   . GLU A 1 79  ? 4.403   12.136  -5.978  1.00 0.00 ? 102 GLU A CB   2  
ATOM 2327  C CG   . GLU A 1 79  ? 3.218   12.562  -6.845  1.00 0.00 ? 102 GLU A CG   2  
ATOM 2328  C CD   . GLU A 1 79  ? 2.667   11.444  -7.744  1.00 0.00 ? 102 GLU A CD   2  
ATOM 2329  O OE1  . GLU A 1 79  ? 3.437   10.586  -8.223  1.00 0.00 ? 102 GLU A OE1  2  
ATOM 2330  O OE2  . GLU A 1 79  ? 1.429   11.399  -7.948  1.00 0.00 ? 102 GLU A OE2  2  
ATOM 2331  H H    . GLU A 1 79  ? 5.017   11.823  -3.509  1.00 0.00 ? 102 GLU A H    2  
ATOM 2332  H HA   . GLU A 1 79  ? 3.007   10.635  -5.264  1.00 0.00 ? 102 GLU A HA   2  
ATOM 2333  H HB2  . GLU A 1 79  ? 4.685   12.980  -5.342  1.00 0.00 ? 102 GLU A HB2  2  
ATOM 2334  H HB3  . GLU A 1 79  ? 5.246   11.919  -6.632  1.00 0.00 ? 102 GLU A HB3  2  
ATOM 2335  H HG2  . GLU A 1 79  ? 2.419   12.919  -6.195  1.00 0.00 ? 102 GLU A HG2  2  
ATOM 2336  H HG3  . GLU A 1 79  ? 3.553   13.394  -7.457  1.00 0.00 ? 102 GLU A HG3  2  
ATOM 2337  N N    . ALA A 1 80  ? 6.239   9.837   -5.441  1.00 0.00 ? 103 ALA A N    2  
ATOM 2338  C CA   . ALA A 1 80  ? 7.165   8.907   -6.066  1.00 0.00 ? 103 ALA A CA   2  
ATOM 2339  C C    . ALA A 1 80  ? 6.996   7.461   -5.601  1.00 0.00 ? 103 ALA A C    2  
ATOM 2340  O O    . ALA A 1 80  ? 6.879   6.573   -6.446  1.00 0.00 ? 103 ALA A O    2  
ATOM 2341  C CB   . ALA A 1 80  ? 8.600   9.390   -5.841  1.00 0.00 ? 103 ALA A CB   2  
ATOM 2342  H H    . ALA A 1 80  ? 6.623   10.745  -5.213  1.00 0.00 ? 103 ALA A H    2  
ATOM 2343  H HA   . ALA A 1 80  ? 6.964   8.931   -7.135  1.00 0.00 ? 103 ALA A HA   2  
ATOM 2344  H HB1  . ALA A 1 80  ? 8.797   9.482   -4.777  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 2345  H HB2  . ALA A 1 80  ? 9.304   8.679   -6.274  1.00 0.00 ? 103 ALA A HB2  2  
ATOM 2346  H HB3  . ALA A 1 80  ? 8.741   10.359  -6.314  1.00 0.00 ? 103 ALA A HB3  2  
ATOM 2347  N N    . PHE A 1 81  ? 7.002   7.221   -4.287  1.00 0.00 ? 104 PHE A N    2  
ATOM 2348  C CA   . PHE A 1 81  ? 6.938   5.878   -3.716  1.00 0.00 ? 104 PHE A CA   2  
ATOM 2349  C C    . PHE A 1 81  ? 5.559   5.267   -3.970  1.00 0.00 ? 104 PHE A C    2  
ATOM 2350  O O    . PHE A 1 81  ? 5.466   4.109   -4.368  1.00 0.00 ? 104 PHE A O    2  
ATOM 2351  C CB   . PHE A 1 81  ? 7.300   5.907   -2.214  1.00 0.00 ? 104 PHE A CB   2  
ATOM 2352  C CG   . PHE A 1 81  ? 6.449   5.003   -1.352  1.00 0.00 ? 104 PHE A CG   2  
ATOM 2353  C CD1  . PHE A 1 81  ? 6.732   3.627   -1.257  1.00 0.00 ? 104 PHE A CD1  2  
ATOM 2354  C CD2  . PHE A 1 81  ? 5.302   5.533   -0.735  1.00 0.00 ? 104 PHE A CD2  2  
ATOM 2355  C CE1  . PHE A 1 81  ? 5.867   2.782   -0.540  1.00 0.00 ? 104 PHE A CE1  2  
ATOM 2356  C CE2  . PHE A 1 81  ? 4.413   4.677   -0.071  1.00 0.00 ? 104 PHE A CE2  2  
ATOM 2357  C CZ   . PHE A 1 81  ? 4.703   3.306   0.049   1.00 0.00 ? 104 PHE A CZ   2  
ATOM 2358  H H    . PHE A 1 81  ? 7.038   8.012   -3.651  1.00 0.00 ? 104 PHE A H    2  
ATOM 2359  H HA   . PHE A 1 81  ? 7.668   5.243   -4.223  1.00 0.00 ? 104 PHE A HA   2  
ATOM 2360  H HB2  . PHE A 1 81  ? 8.342   5.608   -2.100  1.00 0.00 ? 104 PHE A HB2  2  
ATOM 2361  H HB3  . PHE A 1 81  ? 7.206   6.922   -1.825  1.00 0.00 ? 104 PHE A HB3  2  
ATOM 2362  H HD1  . PHE A 1 81  ? 7.599   3.209   -1.749  1.00 0.00 ? 104 PHE A HD1  2  
ATOM 2363  H HD2  . PHE A 1 81  ? 5.094   6.598   -0.769  1.00 0.00 ? 104 PHE A HD2  2  
ATOM 2364  H HE1  . PHE A 1 81  ? 6.096   1.729   -0.448  1.00 0.00 ? 104 PHE A HE1  2  
ATOM 2365  H HE2  . PHE A 1 81  ? 3.522   5.102   0.359   1.00 0.00 ? 104 PHE A HE2  2  
ATOM 2366  H HZ   . PHE A 1 81  ? 4.039   2.657   0.603   1.00 0.00 ? 104 PHE A HZ   2  
ATOM 2367  N N    . VAL A 1 82  ? 4.481   6.030   -3.768  1.00 0.00 ? 105 VAL A N    2  
ATOM 2368  C CA   . VAL A 1 82  ? 3.126   5.528   -3.972  1.00 0.00 ? 105 VAL A CA   2  
ATOM 2369  C C    . VAL A 1 82  ? 2.941   5.206   -5.458  1.00 0.00 ? 105 VAL A C    2  
ATOM 2370  O O    . VAL A 1 82  ? 2.404   4.163   -5.815  1.00 0.00 ? 105 VAL A O    2  
ATOM 2371  C CB   . VAL A 1 82  ? 2.109   6.559   -3.454  1.00 0.00 ? 105 VAL A CB   2  
ATOM 2372  C CG1  . VAL A 1 82  ? 0.676   6.133   -3.759  1.00 0.00 ? 105 VAL A CG1  2  
ATOM 2373  C CG2  . VAL A 1 82  ? 2.224   6.811   -1.945  1.00 0.00 ? 105 VAL A CG2  2  
ATOM 2374  H H    . VAL A 1 82  ? 4.606   7.002   -3.527  1.00 0.00 ? 105 VAL A H    2  
ATOM 2375  H HA   . VAL A 1 82  ? 3.009   4.600   -3.410  1.00 0.00 ? 105 VAL A HA   2  
ATOM 2376  H HB   . VAL A 1 82  ? 2.294   7.499   -3.955  1.00 0.00 ? 105 VAL A HB   2  
ATOM 2377  H HG11 . VAL A 1 82  ? -0.023  6.839   -3.311  1.00 0.00 ? 105 VAL A HG11 2  
ATOM 2378  H HG12 . VAL A 1 82  ? 0.520   6.120   -4.836  1.00 0.00 ? 105 VAL A HG12 2  
ATOM 2379  H HG13 . VAL A 1 82  ? 0.497   5.132   -3.368  1.00 0.00 ? 105 VAL A HG13 2  
ATOM 2380  H HG21 . VAL A 1 82  ? 2.088   5.882   -1.394  1.00 0.00 ? 105 VAL A HG21 2  
ATOM 2381  H HG22 . VAL A 1 82  ? 3.193   7.247   -1.714  1.00 0.00 ? 105 VAL A HG22 2  
ATOM 2382  H HG23 . VAL A 1 82  ? 1.460   7.527   -1.644  1.00 0.00 ? 105 VAL A HG23 2  
ATOM 2383  N N    . THR A 1 83  ? 3.424   6.066   -6.345  1.00 0.00 ? 106 THR A N    2  
ATOM 2384  C CA   . THR A 1 83  ? 3.492   5.806   -7.762  1.00 0.00 ? 106 THR A CA   2  
ATOM 2385  C C    . THR A 1 83  ? 4.285   4.521   -8.038  1.00 0.00 ? 106 THR A C    2  
ATOM 2386  O O    . THR A 1 83  ? 3.825   3.704   -8.835  1.00 0.00 ? 106 THR A O    2  
ATOM 2387  C CB   . THR A 1 83  ? 4.048   7.070   -8.425  1.00 0.00 ? 106 THR A CB   2  
ATOM 2388  O OG1  . THR A 1 83  ? 2.994   8.020   -8.449  1.00 0.00 ? 106 THR A OG1  2  
ATOM 2389  C CG2  . THR A 1 83  ? 4.538   6.789   -9.834  1.00 0.00 ? 106 THR A CG2  2  
ATOM 2390  H H    . THR A 1 83  ? 3.819   6.943   -6.027  1.00 0.00 ? 106 THR A H    2  
ATOM 2391  H HA   . THR A 1 83  ? 2.478   5.641   -8.129  1.00 0.00 ? 106 THR A HA   2  
ATOM 2392  H HB   . THR A 1 83  ? 4.884   7.459   -7.846  1.00 0.00 ? 106 THR A HB   2  
ATOM 2393  H HG1  . THR A 1 83  ? 3.368   8.933   -8.383  1.00 0.00 ? 106 THR A HG1  2  
ATOM 2394  H HG21 . THR A 1 83  ? 3.735   6.358   -10.430 1.00 0.00 ? 106 THR A HG21 2  
ATOM 2395  H HG22 . THR A 1 83  ? 4.893   7.712   -10.282 1.00 0.00 ? 106 THR A HG22 2  
ATOM 2396  H HG23 . THR A 1 83  ? 5.372   6.085   -9.780  1.00 0.00 ? 106 THR A HG23 2  
ATOM 2397  N N    . GLY A 1 84  ? 5.430   4.295   -7.390  1.00 0.00 ? 107 GLY A N    2  
ATOM 2398  C CA   . GLY A 1 84  ? 6.169   3.041   -7.484  1.00 0.00 ? 107 GLY A CA   2  
ATOM 2399  C C    . GLY A 1 84  ? 5.289   1.856   -7.084  1.00 0.00 ? 107 GLY A C    2  
ATOM 2400  O O    . GLY A 1 84  ? 5.247   0.847   -7.797  1.00 0.00 ? 107 GLY A O    2  
ATOM 2401  H H    . GLY A 1 84  ? 5.806   5.003   -6.766  1.00 0.00 ? 107 GLY A H    2  
ATOM 2402  H HA2  . GLY A 1 84  ? 6.525   2.902   -8.506  1.00 0.00 ? 107 GLY A HA2  2  
ATOM 2403  H HA3  . GLY A 1 84  ? 7.027   3.083   -6.812  1.00 0.00 ? 107 GLY A HA3  2  
ATOM 2404  N N    . CYS A 1 85  ? 4.538   1.995   -5.990  1.00 0.00 ? 108 CYS A N    2  
ATOM 2405  C CA   . CYS A 1 85  ? 3.664   0.931   -5.493  1.00 0.00 ? 108 CYS A CA   2  
ATOM 2406  C C    . CYS A 1 85  ? 2.561   0.648   -6.509  1.00 0.00 ? 108 CYS A C    2  
ATOM 2407  O O    . CYS A 1 85  ? 2.127   -0.489  -6.670  1.00 0.00 ? 108 CYS A O    2  
ATOM 2408  C CB   . CYS A 1 85  ? 3.102   1.223   -4.086  1.00 0.00 ? 108 CYS A CB   2  
ATOM 2409  S SG   . CYS A 1 85  ? 1.440   1.957   -3.966  1.00 0.00 ? 108 CYS A SG   2  
ATOM 2410  H H    . CYS A 1 85  ? 4.583   2.904   -5.537  1.00 0.00 ? 108 CYS A H    2  
ATOM 2411  H HA   . CYS A 1 85  ? 4.272   0.029   -5.416  1.00 0.00 ? 108 CYS A HA   2  
ATOM 2412  H HB2  . CYS A 1 85  ? 3.046   0.260   -3.575  1.00 0.00 ? 108 CYS A HB2  2  
ATOM 2413  H HB3  . CYS A 1 85  ? 3.808   1.839   -3.528  1.00 0.00 ? 108 CYS A HB3  2  
ATOM 2414  N N    . ILE A 1 86  ? 2.125   1.670   -7.241  1.00 0.00 ? 109 ILE A N    2  
ATOM 2415  C CA   . ILE A 1 86  ? 1.119   1.568   -8.278  1.00 0.00 ? 109 ILE A CA   2  
ATOM 2416  C C    . ILE A 1 86  ? 1.670   0.907   -9.528  1.00 0.00 ? 109 ILE A C    2  
ATOM 2417  O O    . ILE A 1 86  ? 0.998   0.062   -10.110 1.00 0.00 ? 109 ILE A O    2  
ATOM 2418  C CB   . ILE A 1 86  ? 0.530   2.962   -8.516  1.00 0.00 ? 109 ILE A CB   2  
ATOM 2419  C CG1  . ILE A 1 86  ? -0.651  3.081   -7.542  1.00 0.00 ? 109 ILE A CG1  2  
ATOM 2420  C CG2  . ILE A 1 86  ? 0.102   3.246   -9.956  1.00 0.00 ? 109 ILE A CG2  2  
ATOM 2421  C CD1  . ILE A 1 86  ? -0.922  4.542   -7.235  1.00 0.00 ? 109 ILE A CD1  2  
ATOM 2422  H H    . ILE A 1 86  ? 2.451   2.594   -6.976  1.00 0.00 ? 109 ILE A H    2  
ATOM 2423  H HA   . ILE A 1 86  ? 0.336   0.927   -7.893  1.00 0.00 ? 109 ILE A HA   2  
ATOM 2424  H HB   . ILE A 1 86  ? 1.281   3.707   -8.262  1.00 0.00 ? 109 ILE A HB   2  
ATOM 2425  H HG12 . ILE A 1 86  ? -1.548  2.605   -7.942  1.00 0.00 ? 109 ILE A HG12 2  
ATOM 2426  H HG13 . ILE A 1 86  ? -0.407  2.564   -6.614  1.00 0.00 ? 109 ILE A HG13 2  
ATOM 2427  H HG21 . ILE A 1 86  ? -0.337  4.241   -10.006 1.00 0.00 ? 109 ILE A HG21 2  
ATOM 2428  H HG22 . ILE A 1 86  ? 0.967   3.238   -10.616 1.00 0.00 ? 109 ILE A HG22 2  
ATOM 2429  H HG23 . ILE A 1 86  ? -0.622  2.494   -10.271 1.00 0.00 ? 109 ILE A HG23 2  
ATOM 2430  H HD11 . ILE A 1 86  ? 0.012   5.017   -6.932  1.00 0.00 ? 109 ILE A HD11 2  
ATOM 2431  H HD12 . ILE A 1 86  ? -1.315  5.041   -8.120  1.00 0.00 ? 109 ILE A HD12 2  
ATOM 2432  H HD13 . ILE A 1 86  ? -1.646  4.578   -6.429  1.00 0.00 ? 109 ILE A HD13 2  
ATOM 2433  N N    . ASN A 1 87  ? 2.886   1.259   -9.938  1.00 0.00 ? 110 ASN A N    2  
ATOM 2434  C CA   . ASN A 1 87  ? 3.565   0.578   -11.051 1.00 0.00 ? 110 ASN A CA   2  
ATOM 2435  C C    . ASN A 1 87  ? 3.671   -0.913  -10.766 1.00 0.00 ? 110 ASN A C    2  
ATOM 2436  O O    . ASN A 1 87  ? 3.618   -1.738  -11.678 1.00 0.00 ? 110 ASN A O    2  
ATOM 2437  C CB   . ASN A 1 87  ? 4.990   1.101   -11.281 1.00 0.00 ? 110 ASN A CB   2  
ATOM 2438  C CG   . ASN A 1 87  ? 5.038   2.378   -12.084 1.00 0.00 ? 110 ASN A CG   2  
ATOM 2439  O OD1  . ASN A 1 87  ? 5.495   2.387   -13.220 1.00 0.00 ? 110 ASN A OD1  2  
ATOM 2440  N ND2  . ASN A 1 87  ? 4.639   3.482   -11.492 1.00 0.00 ? 110 ASN A ND2  2  
ATOM 2441  H H    . ASN A 1 87  ? 3.305   2.020   -9.410  1.00 0.00 ? 110 ASN A H    2  
ATOM 2442  H HA   . ASN A 1 87  ? 2.975   0.705   -11.960 1.00 0.00 ? 110 ASN A HA   2  
ATOM 2443  H HB2  . ASN A 1 87  ? 5.509   1.241   -10.334 1.00 0.00 ? 110 ASN A HB2  2  
ATOM 2444  H HB3  . ASN A 1 87  ? 5.552   0.353   -11.843 1.00 0.00 ? 110 ASN A HB3  2  
ATOM 2445  H HD21 . ASN A 1 87  ? 4.345   3.442   -10.520 1.00 0.00 ? 110 ASN A HD21 2  
ATOM 2446  H HD22 . ASN A 1 87  ? 4.782   4.367   -11.970 1.00 0.00 ? 110 ASN A HD22 2  
ATOM 2447  N N    . ALA A 1 88  ? 3.827   -1.265  -9.494  1.00 0.00 ? 111 ALA A N    2  
ATOM 2448  C CA   . ALA A 1 88  ? 3.898   -2.633  -9.059  1.00 0.00 ? 111 ALA A CA   2  
ATOM 2449  C C    . ALA A 1 88  ? 2.500   -3.248  -9.033  1.00 0.00 ? 111 ALA A C    2  
ATOM 2450  O O    . ALA A 1 88  ? 2.281   -4.308  -9.613  1.00 0.00 ? 111 ALA A O    2  
ATOM 2451  C CB   . ALA A 1 88  ? 4.610   -2.635  -7.714  1.00 0.00 ? 111 ALA A CB   2  
ATOM 2452  H H    . ALA A 1 88  ? 3.864   -0.545  -8.784  1.00 0.00 ? 111 ALA A H    2  
ATOM 2453  H HA   . ALA A 1 88  ? 4.489   -3.206  -9.769  1.00 0.00 ? 111 ALA A HA   2  
ATOM 2454  H HB1  . ALA A 1 88  ? 4.034   -2.090  -6.968  1.00 0.00 ? 111 ALA A HB1  2  
ATOM 2455  H HB2  . ALA A 1 88  ? 4.745   -3.659  -7.395  1.00 0.00 ? 111 ALA A HB2  2  
ATOM 2456  H HB3  . ALA A 1 88  ? 5.585   -2.156  -7.819  1.00 0.00 ? 111 ALA A HB3  2  
ATOM 2457  N N    . THR A 1 89  ? 1.534   -2.590  -8.397  1.00 0.00 ? 112 THR A N    2  
ATOM 2458  C CA   . THR A 1 89  ? 0.204   -3.140  -8.184  1.00 0.00 ? 112 THR A CA   2  
ATOM 2459  C C    . THR A 1 89  ? -0.584  -3.279  -9.493  1.00 0.00 ? 112 THR A C    2  
ATOM 2460  O O    . THR A 1 89  ? -1.360  -4.230  -9.626  1.00 0.00 ? 112 THR A O    2  
ATOM 2461  C CB   . THR A 1 89  ? -0.530  -2.311  -7.118  1.00 0.00 ? 112 THR A CB   2  
ATOM 2462  O OG1  . THR A 1 89  ? -1.494  -3.090  -6.467  1.00 0.00 ? 112 THR A OG1  2  
ATOM 2463  C CG2  . THR A 1 89  ? -1.302  -1.144  -7.717  1.00 0.00 ? 112 THR A CG2  2  
ATOM 2464  H H    . THR A 1 89  ? 1.790   -1.729  -7.923  1.00 0.00 ? 112 THR A H    2  
ATOM 2465  H HA   . THR A 1 89  ? 0.350   -4.139  -7.784  1.00 0.00 ? 112 THR A HA   2  
ATOM 2466  H HB   . THR A 1 89  ? 0.176   -1.954  -6.371  1.00 0.00 ? 112 THR A HB   2  
ATOM 2467  H HG1  . THR A 1 89  ? -1.069  -3.830  -5.992  1.00 0.00 ? 112 THR A HG1  2  
ATOM 2468  H HG21 . THR A 1 89  ? -2.203  -1.530  -8.178  1.00 0.00 ? 112 THR A HG21 2  
ATOM 2469  H HG22 . THR A 1 89  ? -1.550  -0.422  -6.946  1.00 0.00 ? 112 THR A HG22 2  
ATOM 2470  H HG23 . THR A 1 89  ? -0.721  -0.673  -8.495  1.00 0.00 ? 112 THR A HG23 2  
ATOM 2471  N N    . GLN A 1 90  ? -0.380  -2.387  -10.474 1.00 0.00 ? 113 GLN A N    2  
ATOM 2472  C CA   . GLN A 1 90  ? -1.069  -2.502  -11.762 1.00 0.00 ? 113 GLN A CA   2  
ATOM 2473  C C    . GLN A 1 90  ? -0.722  -3.843  -12.415 1.00 0.00 ? 113 GLN A C    2  
ATOM 2474  O O    . GLN A 1 90  ? -1.582  -4.478  -13.028 1.00 0.00 ? 113 GLN A O    2  
ATOM 2475  C CB   . GLN A 1 90  ? -0.771  -1.306  -12.692 1.00 0.00 ? 113 GLN A CB   2  
ATOM 2476  C CG   . GLN A 1 90  ? 0.698   -1.180  -13.124 1.00 0.00 ? 113 GLN A CG   2  
ATOM 2477  C CD   . GLN A 1 90  ? 0.990   -0.027  -14.077 1.00 0.00 ? 113 GLN A CD   2  
ATOM 2478  O OE1  . GLN A 1 90  ? 1.585   -0.231  -15.134 1.00 0.00 ? 113 GLN A OE1  2  
ATOM 2479  N NE2  . GLN A 1 90  ? 0.648   1.194   -13.700 1.00 0.00 ? 113 GLN A NE2  2  
ATOM 2480  H H    . GLN A 1 90  ? 0.228   -1.584  -10.295 1.00 0.00 ? 113 GLN A H    2  
ATOM 2481  H HA   . GLN A 1 90  ? -2.143  -2.498  -11.567 1.00 0.00 ? 113 GLN A HA   2  
ATOM 2482  H HB2  . GLN A 1 90  ? -1.380  -1.406  -13.588 1.00 0.00 ? 113 GLN A HB2  2  
ATOM 2483  H HB3  . GLN A 1 90  ? -1.069  -0.390  -12.182 1.00 0.00 ? 113 GLN A HB3  2  
ATOM 2484  H HG2  . GLN A 1 90  ? 1.300   -1.024  -12.242 1.00 0.00 ? 113 GLN A HG2  2  
ATOM 2485  H HG3  . GLN A 1 90  ? 1.020   -2.100  -13.609 1.00 0.00 ? 113 GLN A HG3  2  
ATOM 2486  H HE21 . GLN A 1 90  ? 0.184   1.350   -12.822 1.00 0.00 ? 113 GLN A HE21 2  
ATOM 2487  H HE22 . GLN A 1 90  ? 0.806   1.961   -14.357 1.00 0.00 ? 113 GLN A HE22 2  
ATOM 2488  N N    . ALA A 1 91  ? 0.522   -4.292  -12.232 1.00 0.00 ? 114 ALA A N    2  
ATOM 2489  C CA   . ALA A 1 91  ? 1.016   -5.553  -12.740 1.00 0.00 ? 114 ALA A CA   2  
ATOM 2490  C C    . ALA A 1 91  ? 0.857   -6.685  -11.724 1.00 0.00 ? 114 ALA A C    2  
ATOM 2491  O O    . ALA A 1 91  ? 0.912   -7.847  -12.120 1.00 0.00 ? 114 ALA A O    2  
ATOM 2492  C CB   . ALA A 1 91  ? 2.483   -5.363  -13.129 1.00 0.00 ? 114 ALA A CB   2  
ATOM 2493  H H    . ALA A 1 91  ? 1.167   -3.734  -11.688 1.00 0.00 ? 114 ALA A H    2  
ATOM 2494  H HA   . ALA A 1 91  ? 0.433   -5.828  -13.622 1.00 0.00 ? 114 ALA A HA   2  
ATOM 2495  H HB1  . ALA A 1 91  ? 2.861   -6.278  -13.575 1.00 0.00 ? 114 ALA A HB1  2  
ATOM 2496  H HB2  . ALA A 1 91  ? 2.581   -4.562  -13.858 1.00 0.00 ? 114 ALA A HB2  2  
ATOM 2497  H HB3  . ALA A 1 91  ? 3.075   -5.106  -12.250 1.00 0.00 ? 114 ALA A HB3  2  
ATOM 2498  N N    . ALA A 1 92  ? 0.622   -6.393  -10.437 1.00 0.00 ? 115 ALA A N    2  
ATOM 2499  C CA   . ALA A 1 92  ? 0.206   -7.426  -9.503  1.00 0.00 ? 115 ALA A CA   2  
ATOM 2500  C C    . ALA A 1 92  ? -1.139  -7.939  -10.000 1.00 0.00 ? 115 ALA A C    2  
ATOM 2501  O O    . ALA A 1 92  ? -1.279  -9.126  -10.282 1.00 0.00 ? 115 ALA A O    2  
ATOM 2502  C CB   . ALA A 1 92  ? 0.131   -6.913  -8.055  1.00 0.00 ? 115 ALA A CB   2  
ATOM 2503  H H    . ALA A 1 92  ? 0.591   -5.420  -10.141 1.00 0.00 ? 115 ALA A H    2  
ATOM 2504  H HA   . ALA A 1 92  ? 0.925   -8.246  -9.537  1.00 0.00 ? 115 ALA A HA   2  
ATOM 2505  H HB1  . ALA A 1 92  ? 1.112   -6.574  -7.724  1.00 0.00 ? 115 ALA A HB1  2  
ATOM 2506  H HB2  . ALA A 1 92  ? -0.583  -6.099  -7.966  1.00 0.00 ? 115 ALA A HB2  2  
ATOM 2507  H HB3  . ALA A 1 92  ? -0.221  -7.706  -7.389  1.00 0.00 ? 115 ALA A HB3  2  
ATOM 2508  N N    . ASN A 1 93  ? -2.106  -7.034  -10.140 1.00 0.00 ? 116 ASN A N    2  
ATOM 2509  C CA   . ASN A 1 93  ? -3.509  -7.358  -10.326 1.00 0.00 ? 116 ASN A CA   2  
ATOM 2510  C C    . ASN A 1 93  ? -3.899  -6.978  -11.759 1.00 0.00 ? 116 ASN A C    2  
ATOM 2511  O O    . ASN A 1 93  ? -4.825  -6.190  -11.968 1.00 0.00 ? 116 ASN A O    2  
ATOM 2512  C CB   . ASN A 1 93  ? -4.376  -6.681  -9.235  1.00 0.00 ? 116 ASN A CB   2  
ATOM 2513  C CG   . ASN A 1 93  ? -3.753  -6.636  -7.848  1.00 0.00 ? 116 ASN A CG   2  
ATOM 2514  O OD1  . ASN A 1 93  ? -3.851  -7.568  -7.054  1.00 0.00 ? 116 ASN A OD1  2  
ATOM 2515  N ND2  . ASN A 1 93  ? -3.066  -5.550  -7.549  1.00 0.00 ? 116 ASN A ND2  2  
ATOM 2516  H H    . ASN A 1 93  ? -1.863  -6.064  -9.965  1.00 0.00 ? 116 ASN A H    2  
ATOM 2517  H HA   . ASN A 1 93  ? -3.634  -8.436  -10.215 1.00 0.00 ? 116 ASN A HA   2  
ATOM 2518  H HB2  . ASN A 1 93  ? -4.627  -5.665  -9.534  1.00 0.00 ? 116 ASN A HB2  2  
ATOM 2519  H HB3  . ASN A 1 93  ? -5.303  -7.234  -9.144  1.00 0.00 ? 116 ASN A HB3  2  
ATOM 2520  H HD21 . ASN A 1 93  ? -2.960  -4.812  -8.233  1.00 0.00 ? 116 ASN A HD21 2  
ATOM 2521  H HD22 . ASN A 1 93  ? -2.706  -5.423  -6.614  1.00 0.00 ? 116 ASN A HD22 2  
ATOM 2522  N N    . GLN A 1 94  ? -3.173  -7.511  -12.756 1.00 0.00 ? 117 GLN A N    2  
ATOM 2523  C CA   . GLN A 1 94  ? -3.321  -7.163  -14.173 1.00 0.00 ? 117 GLN A CA   2  
ATOM 2524  C C    . GLN A 1 94  ? -4.787  -7.220  -14.599 1.00 0.00 ? 117 GLN A C    2  
ATOM 2525  O O    . GLN A 1 94  ? -5.396  -6.176  -14.853 1.00 0.00 ? 117 GLN A O    2  
ATOM 2526  C CB   . GLN A 1 94  ? -2.456  -8.083  -15.064 1.00 0.00 ? 117 GLN A CB   2  
ATOM 2527  C CG   . GLN A 1 94  ? -0.962  -7.759  -15.196 1.00 0.00 ? 117 GLN A CG   2  
ATOM 2528  C CD   . GLN A 1 94  ? -0.575  -6.490  -15.964 1.00 0.00 ? 117 GLN A CD   2  
ATOM 2529  O OE1  . GLN A 1 94  ? 0.599   -6.133  -15.995 1.00 0.00 ? 117 GLN A OE1  2  
ATOM 2530  N NE2  . GLN A 1 94  ? -1.483  -5.764  -16.590 1.00 0.00 ? 117 GLN A NE2  2  
ATOM 2531  H H    . GLN A 1 94  ? -2.439  -8.163  -12.512 1.00 0.00 ? 117 GLN A H    2  
ATOM 2532  H HA   . GLN A 1 94  ? -3.023  -6.130  -14.297 1.00 0.00 ? 117 GLN A HA   2  
ATOM 2533  H HB2  . GLN A 1 94  ? -2.510  -9.084  -14.646 1.00 0.00 ? 117 GLN A HB2  2  
ATOM 2534  H HB3  . GLN A 1 94  ? -2.882  -8.132  -16.064 1.00 0.00 ? 117 GLN A HB3  2  
ATOM 2535  H HG2  . GLN A 1 94  ? -0.542  -7.698  -14.198 1.00 0.00 ? 117 GLN A HG2  2  
ATOM 2536  H HG3  . GLN A 1 94  ? -0.484  -8.603  -15.697 1.00 0.00 ? 117 GLN A HG3  2  
ATOM 2537  H HE21 . GLN A 1 94  ? -2.441  -6.084  -16.717 1.00 0.00 ? 117 GLN A HE21 2  
ATOM 2538  H HE22 . GLN A 1 94  ? -1.194  -4.879  -16.991 1.00 0.00 ? 117 GLN A HE22 2  
ATOM 2539  N N    . GLY A 1 95  ? -5.365  -8.421  -14.591 1.00 0.00 ? 118 GLY A N    2  
ATOM 2540  C CA   . GLY A 1 95  ? -6.760  -8.659  -14.918 1.00 0.00 ? 118 GLY A CA   2  
ATOM 2541  C C    . GLY A 1 95  ? -7.695  -8.306  -13.769 1.00 0.00 ? 118 GLY A C    2  
ATOM 2542  O O    . GLY A 1 95  ? -8.695  -8.997  -13.570 1.00 0.00 ? 118 GLY A O    2  
ATOM 2543  H H    . GLY A 1 95  ? -4.811  -9.220  -14.321 1.00 0.00 ? 118 GLY A H    2  
ATOM 2544  H HA2  . GLY A 1 95  ? -7.036  -8.060  -15.788 1.00 0.00 ? 118 GLY A HA2  2  
ATOM 2545  H HA3  . GLY A 1 95  ? -6.896  -9.709  -15.161 1.00 0.00 ? 118 GLY A HA3  2  
ATOM 2546  N N    . GLU A 1 96  ? -7.400  -7.256  -13.007 1.00 0.00 ? 119 GLU A N    2  
ATOM 2547  C CA   . GLU A 1 96  ? -8.302  -6.682  -12.021 1.00 0.00 ? 119 GLU A CA   2  
ATOM 2548  C C    . GLU A 1 96  ? -8.412  -5.184  -12.253 1.00 0.00 ? 119 GLU A C    2  
ATOM 2549  O O    . GLU A 1 96  ? -9.535  -4.683  -12.259 1.00 0.00 ? 119 GLU A O    2  
ATOM 2550  C CB   . GLU A 1 96  ? -7.870  -7.098  -10.612 1.00 0.00 ? 119 GLU A CB   2  
ATOM 2551  C CG   . GLU A 1 96  ? -8.176  -6.076  -9.514  1.00 0.00 ? 119 GLU A CG   2  
ATOM 2552  C CD   . GLU A 1 96  ? -8.202  -6.696  -8.112  1.00 0.00 ? 119 GLU A CD   2  
ATOM 2553  O OE1  . GLU A 1 96  ? -7.620  -7.785  -7.892  1.00 0.00 ? 119 GLU A OE1  2  
ATOM 2554  O OE2  . GLU A 1 96  ? -8.938  -6.167  -7.247  1.00 0.00 ? 119 GLU A OE2  2  
ATOM 2555  H H    . GLU A 1 96  ? -6.527  -6.755  -13.172 1.00 0.00 ? 119 GLU A H    2  
ATOM 2556  H HA   . GLU A 1 96  ? -9.309  -7.065  -12.174 1.00 0.00 ? 119 GLU A HA   2  
ATOM 2557  H HB2  . GLU A 1 96  ? -8.373  -8.037  -10.383 1.00 0.00 ? 119 GLU A HB2  2  
ATOM 2558  H HB3  . GLU A 1 96  ? -6.802  -7.272  -10.608 1.00 0.00 ? 119 GLU A HB3  2  
ATOM 2559  H HG2  . GLU A 1 96  ? -7.430  -5.288  -9.568  1.00 0.00 ? 119 GLU A HG2  2  
ATOM 2560  H HG3  . GLU A 1 96  ? -9.145  -5.628  -9.715  1.00 0.00 ? 119 GLU A HG3  2  
ATOM 2561  N N    . PHE A 1 97  ? -7.300  -4.488  -12.516 1.00 0.00 ? 120 PHE A N    2  
ATOM 2562  C CA   . PHE A 1 97  ? -7.382  -3.144  -13.076 1.00 0.00 ? 120 PHE A CA   2  
ATOM 2563  C C    . PHE A 1 97  ? -7.965  -3.164  -14.490 1.00 0.00 ? 120 PHE A C    2  
ATOM 2564  O O    . PHE A 1 97  ? -8.789  -2.305  -14.810 1.00 0.00 ? 120 PHE A O    2  
ATOM 2565  C CB   . PHE A 1 97  ? -6.019  -2.465  -13.074 1.00 0.00 ? 120 PHE A CB   2  
ATOM 2566  C CG   . PHE A 1 97  ? -5.577  -2.008  -11.705 1.00 0.00 ? 120 PHE A CG   2  
ATOM 2567  C CD1  . PHE A 1 97  ? -4.841  -2.871  -10.877 1.00 0.00 ? 120 PHE A CD1  2  
ATOM 2568  C CD2  . PHE A 1 97  ? -5.902  -0.714  -11.259 1.00 0.00 ? 120 PHE A CD2  2  
ATOM 2569  C CE1  . PHE A 1 97  ? -4.382  -2.423  -9.630  1.00 0.00 ? 120 PHE A CE1  2  
ATOM 2570  C CE2  . PHE A 1 97  ? -5.442  -0.266  -10.015 1.00 0.00 ? 120 PHE A CE2  2  
ATOM 2571  C CZ   . PHE A 1 97  ? -4.666  -1.114  -9.210  1.00 0.00 ? 120 PHE A CZ   2  
ATOM 2572  H H    . PHE A 1 97  ? -6.386  -4.920  -12.390 1.00 0.00 ? 120 PHE A H    2  
ATOM 2573  H HA   . PHE A 1 97  ? -8.053  -2.556  -12.453 1.00 0.00 ? 120 PHE A HA   2  
ATOM 2574  H HB2  . PHE A 1 97  ? -5.281  -3.148  -13.488 1.00 0.00 ? 120 PHE A HB2  2  
ATOM 2575  H HB3  . PHE A 1 97  ? -6.067  -1.592  -13.728 1.00 0.00 ? 120 PHE A HB3  2  
ATOM 2576  H HD1  . PHE A 1 97  ? -4.623  -3.875  -11.202 1.00 0.00 ? 120 PHE A HD1  2  
ATOM 2577  H HD2  . PHE A 1 97  ? -6.495  -0.048  -11.867 1.00 0.00 ? 120 PHE A HD2  2  
ATOM 2578  H HE1  . PHE A 1 97  ? -3.803  -3.081  -9.001  1.00 0.00 ? 120 PHE A HE1  2  
ATOM 2579  H HE2  . PHE A 1 97  ? -5.683  0.737   -9.703  1.00 0.00 ? 120 PHE A HE2  2  
ATOM 2580  H HZ   . PHE A 1 97  ? -4.291  -0.774  -8.259  1.00 0.00 ? 120 PHE A HZ   2  
ATOM 2581  N N    . GLN A 1 98  ? -7.594  -4.142  -15.325 1.00 0.00 ? 121 GLN A N    2  
ATOM 2582  C CA   . GLN A 1 98  ? -8.369  -4.462  -16.513 1.00 0.00 ? 121 GLN A CA   2  
ATOM 2583  C C    . GLN A 1 98  ? -9.586  -5.258  -16.061 1.00 0.00 ? 121 GLN A C    2  
ATOM 2584  O O    . GLN A 1 98  ? -9.622  -6.491  -16.109 1.00 0.00 ? 121 GLN A O    2  
ATOM 2585  C CB   . GLN A 1 98  ? -7.551  -5.210  -17.575 1.00 0.00 ? 121 GLN A CB   2  
ATOM 2586  C CG   . GLN A 1 98  ? -6.725  -4.258  -18.458 1.00 0.00 ? 121 GLN A CG   2  
ATOM 2587  C CD   . GLN A 1 98  ? -6.909  -4.601  -19.937 1.00 0.00 ? 121 GLN A CD   2  
ATOM 2588  O OE1  . GLN A 1 98  ? -6.729  -5.748  -20.342 1.00 0.00 ? 121 GLN A OE1  2  
ATOM 2589  N NE2  . GLN A 1 98  ? -7.315  -3.643  -20.752 1.00 0.00 ? 121 GLN A NE2  2  
ATOM 2590  H H    . GLN A 1 98  ? -6.937  -4.839  -15.005 1.00 0.00 ? 121 GLN A H    2  
ATOM 2591  H HA   . GLN A 1 98  ? -8.742  -3.539  -16.966 1.00 0.00 ? 121 GLN A HA   2  
ATOM 2592  H HB2  . GLN A 1 98  ? -6.904  -5.956  -17.113 1.00 0.00 ? 121 GLN A HB2  2  
ATOM 2593  H HB3  . GLN A 1 98  ? -8.258  -5.742  -18.214 1.00 0.00 ? 121 GLN A HB3  2  
ATOM 2594  H HG2  . GLN A 1 98  ? -7.026  -3.223  -18.292 1.00 0.00 ? 121 GLN A HG2  2  
ATOM 2595  H HG3  . GLN A 1 98  ? -5.672  -4.338  -18.193 1.00 0.00 ? 121 GLN A HG3  2  
ATOM 2596  H HE21 . GLN A 1 98  ? -7.550  -2.718  -20.399 1.00 0.00 ? 121 GLN A HE21 2  
ATOM 2597  H HE22 . GLN A 1 98  ? -7.491  -3.851  -21.732 1.00 0.00 ? 121 GLN A HE22 2  
ATOM 2598  N N    . LYS A 1 99  ? -10.592 -4.536  -15.588 1.00 0.00 ? 122 LYS A N    2  
ATOM 2599  C CA   . LYS A 1 99  ? -11.977 -4.953  -15.742 1.00 0.00 ? 122 LYS A CA   2  
ATOM 2600  C C    . LYS A 1 99  ? -12.451 -4.539  -17.144 1.00 0.00 ? 122 LYS A C    2  
ATOM 2601  O O    . LYS A 1 99  ? -11.858 -3.640  -17.745 1.00 0.00 ? 122 LYS A O    2  
ATOM 2602  C CB   . LYS A 1 99  ? -12.816 -4.332  -14.613 1.00 0.00 ? 122 LYS A CB   2  
ATOM 2603  C CG   . LYS A 1 99  ? -12.920 -5.255  -13.395 1.00 0.00 ? 122 LYS A CG   2  
ATOM 2604  C CD   . LYS A 1 99  ? -13.929 -6.389  -13.621 1.00 0.00 ? 122 LYS A CD   2  
ATOM 2605  C CE   . LYS A 1 99  ? -14.084 -7.292  -12.401 1.00 0.00 ? 122 LYS A CE   2  
ATOM 2606  N NZ   . LYS A 1 99  ? -13.090 -8.384  -12.408 1.00 0.00 ? 122 LYS A NZ   2  
ATOM 2607  H H    . LYS A 1 99  ? -10.394 -3.545  -15.502 1.00 0.00 ? 122 LYS A H    2  
ATOM 2608  H HA   . LYS A 1 99  ? -12.018 -6.037  -15.680 1.00 0.00 ? 122 LYS A HA   2  
ATOM 2609  H HB2  . LYS A 1 99  ? -12.336 -3.411  -14.286 1.00 0.00 ? 122 LYS A HB2  2  
ATOM 2610  H HB3  . LYS A 1 99  ? -13.817 -4.095  -14.972 1.00 0.00 ? 122 LYS A HB3  2  
ATOM 2611  H HG2  . LYS A 1 99  ? -11.936 -5.672  -13.197 1.00 0.00 ? 122 LYS A HG2  2  
ATOM 2612  H HG3  . LYS A 1 99  ? -13.242 -4.665  -12.534 1.00 0.00 ? 122 LYS A HG3  2  
ATOM 2613  H HD2  . LYS A 1 99  ? -14.899 -5.945  -13.841 1.00 0.00 ? 122 LYS A HD2  2  
ATOM 2614  H HD3  . LYS A 1 99  ? -13.611 -7.004  -14.460 1.00 0.00 ? 122 LYS A HD3  2  
ATOM 2615  H HE2  . LYS A 1 99  ? -13.963 -6.689  -11.500 1.00 0.00 ? 122 LYS A HE2  2  
ATOM 2616  H HE3  . LYS A 1 99  ? -15.087 -7.724  -12.400 1.00 0.00 ? 122 LYS A HE3  2  
ATOM 2617  H HZ1  . LYS A 1 99  ? -13.086 -8.850  -11.506 1.00 0.00 ? 122 LYS A HZ1  2  
ATOM 2618  H HZ2  . LYS A 1 99  ? -13.304 -9.065  -13.130 1.00 0.00 ? 122 LYS A HZ2  2  
ATOM 2619  H HZ3  . LYS A 1 99  ? -12.163 -8.014  -12.586 1.00 0.00 ? 122 LYS A HZ3  2  
ATOM 2620  N N    . PRO A 1 100 ? -13.496 -5.187  -17.682 1.00 0.00 ? 123 PRO A N    2  
ATOM 2621  C CA   . PRO A 1 100 ? -14.011 -4.950  -19.026 1.00 0.00 ? 123 PRO A CA   2  
ATOM 2622  C C    . PRO A 1 100 ? -15.113 -3.877  -19.075 1.00 0.00 ? 123 PRO A C    2  
ATOM 2623  O O    . PRO A 1 100 ? -15.662 -3.635  -20.150 1.00 0.00 ? 123 PRO A O    2  
ATOM 2624  C CB   . PRO A 1 100 ? -14.585 -6.311  -19.436 1.00 0.00 ? 123 PRO A CB   2  
ATOM 2625  C CG   . PRO A 1 100 ? -15.190 -6.796  -18.121 1.00 0.00 ? 123 PRO A CG   2  
ATOM 2626  C CD   . PRO A 1 100 ? -14.172 -6.332  -17.093 1.00 0.00 ? 123 PRO A CD   2  
ATOM 2627  H HA   . PRO A 1 100 ? -13.208 -4.668  -19.707 1.00 0.00 ? 123 PRO A HA   2  
ATOM 2628  H HB2  . PRO A 1 100 ? -15.333 -6.236  -20.225 1.00 0.00 ? 123 PRO A HB2  2  
ATOM 2629  H HB3  . PRO A 1 100 ? -13.780 -6.980  -19.742 1.00 0.00 ? 123 PRO A HB3  2  
ATOM 2630  H HG2  . PRO A 1 100 ? -16.137 -6.290  -17.936 1.00 0.00 ? 123 PRO A HG2  2  
ATOM 2631  H HG3  . PRO A 1 100 ? -15.316 -7.874  -18.095 1.00 0.00 ? 123 PRO A HG3  2  
ATOM 2632  H HD2  . PRO A 1 100 ? -14.691 -6.046  -16.182 1.00 0.00 ? 123 PRO A HD2  2  
ATOM 2633  H HD3  . PRO A 1 100 ? -13.456 -7.133  -16.904 1.00 0.00 ? 123 PRO A HD3  2  
ATOM 2634  N N    . ASP A 1 101 ? -15.494 -3.297  -17.933 1.00 0.00 ? 124 ASP A N    2  
ATOM 2635  C CA   . ASP A 1 101 ? -16.694 -2.469  -17.782 1.00 0.00 ? 124 ASP A CA   2  
ATOM 2636  C C    . ASP A 1 101 ? -16.340 -1.208  -16.998 1.00 0.00 ? 124 ASP A C    2  
ATOM 2637  O O    . ASP A 1 101 ? -16.496 -0.098  -17.510 1.00 0.00 ? 124 ASP A O    2  
ATOM 2638  C CB   . ASP A 1 101 ? -17.798 -3.286  -17.095 1.00 0.00 ? 124 ASP A CB   2  
ATOM 2639  C CG   . ASP A 1 101 ? -19.049 -2.443  -16.838 1.00 0.00 ? 124 ASP A CG   2  
ATOM 2640  O OD1  . ASP A 1 101 ? -19.073 -1.688  -15.847 1.00 0.00 ? 124 ASP A OD1  2  
ATOM 2641  O OD2  . ASP A 1 101 ? -20.027 -2.571  -17.617 1.00 0.00 ? 124 ASP A OD2  2  
ATOM 2642  H H    . ASP A 1 101 ? -14.945 -3.467  -17.106 1.00 0.00 ? 124 ASP A H    2  
ATOM 2643  H HA   . ASP A 1 101 ? -17.058 -2.163  -18.764 1.00 0.00 ? 124 ASP A HA   2  
ATOM 2644  H HB2  . ASP A 1 101 ? -18.057 -4.140  -17.722 1.00 0.00 ? 124 ASP A HB2  2  
ATOM 2645  H HB3  . ASP A 1 101 ? -17.424 -3.670  -16.142 1.00 0.00 ? 124 ASP A HB3  2  
ATOM 2646  N N    . ASN A 1 102 ? -15.799 -1.406  -15.791 1.00 0.00 ? 125 ASN A N    2  
ATOM 2647  C CA   . ASN A 1 102 ? -15.040 -0.470  -14.967 1.00 0.00 ? 125 ASN A CA   2  
ATOM 2648  C C    . ASN A 1 102 ? -15.517 0.984   -15.020 1.00 0.00 ? 125 ASN A C    2  
ATOM 2649  O O    . ASN A 1 102 ? -15.032 1.761   -15.844 1.00 0.00 ? 125 ASN A O    2  
ATOM 2650  C CB   . ASN A 1 102 ? -13.522 -0.660  -15.200 1.00 0.00 ? 125 ASN A CB   2  
ATOM 2651  C CG   . ASN A 1 102 ? -12.921 -0.226  -16.533 1.00 0.00 ? 125 ASN A CG   2  
ATOM 2652  O OD1  . ASN A 1 102 ? -13.123 -0.858  -17.564 1.00 0.00 ? 125 ASN A OD1  2  
ATOM 2653  N ND2  . ASN A 1 102 ? -12.087 0.802   -16.551 1.00 0.00 ? 125 ASN A ND2  2  
ATOM 2654  H H    . ASN A 1 102 ? -15.864 -2.341  -15.410 1.00 0.00 ? 125 ASN A H    2  
ATOM 2655  H HA   . ASN A 1 102 ? -15.200 -0.789  -13.941 1.00 0.00 ? 125 ASN A HA   2  
ATOM 2656  H HB2  . ASN A 1 102 ? -12.972 -0.174  -14.402 1.00 0.00 ? 125 ASN A HB2  2  
ATOM 2657  H HB3  . ASN A 1 102 ? -13.308 -1.713  -15.096 1.00 0.00 ? 125 ASN A HB3  2  
ATOM 2658  H HD21 . ASN A 1 102 ? -11.992 1.388   -15.732 1.00 0.00 ? 125 ASN A HD21 2  
ATOM 2659  H HD22 . ASN A 1 102 ? -11.414 0.965   -17.301 1.00 0.00 ? 125 ASN A HD22 2  
ATOM 2660  N N    . LYS A 1 103 ? -16.402 1.393   -14.090 1.00 0.00 ? 126 LYS A N    2  
ATOM 2661  C CA   . LYS A 1 103 ? -16.701 2.807   -13.842 1.00 0.00 ? 126 LYS A CA   2  
ATOM 2662  C C    . LYS A 1 103 ? -16.044 3.334   -12.570 1.00 0.00 ? 126 LYS A C    2  
ATOM 2663  O O    . LYS A 1 103 ? -14.970 3.931   -12.658 1.00 0.00 ? 126 LYS A O    2  
ATOM 2664  C CB   . LYS A 1 103 ? -18.205 3.102   -13.863 1.00 0.00 ? 126 LYS A CB   2  
ATOM 2665  C CG   . LYS A 1 103 ? -18.555 4.559   -13.481 1.00 0.00 ? 126 LYS A CG   2  
ATOM 2666  C CD   . LYS A 1 103 ? -17.622 5.690   -13.973 1.00 0.00 ? 126 LYS A CD   2  
ATOM 2667  C CE   . LYS A 1 103 ? -18.226 6.449   -15.160 1.00 0.00 ? 126 LYS A CE   2  
ATOM 2668  N NZ   . LYS A 1 103 ? -17.198 7.072   -16.019 1.00 0.00 ? 126 LYS A NZ   2  
ATOM 2669  H H    . LYS A 1 103 ? -16.842 0.695   -13.498 1.00 0.00 ? 126 LYS A H    2  
ATOM 2670  H HA   . LYS A 1 103 ? -16.273 3.360   -14.677 1.00 0.00 ? 126 LYS A HA   2  
ATOM 2671  H HB2  . LYS A 1 103 ? -18.590 2.895   -14.861 1.00 0.00 ? 126 LYS A HB2  2  
ATOM 2672  H HB3  . LYS A 1 103 ? -18.685 2.434   -13.139 1.00 0.00 ? 126 LYS A HB3  2  
ATOM 2673  H HG2  . LYS A 1 103 ? -19.569 4.757   -13.806 1.00 0.00 ? 126 LYS A HG2  2  
ATOM 2674  H HG3  . LYS A 1 103 ? -18.585 4.615   -12.398 1.00 0.00 ? 126 LYS A HG3  2  
ATOM 2675  H HD2  . LYS A 1 103 ? -17.455 6.380   -13.144 1.00 0.00 ? 126 LYS A HD2  2  
ATOM 2676  H HD3  . LYS A 1 103 ? -16.625 5.330   -14.214 1.00 0.00 ? 126 LYS A HD3  2  
ATOM 2677  H HE2  . LYS A 1 103 ? -18.816 5.762   -15.772 1.00 0.00 ? 126 LYS A HE2  2  
ATOM 2678  H HE3  . LYS A 1 103 ? -18.891 7.225   -14.773 1.00 0.00 ? 126 LYS A HE3  2  
ATOM 2679  H HZ1  . LYS A 1 103 ? -16.861 6.395   -16.702 1.00 0.00 ? 126 LYS A HZ1  2  
ATOM 2680  H HZ2  . LYS A 1 103 ? -17.607 7.832   -16.555 1.00 0.00 ? 126 LYS A HZ2  2  
ATOM 2681  H HZ3  . LYS A 1 103 ? -16.420 7.445   -15.490 1.00 0.00 ? 126 LYS A HZ3  2  
ATOM 2682  N N    . LEU A 1 104 ? -16.667 3.216   -11.394 1.00 0.00 ? 127 LEU A N    2  
ATOM 2683  C CA   . LEU A 1 104 ? -16.136 3.904   -10.211 1.00 0.00 ? 127 LEU A CA   2  
ATOM 2684  C C    . LEU A 1 104 ? -14.963 3.127   -9.645  1.00 0.00 ? 127 LEU A C    2  
ATOM 2685  O O    . LEU A 1 104 ? -14.142 3.707   -8.943  1.00 0.00 ? 127 LEU A O    2  
ATOM 2686  C CB   . LEU A 1 104 ? -17.198 4.117   -9.113  1.00 0.00 ? 127 LEU A CB   2  
ATOM 2687  C CG   . LEU A 1 104 ? -17.639 5.569   -8.874  1.00 0.00 ? 127 LEU A CG   2  
ATOM 2688  C CD1  . LEU A 1 104 ? -16.522 6.536   -8.474  1.00 0.00 ? 127 LEU A CD1  2  
ATOM 2689  C CD2  . LEU A 1 104 ? -18.318 6.122   -10.114 1.00 0.00 ? 127 LEU A CD2  2  
ATOM 2690  H H    . LEU A 1 104 ? -17.545 2.716   -11.343 1.00 0.00 ? 127 LEU A H    2  
ATOM 2691  H HA   . LEU A 1 104 ? -15.745 4.875   -10.509 1.00 0.00 ? 127 LEU A HA   2  
ATOM 2692  H HB2  . LEU A 1 104 ? -18.081 3.518   -9.334  1.00 0.00 ? 127 LEU A HB2  2  
ATOM 2693  H HB3  . LEU A 1 104 ? -16.797 3.765   -8.163  1.00 0.00 ? 127 LEU A HB3  2  
ATOM 2694  H HG   . LEU A 1 104 ? -18.365 5.552   -8.065  1.00 0.00 ? 127 LEU A HG   2  
ATOM 2695  H HD11 . LEU A 1 104 ? -15.905 6.798   -9.332  1.00 0.00 ? 127 LEU A HD11 2  
ATOM 2696  H HD12 . LEU A 1 104 ? -16.974 7.443   -8.070  1.00 0.00 ? 127 LEU A HD12 2  
ATOM 2697  H HD13 . LEU A 1 104 ? -15.895 6.088   -7.712  1.00 0.00 ? 127 LEU A HD13 2  
ATOM 2698  H HD21 . LEU A 1 104 ? -18.635 7.142   -9.934  1.00 0.00 ? 127 LEU A HD21 2  
ATOM 2699  H HD22 . LEU A 1 104 ? -17.620 6.127   -10.948 1.00 0.00 ? 127 LEU A HD22 2  
ATOM 2700  H HD23 . LEU A 1 104 ? -19.193 5.518   -10.344 1.00 0.00 ? 127 LEU A HD23 2  
ATOM 2701  N N    . HIS A 1 105 ? -14.885 1.826   -9.933  1.00 0.00 ? 128 HIS A N    2  
ATOM 2702  C CA   . HIS A 1 105 ? -13.938 0.958   -9.268  1.00 0.00 ? 128 HIS A CA   2  
ATOM 2703  C C    . HIS A 1 105 ? -12.495 1.405   -9.517  1.00 0.00 ? 128 HIS A C    2  
ATOM 2704  O O    . HIS A 1 105 ? -11.727 1.412   -8.569  1.00 0.00 ? 128 HIS A O    2  
ATOM 2705  C CB   . HIS A 1 105 ? -14.247 -0.524  -9.559  1.00 0.00 ? 128 HIS A CB   2  
ATOM 2706  C CG   . HIS A 1 105 ? -13.180 -1.287  -10.288 1.00 0.00 ? 128 HIS A CG   2  
ATOM 2707  N ND1  . HIS A 1 105 ? -12.375 -2.270  -9.760  1.00 0.00 ? 128 HIS A ND1  2  
ATOM 2708  C CD2  . HIS A 1 105 ? -12.845 -1.126  -11.600 1.00 0.00 ? 128 HIS A CD2  2  
ATOM 2709  C CE1  . HIS A 1 105 ? -11.565 -2.695  -10.740 1.00 0.00 ? 128 HIS A CE1  2  
ATOM 2710  N NE2  . HIS A 1 105 ? -11.801 -2.012  -11.876 1.00 0.00 ? 128 HIS A NE2  2  
ATOM 2711  H H    . HIS A 1 105 ? -15.592 1.411   -10.520 1.00 0.00 ? 128 HIS A H    2  
ATOM 2712  H HA   . HIS A 1 105 ? -14.110 1.112   -8.208  1.00 0.00 ? 128 HIS A HA   2  
ATOM 2713  H HB2  . HIS A 1 105 ? -14.433 -1.034  -8.614  1.00 0.00 ? 128 HIS A HB2  2  
ATOM 2714  H HB3  . HIS A 1 105 ? -15.163 -0.599  -10.142 1.00 0.00 ? 128 HIS A HB3  2  
ATOM 2715  H HD1  . HIS A 1 105 ? -12.382 -2.621  -8.798  1.00 0.00 ? 128 HIS A HD1  2  
ATOM 2716  H HD2  . HIS A 1 105 ? -13.298 -0.408  -12.266 1.00 0.00 ? 128 HIS A HD2  2  
ATOM 2717  H HE1  . HIS A 1 105 ? -10.812 -3.462  -10.617 1.00 0.00 ? 128 HIS A HE1  2  
ATOM 2718  N N    . GLN A 1 106 ? -12.129 1.874   -10.714 1.00 0.00 ? 129 GLN A N    2  
ATOM 2719  C CA   . GLN A 1 106 ? -10.822 2.473   -10.977 1.00 0.00 ? 129 GLN A CA   2  
ATOM 2720  C C    . GLN A 1 106 ? -10.641 3.708   -10.112 1.00 0.00 ? 129 GLN A C    2  
ATOM 2721  O O    . GLN A 1 106 ? -9.702  3.770   -9.327  1.00 0.00 ? 129 GLN A O    2  
ATOM 2722  C CB   . GLN A 1 106 ? -10.715 2.828   -12.461 1.00 0.00 ? 129 GLN A CB   2  
ATOM 2723  C CG   . GLN A 1 106 ? -9.432  3.521   -12.875 1.00 0.00 ? 129 GLN A CG   2  
ATOM 2724  C CD   . GLN A 1 106 ? -9.487  3.807   -14.370 1.00 0.00 ? 129 GLN A CD   2  
ATOM 2725  O OE1  . GLN A 1 106 ? -9.766  4.933   -14.774 1.00 0.00 ? 129 GLN A OE1  2  
ATOM 2726  N NE2  . GLN A 1 106 ? -9.332  2.797   -15.201 1.00 0.00 ? 129 GLN A NE2  2  
ATOM 2727  H H    . GLN A 1 106 ? -12.793 1.854   -11.481 1.00 0.00 ? 129 GLN A H    2  
ATOM 2728  H HA   . GLN A 1 106 ? -10.040 1.761   -10.717 1.00 0.00 ? 129 GLN A HA   2  
ATOM 2729  H HB2  . GLN A 1 106 ? -10.792 1.916   -13.043 1.00 0.00 ? 129 GLN A HB2  2  
ATOM 2730  H HB3  . GLN A 1 106 ? -11.523 3.507   -12.723 1.00 0.00 ? 129 GLN A HB3  2  
ATOM 2731  H HG2  . GLN A 1 106 ? -9.343  4.456   -12.337 1.00 0.00 ? 129 GLN A HG2  2  
ATOM 2732  H HG3  . GLN A 1 106 ? -8.599  2.888   -12.617 1.00 0.00 ? 129 GLN A HG3  2  
ATOM 2733  H HE21 . GLN A 1 106 ? -9.102  1.876   -14.829 1.00 0.00 ? 129 GLN A HE21 2  
ATOM 2734  H HE22 . GLN A 1 106 ? -9.428  2.900   -16.208 1.00 0.00 ? 129 GLN A HE22 2  
ATOM 2735  N N    . GLN A 1 107 ? -11.525 4.692   -10.282 1.00 0.00 ? 130 GLN A N    2  
ATOM 2736  C CA   . GLN A 1 107 ? -11.500 5.951   -9.568  1.00 0.00 ? 130 GLN A CA   2  
ATOM 2737  C C    . GLN A 1 107 ? -11.294 5.770   -8.056  1.00 0.00 ? 130 GLN A C    2  
ATOM 2738  O O    . GLN A 1 107 ? -10.419 6.427   -7.485  1.00 0.00 ? 130 GLN A O    2  
ATOM 2739  C CB   . GLN A 1 107 ? -12.775 6.763   -9.912  1.00 0.00 ? 130 GLN A CB   2  
ATOM 2740  C CG   . GLN A 1 107 ? -12.457 7.884   -10.911 1.00 0.00 ? 130 GLN A CG   2  
ATOM 2741  C CD   . GLN A 1 107 ? -13.279 9.134   -10.609 1.00 0.00 ? 130 GLN A CD   2  
ATOM 2742  O OE1  . GLN A 1 107 ? -12.787 10.074  -9.986  1.00 0.00 ? 130 GLN A OE1  2  
ATOM 2743  N NE2  . GLN A 1 107 ? -14.542 9.158   -10.999 1.00 0.00 ? 130 GLN A NE2  2  
ATOM 2744  H H    . GLN A 1 107 ? -12.155 4.626   -11.063 1.00 0.00 ? 130 GLN A H    2  
ATOM 2745  H HA   . GLN A 1 107 ? -10.605 6.465   -9.924  1.00 0.00 ? 130 GLN A HA   2  
ATOM 2746  H HB2  . GLN A 1 107 ? -13.584 6.144   -10.347 1.00 0.00 ? 130 GLN A HB2  2  
ATOM 2747  H HB3  . GLN A 1 107 ? -13.151 7.214   -8.991  1.00 0.00 ? 130 GLN A HB3  2  
ATOM 2748  H HG2  . GLN A 1 107 ? -11.402 8.138   -10.863 1.00 0.00 ? 130 GLN A HG2  2  
ATOM 2749  H HG3  . GLN A 1 107 ? -12.643 7.545   -11.929 1.00 0.00 ? 130 GLN A HG3  2  
ATOM 2750  H HE21 . GLN A 1 107 ? -14.938 8.341   -11.463 1.00 0.00 ? 130 GLN A HE21 2  
ATOM 2751  H HE22 . GLN A 1 107 ? -15.097 9.994   -10.846 1.00 0.00 ? 130 GLN A HE22 2  
ATOM 2752  N N    . VAL A 1 108 ? -12.057 4.872   -7.424  1.00 0.00 ? 131 VAL A N    2  
ATOM 2753  C CA   . VAL A 1 108 ? -11.880 4.486   -6.029  1.00 0.00 ? 131 VAL A CA   2  
ATOM 2754  C C    . VAL A 1 108 ? -10.516 3.806   -5.871  1.00 0.00 ? 131 VAL A C    2  
ATOM 2755  O O    . VAL A 1 108 ? -9.700  4.287   -5.094  1.00 0.00 ? 131 VAL A O    2  
ATOM 2756  C CB   . VAL A 1 108 ? -13.062 3.607   -5.553  1.00 0.00 ? 131 VAL A CB   2  
ATOM 2757  C CG1  . VAL A 1 108 ? -12.888 3.097   -4.114  1.00 0.00 ? 131 VAL A CG1  2  
ATOM 2758  C CG2  . VAL A 1 108 ? -14.382 4.387   -5.594  1.00 0.00 ? 131 VAL A CG2  2  
ATOM 2759  H H    . VAL A 1 108 ? -12.758 4.373   -7.961  1.00 0.00 ? 131 VAL A H    2  
ATOM 2760  H HA   . VAL A 1 108 ? -11.865 5.394   -5.425  1.00 0.00 ? 131 VAL A HA   2  
ATOM 2761  H HB   . VAL A 1 108 ? -13.157 2.749   -6.219  1.00 0.00 ? 131 VAL A HB   2  
ATOM 2762  H HG11 . VAL A 1 108 ? -13.757 2.506   -3.816  1.00 0.00 ? 131 VAL A HG11 2  
ATOM 2763  H HG12 . VAL A 1 108 ? -12.005 2.463   -4.043  1.00 0.00 ? 131 VAL A HG12 2  
ATOM 2764  H HG13 . VAL A 1 108 ? -12.787 3.937   -3.427  1.00 0.00 ? 131 VAL A HG13 2  
ATOM 2765  H HG21 . VAL A 1 108 ? -14.586 4.720   -6.606  1.00 0.00 ? 131 VAL A HG21 2  
ATOM 2766  H HG22 . VAL A 1 108 ? -15.205 3.745   -5.272  1.00 0.00 ? 131 VAL A HG22 2  
ATOM 2767  H HG23 . VAL A 1 108 ? -14.322 5.253   -4.935  1.00 0.00 ? 131 VAL A HG23 2  
ATOM 2768  N N    . LEU A 1 109 ? -10.252 2.705   -6.585  1.00 0.00 ? 132 LEU A N    2  
ATOM 2769  C CA   . LEU A 1 109 ? -9.091  1.835   -6.383  1.00 0.00 ? 132 LEU A CA   2  
ATOM 2770  C C    . LEU A 1 109 ? -7.785  2.611   -6.498  1.00 0.00 ? 132 LEU A C    2  
ATOM 2771  O O    . LEU A 1 109 ? -6.819  2.255   -5.831  1.00 0.00 ? 132 LEU A O    2  
ATOM 2772  C CB   . LEU A 1 109 ? -9.122  0.639   -7.369  1.00 0.00 ? 132 LEU A CB   2  
ATOM 2773  C CG   . LEU A 1 109 ? -8.060  -0.454  -7.204  1.00 0.00 ? 132 LEU A CG   2  
ATOM 2774  C CD1  . LEU A 1 109 ? -8.157  -1.111  -5.824  1.00 0.00 ? 132 LEU A CD1  2  
ATOM 2775  C CD2  . LEU A 1 109 ? -8.291  -1.492  -8.324  1.00 0.00 ? 132 LEU A CD2  2  
ATOM 2776  H H    . LEU A 1 109 ? -10.920 2.418   -7.292  1.00 0.00 ? 132 LEU A H    2  
ATOM 2777  H HA   . LEU A 1 109 ? -9.167  1.459   -5.365  1.00 0.00 ? 132 LEU A HA   2  
ATOM 2778  H HB2  . LEU A 1 109 ? -10.087 0.147   -7.283  1.00 0.00 ? 132 LEU A HB2  2  
ATOM 2779  H HB3  . LEU A 1 109 ? -9.013  1.010   -8.386  1.00 0.00 ? 132 LEU A HB3  2  
ATOM 2780  H HG   . LEU A 1 109 ? -7.069  -0.018  -7.326  1.00 0.00 ? 132 LEU A HG   2  
ATOM 2781  H HD11 . LEU A 1 109 ? -8.174  -0.361  -5.036  1.00 0.00 ? 132 LEU A HD11 2  
ATOM 2782  H HD12 . LEU A 1 109 ? -9.047  -1.738  -5.761  1.00 0.00 ? 132 LEU A HD12 2  
ATOM 2783  H HD13 . LEU A 1 109 ? -7.284  -1.721  -5.638  1.00 0.00 ? 132 LEU A HD13 2  
ATOM 2784  H HD21 . LEU A 1 109 ? -8.242  -0.999  -9.294  1.00 0.00 ? 132 LEU A HD21 2  
ATOM 2785  H HD22 . LEU A 1 109 ? -7.534  -2.275  -8.312  1.00 0.00 ? 132 LEU A HD22 2  
ATOM 2786  H HD23 . LEU A 1 109 ? -9.273  -1.959  -8.221  1.00 0.00 ? 132 LEU A HD23 2  
ATOM 2787  N N    . TRP A 1 110 ? -7.738  3.659   -7.317  1.00 0.00 ? 133 TRP A N    2  
ATOM 2788  C CA   . TRP A 1 110 ? -6.596  4.547   -7.423  1.00 0.00 ? 133 TRP A CA   2  
ATOM 2789  C C    . TRP A 1 110 ? -6.373  5.253   -6.085  1.00 0.00 ? 133 TRP A C    2  
ATOM 2790  O O    . TRP A 1 110 ? -5.421  4.931   -5.380  1.00 0.00 ? 133 TRP A O    2  
ATOM 2791  C CB   . TRP A 1 110 ? -6.780  5.490   -8.619  1.00 0.00 ? 133 TRP A CB   2  
ATOM 2792  C CG   . TRP A 1 110 ? -5.503  5.849   -9.303  1.00 0.00 ? 133 TRP A CG   2  
ATOM 2793  C CD1  . TRP A 1 110 ? -5.012  7.097   -9.449  1.00 0.00 ? 133 TRP A CD1  2  
ATOM 2794  C CD2  . TRP A 1 110 ? -4.566  4.963   -9.986  1.00 0.00 ? 133 TRP A CD2  2  
ATOM 2795  N NE1  . TRP A 1 110 ? -3.829  7.047   -10.159 1.00 0.00 ? 133 TRP A NE1  2  
ATOM 2796  C CE2  . TRP A 1 110 ? -3.538  5.760   -10.566 1.00 0.00 ? 133 TRP A CE2  2  
ATOM 2797  C CE3  . TRP A 1 110 ? -4.481  3.568   -10.180 1.00 0.00 ? 133 TRP A CE3  2  
ATOM 2798  C CZ2  . TRP A 1 110 ? -2.525  5.200   -11.358 1.00 0.00 ? 133 TRP A CZ2  2  
ATOM 2799  C CZ3  . TRP A 1 110 ? -3.493  2.997   -11.003 1.00 0.00 ? 133 TRP A CZ3  2  
ATOM 2800  C CH2  . TRP A 1 110 ? -2.531  3.815   -11.618 1.00 0.00 ? 133 TRP A CH2  2  
ATOM 2801  H H    . TRP A 1 110 ? -8.564  3.865   -7.869  1.00 0.00 ? 133 TRP A H    2  
ATOM 2802  H HA   . TRP A 1 110 ? -5.713  3.939   -7.613  1.00 0.00 ? 133 TRP A HA   2  
ATOM 2803  H HB2  . TRP A 1 110 ? -7.393  4.994   -9.372  1.00 0.00 ? 133 TRP A HB2  2  
ATOM 2804  H HB3  . TRP A 1 110 ? -7.309  6.395   -8.318  1.00 0.00 ? 133 TRP A HB3  2  
ATOM 2805  H HD1  . TRP A 1 110 ? -5.481  7.989   -9.053  1.00 0.00 ? 133 TRP A HD1  2  
ATOM 2806  H HE1  . TRP A 1 110 ? -3.253  7.877   -10.308 1.00 0.00 ? 133 TRP A HE1  2  
ATOM 2807  H HE3  . TRP A 1 110 ? -5.173  2.925   -9.654  1.00 0.00 ? 133 TRP A HE3  2  
ATOM 2808  H HZ2  . TRP A 1 110 ? -1.761  5.841   -11.766 1.00 0.00 ? 133 TRP A HZ2  2  
ATOM 2809  H HZ3  . TRP A 1 110 ? -3.452  1.921   -11.125 1.00 0.00 ? 133 TRP A HZ3  2  
ATOM 2810  H HH2  . TRP A 1 110 ? -1.755  3.358   -12.222 1.00 0.00 ? 133 TRP A HH2  2  
ATOM 2811  N N    . ARG A 1 111 ? -7.279  6.151   -5.681  1.00 0.00 ? 134 ARG A N    2  
ATOM 2812  C CA   . ARG A 1 111 ? -7.169  6.907   -4.429  1.00 0.00 ? 134 ARG A CA   2  
ATOM 2813  C C    . ARG A 1 111 ? -6.985  5.981   -3.222  1.00 0.00 ? 134 ARG A C    2  
ATOM 2814  O O    . ARG A 1 111 ? -6.229  6.311   -2.312  1.00 0.00 ? 134 ARG A O    2  
ATOM 2815  C CB   . ARG A 1 111 ? -8.415  7.805   -4.293  1.00 0.00 ? 134 ARG A CB   2  
ATOM 2816  C CG   . ARG A 1 111 ? -8.624  8.453   -2.913  1.00 0.00 ? 134 ARG A CG   2  
ATOM 2817  C CD   . ARG A 1 111 ? -7.496  9.412   -2.507  1.00 0.00 ? 134 ARG A CD   2  
ATOM 2818  N NE   . ARG A 1 111 ? -7.599  9.753   -1.075  1.00 0.00 ? 134 ARG A NE   2  
ATOM 2819  C CZ   . ARG A 1 111 ? -6.605  9.685   -0.177  1.00 0.00 ? 134 ARG A CZ   2  
ATOM 2820  N NH1  . ARG A 1 111 ? -5.345  9.588   -0.575  1.00 0.00 ? 134 ARG A NH1  2  
ATOM 2821  N NH2  . ARG A 1 111 ? -6.846  9.723   1.126   1.00 0.00 ? 134 ARG A NH2  2  
ATOM 2822  H H    . ARG A 1 111 ? -8.102  6.288   -6.255  1.00 0.00 ? 134 ARG A H    2  
ATOM 2823  H HA   . ARG A 1 111 ? -6.279  7.536   -4.498  1.00 0.00 ? 134 ARG A HA   2  
ATOM 2824  H HB2  . ARG A 1 111 ? -8.358  8.590   -5.047  1.00 0.00 ? 134 ARG A HB2  2  
ATOM 2825  H HB3  . ARG A 1 111 ? -9.301  7.206   -4.511  1.00 0.00 ? 134 ARG A HB3  2  
ATOM 2826  H HG2  . ARG A 1 111 ? -9.565  9.003   -2.932  1.00 0.00 ? 134 ARG A HG2  2  
ATOM 2827  H HG3  . ARG A 1 111 ? -8.721  7.670   -2.160  1.00 0.00 ? 134 ARG A HG3  2  
ATOM 2828  H HD2  . ARG A 1 111 ? -6.541  8.926   -2.703  1.00 0.00 ? 134 ARG A HD2  2  
ATOM 2829  H HD3  . ARG A 1 111 ? -7.556  10.318  -3.111  1.00 0.00 ? 134 ARG A HD3  2  
ATOM 2830  H HE   . ARG A 1 111 ? -8.546  9.949   -0.759  1.00 0.00 ? 134 ARG A HE   2  
ATOM 2831  H HH11 . ARG A 1 111 ? -5.097  9.765   -1.539  1.00 0.00 ? 134 ARG A HH11 2  
ATOM 2832  H HH12 . ARG A 1 111 ? -4.607  9.485   0.121   1.00 0.00 ? 134 ARG A HH12 2  
ATOM 2833  H HH21 . ARG A 1 111 ? -7.760  9.767   1.559   1.00 0.00 ? 134 ARG A HH21 2  
ATOM 2834  H HH22 . ARG A 1 111 ? -6.053  9.619   1.769   1.00 0.00 ? 134 ARG A HH22 2  
ATOM 2835  N N    . LEU A 1 112 ? -7.678  4.844   -3.220  1.00 0.00 ? 135 LEU A N    2  
ATOM 2836  C CA   . LEU A 1 112 ? -7.653  3.836   -2.173  1.00 0.00 ? 135 LEU A CA   2  
ATOM 2837  C C    . LEU A 1 112 ? -6.230  3.323   -2.045  1.00 0.00 ? 135 LEU A C    2  
ATOM 2838  O O    . LEU A 1 112 ? -5.598  3.562   -1.022  1.00 0.00 ? 135 LEU A O    2  
ATOM 2839  C CB   . LEU A 1 112 ? -8.689  2.748   -2.510  1.00 0.00 ? 135 LEU A CB   2  
ATOM 2840  C CG   . LEU A 1 112 ? -9.109  1.842   -1.355  1.00 0.00 ? 135 LEU A CG   2  
ATOM 2841  C CD1  . LEU A 1 112 ? -10.450 1.198   -1.695  1.00 0.00 ? 135 LEU A CD1  2  
ATOM 2842  C CD2  . LEU A 1 112 ? -8.116  0.736   -1.079  1.00 0.00 ? 135 LEU A CD2  2  
ATOM 2843  H H    . LEU A 1 112 ? -8.279  4.670   -4.018  1.00 0.00 ? 135 LEU A H    2  
ATOM 2844  H HA   . LEU A 1 112 ? -7.928  4.298   -1.223  1.00 0.00 ? 135 LEU A HA   2  
ATOM 2845  H HB2  . LEU A 1 112 ? -9.589  3.250   -2.846  1.00 0.00 ? 135 LEU A HB2  2  
ATOM 2846  H HB3  . LEU A 1 112 ? -8.336  2.128   -3.321  1.00 0.00 ? 135 LEU A HB3  2  
ATOM 2847  H HG   . LEU A 1 112 ? -9.197  2.438   -0.461  1.00 0.00 ? 135 LEU A HG   2  
ATOM 2848  H HD11 . LEU A 1 112 ? -10.362 0.600   -2.596  1.00 0.00 ? 135 LEU A HD11 2  
ATOM 2849  H HD12 . LEU A 1 112 ? -10.775 0.562   -0.873  1.00 0.00 ? 135 LEU A HD12 2  
ATOM 2850  H HD13 . LEU A 1 112 ? -11.201 1.967   -1.862  1.00 0.00 ? 135 LEU A HD13 2  
ATOM 2851  H HD21 . LEU A 1 112 ? -7.179  1.192   -0.800  1.00 0.00 ? 135 LEU A HD21 2  
ATOM 2852  H HD22 . LEU A 1 112 ? -8.468  0.145   -0.232  1.00 0.00 ? 135 LEU A HD22 2  
ATOM 2853  H HD23 . LEU A 1 112 ? -7.989  0.106   -1.957  1.00 0.00 ? 135 LEU A HD23 2  
ATOM 2854  N N    . VAL A 1 113 ? -5.698  2.664   -3.078  1.00 0.00 ? 136 VAL A N    2  
ATOM 2855  C CA   . VAL A 1 113 ? -4.362  2.082   -3.042  1.00 0.00 ? 136 VAL A CA   2  
ATOM 2856  C C    . VAL A 1 113 ? -3.303  3.158   -2.801  1.00 0.00 ? 136 VAL A C    2  
ATOM 2857  O O    . VAL A 1 113 ? -2.317  2.876   -2.118  1.00 0.00 ? 136 VAL A O    2  
ATOM 2858  C CB   . VAL A 1 113 ? -4.096  1.284   -4.329  1.00 0.00 ? 136 VAL A CB   2  
ATOM 2859  C CG1  . VAL A 1 113 ? -2.702  0.653   -4.334  1.00 0.00 ? 136 VAL A CG1  2  
ATOM 2860  C CG2  . VAL A 1 113 ? -5.088  0.126   -4.534  1.00 0.00 ? 136 VAL A CG2  2  
ATOM 2861  H H    . VAL A 1 113 ? -6.217  2.588   -3.946  1.00 0.00 ? 136 VAL A H    2  
ATOM 2862  H HA   . VAL A 1 113 ? -4.313  1.401   -2.200  1.00 0.00 ? 136 VAL A HA   2  
ATOM 2863  H HB   . VAL A 1 113 ? -4.171  1.978   -5.161  1.00 0.00 ? 136 VAL A HB   2  
ATOM 2864  H HG11 . VAL A 1 113 ? -2.489  0.261   -3.335  1.00 0.00 ? 136 VAL A HG11 2  
ATOM 2865  H HG12 . VAL A 1 113 ? -2.661  -0.149  -5.070  1.00 0.00 ? 136 VAL A HG12 2  
ATOM 2866  H HG13 . VAL A 1 113 ? -1.965  1.413   -4.604  1.00 0.00 ? 136 VAL A HG13 2  
ATOM 2867  H HG21 . VAL A 1 113 ? -5.031  -0.218  -5.571  1.00 0.00 ? 136 VAL A HG21 2  
ATOM 2868  H HG22 . VAL A 1 113 ? -4.846  -0.688  -3.856  1.00 0.00 ? 136 VAL A HG22 2  
ATOM 2869  H HG23 . VAL A 1 113 ? -6.109  0.436   -4.340  1.00 0.00 ? 136 VAL A HG23 2  
ATOM 2870  N N    . GLN A 1 114 ? -3.512  4.385   -3.291  1.00 0.00 ? 137 GLN A N    2  
ATOM 2871  C CA   . GLN A 1 114 ? -2.617  5.483   -2.979  1.00 0.00 ? 137 GLN A CA   2  
ATOM 2872  C C    . GLN A 1 114 ? -2.509  5.656   -1.466  1.00 0.00 ? 137 GLN A C    2  
ATOM 2873  O O    . GLN A 1 114 ? -1.394  5.718   -0.943  1.00 0.00 ? 137 GLN A O    2  
ATOM 2874  C CB   . GLN A 1 114 ? -3.041  6.786   -3.679  1.00 0.00 ? 137 GLN A CB   2  
ATOM 2875  C CG   . GLN A 1 114 ? -2.712  6.740   -5.176  1.00 0.00 ? 137 GLN A CG   2  
ATOM 2876  C CD   . GLN A 1 114 ? -3.064  8.021   -5.912  1.00 0.00 ? 137 GLN A CD   2  
ATOM 2877  O OE1  . GLN A 1 114 ? -4.125  8.606   -5.714  1.00 0.00 ? 137 GLN A OE1  2  
ATOM 2878  N NE2  . GLN A 1 114 ? -2.168  8.502   -6.757  1.00 0.00 ? 137 GLN A NE2  2  
ATOM 2879  H H    . GLN A 1 114 ? -4.326  4.560   -3.872  1.00 0.00 ? 137 GLN A H    2  
ATOM 2880  H HA   . GLN A 1 114 ? -1.639  5.190   -3.343  1.00 0.00 ? 137 GLN A HA   2  
ATOM 2881  H HB2  . GLN A 1 114 ? -4.104  6.964   -3.538  1.00 0.00 ? 137 GLN A HB2  2  
ATOM 2882  H HB3  . GLN A 1 114 ? -2.496  7.616   -3.230  1.00 0.00 ? 137 GLN A HB3  2  
ATOM 2883  H HG2  . GLN A 1 114 ? -1.646  6.564   -5.283  1.00 0.00 ? 137 GLN A HG2  2  
ATOM 2884  H HG3  . GLN A 1 114 ? -3.242  5.921   -5.651  1.00 0.00 ? 137 GLN A HG3  2  
ATOM 2885  H HE21 . GLN A 1 114 ? -1.283  8.034   -6.891  1.00 0.00 ? 137 GLN A HE21 2  
ATOM 2886  H HE22 . GLN A 1 114 ? -2.309  9.379   -7.242  1.00 0.00 ? 137 GLN A HE22 2  
ATOM 2887  N N    . GLU A 1 115 ? -3.641  5.688   -0.756  1.00 0.00 ? 138 GLU A N    2  
ATOM 2888  C CA   . GLU A 1 115 ? -3.634  5.812   0.692   1.00 0.00 ? 138 GLU A CA   2  
ATOM 2889  C C    . GLU A 1 115 ? -3.106  4.557   1.389   1.00 0.00 ? 138 GLU A C    2  
ATOM 2890  O O    . GLU A 1 115 ? -2.439  4.668   2.410   1.00 0.00 ? 138 GLU A O    2  
ATOM 2891  C CB   . GLU A 1 115 ? -5.017  6.228   1.225   1.00 0.00 ? 138 GLU A CB   2  
ATOM 2892  C CG   . GLU A 1 115 ? -4.904  6.870   2.618   1.00 0.00 ? 138 GLU A CG   2  
ATOM 2893  C CD   . GLU A 1 115 ? -3.938  8.064   2.624   1.00 0.00 ? 138 GLU A CD   2  
ATOM 2894  O OE1  . GLU A 1 115 ? -4.305  9.127   2.076   1.00 0.00 ? 138 GLU A OE1  2  
ATOM 2895  O OE2  . GLU A 1 115 ? -2.768  7.924   3.061   1.00 0.00 ? 138 GLU A OE2  2  
ATOM 2896  H H    . GLU A 1 115 ? -4.539  5.580   -1.219  1.00 0.00 ? 138 GLU A H    2  
ATOM 2897  H HA   . GLU A 1 115 ? -2.927  6.604   0.903   1.00 0.00 ? 138 GLU A HA   2  
ATOM 2898  H HB2  . GLU A 1 115 ? -5.459  6.954   0.544   1.00 0.00 ? 138 GLU A HB2  2  
ATOM 2899  H HB3  . GLU A 1 115 ? -5.685  5.364   1.280   1.00 0.00 ? 138 GLU A HB3  2  
ATOM 2900  H HG2  . GLU A 1 115 ? -5.891  7.209   2.930   1.00 0.00 ? 138 GLU A HG2  2  
ATOM 2901  H HG3  . GLU A 1 115 ? -4.586  6.113   3.333   1.00 0.00 ? 138 GLU A HG3  2  
ATOM 2902  N N    . LEU A 1 116 ? -3.332  3.362   0.840   1.00 0.00 ? 139 LEU A N    2  
ATOM 2903  C CA   . LEU A 1 116 ? -2.804  2.117   1.409   1.00 0.00 ? 139 LEU A CA   2  
ATOM 2904  C C    . LEU A 1 116 ? -1.280  2.123   1.440   1.00 0.00 ? 139 LEU A C    2  
ATOM 2905  O O    . LEU A 1 116 ? -0.673  1.575   2.368   1.00 0.00 ? 139 LEU A O    2  
ATOM 2906  C CB   . LEU A 1 116 ? -3.283  0.908   0.597   1.00 0.00 ? 139 LEU A CB   2  
ATOM 2907  C CG   . LEU A 1 116 ? -4.805  0.719   0.633   1.00 0.00 ? 139 LEU A CG   2  
ATOM 2908  C CD1  . LEU A 1 116 ? -5.169  -0.584  -0.065  1.00 0.00 ? 139 LEU A CD1  2  
ATOM 2909  C CD2  . LEU A 1 116 ? -5.433  0.790   2.023   1.00 0.00 ? 139 LEU A CD2  2  
ATOM 2910  H H    . LEU A 1 116 ? -3.919  3.333   0.012   1.00 0.00 ? 139 LEU A H    2  
ATOM 2911  H HA   . LEU A 1 116 ? -3.144  2.021   2.441   1.00 0.00 ? 139 LEU A HA   2  
ATOM 2912  H HB2  . LEU A 1 116 ? -2.967  1.026   -0.439  1.00 0.00 ? 139 LEU A HB2  2  
ATOM 2913  H HB3  . LEU A 1 116 ? -2.793  0.010   0.965   1.00 0.00 ? 139 LEU A HB3  2  
ATOM 2914  H HG   . LEU A 1 116 ? -5.244  1.515   0.059   1.00 0.00 ? 139 LEU A HG   2  
ATOM 2915  H HD11 . LEU A 1 116 ? -4.916  -0.504  -1.121  1.00 0.00 ? 139 LEU A HD11 2  
ATOM 2916  H HD12 . LEU A 1 116 ? -4.625  -1.407  0.381   1.00 0.00 ? 139 LEU A HD12 2  
ATOM 2917  H HD13 . LEU A 1 116 ? -6.243  -0.758  0.029   1.00 0.00 ? 139 LEU A HD13 2  
ATOM 2918  H HD21 . LEU A 1 116 ? -5.399  1.814   2.395   1.00 0.00 ? 139 LEU A HD21 2  
ATOM 2919  H HD22 . LEU A 1 116 ? -6.488  0.524   1.961   1.00 0.00 ? 139 LEU A HD22 2  
ATOM 2920  H HD23 . LEU A 1 116 ? -4.923  0.126   2.720   1.00 0.00 ? 139 LEU A HD23 2  
ATOM 2921  N N    . CYS A 1 117 ? -0.668  2.723   0.422   1.00 0.00 ? 140 CYS A N    2  
ATOM 2922  C CA   . CYS A 1 117 ? 0.765   2.922   0.360   1.00 0.00 ? 140 CYS A CA   2  
ATOM 2923  C C    . CYS A 1 117 ? 1.170   4.072   1.285   1.00 0.00 ? 140 CYS A C    2  
ATOM 2924  O O    . CYS A 1 117 ? 2.072   3.888   2.102   1.00 0.00 ? 140 CYS A O    2  
ATOM 2925  C CB   . CYS A 1 117 ? 1.185   3.085   -1.102  1.00 0.00 ? 140 CYS A CB   2  
ATOM 2926  S SG   . CYS A 1 117 ? 0.834   1.583   -2.061  1.00 0.00 ? 140 CYS A SG   2  
ATOM 2927  H H    . CYS A 1 117 ? -1.241  3.074   -0.340  1.00 0.00 ? 140 CYS A H    2  
ATOM 2928  H HA   . CYS A 1 117 ? 1.257   2.021   0.722   1.00 0.00 ? 140 CYS A HA   2  
ATOM 2929  H HB2  . CYS A 1 117 ? 0.637   3.918   -1.536  1.00 0.00 ? 140 CYS A HB2  2  
ATOM 2930  H HB3  . CYS A 1 117 ? 2.253   3.292   -1.153  1.00 0.00 ? 140 CYS A HB3  2  
ATOM 2931  N N    . SER A 1 118 ? 0.533   5.252   1.215   1.00 0.00 ? 141 SER A N    2  
ATOM 2932  C CA   . SER A 1 118 ? 0.936   6.384   2.054   1.00 0.00 ? 141 SER A CA   2  
ATOM 2933  C C    . SER A 1 118 ? 0.517   6.290   3.527   1.00 0.00 ? 141 SER A C    2  
ATOM 2934  O O    . SER A 1 118 ? 0.816   7.219   4.277   1.00 0.00 ? 141 SER A O    2  
ATOM 2935  C CB   . SER A 1 118 ? 0.506   7.721   1.436   1.00 0.00 ? 141 SER A CB   2  
ATOM 2936  O OG   . SER A 1 118 ? -0.880  7.836   1.194   1.00 0.00 ? 141 SER A OG   2  
ATOM 2937  H H    . SER A 1 118 ? -0.213  5.404   0.540   1.00 0.00 ? 141 SER A H    2  
ATOM 2938  H HA   . SER A 1 118 ? 2.021   6.382   2.075   1.00 0.00 ? 141 SER A HA   2  
ATOM 2939  H HB2  . SER A 1 118 ? 0.818   8.531   2.097   1.00 0.00 ? 141 SER A HB2  2  
ATOM 2940  H HB3  . SER A 1 118 ? 1.020   7.836   0.484   1.00 0.00 ? 141 SER A HB3  2  
ATOM 2941  H HG   . SER A 1 118 ? -1.388  7.758   2.038   1.00 0.00 ? 141 SER A HG   2  
ATOM 2942  N N    . LEU A 1 119 ? -0.164  5.215   3.938   1.00 0.00 ? 142 LEU A N    2  
ATOM 2943  C CA   . LEU A 1 119 ? -0.849  5.038   5.215   1.00 0.00 ? 142 LEU A CA   2  
ATOM 2944  C C    . LEU A 1 119 ? -0.022  5.591   6.371   1.00 0.00 ? 142 LEU A C    2  
ATOM 2945  O O    . LEU A 1 119 ? -0.459  6.498   7.083   1.00 0.00 ? 142 LEU A O    2  
ATOM 2946  C CB   . LEU A 1 119 ? -1.164  3.540   5.381   1.00 0.00 ? 142 LEU A CB   2  
ATOM 2947  C CG   . LEU A 1 119 ? -2.409  3.218   6.225   1.00 0.00 ? 142 LEU A CG   2  
ATOM 2948  C CD1  . LEU A 1 119 ? -2.413  3.878   7.608   1.00 0.00 ? 142 LEU A CD1  2  
ATOM 2949  C CD2  . LEU A 1 119 ? -3.699  3.595   5.495   1.00 0.00 ? 142 LEU A CD2  2  
ATOM 2950  H H    . LEU A 1 119 ? -0.477  4.567   3.226   1.00 0.00 ? 142 LEU A H    2  
ATOM 2951  H HA   . LEU A 1 119 ? -1.784  5.595   5.155   1.00 0.00 ? 142 LEU A HA   2  
ATOM 2952  H HB2  . LEU A 1 119 ? -1.313  3.110   4.389   1.00 0.00 ? 142 LEU A HB2  2  
ATOM 2953  H HB3  . LEU A 1 119 ? -0.304  3.028   5.820   1.00 0.00 ? 142 LEU A HB3  2  
ATOM 2954  H HG   . LEU A 1 119 ? -2.412  2.139   6.362   1.00 0.00 ? 142 LEU A HG   2  
ATOM 2955  H HD11 . LEU A 1 119 ? -1.476  3.675   8.127   1.00 0.00 ? 142 LEU A HD11 2  
ATOM 2956  H HD12 . LEU A 1 119 ? -2.579  4.952   7.515   1.00 0.00 ? 142 LEU A HD12 2  
ATOM 2957  H HD13 . LEU A 1 119 ? -3.229  3.469   8.200   1.00 0.00 ? 142 LEU A HD13 2  
ATOM 2958  H HD21 . LEU A 1 119 ? -4.554  3.282   6.095   1.00 0.00 ? 142 LEU A HD21 2  
ATOM 2959  H HD22 . LEU A 1 119 ? -3.753  4.670   5.334   1.00 0.00 ? 142 LEU A HD22 2  
ATOM 2960  H HD23 . LEU A 1 119 ? -3.739  3.080   4.535   1.00 0.00 ? 142 LEU A HD23 2  
ATOM 2961  N N    . LYS A 1 120 ? 1.222   5.128   6.484   1.00 0.00 ? 143 LYS A N    2  
ATOM 2962  C CA   . LYS A 1 120 ? 2.267   5.793   7.239   1.00 0.00 ? 143 LYS A CA   2  
ATOM 2963  C C    . LYS A 1 120 ? 3.449   5.913   6.291   1.00 0.00 ? 143 LYS A C    2  
ATOM 2964  O O    . LYS A 1 120 ? 3.819   4.924   5.656   1.00 0.00 ? 143 LYS A O    2  
ATOM 2965  C CB   . LYS A 1 120 ? 2.613   4.985   8.500   1.00 0.00 ? 143 LYS A CB   2  
ATOM 2966  C CG   . LYS A 1 120 ? 3.433   5.826   9.487   1.00 0.00 ? 143 LYS A CG   2  
ATOM 2967  C CD   . LYS A 1 120 ? 3.959   4.960   10.637  1.00 0.00 ? 143 LYS A CD   2  
ATOM 2968  C CE   . LYS A 1 120 ? 4.623   5.826   11.710  1.00 0.00 ? 143 LYS A CE   2  
ATOM 2969  N NZ   . LYS A 1 120 ? 3.642   6.486   12.600  1.00 0.00 ? 143 LYS A NZ   2  
ATOM 2970  H H    . LYS A 1 120 ? 1.539   4.436   5.815   1.00 0.00 ? 143 LYS A H    2  
ATOM 2971  H HA   . LYS A 1 120 ? 1.928   6.790   7.529   1.00 0.00 ? 143 LYS A HA   2  
ATOM 2972  H HB2  . LYS A 1 120 ? 1.694   4.671   8.999   1.00 0.00 ? 143 LYS A HB2  2  
ATOM 2973  H HB3  . LYS A 1 120 ? 3.173   4.091   8.220   1.00 0.00 ? 143 LYS A HB3  2  
ATOM 2974  H HG2  . LYS A 1 120 ? 4.283   6.279   8.977   1.00 0.00 ? 143 LYS A HG2  2  
ATOM 2975  H HG3  . LYS A 1 120 ? 2.799   6.620   9.885   1.00 0.00 ? 143 LYS A HG3  2  
ATOM 2976  H HD2  . LYS A 1 120 ? 3.153   4.370   11.076  1.00 0.00 ? 143 LYS A HD2  2  
ATOM 2977  H HD3  . LYS A 1 120 ? 4.708   4.275   10.240  1.00 0.00 ? 143 LYS A HD3  2  
ATOM 2978  H HE2  . LYS A 1 120 ? 5.280   5.198   12.314  1.00 0.00 ? 143 LYS A HE2  2  
ATOM 2979  H HE3  . LYS A 1 120 ? 5.251   6.580   11.229  1.00 0.00 ? 143 LYS A HE3  2  
ATOM 2980  H HZ1  . LYS A 1 120 ? 4.140   7.106   13.233  1.00 0.00 ? 143 LYS A HZ1  2  
ATOM 2981  H HZ2  . LYS A 1 120 ? 2.948   7.019   12.087  1.00 0.00 ? 143 LYS A HZ2  2  
ATOM 2982  H HZ3  . LYS A 1 120 ? 3.120   5.801   13.141  1.00 0.00 ? 143 LYS A HZ3  2  
ATOM 2983  N N    . HIS A 1 121 ? 4.018   7.107   6.185   1.00 0.00 ? 144 HIS A N    2  
ATOM 2984  C CA   . HIS A 1 121 ? 5.266   7.387   5.491   1.00 0.00 ? 144 HIS A CA   2  
ATOM 2985  C C    . HIS A 1 121 ? 6.412   6.531   6.050   1.00 0.00 ? 144 HIS A C    2  
ATOM 2986  O O    . HIS A 1 121 ? 6.255   5.931   7.116   1.00 0.00 ? 144 HIS A O    2  
ATOM 2987  C CB   . HIS A 1 121 ? 5.574   8.884   5.652   1.00 0.00 ? 144 HIS A CB   2  
ATOM 2988  C CG   . HIS A 1 121 ? 5.832   9.287   7.089   1.00 0.00 ? 144 HIS A CG   2  
ATOM 2989  N ND1  . HIS A 1 121 ? 4.904   9.427   8.105   1.00 0.00 ? 144 HIS A ND1  2  
ATOM 2990  C CD2  . HIS A 1 121 ? 7.064   9.545   7.621   1.00 0.00 ? 144 HIS A CD2  2  
ATOM 2991  C CE1  . HIS A 1 121 ? 5.585   9.731   9.225   1.00 0.00 ? 144 HIS A CE1  2  
ATOM 2992  N NE2  . HIS A 1 121 ? 6.900   9.810   8.981   1.00 0.00 ? 144 HIS A NE2  2  
ATOM 2993  H H    . HIS A 1 121 ? 3.559   7.894   6.619   1.00 0.00 ? 144 HIS A H    2  
ATOM 2994  H HA   . HIS A 1 121 ? 5.125   7.146   4.444   1.00 0.00 ? 144 HIS A HA   2  
ATOM 2995  H HB2  . HIS A 1 121 ? 6.456   9.119   5.057   1.00 0.00 ? 144 HIS A HB2  2  
ATOM 2996  H HB3  . HIS A 1 121 ? 4.748   9.475   5.256   1.00 0.00 ? 144 HIS A HB3  2  
ATOM 2997  H HD1  . HIS A 1 121 ? 3.891   9.328   8.055   1.00 0.00 ? 144 HIS A HD1  2  
ATOM 2998  H HD2  . HIS A 1 121 ? 7.991   9.549   7.072   1.00 0.00 ? 144 HIS A HD2  2  
ATOM 2999  H HE1  . HIS A 1 121 ? 5.156   9.891   10.200  1.00 0.00 ? 144 HIS A HE1  2  
ATOM 3000  N N    . CYS A 1 122 ? 7.575   6.498   5.384   1.00 0.00 ? 145 CYS A N    2  
ATOM 3001  C CA   . CYS A 1 122 ? 8.793   6.001   6.024   1.00 0.00 ? 145 CYS A CA   2  
ATOM 3002  C C    . CYS A 1 122 ? 9.270   7.047   7.029   1.00 0.00 ? 145 CYS A C    2  
ATOM 3003  O O    . CYS A 1 122 ? 8.868   6.955   8.186   1.00 0.00 ? 145 CYS A O    2  
ATOM 3004  C CB   . CYS A 1 122 ? 9.883   5.595   5.031   1.00 0.00 ? 145 CYS A CB   2  
ATOM 3005  S SG   . CYS A 1 122 ? 9.513   4.125   4.042   1.00 0.00 ? 145 CYS A SG   2  
ATOM 3006  H H    . CYS A 1 122 ? 7.660   6.989   4.505   1.00 0.00 ? 145 CYS A H    2  
ATOM 3007  H HA   . CYS A 1 122 ? 8.542   5.105   6.589   1.00 0.00 ? 145 CYS A HA   2  
ATOM 3008  H HB2  . CYS A 1 122 ? 10.098  6.424   4.363   1.00 0.00 ? 145 CYS A HB2  2  
ATOM 3009  H HB3  . CYS A 1 122 ? 10.789  5.391   5.604   1.00 0.00 ? 145 CYS A HB3  2  
ATOM 3010  N N    . GLU A 1 123 ? 10.059  8.049   6.619   1.00 0.00 ? 146 GLU A N    2  
ATOM 3011  C CA   . GLU A 1 123 ? 10.662  8.990   7.560   1.00 0.00 ? 146 GLU A CA   2  
ATOM 3012  C C    . GLU A 1 123 ? 10.713  10.417  7.015   1.00 0.00 ? 146 GLU A C    2  
ATOM 3013  O O    . GLU A 1 123 ? 9.994   11.275  7.516   1.00 0.00 ? 146 GLU A O    2  
ATOM 3014  C CB   . GLU A 1 123 ? 12.064  8.488   7.958   1.00 0.00 ? 146 GLU A CB   2  
ATOM 3015  C CG   . GLU A 1 123 ? 12.103  7.728   9.292   1.00 0.00 ? 146 GLU A CG   2  
ATOM 3016  C CD   . GLU A 1 123 ? 12.112  8.657   10.502  1.00 0.00 ? 146 GLU A CD   2  
ATOM 3017  O OE1  . GLU A 1 123 ? 11.037  9.188   10.875  1.00 0.00 ? 146 GLU A OE1  2  
ATOM 3018  O OE2  . GLU A 1 123 ? 13.199  8.826   11.114  1.00 0.00 ? 146 GLU A OE2  2  
ATOM 3019  H H    . GLU A 1 123 ? 10.441  8.049   5.677   1.00 0.00 ? 146 GLU A H    2  
ATOM 3020  H HA   . GLU A 1 123 ? 10.019  9.043   8.435   1.00 0.00 ? 146 GLU A HA   2  
ATOM 3021  H HB2  . GLU A 1 123 ? 12.438  7.821   7.180   1.00 0.00 ? 146 GLU A HB2  2  
ATOM 3022  H HB3  . GLU A 1 123 ? 12.750  9.333   8.004   1.00 0.00 ? 146 GLU A HB3  2  
ATOM 3023  H HG2  . GLU A 1 123 ? 11.255  7.047   9.363   1.00 0.00 ? 146 GLU A HG2  2  
ATOM 3024  H HG3  . GLU A 1 123 ? 13.016  7.132   9.321   1.00 0.00 ? 146 GLU A HG3  2  
ATOM 3025  N N    . PHE A 1 124 ? 11.561  10.684  6.025   1.00 0.00 ? 147 PHE A N    2  
ATOM 3026  C CA   . PHE A 1 124 ? 11.885  12.019  5.505   1.00 0.00 ? 147 PHE A CA   2  
ATOM 3027  C C    . PHE A 1 124 ? 10.656  12.740  4.957   1.00 0.00 ? 147 PHE A C    2  
ATOM 3028  O O    . PHE A 1 124 ? 10.507  13.952  5.108   1.00 0.00 ? 147 PHE A O    2  
ATOM 3029  C CB   . PHE A 1 124 ? 12.958  11.826  4.426   1.00 0.00 ? 147 PHE A CB   2  
ATOM 3030  C CG   . PHE A 1 124 ? 12.890  12.671  3.169   1.00 0.00 ? 147 PHE A CG   2  
ATOM 3031  C CD1  . PHE A 1 124 ? 13.309  14.013  3.180   1.00 0.00 ? 147 PHE A CD1  2  
ATOM 3032  C CD2  . PHE A 1 124 ? 12.494  12.074  1.957   1.00 0.00 ? 147 PHE A CD2  2  
ATOM 3033  C CE1  . PHE A 1 124 ? 13.361  14.738  1.976   1.00 0.00 ? 147 PHE A CE1  2  
ATOM 3034  C CE2  . PHE A 1 124 ? 12.548  12.798  0.758   1.00 0.00 ? 147 PHE A CE2  2  
ATOM 3035  C CZ   . PHE A 1 124 ? 12.995  14.128  0.761   1.00 0.00 ? 147 PHE A CZ   2  
ATOM 3036  H H    . PHE A 1 124 ? 12.118  9.916   5.670   1.00 0.00 ? 147 PHE A H    2  
ATOM 3037  H HA   . PHE A 1 124 ? 12.299  12.626  6.309   1.00 0.00 ? 147 PHE A HA   2  
ATOM 3038  H HB2  . PHE A 1 124 ? 13.936  11.957  4.883   1.00 0.00 ? 147 PHE A HB2  2  
ATOM 3039  H HB3  . PHE A 1 124 ? 12.896  10.795  4.101   1.00 0.00 ? 147 PHE A HB3  2  
ATOM 3040  H HD1  . PHE A 1 124 ? 13.623  14.476  4.106   1.00 0.00 ? 147 PHE A HD1  2  
ATOM 3041  H HD2  . PHE A 1 124 ? 12.184  11.040  1.929   1.00 0.00 ? 147 PHE A HD2  2  
ATOM 3042  H HE1  . PHE A 1 124 ? 13.715  15.758  1.993   1.00 0.00 ? 147 PHE A HE1  2  
ATOM 3043  H HE2  . PHE A 1 124 ? 12.263  12.314  -0.166  1.00 0.00 ? 147 PHE A HE2  2  
ATOM 3044  H HZ   . PHE A 1 124 ? 13.066  14.667  -0.173  1.00 0.00 ? 147 PHE A HZ   2  
ATOM 3045  N N    . TRP A 1 125 ? 9.758   11.995  4.329   1.00 0.00 ? 148 TRP A N    2  
ATOM 3046  C CA   . TRP A 1 125 ? 8.562   12.502  3.683   1.00 0.00 ? 148 TRP A CA   2  
ATOM 3047  C C    . TRP A 1 125 ? 7.354   12.413  4.617   1.00 0.00 ? 148 TRP A C    2  
ATOM 3048  O O    . TRP A 1 125 ? 6.239   12.105  4.185   1.00 0.00 ? 148 TRP A O    2  
ATOM 3049  C CB   . TRP A 1 125 ? 8.389   11.746  2.368   1.00 0.00 ? 148 TRP A CB   2  
ATOM 3050  C CG   . TRP A 1 125 ? 8.414   10.246  2.433   1.00 0.00 ? 148 TRP A CG   2  
ATOM 3051  C CD1  . TRP A 1 125 ? 9.500   9.471   2.666   1.00 0.00 ? 148 TRP A CD1  2  
ATOM 3052  C CD2  . TRP A 1 125 ? 7.301   9.317   2.276   1.00 0.00 ? 148 TRP A CD2  2  
ATOM 3053  N NE1  . TRP A 1 125 ? 9.172   8.157   2.435   1.00 0.00 ? 148 TRP A NE1  2  
ATOM 3054  C CE2  . TRP A 1 125 ? 7.827   7.997   2.223   1.00 0.00 ? 148 TRP A CE2  2  
ATOM 3055  C CE3  . TRP A 1 125 ? 5.899   9.447   2.215   1.00 0.00 ? 148 TRP A CE3  2  
ATOM 3056  C CZ2  . TRP A 1 125 ? 7.013   6.877   2.038   1.00 0.00 ? 148 TRP A CZ2  2  
ATOM 3057  C CZ3  . TRP A 1 125 ? 5.065   8.315   2.115   1.00 0.00 ? 148 TRP A CZ3  2  
ATOM 3058  C CH2  . TRP A 1 125 ? 5.623   7.033   2.016   1.00 0.00 ? 148 TRP A CH2  2  
ATOM 3059  H H    . TRP A 1 125 ? 9.961   11.012  4.215   1.00 0.00 ? 148 TRP A H    2  
ATOM 3060  H HA   . TRP A 1 125 ? 8.706   13.558  3.446   1.00 0.00 ? 148 TRP A HA   2  
ATOM 3061  H HB2  . TRP A 1 125 ? 7.458   12.063  1.899   1.00 0.00 ? 148 TRP A HB2  2  
ATOM 3062  H HB3  . TRP A 1 125 ? 9.194   12.064  1.706   1.00 0.00 ? 148 TRP A HB3  2  
ATOM 3063  H HD1  . TRP A 1 125 ? 10.504  9.791   2.924   1.00 0.00 ? 148 TRP A HD1  2  
ATOM 3064  H HE1  . TRP A 1 125 ? 9.881   7.428   2.348   1.00 0.00 ? 148 TRP A HE1  2  
ATOM 3065  H HE3  . TRP A 1 125 ? 5.479   10.437  2.305   1.00 0.00 ? 148 TRP A HE3  2  
ATOM 3066  H HZ2  . TRP A 1 125 ? 7.441   5.897   1.941   1.00 0.00 ? 148 TRP A HZ2  2  
ATOM 3067  H HZ3  . TRP A 1 125 ? 3.992   8.406   2.145   1.00 0.00 ? 148 TRP A HZ3  2  
ATOM 3068  H HH2  . TRP A 1 125 ? 4.994   6.155   1.976   1.00 0.00 ? 148 TRP A HH2  2  
ATOM 3069  N N    . LEU A 1 126 ? 7.563   12.705  5.897   1.00 0.00 ? 149 LEU A N    2  
ATOM 3070  C CA   . LEU A 1 126 ? 6.522   12.806  6.910   1.00 0.00 ? 149 LEU A CA   2  
ATOM 3071  C C    . LEU A 1 126 ? 5.476   13.867  6.586   1.00 0.00 ? 149 LEU A C    2  
ATOM 3072  O O    . LEU A 1 126 ? 5.716   14.808  5.825   1.00 0.00 ? 149 LEU A O    2  
ATOM 3073  C CB   . LEU A 1 126 ? 7.103   13.037  8.314   1.00 0.00 ? 149 LEU A CB   2  
ATOM 3074  C CG   . LEU A 1 126 ? 7.701   14.423  8.578   1.00 0.00 ? 149 LEU A CG   2  
ATOM 3075  C CD1  . LEU A 1 126 ? 8.050   14.515  10.058  1.00 0.00 ? 149 LEU A CD1  2  
ATOM 3076  C CD2  . LEU A 1 126 ? 8.939   14.688  7.715   1.00 0.00 ? 149 LEU A CD2  2  
ATOM 3077  H H    . LEU A 1 126 ? 8.511   12.945  6.162   1.00 0.00 ? 149 LEU A H    2  
ATOM 3078  H HA   . LEU A 1 126 ? 6.031   11.850  6.925   1.00 0.00 ? 149 LEU A HA   2  
ATOM 3079  H HB2  . LEU A 1 126 ? 6.300   12.865  9.034   1.00 0.00 ? 149 LEU A HB2  2  
ATOM 3080  H HB3  . LEU A 1 126 ? 7.873   12.306  8.513   1.00 0.00 ? 149 LEU A HB3  2  
ATOM 3081  H HG   . LEU A 1 126 ? 6.953   15.171  8.365   1.00 0.00 ? 149 LEU A HG   2  
ATOM 3082  H HD11 . LEU A 1 126 ? 7.185   14.272  10.677  1.00 0.00 ? 149 LEU A HD11 2  
ATOM 3083  H HD12 . LEU A 1 126 ? 8.856   13.818  10.263  1.00 0.00 ? 149 LEU A HD12 2  
ATOM 3084  H HD13 . LEU A 1 126 ? 8.392   15.514  10.304  1.00 0.00 ? 149 LEU A HD13 2  
ATOM 3085  H HD21 . LEU A 1 126 ? 9.607   13.822  7.727   1.00 0.00 ? 149 LEU A HD21 2  
ATOM 3086  H HD22 . LEU A 1 126 ? 8.634   14.865  6.684   1.00 0.00 ? 149 LEU A HD22 2  
ATOM 3087  H HD23 . LEU A 1 126 ? 9.481   15.563  8.069   1.00 0.00 ? 149 LEU A HD23 2  
ATOM 3088  N N    . GLU A 1 127 ? 4.319   13.763  7.230   1.00 0.00 ? 150 GLU A N    2  
ATOM 3089  C CA   . GLU A 1 127 ? 3.480   14.905  7.504   1.00 0.00 ? 150 GLU A CA   2  
ATOM 3090  C C    . GLU A 1 127 ? 4.112   15.622  8.694   1.00 0.00 ? 150 GLU A C    2  
ATOM 3091  O O    . GLU A 1 127 ? 4.355   15.000  9.728   1.00 0.00 ? 150 GLU A O    2  
ATOM 3092  C CB   . GLU A 1 127 ? 2.061   14.432  7.830   1.00 0.00 ? 150 GLU A CB   2  
ATOM 3093  C CG   . GLU A 1 127 ? 1.181   14.508  6.577   1.00 0.00 ? 150 GLU A CG   2  
ATOM 3094  C CD   . GLU A 1 127 ? -0.309  14.354  6.861   1.00 0.00 ? 150 GLU A CD   2  
ATOM 3095  O OE1  . GLU A 1 127 ? -0.846  15.137  7.681   1.00 0.00 ? 150 GLU A OE1  2  
ATOM 3096  O OE2  . GLU A 1 127 ? -0.945  13.495  6.201   1.00 0.00 ? 150 GLU A OE2  2  
ATOM 3097  H H    . GLU A 1 127 ? 4.192   13.019  7.898   1.00 0.00 ? 150 GLU A H    2  
ATOM 3098  H HA   . GLU A 1 127 ? 3.460   15.569  6.637   1.00 0.00 ? 150 GLU A HA   2  
ATOM 3099  H HB2  . GLU A 1 127 ? 2.061   13.414  8.230   1.00 0.00 ? 150 GLU A HB2  2  
ATOM 3100  H HB3  . GLU A 1 127 ? 1.671   15.093  8.587   1.00 0.00 ? 150 GLU A HB3  2  
ATOM 3101  H HG2  . GLU A 1 127 ? 1.329   15.468  6.082   1.00 0.00 ? 150 GLU A HG2  2  
ATOM 3102  H HG3  . GLU A 1 127 ? 1.493   13.724  5.896   1.00 0.00 ? 150 GLU A HG3  2  
ATOM 3103  N N    . ALA A 1 29  ? 0.615   -16.154 -5.104  1.00 0.00 ? 52  ALA A N    3  
ATOM 3104  C CA   . ALA A 1 29  ? 0.771   -14.938 -5.871  1.00 0.00 ? 52  ALA A CA   3  
ATOM 3105  C C    . ALA A 1 29  ? 0.450   -13.736 -4.995  1.00 0.00 ? 52  ALA A C    3  
ATOM 3106  O O    . ALA A 1 29  ? 0.818   -12.615 -5.326  1.00 0.00 ? 52  ALA A O    3  
ATOM 3107  C CB   . ALA A 1 29  ? -0.169  -14.979 -7.078  1.00 0.00 ? 52  ALA A CB   3  
ATOM 3108  H H    . ALA A 1 29  ? -0.245  -16.671 -5.230  1.00 0.00 ? 52  ALA A H    3  
ATOM 3109  H HA   . ALA A 1 29  ? 1.804   -14.874 -6.204  1.00 0.00 ? 52  ALA A HA   3  
ATOM 3110  H HB1  . ALA A 1 29  ? -0.101  -14.038 -7.624  1.00 0.00 ? 52  ALA A HB1  3  
ATOM 3111  H HB2  . ALA A 1 29  ? 0.106   -15.808 -7.732  1.00 0.00 ? 52  ALA A HB2  3  
ATOM 3112  H HB3  . ALA A 1 29  ? -1.201  -15.104 -6.743  1.00 0.00 ? 52  ALA A HB3  3  
ATOM 3113  N N    . GLU A 1 30  ? -0.221  -13.958 -3.867  1.00 0.00 ? 53  GLU A N    3  
ATOM 3114  C CA   . GLU A 1 30  ? -0.564  -12.913 -2.921  1.00 0.00 ? 53  GLU A CA   3  
ATOM 3115  C C    . GLU A 1 30  ? 0.700   -12.443 -2.191  1.00 0.00 ? 53  GLU A C    3  
ATOM 3116  O O    . GLU A 1 30  ? 0.767   -11.325 -1.712  1.00 0.00 ? 53  GLU A O    3  
ATOM 3117  C CB   . GLU A 1 30  ? -1.696  -13.362 -1.984  1.00 0.00 ? 53  GLU A CB   3  
ATOM 3118  C CG   . GLU A 1 30  ? -2.783  -14.117 -2.778  1.00 0.00 ? 53  GLU A CG   3  
ATOM 3119  C CD   . GLU A 1 30  ? -4.193  -13.979 -2.201  1.00 0.00 ? 53  GLU A CD   3  
ATOM 3120  O OE1  . GLU A 1 30  ? -4.372  -14.077 -0.967  1.00 0.00 ? 53  GLU A OE1  3  
ATOM 3121  O OE2  . GLU A 1 30  ? -5.122  -13.774 -3.023  1.00 0.00 ? 53  GLU A OE2  3  
ATOM 3122  H H    . GLU A 1 30  ? -0.511  -14.895 -3.643  1.00 0.00 ? 53  GLU A H    3  
ATOM 3123  H HA   . GLU A 1 30  ? -0.953  -12.081 -3.501  1.00 0.00 ? 53  GLU A HA   3  
ATOM 3124  H HB2  . GLU A 1 30  ? -1.302  -14.004 -1.198  1.00 0.00 ? 53  GLU A HB2  3  
ATOM 3125  H HB3  . GLU A 1 30  ? -2.120  -12.463 -1.532  1.00 0.00 ? 53  GLU A HB3  3  
ATOM 3126  H HG2  . GLU A 1 30  ? -2.819  -13.702 -3.788  1.00 0.00 ? 53  GLU A HG2  3  
ATOM 3127  H HG3  . GLU A 1 30  ? -2.505  -15.176 -2.876  1.00 0.00 ? 53  GLU A HG3  3  
ATOM 3128  N N    . ASN A 1 31  ? 1.780   -13.225 -2.223  1.00 0.00 ? 54  ASN A N    3  
ATOM 3129  C CA   . ASN A 1 31  ? 3.111   -12.794 -1.814  1.00 0.00 ? 54  ASN A CA   3  
ATOM 3130  C C    . ASN A 1 31  ? 3.834   -12.043 -2.946  1.00 0.00 ? 54  ASN A C    3  
ATOM 3131  O O    . ASN A 1 31  ? 5.069   -12.004 -2.963  1.00 0.00 ? 54  ASN A O    3  
ATOM 3132  C CB   . ASN A 1 31  ? 3.912   -14.001 -1.292  1.00 0.00 ? 54  ASN A CB   3  
ATOM 3133  C CG   . ASN A 1 31  ? 3.608   -14.298 0.162   1.00 0.00 ? 54  ASN A CG   3  
ATOM 3134  O OD1  . ASN A 1 31  ? 4.312   -13.851 1.069   1.00 0.00 ? 54  ASN A OD1  3  
ATOM 3135  N ND2  . ASN A 1 31  ? 2.550   -15.044 0.400   1.00 0.00 ? 54  ASN A ND2  3  
ATOM 3136  H H    . ASN A 1 31  ? 1.668   -14.148 -2.622  1.00 0.00 ? 54  ASN A H    3  
ATOM 3137  H HA   . ASN A 1 31  ? 3.013   -12.087 -0.988  1.00 0.00 ? 54  ASN A HA   3  
ATOM 3138  H HB2  . ASN A 1 31  ? 3.728   -14.884 -1.902  1.00 0.00 ? 54  ASN A HB2  3  
ATOM 3139  H HB3  . ASN A 1 31  ? 4.967   -13.786 -1.345  1.00 0.00 ? 54  ASN A HB3  3  
ATOM 3140  H HD21 . ASN A 1 31  ? 2.003   -15.354 -0.409  1.00 0.00 ? 54  ASN A HD21 3  
ATOM 3141  H HD22 . ASN A 1 31  ? 2.234   -15.202 1.343   1.00 0.00 ? 54  ASN A HD22 3  
ATOM 3142  N N    . ARG A 1 32  ? 3.149   -11.471 -3.942  1.00 0.00 ? 55  ARG A N    3  
ATOM 3143  C CA   . ARG A 1 32  ? 3.804   -10.579 -4.906  1.00 0.00 ? 55  ARG A CA   3  
ATOM 3144  C C    . ARG A 1 32  ? 4.039   -9.199  -4.301  1.00 0.00 ? 55  ARG A C    3  
ATOM 3145  O O    . ARG A 1 32  ? 3.179   -8.708  -3.572  1.00 0.00 ? 55  ARG A O    3  
ATOM 3146  C CB   . ARG A 1 32  ? 2.968   -10.413 -6.181  1.00 0.00 ? 55  ARG A CB   3  
ATOM 3147  C CG   . ARG A 1 32  ? 3.332   -11.450 -7.226  1.00 0.00 ? 55  ARG A CG   3  
ATOM 3148  C CD   . ARG A 1 32  ? 2.708   -11.114 -8.585  1.00 0.00 ? 55  ARG A CD   3  
ATOM 3149  N NE   . ARG A 1 32  ? 3.759   -10.878 -9.589  1.00 0.00 ? 55  ARG A NE   3  
ATOM 3150  C CZ   . ARG A 1 32  ? 4.514   -11.840 -10.138 1.00 0.00 ? 55  ARG A CZ   3  
ATOM 3151  N NH1  . ARG A 1 32  ? 4.141   -13.119 -10.076 1.00 0.00 ? 55  ARG A NH1  3  
ATOM 3152  N NH2  . ARG A 1 32  ? 5.662   -11.524 -10.724 1.00 0.00 ? 55  ARG A NH2  3  
ATOM 3153  H H    . ARG A 1 32  ? 2.137   -11.522 -3.932  1.00 0.00 ? 55  ARG A H    3  
ATOM 3154  H HA   . ARG A 1 32  ? 4.765   -11.010 -5.165  1.00 0.00 ? 55  ARG A HA   3  
ATOM 3155  H HB2  . ARG A 1 32  ? 1.922   -10.536 -5.990  1.00 0.00 ? 55  ARG A HB2  3  
ATOM 3156  H HB3  . ARG A 1 32  ? 3.066   -9.404  -6.564  1.00 0.00 ? 55  ARG A HB3  3  
ATOM 3157  H HG2  . ARG A 1 32  ? 4.417   -11.517 -7.310  1.00 0.00 ? 55  ARG A HG2  3  
ATOM 3158  H HG3  . ARG A 1 32  ? 2.939   -12.398 -6.874  1.00 0.00 ? 55  ARG A HG3  3  
ATOM 3159  H HD2  . ARG A 1 32  ? 2.076   -11.943 -8.889  1.00 0.00 ? 55  ARG A HD2  3  
ATOM 3160  H HD3  . ARG A 1 32  ? 2.067   -10.234 -8.499  1.00 0.00 ? 55  ARG A HD3  3  
ATOM 3161  H HE   . ARG A 1 32  ? 3.954   -9.900  -9.783  1.00 0.00 ? 55  ARG A HE   3  
ATOM 3162  H HH11 . ARG A 1 32  ? 3.202   -13.369 -9.752  1.00 0.00 ? 55  ARG A HH11 3  
ATOM 3163  H HH12 . ARG A 1 32  ? 4.711   -13.862 -10.448 1.00 0.00 ? 55  ARG A HH12 3  
ATOM 3164  H HH21 . ARG A 1 32  ? 6.009   -10.563 -10.737 1.00 0.00 ? 55  ARG A HH21 3  
ATOM 3165  H HH22 . ARG A 1 32  ? 6.251   -12.237 -11.154 1.00 0.00 ? 55  ARG A HH22 3  
ATOM 3166  N N    . PRO A 1 33  ? 5.092   -8.478  -4.723  1.00 0.00 ? 56  PRO A N    3  
ATOM 3167  C CA   . PRO A 1 33  ? 5.165   -7.051  -4.487  1.00 0.00 ? 56  PRO A CA   3  
ATOM 3168  C C    . PRO A 1 33  ? 3.977   -6.416  -5.207  1.00 0.00 ? 56  PRO A C    3  
ATOM 3169  O O    . PRO A 1 33  ? 3.847   -6.532  -6.432  1.00 0.00 ? 56  PRO A O    3  
ATOM 3170  C CB   . PRO A 1 33  ? 6.509   -6.565  -5.041  1.00 0.00 ? 56  PRO A CB   3  
ATOM 3171  C CG   . PRO A 1 33  ? 7.209   -7.815  -5.568  1.00 0.00 ? 56  PRO A CG   3  
ATOM 3172  C CD   . PRO A 1 33  ? 6.113   -8.878  -5.671  1.00 0.00 ? 56  PRO A CD   3  
ATOM 3173  H HA   . PRO A 1 33  ? 5.120   -6.859  -3.414  1.00 0.00 ? 56  PRO A HA   3  
ATOM 3174  H HB2  . PRO A 1 33  ? 6.359   -5.856  -5.856  1.00 0.00 ? 56  PRO A HB2  3  
ATOM 3175  H HB3  . PRO A 1 33  ? 7.104   -6.099  -4.254  1.00 0.00 ? 56  PRO A HB3  3  
ATOM 3176  H HG2  . PRO A 1 33  ? 7.651   -7.598  -6.537  1.00 0.00 ? 56  PRO A HG2  3  
ATOM 3177  H HG3  . PRO A 1 33  ? 7.970   -8.139  -4.857  1.00 0.00 ? 56  PRO A HG3  3  
ATOM 3178  H HD2  . PRO A 1 33  ? 5.690   -8.876  -6.676  1.00 0.00 ? 56  PRO A HD2  3  
ATOM 3179  H HD3  . PRO A 1 33  ? 6.495   -9.870  -5.437  1.00 0.00 ? 56  PRO A HD3  3  
ATOM 3180  N N    . GLY A 1 34  ? 3.098   -5.766  -4.450  1.00 0.00 ? 57  GLY A N    3  
ATOM 3181  C CA   . GLY A 1 34  ? 1.924   -5.105  -4.988  1.00 0.00 ? 57  GLY A CA   3  
ATOM 3182  C C    . GLY A 1 34  ? 0.690   -5.998  -5.032  1.00 0.00 ? 57  GLY A C    3  
ATOM 3183  O O    . GLY A 1 34  ? -0.354  -5.517  -5.459  1.00 0.00 ? 57  GLY A O    3  
ATOM 3184  H H    . GLY A 1 34  ? 3.209   -5.797  -3.445  1.00 0.00 ? 57  GLY A H    3  
ATOM 3185  H HA2  . GLY A 1 34  ? 1.689   -4.252  -4.361  1.00 0.00 ? 57  GLY A HA2  3  
ATOM 3186  H HA3  . GLY A 1 34  ? 2.133   -4.737  -5.992  1.00 0.00 ? 57  GLY A HA3  3  
ATOM 3187  N N    . ALA A 1 35  ? 0.767   -7.256  -4.599  1.00 0.00 ? 58  ALA A N    3  
ATOM 3188  C CA   . ALA A 1 35  ? -0.407  -8.092  -4.426  1.00 0.00 ? 58  ALA A CA   3  
ATOM 3189  C C    . ALA A 1 35  ? -1.447  -7.460  -3.488  1.00 0.00 ? 58  ALA A C    3  
ATOM 3190  O O    . ALA A 1 35  ? -1.081  -6.819  -2.493  1.00 0.00 ? 58  ALA A O    3  
ATOM 3191  C CB   . ALA A 1 35  ? 0.084   -9.402  -3.850  1.00 0.00 ? 58  ALA A CB   3  
ATOM 3192  H H    . ALA A 1 35  ? 1.644   -7.694  -4.329  1.00 0.00 ? 58  ALA A H    3  
ATOM 3193  H HA   . ALA A 1 35  ? -0.861  -8.272  -5.401  1.00 0.00 ? 58  ALA A HA   3  
ATOM 3194  H HB1  . ALA A 1 35  ? -0.771  -10.042 -3.662  1.00 0.00 ? 58  ALA A HB1  3  
ATOM 3195  H HB2  . ALA A 1 35  ? 0.768   -9.871  -4.546  1.00 0.00 ? 58  ALA A HB2  3  
ATOM 3196  H HB3  . ALA A 1 35  ? 0.619   -9.219  -2.918  1.00 0.00 ? 58  ALA A HB3  3  
ATOM 3197  N N    . PHE A 1 36  ? -2.728  -7.668  -3.793  1.00 0.00 ? 59  PHE A N    3  
ATOM 3198  C CA   . PHE A 1 36  ? -3.886  -7.168  -3.058  1.00 0.00 ? 59  PHE A CA   3  
ATOM 3199  C C    . PHE A 1 36  ? -4.250  -8.129  -1.914  1.00 0.00 ? 59  PHE A C    3  
ATOM 3200  O O    . PHE A 1 36  ? -4.542  -9.298  -2.174  1.00 0.00 ? 59  PHE A O    3  
ATOM 3201  C CB   . PHE A 1 36  ? -5.080  -7.054  -4.030  1.00 0.00 ? 59  PHE A CB   3  
ATOM 3202  C CG   . PHE A 1 36  ? -5.252  -5.765  -4.823  1.00 0.00 ? 59  PHE A CG   3  
ATOM 3203  C CD1  . PHE A 1 36  ? -4.255  -4.768  -4.883  1.00 0.00 ? 59  PHE A CD1  3  
ATOM 3204  C CD2  . PHE A 1 36  ? -6.489  -5.527  -5.457  1.00 0.00 ? 59  PHE A CD2  3  
ATOM 3205  C CE1  . PHE A 1 36  ? -4.512  -3.540  -5.512  1.00 0.00 ? 59  PHE A CE1  3  
ATOM 3206  C CE2  . PHE A 1 36  ? -6.719  -4.317  -6.136  1.00 0.00 ? 59  PHE A CE2  3  
ATOM 3207  C CZ   . PHE A 1 36  ? -5.743  -3.307  -6.138  1.00 0.00 ? 59  PHE A CZ   3  
ATOM 3208  H H    . PHE A 1 36  ? -2.916  -8.321  -4.553  1.00 0.00 ? 59  PHE A H    3  
ATOM 3209  H HA   . PHE A 1 36  ? -3.658  -6.185  -2.649  1.00 0.00 ? 59  PHE A HA   3  
ATOM 3210  H HB2  . PHE A 1 36  ? -5.059  -7.892  -4.727  1.00 0.00 ? 59  PHE A HB2  3  
ATOM 3211  H HB3  . PHE A 1 36  ? -5.990  -7.170  -3.442  1.00 0.00 ? 59  PHE A HB3  3  
ATOM 3212  H HD1  . PHE A 1 36  ? -3.278  -4.893  -4.449  1.00 0.00 ? 59  PHE A HD1  3  
ATOM 3213  H HD2  . PHE A 1 36  ? -7.282  -6.266  -5.409  1.00 0.00 ? 59  PHE A HD2  3  
ATOM 3214  H HE1  . PHE A 1 36  ? -3.753  -2.775  -5.523  1.00 0.00 ? 59  PHE A HE1  3  
ATOM 3215  H HE2  . PHE A 1 36  ? -7.669  -4.168  -6.629  1.00 0.00 ? 59  PHE A HE2  3  
ATOM 3216  H HZ   . PHE A 1 36  ? -5.930  -2.338  -6.584  1.00 0.00 ? 59  PHE A HZ   3  
ATOM 3217  N N    . ILE A 1 37  ? -4.299  -7.637  -0.666  1.00 0.00 ? 60  ILE A N    3  
ATOM 3218  C CA   . ILE A 1 37  ? -4.728  -8.435  0.495   1.00 0.00 ? 60  ILE A CA   3  
ATOM 3219  C C    . ILE A 1 37  ? -6.229  -8.761  0.421   1.00 0.00 ? 60  ILE A C    3  
ATOM 3220  O O    . ILE A 1 37  ? -6.631  -9.909  0.601   1.00 0.00 ? 60  ILE A O    3  
ATOM 3221  C CB   . ILE A 1 37  ? -4.358  -7.711  1.815   1.00 0.00 ? 60  ILE A CB   3  
ATOM 3222  C CG1  . ILE A 1 37  ? -2.822  -7.620  1.965   1.00 0.00 ? 60  ILE A CG1  3  
ATOM 3223  C CG2  . ILE A 1 37  ? -4.966  -8.437  3.028   1.00 0.00 ? 60  ILE A CG2  3  
ATOM 3224  C CD1  . ILE A 1 37  ? -2.353  -6.785  3.155   1.00 0.00 ? 60  ILE A CD1  3  
ATOM 3225  H H    . ILE A 1 37  ? -3.987  -6.685  -0.494  1.00 0.00 ? 60  ILE A H    3  
ATOM 3226  H HA   . ILE A 1 37  ? -4.201  -9.390  0.470   1.00 0.00 ? 60  ILE A HA   3  
ATOM 3227  H HB   . ILE A 1 37  ? -4.769  -6.700  1.787   1.00 0.00 ? 60  ILE A HB   3  
ATOM 3228  H HG12 . ILE A 1 37  ? -2.420  -8.625  2.084   1.00 0.00 ? 60  ILE A HG12 3  
ATOM 3229  H HG13 . ILE A 1 37  ? -2.395  -7.171  1.068   1.00 0.00 ? 60  ILE A HG13 3  
ATOM 3230  H HG21 . ILE A 1 37  ? -4.621  -9.473  3.057   1.00 0.00 ? 60  ILE A HG21 3  
ATOM 3231  H HG22 . ILE A 1 37  ? -4.685  -7.937  3.953   1.00 0.00 ? 60  ILE A HG22 3  
ATOM 3232  H HG23 . ILE A 1 37  ? -6.053  -8.418  2.969   1.00 0.00 ? 60  ILE A HG23 3  
ATOM 3233  H HD11 . ILE A 1 37  ? -2.956  -5.887  3.232   1.00 0.00 ? 60  ILE A HD11 3  
ATOM 3234  H HD12 . ILE A 1 37  ? -2.443  -7.370  4.068   1.00 0.00 ? 60  ILE A HD12 3  
ATOM 3235  H HD13 . ILE A 1 37  ? -1.313  -6.495  3.016   1.00 0.00 ? 60  ILE A HD13 3  
ATOM 3236  N N    . LYS A 1 38  ? -7.078  -7.758  0.151   1.00 0.00 ? 61  LYS A N    3  
ATOM 3237  C CA   . LYS A 1 38  ? -8.483  -7.957  -0.181  1.00 0.00 ? 61  LYS A CA   3  
ATOM 3238  C C    . LYS A 1 38  ? -9.254  -8.776  0.867   1.00 0.00 ? 61  LYS A C    3  
ATOM 3239  O O    . LYS A 1 38  ? -10.013 -9.682  0.527   1.00 0.00 ? 61  LYS A O    3  
ATOM 3240  C CB   . LYS A 1 38  ? -8.479  -8.513  -1.618  1.00 0.00 ? 61  LYS A CB   3  
ATOM 3241  C CG   . LYS A 1 38  ? -9.550  -7.981  -2.554  1.00 0.00 ? 61  LYS A CG   3  
ATOM 3242  C CD   . LYS A 1 38  ? -10.990 -8.346  -2.197  1.00 0.00 ? 61  LYS A CD   3  
ATOM 3243  C CE   . LYS A 1 38  ? -11.387 -9.744  -2.692  1.00 0.00 ? 61  LYS A CE   3  
ATOM 3244  N NZ   . LYS A 1 38  ? -10.757 -10.859 -1.941  1.00 0.00 ? 61  LYS A NZ   3  
ATOM 3245  H H    . LYS A 1 38  ? -6.704  -6.874  -0.134  1.00 0.00 ? 61  LYS A H    3  
ATOM 3246  H HA   . LYS A 1 38  ? -8.974  -6.986  -0.180  1.00 0.00 ? 61  LYS A HA   3  
ATOM 3247  H HB2  . LYS A 1 38  ? -7.534  -8.254  -2.101  1.00 0.00 ? 61  LYS A HB2  3  
ATOM 3248  H HB3  . LYS A 1 38  ? -8.525  -9.591  -1.591  1.00 0.00 ? 61  LYS A HB3  3  
ATOM 3249  H HG2  . LYS A 1 38  ? -9.447  -6.904  -2.626  1.00 0.00 ? 61  LYS A HG2  3  
ATOM 3250  H HG3  . LYS A 1 38  ? -9.321  -8.383  -3.528  1.00 0.00 ? 61  LYS A HG3  3  
ATOM 3251  H HD2  . LYS A 1 38  ? -11.151 -8.216  -1.129  1.00 0.00 ? 61  LYS A HD2  3  
ATOM 3252  H HD3  . LYS A 1 38  ? -11.640 -7.647  -2.718  1.00 0.00 ? 61  LYS A HD3  3  
ATOM 3253  H HE2  . LYS A 1 38  ? -12.475 -9.838  -2.627  1.00 0.00 ? 61  LYS A HE2  3  
ATOM 3254  H HE3  . LYS A 1 38  ? -11.087 -9.795  -3.745  1.00 0.00 ? 61  LYS A HE3  3  
ATOM 3255  H HZ1  . LYS A 1 38  ? -11.216 -11.739 -2.136  1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 3256  H HZ2  . LYS A 1 38  ? -9.785  -10.965 -2.206  1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 3257  H HZ3  . LYS A 1 38  ? -10.772 -10.690 -0.940  1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 3258  N N    . GLN A 1 39  ? -9.148  -8.351  2.132   1.00 0.00 ? 62  GLN A N    3  
ATOM 3259  C CA   . GLN A 1 39  ? -9.858  -8.892  3.298   1.00 0.00 ? 62  GLN A CA   3  
ATOM 3260  C C    . GLN A 1 39  ? -11.402 -8.797  3.241   1.00 0.00 ? 62  GLN A C    3  
ATOM 3261  O O    . GLN A 1 39  ? -12.058 -9.084  4.246   1.00 0.00 ? 62  GLN A O    3  
ATOM 3262  C CB   . GLN A 1 39  ? -9.314  -8.200  4.572   1.00 0.00 ? 62  GLN A CB   3  
ATOM 3263  C CG   . GLN A 1 39  ? -7.970  -8.787  5.042   1.00 0.00 ? 62  GLN A CG   3  
ATOM 3264  C CD   . GLN A 1 39  ? -8.122  -9.444  6.415   1.00 0.00 ? 62  GLN A CD   3  
ATOM 3265  O OE1  . GLN A 1 39  ? -8.854  -10.415 6.577   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 3266  N NE2  . GLN A 1 39  ? -7.526  -8.891  7.452   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 3267  H H    . GLN A 1 39  ? -8.479  -7.618  2.313   1.00 0.00 ? 62  GLN A H    3  
ATOM 3268  H HA   . GLN A 1 39  ? -9.626  -9.956  3.369   1.00 0.00 ? 62  GLN A HA   3  
ATOM 3269  H HB2  . GLN A 1 39  ? -9.225  -7.116  4.434   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 3270  H HB3  . GLN A 1 39  ? -10.024 -8.327  5.387   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 3271  H HG2  . GLN A 1 39  ? -7.604  -9.536  4.337   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 3272  H HG3  . GLN A 1 39  ? -7.235  -7.984  5.096   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 3273  H HE21 . GLN A 1 39  ? -6.751  -8.263  7.228   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 3274  H HE22 . GLN A 1 39  ? -7.464  -9.392  8.334   1.00 0.00 ? 62  GLN A HE22 3  
ATOM 3275  N N    . GLY A 1 40  ? -12.013 -8.345  2.138   1.00 0.00 ? 63  GLY A N    3  
ATOM 3276  C CA   . GLY A 1 40  ? -13.470 -8.284  1.996   1.00 0.00 ? 63  GLY A CA   3  
ATOM 3277  C C    . GLY A 1 40  ? -14.144 -7.249  2.910   1.00 0.00 ? 63  GLY A C    3  
ATOM 3278  O O    . GLY A 1 40  ? -15.357 -7.310  3.139   1.00 0.00 ? 63  GLY A O    3  
ATOM 3279  H H    . GLY A 1 40  ? -11.463 -8.222  1.300   1.00 0.00 ? 63  GLY A H    3  
ATOM 3280  H HA2  . GLY A 1 40  ? -13.706 -8.050  0.959   1.00 0.00 ? 63  GLY A HA2  3  
ATOM 3281  H HA3  . GLY A 1 40  ? -13.886 -9.266  2.220   1.00 0.00 ? 63  GLY A HA3  3  
ATOM 3282  N N    . ARG A 1 41  ? -13.370 -6.307  3.455   1.00 0.00 ? 64  ARG A N    3  
ATOM 3283  C CA   . ARG A 1 41  ? -13.808 -5.261  4.382   1.00 0.00 ? 64  ARG A CA   3  
ATOM 3284  C C    . ARG A 1 41  ? -14.088 -3.968  3.631   1.00 0.00 ? 64  ARG A C    3  
ATOM 3285  O O    . ARG A 1 41  ? -13.544 -3.748  2.550   1.00 0.00 ? 64  ARG A O    3  
ATOM 3286  C CB   . ARG A 1 41  ? -12.788 -5.020  5.521   1.00 0.00 ? 64  ARG A CB   3  
ATOM 3287  C CG   . ARG A 1 41  ? -11.311 -5.243  5.160   1.00 0.00 ? 64  ARG A CG   3  
ATOM 3288  C CD   . ARG A 1 41  ? -10.429 -5.331  6.414   1.00 0.00 ? 64  ARG A CD   3  
ATOM 3289  N NE   . ARG A 1 41  ? -10.345 -4.048  7.122   1.00 0.00 ? 64  ARG A NE   3  
ATOM 3290  C CZ   . ARG A 1 41  ? -9.363  -3.654  7.946   1.00 0.00 ? 64  ARG A CZ   3  
ATOM 3291  N NH1  . ARG A 1 41  ? -8.223  -4.332  7.998   1.00 0.00 ? 64  ARG A NH1  3  
ATOM 3292  N NH2  . ARG A 1 41  ? -9.527  -2.599  8.744   1.00 0.00 ? 64  ARG A NH2  3  
ATOM 3293  H H    . ARG A 1 41  ? -12.419 -6.259  3.130   1.00 0.00 ? 64  ARG A H    3  
ATOM 3294  H HA   . ARG A 1 41  ? -14.741 -5.581  4.841   1.00 0.00 ? 64  ARG A HA   3  
ATOM 3295  H HB2  . ARG A 1 41  ? -12.907 -4.005  5.902   1.00 0.00 ? 64  ARG A HB2  3  
ATOM 3296  H HB3  . ARG A 1 41  ? -13.025 -5.679  6.350   1.00 0.00 ? 64  ARG A HB3  3  
ATOM 3297  H HG2  . ARG A 1 41  ? -11.223 -6.185  4.629   1.00 0.00 ? 64  ARG A HG2  3  
ATOM 3298  H HG3  . ARG A 1 41  ? -10.956 -4.462  4.490   1.00 0.00 ? 64  ARG A HG3  3  
ATOM 3299  H HD2  . ARG A 1 41  ? -10.841 -6.077  7.094   1.00 0.00 ? 64  ARG A HD2  3  
ATOM 3300  H HD3  . ARG A 1 41  ? -9.437  -5.667  6.127   1.00 0.00 ? 64  ARG A HD3  3  
ATOM 3301  H HE   . ARG A 1 41  ? -11.120 -3.441  6.929   1.00 0.00 ? 64  ARG A HE   3  
ATOM 3302  H HH11 . ARG A 1 41  ? -7.932  -4.827  7.148   1.00 0.00 ? 64  ARG A HH11 3  
ATOM 3303  H HH12 . ARG A 1 41  ? -7.466  -4.161  8.658   1.00 0.00 ? 64  ARG A HH12 3  
ATOM 3304  H HH21 . ARG A 1 41  ? -10.338 -1.980  8.700   1.00 0.00 ? 64  ARG A HH21 3  
ATOM 3305  H HH22 . ARG A 1 41  ? -8.699  -2.162  9.159   1.00 0.00 ? 64  ARG A HH22 3  
ATOM 3306  N N    . LYS A 1 42  ? -14.904 -3.118  4.246   1.00 0.00 ? 65  LYS A N    3  
ATOM 3307  C CA   . LYS A 1 42  ? -15.143 -1.726  3.886   1.00 0.00 ? 65  LYS A CA   3  
ATOM 3308  C C    . LYS A 1 42  ? -14.270 -0.871  4.783   1.00 0.00 ? 65  LYS A C    3  
ATOM 3309  O O    . LYS A 1 42  ? -14.223 -1.153  5.983   1.00 0.00 ? 65  LYS A O    3  
ATOM 3310  C CB   . LYS A 1 42  ? -16.606 -1.374  4.186   1.00 0.00 ? 65  LYS A CB   3  
ATOM 3311  C CG   . LYS A 1 42  ? -17.086 -0.132  3.422   1.00 0.00 ? 65  LYS A CG   3  
ATOM 3312  C CD   . LYS A 1 42  ? -18.251 0.583   4.110   1.00 0.00 ? 65  LYS A CD   3  
ATOM 3313  C CE   . LYS A 1 42  ? -19.238 -0.325  4.839   1.00 0.00 ? 65  LYS A CE   3  
ATOM 3314  N NZ   . LYS A 1 42  ? -20.123 0.449   5.707   1.00 0.00 ? 65  LYS A NZ   3  
ATOM 3315  H H    . LYS A 1 42  ? -15.243 -3.411  5.155   1.00 0.00 ? 65  LYS A H    3  
ATOM 3316  H HA   . LYS A 1 42  ? -14.890 -1.558  2.840   1.00 0.00 ? 65  LYS A HA   3  
ATOM 3317  H HB2  . LYS A 1 42  ? -17.254 -2.211  3.933   1.00 0.00 ? 65  LYS A HB2  3  
ATOM 3318  H HB3  . LYS A 1 42  ? -16.711 -1.204  5.260   1.00 0.00 ? 65  LYS A HB3  3  
ATOM 3319  H HG2  . LYS A 1 42  ? -16.283 0.597   3.308   1.00 0.00 ? 65  LYS A HG2  3  
ATOM 3320  H HG3  . LYS A 1 42  ? -17.400 -0.432  2.429   1.00 0.00 ? 65  LYS A HG3  3  
ATOM 3321  H HD2  . LYS A 1 42  ? -17.841 1.300   4.821   1.00 0.00 ? 65  LYS A HD2  3  
ATOM 3322  H HD3  . LYS A 1 42  ? -18.805 1.123   3.351   1.00 0.00 ? 65  LYS A HD3  3  
ATOM 3323  H HE2  . LYS A 1 42  ? -19.839 -0.882  4.124   1.00 0.00 ? 65  LYS A HE2  3  
ATOM 3324  H HE3  . LYS A 1 42  ? -18.708 -1.035  5.463   1.00 0.00 ? 65  LYS A HE3  3  
ATOM 3325  H HZ1  . LYS A 1 42  ? -20.776 0.948   5.112   1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 3326  H HZ2  . LYS A 1 42  ? -20.644 -0.182  6.308   1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 3327  H HZ3  . LYS A 1 42  ? -19.611 1.126   6.269   1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 3328  N N    . LEU A 1 43  ? -13.588 0.124   4.223   1.00 0.00 ? 66  LEU A N    3  
ATOM 3329  C CA   . LEU A 1 43  ? -12.741 1.034   4.968   1.00 0.00 ? 66  LEU A CA   3  
ATOM 3330  C C    . LEU A 1 43  ? -13.335 2.427   4.802   1.00 0.00 ? 66  LEU A C    3  
ATOM 3331  O O    . LEU A 1 43  ? -13.689 2.847   3.698   1.00 0.00 ? 66  LEU A O    3  
ATOM 3332  C CB   . LEU A 1 43  ? -11.310 1.017   4.415   1.00 0.00 ? 66  LEU A CB   3  
ATOM 3333  C CG   . LEU A 1 43  ? -10.467 -0.254  4.601   1.00 0.00 ? 66  LEU A CG   3  
ATOM 3334  C CD1  . LEU A 1 43  ? -9.902  -0.289  6.014   1.00 0.00 ? 66  LEU A CD1  3  
ATOM 3335  C CD2  . LEU A 1 43  ? -11.179 -1.589  4.424   1.00 0.00 ? 66  LEU A CD2  3  
ATOM 3336  H H    . LEU A 1 43  ? -13.528 0.233   3.219   1.00 0.00 ? 66  LEU A H    3  
ATOM 3337  H HA   . LEU A 1 43  ? -12.708 0.759   6.025   1.00 0.00 ? 66  LEU A HA   3  
ATOM 3338  H HB2  . LEU A 1 43  ? -11.339 1.267   3.356   1.00 0.00 ? 66  LEU A HB2  3  
ATOM 3339  H HB3  . LEU A 1 43  ? -10.769 1.820   4.910   1.00 0.00 ? 66  LEU A HB3  3  
ATOM 3340  H HG   . LEU A 1 43  ? -9.666  -0.200  3.872   1.00 0.00 ? 66  LEU A HG   3  
ATOM 3341  H HD11 . LEU A 1 43  ? -9.259  -1.160  6.139   1.00 0.00 ? 66  LEU A HD11 3  
ATOM 3342  H HD12 . LEU A 1 43  ? -9.329  0.623   6.169   1.00 0.00 ? 66  LEU A HD12 3  
ATOM 3343  H HD13 . LEU A 1 43  ? -10.722 -0.351  6.722   1.00 0.00 ? 66  LEU A HD13 3  
ATOM 3344  H HD21 . LEU A 1 43  ? -10.429 -2.373  4.426   1.00 0.00 ? 66  LEU A HD21 3  
ATOM 3345  H HD22 . LEU A 1 43  ? -11.868 -1.715  5.258   1.00 0.00 ? 66  LEU A HD22 3  
ATOM 3346  H HD23 . LEU A 1 43  ? -11.708 -1.607  3.476   1.00 0.00 ? 66  LEU A HD23 3  
ATOM 3347  N N    . ASP A 1 44  ? -13.389 3.183   5.884   1.00 0.00 ? 67  ASP A N    3  
ATOM 3348  C CA   . ASP A 1 44  ? -13.985 4.525   5.917   1.00 0.00 ? 67  ASP A CA   3  
ATOM 3349  C C    . ASP A 1 44  ? -12.955 5.586   5.476   1.00 0.00 ? 67  ASP A C    3  
ATOM 3350  O O    . ASP A 1 44  ? -12.851 6.679   6.030   1.00 0.00 ? 67  ASP A O    3  
ATOM 3351  C CB   . ASP A 1 44  ? -14.708 4.804   7.252   1.00 0.00 ? 67  ASP A CB   3  
ATOM 3352  C CG   . ASP A 1 44  ? -16.184 4.394   7.222   1.00 0.00 ? 67  ASP A CG   3  
ATOM 3353  O OD1  . ASP A 1 44  ? -16.661 3.712   6.277   1.00 0.00 ? 67  ASP A OD1  3  
ATOM 3354  O OD2  . ASP A 1 44  ? -16.909 4.745   8.181   1.00 0.00 ? 67  ASP A OD2  3  
ATOM 3355  H H    . ASP A 1 44  ? -13.122 2.703   6.741   1.00 0.00 ? 67  ASP A H    3  
ATOM 3356  H HA   . ASP A 1 44  ? -14.765 4.562   5.160   1.00 0.00 ? 67  ASP A HA   3  
ATOM 3357  H HB2  . ASP A 1 44  ? -14.193 4.301   8.074   1.00 0.00 ? 67  ASP A HB2  3  
ATOM 3358  H HB3  . ASP A 1 44  ? -14.692 5.875   7.451   1.00 0.00 ? 67  ASP A HB3  3  
ATOM 3359  N N    . ILE A 1 45  ? -12.216 5.299   4.400   1.00 0.00 ? 68  ILE A N    3  
ATOM 3360  C CA   . ILE A 1 45  ? -11.301 6.227   3.718   1.00 0.00 ? 68  ILE A CA   3  
ATOM 3361  C C    . ILE A 1 45  ? -12.220 7.134   2.873   1.00 0.00 ? 68  ILE A C    3  
ATOM 3362  O O    . ILE A 1 45  ? -13.330 6.721   2.508   1.00 0.00 ? 68  ILE A O    3  
ATOM 3363  C CB   . ILE A 1 45  ? -10.304 5.444   2.802   1.00 0.00 ? 68  ILE A CB   3  
ATOM 3364  C CG1  . ILE A 1 45  ? -9.662  4.209   3.492   1.00 0.00 ? 68  ILE A CG1  3  
ATOM 3365  C CG2  . ILE A 1 45  ? -9.195  6.358   2.238   1.00 0.00 ? 68  ILE A CG2  3  
ATOM 3366  C CD1  . ILE A 1 45  ? -8.839  3.285   2.583   1.00 0.00 ? 68  ILE A CD1  3  
ATOM 3367  H H    . ILE A 1 45  ? -12.388 4.405   3.969   1.00 0.00 ? 68  ILE A H    3  
ATOM 3368  H HA   . ILE A 1 45  ? -10.762 6.812   4.467   1.00 0.00 ? 68  ILE A HA   3  
ATOM 3369  H HB   . ILE A 1 45  ? -10.887 5.070   1.959   1.00 0.00 ? 68  ILE A HB   3  
ATOM 3370  H HG12 . ILE A 1 45  ? -9.060  4.487   4.359   1.00 0.00 ? 68  ILE A HG12 3  
ATOM 3371  H HG13 . ILE A 1 45  ? -10.467 3.596   3.858   1.00 0.00 ? 68  ILE A HG13 3  
ATOM 3372  H HG21 . ILE A 1 45  ? -9.629  7.198   1.697   1.00 0.00 ? 68  ILE A HG21 3  
ATOM 3373  H HG22 . ILE A 1 45  ? -8.567  6.724   3.054   1.00 0.00 ? 68  ILE A HG22 3  
ATOM 3374  H HG23 . ILE A 1 45  ? -8.577  5.809   1.526   1.00 0.00 ? 68  ILE A HG23 3  
ATOM 3375  H HD11 . ILE A 1 45  ? -7.929  3.776   2.241   1.00 0.00 ? 68  ILE A HD11 3  
ATOM 3376  H HD12 . ILE A 1 45  ? -8.560  2.389   3.141   1.00 0.00 ? 68  ILE A HD12 3  
ATOM 3377  H HD13 . ILE A 1 45  ? -9.442  2.989   1.726   1.00 0.00 ? 68  ILE A HD13 3  
ATOM 3378  N N    . ASP A 1 46  ? -11.823 8.381   2.604   1.00 0.00 ? 69  ASP A N    3  
ATOM 3379  C CA   . ASP A 1 46  ? -12.637 9.315   1.826   1.00 0.00 ? 69  ASP A CA   3  
ATOM 3380  C C    . ASP A 1 46  ? -12.199 9.347   0.363   1.00 0.00 ? 69  ASP A C    3  
ATOM 3381  O O    . ASP A 1 46  ? -11.010 9.441   0.050   1.00 0.00 ? 69  ASP A O    3  
ATOM 3382  C CB   . ASP A 1 46  ? -12.603 10.725  2.415   1.00 0.00 ? 69  ASP A CB   3  
ATOM 3383  C CG   . ASP A 1 46  ? -13.183 11.725  1.413   1.00 0.00 ? 69  ASP A CG   3  
ATOM 3384  O OD1  . ASP A 1 46  ? -14.388 11.634  1.086   1.00 0.00 ? 69  ASP A OD1  3  
ATOM 3385  O OD2  . ASP A 1 46  ? -12.417 12.554  0.870   1.00 0.00 ? 69  ASP A OD2  3  
ATOM 3386  H H    . ASP A 1 46  ? -10.893 8.683   2.854   1.00 0.00 ? 69  ASP A H    3  
ATOM 3387  H HA   . ASP A 1 46  ? -13.675 8.996   1.868   1.00 0.00 ? 69  ASP A HA   3  
ATOM 3388  H HB2  . ASP A 1 46  ? -13.198 10.745  3.326   1.00 0.00 ? 69  ASP A HB2  3  
ATOM 3389  H HB3  . ASP A 1 46  ? -11.579 10.997  2.661   1.00 0.00 ? 69  ASP A HB3  3  
ATOM 3390  N N    . PHE A 1 47  ? -13.186 9.366   -0.528  1.00 0.00 ? 70  PHE A N    3  
ATOM 3391  C CA   . PHE A 1 47  ? -13.063 9.357   -1.978  1.00 0.00 ? 70  PHE A CA   3  
ATOM 3392  C C    . PHE A 1 47  ? -13.700 10.591  -2.623  1.00 0.00 ? 70  PHE A C    3  
ATOM 3393  O O    . PHE A 1 47  ? -13.672 10.700  -3.854  1.00 0.00 ? 70  PHE A O    3  
ATOM 3394  C CB   . PHE A 1 47  ? -13.679 8.052   -2.495  1.00 0.00 ? 70  PHE A CB   3  
ATOM 3395  C CG   . PHE A 1 47  ? -12.898 6.848   -2.020  1.00 0.00 ? 70  PHE A CG   3  
ATOM 3396  C CD1  . PHE A 1 47  ? -11.725 6.502   -2.705  1.00 0.00 ? 70  PHE A CD1  3  
ATOM 3397  C CD2  . PHE A 1 47  ? -13.248 6.159   -0.841  1.00 0.00 ? 70  PHE A CD2  3  
ATOM 3398  C CE1  . PHE A 1 47  ? -10.891 5.494   -2.203  1.00 0.00 ? 70  PHE A CE1  3  
ATOM 3399  C CE2  . PHE A 1 47  ? -12.403 5.154   -0.341  1.00 0.00 ? 70  PHE A CE2  3  
ATOM 3400  C CZ   . PHE A 1 47  ? -11.215 4.828   -1.015  1.00 0.00 ? 70  PHE A CZ   3  
ATOM 3401  H H    . PHE A 1 47  ? -14.118 9.242   -0.143  1.00 0.00 ? 70  PHE A H    3  
ATOM 3402  H HA   . PHE A 1 47  ? -12.007 9.360   -2.252  1.00 0.00 ? 70  PHE A HA   3  
ATOM 3403  H HB2  . PHE A 1 47  ? -14.713 7.982   -2.163  1.00 0.00 ? 70  PHE A HB2  3  
ATOM 3404  H HB3  . PHE A 1 47  ? -13.671 8.059   -3.585  1.00 0.00 ? 70  PHE A HB3  3  
ATOM 3405  H HD1  . PHE A 1 47  ? -11.455 7.033   -3.603  1.00 0.00 ? 70  PHE A HD1  3  
ATOM 3406  H HD2  . PHE A 1 47  ? -14.129 6.423   -0.273  1.00 0.00 ? 70  PHE A HD2  3  
ATOM 3407  H HE1  . PHE A 1 47  ? -9.989  5.236   -2.720  1.00 0.00 ? 70  PHE A HE1  3  
ATOM 3408  H HE2  . PHE A 1 47  ? -12.663 4.659   0.582   1.00 0.00 ? 70  PHE A HE2  3  
ATOM 3409  H HZ   . PHE A 1 47  ? -10.538 4.073   -0.639  1.00 0.00 ? 70  PHE A HZ   3  
ATOM 3410  N N    . GLY A 1 48  ? -14.249 11.519  -1.833  1.00 0.00 ? 71  GLY A N    3  
ATOM 3411  C CA   . GLY A 1 48  ? -14.889 12.745  -2.279  1.00 0.00 ? 71  GLY A CA   3  
ATOM 3412  C C    . GLY A 1 48  ? -16.392 12.642  -2.045  1.00 0.00 ? 71  GLY A C    3  
ATOM 3413  O O    . GLY A 1 48  ? -16.841 12.806  -0.914  1.00 0.00 ? 71  GLY A O    3  
ATOM 3414  H H    . GLY A 1 48  ? -14.220 11.392  -0.824  1.00 0.00 ? 71  GLY A H    3  
ATOM 3415  H HA2  . GLY A 1 48  ? -14.489 13.573  -1.697  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 3416  H HA3  . GLY A 1 48  ? -14.678 12.939  -3.327  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 3417  N N    . ALA A 1 49  ? -17.165 12.320  -3.082  1.00 0.00 ? 72  ALA A N    3  
ATOM 3418  C CA   . ALA A 1 49  ? -18.602 12.077  -2.992  1.00 0.00 ? 72  ALA A CA   3  
ATOM 3419  C C    . ALA A 1 49  ? -18.877 10.653  -3.464  1.00 0.00 ? 72  ALA A C    3  
ATOM 3420  O O    . ALA A 1 49  ? -18.868 9.711   -2.669  1.00 0.00 ? 72  ALA A O    3  
ATOM 3421  C CB   . ALA A 1 49  ? -19.365 13.128  -3.822  1.00 0.00 ? 72  ALA A CB   3  
ATOM 3422  H H    . ALA A 1 49  ? -16.714 12.187  -3.981  1.00 0.00 ? 72  ALA A H    3  
ATOM 3423  H HA   . ALA A 1 49  ? -18.933 12.148  -1.951  1.00 0.00 ? 72  ALA A HA   3  
ATOM 3424  H HB1  . ALA A 1 49  ? -19.218 14.114  -3.384  1.00 0.00 ? 72  ALA A HB1  3  
ATOM 3425  H HB2  . ALA A 1 49  ? -19.021 13.135  -4.862  1.00 0.00 ? 72  ALA A HB2  3  
ATOM 3426  H HB3  . ALA A 1 49  ? -20.432 12.891  -3.810  1.00 0.00 ? 72  ALA A HB3  3  
ATOM 3427  N N    . GLU A 1 50  ? -19.036 10.515  -4.780  1.00 0.00 ? 73  GLU A N    3  
ATOM 3428  C CA   . GLU A 1 50  ? -19.494 9.343   -5.511  1.00 0.00 ? 73  GLU A CA   3  
ATOM 3429  C C    . GLU A 1 50  ? -18.742 8.092   -5.086  1.00 0.00 ? 73  GLU A C    3  
ATOM 3430  O O    . GLU A 1 50  ? -19.348 7.043   -4.892  1.00 0.00 ? 73  GLU A O    3  
ATOM 3431  C CB   . GLU A 1 50  ? -19.231 9.571   -7.002  1.00 0.00 ? 73  GLU A CB   3  
ATOM 3432  C CG   . GLU A 1 50  ? -19.860 10.804  -7.628  1.00 0.00 ? 73  GLU A CG   3  
ATOM 3433  C CD   . GLU A 1 50  ? -21.366 10.711  -7.898  1.00 0.00 ? 73  GLU A CD   3  
ATOM 3434  O OE1  . GLU A 1 50  ? -22.043 9.803   -7.378  1.00 0.00 ? 73  GLU A OE1  3  
ATOM 3435  O OE2  . GLU A 1 50  ? -21.856 11.486  -8.754  1.00 0.00 ? 73  GLU A OE2  3  
ATOM 3436  H H    . GLU A 1 50  ? -18.975 11.369  -5.315  1.00 0.00 ? 73  GLU A H    3  
ATOM 3437  H HA   . GLU A 1 50  ? -20.560 9.191   -5.340  1.00 0.00 ? 73  GLU A HA   3  
ATOM 3438  H HB2  . GLU A 1 50  ? -18.164 9.741   -7.099  1.00 0.00 ? 73  GLU A HB2  3  
ATOM 3439  H HB3  . GLU A 1 50  ? -19.523 8.686   -7.564  1.00 0.00 ? 73  GLU A HB3  3  
ATOM 3440  H HG2  . GLU A 1 50  ? -19.594 11.638  -7.005  1.00 0.00 ? 73  GLU A HG2  3  
ATOM 3441  H HG3  . GLU A 1 50  ? -19.356 10.988  -8.569  1.00 0.00 ? 73  GLU A HG3  3  
ATOM 3442  N N    . GLY A 1 51  ? -17.416 8.187   -4.957  1.00 0.00 ? 74  GLY A N    3  
ATOM 3443  C CA   . GLY A 1 51  ? -16.590 7.032   -4.675  1.00 0.00 ? 74  GLY A CA   3  
ATOM 3444  C C    . GLY A 1 51  ? -16.922 6.407   -3.324  1.00 0.00 ? 74  GLY A C    3  
ATOM 3445  O O    . GLY A 1 51  ? -16.913 5.185   -3.220  1.00 0.00 ? 74  GLY A O    3  
ATOM 3446  H H    . GLY A 1 51  ? -16.961 9.070   -5.137  1.00 0.00 ? 74  GLY A H    3  
ATOM 3447  H HA2  . GLY A 1 51  ? -16.765 6.289   -5.453  1.00 0.00 ? 74  GLY A HA2  3  
ATOM 3448  H HA3  . GLY A 1 51  ? -15.541 7.321   -4.704  1.00 0.00 ? 74  GLY A HA3  3  
ATOM 3449  N N    . ASN A 1 52  ? -17.269 7.218   -2.318  1.00 0.00 ? 75  ASN A N    3  
ATOM 3450  C CA   . ASN A 1 52  ? -17.645 6.733   -0.989  1.00 0.00 ? 75  ASN A CA   3  
ATOM 3451  C C    . ASN A 1 52  ? -18.933 5.934   -1.101  1.00 0.00 ? 75  ASN A C    3  
ATOM 3452  O O    . ASN A 1 52  ? -19.035 4.823   -0.573  1.00 0.00 ? 75  ASN A O    3  
ATOM 3453  C CB   . ASN A 1 52  ? -17.877 7.892   -0.009  1.00 0.00 ? 75  ASN A CB   3  
ATOM 3454  C CG   . ASN A 1 52  ? -16.680 8.805   0.105   1.00 0.00 ? 75  ASN A CG   3  
ATOM 3455  O OD1  . ASN A 1 52  ? -15.627 8.422   0.593   1.00 0.00 ? 75  ASN A OD1  3  
ATOM 3456  N ND2  . ASN A 1 52  ? -16.815 10.012  -0.403  1.00 0.00 ? 75  ASN A ND2  3  
ATOM 3457  H H    . ASN A 1 52  ? -17.393 8.201   -2.532  1.00 0.00 ? 75  ASN A H    3  
ATOM 3458  H HA   . ASN A 1 52  ? -16.852 6.088   -0.605  1.00 0.00 ? 75  ASN A HA   3  
ATOM 3459  H HB2  . ASN A 1 52  ? -18.753 8.469   -0.309  1.00 0.00 ? 75  ASN A HB2  3  
ATOM 3460  H HB3  . ASN A 1 52  ? -18.082 7.496   0.982   1.00 0.00 ? 75  ASN A HB3  3  
ATOM 3461  H HD21 . ASN A 1 52  ? -17.705 10.250  -0.827  1.00 0.00 ? 75  ASN A HD21 3  
ATOM 3462  H HD22 . ASN A 1 52  ? -16.186 10.767  -0.145  1.00 0.00 ? 75  ASN A HD22 3  
ATOM 3463  N N    . ARG A 1 53  ? -19.915 6.511   -1.800  1.00 0.00 ? 76  ARG A N    3  
ATOM 3464  C CA   . ARG A 1 53  ? -21.207 5.889   -2.049  1.00 0.00 ? 76  ARG A CA   3  
ATOM 3465  C C    . ARG A 1 53  ? -21.031 4.570   -2.786  1.00 0.00 ? 76  ARG A C    3  
ATOM 3466  O O    . ARG A 1 53  ? -21.655 3.576   -2.418  1.00 0.00 ? 76  ARG A O    3  
ATOM 3467  C CB   . ARG A 1 53  ? -22.096 6.855   -2.845  1.00 0.00 ? 76  ARG A CB   3  
ATOM 3468  C CG   . ARG A 1 53  ? -22.713 7.942   -1.958  1.00 0.00 ? 76  ARG A CG   3  
ATOM 3469  C CD   . ARG A 1 53  ? -24.116 7.570   -1.471  1.00 0.00 ? 76  ARG A CD   3  
ATOM 3470  N NE   . ARG A 1 53  ? -24.136 6.411   -0.562  1.00 0.00 ? 76  ARG A NE   3  
ATOM 3471  C CZ   . ARG A 1 53  ? -25.154 6.102   0.247   1.00 0.00 ? 76  ARG A CZ   3  
ATOM 3472  N NH1  . ARG A 1 53  ? -26.306 6.762   0.173   1.00 0.00 ? 76  ARG A NH1  3  
ATOM 3473  N NH2  . ARG A 1 53  ? -25.001 5.125   1.130   1.00 0.00 ? 76  ARG A NH2  3  
ATOM 3474  H H    . ARG A 1 53  ? -19.728 7.438   -2.169  1.00 0.00 ? 76  ARG A H    3  
ATOM 3475  H HA   . ARG A 1 53  ? -21.660 5.676   -1.086  1.00 0.00 ? 76  ARG A HA   3  
ATOM 3476  H HB2  . ARG A 1 53  ? -21.511 7.335   -3.630  1.00 0.00 ? 76  ARG A HB2  3  
ATOM 3477  H HB3  . ARG A 1 53  ? -22.894 6.297   -3.334  1.00 0.00 ? 76  ARG A HB3  3  
ATOM 3478  H HG2  . ARG A 1 53  ? -22.068 8.172   -1.108  1.00 0.00 ? 76  ARG A HG2  3  
ATOM 3479  H HG3  . ARG A 1 53  ? -22.799 8.844   -2.555  1.00 0.00 ? 76  ARG A HG3  3  
ATOM 3480  H HD2  . ARG A 1 53  ? -24.517 8.435   -0.944  1.00 0.00 ? 76  ARG A HD2  3  
ATOM 3481  H HD3  . ARG A 1 53  ? -24.753 7.363   -2.332  1.00 0.00 ? 76  ARG A HD3  3  
ATOM 3482  H HE   . ARG A 1 53  ? -23.316 5.818   -0.555  1.00 0.00 ? 76  ARG A HE   3  
ATOM 3483  H HH11 . ARG A 1 53  ? -26.404 7.539   -0.478  1.00 0.00 ? 76  ARG A HH11 3  
ATOM 3484  H HH12 . ARG A 1 53  ? -27.063 6.621   0.837   1.00 0.00 ? 76  ARG A HH12 3  
ATOM 3485  H HH21 . ARG A 1 53  ? -24.071 4.915   1.495   1.00 0.00 ? 76  ARG A HH21 3  
ATOM 3486  H HH22 . ARG A 1 53  ? -25.741 4.909   1.800   1.00 0.00 ? 76  ARG A HH22 3  
ATOM 3487  N N    . TYR A 1 54  ? -20.206 4.557   -3.830  1.00 0.00 ? 77  TYR A N    3  
ATOM 3488  C CA   . TYR A 1 54  ? -19.933 3.361   -4.601  1.00 0.00 ? 77  TYR A CA   3  
ATOM 3489  C C    . TYR A 1 54  ? -19.198 2.314   -3.772  1.00 0.00 ? 77  TYR A C    3  
ATOM 3490  O O    . TYR A 1 54  ? -19.450 1.121   -3.917  1.00 0.00 ? 77  TYR A O    3  
ATOM 3491  C CB   . TYR A 1 54  ? -19.113 3.766   -5.832  1.00 0.00 ? 77  TYR A CB   3  
ATOM 3492  C CG   . TYR A 1 54  ? -19.452 2.973   -7.064  1.00 0.00 ? 77  TYR A CG   3  
ATOM 3493  C CD1  . TYR A 1 54  ? -20.775 3.004   -7.537  1.00 0.00 ? 77  TYR A CD1  3  
ATOM 3494  C CD2  . TYR A 1 54  ? -18.449 2.305   -7.791  1.00 0.00 ? 77  TYR A CD2  3  
ATOM 3495  C CE1  . TYR A 1 54  ? -21.112 2.336   -8.717  1.00 0.00 ? 77  TYR A CE1  3  
ATOM 3496  C CE2  . TYR A 1 54  ? -18.770 1.715   -9.024  1.00 0.00 ? 77  TYR A CE2  3  
ATOM 3497  C CZ   . TYR A 1 54  ? -20.105 1.694   -9.465  1.00 0.00 ? 77  TYR A CZ   3  
ATOM 3498  O OH   . TYR A 1 54  ? -20.409 1.079   -10.630 1.00 0.00 ? 77  TYR A OH   3  
ATOM 3499  H H    . TYR A 1 54  ? -19.813 5.430   -4.180  1.00 0.00 ? 77  TYR A H    3  
ATOM 3500  H HA   . TYR A 1 54  ? -20.890 2.927   -4.905  1.00 0.00 ? 77  TYR A HA   3  
ATOM 3501  H HB2  . TYR A 1 54  ? -19.313 4.808   -6.079  1.00 0.00 ? 77  TYR A HB2  3  
ATOM 3502  H HB3  . TYR A 1 54  ? -18.048 3.694   -5.615  1.00 0.00 ? 77  TYR A HB3  3  
ATOM 3503  H HD1  . TYR A 1 54  ? -21.545 3.551   -7.009  1.00 0.00 ? 77  TYR A HD1  3  
ATOM 3504  H HD2  . TYR A 1 54  ? -17.427 2.295   -7.441  1.00 0.00 ? 77  TYR A HD2  3  
ATOM 3505  H HE1  . TYR A 1 54  ? -22.137 2.348   -9.047  1.00 0.00 ? 77  TYR A HE1  3  
ATOM 3506  H HE2  . TYR A 1 54  ? -18.015 1.292   -9.665  1.00 0.00 ? 77  TYR A HE2  3  
ATOM 3507  H HH   . TYR A 1 54  ? -21.375 1.094   -10.730 1.00 0.00 ? 77  TYR A HH   3  
ATOM 3508  N N    . TYR A 1 55  ? -18.301 2.736   -2.877  1.00 0.00 ? 78  TYR A N    3  
ATOM 3509  C CA   . TYR A 1 55  ? -17.549 1.828   -2.030  1.00 0.00 ? 78  TYR A CA   3  
ATOM 3510  C C    . TYR A 1 55  ? -18.509 0.996   -1.188  1.00 0.00 ? 78  TYR A C    3  
ATOM 3511  O O    . TYR A 1 55  ? -18.459 -0.227  -1.243  1.00 0.00 ? 78  TYR A O    3  
ATOM 3512  C CB   . TYR A 1 55  ? -16.563 2.609   -1.157  1.00 0.00 ? 78  TYR A CB   3  
ATOM 3513  C CG   . TYR A 1 55  ? -15.413 1.846   -0.544  1.00 0.00 ? 78  TYR A CG   3  
ATOM 3514  C CD1  . TYR A 1 55  ? -15.176 0.482   -0.800  1.00 0.00 ? 78  TYR A CD1  3  
ATOM 3515  C CD2  . TYR A 1 55  ? -14.551 2.555   0.302   1.00 0.00 ? 78  TYR A CD2  3  
ATOM 3516  C CE1  . TYR A 1 55  ? -14.117 -0.184  -0.159  1.00 0.00 ? 78  TYR A CE1  3  
ATOM 3517  C CE2  . TYR A 1 55  ? -13.474 1.905   0.917   1.00 0.00 ? 78  TYR A CE2  3  
ATOM 3518  C CZ   . TYR A 1 55  ? -13.290 0.525   0.733   1.00 0.00 ? 78  TYR A CZ   3  
ATOM 3519  O OH   . TYR A 1 55  ? -12.339 -0.108  1.458   1.00 0.00 ? 78  TYR A OH   3  
ATOM 3520  H H    . TYR A 1 55  ? -18.103 3.728   -2.792  1.00 0.00 ? 78  TYR A H    3  
ATOM 3521  H HA   . TYR A 1 55  ? -16.999 1.162   -2.692  1.00 0.00 ? 78  TYR A HA   3  
ATOM 3522  H HB2  . TYR A 1 55  ? -16.118 3.403   -1.752  1.00 0.00 ? 78  TYR A HB2  3  
ATOM 3523  H HB3  . TYR A 1 55  ? -17.119 3.059   -0.336  1.00 0.00 ? 78  TYR A HB3  3  
ATOM 3524  H HD1  . TYR A 1 55  ? -15.824 -0.077  -1.450  1.00 0.00 ? 78  TYR A HD1  3  
ATOM 3525  H HD2  . TYR A 1 55  ? -14.743 3.600   0.496   1.00 0.00 ? 78  TYR A HD2  3  
ATOM 3526  H HE1  . TYR A 1 55  ? -13.941 -1.236  -0.327  1.00 0.00 ? 78  TYR A HE1  3  
ATOM 3527  H HE2  . TYR A 1 55  ? -12.796 2.450   1.553   1.00 0.00 ? 78  TYR A HE2  3  
ATOM 3528  H HH   . TYR A 1 55  ? -12.144 -1.020  1.142   1.00 0.00 ? 78  TYR A HH   3  
ATOM 3529  N N    . GLU A 1 56  ? -19.442 1.636   -0.481  1.00 0.00 ? 79  GLU A N    3  
ATOM 3530  C CA   . GLU A 1 56  ? -20.464 0.976   0.337   1.00 0.00 ? 79  GLU A CA   3  
ATOM 3531  C C    . GLU A 1 56  ? -21.276 -0.045  -0.462  1.00 0.00 ? 79  GLU A C    3  
ATOM 3532  O O    . GLU A 1 56  ? -21.835 -0.985  0.113   1.00 0.00 ? 79  GLU A O    3  
ATOM 3533  C CB   . GLU A 1 56  ? -21.418 2.055   0.855   1.00 0.00 ? 79  GLU A CB   3  
ATOM 3534  C CG   . GLU A 1 56  ? -20.761 2.881   1.960   1.00 0.00 ? 79  GLU A CG   3  
ATOM 3535  C CD   . GLU A 1 56  ? -21.254 2.501   3.363   1.00 0.00 ? 79  GLU A CD   3  
ATOM 3536  O OE1  . GLU A 1 56  ? -21.592 1.326   3.622   1.00 0.00 ? 79  GLU A OE1  3  
ATOM 3537  O OE2  . GLU A 1 56  ? -21.334 3.378   4.255   1.00 0.00 ? 79  GLU A OE2  3  
ATOM 3538  H H    . GLU A 1 56  ? -19.445 2.652   -0.516  1.00 0.00 ? 79  GLU A H    3  
ATOM 3539  H HA   . GLU A 1 56  ? -19.994 0.459   1.178   1.00 0.00 ? 79  GLU A HA   3  
ATOM 3540  H HB2  . GLU A 1 56  ? -21.703 2.715   0.033   1.00 0.00 ? 79  GLU A HB2  3  
ATOM 3541  H HB3  . GLU A 1 56  ? -22.343 1.611   1.223   1.00 0.00 ? 79  GLU A HB3  3  
ATOM 3542  H HG2  . GLU A 1 56  ? -19.666 2.815   1.910   1.00 0.00 ? 79  GLU A HG2  3  
ATOM 3543  H HG3  . GLU A 1 56  ? -21.037 3.905   1.744   1.00 0.00 ? 79  GLU A HG3  3  
ATOM 3544  N N    . ALA A 1 57  ? -21.336 0.111   -1.783  1.00 0.00 ? 80  ALA A N    3  
ATOM 3545  C CA   . ALA A 1 57  ? -22.063 -0.803  -2.633  1.00 0.00 ? 80  ALA A CA   3  
ATOM 3546  C C    . ALA A 1 57  ? -21.331 -2.130  -2.878  1.00 0.00 ? 80  ALA A C    3  
ATOM 3547  O O    . ALA A 1 57  ? -21.988 -3.169  -3.012  1.00 0.00 ? 80  ALA A O    3  
ATOM 3548  C CB   . ALA A 1 57  ? -22.451 -0.104  -3.951  1.00 0.00 ? 80  ALA A CB   3  
ATOM 3549  H H    . ALA A 1 57  ? -20.870 0.915   -2.184  1.00 0.00 ? 80  ALA A H    3  
ATOM 3550  H HA   . ALA A 1 57  ? -22.940 -1.038  -2.045  1.00 0.00 ? 80  ALA A HA   3  
ATOM 3551  H HB1  . ALA A 1 57  ? -23.189 -0.707  -4.481  1.00 0.00 ? 80  ALA A HB1  3  
ATOM 3552  H HB2  . ALA A 1 57  ? -22.873 0.885   -3.746  1.00 0.00 ? 80  ALA A HB2  3  
ATOM 3553  H HB3  . ALA A 1 57  ? -21.585 0.017   -4.610  1.00 0.00 ? 80  ALA A HB3  3  
ATOM 3554  N N    . ASN A 1 58  ? -19.996 -2.140  -2.931  1.00 0.00 ? 81  ASN A N    3  
ATOM 3555  C CA   . ASN A 1 58  ? -19.229 -3.304  -3.405  1.00 0.00 ? 81  ASN A CA   3  
ATOM 3556  C C    . ASN A 1 58  ? -17.815 -3.364  -2.833  1.00 0.00 ? 81  ASN A C    3  
ATOM 3557  O O    . ASN A 1 58  ? -16.892 -3.892  -3.444  1.00 0.00 ? 81  ASN A O    3  
ATOM 3558  C CB   . ASN A 1 58  ? -19.256 -3.415  -4.942  1.00 0.00 ? 81  ASN A CB   3  
ATOM 3559  C CG   . ASN A 1 58  ? -19.350 -2.094  -5.674  1.00 0.00 ? 81  ASN A CG   3  
ATOM 3560  O OD1  . ASN A 1 58  ? -20.387 -1.791  -6.254  1.00 0.00 ? 81  ASN A OD1  3  
ATOM 3561  N ND2  . ASN A 1 58  ? -18.311 -1.288  -5.621  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 3562  H H    . ASN A 1 58  ? -19.517 -1.250  -2.808  1.00 0.00 ? 81  ASN A H    3  
ATOM 3563  H HA   . ASN A 1 58  ? -19.726 -4.194  -3.026  1.00 0.00 ? 81  ASN A HA   3  
ATOM 3564  H HB2  . ASN A 1 58  ? -18.402 -3.961  -5.332  1.00 0.00 ? 81  ASN A HB2  3  
ATOM 3565  H HB3  . ASN A 1 58  ? -20.130 -4.003  -5.190  1.00 0.00 ? 81  ASN A HB3  3  
ATOM 3566  H HD21 . ASN A 1 58  ? -17.477 -1.528  -5.121  1.00 0.00 ? 81  ASN A HD21 3  
ATOM 3567  H HD22 . ASN A 1 58  ? -18.389 -0.400  -6.086  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 3568  N N    . TYR A 1 59  ? -17.634 -2.857  -1.623  1.00 0.00 ? 82  TYR A N    3  
ATOM 3569  C CA   . TYR A 1 59  ? -16.365 -2.817  -0.911  1.00 0.00 ? 82  TYR A CA   3  
ATOM 3570  C C    . TYR A 1 59  ? -15.680 -4.171  -0.753  1.00 0.00 ? 82  TYR A C    3  
ATOM 3571  O O    . TYR A 1 59  ? -14.457 -4.238  -0.718  1.00 0.00 ? 82  TYR A O    3  
ATOM 3572  C CB   . TYR A 1 59  ? -16.626 -2.235  0.476   1.00 0.00 ? 82  TYR A CB   3  
ATOM 3573  C CG   . TYR A 1 59  ? -17.731 -2.931  1.246   1.00 0.00 ? 82  TYR A CG   3  
ATOM 3574  C CD1  . TYR A 1 59  ? -17.418 -4.078  1.998   1.00 0.00 ? 82  TYR A CD1  3  
ATOM 3575  C CD2  . TYR A 1 59  ? -19.054 -2.437  1.224   1.00 0.00 ? 82  TYR A CD2  3  
ATOM 3576  C CE1  . TYR A 1 59  ? -18.414 -4.740  2.728   1.00 0.00 ? 82  TYR A CE1  3  
ATOM 3577  C CE2  . TYR A 1 59  ? -20.030 -3.041  2.034   1.00 0.00 ? 82  TYR A CE2  3  
ATOM 3578  C CZ   . TYR A 1 59  ? -19.718 -4.208  2.771   1.00 0.00 ? 82  TYR A CZ   3  
ATOM 3579  O OH   . TYR A 1 59  ? -20.672 -4.869  3.474   1.00 0.00 ? 82  TYR A OH   3  
ATOM 3580  H H    . TYR A 1 59  ? -18.391 -2.335  -1.201  1.00 0.00 ? 82  TYR A H    3  
ATOM 3581  H HA   . TYR A 1 59  ? -15.686 -2.176  -1.470  1.00 0.00 ? 82  TYR A HA   3  
ATOM 3582  H HB2  . TYR A 1 59  ? -15.703 -2.302  1.049   1.00 0.00 ? 82  TYR A HB2  3  
ATOM 3583  H HB3  . TYR A 1 59  ? -16.872 -1.181  0.391   1.00 0.00 ? 82  TYR A HB3  3  
ATOM 3584  H HD1  . TYR A 1 59  ? -16.407 -4.460  2.011   1.00 0.00 ? 82  TYR A HD1  3  
ATOM 3585  H HD2  . TYR A 1 59  ? -19.356 -1.597  0.598   1.00 0.00 ? 82  TYR A HD2  3  
ATOM 3586  H HE1  . TYR A 1 59  ? -18.178 -5.637  3.284   1.00 0.00 ? 82  TYR A HE1  3  
ATOM 3587  H HE2  . TYR A 1 59  ? -21.022 -2.611  2.061   1.00 0.00 ? 82  TYR A HE2  3  
ATOM 3588  H HH   . TYR A 1 59  ? -21.294 -4.257  3.924   1.00 0.00 ? 82  TYR A HH   3  
ATOM 3589  N N    . TRP A 1 60  ? -16.453 -5.253  -0.686  1.00 0.00 ? 83  TRP A N    3  
ATOM 3590  C CA   . TRP A 1 60  ? -15.946 -6.615  -0.605  1.00 0.00 ? 83  TRP A CA   3  
ATOM 3591  C C    . TRP A 1 60  ? -15.005 -6.947  -1.768  1.00 0.00 ? 83  TRP A C    3  
ATOM 3592  O O    . TRP A 1 60  ? -14.146 -7.813  -1.631  1.00 0.00 ? 83  TRP A O    3  
ATOM 3593  C CB   . TRP A 1 60  ? -17.137 -7.567  -0.498  1.00 0.00 ? 83  TRP A CB   3  
ATOM 3594  C CG   . TRP A 1 60  ? -18.216 -7.436  -1.535  1.00 0.00 ? 83  TRP A CG   3  
ATOM 3595  C CD1  . TRP A 1 60  ? -19.206 -6.517  -1.558  1.00 0.00 ? 83  TRP A CD1  3  
ATOM 3596  C CD2  . TRP A 1 60  ? -18.478 -8.313  -2.662  1.00 0.00 ? 83  TRP A CD2  3  
ATOM 3597  N NE1  . TRP A 1 60  ? -20.095 -6.803  -2.573  1.00 0.00 ? 83  TRP A NE1  3  
ATOM 3598  C CE2  . TRP A 1 60  ? -19.701 -7.922  -3.280  1.00 0.00 ? 83  TRP A CE2  3  
ATOM 3599  C CE3  . TRP A 1 60  ? -17.805 -9.422  -3.196  1.00 0.00 ? 83  TRP A CE3  3  
ATOM 3600  C CZ2  . TRP A 1 60  ? -20.261 -8.649  -4.342  1.00 0.00 ? 83  TRP A CZ2  3  
ATOM 3601  C CZ3  . TRP A 1 60  ? -18.359 -10.166 -4.256  1.00 0.00 ? 83  TRP A CZ3  3  
ATOM 3602  C CH2  . TRP A 1 60  ? -19.594 -9.791  -4.820  1.00 0.00 ? 83  TRP A CH2  3  
ATOM 3603  H H    . TRP A 1 60  ? -17.451 -5.134  -0.702  1.00 0.00 ? 83  TRP A H    3  
ATOM 3604  H HA   . TRP A 1 60  ? -15.365 -6.730  0.302   1.00 0.00 ? 83  TRP A HA   3  
ATOM 3605  H HB2  . TRP A 1 60  ? -16.760 -8.591  -0.514  1.00 0.00 ? 83  TRP A HB2  3  
ATOM 3606  H HB3  . TRP A 1 60  ? -17.595 -7.421  0.482   1.00 0.00 ? 83  TRP A HB3  3  
ATOM 3607  H HD1  . TRP A 1 60  ? -19.322 -5.720  -0.847  1.00 0.00 ? 83  TRP A HD1  3  
ATOM 3608  H HE1  . TRP A 1 60  ? -20.968 -6.297  -2.688  1.00 0.00 ? 83  TRP A HE1  3  
ATOM 3609  H HE3  . TRP A 1 60  ? -16.864 -9.697  -2.732  1.00 0.00 ? 83  TRP A HE3  3  
ATOM 3610  H HZ2  . TRP A 1 60  ? -21.214 -8.369  -4.761  1.00 0.00 ? 83  TRP A HZ2  3  
ATOM 3611  H HZ3  . TRP A 1 60  ? -17.845 -11.050 -4.610  1.00 0.00 ? 83  TRP A HZ3  3  
ATOM 3612  H HH2  . TRP A 1 60  ? -20.026 -10.379 -5.619  1.00 0.00 ? 83  TRP A HH2  3  
ATOM 3613  N N    . GLN A 1 61  ? -15.116 -6.217  -2.879  1.00 0.00 ? 84  GLN A N    3  
ATOM 3614  C CA   . GLN A 1 61  ? -14.314 -6.413  -4.073  1.00 0.00 ? 84  GLN A CA   3  
ATOM 3615  C C    . GLN A 1 61  ? -12.963 -5.688  -4.021  1.00 0.00 ? 84  GLN A C    3  
ATOM 3616  O O    . GLN A 1 61  ? -12.205 -5.787  -4.983  1.00 0.00 ? 84  GLN A O    3  
ATOM 3617  C CB   . GLN A 1 61  ? -15.116 -5.981  -5.309  1.00 0.00 ? 84  GLN A CB   3  
ATOM 3618  C CG   . GLN A 1 61  ? -16.550 -6.557  -5.338  1.00 0.00 ? 84  GLN A CG   3  
ATOM 3619  C CD   . GLN A 1 61  ? -16.961 -7.154  -6.684  1.00 0.00 ? 84  GLN A CD   3  
ATOM 3620  O OE1  . GLN A 1 61  ? -16.376 -6.910  -7.739  1.00 0.00 ? 84  GLN A OE1  3  
ATOM 3621  N NE2  . GLN A 1 61  ? -17.970 -8.004  -6.668  1.00 0.00 ? 84  GLN A NE2  3  
ATOM 3622  H H    . GLN A 1 61  ? -15.823 -5.492  -2.921  1.00 0.00 ? 84  GLN A H    3  
ATOM 3623  H HA   . GLN A 1 61  ? -14.109 -7.473  -4.173  1.00 0.00 ? 84  GLN A HA   3  
ATOM 3624  H HB2  . GLN A 1 61  ? -15.173 -4.892  -5.347  1.00 0.00 ? 84  GLN A HB2  3  
ATOM 3625  H HB3  . GLN A 1 61  ? -14.556 -6.315  -6.181  1.00 0.00 ? 84  GLN A HB3  3  
ATOM 3626  H HG2  . GLN A 1 61  ? -16.668 -7.325  -4.573  1.00 0.00 ? 84  GLN A HG2  3  
ATOM 3627  H HG3  . GLN A 1 61  ? -17.252 -5.766  -5.072  1.00 0.00 ? 84  GLN A HG3  3  
ATOM 3628  H HE21 . GLN A 1 61  ? -18.438 -8.214  -5.790  1.00 0.00 ? 84  GLN A HE21 3  
ATOM 3629  H HE22 . GLN A 1 61  ? -18.509 -8.112  -7.532  1.00 0.00 ? 84  GLN A HE22 3  
ATOM 3630  N N    . PHE A 1 62  ? -12.641 -4.957  -2.949  1.00 0.00 ? 85  PHE A N    3  
ATOM 3631  C CA   . PHE A 1 62  ? -11.501 -4.043  -2.920  1.00 0.00 ? 85  PHE A CA   3  
ATOM 3632  C C    . PHE A 1 62  ? -10.411 -4.534  -1.960  1.00 0.00 ? 85  PHE A C    3  
ATOM 3633  O O    . PHE A 1 62  ? -10.695 -5.305  -1.036  1.00 0.00 ? 85  PHE A O    3  
ATOM 3634  C CB   . PHE A 1 62  ? -11.993 -2.641  -2.538  1.00 0.00 ? 85  PHE A CB   3  
ATOM 3635  C CG   . PHE A 1 62  ? -12.714 -1.906  -3.650  1.00 0.00 ? 85  PHE A CG   3  
ATOM 3636  C CD1  . PHE A 1 62  ? -13.998 -2.315  -4.061  1.00 0.00 ? 85  PHE A CD1  3  
ATOM 3637  C CD2  . PHE A 1 62  ? -12.100 -0.806  -4.275  1.00 0.00 ? 85  PHE A CD2  3  
ATOM 3638  C CE1  . PHE A 1 62  ? -14.679 -1.596  -5.057  1.00 0.00 ? 85  PHE A CE1  3  
ATOM 3639  C CE2  . PHE A 1 62  ? -12.781 -0.094  -5.273  1.00 0.00 ? 85  PHE A CE2  3  
ATOM 3640  C CZ   . PHE A 1 62  ? -14.078 -0.470  -5.644  1.00 0.00 ? 85  PHE A CZ   3  
ATOM 3641  H H    . PHE A 1 62  ? -13.248 -4.945  -2.136  1.00 0.00 ? 85  PHE A H    3  
ATOM 3642  H HA   . PHE A 1 62  ? -11.074 -3.983  -3.921  1.00 0.00 ? 85  PHE A HA   3  
ATOM 3643  H HB2  . PHE A 1 62  ? -12.667 -2.719  -1.690  1.00 0.00 ? 85  PHE A HB2  3  
ATOM 3644  H HB3  . PHE A 1 62  ? -11.144 -2.039  -2.211  1.00 0.00 ? 85  PHE A HB3  3  
ATOM 3645  H HD1  . PHE A 1 62  ? -14.459 -3.189  -3.617  1.00 0.00 ? 85  PHE A HD1  3  
ATOM 3646  H HD2  . PHE A 1 62  ? -11.105 -0.498  -3.995  1.00 0.00 ? 85  PHE A HD2  3  
ATOM 3647  H HE1  . PHE A 1 62  ? -15.658 -1.925  -5.369  1.00 0.00 ? 85  PHE A HE1  3  
ATOM 3648  H HE2  . PHE A 1 62  ? -12.303 0.740   -5.763  1.00 0.00 ? 85  PHE A HE2  3  
ATOM 3649  H HZ   . PHE A 1 62  ? -14.601 0.118   -6.381  1.00 0.00 ? 85  PHE A HZ   3  
ATOM 3650  N N    . PRO A 1 63  ? -9.148  -4.106  -2.159  1.00 0.00 ? 86  PRO A N    3  
ATOM 3651  C CA   . PRO A 1 63  ? -8.039  -4.451  -1.281  1.00 0.00 ? 86  PRO A CA   3  
ATOM 3652  C C    . PRO A 1 63  ? -8.219  -3.823  0.106   1.00 0.00 ? 86  PRO A C    3  
ATOM 3653  O O    . PRO A 1 63  ? -9.201  -3.133  0.380   1.00 0.00 ? 86  PRO A O    3  
ATOM 3654  C CB   . PRO A 1 63  ? -6.771  -4.001  -2.007  1.00 0.00 ? 86  PRO A CB   3  
ATOM 3655  C CG   . PRO A 1 63  ? -7.258  -2.867  -2.894  1.00 0.00 ? 86  PRO A CG   3  
ATOM 3656  C CD   . PRO A 1 63  ? -8.669  -3.305  -3.273  1.00 0.00 ? 86  PRO A CD   3  
ATOM 3657  H HA   . PRO A 1 63  ? -7.988  -5.529  -1.182  1.00 0.00 ? 86  PRO A HA   3  
ATOM 3658  H HB2  . PRO A 1 63  ? -5.973  -3.690  -1.336  1.00 0.00 ? 86  PRO A HB2  3  
ATOM 3659  H HB3  . PRO A 1 63  ? -6.420  -4.819  -2.628  1.00 0.00 ? 86  PRO A HB3  3  
ATOM 3660  H HG2  . PRO A 1 63  ? -7.300  -1.953  -2.313  1.00 0.00 ? 86  PRO A HG2  3  
ATOM 3661  H HG3  . PRO A 1 63  ? -6.623  -2.723  -3.762  1.00 0.00 ? 86  PRO A HG3  3  
ATOM 3662  H HD2  . PRO A 1 63  ? -9.295  -2.429  -3.440  1.00 0.00 ? 86  PRO A HD2  3  
ATOM 3663  H HD3  . PRO A 1 63  ? -8.641  -3.930  -4.167  1.00 0.00 ? 86  PRO A HD3  3  
ATOM 3664  N N    . ASP A 1 64  ? -7.262  -4.084  0.993   1.00 0.00 ? 87  ASP A N    3  
ATOM 3665  C CA   . ASP A 1 64  ? -7.287  -3.626  2.385   1.00 0.00 ? 87  ASP A CA   3  
ATOM 3666  C C    . ASP A 1 64  ? -5.912  -3.083  2.770   1.00 0.00 ? 87  ASP A C    3  
ATOM 3667  O O    . ASP A 1 64  ? -5.780  -1.977  3.293   1.00 0.00 ? 87  ASP A O    3  
ATOM 3668  C CB   . ASP A 1 64  ? -7.697  -4.790  3.295   1.00 0.00 ? 87  ASP A CB   3  
ATOM 3669  C CG   . ASP A 1 64  ? -7.616  -4.383  4.762   1.00 0.00 ? 87  ASP A CG   3  
ATOM 3670  O OD1  . ASP A 1 64  ? -8.108  -3.295  5.111   1.00 0.00 ? 87  ASP A OD1  3  
ATOM 3671  O OD2  . ASP A 1 64  ? -7.130  -5.183  5.587   1.00 0.00 ? 87  ASP A OD2  3  
ATOM 3672  H H    . ASP A 1 64  ? -6.423  -4.540  0.669   1.00 0.00 ? 87  ASP A H    3  
ATOM 3673  H HA   . ASP A 1 64  ? -8.018  -2.823  2.507   1.00 0.00 ? 87  ASP A HA   3  
ATOM 3674  H HB2  . ASP A 1 64  ? -8.721  -5.093  3.067   1.00 0.00 ? 87  ASP A HB2  3  
ATOM 3675  H HB3  . ASP A 1 64  ? -7.044  -5.646  3.117   1.00 0.00 ? 87  ASP A HB3  3  
ATOM 3676  N N    . GLY A 1 65  ? -4.877  -3.832  2.398   1.00 0.00 ? 88  GLY A N    3  
ATOM 3677  C CA   . GLY A 1 65  ? -3.510  -3.378  2.312   1.00 0.00 ? 88  GLY A CA   3  
ATOM 3678  C C    . GLY A 1 65  ? -2.840  -4.030  1.111   1.00 0.00 ? 88  GLY A C    3  
ATOM 3679  O O    . GLY A 1 65  ? -3.483  -4.777  0.358   1.00 0.00 ? 88  GLY A O    3  
ATOM 3680  H H    . GLY A 1 65  ? -5.029  -4.745  2.003   1.00 0.00 ? 88  GLY A H    3  
ATOM 3681  H HA2  . GLY A 1 65  ? -3.494  -2.295  2.200   1.00 0.00 ? 88  GLY A HA2  3  
ATOM 3682  H HA3  . GLY A 1 65  ? -2.978  -3.660  3.219   1.00 0.00 ? 88  GLY A HA3  3  
ATOM 3683  N N    . ILE A 1 66  ? -1.550  -3.744  0.950   1.00 0.00 ? 89  ILE A N    3  
ATOM 3684  C CA   . ILE A 1 66  ? -0.692  -4.244  -0.117  1.00 0.00 ? 89  ILE A CA   3  
ATOM 3685  C C    . ILE A 1 66  ? 0.549   -4.856  0.533   1.00 0.00 ? 89  ILE A C    3  
ATOM 3686  O O    . ILE A 1 66  ? 1.016   -4.385  1.572   1.00 0.00 ? 89  ILE A O    3  
ATOM 3687  C CB   . ILE A 1 66  ? -0.331  -3.103  -1.098  1.00 0.00 ? 89  ILE A CB   3  
ATOM 3688  C CG1  . ILE A 1 66  ? -1.555  -2.337  -1.637  1.00 0.00 ? 89  ILE A CG1  3  
ATOM 3689  C CG2  . ILE A 1 66  ? 0.471   -3.650  -2.283  1.00 0.00 ? 89  ILE A CG2  3  
ATOM 3690  C CD1  . ILE A 1 66  ? -2.477  -3.146  -2.556  1.00 0.00 ? 89  ILE A CD1  3  
ATOM 3691  H H    . ILE A 1 66  ? -1.106  -3.156  1.649   1.00 0.00 ? 89  ILE A H    3  
ATOM 3692  H HA   . ILE A 1 66  ? -1.203  -5.022  -0.686  1.00 0.00 ? 89  ILE A HA   3  
ATOM 3693  H HB   . ILE A 1 66  ? 0.293   -2.377  -0.575  1.00 0.00 ? 89  ILE A HB   3  
ATOM 3694  H HG12 . ILE A 1 66  ? -2.140  -1.974  -0.800  1.00 0.00 ? 89  ILE A HG12 3  
ATOM 3695  H HG13 . ILE A 1 66  ? -1.196  -1.465  -2.182  1.00 0.00 ? 89  ILE A HG13 3  
ATOM 3696  H HG21 . ILE A 1 66  ? 1.461   -3.963  -1.966  1.00 0.00 ? 89  ILE A HG21 3  
ATOM 3697  H HG22 . ILE A 1 66  ? -0.048  -4.512  -2.706  1.00 0.00 ? 89  ILE A HG22 3  
ATOM 3698  H HG23 . ILE A 1 66  ? 0.595   -2.878  -3.042  1.00 0.00 ? 89  ILE A HG23 3  
ATOM 3699  H HD11 . ILE A 1 66  ? -2.726  -4.105  -2.104  1.00 0.00 ? 89  ILE A HD11 3  
ATOM 3700  H HD12 . ILE A 1 66  ? -3.401  -2.594  -2.729  1.00 0.00 ? 89  ILE A HD12 3  
ATOM 3701  H HD13 . ILE A 1 66  ? -1.984  -3.309  -3.515  1.00 0.00 ? 89  ILE A HD13 3  
ATOM 3702  N N    . HIS A 1 67  ? 1.104   -5.873  -0.120  1.00 0.00 ? 90  HIS A N    3  
ATOM 3703  C CA   . HIS A 1 67  ? 2.323   -6.580  0.263   1.00 0.00 ? 90  HIS A CA   3  
ATOM 3704  C C    . HIS A 1 67  ? 3.585   -5.864  -0.245  1.00 0.00 ? 90  HIS A C    3  
ATOM 3705  O O    . HIS A 1 67  ? 4.589   -6.517  -0.527  1.00 0.00 ? 90  HIS A O    3  
ATOM 3706  C CB   . HIS A 1 67  ? 2.251   -8.002  -0.311  1.00 0.00 ? 90  HIS A CB   3  
ATOM 3707  C CG   . HIS A 1 67  ? 1.027   -8.773  0.096   1.00 0.00 ? 90  HIS A CG   3  
ATOM 3708  N ND1  . HIS A 1 67  ? -0.232  -8.630  -0.438  1.00 0.00 ? 90  HIS A ND1  3  
ATOM 3709  C CD2  . HIS A 1 67  ? 0.987   -9.799  0.997   1.00 0.00 ? 90  HIS A CD2  3  
ATOM 3710  C CE1  . HIS A 1 67  ? -1.012  -9.564  0.119   1.00 0.00 ? 90  HIS A CE1  3  
ATOM 3711  N NE2  . HIS A 1 67  ? -0.331  -10.263 1.046   1.00 0.00 ? 90  HIS A NE2  3  
ATOM 3712  H H    . HIS A 1 67  ? 0.636   -6.205  -0.950  1.00 0.00 ? 90  HIS A H    3  
ATOM 3713  H HA   . HIS A 1 67  ? 2.373   -6.639  1.351   1.00 0.00 ? 90  HIS A HA   3  
ATOM 3714  H HB2  . HIS A 1 67  ? 2.264   -7.940  -1.397  1.00 0.00 ? 90  HIS A HB2  3  
ATOM 3715  H HB3  . HIS A 1 67  ? 3.130   -8.563  0.008   1.00 0.00 ? 90  HIS A HB3  3  
ATOM 3716  H HD1  . HIS A 1 67  ? -0.517  -8.007  -1.186  1.00 0.00 ? 90  HIS A HD1  3  
ATOM 3717  H HD2  . HIS A 1 67  ? 1.831   -10.183 1.549   1.00 0.00 ? 90  HIS A HD2  3  
ATOM 3718  H HE1  . HIS A 1 67  ? -2.048  -9.694  -0.148  1.00 0.00 ? 90  HIS A HE1  3  
ATOM 3719  N N    . TYR A 1 68  ? 3.529   -4.558  -0.503  1.00 0.00 ? 91  TYR A N    3  
ATOM 3720  C CA   . TYR A 1 68  ? 4.659   -3.777  -1.000  1.00 0.00 ? 91  TYR A CA   3  
ATOM 3721  C C    . TYR A 1 68  ? 5.240   -2.994  0.179   1.00 0.00 ? 91  TYR A C    3  
ATOM 3722  O O    . TYR A 1 68  ? 4.637   -2.962  1.255   1.00 0.00 ? 91  TYR A O    3  
ATOM 3723  C CB   . TYR A 1 68  ? 4.168   -2.856  -2.122  1.00 0.00 ? 91  TYR A CB   3  
ATOM 3724  C CG   . TYR A 1 68  ? 5.237   -2.379  -3.081  1.00 0.00 ? 91  TYR A CG   3  
ATOM 3725  C CD1  . TYR A 1 68  ? 5.605   -3.187  -4.172  1.00 0.00 ? 91  TYR A CD1  3  
ATOM 3726  C CD2  . TYR A 1 68  ? 5.840   -1.123  -2.903  1.00 0.00 ? 91  TYR A CD2  3  
ATOM 3727  C CE1  . TYR A 1 68  ? 6.581   -2.747  -5.082  1.00 0.00 ? 91  TYR A CE1  3  
ATOM 3728  C CE2  . TYR A 1 68  ? 6.829   -0.678  -3.798  1.00 0.00 ? 91  TYR A CE2  3  
ATOM 3729  C CZ   . TYR A 1 68  ? 7.201   -1.493  -4.892  1.00 0.00 ? 91  TYR A CZ   3  
ATOM 3730  O OH   . TYR A 1 68  ? 8.132   -1.080  -5.791  1.00 0.00 ? 91  TYR A OH   3  
ATOM 3731  H H    . TYR A 1 68  ? 2.762   -4.027  -0.107  1.00 0.00 ? 91  TYR A H    3  
ATOM 3732  H HA   . TYR A 1 68  ? 5.424   -4.438  -1.411  1.00 0.00 ? 91  TYR A HA   3  
ATOM 3733  H HB2  . TYR A 1 68  ? 3.445   -3.397  -2.727  1.00 0.00 ? 91  TYR A HB2  3  
ATOM 3734  H HB3  . TYR A 1 68  ? 3.660   -1.999  -1.676  1.00 0.00 ? 91  TYR A HB3  3  
ATOM 3735  H HD1  . TYR A 1 68  ? 5.140   -4.149  -4.307  1.00 0.00 ? 91  TYR A HD1  3  
ATOM 3736  H HD2  . TYR A 1 68  ? 5.535   -0.504  -2.072  1.00 0.00 ? 91  TYR A HD2  3  
ATOM 3737  H HE1  . TYR A 1 68  ? 6.875   -3.367  -5.915  1.00 0.00 ? 91  TYR A HE1  3  
ATOM 3738  H HE2  . TYR A 1 68  ? 7.304   0.280   -3.638  1.00 0.00 ? 91  TYR A HE2  3  
ATOM 3739  H HH   . TYR A 1 68  ? 8.685   -0.346  -5.462  1.00 0.00 ? 91  TYR A HH   3  
ATOM 3740  N N    . ASN A 1 69  ? 6.383   -2.341  -0.001  1.00 0.00 ? 92  ASN A N    3  
ATOM 3741  C CA   . ASN A 1 69  ? 6.965   -1.457  1.005   1.00 0.00 ? 92  ASN A CA   3  
ATOM 3742  C C    . ASN A 1 69  ? 8.039   -0.585  0.373   1.00 0.00 ? 92  ASN A C    3  
ATOM 3743  O O    . ASN A 1 69  ? 8.532   -0.881  -0.717  1.00 0.00 ? 92  ASN A O    3  
ATOM 3744  C CB   . ASN A 1 69  ? 7.557   -2.243  2.189   1.00 0.00 ? 92  ASN A CB   3  
ATOM 3745  C CG   . ASN A 1 69  ? 8.264   -3.531  1.771   1.00 0.00 ? 92  ASN A CG   3  
ATOM 3746  O OD1  . ASN A 1 69  ? 9.136   -3.555  0.903   1.00 0.00 ? 92  ASN A OD1  3  
ATOM 3747  N ND2  . ASN A 1 69  ? 7.848   -4.663  2.322   1.00 0.00 ? 92  ASN A ND2  3  
ATOM 3748  H H    . ASN A 1 69  ? 6.891   -2.403  -0.881  1.00 0.00 ? 92  ASN A H    3  
ATOM 3749  H HA   . ASN A 1 69  ? 6.181   -0.803  1.384   1.00 0.00 ? 92  ASN A HA   3  
ATOM 3750  H HB2  . ASN A 1 69  ? 8.246   -1.583  2.726   1.00 0.00 ? 92  ASN A HB2  3  
ATOM 3751  H HB3  . ASN A 1 69  ? 6.749   -2.487  2.881   1.00 0.00 ? 92  ASN A HB3  3  
ATOM 3752  H HD21 . ASN A 1 69  ? 7.092   -4.646  2.994   1.00 0.00 ? 92  ASN A HD21 3  
ATOM 3753  H HD22 . ASN A 1 69  ? 8.287   -5.541  2.086   1.00 0.00 ? 92  ASN A HD22 3  
ATOM 3754  N N    . GLY A 1 70  ? 8.380   0.506   1.058   1.00 0.00 ? 93  GLY A N    3  
ATOM 3755  C CA   . GLY A 1 70  ? 9.369   1.481   0.637   1.00 0.00 ? 93  GLY A CA   3  
ATOM 3756  C C    . GLY A 1 70  ? 10.441  1.523   1.700   1.00 0.00 ? 93  GLY A C    3  
ATOM 3757  O O    . GLY A 1 70  ? 11.291  0.629   1.741   1.00 0.00 ? 93  GLY A O    3  
ATOM 3758  H H    . GLY A 1 70  ? 7.974   0.634   1.982   1.00 0.00 ? 93  GLY A H    3  
ATOM 3759  H HA2  . GLY A 1 70  ? 9.825   1.190   -0.305  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 3760  H HA3  . GLY A 1 70  ? 8.908   2.462   0.526   1.00 0.00 ? 93  GLY A HA3  3  
ATOM 3761  N N    . CYS A 1 71  ? 10.331  2.492   2.612   1.00 0.00 ? 94  CYS A N    3  
ATOM 3762  C CA   . CYS A 1 71  ? 11.181  2.625   3.788   1.00 0.00 ? 94  CYS A CA   3  
ATOM 3763  C C    . CYS A 1 71  ? 12.679  2.729   3.452   1.00 0.00 ? 94  CYS A C    3  
ATOM 3764  O O    . CYS A 1 71  ? 13.516  2.384   4.287   1.00 0.00 ? 94  CYS A O    3  
ATOM 3765  C CB   . CYS A 1 71  ? 10.847  1.486   4.778   1.00 0.00 ? 94  CYS A CB   3  
ATOM 3766  S SG   . CYS A 1 71  ? 10.139  1.865   6.415   1.00 0.00 ? 94  CYS A SG   3  
ATOM 3767  H H    . CYS A 1 71  ? 9.594   3.179   2.513   1.00 0.00 ? 94  CYS A H    3  
ATOM 3768  H HA   . CYS A 1 71  ? 10.927  3.571   4.243   1.00 0.00 ? 94  CYS A HA   3  
ATOM 3769  H HB2  . CYS A 1 71  ? 10.145  0.804   4.303   1.00 0.00 ? 94  CYS A HB2  3  
ATOM 3770  H HB3  . CYS A 1 71  ? 11.742  0.886   4.918   1.00 0.00 ? 94  CYS A HB3  3  
ATOM 3771  N N    . SER A 1 72  ? 13.046  3.179   2.245   1.00 0.00 ? 95  SER A N    3  
ATOM 3772  C CA   . SER A 1 72  ? 14.418  3.052   1.756   1.00 0.00 ? 95  SER A CA   3  
ATOM 3773  C C    . SER A 1 72  ? 14.957  4.319   1.077   1.00 0.00 ? 95  SER A C    3  
ATOM 3774  O O    . SER A 1 72  ? 15.991  4.276   0.404   1.00 0.00 ? 95  SER A O    3  
ATOM 3775  C CB   . SER A 1 72  ? 14.506  1.794   0.884   1.00 0.00 ? 95  SER A CB   3  
ATOM 3776  O OG   . SER A 1 72  ? 15.738  1.146   1.113   1.00 0.00 ? 95  SER A OG   3  
ATOM 3777  H H    . SER A 1 72  ? 12.326  3.440   1.584   1.00 0.00 ? 95  SER A H    3  
ATOM 3778  H HA   . SER A 1 72  ? 15.064  2.897   2.619   1.00 0.00 ? 95  SER A HA   3  
ATOM 3779  H HB2  . SER A 1 72  ? 13.713  1.093   1.147   1.00 0.00 ? 95  SER A HB2  3  
ATOM 3780  H HB3  . SER A 1 72  ? 14.408  2.062   -0.168  1.00 0.00 ? 95  SER A HB3  3  
ATOM 3781  H HG   . SER A 1 72  ? 15.723  0.332   0.560   1.00 0.00 ? 95  SER A HG   3  
ATOM 3782  N N    . GLU A 1 73  ? 14.291  5.454   1.269   1.00 0.00 ? 96  GLU A N    3  
ATOM 3783  C CA   . GLU A 1 73  ? 14.873  6.790   1.213   1.00 0.00 ? 96  GLU A CA   3  
ATOM 3784  C C    . GLU A 1 73  ? 14.381  7.526   2.449   1.00 0.00 ? 96  GLU A C    3  
ATOM 3785  O O    . GLU A 1 73  ? 13.626  6.967   3.246   1.00 0.00 ? 96  GLU A O    3  
ATOM 3786  C CB   . GLU A 1 73  ? 14.519  7.512   -0.105  1.00 0.00 ? 96  GLU A CB   3  
ATOM 3787  C CG   . GLU A 1 73  ? 15.569  7.201   -1.173  1.00 0.00 ? 96  GLU A CG   3  
ATOM 3788  C CD   . GLU A 1 73  ? 15.434  8.075   -2.416  1.00 0.00 ? 96  GLU A CD   3  
ATOM 3789  O OE1  . GLU A 1 73  ? 14.479  7.870   -3.195  1.00 0.00 ? 96  GLU A OE1  3  
ATOM 3790  O OE2  . GLU A 1 73  ? 16.358  8.873   -2.700  1.00 0.00 ? 96  GLU A OE2  3  
ATOM 3791  H H    . GLU A 1 73  ? 13.489  5.431   1.889   1.00 0.00 ? 96  GLU A H    3  
ATOM 3792  H HA   . GLU A 1 73  ? 15.952  6.740   1.333   1.00 0.00 ? 96  GLU A HA   3  
ATOM 3793  H HB2  . GLU A 1 73  ? 13.534  7.202   -0.454  1.00 0.00 ? 96  GLU A HB2  3  
ATOM 3794  H HB3  . GLU A 1 73  ? 14.498  8.591   0.044   1.00 0.00 ? 96  GLU A HB3  3  
ATOM 3795  H HG2  . GLU A 1 73  ? 16.564  7.348   -0.752  1.00 0.00 ? 96  GLU A HG2  3  
ATOM 3796  H HG3  . GLU A 1 73  ? 15.467  6.159   -1.468  1.00 0.00 ? 96  GLU A HG3  3  
ATOM 3797  N N    . ALA A 1 74  ? 14.836  8.757   2.636   1.00 0.00 ? 97  ALA A N    3  
ATOM 3798  C CA   . ALA A 1 74  ? 14.354  9.669   3.660   1.00 0.00 ? 97  ALA A CA   3  
ATOM 3799  C C    . ALA A 1 74  ? 13.785  10.941  3.022   1.00 0.00 ? 97  ALA A C    3  
ATOM 3800  O O    . ALA A 1 74  ? 13.261  11.800  3.735   1.00 0.00 ? 97  ALA A O    3  
ATOM 3801  C CB   . ALA A 1 74  ? 15.514  9.971   4.601   1.00 0.00 ? 97  ALA A CB   3  
ATOM 3802  H H    . ALA A 1 74  ? 15.563  9.118   2.019   1.00 0.00 ? 97  ALA A H    3  
ATOM 3803  H HA   . ALA A 1 74  ? 13.559  9.197   4.241   1.00 0.00 ? 97  ALA A HA   3  
ATOM 3804  H HB1  . ALA A 1 74  ? 16.289  10.487  4.039   1.00 0.00 ? 97  ALA A HB1  3  
ATOM 3805  H HB2  . ALA A 1 74  ? 15.171  10.598  5.422   1.00 0.00 ? 97  ALA A HB2  3  
ATOM 3806  H HB3  . ALA A 1 74  ? 15.913  9.033   4.992   1.00 0.00 ? 97  ALA A HB3  3  
ATOM 3807  N N    . ASN A 1 75  ? 13.862  11.052  1.690   1.00 0.00 ? 98  ASN A N    3  
ATOM 3808  C CA   . ASN A 1 75  ? 13.337  12.139  0.881   1.00 0.00 ? 98  ASN A CA   3  
ATOM 3809  C C    . ASN A 1 75  ? 12.628  11.517  -0.323  1.00 0.00 ? 98  ASN A C    3  
ATOM 3810  O O    . ASN A 1 75  ? 13.194  11.425  -1.413  1.00 0.00 ? 98  ASN A O    3  
ATOM 3811  C CB   . ASN A 1 75  ? 14.452  13.117  0.473   1.00 0.00 ? 98  ASN A CB   3  
ATOM 3812  C CG   . ASN A 1 75  ? 14.999  13.896  1.662   1.00 0.00 ? 98  ASN A CG   3  
ATOM 3813  O OD1  . ASN A 1 75  ? 15.976  13.488  2.288   1.00 0.00 ? 98  ASN A OD1  3  
ATOM 3814  N ND2  . ASN A 1 75  ? 14.373  14.997  2.039   1.00 0.00 ? 98  ASN A ND2  3  
ATOM 3815  H H    . ASN A 1 75  ? 14.354  10.327  1.185   1.00 0.00 ? 98  ASN A H    3  
ATOM 3816  H HA   . ASN A 1 75  ? 12.615  12.701  1.461   1.00 0.00 ? 98  ASN A HA   3  
ATOM 3817  H HB2  . ASN A 1 75  ? 15.266  12.569  -0.004  1.00 0.00 ? 98  ASN A HB2  3  
ATOM 3818  H HB3  . ASN A 1 75  ? 14.050  13.820  -0.257  1.00 0.00 ? 98  ASN A HB3  3  
ATOM 3819  H HD21 . ASN A 1 75  ? 13.545  15.359  1.563   1.00 0.00 ? 98  ASN A HD21 3  
ATOM 3820  H HD22 . ASN A 1 75  ? 14.769  15.568  2.769   1.00 0.00 ? 98  ASN A HD22 3  
ATOM 3821  N N    . VAL A 1 76  ? 11.387  11.056  -0.138  1.00 0.00 ? 99  VAL A N    3  
ATOM 3822  C CA   . VAL A 1 76  ? 10.572  10.488  -1.209  1.00 0.00 ? 99  VAL A CA   3  
ATOM 3823  C C    . VAL A 1 76  ? 9.157   11.024  -1.082  1.00 0.00 ? 99  VAL A C    3  
ATOM 3824  O O    . VAL A 1 76  ? 8.766   11.490  -0.017  1.00 0.00 ? 99  VAL A O    3  
ATOM 3825  C CB   . VAL A 1 76  ? 10.671  8.959   -1.145  1.00 0.00 ? 99  VAL A CB   3  
ATOM 3826  C CG1  . VAL A 1 76  ? 9.881   8.409   0.043   1.00 0.00 ? 99  VAL A CG1  3  
ATOM 3827  C CG2  . VAL A 1 76  ? 10.280  8.224   -2.417  1.00 0.00 ? 99  VAL A CG2  3  
ATOM 3828  H H    . VAL A 1 76  ? 10.886  11.165  0.739   1.00 0.00 ? 99  VAL A H    3  
ATOM 3829  H HA   . VAL A 1 76  ? 10.959  10.814  -2.164  1.00 0.00 ? 99  VAL A HA   3  
ATOM 3830  H HB   . VAL A 1 76  ? 11.717  8.736   -1.020  1.00 0.00 ? 99  VAL A HB   3  
ATOM 3831  H HG11 . VAL A 1 76  ? 10.084  9.024   0.918   1.00 0.00 ? 99  VAL A HG11 3  
ATOM 3832  H HG12 . VAL A 1 76  ? 8.811   8.441   -0.162  1.00 0.00 ? 99  VAL A HG12 3  
ATOM 3833  H HG13 . VAL A 1 76  ? 10.177  7.377   0.233   1.00 0.00 ? 99  VAL A HG13 3  
ATOM 3834  H HG21 . VAL A 1 76  ? 10.784  8.681   -3.265  1.00 0.00 ? 99  VAL A HG21 3  
ATOM 3835  H HG22 . VAL A 1 76  ? 10.634  7.195   -2.341  1.00 0.00 ? 99  VAL A HG22 3  
ATOM 3836  H HG23 . VAL A 1 76  ? 9.203   8.230   -2.554  1.00 0.00 ? 99  VAL A HG23 3  
ATOM 3837  N N    . THR A 1 77  ? 8.382   10.924  -2.147  1.00 0.00 ? 100 THR A N    3  
ATOM 3838  C CA   . THR A 1 77  ? 6.988   11.348  -2.169  1.00 0.00 ? 100 THR A CA   3  
ATOM 3839  C C    . THR A 1 77  ? 6.128   10.127  -2.464  1.00 0.00 ? 100 THR A C    3  
ATOM 3840  O O    . THR A 1 77  ? 6.630   9.124   -2.979  1.00 0.00 ? 100 THR A O    3  
ATOM 3841  C CB   . THR A 1 77  ? 6.793   12.473  -3.205  1.00 0.00 ? 100 THR A CB   3  
ATOM 3842  O OG1  . THR A 1 77  ? 7.331   12.153  -4.477  1.00 0.00 ? 100 THR A OG1  3  
ATOM 3843  C CG2  . THR A 1 77  ? 7.443   13.776  -2.753  1.00 0.00 ? 100 THR A CG2  3  
ATOM 3844  H H    . THR A 1 77  ? 8.729   10.364  -2.912  1.00 0.00 ? 100 THR A H    3  
ATOM 3845  H HA   . THR A 1 77  ? 6.697   11.728  -1.187  1.00 0.00 ? 100 THR A HA   3  
ATOM 3846  H HB   . THR A 1 77  ? 5.725   12.650  -3.324  1.00 0.00 ? 100 THR A HB   3  
ATOM 3847  H HG1  . THR A 1 77  ? 7.014   12.855  -5.084  1.00 0.00 ? 100 THR A HG1  3  
ATOM 3848  H HG21 . THR A 1 77  ? 8.520   13.652  -2.644  1.00 0.00 ? 100 THR A HG21 3  
ATOM 3849  H HG22 . THR A 1 77  ? 7.243   14.548  -3.493  1.00 0.00 ? 100 THR A HG22 3  
ATOM 3850  H HG23 . THR A 1 77  ? 7.017   14.085  -1.800  1.00 0.00 ? 100 THR A HG23 3  
ATOM 3851  N N    . LYS A 1 78  ? 4.816   10.199  -2.225  1.00 0.00 ? 101 LYS A N    3  
ATOM 3852  C CA   . LYS A 1 78  ? 3.926   9.126   -2.671  1.00 0.00 ? 101 LYS A CA   3  
ATOM 3853  C C    . LYS A 1 78  ? 4.027   8.946   -4.183  1.00 0.00 ? 101 LYS A C    3  
ATOM 3854  O O    . LYS A 1 78  ? 4.002   7.825   -4.679  1.00 0.00 ? 101 LYS A O    3  
ATOM 3855  C CB   . LYS A 1 78  ? 2.476   9.399   -2.242  1.00 0.00 ? 101 LYS A CB   3  
ATOM 3856  C CG   . LYS A 1 78  ? 2.323   9.208   -0.728  1.00 0.00 ? 101 LYS A CG   3  
ATOM 3857  C CD   . LYS A 1 78  ? 0.979   9.683   -0.169  1.00 0.00 ? 101 LYS A CD   3  
ATOM 3858  C CE   . LYS A 1 78  ? -0.246  8.928   -0.710  1.00 0.00 ? 101 LYS A CE   3  
ATOM 3859  N NZ   . LYS A 1 78  ? -1.088  9.772   -1.583  1.00 0.00 ? 101 LYS A NZ   3  
ATOM 3860  H H    . LYS A 1 78  ? 4.415   11.006  -1.764  1.00 0.00 ? 101 LYS A H    3  
ATOM 3861  H HA   . LYS A 1 78  ? 4.269   8.203   -2.206  1.00 0.00 ? 101 LYS A HA   3  
ATOM 3862  H HB2  . LYS A 1 78  ? 2.196   10.415  -2.522  1.00 0.00 ? 101 LYS A HB2  3  
ATOM 3863  H HB3  . LYS A 1 78  ? 1.815   8.699   -2.755  1.00 0.00 ? 101 LYS A HB3  3  
ATOM 3864  H HG2  . LYS A 1 78  ? 2.465   8.159   -0.480  1.00 0.00 ? 101 LYS A HG2  3  
ATOM 3865  H HG3  . LYS A 1 78  ? 3.107   9.766   -0.222  1.00 0.00 ? 101 LYS A HG3  3  
ATOM 3866  H HD2  . LYS A 1 78  ? 1.005   9.542   0.914   1.00 0.00 ? 101 LYS A HD2  3  
ATOM 3867  H HD3  . LYS A 1 78  ? 0.882   10.750  -0.361  1.00 0.00 ? 101 LYS A HD3  3  
ATOM 3868  H HE2  . LYS A 1 78  ? 0.065   8.025   -1.239  1.00 0.00 ? 101 LYS A HE2  3  
ATOM 3869  H HE3  . LYS A 1 78  ? -0.841  8.619   0.150   1.00 0.00 ? 101 LYS A HE3  3  
ATOM 3870  H HZ1  . LYS A 1 78  ? -0.703  9.876   -2.518  1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 3871  H HZ2  . LYS A 1 78  ? -2.044  9.441   -1.671  1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 3872  H HZ3  . LYS A 1 78  ? -1.176  10.713  -1.215  1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 3873  N N    . GLU A 1 79  ? 4.252   10.027  -4.919  1.00 0.00 ? 102 GLU A N    3  
ATOM 3874  C CA   . GLU A 1 79  ? 4.323   9.983   -6.365  1.00 0.00 ? 102 GLU A CA   3  
ATOM 3875  C C    . GLU A 1 79  ? 5.639   9.399   -6.879  1.00 0.00 ? 102 GLU A C    3  
ATOM 3876  O O    . GLU A 1 79  ? 5.791   9.196   -8.086  1.00 0.00 ? 102 GLU A O    3  
ATOM 3877  C CB   . GLU A 1 79  ? 4.134   11.411  -6.887  1.00 0.00 ? 102 GLU A CB   3  
ATOM 3878  C CG   . GLU A 1 79  ? 2.695   11.643  -7.357  1.00 0.00 ? 102 GLU A CG   3  
ATOM 3879  C CD   . GLU A 1 79  ? 1.687   11.449  -6.228  1.00 0.00 ? 102 GLU A CD   3  
ATOM 3880  O OE1  . GLU A 1 79  ? 1.515   12.400  -5.434  1.00 0.00 ? 102 GLU A OE1  3  
ATOM 3881  O OE2  . GLU A 1 79  ? 1.077   10.364  -6.114  1.00 0.00 ? 102 GLU A OE2  3  
ATOM 3882  H H    . GLU A 1 79  ? 4.400   10.916  -4.473  1.00 0.00 ? 102 GLU A H    3  
ATOM 3883  H HA   . GLU A 1 79  ? 3.523   9.315   -6.694  1.00 0.00 ? 102 GLU A HA   3  
ATOM 3884  H HB2  . GLU A 1 79  ? 4.437   12.130  -6.121  1.00 0.00 ? 102 GLU A HB2  3  
ATOM 3885  H HB3  . GLU A 1 79  ? 4.807   11.591  -7.721  1.00 0.00 ? 102 GLU A HB3  3  
ATOM 3886  H HG2  . GLU A 1 79  ? 2.615   12.662  -7.737  1.00 0.00 ? 102 GLU A HG2  3  
ATOM 3887  H HG3  . GLU A 1 79  ? 2.471   10.942  -8.163  1.00 0.00 ? 102 GLU A HG3  3  
ATOM 3888  N N    . ALA A 1 80  ? 6.580   9.130   -5.978  1.00 0.00 ? 103 ALA A N    3  
ATOM 3889  C CA   . ALA A 1 80  ? 7.814   8.417   -6.232  1.00 0.00 ? 103 ALA A CA   3  
ATOM 3890  C C    . ALA A 1 80  ? 7.628   6.983   -5.723  1.00 0.00 ? 103 ALA A C    3  
ATOM 3891  O O    . ALA A 1 80  ? 7.598   6.038   -6.513  1.00 0.00 ? 103 ALA A O    3  
ATOM 3892  C CB   . ALA A 1 80  ? 8.946   9.193   -5.539  1.00 0.00 ? 103 ALA A CB   3  
ATOM 3893  H H    . ALA A 1 80  ? 6.373   9.326   -5.007  1.00 0.00 ? 103 ALA A H    3  
ATOM 3894  H HA   . ALA A 1 80  ? 8.020   8.378   -7.305  1.00 0.00 ? 103 ALA A HA   3  
ATOM 3895  H HB1  . ALA A 1 80  ? 9.011   10.184  -5.987  1.00 0.00 ? 103 ALA A HB1  3  
ATOM 3896  H HB2  . ALA A 1 80  ? 8.736   9.306   -4.475  1.00 0.00 ? 103 ALA A HB2  3  
ATOM 3897  H HB3  . ALA A 1 80  ? 9.900   8.678   -5.664  1.00 0.00 ? 103 ALA A HB3  3  
ATOM 3898  N N    . PHE A 1 81  ? 7.416   6.823   -4.415  1.00 0.00 ? 104 PHE A N    3  
ATOM 3899  C CA   . PHE A 1 81  ? 7.343   5.525   -3.753  1.00 0.00 ? 104 PHE A CA   3  
ATOM 3900  C C    . PHE A 1 81  ? 6.081   4.752   -4.177  1.00 0.00 ? 104 PHE A C    3  
ATOM 3901  O O    . PHE A 1 81  ? 6.177   3.667   -4.754  1.00 0.00 ? 104 PHE A O    3  
ATOM 3902  C CB   . PHE A 1 81  ? 7.439   5.700   -2.223  1.00 0.00 ? 104 PHE A CB   3  
ATOM 3903  C CG   . PHE A 1 81  ? 6.771   4.579   -1.452  1.00 0.00 ? 104 PHE A CG   3  
ATOM 3904  C CD1  . PHE A 1 81  ? 7.194   3.248   -1.628  1.00 0.00 ? 104 PHE A CD1  3  
ATOM 3905  C CD2  . PHE A 1 81  ? 5.616   4.851   -0.699  1.00 0.00 ? 104 PHE A CD2  3  
ATOM 3906  C CE1  . PHE A 1 81  ? 6.451   2.197   -1.068  1.00 0.00 ? 104 PHE A CE1  3  
ATOM 3907  C CE2  . PHE A 1 81  ? 4.866   3.798   -0.157  1.00 0.00 ? 104 PHE A CE2  3  
ATOM 3908  C CZ   . PHE A 1 81  ? 5.287   2.469   -0.330  1.00 0.00 ? 104 PHE A CZ   3  
ATOM 3909  H H    . PHE A 1 81  ? 7.312   7.662   -3.851  1.00 0.00 ? 104 PHE A H    3  
ATOM 3910  H HA   . PHE A 1 81  ? 8.210   4.944   -4.072  1.00 0.00 ? 104 PHE A HA   3  
ATOM 3911  H HB2  . PHE A 1 81  ? 8.491   5.758   -1.938  1.00 0.00 ? 104 PHE A HB2  3  
ATOM 3912  H HB3  . PHE A 1 81  ? 6.967   6.642   -1.938  1.00 0.00 ? 104 PHE A HB3  3  
ATOM 3913  H HD1  . PHE A 1 81  ? 8.069   3.025   -2.223  1.00 0.00 ? 104 PHE A HD1  3  
ATOM 3914  H HD2  . PHE A 1 81  ? 5.274   5.868   -0.572  1.00 0.00 ? 104 PHE A HD2  3  
ATOM 3915  H HE1  . PHE A 1 81  ? 6.777   1.183   -1.221  1.00 0.00 ? 104 PHE A HE1  3  
ATOM 3916  H HE2  . PHE A 1 81  ? 3.949   4.027   0.361   1.00 0.00 ? 104 PHE A HE2  3  
ATOM 3917  H HZ   . PHE A 1 81  ? 4.712   1.663   0.102   1.00 0.00 ? 104 PHE A HZ   3  
ATOM 3918  N N    . VAL A 1 82  ? 4.890   5.282   -3.883  1.00 0.00 ? 105 VAL A N    3  
ATOM 3919  C CA   . VAL A 1 82  ? 3.627   4.582   -4.107  1.00 0.00 ? 105 VAL A CA   3  
ATOM 3920  C C    . VAL A 1 82  ? 3.423   4.371   -5.608  1.00 0.00 ? 105 VAL A C    3  
ATOM 3921  O O    . VAL A 1 82  ? 2.918   3.329   -6.002  1.00 0.00 ? 105 VAL A O    3  
ATOM 3922  C CB   . VAL A 1 82  ? 2.432   5.316   -3.457  1.00 0.00 ? 105 VAL A CB   3  
ATOM 3923  C CG1  . VAL A 1 82  ? 1.106   4.566   -3.602  1.00 0.00 ? 105 VAL A CG1  3  
ATOM 3924  C CG2  . VAL A 1 82  ? 2.644   5.697   -2.002  1.00 0.00 ? 105 VAL A CG2  3  
ATOM 3925  H H    . VAL A 1 82  ? 4.847   6.227   -3.536  1.00 0.00 ? 105 VAL A H    3  
ATOM 3926  H HA   . VAL A 1 82  ? 3.719   3.604   -3.637  1.00 0.00 ? 105 VAL A HA   3  
ATOM 3927  H HB   . VAL A 1 82  ? 2.291   6.264   -3.939  1.00 0.00 ? 105 VAL A HB   3  
ATOM 3928  H HG11 . VAL A 1 82  ? 0.511   5.094   -4.343  1.00 0.00 ? 105 VAL A HG11 3  
ATOM 3929  H HG12 . VAL A 1 82  ? 1.269   3.540   -3.931  1.00 0.00 ? 105 VAL A HG12 3  
ATOM 3930  H HG13 . VAL A 1 82  ? 0.548   4.552   -2.668  1.00 0.00 ? 105 VAL A HG13 3  
ATOM 3931  H HG21 . VAL A 1 82  ? 2.685   4.810   -1.379  1.00 0.00 ? 105 VAL A HG21 3  
ATOM 3932  H HG22 . VAL A 1 82  ? 3.552   6.281   -1.911  1.00 0.00 ? 105 VAL A HG22 3  
ATOM 3933  H HG23 . VAL A 1 82  ? 1.813   6.327   -1.699  1.00 0.00 ? 105 VAL A HG23 3  
ATOM 3934  N N    . THR A 1 83  ? 3.874   5.287   -6.462  1.00 0.00 ? 106 THR A N    3  
ATOM 3935  C CA   . THR A 1 83  ? 4.003   5.061   -7.893  1.00 0.00 ? 106 THR A CA   3  
ATOM 3936  C C    . THR A 1 83  ? 4.639   3.703   -8.208  1.00 0.00 ? 106 THR A C    3  
ATOM 3937  O O    . THR A 1 83  ? 4.075   2.964   -9.013  1.00 0.00 ? 106 THR A O    3  
ATOM 3938  C CB   . THR A 1 83  ? 4.774   6.234   -8.505  1.00 0.00 ? 106 THR A CB   3  
ATOM 3939  O OG1  . THR A 1 83  ? 3.897   7.337   -8.582  1.00 0.00 ? 106 THR A OG1  3  
ATOM 3940  C CG2  . THR A 1 83  ? 5.381   5.951   -9.880  1.00 0.00 ? 106 THR A CG2  3  
ATOM 3941  H H    . THR A 1 83  ? 4.112   6.196   -6.096  1.00 0.00 ? 106 THR A H    3  
ATOM 3942  H HA   . THR A 1 83  ? 2.999   5.044   -8.310  1.00 0.00 ? 106 THR A HA   3  
ATOM 3943  H HB   . THR A 1 83  ? 5.587   6.499   -7.835  1.00 0.00 ? 106 THR A HB   3  
ATOM 3944  H HG1  . THR A 1 83  ? 4.467   8.122   -8.667  1.00 0.00 ? 106 THR A HG1  3  
ATOM 3945  H HG21 . THR A 1 83  ? 5.934   6.816   -10.221 1.00 0.00 ? 106 THR A HG21 3  
ATOM 3946  H HG22 . THR A 1 83  ? 6.085   5.120   -9.814  1.00 0.00 ? 106 THR A HG22 3  
ATOM 3947  H HG23 . THR A 1 83  ? 4.605   5.719   -10.604 1.00 0.00 ? 106 THR A HG23 3  
ATOM 3948  N N    . GLY A 1 84  ? 5.773   3.357   -7.591  1.00 0.00 ? 107 GLY A N    3  
ATOM 3949  C CA   . GLY A 1 84  ? 6.415   2.066   -7.800  1.00 0.00 ? 107 GLY A CA   3  
ATOM 3950  C C    . GLY A 1 84  ? 5.488   0.929   -7.373  1.00 0.00 ? 107 GLY A C    3  
ATOM 3951  O O    . GLY A 1 84  ? 5.310   -0.033  -8.123  1.00 0.00 ? 107 GLY A O    3  
ATOM 3952  H H    . GLY A 1 84  ? 6.179   3.967   -6.890  1.00 0.00 ? 107 GLY A H    3  
ATOM 3953  H HA2  . GLY A 1 84  ? 6.668   1.953   -8.856  1.00 0.00 ? 107 GLY A HA2  3  
ATOM 3954  H HA3  . GLY A 1 84  ? 7.334   2.018   -7.214  1.00 0.00 ? 107 GLY A HA3  3  
ATOM 3955  N N    . CYS A 1 85  ? 4.850   1.075   -6.208  1.00 0.00 ? 108 CYS A N    3  
ATOM 3956  C CA   . CYS A 1 85  ? 3.864   0.125   -5.691  1.00 0.00 ? 108 CYS A CA   3  
ATOM 3957  C C    . CYS A 1 85  ? 2.739   -0.084  -6.714  1.00 0.00 ? 108 CYS A C    3  
ATOM 3958  O O    . CYS A 1 85  ? 2.292   -1.207  -6.941  1.00 0.00 ? 108 CYS A O    3  
ATOM 3959  C CB   . CYS A 1 85  ? 3.303   0.646   -4.358  1.00 0.00 ? 108 CYS A CB   3  
ATOM 3960  S SG   . CYS A 1 85  ? 2.148   -0.444  -3.495  1.00 0.00 ? 108 CYS A SG   3  
ATOM 3961  H H    . CYS A 1 85  ? 5.026   1.945   -5.715  1.00 0.00 ? 108 CYS A H    3  
ATOM 3962  H HA   . CYS A 1 85  ? 4.362   -0.831  -5.521  1.00 0.00 ? 108 CYS A HA   3  
ATOM 3963  H HB2  . CYS A 1 85  ? 4.128   0.878   -3.685  1.00 0.00 ? 108 CYS A HB2  3  
ATOM 3964  H HB3  . CYS A 1 85  ? 2.762   1.567   -4.542  1.00 0.00 ? 108 CYS A HB3  3  
ATOM 3965  N N    . ILE A 1 86  ? 2.285   0.986   -7.362  1.00 0.00 ? 109 ILE A N    3  
ATOM 3966  C CA   . ILE A 1 86  ? 1.177   0.987   -8.305  1.00 0.00 ? 109 ILE A CA   3  
ATOM 3967  C C    . ILE A 1 86  ? 1.587   0.415   -9.655  1.00 0.00 ? 109 ILE A C    3  
ATOM 3968  O O    . ILE A 1 86  ? 0.812   -0.310  -10.276 1.00 0.00 ? 109 ILE A O    3  
ATOM 3969  C CB   . ILE A 1 86  ? 0.610   2.412   -8.373  1.00 0.00 ? 109 ILE A CB   3  
ATOM 3970  C CG1  . ILE A 1 86  ? -0.327  2.533   -7.162  1.00 0.00 ? 109 ILE A CG1  3  
ATOM 3971  C CG2  . ILE A 1 86  ? -0.165  2.756   -9.649  1.00 0.00 ? 109 ILE A CG2  3  
ATOM 3972  C CD1  . ILE A 1 86  ? -0.362  3.963   -6.645  1.00 0.00 ? 109 ILE A CD1  3  
ATOM 3973  H H    . ILE A 1 86  ? 2.681   1.885   -7.106  1.00 0.00 ? 109 ILE A H    3  
ATOM 3974  H HA   . ILE A 1 86  ? 0.411   0.345   -7.888  1.00 0.00 ? 109 ILE A HA   3  
ATOM 3975  H HB   . ILE A 1 86  ? 1.433   3.124   -8.289  1.00 0.00 ? 109 ILE A HB   3  
ATOM 3976  H HG12 . ILE A 1 86  ? -1.331  2.207   -7.433  1.00 0.00 ? 109 ILE A HG12 3  
ATOM 3977  H HG13 . ILE A 1 86  ? 0.008   1.877   -6.357  1.00 0.00 ? 109 ILE A HG13 3  
ATOM 3978  H HG21 . ILE A 1 86  ? -0.536  3.779   -9.586  1.00 0.00 ? 109 ILE A HG21 3  
ATOM 3979  H HG22 . ILE A 1 86  ? 0.487   2.699   -10.519 1.00 0.00 ? 109 ILE A HG22 3  
ATOM 3980  H HG23 . ILE A 1 86  ? -0.992  2.061   -9.773  1.00 0.00 ? 109 ILE A HG23 3  
ATOM 3981  H HD11 . ILE A 1 86  ? -0.755  4.635   -7.404  1.00 0.00 ? 109 ILE A HD11 3  
ATOM 3982  H HD12 . ILE A 1 86  ? -0.991  3.983   -5.754  1.00 0.00 ? 109 ILE A HD12 3  
ATOM 3983  H HD13 . ILE A 1 86  ? 0.649   4.279   -6.411  1.00 0.00 ? 109 ILE A HD13 3  
ATOM 3984  N N    . ASN A 1 87  ? 2.812   0.681   -10.088 1.00 0.00 ? 110 ASN A N    3  
ATOM 3985  C CA   . ASN A 1 87  ? 3.399   0.050   -11.268 1.00 0.00 ? 110 ASN A CA   3  
ATOM 3986  C C    . ASN A 1 87  ? 3.634   -1.442  -11.058 1.00 0.00 ? 110 ASN A C    3  
ATOM 3987  O O    . ASN A 1 87  ? 3.964   -2.154  -12.004 1.00 0.00 ? 110 ASN A O    3  
ATOM 3988  C CB   . ASN A 1 87  ? 4.734   0.695   -11.624 1.00 0.00 ? 110 ASN A CB   3  
ATOM 3989  C CG   . ASN A 1 87  ? 4.615   2.145   -12.053 1.00 0.00 ? 110 ASN A CG   3  
ATOM 3990  O OD1  . ASN A 1 87  ? 3.584   2.600   -12.542 1.00 0.00 ? 110 ASN A OD1  3  
ATOM 3991  N ND2  . ASN A 1 87  ? 5.660   2.908   -11.827 1.00 0.00 ? 110 ASN A ND2  3  
ATOM 3992  H H    . ASN A 1 87  ? 3.349   1.350   -9.543  1.00 0.00 ? 110 ASN A H    3  
ATOM 3993  H HA   . ASN A 1 87  ? 2.727   0.169   -12.113 1.00 0.00 ? 110 ASN A HA   3  
ATOM 3994  H HB2  . ASN A 1 87  ? 5.409   0.614   -10.771 1.00 0.00 ? 110 ASN A HB2  3  
ATOM 3995  H HB3  . ASN A 1 87  ? 5.162   0.139   -12.456 1.00 0.00 ? 110 ASN A HB3  3  
ATOM 3996  H HD21 . ASN A 1 87  ? 6.521   2.462   -11.516 1.00 0.00 ? 110 ASN A HD21 3  
ATOM 3997  H HD22 . ASN A 1 87  ? 5.700   3.823   -12.249 1.00 0.00 ? 110 ASN A HD22 3  
ATOM 3998  N N    . ALA A 1 88  ? 3.524   -1.919  -9.821  1.00 0.00 ? 111 ALA A N    3  
ATOM 3999  C CA   . ALA A 1 88  ? 3.731   -3.301  -9.444  1.00 0.00 ? 111 ALA A CA   3  
ATOM 4000  C C    . ALA A 1 88  ? 2.378   -3.991  -9.213  1.00 0.00 ? 111 ALA A C    3  
ATOM 4001  O O    . ALA A 1 88  ? 2.172   -5.105  -9.699  1.00 0.00 ? 111 ALA A O    3  
ATOM 4002  C CB   . ALA A 1 88  ? 4.680   -3.301  -8.241  1.00 0.00 ? 111 ALA A CB   3  
ATOM 4003  H H    . ALA A 1 88  ? 3.367   -1.245  -9.086  1.00 0.00 ? 111 ALA A H    3  
ATOM 4004  H HA   . ALA A 1 88  ? 4.235   -3.822  -10.258 1.00 0.00 ? 111 ALA A HA   3  
ATOM 4005  H HB1  . ALA A 1 88  ? 4.954   -4.320  -7.980  1.00 0.00 ? 111 ALA A HB1  3  
ATOM 4006  H HB2  . ALA A 1 88  ? 5.578   -2.734  -8.509  1.00 0.00 ? 111 ALA A HB2  3  
ATOM 4007  H HB3  . ALA A 1 88  ? 4.212   -2.821  -7.385  1.00 0.00 ? 111 ALA A HB3  3  
ATOM 4008  N N    . THR A 1 89  ? 1.427   -3.327  -8.545  1.00 0.00 ? 112 THR A N    3  
ATOM 4009  C CA   . THR A 1 89  ? 0.067   -3.823  -8.369  1.00 0.00 ? 112 THR A CA   3  
ATOM 4010  C C    . THR A 1 89  ? -0.680  -3.846  -9.704  1.00 0.00 ? 112 THR A C    3  
ATOM 4011  O O    . THR A 1 89  ? -1.439  -4.779  -9.949  1.00 0.00 ? 112 THR A O    3  
ATOM 4012  C CB   . THR A 1 89  ? -0.678  -3.012  -7.292  1.00 0.00 ? 112 THR A CB   3  
ATOM 4013  O OG1  . THR A 1 89  ? -1.738  -3.754  -6.761  1.00 0.00 ? 112 THR A OG1  3  
ATOM 4014  C CG2  . THR A 1 89  ? -1.300  -1.719  -7.812  1.00 0.00 ? 112 THR A CG2  3  
ATOM 4015  H H    . THR A 1 89  ? 1.662   -2.444  -8.103  1.00 0.00 ? 112 THR A H    3  
ATOM 4016  H HA   . THR A 1 89  ? 0.143   -4.851  -8.013  1.00 0.00 ? 112 THR A HA   3  
ATOM 4017  H HB   . THR A 1 89  ? 0.012   -2.791  -6.481  1.00 0.00 ? 112 THR A HB   3  
ATOM 4018  H HG1  . THR A 1 89  ? -1.347  -4.473  -6.223  1.00 0.00 ? 112 THR A HG1  3  
ATOM 4019  H HG21 . THR A 1 89  ? -2.199  -1.943  -8.381  1.00 0.00 ? 112 THR A HG21 3  
ATOM 4020  H HG22 . THR A 1 89  ? -1.540  -1.055  -6.983  1.00 0.00 ? 112 THR A HG22 3  
ATOM 4021  H HG23 . THR A 1 89  ? -0.611  -1.241  -8.488  1.00 0.00 ? 112 THR A HG23 3  
ATOM 4022  N N    . GLN A 1 90  ? -0.462  -2.883  -10.613 1.00 0.00 ? 113 GLN A N    3  
ATOM 4023  C CA   . GLN A 1 90  ? -1.163  -2.924  -11.899 1.00 0.00 ? 113 GLN A CA   3  
ATOM 4024  C C    . GLN A 1 90  ? -0.881  -4.217  -12.665 1.00 0.00 ? 113 GLN A C    3  
ATOM 4025  O O    . GLN A 1 90  ? -1.757  -4.705  -13.371 1.00 0.00 ? 113 GLN A O    3  
ATOM 4026  C CB   . GLN A 1 90  ? -0.902  -1.680  -12.748 1.00 0.00 ? 113 GLN A CB   3  
ATOM 4027  C CG   . GLN A 1 90  ? 0.531   -1.503  -13.264 1.00 0.00 ? 113 GLN A CG   3  
ATOM 4028  C CD   . GLN A 1 90  ? 0.669   -0.153  -13.960 1.00 0.00 ? 113 GLN A CD   3  
ATOM 4029  O OE1  . GLN A 1 90  ? 0.888   -0.092  -15.167 1.00 0.00 ? 113 GLN A OE1  3  
ATOM 4030  N NE2  . GLN A 1 90  ? 0.511   0.935   -13.227 1.00 0.00 ? 113 GLN A NE2  3  
ATOM 4031  H H    . GLN A 1 90  ? 0.042   -2.039  -10.336 1.00 0.00 ? 113 GLN A H    3  
ATOM 4032  H HA   . GLN A 1 90  ? -2.229  -2.919  -11.684 1.00 0.00 ? 113 GLN A HA   3  
ATOM 4033  H HB2  . GLN A 1 90  ? -1.550  -1.731  -13.620 1.00 0.00 ? 113 GLN A HB2  3  
ATOM 4034  H HB3  . GLN A 1 90  ? -1.193  -0.810  -12.160 1.00 0.00 ? 113 GLN A HB3  3  
ATOM 4035  H HG2  . GLN A 1 90  ? 1.236   -1.569  -12.442 1.00 0.00 ? 113 GLN A HG2  3  
ATOM 4036  H HG3  . GLN A 1 90  ? 0.763   -2.297  -13.976 1.00 0.00 ? 113 GLN A HG3  3  
ATOM 4037  H HE21 . GLN A 1 90  ? 0.306   0.856   -12.243 1.00 0.00 ? 113 GLN A HE21 3  
ATOM 4038  H HE22 . GLN A 1 90  ? 0.426   1.845   -13.689 1.00 0.00 ? 113 GLN A HE22 3  
ATOM 4039  N N    . ALA A 1 91  ? 0.304   -4.804  -12.485 1.00 0.00 ? 114 ALA A N    3  
ATOM 4040  C CA   . ALA A 1 91  ? 0.654   -6.098  -13.047 1.00 0.00 ? 114 ALA A CA   3  
ATOM 4041  C C    . ALA A 1 91  ? 0.255   -7.264  -12.132 1.00 0.00 ? 114 ALA A C    3  
ATOM 4042  O O    . ALA A 1 91  ? 0.223   -8.405  -12.601 1.00 0.00 ? 114 ALA A O    3  
ATOM 4043  C CB   . ALA A 1 91  ? 2.159   -6.096  -13.298 1.00 0.00 ? 114 ALA A CB   3  
ATOM 4044  H H    . ALA A 1 91  ? 0.973   -4.365  -11.872 1.00 0.00 ? 114 ALA A H    3  
ATOM 4045  H HA   . ALA A 1 91  ? 0.134   -6.229  -14.002 1.00 0.00 ? 114 ALA A HA   3  
ATOM 4046  H HB1  . ALA A 1 91  ? 2.412   -5.235  -13.921 1.00 0.00 ? 114 ALA A HB1  3  
ATOM 4047  H HB2  . ALA A 1 91  ? 2.698   -6.021  -12.353 1.00 0.00 ? 114 ALA A HB2  3  
ATOM 4048  H HB3  . ALA A 1 91  ? 2.448   -7.012  -13.813 1.00 0.00 ? 114 ALA A HB3  3  
ATOM 4049  N N    . ALA A 1 92  ? -0.070  -7.008  -10.858 1.00 0.00 ? 115 ALA A N    3  
ATOM 4050  C CA   . ALA A 1 92  ? -0.726  -7.993  -10.005 1.00 0.00 ? 115 ALA A CA   3  
ATOM 4051  C C    . ALA A 1 92  ? -2.172  -8.200  -10.468 1.00 0.00 ? 115 ALA A C    3  
ATOM 4052  O O    . ALA A 1 92  ? -2.663  -9.320  -10.371 1.00 0.00 ? 115 ALA A O    3  
ATOM 4053  C CB   . ALA A 1 92  ? -0.685  -7.575  -8.522  1.00 0.00 ? 115 ALA A CB   3  
ATOM 4054  H H    . ALA A 1 92  ? -0.103  -6.047  -10.539 1.00 0.00 ? 115 ALA A H    3  
ATOM 4055  H HA   . ALA A 1 92  ? -0.200  -8.945  -10.095 1.00 0.00 ? 115 ALA A HA   3  
ATOM 4056  H HB1  . ALA A 1 92  ? -1.088  -8.386  -7.912  1.00 0.00 ? 115 ALA A HB1  3  
ATOM 4057  H HB2  . ALA A 1 92  ? 0.336   -7.371  -8.203  1.00 0.00 ? 115 ALA A HB2  3  
ATOM 4058  H HB3  . ALA A 1 92  ? -1.306  -6.698  -8.339  1.00 0.00 ? 115 ALA A HB3  3  
ATOM 4059  N N    . ASN A 1 93  ? -2.852  -7.160  -10.982 1.00 0.00 ? 116 ASN A N    3  
ATOM 4060  C CA   . ASN A 1 93  ? -4.307  -7.190  -11.181 1.00 0.00 ? 116 ASN A CA   3  
ATOM 4061  C C    . ASN A 1 93  ? -4.752  -6.547  -12.508 1.00 0.00 ? 116 ASN A C    3  
ATOM 4062  O O    . ASN A 1 93  ? -5.652  -5.701  -12.526 1.00 0.00 ? 116 ASN A O    3  
ATOM 4063  C CB   . ASN A 1 93  ? -5.060  -6.564  -9.980  1.00 0.00 ? 116 ASN A CB   3  
ATOM 4064  C CG   . ASN A 1 93  ? -4.426  -6.717  -8.608  1.00 0.00 ? 116 ASN A CG   3  
ATOM 4065  O OD1  . ASN A 1 93  ? -4.320  -7.815  -8.074  1.00 0.00 ? 116 ASN A OD1  3  
ATOM 4066  N ND2  . ASN A 1 93  ? -4.003  -5.617  -8.012  1.00 0.00 ? 116 ASN A ND2  3  
ATOM 4067  H H    . ASN A 1 93  ? -2.391  -6.258  -10.996 1.00 0.00 ? 116 ASN A H    3  
ATOM 4068  H HA   . ASN A 1 93  ? -4.614  -8.234  -11.237 1.00 0.00 ? 116 ASN A HA   3  
ATOM 4069  H HB2  . ASN A 1 93  ? -5.239  -5.505  -10.160 1.00 0.00 ? 116 ASN A HB2  3  
ATOM 4070  H HB3  . ASN A 1 93  ? -6.025  -7.058  -9.924  1.00 0.00 ? 116 ASN A HB3  3  
ATOM 4071  H HD21 . ASN A 1 93  ? -4.189  -4.719  -8.425  1.00 0.00 ? 116 ASN A HD21 3  
ATOM 4072  H HD22 . ASN A 1 93  ? -3.634  -5.659  -7.073  1.00 0.00 ? 116 ASN A HD22 3  
ATOM 4073  N N    . GLN A 1 94  ? -4.159  -6.918  -13.649 1.00 0.00 ? 117 GLN A N    3  
ATOM 4074  C CA   . GLN A 1 94  ? -4.622  -6.392  -14.938 1.00 0.00 ? 117 GLN A CA   3  
ATOM 4075  C C    . GLN A 1 94  ? -6.100  -6.701  -15.170 1.00 0.00 ? 117 GLN A C    3  
ATOM 4076  O O    . GLN A 1 94  ? -6.850  -5.812  -15.560 1.00 0.00 ? 117 GLN A O    3  
ATOM 4077  C CB   . GLN A 1 94  ? -3.797  -6.952  -16.099 1.00 0.00 ? 117 GLN A CB   3  
ATOM 4078  C CG   . GLN A 1 94  ? -2.504  -6.177  -16.317 1.00 0.00 ? 117 GLN A CG   3  
ATOM 4079  C CD   . GLN A 1 94  ? -2.747  -4.736  -16.778 1.00 0.00 ? 117 GLN A CD   3  
ATOM 4080  O OE1  . GLN A 1 94  ? -3.266  -4.496  -17.865 1.00 0.00 ? 117 GLN A OE1  3  
ATOM 4081  N NE2  . GLN A 1 94  ? -2.406  -3.758  -15.954 1.00 0.00 ? 117 GLN A NE2  3  
ATOM 4082  H H    . GLN A 1 94  ? -3.431  -7.623  -13.648 1.00 0.00 ? 117 GLN A H    3  
ATOM 4083  H HA   . GLN A 1 94  ? -4.526  -5.307  -14.918 1.00 0.00 ? 117 GLN A HA   3  
ATOM 4084  H HB2  . GLN A 1 94  ? -3.549  -7.992  -15.899 1.00 0.00 ? 117 GLN A HB2  3  
ATOM 4085  H HB3  . GLN A 1 94  ? -4.383  -6.912  -17.019 1.00 0.00 ? 117 GLN A HB3  3  
ATOM 4086  H HG2  . GLN A 1 94  ? -1.915  -6.210  -15.401 1.00 0.00 ? 117 GLN A HG2  3  
ATOM 4087  H HG3  . GLN A 1 94  ? -1.961  -6.703  -17.093 1.00 0.00 ? 117 GLN A HG3  3  
ATOM 4088  H HE21 . GLN A 1 94  ? -2.040  -4.023  -15.046 1.00 0.00 ? 117 GLN A HE21 3  
ATOM 4089  H HE22 . GLN A 1 94  ? -2.407  -2.786  -16.246 1.00 0.00 ? 117 GLN A HE22 3  
ATOM 4090  N N    . GLY A 1 95  ? -6.525  -7.933  -14.888 1.00 0.00 ? 118 GLY A N    3  
ATOM 4091  C CA   . GLY A 1 95  ? -7.909  -8.387  -15.048 1.00 0.00 ? 118 GLY A CA   3  
ATOM 4092  C C    . GLY A 1 95  ? -8.912  -7.764  -14.071 1.00 0.00 ? 118 GLY A C    3  
ATOM 4093  O O    . GLY A 1 95  ? -10.015 -8.290  -13.907 1.00 0.00 ? 118 GLY A O    3  
ATOM 4094  H H    . GLY A 1 95  ? -5.825  -8.591  -14.561 1.00 0.00 ? 118 GLY A H    3  
ATOM 4095  H HA2  . GLY A 1 95  ? -8.240  -8.148  -16.057 1.00 0.00 ? 118 GLY A HA2  3  
ATOM 4096  H HA3  . GLY A 1 95  ? -7.945  -9.467  -14.929 1.00 0.00 ? 118 GLY A HA3  3  
ATOM 4097  N N    . GLU A 1 96  ? -8.542  -6.696  -13.367 1.00 0.00 ? 119 GLU A N    3  
ATOM 4098  C CA   . GLU A 1 96  ? -9.308  -6.052  -12.336 1.00 0.00 ? 119 GLU A CA   3  
ATOM 4099  C C    . GLU A 1 96  ? -9.375  -4.569  -12.605 1.00 0.00 ? 119 GLU A C    3  
ATOM 4100  O O    . GLU A 1 96  ? -10.471 -4.021  -12.650 1.00 0.00 ? 119 GLU A O    3  
ATOM 4101  C CB   . GLU A 1 96  ? -8.636  -6.426  -11.030 1.00 0.00 ? 119 GLU A CB   3  
ATOM 4102  C CG   . GLU A 1 96  ? -9.191  -5.650  -9.853  1.00 0.00 ? 119 GLU A CG   3  
ATOM 4103  C CD   . GLU A 1 96  ? -8.792  -6.278  -8.519  1.00 0.00 ? 119 GLU A CD   3  
ATOM 4104  O OE1  . GLU A 1 96  ? -8.072  -7.305  -8.508  1.00 0.00 ? 119 GLU A OE1  3  
ATOM 4105  O OE2  . GLU A 1 96  ? -9.269  -5.803  -7.473  1.00 0.00 ? 119 GLU A OE2  3  
ATOM 4106  H H    . GLU A 1 96  ? -7.617  -6.300  -13.437 1.00 0.00 ? 119 GLU A H    3  
ATOM 4107  H HA   . GLU A 1 96  ? -10.329 -6.387  -12.322 1.00 0.00 ? 119 GLU A HA   3  
ATOM 4108  H HB2  . GLU A 1 96  ? -8.746  -7.499  -10.887 1.00 0.00 ? 119 GLU A HB2  3  
ATOM 4109  H HB3  . GLU A 1 96  ? -7.582  -6.195  -11.097 1.00 0.00 ? 119 GLU A HB3  3  
ATOM 4110  H HG2  . GLU A 1 96  ? -8.776  -4.649  -9.958  1.00 0.00 ? 119 GLU A HG2  3  
ATOM 4111  H HG3  . GLU A 1 96  ? -10.279 -5.619  -9.920  1.00 0.00 ? 119 GLU A HG3  3  
ATOM 4112  N N    . PHE A 1 97  ? -8.234  -3.937  -12.857 1.00 0.00 ? 120 PHE A N    3  
ATOM 4113  C CA   . PHE A 1 97  ? -8.199  -2.515  -13.138 1.00 0.00 ? 120 PHE A CA   3  
ATOM 4114  C C    . PHE A 1 97  ? -8.744  -2.130  -14.525 1.00 0.00 ? 120 PHE A C    3  
ATOM 4115  O O    . PHE A 1 97  ? -8.613  -0.965  -14.909 1.00 0.00 ? 120 PHE A O    3  
ATOM 4116  C CB   . PHE A 1 97  ? -6.762  -2.035  -12.969 1.00 0.00 ? 120 PHE A CB   3  
ATOM 4117  C CG   . PHE A 1 97  ? -6.197  -2.147  -11.568 1.00 0.00 ? 120 PHE A CG   3  
ATOM 4118  C CD1  . PHE A 1 97  ? -6.801  -1.469  -10.492 1.00 0.00 ? 120 PHE A CD1  3  
ATOM 4119  C CD2  . PHE A 1 97  ? -5.015  -2.875  -11.357 1.00 0.00 ? 120 PHE A CD2  3  
ATOM 4120  C CE1  . PHE A 1 97  ? -6.135  -1.393  -9.257  1.00 0.00 ? 120 PHE A CE1  3  
ATOM 4121  C CE2  . PHE A 1 97  ? -4.381  -2.841  -10.106 1.00 0.00 ? 120 PHE A CE2  3  
ATOM 4122  C CZ   . PHE A 1 97  ? -4.916  -2.064  -9.071  1.00 0.00 ? 120 PHE A CZ   3  
ATOM 4123  H H    . PHE A 1 97  ? -7.356  -4.437  -12.760 1.00 0.00 ? 120 PHE A H    3  
ATOM 4124  H HA   . PHE A 1 97  ? -8.827  -2.024  -12.397 1.00 0.00 ? 120 PHE A HA   3  
ATOM 4125  H HB2  . PHE A 1 97  ? -6.131  -2.587  -13.669 1.00 0.00 ? 120 PHE A HB2  3  
ATOM 4126  H HB3  . PHE A 1 97  ? -6.714  -0.981  -13.243 1.00 0.00 ? 120 PHE A HB3  3  
ATOM 4127  H HD1  . PHE A 1 97  ? -7.785  -1.021  -10.592 1.00 0.00 ? 120 PHE A HD1  3  
ATOM 4128  H HD2  . PHE A 1 97  ? -4.611  -3.475  -12.160 1.00 0.00 ? 120 PHE A HD2  3  
ATOM 4129  H HE1  . PHE A 1 97  ? -6.570  -0.835  -8.443  1.00 0.00 ? 120 PHE A HE1  3  
ATOM 4130  H HE2  . PHE A 1 97  ? -3.480  -3.405  -9.938  1.00 0.00 ? 120 PHE A HE2  3  
ATOM 4131  H HZ   . PHE A 1 97  ? -4.405  -2.009  -8.122  1.00 0.00 ? 120 PHE A HZ   3  
ATOM 4132  N N    . GLN A 1 98  ? -9.259  -3.078  -15.313 1.00 0.00 ? 121 GLN A N    3  
ATOM 4133  C CA   . GLN A 1 98  ? -9.640  -2.918  -16.708 1.00 0.00 ? 121 GLN A CA   3  
ATOM 4134  C C    . GLN A 1 98  ? -11.019 -3.535  -17.022 1.00 0.00 ? 121 GLN A C    3  
ATOM 4135  O O    . GLN A 1 98  ? -11.299 -3.945  -18.156 1.00 0.00 ? 121 GLN A O    3  
ATOM 4136  C CB   . GLN A 1 98  ? -8.479  -3.509  -17.530 1.00 0.00 ? 121 GLN A CB   3  
ATOM 4137  C CG   . GLN A 1 98  ? -7.800  -2.490  -18.422 1.00 0.00 ? 121 GLN A CG   3  
ATOM 4138  C CD   . GLN A 1 98  ? -8.321  -2.542  -19.856 1.00 0.00 ? 121 GLN A CD   3  
ATOM 4139  O OE1  . GLN A 1 98  ? -9.525  -2.476  -20.098 1.00 0.00 ? 121 GLN A OE1  3  
ATOM 4140  N NE2  . GLN A 1 98  ? -7.449  -2.724  -20.828 1.00 0.00 ? 121 GLN A NE2  3  
ATOM 4141  H H    . GLN A 1 98  ? -9.154  -4.036  -15.024 1.00 0.00 ? 121 GLN A H    3  
ATOM 4142  H HA   . GLN A 1 98  ? -9.740  -1.853  -16.915 1.00 0.00 ? 121 GLN A HA   3  
ATOM 4143  H HB2  . GLN A 1 98  ? -7.711  -3.914  -16.874 1.00 0.00 ? 121 GLN A HB2  3  
ATOM 4144  H HB3  . GLN A 1 98  ? -8.814  -4.318  -18.148 1.00 0.00 ? 121 GLN A HB3  3  
ATOM 4145  H HG2  . GLN A 1 98  ? -7.972  -1.515  -17.998 1.00 0.00 ? 121 GLN A HG2  3  
ATOM 4146  H HG3  . GLN A 1 98  ? -6.737  -2.700  -18.385 1.00 0.00 ? 121 GLN A HG3  3  
ATOM 4147  H HE21 . GLN A 1 98  ? -6.455  -2.793  -20.622 1.00 0.00 ? 121 GLN A HE21 3  
ATOM 4148  H HE22 . GLN A 1 98  ? -7.782  -2.705  -21.789 1.00 0.00 ? 121 GLN A HE22 3  
ATOM 4149  N N    . LYS A 1 99  ? -11.903 -3.615  -16.025 1.00 0.00 ? 122 LYS A N    3  
ATOM 4150  C CA   . LYS A 1 99  ? -13.243 -4.180  -16.184 1.00 0.00 ? 122 LYS A CA   3  
ATOM 4151  C C    . LYS A 1 99  ? -14.085 -3.333  -17.143 1.00 0.00 ? 122 LYS A C    3  
ATOM 4152  O O    . LYS A 1 99  ? -13.746 -2.179  -17.395 1.00 0.00 ? 122 LYS A O    3  
ATOM 4153  C CB   . LYS A 1 99  ? -13.911 -4.270  -14.805 1.00 0.00 ? 122 LYS A CB   3  
ATOM 4154  C CG   . LYS A 1 99  ? -13.286 -5.365  -13.936 1.00 0.00 ? 122 LYS A CG   3  
ATOM 4155  C CD   . LYS A 1 99  ? -14.364 -6.250  -13.300 1.00 0.00 ? 122 LYS A CD   3  
ATOM 4156  C CE   . LYS A 1 99  ? -13.822 -7.038  -12.109 1.00 0.00 ? 122 LYS A CE   3  
ATOM 4157  N NZ   . LYS A 1 99  ? -13.363 -6.147  -11.020 1.00 0.00 ? 122 LYS A NZ   3  
ATOM 4158  H H    . LYS A 1 99  ? -11.700 -3.087  -15.185 1.00 0.00 ? 122 LYS A H    3  
ATOM 4159  H HA   . LYS A 1 99  ? -13.141 -5.179  -16.613 1.00 0.00 ? 122 LYS A HA   3  
ATOM 4160  H HB2  . LYS A 1 99  ? -13.834 -3.310  -14.292 1.00 0.00 ? 122 LYS A HB2  3  
ATOM 4161  H HB3  . LYS A 1 99  ? -14.969 -4.485  -14.920 1.00 0.00 ? 122 LYS A HB3  3  
ATOM 4162  H HG2  . LYS A 1 99  ? -12.616 -5.996  -14.521 1.00 0.00 ? 122 LYS A HG2  3  
ATOM 4163  H HG3  . LYS A 1 99  ? -12.712 -4.871  -13.159 1.00 0.00 ? 122 LYS A HG3  3  
ATOM 4164  H HD2  . LYS A 1 99  ? -15.193 -5.633  -12.961 1.00 0.00 ? 122 LYS A HD2  3  
ATOM 4165  H HD3  . LYS A 1 99  ? -14.743 -6.948  -14.048 1.00 0.00 ? 122 LYS A HD3  3  
ATOM 4166  H HE2  . LYS A 1 99  ? -14.618 -7.684  -11.736 1.00 0.00 ? 122 LYS A HE2  3  
ATOM 4167  H HE3  . LYS A 1 99  ? -12.999 -7.667  -12.446 1.00 0.00 ? 122 LYS A HE3  3  
ATOM 4168  H HZ1  . LYS A 1 99  ? -13.161 -6.688  -10.178 1.00 0.00 ? 122 LYS A HZ1  3  
ATOM 4169  H HZ2  . LYS A 1 99  ? -12.537 -5.634  -11.289 1.00 0.00 ? 122 LYS A HZ2  3  
ATOM 4170  H HZ3  . LYS A 1 99  ? -14.096 -5.488  -10.773 1.00 0.00 ? 122 LYS A HZ3  3  
ATOM 4171  N N    . PRO A 1 100 ? -15.212 -3.859  -17.654 1.00 0.00 ? 123 PRO A N    3  
ATOM 4172  C CA   . PRO A 1 100 ? -16.039 -3.136  -18.614 1.00 0.00 ? 123 PRO A CA   3  
ATOM 4173  C C    . PRO A 1 100 ? -16.897 -2.025  -18.008 1.00 0.00 ? 123 PRO A C    3  
ATOM 4174  O O    . PRO A 1 100 ? -17.591 -1.328  -18.744 1.00 0.00 ? 123 PRO A O    3  
ATOM 4175  C CB   . PRO A 1 100 ? -16.895 -4.196  -19.295 1.00 0.00 ? 123 PRO A CB   3  
ATOM 4176  C CG   . PRO A 1 100 ? -17.031 -5.264  -18.217 1.00 0.00 ? 123 PRO A CG   3  
ATOM 4177  C CD   . PRO A 1 100 ? -15.661 -5.240  -17.550 1.00 0.00 ? 123 PRO A CD   3  
ATOM 4178  H HA   . PRO A 1 100 ? -15.381 -2.686  -19.350 1.00 0.00 ? 123 PRO A HA   3  
ATOM 4179  H HB2  . PRO A 1 100 ? -17.864 -3.817  -19.624 1.00 0.00 ? 123 PRO A HB2  3  
ATOM 4180  H HB3  . PRO A 1 100 ? -16.327 -4.588  -20.136 1.00 0.00 ? 123 PRO A HB3  3  
ATOM 4181  H HG2  . PRO A 1 100 ? -17.801 -4.976  -17.501 1.00 0.00 ? 123 PRO A HG2  3  
ATOM 4182  H HG3  . PRO A 1 100 ? -17.246 -6.237  -18.637 1.00 0.00 ? 123 PRO A HG3  3  
ATOM 4183  H HD2  . PRO A 1 100 ? -15.751 -5.577  -16.521 1.00 0.00 ? 123 PRO A HD2  3  
ATOM 4184  H HD3  . PRO A 1 100 ? -14.970 -5.886  -18.094 1.00 0.00 ? 123 PRO A HD3  3  
ATOM 4185  N N    . ASP A 1 101 ? -16.875 -1.840  -16.693 1.00 0.00 ? 124 ASP A N    3  
ATOM 4186  C CA   . ASP A 1 101 ? -17.431 -0.664  -16.023 1.00 0.00 ? 124 ASP A CA   3  
ATOM 4187  C C    . ASP A 1 101 ? -16.344 -0.167  -15.084 1.00 0.00 ? 124 ASP A C    3  
ATOM 4188  O O    . ASP A 1 101 ? -16.280 -0.543  -13.913 1.00 0.00 ? 124 ASP A O    3  
ATOM 4189  C CB   . ASP A 1 101 ? -18.760 -0.981  -15.325 1.00 0.00 ? 124 ASP A CB   3  
ATOM 4190  C CG   . ASP A 1 101 ? -19.298 0.174   -14.471 1.00 0.00 ? 124 ASP A CG   3  
ATOM 4191  O OD1  . ASP A 1 101 ? -18.782 1.313   -14.535 1.00 0.00 ? 124 ASP A OD1  3  
ATOM 4192  O OD2  . ASP A 1 101 ? -20.275 -0.071  -13.726 1.00 0.00 ? 124 ASP A OD2  3  
ATOM 4193  H H    . ASP A 1 101 ? -16.282 -2.453  -16.154 1.00 0.00 ? 124 ASP A H    3  
ATOM 4194  H HA   . ASP A 1 101 ? -17.637 0.127   -16.748 1.00 0.00 ? 124 ASP A HA   3  
ATOM 4195  H HB2  . ASP A 1 101 ? -19.504 -1.219  -16.088 1.00 0.00 ? 124 ASP A HB2  3  
ATOM 4196  H HB3  . ASP A 1 101 ? -18.632 -1.859  -14.694 1.00 0.00 ? 124 ASP A HB3  3  
ATOM 4197  N N    . ASN A 1 102 ? -15.414 0.589   -15.662 1.00 0.00 ? 125 ASN A N    3  
ATOM 4198  C CA   . ASN A 1 102 ? -14.154 0.997   -15.049 1.00 0.00 ? 125 ASN A CA   3  
ATOM 4199  C C    . ASN A 1 102 ? -14.261 2.426   -14.515 1.00 0.00 ? 125 ASN A C    3  
ATOM 4200  O O    . ASN A 1 102 ? -13.399 3.270   -14.773 1.00 0.00 ? 125 ASN A O    3  
ATOM 4201  C CB   . ASN A 1 102 ? -13.019 0.818   -16.082 1.00 0.00 ? 125 ASN A CB   3  
ATOM 4202  C CG   . ASN A 1 102 ? -11.756 0.255   -15.451 1.00 0.00 ? 125 ASN A CG   3  
ATOM 4203  O OD1  . ASN A 1 102 ? -11.804 -0.705  -14.689 1.00 0.00 ? 125 ASN A OD1  3  
ATOM 4204  N ND2  . ASN A 1 102 ? -10.602 0.795   -15.790 1.00 0.00 ? 125 ASN A ND2  3  
ATOM 4205  H H    . ASN A 1 102 ? -15.520 0.763   -16.650 1.00 0.00 ? 125 ASN A H    3  
ATOM 4206  H HA   . ASN A 1 102 ? -13.970 0.356   -14.187 1.00 0.00 ? 125 ASN A HA   3  
ATOM 4207  H HB2  . ASN A 1 102 ? -13.319 0.123   -16.859 1.00 0.00 ? 125 ASN A HB2  3  
ATOM 4208  H HB3  . ASN A 1 102 ? -12.808 1.759   -16.593 1.00 0.00 ? 125 ASN A HB3  3  
ATOM 4209  H HD21 . ASN A 1 102 ? -10.551 1.483   -16.534 1.00 0.00 ? 125 ASN A HD21 3  
ATOM 4210  H HD22 . ASN A 1 102 ? -9.763  0.323   -15.471 1.00 0.00 ? 125 ASN A HD22 3  
ATOM 4211  N N    . LYS A 1 103 ? -15.374 2.736   -13.839 1.00 0.00 ? 126 LYS A N    3  
ATOM 4212  C CA   . LYS A 1 103 ? -15.756 4.117   -13.568 1.00 0.00 ? 126 LYS A CA   3  
ATOM 4213  C C    . LYS A 1 103 ? -15.397 4.498   -12.140 1.00 0.00 ? 126 LYS A C    3  
ATOM 4214  O O    . LYS A 1 103 ? -14.250 4.847   -11.864 1.00 0.00 ? 126 LYS A O    3  
ATOM 4215  C CB   . LYS A 1 103 ? -17.234 4.334   -13.949 1.00 0.00 ? 126 LYS A CB   3  
ATOM 4216  C CG   . LYS A 1 103 ? -17.481 5.754   -14.476 1.00 0.00 ? 126 LYS A CG   3  
ATOM 4217  C CD   . LYS A 1 103 ? -17.211 6.876   -13.463 1.00 0.00 ? 126 LYS A CD   3  
ATOM 4218  C CE   . LYS A 1 103 ? -17.329 8.199   -14.213 1.00 0.00 ? 126 LYS A CE   3  
ATOM 4219  N NZ   . LYS A 1 103 ? -16.960 9.370   -13.408 1.00 0.00 ? 126 LYS A NZ   3  
ATOM 4220  H H    . LYS A 1 103 ? -16.050 2.005   -13.644 1.00 0.00 ? 126 LYS A H    3  
ATOM 4221  H HA   . LYS A 1 103 ? -15.159 4.764   -14.216 1.00 0.00 ? 126 LYS A HA   3  
ATOM 4222  H HB2  . LYS A 1 103 ? -17.474 3.657   -14.767 1.00 0.00 ? 126 LYS A HB2  3  
ATOM 4223  H HB3  . LYS A 1 103 ? -17.908 4.093   -13.117 1.00 0.00 ? 126 LYS A HB3  3  
ATOM 4224  H HG2  . LYS A 1 103 ? -16.851 5.907   -15.354 1.00 0.00 ? 126 LYS A HG2  3  
ATOM 4225  H HG3  . LYS A 1 103 ? -18.522 5.816   -14.799 1.00 0.00 ? 126 LYS A HG3  3  
ATOM 4226  H HD2  . LYS A 1 103 ? -17.958 6.817   -12.677 1.00 0.00 ? 126 LYS A HD2  3  
ATOM 4227  H HD3  . LYS A 1 103 ? -16.206 6.803   -13.037 1.00 0.00 ? 126 LYS A HD3  3  
ATOM 4228  H HE2  . LYS A 1 103 ? -16.651 8.153   -15.063 1.00 0.00 ? 126 LYS A HE2  3  
ATOM 4229  H HE3  . LYS A 1 103 ? -18.345 8.321   -14.591 1.00 0.00 ? 126 LYS A HE3  3  
ATOM 4230  H HZ1  . LYS A 1 103 ? -15.972 9.361   -13.175 1.00 0.00 ? 126 LYS A HZ1  3  
ATOM 4231  H HZ2  . LYS A 1 103 ? -17.124 10.208  -13.959 1.00 0.00 ? 126 LYS A HZ2  3  
ATOM 4232  H HZ3  . LYS A 1 103 ? -17.540 9.468   -12.578 1.00 0.00 ? 126 LYS A HZ3  3  
ATOM 4233  N N    . LEU A 1 104 ? -16.353 4.462   -11.207 1.00 0.00 ? 127 LEU A N    3  
ATOM 4234  C CA   . LEU A 1 104 ? -16.055 4.877   -9.850  1.00 0.00 ? 127 LEU A CA   3  
ATOM 4235  C C    . LEU A 1 104 ? -15.208 3.806   -9.221  1.00 0.00 ? 127 LEU A C    3  
ATOM 4236  O O    . LEU A 1 104 ? -14.293 4.144   -8.492  1.00 0.00 ? 127 LEU A O    3  
ATOM 4237  C CB   . LEU A 1 104 ? -17.301 5.084   -8.984  1.00 0.00 ? 127 LEU A CB   3  
ATOM 4238  C CG   . LEU A 1 104 ? -17.678 6.534   -8.685  1.00 0.00 ? 127 LEU A CG   3  
ATOM 4239  C CD1  . LEU A 1 104 ? -16.521 7.418   -8.201  1.00 0.00 ? 127 LEU A CD1  3  
ATOM 4240  C CD2  . LEU A 1 104 ? -18.328 7.217   -9.869  1.00 0.00 ? 127 LEU A CD2  3  
ATOM 4241  H H    . LEU A 1 104 ? -17.198 3.933   -11.379 1.00 0.00 ? 127 LEU A H    3  
ATOM 4242  H HA   . LEU A 1 104 ? -15.458 5.786   -9.883  1.00 0.00 ? 127 LEU A HA   3  
ATOM 4243  H HB2  . LEU A 1 104 ? -18.156 4.560   -9.412  1.00 0.00 ? 127 LEU A HB2  3  
ATOM 4244  H HB3  . LEU A 1 104 ? -17.109 4.640   -8.006  1.00 0.00 ? 127 LEU A HB3  3  
ATOM 4245  H HG   . LEU A 1 104 ? -18.430 6.458   -7.914  1.00 0.00 ? 127 LEU A HG   3  
ATOM 4246  H HD11 . LEU A 1 104 ? -15.969 6.919   -7.408  1.00 0.00 ? 127 LEU A HD11 3  
ATOM 4247  H HD12 . LEU A 1 104 ? -15.838 7.673   -9.009  1.00 0.00 ? 127 LEU A HD12 3  
ATOM 4248  H HD13 . LEU A 1 104 ? -16.912 8.356   -7.816  1.00 0.00 ? 127 LEU A HD13 3  
ATOM 4249  H HD21 . LEU A 1 104 ? -19.127 6.572   -10.227 1.00 0.00 ? 127 LEU A HD21 3  
ATOM 4250  H HD22 . LEU A 1 104 ? -18.742 8.172   -9.538  1.00 0.00 ? 127 LEU A HD22 3  
ATOM 4251  H HD23 . LEU A 1 104 ? -17.571 7.393   -10.628 1.00 0.00 ? 127 LEU A HD23 3  
ATOM 4252  N N    . HIS A 1 105 ? -15.491 2.534   -9.503  1.00 0.00 ? 128 HIS A N    3  
ATOM 4253  C CA   . HIS A 1 105 ? -14.760 1.444   -8.892  1.00 0.00 ? 128 HIS A CA   3  
ATOM 4254  C C    . HIS A 1 105 ? -13.259 1.595   -9.174  1.00 0.00 ? 128 HIS A C    3  
ATOM 4255  O O    . HIS A 1 105 ? -12.467 1.419   -8.256  1.00 0.00 ? 128 HIS A O    3  
ATOM 4256  C CB   . HIS A 1 105 ? -15.379 0.100   -9.320  1.00 0.00 ? 128 HIS A CB   3  
ATOM 4257  C CG   . HIS A 1 105 ? -14.393 -0.932  -9.786  1.00 0.00 ? 128 HIS A CG   3  
ATOM 4258  N ND1  . HIS A 1 105 ? -13.607 -1.741  -8.994  1.00 0.00 ? 128 HIS A ND1  3  
ATOM 4259  C CD2  . HIS A 1 105 ? -14.138 -1.231  -11.094 1.00 0.00 ? 128 HIS A CD2  3  
ATOM 4260  C CE1  . HIS A 1 105 ? -12.884 -2.521  -9.814  1.00 0.00 ? 128 HIS A CE1  3  
ATOM 4261  N NE2  . HIS A 1 105 ? -13.214 -2.284  -11.098 1.00 0.00 ? 128 HIS A NE2  3  
ATOM 4262  H H    . HIS A 1 105 ? -16.251 2.323   -10.136 1.00 0.00 ? 128 HIS A H    3  
ATOM 4263  H HA   . HIS A 1 105 ? -14.892 1.556   -7.818  1.00 0.00 ? 128 HIS A HA   3  
ATOM 4264  H HB2  . HIS A 1 105 ? -15.948 -0.310  -8.484  1.00 0.00 ? 128 HIS A HB2  3  
ATOM 4265  H HB3  . HIS A 1 105 ? -16.080 0.259   -10.142 1.00 0.00 ? 128 HIS A HB3  3  
ATOM 4266  H HD1  . HIS A 1 105 ? -13.579 -1.761  -7.981  1.00 0.00 ? 128 HIS A HD1  3  
ATOM 4267  H HD2  . HIS A 1 105 ? -14.603 -0.728  -11.938 1.00 0.00 ? 128 HIS A HD2  3  
ATOM 4268  H HE1  . HIS A 1 105 ? -12.161 -3.255  -9.480  1.00 0.00 ? 128 HIS A HE1  3  
ATOM 4269  N N    . GLN A 1 106 ? -12.891 2.020   -10.388 1.00 0.00 ? 129 GLN A N    3  
ATOM 4270  C CA   . GLN A 1 106 ? -11.535 2.370   -10.794 1.00 0.00 ? 129 GLN A CA   3  
ATOM 4271  C C    . GLN A 1 106 ? -10.995 3.552   -9.992  1.00 0.00 ? 129 GLN A C    3  
ATOM 4272  O O    . GLN A 1 106 ? -9.946  3.429   -9.360  1.00 0.00 ? 129 GLN A O    3  
ATOM 4273  C CB   . GLN A 1 106 ? -11.564 2.652   -12.295 1.00 0.00 ? 129 GLN A CB   3  
ATOM 4274  C CG   . GLN A 1 106 ? -10.322 3.244   -12.943 1.00 0.00 ? 129 GLN A CG   3  
ATOM 4275  C CD   . GLN A 1 106 ? -10.341 4.759   -13.142 1.00 0.00 ? 129 GLN A CD   3  
ATOM 4276  O OE1  . GLN A 1 106 ? -9.453  5.481   -12.683 1.00 0.00 ? 129 GLN A OE1  3  
ATOM 4277  N NE2  . GLN A 1 106 ? -11.312 5.266   -13.883 1.00 0.00 ? 129 GLN A NE2  3  
ATOM 4278  H H    . GLN A 1 106 ? -13.618 2.181   -11.066 1.00 0.00 ? 129 GLN A H    3  
ATOM 4279  H HA   . GLN A 1 106 ? -10.881 1.517   -10.628 1.00 0.00 ? 129 GLN A HA   3  
ATOM 4280  H HB2  . GLN A 1 106 ? -11.803 1.715   -12.801 1.00 0.00 ? 129 GLN A HB2  3  
ATOM 4281  H HB3  . GLN A 1 106 ? -12.347 3.345   -12.518 1.00 0.00 ? 129 GLN A HB3  3  
ATOM 4282  H HG2  . GLN A 1 106 ? -9.420  2.927   -12.423 1.00 0.00 ? 129 GLN A HG2  3  
ATOM 4283  H HG3  . GLN A 1 106 ? -10.356 2.819   -13.929 1.00 0.00 ? 129 GLN A HG3  3  
ATOM 4284  H HE21 . GLN A 1 106 ? -12.032 4.647   -14.260 1.00 0.00 ? 129 GLN A HE21 3  
ATOM 4285  H HE22 . GLN A 1 106 ? -11.342 6.252   -14.107 1.00 0.00 ? 129 GLN A HE22 3  
ATOM 4286  N N    . GLN A 1 107 ? -11.683 4.700   -10.019 1.00 0.00 ? 130 GLN A N    3  
ATOM 4287  C CA   . GLN A 1 107 ? -11.196 5.891   -9.332  1.00 0.00 ? 130 GLN A CA   3  
ATOM 4288  C C    . GLN A 1 107 ? -11.040 5.649   -7.820  1.00 0.00 ? 130 GLN A C    3  
ATOM 4289  O O    . GLN A 1 107 ? -10.031 6.057   -7.241  1.00 0.00 ? 130 GLN A O    3  
ATOM 4290  C CB   . GLN A 1 107 ? -12.109 7.104   -9.611  1.00 0.00 ? 130 GLN A CB   3  
ATOM 4291  C CG   . GLN A 1 107 ? -11.668 7.916   -10.842 1.00 0.00 ? 130 GLN A CG   3  
ATOM 4292  C CD   . GLN A 1 107 ? -11.897 9.417   -10.631 1.00 0.00 ? 130 GLN A CD   3  
ATOM 4293  O OE1  . GLN A 1 107 ? -10.954 10.203  -10.554 1.00 0.00 ? 130 GLN A OE1  3  
ATOM 4294  N NE2  . GLN A 1 107 ? -13.144 9.834   -10.482 1.00 0.00 ? 130 GLN A NE2  3  
ATOM 4295  H H    . GLN A 1 107 ? -12.532 4.771   -10.567 1.00 0.00 ? 130 GLN A H    3  
ATOM 4296  H HA   . GLN A 1 107 ? -10.196 6.085   -9.728  1.00 0.00 ? 130 GLN A HA   3  
ATOM 4297  H HB2  . GLN A 1 107 ? -13.150 6.789   -9.752  1.00 0.00 ? 130 GLN A HB2  3  
ATOM 4298  H HB3  . GLN A 1 107 ? -12.068 7.758   -8.736  1.00 0.00 ? 130 GLN A HB3  3  
ATOM 4299  H HG2  . GLN A 1 107 ? -10.606 7.751   -11.025 1.00 0.00 ? 130 GLN A HG2  3  
ATOM 4300  H HG3  . GLN A 1 107 ? -12.215 7.572   -11.723 1.00 0.00 ? 130 GLN A HG3  3  
ATOM 4301  H HE21 . GLN A 1 107 ? -13.904 9.181   -10.544 1.00 0.00 ? 130 GLN A HE21 3  
ATOM 4302  H HE22 . GLN A 1 107 ? -13.329 10.825  -10.351 1.00 0.00 ? 130 GLN A HE22 3  
ATOM 4303  N N    . VAL A 1 108 ? -12.004 4.965   -7.193  1.00 0.00 ? 131 VAL A N    3  
ATOM 4304  C CA   . VAL A 1 108 ? -11.918 4.484   -5.819  1.00 0.00 ? 131 VAL A CA   3  
ATOM 4305  C C    . VAL A 1 108 ? -10.665 3.631   -5.703  1.00 0.00 ? 131 VAL A C    3  
ATOM 4306  O O    . VAL A 1 108 ? -9.829  3.943   -4.864  1.00 0.00 ? 131 VAL A O    3  
ATOM 4307  C CB   . VAL A 1 108 ? -13.175 3.688   -5.402  1.00 0.00 ? 131 VAL A CB   3  
ATOM 4308  C CG1  . VAL A 1 108 ? -13.056 3.097   -3.985  1.00 0.00 ? 131 VAL A CG1  3  
ATOM 4309  C CG2  . VAL A 1 108 ? -14.446 4.540   -5.400  1.00 0.00 ? 131 VAL A CG2  3  
ATOM 4310  H H    . VAL A 1 108 ? -12.810 4.667   -7.730  1.00 0.00 ? 131 VAL A H    3  
ATOM 4311  H HA   . VAL A 1 108 ? -11.808 5.342   -5.158  1.00 0.00 ? 131 VAL A HA   3  
ATOM 4312  H HB   . VAL A 1 108 ? -13.321 2.873   -6.111  1.00 0.00 ? 131 VAL A HB   3  
ATOM 4313  H HG11 . VAL A 1 108 ? -13.959 2.543   -3.731  1.00 0.00 ? 131 VAL A HG11 3  
ATOM 4314  H HG12 . VAL A 1 108 ? -12.207 2.417   -3.919  1.00 0.00 ? 131 VAL A HG12 3  
ATOM 4315  H HG13 . VAL A 1 108 ? -12.914 3.896   -3.255  1.00 0.00 ? 131 VAL A HG13 3  
ATOM 4316  H HG21 . VAL A 1 108 ? -14.466 5.174   -4.515  1.00 0.00 ? 131 VAL A HG21 3  
ATOM 4317  H HG22 . VAL A 1 108 ? -14.498 5.173   -6.280  1.00 0.00 ? 131 VAL A HG22 3  
ATOM 4318  H HG23 . VAL A 1 108 ? -15.302 3.865   -5.401  1.00 0.00 ? 131 VAL A HG23 3  
ATOM 4319  N N    . LEU A 1 109 ? -10.518 2.584   -6.529  1.00 0.00 ? 132 LEU A N    3  
ATOM 4320  C CA   . LEU A 1 109 ? -9.428  1.621   -6.406  1.00 0.00 ? 132 LEU A CA   3  
ATOM 4321  C C    . LEU A 1 109 ? -8.099  2.346   -6.348  1.00 0.00 ? 132 LEU A C    3  
ATOM 4322  O O    . LEU A 1 109 ? -7.267  2.011   -5.511  1.00 0.00 ? 132 LEU A O    3  
ATOM 4323  C CB   . LEU A 1 109 ? -9.397  0.588   -7.560  1.00 0.00 ? 132 LEU A CB   3  
ATOM 4324  C CG   . LEU A 1 109 ? -9.615  -0.854  -7.082  1.00 0.00 ? 132 LEU A CG   3  
ATOM 4325  C CD1  . LEU A 1 109 ? -9.618  -1.862  -8.235  1.00 0.00 ? 132 LEU A CD1  3  
ATOM 4326  C CD2  . LEU A 1 109 ? -8.581  -1.258  -6.023  1.00 0.00 ? 132 LEU A CD2  3  
ATOM 4327  H H    . LEU A 1 109 ? -11.224 2.400   -7.236  1.00 0.00 ? 132 LEU A H    3  
ATOM 4328  H HA   . LEU A 1 109 ? -9.572  1.117   -5.452  1.00 0.00 ? 132 LEU A HA   3  
ATOM 4329  H HB2  . LEU A 1 109 ? -10.153 0.829   -8.299  1.00 0.00 ? 132 LEU A HB2  3  
ATOM 4330  H HB3  . LEU A 1 109 ? -8.439  0.638   -8.079  1.00 0.00 ? 132 LEU A HB3  3  
ATOM 4331  H HG   . LEU A 1 109 ? -10.597 -0.910  -6.643  1.00 0.00 ? 132 LEU A HG   3  
ATOM 4332  H HD11 . LEU A 1 109 ? -8.613  -2.040  -8.595  1.00 0.00 ? 132 LEU A HD11 3  
ATOM 4333  H HD12 . LEU A 1 109 ? -10.022 -2.815  -7.885  1.00 0.00 ? 132 LEU A HD12 3  
ATOM 4334  H HD13 . LEU A 1 109 ? -10.238 -1.495  -9.055  1.00 0.00 ? 132 LEU A HD13 3  
ATOM 4335  H HD21 . LEU A 1 109 ? -8.637  -2.330  -5.866  1.00 0.00 ? 132 LEU A HD21 3  
ATOM 4336  H HD22 . LEU A 1 109 ? -7.580  -0.974  -6.340  1.00 0.00 ? 132 LEU A HD22 3  
ATOM 4337  H HD23 . LEU A 1 109 ? -8.787  -0.775  -5.070  1.00 0.00 ? 132 LEU A HD23 3  
ATOM 4338  N N    . TRP A 1 110 ? -7.914  3.336   -7.220  1.00 0.00 ? 133 TRP A N    3  
ATOM 4339  C CA   . TRP A 1 110 ? -6.711  4.138   -7.284  1.00 0.00 ? 133 TRP A CA   3  
ATOM 4340  C C    . TRP A 1 110 ? -6.485  4.929   -5.998  1.00 0.00 ? 133 TRP A C    3  
ATOM 4341  O O    . TRP A 1 110 ? -5.455  4.737   -5.360  1.00 0.00 ? 133 TRP A O    3  
ATOM 4342  C CB   . TRP A 1 110 ? -6.726  5.005   -8.545  1.00 0.00 ? 133 TRP A CB   3  
ATOM 4343  C CG   . TRP A 1 110 ? -5.468  4.921   -9.346  1.00 0.00 ? 133 TRP A CG   3  
ATOM 4344  C CD1  . TRP A 1 110 ? -4.684  5.973   -9.659  1.00 0.00 ? 133 TRP A CD1  3  
ATOM 4345  C CD2  . TRP A 1 110 ? -4.801  3.736   -9.890  1.00 0.00 ? 133 TRP A CD2  3  
ATOM 4346  N NE1  . TRP A 1 110 ? -3.619  5.543   -10.423 1.00 0.00 ? 133 TRP A NE1  3  
ATOM 4347  C CE2  . TRP A 1 110 ? -3.699  4.187   -10.679 1.00 0.00 ? 133 TRP A CE2  3  
ATOM 4348  C CE3  . TRP A 1 110 ? -4.933  2.334   -9.713  1.00 0.00 ? 133 TRP A CE3  3  
ATOM 4349  C CZ2  . TRP A 1 110 ? -2.902  3.302   -11.420 1.00 0.00 ? 133 TRP A CZ2  3  
ATOM 4350  C CZ3  . TRP A 1 110 ? -4.139  1.442   -10.461 1.00 0.00 ? 133 TRP A CZ3  3  
ATOM 4351  C CH2  . TRP A 1 110 ? -3.159  1.923   -11.349 1.00 0.00 ? 133 TRP A CH2  3  
ATOM 4352  H H    . TRP A 1 110 ? -8.661  3.528   -7.881  1.00 0.00 ? 133 TRP A H    3  
ATOM 4353  H HA   . TRP A 1 110 ? -5.876  3.449   -7.362  1.00 0.00 ? 133 TRP A HA   3  
ATOM 4354  H HB2  . TRP A 1 110 ? -7.537  4.692   -9.203  1.00 0.00 ? 133 TRP A HB2  3  
ATOM 4355  H HB3  . TRP A 1 110 ? -6.920  6.044   -8.278  1.00 0.00 ? 133 TRP A HB3  3  
ATOM 4356  H HD1  . TRP A 1 110 ? -4.877  6.990   -9.339  1.00 0.00 ? 133 TRP A HD1  3  
ATOM 4357  H HE1  . TRP A 1 110 ? -2.819  6.146   -10.623 1.00 0.00 ? 133 TRP A HE1  3  
ATOM 4358  H HE3  . TRP A 1 110 ? -5.610  1.931   -8.956  1.00 0.00 ? 133 TRP A HE3  3  
ATOM 4359  H HZ2  . TRP A 1 110 ? -2.072  3.665   -12.012 1.00 0.00 ? 133 TRP A HZ2  3  
ATOM 4360  H HZ3  . TRP A 1 110 ? -4.256  0.374   -10.339 1.00 0.00 ? 133 TRP A HZ3  3  
ATOM 4361  H HH2  . TRP A 1 110 ? -2.556  1.229   -11.923 1.00 0.00 ? 133 TRP A HH2  3  
ATOM 4362  N N    . ARG A 1 111 ? -7.424  5.783   -5.568  1.00 0.00 ? 134 ARG A N    3  
ATOM 4363  C CA   . ARG A 1 111 ? -7.239  6.532   -4.316  1.00 0.00 ? 134 ARG A CA   3  
ATOM 4364  C C    . ARG A 1 111 ? -7.000  5.585   -3.139  1.00 0.00 ? 134 ARG A C    3  
ATOM 4365  O O    . ARG A 1 111 ? -6.219  5.908   -2.247  1.00 0.00 ? 134 ARG A O    3  
ATOM 4366  C CB   . ARG A 1 111 ? -8.432  7.472   -4.066  1.00 0.00 ? 134 ARG A CB   3  
ATOM 4367  C CG   . ARG A 1 111 ? -8.456  8.131   -2.670  1.00 0.00 ? 134 ARG A CG   3  
ATOM 4368  C CD   . ARG A 1 111 ? -7.223  9.012   -2.425  1.00 0.00 ? 134 ARG A CD   3  
ATOM 4369  N NE   . ARG A 1 111 ? -7.090  9.418   -1.013  1.00 0.00 ? 134 ARG A NE   3  
ATOM 4370  C CZ   . ARG A 1 111 ? -6.692  10.622  -0.586  1.00 0.00 ? 134 ARG A CZ   3  
ATOM 4371  N NH1  . ARG A 1 111 ? -6.769  11.685  -1.381  1.00 0.00 ? 134 ARG A NH1  3  
ATOM 4372  N NH2  . ARG A 1 111 ? -6.176  10.758  0.624   1.00 0.00 ? 134 ARG A NH2  3  
ATOM 4373  H H    . ARG A 1 111 ? -8.292  5.871   -6.087  1.00 0.00 ? 134 ARG A H    3  
ATOM 4374  H HA   . ARG A 1 111 ? -6.338  7.133   -4.423  1.00 0.00 ? 134 ARG A HA   3  
ATOM 4375  H HB2  . ARG A 1 111 ? -8.435  8.250   -4.827  1.00 0.00 ? 134 ARG A HB2  3  
ATOM 4376  H HB3  . ARG A 1 111 ? -9.347  6.902   -4.195  1.00 0.00 ? 134 ARG A HB3  3  
ATOM 4377  H HG2  . ARG A 1 111 ? -9.357  8.741   -2.588  1.00 0.00 ? 134 ARG A HG2  3  
ATOM 4378  H HG3  . ARG A 1 111 ? -8.512  7.364   -1.898  1.00 0.00 ? 134 ARG A HG3  3  
ATOM 4379  H HD2  . ARG A 1 111 ? -6.319  8.464   -2.689  1.00 0.00 ? 134 ARG A HD2  3  
ATOM 4380  H HD3  . ARG A 1 111 ? -7.276  9.881   -3.076  1.00 0.00 ? 134 ARG A HD3  3  
ATOM 4381  H HE   . ARG A 1 111 ? -7.094  8.658   -0.339  1.00 0.00 ? 134 ARG A HE   3  
ATOM 4382  H HH11 . ARG A 1 111 ? -7.320  11.622  -2.233  1.00 0.00 ? 134 ARG A HH11 3  
ATOM 4383  H HH12 . ARG A 1 111 ? -6.544  12.611  -1.054  1.00 0.00 ? 134 ARG A HH12 3  
ATOM 4384  H HH21 . ARG A 1 111 ? -6.161  9.961   1.267   1.00 0.00 ? 134 ARG A HH21 3  
ATOM 4385  H HH22 . ARG A 1 111 ? -5.683  11.584  0.957   1.00 0.00 ? 134 ARG A HH22 3  
ATOM 4386  N N    . LEU A 1 112 ? -7.667  4.432   -3.145  1.00 0.00 ? 135 LEU A N    3  
ATOM 4387  C CA   . LEU A 1 112 ? -7.566  3.424   -2.111  1.00 0.00 ? 135 LEU A CA   3  
ATOM 4388  C C    . LEU A 1 112 ? -6.116  2.957   -2.101  1.00 0.00 ? 135 LEU A C    3  
ATOM 4389  O O    . LEU A 1 112 ? -5.429  3.197   -1.113  1.00 0.00 ? 135 LEU A O    3  
ATOM 4390  C CB   . LEU A 1 112 ? -8.617  2.319   -2.356  1.00 0.00 ? 135 LEU A CB   3  
ATOM 4391  C CG   . LEU A 1 112 ? -9.091  1.550   -1.121  1.00 0.00 ? 135 LEU A CG   3  
ATOM 4392  C CD1  . LEU A 1 112 ? -10.586 1.216   -1.189  1.00 0.00 ? 135 LEU A CD1  3  
ATOM 4393  C CD2  . LEU A 1 112 ? -8.380  0.221   -1.054  1.00 0.00 ? 135 LEU A CD2  3  
ATOM 4394  H H    . LEU A 1 112 ? -8.279  4.239   -3.932  1.00 0.00 ? 135 LEU A H    3  
ATOM 4395  H HA   . LEU A 1 112 ? -7.778  3.909   -1.156  1.00 0.00 ? 135 LEU A HA   3  
ATOM 4396  H HB2  . LEU A 1 112 ? -9.502  2.779   -2.734  1.00 0.00 ? 135 LEU A HB2  3  
ATOM 4397  H HB3  . LEU A 1 112 ? -8.292  1.640   -3.136  1.00 0.00 ? 135 LEU A HB3  3  
ATOM 4398  H HG   . LEU A 1 112 ? -8.878  2.122   -0.221  1.00 0.00 ? 135 LEU A HG   3  
ATOM 4399  H HD11 . LEU A 1 112 ? -11.203 2.100   -1.059  1.00 0.00 ? 135 LEU A HD11 3  
ATOM 4400  H HD12 . LEU A 1 112 ? -10.835 0.758   -2.143  1.00 0.00 ? 135 LEU A HD12 3  
ATOM 4401  H HD13 . LEU A 1 112 ? -10.822 0.512   -0.397  1.00 0.00 ? 135 LEU A HD13 3  
ATOM 4402  H HD21 . LEU A 1 112 ? -7.332  0.397   -1.259  1.00 0.00 ? 135 LEU A HD21 3  
ATOM 4403  H HD22 . LEU A 1 112 ? -8.523  -0.208  -0.060  1.00 0.00 ? 135 LEU A HD22 3  
ATOM 4404  H HD23 . LEU A 1 112 ? -8.790  -0.457  -1.800  1.00 0.00 ? 135 LEU A HD23 3  
ATOM 4405  N N    . VAL A 1 113 ? -5.614  2.361   -3.190  1.00 0.00 ? 136 VAL A N    3  
ATOM 4406  C CA   . VAL A 1 113 ? -4.261  1.809   -3.251  1.00 0.00 ? 136 VAL A CA   3  
ATOM 4407  C C    . VAL A 1 113 ? -3.163  2.873   -3.081  1.00 0.00 ? 136 VAL A C    3  
ATOM 4408  O O    . VAL A 1 113 ? -2.116  2.576   -2.500  1.00 0.00 ? 136 VAL A O    3  
ATOM 4409  C CB   . VAL A 1 113 ? -4.125  0.833   -4.441  1.00 0.00 ? 136 VAL A CB   3  
ATOM 4410  C CG1  . VAL A 1 113 ? -4.154  1.373   -5.847  1.00 0.00 ? 136 VAL A CG1  3  
ATOM 4411  C CG2  . VAL A 1 113 ? -2.858  -0.014  -4.323  1.00 0.00 ? 136 VAL A CG2  3  
ATOM 4412  H H    . VAL A 1 113 ? -6.198  2.268   -4.016  1.00 0.00 ? 136 VAL A H    3  
ATOM 4413  H HA   . VAL A 1 113 ? -4.162  1.180   -2.381  1.00 0.00 ? 136 VAL A HA   3  
ATOM 4414  H HB   . VAL A 1 113 ? -4.998  0.188   -4.427  1.00 0.00 ? 136 VAL A HB   3  
ATOM 4415  H HG11 . VAL A 1 113 ? -4.413  0.530   -6.500  1.00 0.00 ? 136 VAL A HG11 3  
ATOM 4416  H HG12 . VAL A 1 113 ? -4.907  2.144   -5.898  1.00 0.00 ? 136 VAL A HG12 3  
ATOM 4417  H HG13 . VAL A 1 113 ? -3.189  1.797   -6.098  1.00 0.00 ? 136 VAL A HG13 3  
ATOM 4418  H HG21 . VAL A 1 113 ? -2.879  -0.809  -5.063  1.00 0.00 ? 136 VAL A HG21 3  
ATOM 4419  H HG22 . VAL A 1 113 ? -1.975  0.613   -4.488  1.00 0.00 ? 136 VAL A HG22 3  
ATOM 4420  H HG23 . VAL A 1 113 ? -2.813  -0.447  -3.331  1.00 0.00 ? 136 VAL A HG23 3  
ATOM 4421  N N    . GLN A 1 114 ? -3.421  4.129   -3.457  1.00 0.00 ? 137 GLN A N    3  
ATOM 4422  C CA   . GLN A 1 114 ? -2.552  5.261   -3.131  1.00 0.00 ? 137 GLN A CA   3  
ATOM 4423  C C    . GLN A 1 114 ? -2.351  5.405   -1.615  1.00 0.00 ? 137 GLN A C    3  
ATOM 4424  O O    . GLN A 1 114 ? -1.217  5.631   -1.172  1.00 0.00 ? 137 GLN A O    3  
ATOM 4425  C CB   . GLN A 1 114 ? -3.085  6.575   -3.733  1.00 0.00 ? 137 GLN A CB   3  
ATOM 4426  C CG   . GLN A 1 114 ? -2.788  6.692   -5.236  1.00 0.00 ? 137 GLN A CG   3  
ATOM 4427  C CD   . GLN A 1 114 ? -3.438  7.918   -5.870  1.00 0.00 ? 137 GLN A CD   3  
ATOM 4428  O OE1  . GLN A 1 114 ? -4.649  8.110   -5.818  1.00 0.00 ? 137 GLN A OE1  3  
ATOM 4429  N NE2  . GLN A 1 114 ? -2.667  8.772   -6.519  1.00 0.00 ? 137 GLN A NE2  3  
ATOM 4430  H H    . GLN A 1 114 ? -4.276  4.288   -3.983  1.00 0.00 ? 137 GLN A H    3  
ATOM 4431  H HA   . GLN A 1 114 ? -1.575  5.059   -3.565  1.00 0.00 ? 137 GLN A HA   3  
ATOM 4432  H HB2  . GLN A 1 114 ? -4.159  6.651   -3.568  1.00 0.00 ? 137 GLN A HB2  3  
ATOM 4433  H HB3  . GLN A 1 114 ? -2.608  7.413   -3.222  1.00 0.00 ? 137 GLN A HB3  3  
ATOM 4434  H HG2  . GLN A 1 114 ? -1.710  6.721   -5.394  1.00 0.00 ? 137 GLN A HG2  3  
ATOM 4435  H HG3  . GLN A 1 114 ? -3.173  5.820   -5.748  1.00 0.00 ? 137 GLN A HG3  3  
ATOM 4436  H HE21 . GLN A 1 114 ? -1.664  8.611   -6.620  1.00 0.00 ? 137 GLN A HE21 3  
ATOM 4437  H HE22 . GLN A 1 114 ? -3.098  9.601   -6.888  1.00 0.00 ? 137 GLN A HE22 3  
ATOM 4438  N N    . GLU A 1 115 ? -3.410  5.280   -0.810  1.00 0.00 ? 138 GLU A N    3  
ATOM 4439  C CA   . GLU A 1 115 ? -3.271  5.230   0.642   1.00 0.00 ? 138 GLU A CA   3  
ATOM 4440  C C    . GLU A 1 115 ? -2.738  3.863   1.091   1.00 0.00 ? 138 GLU A C    3  
ATOM 4441  O O    . GLU A 1 115 ? -1.925  3.814   2.005   1.00 0.00 ? 138 GLU A O    3  
ATOM 4442  C CB   . GLU A 1 115 ? -4.583  5.604   1.354   1.00 0.00 ? 138 GLU A CB   3  
ATOM 4443  C CG   . GLU A 1 115 ? -4.375  5.812   2.865   1.00 0.00 ? 138 GLU A CG   3  
ATOM 4444  C CD   . GLU A 1 115 ? -3.385  6.939   3.207   1.00 0.00 ? 138 GLU A CD   3  
ATOM 4445  O OE1  . GLU A 1 115 ? -3.771  8.128   3.081   1.00 0.00 ? 138 GLU A OE1  3  
ATOM 4446  O OE2  . GLU A 1 115 ? -2.224  6.658   3.590   1.00 0.00 ? 138 GLU A OE2  3  
ATOM 4447  H H    . GLU A 1 115 ? -4.326  5.105   -1.217  1.00 0.00 ? 138 GLU A H    3  
ATOM 4448  H HA   . GLU A 1 115 ? -2.533  5.980   0.922   1.00 0.00 ? 138 GLU A HA   3  
ATOM 4449  H HB2  . GLU A 1 115 ? -4.967  6.527   0.922   1.00 0.00 ? 138 GLU A HB2  3  
ATOM 4450  H HB3  . GLU A 1 115 ? -5.330  4.819   1.212   1.00 0.00 ? 138 GLU A HB3  3  
ATOM 4451  H HG2  . GLU A 1 115 ? -5.335  6.051   3.325   1.00 0.00 ? 138 GLU A HG2  3  
ATOM 4452  H HG3  . GLU A 1 115 ? -4.032  4.872   3.286   1.00 0.00 ? 138 GLU A HG3  3  
ATOM 4453  N N    . LEU A 1 116 ? -3.114  2.749   0.454   1.00 0.00 ? 139 LEU A N    3  
ATOM 4454  C CA   . LEU A 1 116 ? -2.763  1.423   0.977   1.00 0.00 ? 139 LEU A CA   3  
ATOM 4455  C C    . LEU A 1 116 ? -1.259  1.185   1.007   1.00 0.00 ? 139 LEU A C    3  
ATOM 4456  O O    . LEU A 1 116 ? -0.769  0.592   1.969   1.00 0.00 ? 139 LEU A O    3  
ATOM 4457  C CB   . LEU A 1 116 ? -3.393  0.258   0.200   1.00 0.00 ? 139 LEU A CB   3  
ATOM 4458  C CG   . LEU A 1 116 ? -4.923  0.214   0.097   1.00 0.00 ? 139 LEU A CG   3  
ATOM 4459  C CD1  . LEU A 1 116 ? -5.390  -1.166  -0.365  1.00 0.00 ? 139 LEU A CD1  3  
ATOM 4460  C CD2  . LEU A 1 116 ? -5.635  0.687   1.354   1.00 0.00 ? 139 LEU A CD2  3  
ATOM 4461  H H    . LEU A 1 116 ? -3.815  2.843   -0.274  1.00 0.00 ? 139 LEU A H    3  
ATOM 4462  H HA   . LEU A 1 116 ? -3.111  1.372   2.011   1.00 0.00 ? 139 LEU A HA   3  
ATOM 4463  H HB2  . LEU A 1 116 ? -2.971  0.222   -0.805  1.00 0.00 ? 139 LEU A HB2  3  
ATOM 4464  H HB3  . LEU A 1 116 ? -3.075  -0.645  0.720   1.00 0.00 ? 139 LEU A HB3  3  
ATOM 4465  H HG   . LEU A 1 116 ? -5.233  0.885   -0.680  1.00 0.00 ? 139 LEU A HG   3  
ATOM 4466  H HD11 . LEU A 1 116 ? -5.191  -1.249  -1.435  1.00 0.00 ? 139 LEU A HD11 3  
ATOM 4467  H HD12 . LEU A 1 116 ? -4.891  -1.958  0.186   1.00 0.00 ? 139 LEU A HD12 3  
ATOM 4468  H HD13 . LEU A 1 116 ? -6.466  -1.259  -0.220  1.00 0.00 ? 139 LEU A HD13 3  
ATOM 4469  H HD21 . LEU A 1 116 ? -5.206  0.204   2.228   1.00 0.00 ? 139 LEU A HD21 3  
ATOM 4470  H HD22 . LEU A 1 116 ? -5.517  1.768   1.422   1.00 0.00 ? 139 LEU A HD22 3  
ATOM 4471  H HD23 . LEU A 1 116 ? -6.700  0.487   1.276   1.00 0.00 ? 139 LEU A HD23 3  
ATOM 4472  N N    . CYS A 1 117 ? -0.528  1.596   -0.035  1.00 0.00 ? 140 CYS A N    3  
ATOM 4473  C CA   . CYS A 1 117 ? 0.924   1.458   -0.016  1.00 0.00 ? 140 CYS A CA   3  
ATOM 4474  C C    . CYS A 1 117 ? 1.528   2.400   1.034   1.00 0.00 ? 140 CYS A C    3  
ATOM 4475  O O    . CYS A 1 117 ? 2.533   2.058   1.656   1.00 0.00 ? 140 CYS A O    3  
ATOM 4476  C CB   . CYS A 1 117 ? 1.518   1.724   -1.402  1.00 0.00 ? 140 CYS A CB   3  
ATOM 4477  S SG   . CYS A 1 117 ? 0.731   0.835   -2.780  1.00 0.00 ? 140 CYS A SG   3  
ATOM 4478  H H    . CYS A 1 117 ? -0.990  2.033   -0.827  1.00 0.00 ? 140 CYS A H    3  
ATOM 4479  H HA   . CYS A 1 117 ? 1.159   0.434   0.264   1.00 0.00 ? 140 CYS A HA   3  
ATOM 4480  H HB2  . CYS A 1 117 ? 1.443   2.790   -1.598  1.00 0.00 ? 140 CYS A HB2  3  
ATOM 4481  H HB3  . CYS A 1 117 ? 2.580   1.473   -1.374  1.00 0.00 ? 140 CYS A HB3  3  
ATOM 4482  N N    . SER A 1 118 ? 0.927   3.585   1.198   1.00 0.00 ? 141 SER A N    3  
ATOM 4483  C CA   . SER A 1 118 ? 1.236   4.586   2.209   1.00 0.00 ? 141 SER A CA   3  
ATOM 4484  C C    . SER A 1 118 ? 1.007   4.087   3.650   1.00 0.00 ? 141 SER A C    3  
ATOM 4485  O O    . SER A 1 118 ? 1.964   3.598   4.253   1.00 0.00 ? 141 SER A O    3  
ATOM 4486  C CB   . SER A 1 118 ? 0.454   5.870   1.893   1.00 0.00 ? 141 SER A CB   3  
ATOM 4487  O OG   . SER A 1 118 ? 0.715   6.315   0.576   1.00 0.00 ? 141 SER A OG   3  
ATOM 4488  H H    . SER A 1 118 ? 0.152   3.804   0.589   1.00 0.00 ? 141 SER A H    3  
ATOM 4489  H HA   . SER A 1 118 ? 2.295   4.814   2.125   1.00 0.00 ? 141 SER A HA   3  
ATOM 4490  H HB2  . SER A 1 118 ? -0.612  5.718   1.989   1.00 0.00 ? 141 SER A HB2  3  
ATOM 4491  H HB3  . SER A 1 118 ? 0.728   6.626   2.619   1.00 0.00 ? 141 SER A HB3  3  
ATOM 4492  H HG   . SER A 1 118 ? 0.017   5.966   -0.013  1.00 0.00 ? 141 SER A HG   3  
ATOM 4493  N N    . LEU A 1 119 ? -0.200  4.295   4.208   1.00 0.00 ? 142 LEU A N    3  
ATOM 4494  C CA   . LEU A 1 119 ? -0.816  3.916   5.498   1.00 0.00 ? 142 LEU A CA   3  
ATOM 4495  C C    . LEU A 1 119 ? 0.107   3.669   6.706   1.00 0.00 ? 142 LEU A C    3  
ATOM 4496  O O    . LEU A 1 119 ? -0.162  2.847   7.593   1.00 0.00 ? 142 LEU A O    3  
ATOM 4497  C CB   . LEU A 1 119 ? -1.865  2.805   5.262   1.00 0.00 ? 142 LEU A CB   3  
ATOM 4498  C CG   . LEU A 1 119 ? -3.273  3.295   5.655   1.00 0.00 ? 142 LEU A CG   3  
ATOM 4499  C CD1  . LEU A 1 119 ? -4.351  2.446   4.975   1.00 0.00 ? 142 LEU A CD1  3  
ATOM 4500  C CD2  . LEU A 1 119 ? -3.474  3.327   7.174   1.00 0.00 ? 142 LEU A CD2  3  
ATOM 4501  H H    . LEU A 1 119 ? -0.890  4.706   3.582   1.00 0.00 ? 142 LEU A H    3  
ATOM 4502  H HA   . LEU A 1 119 ? -1.366  4.813   5.781   1.00 0.00 ? 142 LEU A HA   3  
ATOM 4503  H HB2  . LEU A 1 119 ? -1.871  2.535   4.206   1.00 0.00 ? 142 LEU A HB2  3  
ATOM 4504  H HB3  . LEU A 1 119 ? -1.614  1.894   5.807   1.00 0.00 ? 142 LEU A HB3  3  
ATOM 4505  H HG   . LEU A 1 119 ? -3.407  4.315   5.300   1.00 0.00 ? 142 LEU A HG   3  
ATOM 4506  H HD11 . LEU A 1 119 ? -4.289  1.412   5.305   1.00 0.00 ? 142 LEU A HD11 3  
ATOM 4507  H HD12 . LEU A 1 119 ? -5.343  2.836   5.201   1.00 0.00 ? 142 LEU A HD12 3  
ATOM 4508  H HD13 . LEU A 1 119 ? -4.214  2.475   3.894   1.00 0.00 ? 142 LEU A HD13 3  
ATOM 4509  H HD21 . LEU A 1 119 ? -2.837  4.092   7.619   1.00 0.00 ? 142 LEU A HD21 3  
ATOM 4510  H HD22 . LEU A 1 119 ? -4.511  3.555   7.417   1.00 0.00 ? 142 LEU A HD22 3  
ATOM 4511  H HD23 . LEU A 1 119 ? -3.223  2.363   7.610   1.00 0.00 ? 142 LEU A HD23 3  
ATOM 4512  N N    . LYS A 1 120 ? 1.214   4.399   6.733   1.00 0.00 ? 143 LYS A N    3  
ATOM 4513  C CA   . LYS A 1 120 ? 2.351   4.313   7.635   1.00 0.00 ? 143 LYS A CA   3  
ATOM 4514  C C    . LYS A 1 120 ? 3.326   5.397   7.187   1.00 0.00 ? 143 LYS A C    3  
ATOM 4515  O O    . LYS A 1 120 ? 3.750   6.209   8.006   1.00 0.00 ? 143 LYS A O    3  
ATOM 4516  C CB   . LYS A 1 120 ? 3.014   2.919   7.557   1.00 0.00 ? 143 LYS A CB   3  
ATOM 4517  C CG   . LYS A 1 120 ? 4.174   2.782   8.552   1.00 0.00 ? 143 LYS A CG   3  
ATOM 4518  C CD   . LYS A 1 120 ? 5.028   1.536   8.278   1.00 0.00 ? 143 LYS A CD   3  
ATOM 4519  C CE   . LYS A 1 120 ? 6.422   1.768   8.862   1.00 0.00 ? 143 LYS A CE   3  
ATOM 4520  N NZ   . LYS A 1 120 ? 7.307   0.597   8.725   1.00 0.00 ? 143 LYS A NZ   3  
ATOM 4521  H H    . LYS A 1 120 ? 1.302   5.056   5.971   1.00 0.00 ? 143 LYS A H    3  
ATOM 4522  H HA   . LYS A 1 120 ? 2.030   4.524   8.655   1.00 0.00 ? 143 LYS A HA   3  
ATOM 4523  H HB2  . LYS A 1 120 ? 2.286   2.139   7.777   1.00 0.00 ? 143 LYS A HB2  3  
ATOM 4524  H HB3  . LYS A 1 120 ? 3.383   2.758   6.543   1.00 0.00 ? 143 LYS A HB3  3  
ATOM 4525  H HG2  . LYS A 1 120 ? 4.805   3.662   8.501   1.00 0.00 ? 143 LYS A HG2  3  
ATOM 4526  H HG3  . LYS A 1 120 ? 3.778   2.740   9.565   1.00 0.00 ? 143 LYS A HG3  3  
ATOM 4527  H HD2  . LYS A 1 120 ? 4.561   0.666   8.737   1.00 0.00 ? 143 LYS A HD2  3  
ATOM 4528  H HD3  . LYS A 1 120 ? 5.120   1.366   7.206   1.00 0.00 ? 143 LYS A HD3  3  
ATOM 4529  H HE2  . LYS A 1 120 ? 6.872   2.615   8.339   1.00 0.00 ? 143 LYS A HE2  3  
ATOM 4530  H HE3  . LYS A 1 120 ? 6.327   2.032   9.918   1.00 0.00 ? 143 LYS A HE3  3  
ATOM 4531  H HZ1  . LYS A 1 120 ? 7.441   0.352   7.747   1.00 0.00 ? 143 LYS A HZ1  3  
ATOM 4532  H HZ2  . LYS A 1 120 ? 8.217   0.815   9.129   1.00 0.00 ? 143 LYS A HZ2  3  
ATOM 4533  H HZ3  . LYS A 1 120 ? 6.938   -0.198  9.223   1.00 0.00 ? 143 LYS A HZ3  3  
ATOM 4534  N N    . HIS A 1 121 ? 3.630   5.440   5.881   1.00 0.00 ? 144 HIS A N    3  
ATOM 4535  C CA   . HIS A 1 121 ? 4.786   6.126   5.294   1.00 0.00 ? 144 HIS A CA   3  
ATOM 4536  C C    . HIS A 1 121 ? 6.088   5.564   5.894   1.00 0.00 ? 144 HIS A C    3  
ATOM 4537  O O    . HIS A 1 121 ? 6.033   4.583   6.643   1.00 0.00 ? 144 HIS A O    3  
ATOM 4538  C CB   . HIS A 1 121 ? 4.629   7.657   5.389   1.00 0.00 ? 144 HIS A CB   3  
ATOM 4539  C CG   . HIS A 1 121 ? 5.533   8.374   6.359   1.00 0.00 ? 144 HIS A CG   3  
ATOM 4540  N ND1  . HIS A 1 121 ? 5.817   8.029   7.659   1.00 0.00 ? 144 HIS A ND1  3  
ATOM 4541  C CD2  . HIS A 1 121 ? 6.357   9.404   6.019   1.00 0.00 ? 144 HIS A CD2  3  
ATOM 4542  C CE1  . HIS A 1 121 ? 6.810   8.824   8.083   1.00 0.00 ? 144 HIS A CE1  3  
ATOM 4543  N NE2  . HIS A 1 121 ? 7.140   9.715   7.132   1.00 0.00 ? 144 HIS A NE2  3  
ATOM 4544  H H    . HIS A 1 121 ? 3.190   4.741   5.294   1.00 0.00 ? 144 HIS A H    3  
ATOM 4545  H HA   . HIS A 1 121 ? 4.781   5.884   4.229   1.00 0.00 ? 144 HIS A HA   3  
ATOM 4546  H HB2  . HIS A 1 121 ? 4.877   8.046   4.409   1.00 0.00 ? 144 HIS A HB2  3  
ATOM 4547  H HB3  . HIS A 1 121 ? 3.592   7.928   5.588   1.00 0.00 ? 144 HIS A HB3  3  
ATOM 4548  H HD1  . HIS A 1 121 ? 5.367   7.284   8.193   1.00 0.00 ? 144 HIS A HD1  3  
ATOM 4549  H HD2  . HIS A 1 121 ? 6.411   9.841   5.037   1.00 0.00 ? 144 HIS A HD2  3  
ATOM 4550  H HE1  . HIS A 1 121 ? 7.241   8.779   9.074   1.00 0.00 ? 144 HIS A HE1  3  
ATOM 4551  N N    . CYS A 1 122 ? 7.263   6.110   5.578   1.00 0.00 ? 145 CYS A N    3  
ATOM 4552  C CA   . CYS A 1 122 ? 8.449   5.861   6.394   1.00 0.00 ? 145 CYS A CA   3  
ATOM 4553  C C    . CYS A 1 122 ? 9.431   7.038   6.446   1.00 0.00 ? 145 CYS A C    3  
ATOM 4554  O O    . CYS A 1 122 ? 10.380  6.988   7.228   1.00 0.00 ? 145 CYS A O    3  
ATOM 4555  C CB   . CYS A 1 122 ? 9.104   4.592   5.854   1.00 0.00 ? 145 CYS A CB   3  
ATOM 4556  S SG   . CYS A 1 122 ? 10.429  3.837   6.828   1.00 0.00 ? 145 CYS A SG   3  
ATOM 4557  H H    . CYS A 1 122 ? 7.339   6.765   4.801   1.00 0.00 ? 145 CYS A H    3  
ATOM 4558  H HA   . CYS A 1 122 ? 8.128   5.672   7.418   1.00 0.00 ? 145 CYS A HA   3  
ATOM 4559  H HB2  . CYS A 1 122 ? 8.322   3.839   5.743   1.00 0.00 ? 145 CYS A HB2  3  
ATOM 4560  H HB3  . CYS A 1 122 ? 9.487   4.820   4.865   1.00 0.00 ? 145 CYS A HB3  3  
ATOM 4561  N N    . GLU A 1 123 ? 9.234   8.086   5.648   1.00 0.00 ? 146 GLU A N    3  
ATOM 4562  C CA   . GLU A 1 123 ? 10.279  9.030   5.299   1.00 0.00 ? 146 GLU A CA   3  
ATOM 4563  C C    . GLU A 1 123 ? 10.026  10.382  5.978   1.00 0.00 ? 146 GLU A C    3  
ATOM 4564  O O    . GLU A 1 123 ? 10.476  10.559  7.114   1.00 0.00 ? 146 GLU A O    3  
ATOM 4565  C CB   . GLU A 1 123 ? 10.454  9.027   3.770   1.00 0.00 ? 146 GLU A CB   3  
ATOM 4566  C CG   . GLU A 1 123 ? 10.669  7.589   3.230   1.00 0.00 ? 146 GLU A CG   3  
ATOM 4567  C CD   . GLU A 1 123 ? 9.398   6.764   2.959   1.00 0.00 ? 146 GLU A CD   3  
ATOM 4568  O OE1  . GLU A 1 123 ? 8.286   7.292   3.211   1.00 0.00 ? 146 GLU A OE1  3  
ATOM 4569  O OE2  . GLU A 1 123 ? 9.533   5.569   2.617   1.00 0.00 ? 146 GLU A OE2  3  
ATOM 4570  H H    . GLU A 1 123 ? 8.484   8.020   4.967   1.00 0.00 ? 146 GLU A H    3  
ATOM 4571  H HA   . GLU A 1 123 ? 11.221  8.665   5.702   1.00 0.00 ? 146 GLU A HA   3  
ATOM 4572  H HB2  . GLU A 1 123 ? 9.599   9.496   3.286   1.00 0.00 ? 146 GLU A HB2  3  
ATOM 4573  H HB3  . GLU A 1 123 ? 11.330  9.624   3.526   1.00 0.00 ? 146 GLU A HB3  3  
ATOM 4574  H HG2  . GLU A 1 123 ? 11.241  7.647   2.309   1.00 0.00 ? 146 GLU A HG2  3  
ATOM 4575  H HG3  . GLU A 1 123 ? 11.272  7.040   3.954   1.00 0.00 ? 146 GLU A HG3  3  
ATOM 4576  N N    . PHE A 1 124 ? 9.296   11.312  5.343   1.00 0.00 ? 147 PHE A N    3  
ATOM 4577  C CA   . PHE A 1 124 ? 8.981   12.628  5.926   1.00 0.00 ? 147 PHE A CA   3  
ATOM 4578  C C    . PHE A 1 124 ? 7.492   12.981  5.891   1.00 0.00 ? 147 PHE A C    3  
ATOM 4579  O O    . PHE A 1 124 ? 7.038   13.850  6.640   1.00 0.00 ? 147 PHE A O    3  
ATOM 4580  C CB   . PHE A 1 124 ? 9.774   13.730  5.206   1.00 0.00 ? 147 PHE A CB   3  
ATOM 4581  C CG   . PHE A 1 124 ? 9.432   13.940  3.735   1.00 0.00 ? 147 PHE A CG   3  
ATOM 4582  C CD1  . PHE A 1 124 ? 8.221   14.546  3.337   1.00 0.00 ? 147 PHE A CD1  3  
ATOM 4583  C CD2  . PHE A 1 124 ? 10.327  13.509  2.744   1.00 0.00 ? 147 PHE A CD2  3  
ATOM 4584  C CE1  . PHE A 1 124 ? 7.901   14.705  1.980   1.00 0.00 ? 147 PHE A CE1  3  
ATOM 4585  C CE2  . PHE A 1 124 ? 10.017  13.697  1.385   1.00 0.00 ? 147 PHE A CE2  3  
ATOM 4586  C CZ   . PHE A 1 124 ? 8.813   14.302  0.999   1.00 0.00 ? 147 PHE A CZ   3  
ATOM 4587  H H    . PHE A 1 124 ? 8.959   11.083  4.422   1.00 0.00 ? 147 PHE A H    3  
ATOM 4588  H HA   . PHE A 1 124 ? 9.289   12.637  6.974   1.00 0.00 ? 147 PHE A HA   3  
ATOM 4589  H HB2  . PHE A 1 124 ? 9.608   14.669  5.735   1.00 0.00 ? 147 PHE A HB2  3  
ATOM 4590  H HB3  . PHE A 1 124 ? 10.837  13.503  5.299   1.00 0.00 ? 147 PHE A HB3  3  
ATOM 4591  H HD1  . PHE A 1 124 ? 7.493   14.864  4.060   1.00 0.00 ? 147 PHE A HD1  3  
ATOM 4592  H HD2  . PHE A 1 124 ? 11.247  13.034  3.043   1.00 0.00 ? 147 PHE A HD2  3  
ATOM 4593  H HE1  . PHE A 1 124 ? 6.937   15.105  1.694   1.00 0.00 ? 147 PHE A HE1  3  
ATOM 4594  H HE2  . PHE A 1 124 ? 10.673  13.346  0.606   1.00 0.00 ? 147 PHE A HE2  3  
ATOM 4595  H HZ   . PHE A 1 124 ? 8.576   14.405  -0.052  1.00 0.00 ? 147 PHE A HZ   3  
ATOM 4596  N N    . TRP A 1 125 ? 6.734   12.383  4.976   1.00 0.00 ? 148 TRP A N    3  
ATOM 4597  C CA   . TRP A 1 125 ? 5.347   12.711  4.657   1.00 0.00 ? 148 TRP A CA   3  
ATOM 4598  C C    . TRP A 1 125 ? 4.346   11.972  5.570   1.00 0.00 ? 148 TRP A C    3  
ATOM 4599  O O    . TRP A 1 125 ? 3.330   11.438  5.114   1.00 0.00 ? 148 TRP A O    3  
ATOM 4600  C CB   . TRP A 1 125 ? 5.145   12.451  3.156   1.00 0.00 ? 148 TRP A CB   3  
ATOM 4601  C CG   . TRP A 1 125 ? 5.690   11.152  2.629   1.00 0.00 ? 148 TRP A CG   3  
ATOM 4602  C CD1  . TRP A 1 125 ? 6.986   10.889  2.332   1.00 0.00 ? 148 TRP A CD1  3  
ATOM 4603  C CD2  . TRP A 1 125 ? 4.973   9.908   2.371   1.00 0.00 ? 148 TRP A CD2  3  
ATOM 4604  N NE1  . TRP A 1 125 ? 7.113   9.567   1.961   1.00 0.00 ? 148 TRP A NE1  3  
ATOM 4605  C CE2  . TRP A 1 125 ? 5.905   8.922   1.940   1.00 0.00 ? 148 TRP A CE2  3  
ATOM 4606  C CE3  . TRP A 1 125 ? 3.635   9.491   2.500   1.00 0.00 ? 148 TRP A CE3  3  
ATOM 4607  C CZ2  . TRP A 1 125 ? 5.543   7.600   1.652   1.00 0.00 ? 148 TRP A CZ2  3  
ATOM 4608  C CZ3  . TRP A 1 125 ? 3.261   8.166   2.224   1.00 0.00 ? 148 TRP A CZ3  3  
ATOM 4609  C CH2  . TRP A 1 125 ? 4.201   7.220   1.784   1.00 0.00 ? 148 TRP A CH2  3  
ATOM 4610  H H    . TRP A 1 125 ? 7.175   11.714  4.359   1.00 0.00 ? 148 TRP A H    3  
ATOM 4611  H HA   . TRP A 1 125 ? 5.191   13.775  4.827   1.00 0.00 ? 148 TRP A HA   3  
ATOM 4612  H HB2  . TRP A 1 125 ? 4.079   12.501  2.946   1.00 0.00 ? 148 TRP A HB2  3  
ATOM 4613  H HB3  . TRP A 1 125 ? 5.613   13.262  2.599   1.00 0.00 ? 148 TRP A HB3  3  
ATOM 4614  H HD1  . TRP A 1 125 ? 7.817   11.580  2.396   1.00 0.00 ? 148 TRP A HD1  3  
ATOM 4615  H HE1  . TRP A 1 125 ? 7.981   9.052   1.861   1.00 0.00 ? 148 TRP A HE1  3  
ATOM 4616  H HE3  . TRP A 1 125 ? 2.885   10.186  2.842   1.00 0.00 ? 148 TRP A HE3  3  
ATOM 4617  H HZ2  . TRP A 1 125 ? 6.303   6.881   1.377   1.00 0.00 ? 148 TRP A HZ2  3  
ATOM 4618  H HZ3  . TRP A 1 125 ? 2.236   7.888   2.371   1.00 0.00 ? 148 TRP A HZ3  3  
ATOM 4619  H HH2  . TRP A 1 125 ? 3.900   6.205   1.575   1.00 0.00 ? 148 TRP A HH2  3  
ATOM 4620  N N    . LEU A 1 126 ? 4.639   11.906  6.870   1.00 0.00 ? 149 LEU A N    3  
ATOM 4621  C CA   . LEU A 1 126 ? 3.789   11.242  7.850   1.00 0.00 ? 149 LEU A CA   3  
ATOM 4622  C C    . LEU A 1 126 ? 2.437   11.939  8.014   1.00 0.00 ? 149 LEU A C    3  
ATOM 4623  O O    . LEU A 1 126 ? 2.275   13.104  7.644   1.00 0.00 ? 149 LEU A O    3  
ATOM 4624  C CB   . LEU A 1 126 ? 4.465   11.118  9.220   1.00 0.00 ? 149 LEU A CB   3  
ATOM 4625  C CG   . LEU A 1 126 ? 5.118   12.392  9.772   1.00 0.00 ? 149 LEU A CG   3  
ATOM 4626  C CD1  . LEU A 1 126 ? 4.804   12.566  11.257  1.00 0.00 ? 149 LEU A CD1  3  
ATOM 4627  C CD2  . LEU A 1 126 ? 6.631   12.292  9.576   1.00 0.00 ? 149 LEU A CD2  3  
ATOM 4628  H H    . LEU A 1 126 ? 5.474   12.356  7.208   1.00 0.00 ? 149 LEU A H    3  
ATOM 4629  H HA   . LEU A 1 126 ? 3.642   10.231  7.493   1.00 0.00 ? 149 LEU A HA   3  
ATOM 4630  H HB2  . LEU A 1 126 ? 3.716   10.774  9.921   1.00 0.00 ? 149 LEU A HB2  3  
ATOM 4631  H HB3  . LEU A 1 126 ? 5.195   10.323  9.179   1.00 0.00 ? 149 LEU A HB3  3  
ATOM 4632  H HG   . LEU A 1 126 ? 4.740   13.261  9.237   1.00 0.00 ? 149 LEU A HG   3  
ATOM 4633  H HD11 . LEU A 1 126 ? 5.363   13.412  11.658  1.00 0.00 ? 149 LEU A HD11 3  
ATOM 4634  H HD12 . LEU A 1 126 ? 3.739   12.768  11.360  1.00 0.00 ? 149 LEU A HD12 3  
ATOM 4635  H HD13 . LEU A 1 126 ? 5.029   11.642  11.790  1.00 0.00 ? 149 LEU A HD13 3  
ATOM 4636  H HD21 . LEU A 1 126 ? 6.834   12.039  8.537   1.00 0.00 ? 149 LEU A HD21 3  
ATOM 4637  H HD22 . LEU A 1 126 ? 7.113   13.234  9.832   1.00 0.00 ? 149 LEU A HD22 3  
ATOM 4638  H HD23 . LEU A 1 126 ? 7.039   11.491  10.192  1.00 0.00 ? 149 LEU A HD23 3  
ATOM 4639  N N    . GLU A 1 127 ? 1.493   11.243  8.641   1.00 0.00 ? 150 GLU A N    3  
ATOM 4640  C CA   . GLU A 1 127 ? 0.290   11.791  9.216   1.00 0.00 ? 150 GLU A CA   3  
ATOM 4641  C C    . GLU A 1 127 ? 0.679   12.812  10.298  1.00 0.00 ? 150 GLU A C    3  
ATOM 4642  O O    . GLU A 1 127 ? 0.877   12.471  11.470  1.00 0.00 ? 150 GLU A O    3  
ATOM 4643  C CB   . GLU A 1 127 ? -0.541  10.605  9.738   1.00 0.00 ? 150 GLU A CB   3  
ATOM 4644  C CG   . GLU A 1 127 ? -1.411  9.980   8.635   1.00 0.00 ? 150 GLU A CG   3  
ATOM 4645  C CD   . GLU A 1 127 ? -2.265  8.798   9.120   1.00 0.00 ? 150 GLU A CD   3  
ATOM 4646  O OE1  . GLU A 1 127 ? -1.732  7.913   9.835   1.00 0.00 ? 150 GLU A OE1  3  
ATOM 4647  O OE2  . GLU A 1 127 ? -3.459  8.704   8.763   1.00 0.00 ? 150 GLU A OE2  3  
ATOM 4648  H H    . GLU A 1 127 ? 1.642   10.264  8.860   1.00 0.00 ? 150 GLU A H    3  
ATOM 4649  H HA   . GLU A 1 127 ? -0.273  12.309  8.439   1.00 0.00 ? 150 GLU A HA   3  
ATOM 4650  H HB2  . GLU A 1 127 ? 0.120   9.850   10.164  1.00 0.00 ? 150 GLU A HB2  3  
ATOM 4651  H HB3  . GLU A 1 127 ? -1.182  10.945  10.528  1.00 0.00 ? 150 GLU A HB3  3  
ATOM 4652  H HG2  . GLU A 1 127 ? -2.072  10.748  8.234   1.00 0.00 ? 150 GLU A HG2  3  
ATOM 4653  H HG3  . GLU A 1 127 ? -0.773  9.622   7.832   1.00 0.00 ? 150 GLU A HG3  3  
ATOM 4654  N N    . ALA A 1 29  ? 1.284   -16.552 -2.846  1.00 0.00 ? 52  ALA A N    4  
ATOM 4655  C CA   . ALA A 1 29  ? 1.063   -15.743 -4.048  1.00 0.00 ? 52  ALA A CA   4  
ATOM 4656  C C    . ALA A 1 29  ? 0.793   -14.254 -3.775  1.00 0.00 ? 52  ALA A C    4  
ATOM 4657  O O    . ALA A 1 29  ? 1.111   -13.387 -4.588  1.00 0.00 ? 52  ALA A O    4  
ATOM 4658  C CB   . ALA A 1 29  ? -0.054  -16.374 -4.870  1.00 0.00 ? 52  ALA A CB   4  
ATOM 4659  H H    . ALA A 1 29  ? 2.236   -16.878 -2.758  1.00 0.00 ? 52  ALA A H    4  
ATOM 4660  H HA   . ALA A 1 29  ? 1.976   -15.796 -4.644  1.00 0.00 ? 52  ALA A HA   4  
ATOM 4661  H HB1  . ALA A 1 29  ? 0.128   -17.443 -4.971  1.00 0.00 ? 52  ALA A HB1  4  
ATOM 4662  H HB2  . ALA A 1 29  ? -0.994  -16.228 -4.347  1.00 0.00 ? 52  ALA A HB2  4  
ATOM 4663  H HB3  . ALA A 1 29  ? -0.106  -15.906 -5.852  1.00 0.00 ? 52  ALA A HB3  4  
ATOM 4664  N N    . GLU A 1 30  ? 0.224   -13.929 -2.622  1.00 0.00 ? 53  GLU A N    4  
ATOM 4665  C CA   . GLU A 1 30  ? 0.019   -12.580 -2.119  1.00 0.00 ? 53  GLU A CA   4  
ATOM 4666  C C    . GLU A 1 30  ? 1.276   -11.949 -1.517  1.00 0.00 ? 53  GLU A C    4  
ATOM 4667  O O    . GLU A 1 30  ? 1.289   -10.783 -1.154  1.00 0.00 ? 53  GLU A O    4  
ATOM 4668  C CB   . GLU A 1 30  ? -1.124  -12.573 -1.118  1.00 0.00 ? 53  GLU A CB   4  
ATOM 4669  C CG   . GLU A 1 30  ? -1.003  -13.572 0.047   1.00 0.00 ? 53  GLU A CG   4  
ATOM 4670  C CD   . GLU A 1 30  ? -2.351  -13.931 0.668   1.00 0.00 ? 53  GLU A CD   4  
ATOM 4671  O OE1  . GLU A 1 30  ? -3.408  -13.774 0.018   1.00 0.00 ? 53  GLU A OE1  4  
ATOM 4672  O OE2  . GLU A 1 30  ? -2.381  -14.427 1.813   1.00 0.00 ? 53  GLU A OE2  4  
ATOM 4673  H H    . GLU A 1 30  ? -0.157  -14.690 -2.073  1.00 0.00 ? 53  GLU A H    4  
ATOM 4674  H HA   . GLU A 1 30  ? -0.282  -11.968 -2.964  1.00 0.00 ? 53  GLU A HA   4  
ATOM 4675  H HB2  . GLU A 1 30  ? -1.144  -11.578 -0.700  1.00 0.00 ? 53  GLU A HB2  4  
ATOM 4676  H HB3  . GLU A 1 30  ? -2.035  -12.748 -1.690  1.00 0.00 ? 53  GLU A HB3  4  
ATOM 4677  H HG2  . GLU A 1 30  ? -0.566  -14.502 -0.298  1.00 0.00 ? 53  GLU A HG2  4  
ATOM 4678  H HG3  . GLU A 1 30  ? -0.341  -13.155 0.807   1.00 0.00 ? 53  GLU A HG3  4  
ATOM 4679  N N    . ASN A 1 31  ? 2.366   -12.697 -1.468  1.00 0.00 ? 54  ASN A N    4  
ATOM 4680  C CA   . ASN A 1 31  ? 3.698   -12.129 -1.258  1.00 0.00 ? 54  ASN A CA   4  
ATOM 4681  C C    . ASN A 1 31  ? 4.154   -11.225 -2.402  1.00 0.00 ? 54  ASN A C    4  
ATOM 4682  O O    . ASN A 1 31  ? 5.196   -10.576 -2.270  1.00 0.00 ? 54  ASN A O    4  
ATOM 4683  C CB   . ASN A 1 31  ? 4.775   -13.206 -1.110  1.00 0.00 ? 54  ASN A CB   4  
ATOM 4684  C CG   . ASN A 1 31  ? 5.137   -13.874 -2.445  1.00 0.00 ? 54  ASN A CG   4  
ATOM 4685  O OD1  . ASN A 1 31  ? 4.250   -14.323 -3.161  1.00 0.00 ? 54  ASN A OD1  4  
ATOM 4686  N ND2  . ASN A 1 31  ? 6.407   -13.952 -2.819  1.00 0.00 ? 54  ASN A ND2  4  
ATOM 4687  H H    . ASN A 1 31  ? 2.212   -13.635 -1.785  1.00 0.00 ? 54  ASN A H    4  
ATOM 4688  H HA   . ASN A 1 31  ? 3.674   -11.530 -0.346  1.00 0.00 ? 54  ASN A HA   4  
ATOM 4689  H HB2  . ASN A 1 31  ? 5.640   -12.668 -0.742  1.00 0.00 ? 54  ASN A HB2  4  
ATOM 4690  H HB3  . ASN A 1 31  ? 4.472   -13.939 -0.365  1.00 0.00 ? 54  ASN A HB3  4  
ATOM 4691  H HD21 . ASN A 1 31  ? 7.165   -13.539 -2.275  1.00 0.00 ? 54  ASN A HD21 4  
ATOM 4692  H HD22 . ASN A 1 31  ? 6.602   -14.311 -3.754  1.00 0.00 ? 54  ASN A HD22 4  
ATOM 4693  N N    . ARG A 1 32  ? 3.464   -11.235 -3.549  1.00 0.00 ? 55  ARG A N    4  
ATOM 4694  C CA   . ARG A 1 32  ? 3.908   -10.465 -4.700  1.00 0.00 ? 55  ARG A CA   4  
ATOM 4695  C C    . ARG A 1 32  ? 4.025   -8.993  -4.305  1.00 0.00 ? 55  ARG A C    4  
ATOM 4696  O O    . ARG A 1 32  ? 3.228   -8.497  -3.512  1.00 0.00 ? 55  ARG A O    4  
ATOM 4697  C CB   . ARG A 1 32  ? 2.970   -10.672 -5.895  1.00 0.00 ? 55  ARG A CB   4  
ATOM 4698  C CG   . ARG A 1 32  ? 3.257   -12.017 -6.567  1.00 0.00 ? 55  ARG A CG   4  
ATOM 4699  C CD   . ARG A 1 32  ? 2.165   -12.517 -7.529  1.00 0.00 ? 55  ARG A CD   4  
ATOM 4700  N NE   . ARG A 1 32  ? 2.543   -12.348 -8.942  1.00 0.00 ? 55  ARG A NE   4  
ATOM 4701  C CZ   . ARG A 1 32  ? 3.449   -13.075 -9.608  1.00 0.00 ? 55  ARG A CZ   4  
ATOM 4702  N NH1  . ARG A 1 32  ? 4.045   -14.134 -9.078  1.00 0.00 ? 55  ARG A NH1  4  
ATOM 4703  N NH2  . ARG A 1 32  ? 3.776   -12.705 -10.836 1.00 0.00 ? 55  ARG A NH2  4  
ATOM 4704  H H    . ARG A 1 32  ? 2.649   -11.828 -3.627  1.00 0.00 ? 55  ARG A H    4  
ATOM 4705  H HA   . ARG A 1 32  ? 4.896   -10.850 -4.950  1.00 0.00 ? 55  ARG A HA   4  
ATOM 4706  H HB2  . ARG A 1 32  ? 1.960   -10.626 -5.537  1.00 0.00 ? 55  ARG A HB2  4  
ATOM 4707  H HB3  . ARG A 1 32  ? 3.092   -9.872  -6.623  1.00 0.00 ? 55  ARG A HB3  4  
ATOM 4708  H HG2  . ARG A 1 32  ? 4.193   -11.890 -7.100  1.00 0.00 ? 55  ARG A HG2  4  
ATOM 4709  H HG3  . ARG A 1 32  ? 3.406   -12.778 -5.803  1.00 0.00 ? 55  ARG A HG3  4  
ATOM 4710  H HD2  . ARG A 1 32  ? 1.987   -13.576 -7.336  1.00 0.00 ? 55  ARG A HD2  4  
ATOM 4711  H HD3  . ARG A 1 32  ? 1.234   -11.985 -7.341  1.00 0.00 ? 55  ARG A HD3  4  
ATOM 4712  H HE   . ARG A 1 32  ? 2.056   -11.617 -9.453  1.00 0.00 ? 55  ARG A HE   4  
ATOM 4713  H HH11 . ARG A 1 32  ? 3.822   -14.497 -8.144  1.00 0.00 ? 55  ARG A HH11 4  
ATOM 4714  H HH12 . ARG A 1 32  ? 4.798   -14.602 -9.569  1.00 0.00 ? 55  ARG A HH12 4  
ATOM 4715  H HH21 . ARG A 1 32  ? 3.305   -11.899 -11.241 1.00 0.00 ? 55  ARG A HH21 4  
ATOM 4716  H HH22 . ARG A 1 32  ? 4.508   -13.151 -11.377 1.00 0.00 ? 55  ARG A HH22 4  
ATOM 4717  N N    . PRO A 1 33  ? 4.992   -8.273  -4.882  1.00 0.00 ? 56  PRO A N    4  
ATOM 4718  C CA   . PRO A 1 33  ? 5.241   -6.878  -4.580  1.00 0.00 ? 56  PRO A CA   4  
ATOM 4719  C C    . PRO A 1 33  ? 4.033   -6.109  -5.090  1.00 0.00 ? 56  PRO A C    4  
ATOM 4720  O O    . PRO A 1 33  ? 3.785   -6.038  -6.299  1.00 0.00 ? 56  PRO A O    4  
ATOM 4721  C CB   . PRO A 1 33  ? 6.567   -6.533  -5.247  1.00 0.00 ? 56  PRO A CB   4  
ATOM 4722  C CG   . PRO A 1 33  ? 6.681   -7.550  -6.373  1.00 0.00 ? 56  PRO A CG   4  
ATOM 4723  C CD   . PRO A 1 33  ? 5.775   -8.719  -6.010  1.00 0.00 ? 56  PRO A CD   4  
ATOM 4724  H HA   . PRO A 1 33  ? 5.353   -6.720  -3.510  1.00 0.00 ? 56  PRO A HA   4  
ATOM 4725  H HB2  . PRO A 1 33  ? 6.588   -5.510  -5.622  1.00 0.00 ? 56  PRO A HB2  4  
ATOM 4726  H HB3  . PRO A 1 33  ? 7.377   -6.694  -4.536  1.00 0.00 ? 56  PRO A HB3  4  
ATOM 4727  H HG2  . PRO A 1 33  ? 6.318   -7.093  -7.280  1.00 0.00 ? 56  PRO A HG2  4  
ATOM 4728  H HG3  . PRO A 1 33  ? 7.705   -7.873  -6.491  1.00 0.00 ? 56  PRO A HG3  4  
ATOM 4729  H HD2  . PRO A 1 33  ? 5.120   -8.956  -6.849  1.00 0.00 ? 56  PRO A HD2  4  
ATOM 4730  H HD3  . PRO A 1 33  ? 6.329   -9.612  -5.735  1.00 0.00 ? 56  PRO A HD3  4  
ATOM 4731  N N    . GLY A 1 34  ? 3.227   -5.630  -4.148  1.00 0.00 ? 57  GLY A N    4  
ATOM 4732  C CA   . GLY A 1 34  ? 1.854   -5.252  -4.398  1.00 0.00 ? 57  GLY A CA   4  
ATOM 4733  C C    . GLY A 1 34  ? 0.949   -6.323  -3.820  1.00 0.00 ? 57  GLY A C    4  
ATOM 4734  O O    . GLY A 1 34  ? 0.484   -6.169  -2.683  1.00 0.00 ? 57  GLY A O    4  
ATOM 4735  H H    . GLY A 1 34  ? 3.460   -5.841  -3.183  1.00 0.00 ? 57  GLY A H    4  
ATOM 4736  H HA2  . GLY A 1 34  ? 1.636   -4.310  -3.908  1.00 0.00 ? 57  GLY A HA2  4  
ATOM 4737  H HA3  . GLY A 1 34  ? 1.671   -5.132  -5.465  1.00 0.00 ? 57  GLY A HA3  4  
ATOM 4738  N N    . ALA A 1 35  ? 0.707   -7.386  -4.604  1.00 0.00 ? 58  ALA A N    4  
ATOM 4739  C CA   . ALA A 1 35  ? -0.425  -8.298  -4.423  1.00 0.00 ? 58  ALA A CA   4  
ATOM 4740  C C    . ALA A 1 35  ? -1.712  -7.479  -4.180  1.00 0.00 ? 58  ALA A C    4  
ATOM 4741  O O    . ALA A 1 35  ? -1.757  -6.341  -4.649  1.00 0.00 ? 58  ALA A O    4  
ATOM 4742  C CB   . ALA A 1 35  ? -0.044  -9.339  -3.370  1.00 0.00 ? 58  ALA A CB   4  
ATOM 4743  H H    . ALA A 1 35  ? 1.284   -7.531  -5.421  1.00 0.00 ? 58  ALA A H    4  
ATOM 4744  H HA   . ALA A 1 35  ? -0.585  -8.845  -5.351  1.00 0.00 ? 58  ALA A HA   4  
ATOM 4745  H HB1  . ALA A 1 35  ? -0.907  -9.933  -3.083  1.00 0.00 ? 58  ALA A HB1  4  
ATOM 4746  H HB2  . ALA A 1 35  ? 0.738   -9.996  -3.759  1.00 0.00 ? 58  ALA A HB2  4  
ATOM 4747  H HB3  . ALA A 1 35  ? 0.384   -8.864  -2.496  1.00 0.00 ? 58  ALA A HB3  4  
ATOM 4748  N N    . PHE A 1 36  ? -2.750  -8.026  -3.531  1.00 0.00 ? 59  PHE A N    4  
ATOM 4749  C CA   . PHE A 1 36  ? -3.921  -7.338  -2.954  1.00 0.00 ? 59  PHE A CA   4  
ATOM 4750  C C    . PHE A 1 36  ? -4.340  -8.191  -1.732  1.00 0.00 ? 59  PHE A C    4  
ATOM 4751  O O    . PHE A 1 36  ? -4.369  -9.417  -1.853  1.00 0.00 ? 59  PHE A O    4  
ATOM 4752  C CB   . PHE A 1 36  ? -5.086  -7.202  -3.981  1.00 0.00 ? 59  PHE A CB   4  
ATOM 4753  C CG   . PHE A 1 36  ? -5.251  -5.909  -4.803  1.00 0.00 ? 59  PHE A CG   4  
ATOM 4754  C CD1  . PHE A 1 36  ? -4.299  -4.868  -4.777  1.00 0.00 ? 59  PHE A CD1  4  
ATOM 4755  C CD2  . PHE A 1 36  ? -6.430  -5.701  -5.563  1.00 0.00 ? 59  PHE A CD2  4  
ATOM 4756  C CE1  . PHE A 1 36  ? -4.439  -3.724  -5.572  1.00 0.00 ? 59  PHE A CE1  4  
ATOM 4757  C CE2  . PHE A 1 36  ? -6.611  -4.510  -6.303  1.00 0.00 ? 59  PHE A CE2  4  
ATOM 4758  C CZ   . PHE A 1 36  ? -5.589  -3.555  -6.344  1.00 0.00 ? 59  PHE A CZ   4  
ATOM 4759  H H    . PHE A 1 36  ? -2.670  -8.993  -3.243  1.00 0.00 ? 59  PHE A H    4  
ATOM 4760  H HA   . PHE A 1 36  ? -3.640  -6.349  -2.607  1.00 0.00 ? 59  PHE A HA   4  
ATOM 4761  H HB2  . PHE A 1 36  ? -5.041  -8.044  -4.673  1.00 0.00 ? 59  PHE A HB2  4  
ATOM 4762  H HB3  . PHE A 1 36  ? -6.016  -7.313  -3.426  1.00 0.00 ? 59  PHE A HB3  4  
ATOM 4763  H HD1  . PHE A 1 36  ? -3.434  -4.901  -4.147  1.00 0.00 ? 59  PHE A HD1  4  
ATOM 4764  H HD2  . PHE A 1 36  ? -7.222  -6.437  -5.558  1.00 0.00 ? 59  PHE A HD2  4  
ATOM 4765  H HE1  . PHE A 1 36  ? -3.674  -2.960  -5.568  1.00 0.00 ? 59  PHE A HE1  4  
ATOM 4766  H HE2  . PHE A 1 36  ? -7.529  -4.263  -6.836  1.00 0.00 ? 59  PHE A HE2  4  
ATOM 4767  H HZ   . PHE A 1 36  ? -5.723  -2.657  -6.921  1.00 0.00 ? 59  PHE A HZ   4  
ATOM 4768  N N    . ILE A 1 37  ? -4.631  -7.598  -0.558  1.00 0.00 ? 60  ILE A N    4  
ATOM 4769  C CA   . ILE A 1 37  ? -5.037  -8.334  0.666   1.00 0.00 ? 60  ILE A CA   4  
ATOM 4770  C C    . ILE A 1 37  ? -6.505  -8.797  0.627   1.00 0.00 ? 60  ILE A C    4  
ATOM 4771  O O    . ILE A 1 37  ? -6.818  -9.858  1.160   1.00 0.00 ? 60  ILE A O    4  
ATOM 4772  C CB   . ILE A 1 37  ? -4.741  -7.491  1.948   1.00 0.00 ? 60  ILE A CB   4  
ATOM 4773  C CG1  . ILE A 1 37  ? -3.379  -7.890  2.556   1.00 0.00 ? 60  ILE A CG1  4  
ATOM 4774  C CG2  . ILE A 1 37  ? -5.841  -7.515  3.024   1.00 0.00 ? 60  ILE A CG2  4  
ATOM 4775  C CD1  . ILE A 1 37  ? -3.117  -7.480  4.014   1.00 0.00 ? 60  ILE A CD1  4  
ATOM 4776  H H    . ILE A 1 37  ? -4.459  -6.604  -0.474  1.00 0.00 ? 60  ILE A H    4  
ATOM 4777  H HA   . ILE A 1 37  ? -4.439  -9.246  0.711   1.00 0.00 ? 60  ILE A HA   4  
ATOM 4778  H HB   . ILE A 1 37  ? -4.665  -6.457  1.642   1.00 0.00 ? 60  ILE A HB   4  
ATOM 4779  H HG12 . ILE A 1 37  ? -3.264  -8.973  2.503   1.00 0.00 ? 60  ILE A HG12 4  
ATOM 4780  H HG13 . ILE A 1 37  ? -2.609  -7.424  1.946   1.00 0.00 ? 60  ILE A HG13 4  
ATOM 4781  H HG21 . ILE A 1 37  ? -5.908  -8.517  3.446   1.00 0.00 ? 60  ILE A HG21 4  
ATOM 4782  H HG22 . ILE A 1 37  ? -5.624  -6.800  3.817   1.00 0.00 ? 60  ILE A HG22 4  
ATOM 4783  H HG23 . ILE A 1 37  ? -6.800  -7.219  2.607   1.00 0.00 ? 60  ILE A HG23 4  
ATOM 4784  H HD11 . ILE A 1 37  ? -2.092  -7.722  4.277   1.00 0.00 ? 60  ILE A HD11 4  
ATOM 4785  H HD12 . ILE A 1 37  ? -3.265  -6.412  4.143   1.00 0.00 ? 60  ILE A HD12 4  
ATOM 4786  H HD13 . ILE A 1 37  ? -3.771  -8.031  4.691   1.00 0.00 ? 60  ILE A HD13 4  
ATOM 4787  N N    . LYS A 1 38  ? -7.389  -7.969  0.062   1.00 0.00 ? 61  LYS A N    4  
ATOM 4788  C CA   . LYS A 1 38  ? -8.817  -8.189  -0.198  1.00 0.00 ? 61  LYS A CA   4  
ATOM 4789  C C    . LYS A 1 38  ? -9.527  -9.191  0.729   1.00 0.00 ? 61  LYS A C    4  
ATOM 4790  O O    . LYS A 1 38  ? -9.657  -10.372 0.407   1.00 0.00 ? 61  LYS A O    4  
ATOM 4791  C CB   . LYS A 1 38  ? -9.022  -8.450  -1.704  1.00 0.00 ? 61  LYS A CB   4  
ATOM 4792  C CG   . LYS A 1 38  ? -7.990  -9.296  -2.442  1.00 0.00 ? 61  LYS A CG   4  
ATOM 4793  C CD   . LYS A 1 38  ? -8.085  -10.797 -2.167  1.00 0.00 ? 61  LYS A CD   4  
ATOM 4794  C CE   . LYS A 1 38  ? -7.199  -11.519 -3.182  1.00 0.00 ? 61  LYS A CE   4  
ATOM 4795  N NZ   . LYS A 1 38  ? -6.801  -12.866 -2.739  1.00 0.00 ? 61  LYS A NZ   4  
ATOM 4796  H H    . LYS A 1 38  ? -6.988  -7.154  -0.365  1.00 0.00 ? 61  LYS A H    4  
ATOM 4797  H HA   . LYS A 1 38  ? -9.327  -7.247  0.007   1.00 0.00 ? 61  LYS A HA   4  
ATOM 4798  H HB2  . LYS A 1 38  ? -10.017 -8.858  -1.882  1.00 0.00 ? 61  LYS A HB2  4  
ATOM 4799  H HB3  . LYS A 1 38  ? -8.957  -7.491  -2.212  1.00 0.00 ? 61  LYS A HB3  4  
ATOM 4800  H HG2  . LYS A 1 38  ? -8.140  -9.079  -3.495  1.00 0.00 ? 61  LYS A HG2  4  
ATOM 4801  H HG3  . LYS A 1 38  ? -6.987  -8.957  -2.206  1.00 0.00 ? 61  LYS A HG3  4  
ATOM 4802  H HD2  . LYS A 1 38  ? -7.721  -10.994 -1.159  1.00 0.00 ? 61  LYS A HD2  4  
ATOM 4803  H HD3  . LYS A 1 38  ? -9.120  -11.128 -2.252  1.00 0.00 ? 61  LYS A HD3  4  
ATOM 4804  H HE2  . LYS A 1 38  ? -7.708  -11.573 -4.145  1.00 0.00 ? 61  LYS A HE2  4  
ATOM 4805  H HE3  . LYS A 1 38  ? -6.284  -10.938 -3.313  1.00 0.00 ? 61  LYS A HE3  4  
ATOM 4806  H HZ1  . LYS A 1 38  ? -6.319  -12.795 -1.845  1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 4807  H HZ2  . LYS A 1 38  ? -7.583  -13.495 -2.628  1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 4808  H HZ3  . LYS A 1 38  ? -6.123  -13.229 -3.405  1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 4809  N N    . GLN A 1 39  ? -10.000 -8.713  1.881   1.00 0.00 ? 62  GLN A N    4  
ATOM 4810  C CA   . GLN A 1 39  ? -10.724 -9.477  2.899   1.00 0.00 ? 62  GLN A CA   4  
ATOM 4811  C C    . GLN A 1 39  ? -12.228 -9.177  2.893   1.00 0.00 ? 62  GLN A C    4  
ATOM 4812  O O    . GLN A 1 39  ? -12.967 -9.663  3.752   1.00 0.00 ? 62  GLN A O    4  
ATOM 4813  C CB   . GLN A 1 39  ? -10.155 -9.168  4.290   1.00 0.00 ? 62  GLN A CB   4  
ATOM 4814  C CG   . GLN A 1 39  ? -8.648  -9.428  4.371   1.00 0.00 ? 62  GLN A CG   4  
ATOM 4815  C CD   . GLN A 1 39  ? -8.099  -9.393  5.795   1.00 0.00 ? 62  GLN A CD   4  
ATOM 4816  O OE1  . GLN A 1 39  ? -8.839  -9.363  6.775   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 4817  N NE2  . GLN A 1 39  ? -6.788  -9.416  5.959   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 4818  H H    . GLN A 1 39  ? -9.947  -7.709  2.049   1.00 0.00 ? 62  GLN A H    4  
ATOM 4819  H HA   . GLN A 1 39  ? -10.598 -10.543 2.708   1.00 0.00 ? 62  GLN A HA   4  
ATOM 4820  H HB2  . GLN A 1 39  ? -10.353 -8.126  4.546   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 4821  H HB3  . GLN A 1 39  ? -10.672 -9.797  5.010   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 4822  H HG2  . GLN A 1 39  ? -8.415  -10.396 3.923   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 4823  H HG3  . GLN A 1 39  ? -8.173  -8.634  3.803   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 4824  H HE21 . GLN A 1 39  ? -6.242  -9.791  5.187   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 4825  H HE22 . GLN A 1 39  ? -6.375  -9.480  6.886   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 4826  N N    . GLY A 1 40  ? -12.710 -8.366  1.957   1.00 0.00 ? 63  GLY A N    4  
ATOM 4827  C CA   . GLY A 1 40  ? -14.125 -8.125  1.754   1.00 0.00 ? 63  GLY A CA   4  
ATOM 4828  C C    . GLY A 1 40  ? -14.720 -7.131  2.745   1.00 0.00 ? 63  GLY A C    4  
ATOM 4829  O O    . GLY A 1 40  ? -15.937 -7.169  2.940   1.00 0.00 ? 63  GLY A O    4  
ATOM 4830  H H    . GLY A 1 40  ? -12.082 -8.002  1.246   1.00 0.00 ? 63  GLY A H    4  
ATOM 4831  H HA2  . GLY A 1 40  ? -14.265 -7.752  0.744   1.00 0.00 ? 63  GLY A HA2  4  
ATOM 4832  H HA3  . GLY A 1 40  ? -14.661 -9.071  1.840   1.00 0.00 ? 63  GLY A HA3  4  
ATOM 4833  N N    . ARG A 1 41  ? -13.913 -6.293  3.413   1.00 0.00 ? 64  ARG A N    4  
ATOM 4834  C CA   . ARG A 1 41  ? -14.400 -5.340  4.420   1.00 0.00 ? 64  ARG A CA   4  
ATOM 4835  C C    . ARG A 1 41  ? -14.710 -3.975  3.807   1.00 0.00 ? 64  ARG A C    4  
ATOM 4836  O O    . ARG A 1 41  ? -14.284 -3.695  2.686   1.00 0.00 ? 64  ARG A O    4  
ATOM 4837  C CB   . ARG A 1 41  ? -13.486 -5.292  5.658   1.00 0.00 ? 64  ARG A CB   4  
ATOM 4838  C CG   . ARG A 1 41  ? -12.006 -5.020  5.383   1.00 0.00 ? 64  ARG A CG   4  
ATOM 4839  C CD   . ARG A 1 41  ? -11.072 -5.344  6.564   1.00 0.00 ? 64  ARG A CD   4  
ATOM 4840  N NE   . ARG A 1 41  ? -11.737 -5.250  7.877   1.00 0.00 ? 64  ARG A NE   4  
ATOM 4841  C CZ   . ARG A 1 41  ? -11.654 -4.287  8.804   1.00 0.00 ? 64  ARG A CZ   4  
ATOM 4842  N NH1  . ARG A 1 41  ? -10.795 -3.280  8.701   1.00 0.00 ? 64  ARG A NH1  4  
ATOM 4843  N NH2  . ARG A 1 41  ? -12.454 -4.367  9.859   1.00 0.00 ? 64  ARG A NH2  4  
ATOM 4844  H H    . ARG A 1 41  ? -12.940 -6.229  3.133   1.00 0.00 ? 64  ARG A H    4  
ATOM 4845  H HA   . ARG A 1 41  ? -15.334 -5.721  4.792   1.00 0.00 ? 64  ARG A HA   4  
ATOM 4846  H HB2  . ARG A 1 41  ? -13.848 -4.523  6.342   1.00 0.00 ? 64  ARG A HB2  4  
ATOM 4847  H HB3  . ARG A 1 41  ? -13.563 -6.256  6.158   1.00 0.00 ? 64  ARG A HB3  4  
ATOM 4848  H HG2  . ARG A 1 41  ? -11.707 -5.655  4.550   1.00 0.00 ? 64  ARG A HG2  4  
ATOM 4849  H HG3  . ARG A 1 41  ? -11.890 -3.972  5.108   1.00 0.00 ? 64  ARG A HG3  4  
ATOM 4850  H HD2  . ARG A 1 41  ? -10.736 -6.374  6.443   1.00 0.00 ? 64  ARG A HD2  4  
ATOM 4851  H HD3  . ARG A 1 41  ? -10.196 -4.700  6.517   1.00 0.00 ? 64  ARG A HD3  4  
ATOM 4852  H HE   . ARG A 1 41  ? -12.332 -6.046  8.073   1.00 0.00 ? 64  ARG A HE   4  
ATOM 4853  H HH11 . ARG A 1 41  ? -10.060 -3.273  7.989   1.00 0.00 ? 64  ARG A HH11 4  
ATOM 4854  H HH12 . ARG A 1 41  ? -10.756 -2.537  9.400   1.00 0.00 ? 64  ARG A HH12 4  
ATOM 4855  H HH21 . ARG A 1 41  ? -13.146 -5.109  9.930   1.00 0.00 ? 64  ARG A HH21 4  
ATOM 4856  H HH22 . ARG A 1 41  ? -12.387 -3.730  10.650  1.00 0.00 ? 64  ARG A HH22 4  
ATOM 4857  N N    . LYS A 1 42  ? -15.466 -3.132  4.525   1.00 0.00 ? 65  LYS A N    4  
ATOM 4858  C CA   . LYS A 1 42  ? -15.757 -1.755  4.130   1.00 0.00 ? 65  LYS A CA   4  
ATOM 4859  C C    . LYS A 1 42  ? -14.914 -0.844  5.002   1.00 0.00 ? 65  LYS A C    4  
ATOM 4860  O O    . LYS A 1 42  ? -15.255 -0.617  6.166   1.00 0.00 ? 65  LYS A O    4  
ATOM 4861  C CB   . LYS A 1 42  ? -17.257 -1.418  4.240   1.00 0.00 ? 65  LYS A CB   4  
ATOM 4862  C CG   . LYS A 1 42  ? -17.518 -0.087  3.514   1.00 0.00 ? 65  LYS A CG   4  
ATOM 4863  C CD   . LYS A 1 42  ? -18.994 0.300   3.411   1.00 0.00 ? 65  LYS A CD   4  
ATOM 4864  C CE   . LYS A 1 42  ? -19.714 0.576   4.727   1.00 0.00 ? 65  LYS A CE   4  
ATOM 4865  N NZ   . LYS A 1 42  ? -19.190 1.730   5.486   1.00 0.00 ? 65  LYS A NZ   4  
ATOM 4866  H H    . LYS A 1 42  ? -15.787 -3.425  5.440   1.00 0.00 ? 65  LYS A H    4  
ATOM 4867  H HA   . LYS A 1 42  ? -15.451 -1.622  3.091   1.00 0.00 ? 65  LYS A HA   4  
ATOM 4868  H HB2  . LYS A 1 42  ? -17.849 -2.203  3.776   1.00 0.00 ? 65  LYS A HB2  4  
ATOM 4869  H HB3  . LYS A 1 42  ? -17.558 -1.343  5.286   1.00 0.00 ? 65  LYS A HB3  4  
ATOM 4870  H HG2  . LYS A 1 42  ? -16.975 0.714   3.997   1.00 0.00 ? 65  LYS A HG2  4  
ATOM 4871  H HG3  . LYS A 1 42  ? -17.130 -0.157  2.501   1.00 0.00 ? 65  LYS A HG3  4  
ATOM 4872  H HD2  . LYS A 1 42  ? -19.074 1.183   2.782   1.00 0.00 ? 65  LYS A HD2  4  
ATOM 4873  H HD3  . LYS A 1 42  ? -19.538 -0.500  2.919   1.00 0.00 ? 65  LYS A HD3  4  
ATOM 4874  H HE2  . LYS A 1 42  ? -20.747 0.790   4.457   1.00 0.00 ? 65  LYS A HE2  4  
ATOM 4875  H HE3  . LYS A 1 42  ? -19.710 -0.318  5.348   1.00 0.00 ? 65  LYS A HE3  4  
ATOM 4876  H HZ1  . LYS A 1 42  ? -18.428 1.468   6.102   1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 4877  H HZ2  . LYS A 1 42  ? -18.873 2.476   4.871   1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 4878  H HZ3  . LYS A 1 42  ? -19.927 2.139   6.051   1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 4879  N N    . LEU A 1 43  ? -13.798 -0.369  4.475   1.00 0.00 ? 66  LEU A N    4  
ATOM 4880  C CA   . LEU A 1 43  ? -12.869 0.484   5.193   1.00 0.00 ? 66  LEU A CA   4  
ATOM 4881  C C    . LEU A 1 43  ? -13.439 1.874   5.439   1.00 0.00 ? 66  LEU A C    4  
ATOM 4882  O O    . LEU A 1 43  ? -14.449 2.279   4.860   1.00 0.00 ? 66  LEU A O    4  
ATOM 4883  C CB   . LEU A 1 43  ? -11.567 0.589   4.391   1.00 0.00 ? 66  LEU A CB   4  
ATOM 4884  C CG   . LEU A 1 43  ? -10.798 -0.729  4.327   1.00 0.00 ? 66  LEU A CG   4  
ATOM 4885  C CD1  . LEU A 1 43  ? -9.676  -0.650  3.297   1.00 0.00 ? 66  LEU A CD1  4  
ATOM 4886  C CD2  . LEU A 1 43  ? -10.208 -0.977  5.711   1.00 0.00 ? 66  LEU A CD2  4  
ATOM 4887  H H    . LEU A 1 43  ? -13.565 -0.598  3.515   1.00 0.00 ? 66  LEU A H    4  
ATOM 4888  H HA   . LEU A 1 43  ? -12.672 0.040   6.168   1.00 0.00 ? 66  LEU A HA   4  
ATOM 4889  H HB2  . LEU A 1 43  ? -11.796 0.917   3.381   1.00 0.00 ? 66  LEU A HB2  4  
ATOM 4890  H HB3  . LEU A 1 43  ? -10.922 1.328   4.859   1.00 0.00 ? 66  LEU A HB3  4  
ATOM 4891  H HG   . LEU A 1 43  ? -11.475 -1.529  4.044   1.00 0.00 ? 66  LEU A HG   4  
ATOM 4892  H HD11 . LEU A 1 43  ? -8.895  0.025   3.636   1.00 0.00 ? 66  LEU A HD11 4  
ATOM 4893  H HD12 . LEU A 1 43  ? -9.262  -1.644  3.172   1.00 0.00 ? 66  LEU A HD12 4  
ATOM 4894  H HD13 . LEU A 1 43  ? -10.072 -0.320  2.337   1.00 0.00 ? 66  LEU A HD13 4  
ATOM 4895  H HD21 . LEU A 1 43  ? -10.994 -1.210  6.429   1.00 0.00 ? 66  LEU A HD21 4  
ATOM 4896  H HD22 . LEU A 1 43  ? -9.540  -1.834  5.674   1.00 0.00 ? 66  LEU A HD22 4  
ATOM 4897  H HD23 . LEU A 1 43  ? -9.670  -0.064  6.008   1.00 0.00 ? 66  LEU A HD23 4  
ATOM 4898  N N    . ASP A 1 44  ? -12.754 2.619   6.295   1.00 0.00 ? 67  ASP A N    4  
ATOM 4899  C CA   . ASP A 1 44  ? -13.044 3.974   6.711   1.00 0.00 ? 67  ASP A CA   4  
ATOM 4900  C C    . ASP A 1 44  ? -12.028 4.900   6.038   1.00 0.00 ? 67  ASP A C    4  
ATOM 4901  O O    . ASP A 1 44  ? -11.028 5.317   6.626   1.00 0.00 ? 67  ASP A O    4  
ATOM 4902  C CB   . ASP A 1 44  ? -13.067 4.034   8.248   1.00 0.00 ? 67  ASP A CB   4  
ATOM 4903  C CG   . ASP A 1 44  ? -11.735 3.711   8.934   1.00 0.00 ? 67  ASP A CG   4  
ATOM 4904  O OD1  . ASP A 1 44  ? -11.059 2.718   8.568   1.00 0.00 ? 67  ASP A OD1  4  
ATOM 4905  O OD2  . ASP A 1 44  ? -11.360 4.449   9.871   1.00 0.00 ? 67  ASP A OD2  4  
ATOM 4906  H H    . ASP A 1 44  ? -11.935 2.238   6.757   1.00 0.00 ? 67  ASP A H    4  
ATOM 4907  H HA   . ASP A 1 44  ? -14.034 4.252   6.357   1.00 0.00 ? 67  ASP A HA   4  
ATOM 4908  H HB2  . ASP A 1 44  ? -13.376 5.036   8.531   1.00 0.00 ? 67  ASP A HB2  4  
ATOM 4909  H HB3  . ASP A 1 44  ? -13.823 3.338   8.616   1.00 0.00 ? 67  ASP A HB3  4  
ATOM 4910  N N    . ILE A 1 45  ? -12.254 5.159   4.749   1.00 0.00 ? 68  ILE A N    4  
ATOM 4911  C CA   . ILE A 1 45  ? -11.397 5.959   3.879   1.00 0.00 ? 68  ILE A CA   4  
ATOM 4912  C C    . ILE A 1 45  ? -12.334 6.912   3.125   1.00 0.00 ? 68  ILE A C    4  
ATOM 4913  O O    . ILE A 1 45  ? -13.382 6.483   2.646   1.00 0.00 ? 68  ILE A O    4  
ATOM 4914  C CB   . ILE A 1 45  ? -10.560 5.052   2.936   1.00 0.00 ? 68  ILE A CB   4  
ATOM 4915  C CG1  . ILE A 1 45  ? -9.976  3.794   3.642   1.00 0.00 ? 68  ILE A CG1  4  
ATOM 4916  C CG2  . ILE A 1 45  ? -9.478  5.887   2.227   1.00 0.00 ? 68  ILE A CG2  4  
ATOM 4917  C CD1  . ILE A 1 45  ? -8.939  3.014   2.835   1.00 0.00 ? 68  ILE A CD1  4  
ATOM 4918  H H    . ILE A 1 45  ? -13.092 4.800   4.309   1.00 0.00 ? 68  ILE A H    4  
ATOM 4919  H HA   . ILE A 1 45  ? -10.715 6.544   4.493   1.00 0.00 ? 68  ILE A HA   4  
ATOM 4920  H HB   . ILE A 1 45  ? -11.229 4.685   2.159   1.00 0.00 ? 68  ILE A HB   4  
ATOM 4921  H HG12 . ILE A 1 45  ? -9.552  3.999   4.625   1.00 0.00 ? 68  ILE A HG12 4  
ATOM 4922  H HG13 . ILE A 1 45  ? -10.806 3.120   3.813   1.00 0.00 ? 68  ILE A HG13 4  
ATOM 4923  H HG21 . ILE A 1 45  ? -9.027  5.308   1.420   1.00 0.00 ? 68  ILE A HG21 4  
ATOM 4924  H HG22 . ILE A 1 45  ? -9.912  6.780   1.782   1.00 0.00 ? 68  ILE A HG22 4  
ATOM 4925  H HG23 . ILE A 1 45  ? -8.706  6.180   2.939   1.00 0.00 ? 68  ILE A HG23 4  
ATOM 4926  H HD11 . ILE A 1 45  ? -8.054  3.621   2.632   1.00 0.00 ? 68  ILE A HD11 4  
ATOM 4927  H HD12 . ILE A 1 45  ? -8.622  2.153   3.417   1.00 0.00 ? 68  ILE A HD12 4  
ATOM 4928  H HD13 . ILE A 1 45  ? -9.401  2.676   1.911   1.00 0.00 ? 68  ILE A HD13 4  
ATOM 4929  N N    . ASP A 1 46  ? -12.009 8.205   3.075   1.00 0.00 ? 69  ASP A N    4  
ATOM 4930  C CA   . ASP A 1 46  ? -12.855 9.299   2.583   1.00 0.00 ? 69  ASP A CA   4  
ATOM 4931  C C    . ASP A 1 46  ? -12.645 9.505   1.077   1.00 0.00 ? 69  ASP A C    4  
ATOM 4932  O O    . ASP A 1 46  ? -11.630 10.071  0.645   1.00 0.00 ? 69  ASP A O    4  
ATOM 4933  C CB   . ASP A 1 46  ? -12.531 10.558  3.398   1.00 0.00 ? 69  ASP A CB   4  
ATOM 4934  C CG   . ASP A 1 46  ? -13.331 11.809  3.015   1.00 0.00 ? 69  ASP A CG   4  
ATOM 4935  O OD1  . ASP A 1 46  ? -13.526 12.127  1.821   1.00 0.00 ? 69  ASP A OD1  4  
ATOM 4936  O OD2  . ASP A 1 46  ? -13.700 12.537  3.960   1.00 0.00 ? 69  ASP A OD2  4  
ATOM 4937  H H    . ASP A 1 46  ? -11.110 8.469   3.471   1.00 0.00 ? 69  ASP A H    4  
ATOM 4938  H HA   . ASP A 1 46  ? -13.902 9.054   2.764   1.00 0.00 ? 69  ASP A HA   4  
ATOM 4939  H HB2  . ASP A 1 46  ? -12.730 10.327  4.448   1.00 0.00 ? 69  ASP A HB2  4  
ATOM 4940  H HB3  . ASP A 1 46  ? -11.470 10.785  3.316   1.00 0.00 ? 69  ASP A HB3  4  
ATOM 4941  N N    . PHE A 1 47  ? -13.573 8.994   0.260   1.00 0.00 ? 70  PHE A N    4  
ATOM 4942  C CA   . PHE A 1 47  ? -13.399 8.947   -1.187  1.00 0.00 ? 70  PHE A CA   4  
ATOM 4943  C C    . PHE A 1 47  ? -13.907 10.183  -1.924  1.00 0.00 ? 70  PHE A C    4  
ATOM 4944  O O    . PHE A 1 47  ? -13.383 10.466  -3.003  1.00 0.00 ? 70  PHE A O    4  
ATOM 4945  C CB   . PHE A 1 47  ? -14.058 7.684   -1.744  1.00 0.00 ? 70  PHE A CB   4  
ATOM 4946  C CG   . PHE A 1 47  ? -13.259 6.448   -1.417  1.00 0.00 ? 70  PHE A CG   4  
ATOM 4947  C CD1  . PHE A 1 47  ? -11.991 6.285   -2.004  1.00 0.00 ? 70  PHE A CD1  4  
ATOM 4948  C CD2  . PHE A 1 47  ? -13.730 5.509   -0.482  1.00 0.00 ? 70  PHE A CD2  4  
ATOM 4949  C CE1  . PHE A 1 47  ? -11.172 5.209   -1.633  1.00 0.00 ? 70  PHE A CE1  4  
ATOM 4950  C CE2  . PHE A 1 47  ? -12.931 4.405   -0.149  1.00 0.00 ? 70  PHE A CE2  4  
ATOM 4951  C CZ   . PHE A 1 47  ? -11.661 4.251   -0.725  1.00 0.00 ? 70  PHE A CZ   4  
ATOM 4952  H H    . PHE A 1 47  ? -14.368 8.511   0.662   1.00 0.00 ? 70  PHE A H    4  
ATOM 4953  H HA   . PHE A 1 47  ? -12.330 8.881   -1.394  1.00 0.00 ? 70  PHE A HA   4  
ATOM 4954  H HB2  . PHE A 1 47  ? -15.060 7.596   -1.332  1.00 0.00 ? 70  PHE A HB2  4  
ATOM 4955  H HB3  . PHE A 1 47  ? -14.134 7.762   -2.830  1.00 0.00 ? 70  PHE A HB3  4  
ATOM 4956  H HD1  . PHE A 1 47  ? -11.637 7.004   -2.727  1.00 0.00 ? 70  PHE A HD1  4  
ATOM 4957  H HD2  . PHE A 1 47  ? -14.688 5.633   0.000   1.00 0.00 ? 70  PHE A HD2  4  
ATOM 4958  H HE1  . PHE A 1 47  ? -10.176 5.143   -2.052  1.00 0.00 ? 70  PHE A HE1  4  
ATOM 4959  H HE2  . PHE A 1 47  ? -13.279 3.682   0.573   1.00 0.00 ? 70  PHE A HE2  4  
ATOM 4960  H HZ   . PHE A 1 47  ? -11.090 3.382   -0.452  1.00 0.00 ? 70  PHE A HZ   4  
ATOM 4961  N N    . GLY A 1 48  ? -14.865 10.935  -1.385  1.00 0.00 ? 71  GLY A N    4  
ATOM 4962  C CA   . GLY A 1 48  ? -15.503 12.047  -2.071  1.00 0.00 ? 71  GLY A CA   4  
ATOM 4963  C C    . GLY A 1 48  ? -17.006 11.820  -2.048  1.00 0.00 ? 71  GLY A C    4  
ATOM 4964  O O    . GLY A 1 48  ? -17.557 11.445  -1.011  1.00 0.00 ? 71  GLY A O    4  
ATOM 4965  H H    . GLY A 1 48  ? -15.271 10.704  -0.491  1.00 0.00 ? 71  GLY A H    4  
ATOM 4966  H HA2  . GLY A 1 48  ? -15.274 12.977  -1.555  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 4967  H HA3  . GLY A 1 48  ? -15.154 12.122  -3.102  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 4968  N N    . ALA A 1 49  ? -17.666 11.989  -3.193  1.00 0.00 ? 72  ALA A N    4  
ATOM 4969  C CA   . ALA A 1 49  ? -19.088 11.718  -3.359  1.00 0.00 ? 72  ALA A CA   4  
ATOM 4970  C C    . ALA A 1 49  ? -19.282 10.453  -4.190  1.00 0.00 ? 72  ALA A C    4  
ATOM 4971  O O    . ALA A 1 49  ? -19.588 9.420   -3.596  1.00 0.00 ? 72  ALA A O    4  
ATOM 4972  C CB   . ALA A 1 49  ? -19.817 12.934  -3.923  1.00 0.00 ? 72  ALA A CB   4  
ATOM 4973  H H    . ALA A 1 49  ? -17.134 12.289  -3.996  1.00 0.00 ? 72  ALA A H    4  
ATOM 4974  H HA   . ALA A 1 49  ? -19.535 11.525  -2.385  1.00 0.00 ? 72  ALA A HA   4  
ATOM 4975  H HB1  . ALA A 1 49  ? -19.790 13.750  -3.203  1.00 0.00 ? 72  ALA A HB1  4  
ATOM 4976  H HB2  . ALA A 1 49  ? -19.343 13.257  -4.836  1.00 0.00 ? 72  ALA A HB2  4  
ATOM 4977  H HB3  . ALA A 1 49  ? -20.851 12.673  -4.140  1.00 0.00 ? 72  ALA A HB3  4  
ATOM 4978  N N    . GLU A 1 50  ? -19.067 10.497  -5.516  1.00 0.00 ? 73  GLU A N    4  
ATOM 4979  C CA   . GLU A 1 50  ? -19.346 9.369   -6.413  1.00 0.00 ? 73  GLU A CA   4  
ATOM 4980  C C    . GLU A 1 50  ? -18.684 8.100   -5.881  1.00 0.00 ? 73  GLU A C    4  
ATOM 4981  O O    . GLU A 1 50  ? -19.343 7.075   -5.715  1.00 0.00 ? 73  GLU A O    4  
ATOM 4982  C CB   . GLU A 1 50  ? -18.806 9.588   -7.838  1.00 0.00 ? 73  GLU A CB   4  
ATOM 4983  C CG   . GLU A 1 50  ? -19.545 10.548  -8.746  1.00 0.00 ? 73  GLU A CG   4  
ATOM 4984  C CD   . GLU A 1 50  ? -19.099 10.516  -10.217 1.00 0.00 ? 73  GLU A CD   4  
ATOM 4985  O OE1  . GLU A 1 50  ? -18.145 11.236  -10.590 1.00 0.00 ? 73  GLU A OE1  4  
ATOM 4986  O OE2  . GLU A 1 50  ? -19.705 9.788   -11.036 1.00 0.00 ? 73  GLU A OE2  4  
ATOM 4987  H H    . GLU A 1 50  ? -18.733 11.359  -5.937  1.00 0.00 ? 73  GLU A H    4  
ATOM 4988  H HA   . GLU A 1 50  ? -20.424 9.206   -6.452  1.00 0.00 ? 73  GLU A HA   4  
ATOM 4989  H HB2  . GLU A 1 50  ? -17.775 9.929   -7.762  1.00 0.00 ? 73  GLU A HB2  4  
ATOM 4990  H HB3  . GLU A 1 50  ? -18.866 8.623   -8.331  1.00 0.00 ? 73  GLU A HB3  4  
ATOM 4991  H HG2  . GLU A 1 50  ? -20.592 10.287  -8.689  1.00 0.00 ? 73  GLU A HG2  4  
ATOM 4992  H HG3  . GLU A 1 50  ? -19.343 11.528  -8.354  1.00 0.00 ? 73  GLU A HG3  4  
ATOM 4993  N N    . GLY A 1 51  ? -17.376 8.177   -5.621  1.00 0.00 ? 74  GLY A N    4  
ATOM 4994  C CA   . GLY A 1 51  ? -16.577 7.026   -5.254  1.00 0.00 ? 74  GLY A CA   4  
ATOM 4995  C C    . GLY A 1 51  ? -16.904 6.505   -3.868  1.00 0.00 ? 74  GLY A C    4  
ATOM 4996  O O    . GLY A 1 51  ? -16.838 5.304   -3.648  1.00 0.00 ? 74  GLY A O    4  
ATOM 4997  H H    . GLY A 1 51  ? -16.894 9.041   -5.823  1.00 0.00 ? 74  GLY A H    4  
ATOM 4998  H HA2  . GLY A 1 51  ? -16.759 6.224   -5.968  1.00 0.00 ? 74  GLY A HA2  4  
ATOM 4999  H HA3  . GLY A 1 51  ? -15.524 7.298   -5.291  1.00 0.00 ? 74  GLY A HA3  4  
ATOM 5000  N N    . ASN A 1 52  ? -17.289 7.371   -2.933  1.00 0.00 ? 75  ASN A N    4  
ATOM 5001  C CA   . ASN A 1 52  ? -17.722 6.930   -1.613  1.00 0.00 ? 75  ASN A CA   4  
ATOM 5002  C C    . ASN A 1 52  ? -19.037 6.162   -1.739  1.00 0.00 ? 75  ASN A C    4  
ATOM 5003  O O    . ASN A 1 52  ? -19.125 5.025   -1.282  1.00 0.00 ? 75  ASN A O    4  
ATOM 5004  C CB   . ASN A 1 52  ? -17.761 8.123   -0.649  1.00 0.00 ? 75  ASN A CB   4  
ATOM 5005  C CG   . ASN A 1 52  ? -19.125 8.430   -0.060  1.00 0.00 ? 75  ASN A CG   4  
ATOM 5006  O OD1  . ASN A 1 52  ? -19.664 7.656   0.723   1.00 0.00 ? 75  ASN A OD1  4  
ATOM 5007  N ND2  . ASN A 1 52  ? -19.693 9.557   -0.430  1.00 0.00 ? 75  ASN A ND2  4  
ATOM 5008  H H    . ASN A 1 52  ? -17.384 8.346   -3.173  1.00 0.00 ? 75  ASN A H    4  
ATOM 5009  H HA   . ASN A 1 52  ? -16.981 6.226   -1.230  1.00 0.00 ? 75  ASN A HA   4  
ATOM 5010  H HB2  . ASN A 1 52  ? -17.099 7.906   0.177   1.00 0.00 ? 75  ASN A HB2  4  
ATOM 5011  H HB3  . ASN A 1 52  ? -17.352 9.003   -1.132  1.00 0.00 ? 75  ASN A HB3  4  
ATOM 5012  H HD21 . ASN A 1 52  ? -19.142 10.235  -0.944  1.00 0.00 ? 75  ASN A HD21 4  
ATOM 5013  H HD22 . ASN A 1 52  ? -20.473 9.884   0.126   1.00 0.00 ? 75  ASN A HD22 4  
ATOM 5014  N N    . ARG A 1 53  ? -20.023 6.723   -2.447  1.00 0.00 ? 76  ARG A N    4  
ATOM 5015  C CA   . ARG A 1 53  ? -21.283 6.039   -2.732  1.00 0.00 ? 76  ARG A CA   4  
ATOM 5016  C C    . ARG A 1 53  ? -21.060 4.708   -3.447  1.00 0.00 ? 76  ARG A C    4  
ATOM 5017  O O    . ARG A 1 53  ? -21.757 3.732   -3.165  1.00 0.00 ? 76  ARG A O    4  
ATOM 5018  C CB   . ARG A 1 53  ? -22.189 6.968   -3.537  1.00 0.00 ? 76  ARG A CB   4  
ATOM 5019  C CG   . ARG A 1 53  ? -22.792 8.074   -2.670  1.00 0.00 ? 76  ARG A CG   4  
ATOM 5020  C CD   . ARG A 1 53  ? -23.970 7.661   -1.767  1.00 0.00 ? 76  ARG A CD   4  
ATOM 5021  N NE   . ARG A 1 53  ? -23.594 6.968   -0.519  1.00 0.00 ? 76  ARG A NE   4  
ATOM 5022  C CZ   . ARG A 1 53  ? -23.060 7.526   0.575   1.00 0.00 ? 76  ARG A CZ   4  
ATOM 5023  N NH1  . ARG A 1 53  ? -22.720 8.810   0.548   1.00 0.00 ? 76  ARG A NH1  4  
ATOM 5024  N NH2  . ARG A 1 53  ? -22.884 6.828   1.693   1.00 0.00 ? 76  ARG A NH2  4  
ATOM 5025  H H    . ARG A 1 53  ? -19.896 7.671   -2.794  1.00 0.00 ? 76  ARG A H    4  
ATOM 5026  H HA   . ARG A 1 53  ? -21.775 5.833   -1.789  1.00 0.00 ? 76  ARG A HA   4  
ATOM 5027  H HB2  . ARG A 1 53  ? -21.616 7.424   -4.343  1.00 0.00 ? 76  ARG A HB2  4  
ATOM 5028  H HB3  . ARG A 1 53  ? -22.988 6.400   -3.991  1.00 0.00 ? 76  ARG A HB3  4  
ATOM 5029  H HG2  . ARG A 1 53  ? -22.003 8.529   -2.086  1.00 0.00 ? 76  ARG A HG2  4  
ATOM 5030  H HG3  . ARG A 1 53  ? -23.163 8.830   -3.348  1.00 0.00 ? 76  ARG A HG3  4  
ATOM 5031  H HD2  . ARG A 1 53  ? -24.535 8.556   -1.508  1.00 0.00 ? 76  ARG A HD2  4  
ATOM 5032  H HD3  . ARG A 1 53  ? -24.633 7.013   -2.335  1.00 0.00 ? 76  ARG A HD3  4  
ATOM 5033  H HE   . ARG A 1 53  ? -23.859 5.983   -0.488  1.00 0.00 ? 76  ARG A HE   4  
ATOM 5034  H HH11 . ARG A 1 53  ? -22.775 9.362   -0.306  1.00 0.00 ? 76  ARG A HH11 4  
ATOM 5035  H HH12 . ARG A 1 53  ? -22.189 9.243   1.299   1.00 0.00 ? 76  ARG A HH12 4  
ATOM 5036  H HH21 . ARG A 1 53  ? -23.142 5.838   1.790   1.00 0.00 ? 76  ARG A HH21 4  
ATOM 5037  H HH22 . ARG A 1 53  ? -22.382 7.202   2.492   1.00 0.00 ? 76  ARG A HH22 4  
ATOM 5038  N N    . TYR A 1 54  ? -20.106 4.653   -4.371  1.00 0.00 ? 77  TYR A N    4  
ATOM 5039  C CA   . TYR A 1 54  ? -19.703 3.426   -5.030  1.00 0.00 ? 77  TYR A CA   4  
ATOM 5040  C C    . TYR A 1 54  ? -19.066 2.444   -4.051  1.00 0.00 ? 77  TYR A C    4  
ATOM 5041  O O    . TYR A 1 54  ? -19.434 1.273   -4.052  1.00 0.00 ? 77  TYR A O    4  
ATOM 5042  C CB   . TYR A 1 54  ? -18.725 3.794   -6.141  1.00 0.00 ? 77  TYR A CB   4  
ATOM 5043  C CG   . TYR A 1 54  ? -18.785 2.814   -7.269  1.00 0.00 ? 77  TYR A CG   4  
ATOM 5044  C CD1  . TYR A 1 54  ? -19.714 3.030   -8.297  1.00 0.00 ? 77  TYR A CD1  4  
ATOM 5045  C CD2  . TYR A 1 54  ? -17.937 1.699   -7.289  1.00 0.00 ? 77  TYR A CD2  4  
ATOM 5046  C CE1  . TYR A 1 54  ? -19.770 2.136   -9.371  1.00 0.00 ? 77  TYR A CE1  4  
ATOM 5047  C CE2  . TYR A 1 54  ? -18.069 0.748   -8.310  1.00 0.00 ? 77  TYR A CE2  4  
ATOM 5048  C CZ   . TYR A 1 54  ? -18.994 0.960   -9.353  1.00 0.00 ? 77  TYR A CZ   4  
ATOM 5049  O OH   . TYR A 1 54  ? -19.186 0.000   -10.288 1.00 0.00 ? 77  TYR A OH   4  
ATOM 5050  H H    . TYR A 1 54  ? -19.651 5.513   -4.669  1.00 0.00 ? 77  TYR A H    4  
ATOM 5051  H HA   . TYR A 1 54  ? -20.580 2.921   -5.465  1.00 0.00 ? 77  TYR A HA   4  
ATOM 5052  H HB2  . TYR A 1 54  ? -18.982 4.768   -6.553  1.00 0.00 ? 77  TYR A HB2  4  
ATOM 5053  H HB3  . TYR A 1 54  ? -17.708 3.859   -5.755  1.00 0.00 ? 77  TYR A HB3  4  
ATOM 5054  H HD1  . TYR A 1 54  ? -20.360 3.901   -8.286  1.00 0.00 ? 77  TYR A HD1  4  
ATOM 5055  H HD2  . TYR A 1 54  ? -17.217 1.560   -6.499  1.00 0.00 ? 77  TYR A HD2  4  
ATOM 5056  H HE1  . TYR A 1 54  ? -20.411 2.372   -10.201 1.00 0.00 ? 77  TYR A HE1  4  
ATOM 5057  H HE2  . TYR A 1 54  ? -17.485 -0.155  -8.289  1.00 0.00 ? 77  TYR A HE2  4  
ATOM 5058  H HH   . TYR A 1 54  ? -20.101 0.007   -10.596 1.00 0.00 ? 77  TYR A HH   4  
ATOM 5059  N N    . TYR A 1 55  ? -18.108 2.875   -3.225  1.00 0.00 ? 78  TYR A N    4  
ATOM 5060  C CA   . TYR A 1 55  ? -17.448 2.013   -2.252  1.00 0.00 ? 78  TYR A CA   4  
ATOM 5061  C C    . TYR A 1 55  ? -18.525 1.393   -1.371  1.00 0.00 ? 78  TYR A C    4  
ATOM 5062  O O    . TYR A 1 55  ? -18.667 0.180   -1.383  1.00 0.00 ? 78  TYR A O    4  
ATOM 5063  C CB   . TYR A 1 55  ? -16.412 2.785   -1.426  1.00 0.00 ? 78  TYR A CB   4  
ATOM 5064  C CG   . TYR A 1 55  ? -15.465 1.911   -0.625  1.00 0.00 ? 78  TYR A CG   4  
ATOM 5065  C CD1  . TYR A 1 55  ? -14.647 0.950   -1.254  1.00 0.00 ? 78  TYR A CD1  4  
ATOM 5066  C CD2  . TYR A 1 55  ? -15.381 2.083   0.768   1.00 0.00 ? 78  TYR A CD2  4  
ATOM 5067  C CE1  . TYR A 1 55  ? -13.837 0.091   -0.492  1.00 0.00 ? 78  TYR A CE1  4  
ATOM 5068  C CE2  . TYR A 1 55  ? -14.528 1.270   1.527   1.00 0.00 ? 78  TYR A CE2  4  
ATOM 5069  C CZ   . TYR A 1 55  ? -13.787 0.245   0.907   1.00 0.00 ? 78  TYR A CZ   4  
ATOM 5070  O OH   . TYR A 1 55  ? -13.033 -0.572  1.682   1.00 0.00 ? 78  TYR A OH   4  
ATOM 5071  H H    . TYR A 1 55  ? -17.829 3.850   -3.241  1.00 0.00 ? 78  TYR A H    4  
ATOM 5072  H HA   . TYR A 1 55  ? -16.937 1.217   -2.793  1.00 0.00 ? 78  TYR A HA   4  
ATOM 5073  H HB2  . TYR A 1 55  ? -15.818 3.425   -2.077  1.00 0.00 ? 78  TYR A HB2  4  
ATOM 5074  H HB3  . TYR A 1 55  ? -16.969 3.403   -0.724  1.00 0.00 ? 78  TYR A HB3  4  
ATOM 5075  H HD1  . TYR A 1 55  ? -14.605 0.866   -2.326  1.00 0.00 ? 78  TYR A HD1  4  
ATOM 5076  H HD2  . TYR A 1 55  ? -15.924 2.874   1.260   1.00 0.00 ? 78  TYR A HD2  4  
ATOM 5077  H HE1  . TYR A 1 55  ? -13.230 -0.667  -0.968  1.00 0.00 ? 78  TYR A HE1  4  
ATOM 5078  H HE2  . TYR A 1 55  ? -14.421 1.444   2.584   1.00 0.00 ? 78  TYR A HE2  4  
ATOM 5079  H HH   . TYR A 1 55  ? -12.664 -1.373  1.243   1.00 0.00 ? 78  TYR A HH   4  
ATOM 5080  N N    . GLU A 1 56  ? -19.375 2.207   -0.741  1.00 0.00 ? 79  GLU A N    4  
ATOM 5081  C CA   . GLU A 1 56  ? -20.557 1.812   0.025   1.00 0.00 ? 79  GLU A CA   4  
ATOM 5082  C C    . GLU A 1 56  ? -21.365 0.706   -0.649  1.00 0.00 ? 79  GLU A C    4  
ATOM 5083  O O    . GLU A 1 56  ? -21.902 -0.159  0.045   1.00 0.00 ? 79  GLU A O    4  
ATOM 5084  C CB   . GLU A 1 56  ? -21.460 3.037   0.189   1.00 0.00 ? 79  GLU A CB   4  
ATOM 5085  C CG   . GLU A 1 56  ? -20.963 4.005   1.255   1.00 0.00 ? 79  GLU A CG   4  
ATOM 5086  C CD   . GLU A 1 56  ? -21.706 3.781   2.564   1.00 0.00 ? 79  GLU A CD   4  
ATOM 5087  O OE1  . GLU A 1 56  ? -22.887 4.184   2.644   1.00 0.00 ? 79  GLU A OE1  4  
ATOM 5088  O OE2  . GLU A 1 56  ? -21.105 3.197   3.495   1.00 0.00 ? 79  GLU A OE2  4  
ATOM 5089  H H    . GLU A 1 56  ? -19.218 3.208   -0.844  1.00 0.00 ? 79  GLU A H    4  
ATOM 5090  H HA   . GLU A 1 56  ? -20.258 1.455   1.009   1.00 0.00 ? 79  GLU A HA   4  
ATOM 5091  H HB2  . GLU A 1 56  ? -21.504 3.572   -0.752  1.00 0.00 ? 79  GLU A HB2  4  
ATOM 5092  H HB3  . GLU A 1 56  ? -22.475 2.719   0.430   1.00 0.00 ? 79  GLU A HB3  4  
ATOM 5093  H HG2  . GLU A 1 56  ? -19.893 3.876   1.402   1.00 0.00 ? 79  GLU A HG2  4  
ATOM 5094  H HG3  . GLU A 1 56  ? -21.135 5.021   0.908   1.00 0.00 ? 79  GLU A HG3  4  
ATOM 5095  N N    . ALA A 1 57  ? -21.448 0.726   -1.980  1.00 0.00 ? 80  ALA A N    4  
ATOM 5096  C CA   . ALA A 1 57  ? -22.226 -0.232  -2.730  1.00 0.00 ? 80  ALA A CA   4  
ATOM 5097  C C    . ALA A 1 57  ? -21.555 -1.597  -2.895  1.00 0.00 ? 80  ALA A C    4  
ATOM 5098  O O    . ALA A 1 57  ? -22.248 -2.620  -2.901  1.00 0.00 ? 80  ALA A O    4  
ATOM 5099  C CB   . ALA A 1 57  ? -22.577 0.359   -4.098  1.00 0.00 ? 80  ALA A CB   4  
ATOM 5100  H H    . ALA A 1 57  ? -20.982 1.465   -2.492  1.00 0.00 ? 80  ALA A H    4  
ATOM 5101  H HA   . ALA A 1 57  ? -23.124 -0.373  -2.155  1.00 0.00 ? 80  ALA A HA   4  
ATOM 5102  H HB1  . ALA A 1 57  ? -23.237 -0.315  -4.641  1.00 0.00 ? 80  ALA A HB1  4  
ATOM 5103  H HB2  . ALA A 1 57  ? -23.064 1.327   -3.974  1.00 0.00 ? 80  ALA A HB2  4  
ATOM 5104  H HB3  . ALA A 1 57  ? -21.678 0.481   -4.696  1.00 0.00 ? 80  ALA A HB3  4  
ATOM 5105  N N    . ASN A 1 58  ? -20.234 -1.633  -3.084  1.00 0.00 ? 81  ASN A N    4  
ATOM 5106  C CA   . ASN A 1 58  ? -19.529 -2.810  -3.609  1.00 0.00 ? 81  ASN A CA   4  
ATOM 5107  C C    . ASN A 1 58  ? -18.147 -3.035  -2.986  1.00 0.00 ? 81  ASN A C    4  
ATOM 5108  O O    . ASN A 1 58  ? -17.358 -3.804  -3.521  1.00 0.00 ? 81  ASN A O    4  
ATOM 5109  C CB   . ASN A 1 58  ? -19.447 -2.759  -5.147  1.00 0.00 ? 81  ASN A CB   4  
ATOM 5110  C CG   . ASN A 1 58  ? -18.284 -1.954  -5.709  1.00 0.00 ? 81  ASN A CG   4  
ATOM 5111  O OD1  . ASN A 1 58  ? -17.567 -2.399  -6.595  1.00 0.00 ? 81  ASN A OD1  4  
ATOM 5112  N ND2  . ASN A 1 58  ? -18.035 -0.753  -5.231  1.00 0.00 ? 81  ASN A ND2  4  
ATOM 5113  H H    . ASN A 1 58  ? -19.733 -0.760  -2.952  1.00 0.00 ? 81  ASN A H    4  
ATOM 5114  H HA   . ASN A 1 58  ? -20.118 -3.693  -3.359  1.00 0.00 ? 81  ASN A HA   4  
ATOM 5115  H HB2  . ASN A 1 58  ? -19.297 -3.780  -5.488  1.00 0.00 ? 81  ASN A HB2  4  
ATOM 5116  H HB3  . ASN A 1 58  ? -20.384 -2.401  -5.574  1.00 0.00 ? 81  ASN A HB3  4  
ATOM 5117  H HD21 . ASN A 1 58  ? -18.637 -0.287  -4.559  1.00 0.00 ? 81  ASN A HD21 4  
ATOM 5118  H HD22 . ASN A 1 58  ? -17.265 -0.262  -5.643  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 5119  N N    . TYR A 1 59  ? -17.852 -2.392  -1.861  1.00 0.00 ? 82  TYR A N    4  
ATOM 5120  C CA   . TYR A 1 59  ? -16.568 -2.314  -1.162  1.00 0.00 ? 82  TYR A CA   4  
ATOM 5121  C C    . TYR A 1 59  ? -15.835 -3.653  -1.011  1.00 0.00 ? 82  TYR A C    4  
ATOM 5122  O O    . TYR A 1 59  ? -14.613 -3.678  -0.948  1.00 0.00 ? 82  TYR A O    4  
ATOM 5123  C CB   . TYR A 1 59  ? -16.811 -1.735  0.243   1.00 0.00 ? 82  TYR A CB   4  
ATOM 5124  C CG   . TYR A 1 59  ? -17.931 -2.458  0.970   1.00 0.00 ? 82  TYR A CG   4  
ATOM 5125  C CD1  . TYR A 1 59  ? -17.639 -3.670  1.618   1.00 0.00 ? 82  TYR A CD1  4  
ATOM 5126  C CD2  . TYR A 1 59  ? -19.268 -2.011  0.886   1.00 0.00 ? 82  TYR A CD2  4  
ATOM 5127  C CE1  . TYR A 1 59  ? -18.667 -4.481  2.115   1.00 0.00 ? 82  TYR A CE1  4  
ATOM 5128  C CE2  . TYR A 1 59  ? -20.302 -2.807  1.412   1.00 0.00 ? 82  TYR A CE2  4  
ATOM 5129  C CZ   . TYR A 1 59  ? -20.006 -4.055  2.009   1.00 0.00 ? 82  TYR A CZ   4  
ATOM 5130  O OH   . TYR A 1 59  ? -21.004 -4.872  2.437   1.00 0.00 ? 82  TYR A OH   4  
ATOM 5131  H H    . TYR A 1 59  ? -18.545 -1.746  -1.504  1.00 0.00 ? 82  TYR A H    4  
ATOM 5132  H HA   . TYR A 1 59  ? -15.938 -1.625  -1.726  1.00 0.00 ? 82  TYR A HA   4  
ATOM 5133  H HB2  . TYR A 1 59  ? -15.891 -1.828  0.820   1.00 0.00 ? 82  TYR A HB2  4  
ATOM 5134  H HB3  . TYR A 1 59  ? -17.031 -0.673  0.183   1.00 0.00 ? 82  TYR A HB3  4  
ATOM 5135  H HD1  . TYR A 1 59  ? -16.615 -3.997  1.706   1.00 0.00 ? 82  TYR A HD1  4  
ATOM 5136  H HD2  . TYR A 1 59  ? -19.523 -1.059  0.424   1.00 0.00 ? 82  TYR A HD2  4  
ATOM 5137  H HE1  . TYR A 1 59  ? -18.423 -5.432  2.567   1.00 0.00 ? 82  TYR A HE1  4  
ATOM 5138  H HE2  . TYR A 1 59  ? -21.324 -2.467  1.330   1.00 0.00 ? 82  TYR A HE2  4  
ATOM 5139  H HH   . TYR A 1 59  ? -20.677 -5.779  2.527   1.00 0.00 ? 82  TYR A HH   4  
ATOM 5140  N N    . TRP A 1 60  ? -16.543 -4.784  -0.957  1.00 0.00 ? 83  TRP A N    4  
ATOM 5141  C CA   . TRP A 1 60  ? -15.909 -6.088  -0.827  1.00 0.00 ? 83  TRP A CA   4  
ATOM 5142  C C    . TRP A 1 60  ? -15.098 -6.465  -2.072  1.00 0.00 ? 83  TRP A C    4  
ATOM 5143  O O    . TRP A 1 60  ? -14.310 -7.409  -2.050  1.00 0.00 ? 83  TRP A O    4  
ATOM 5144  C CB   . TRP A 1 60  ? -16.973 -7.142  -0.509  1.00 0.00 ? 83  TRP A CB   4  
ATOM 5145  C CG   . TRP A 1 60  ? -17.994 -7.414  -1.575  1.00 0.00 ? 83  TRP A CG   4  
ATOM 5146  C CD1  . TRP A 1 60  ? -19.086 -6.665  -1.843  1.00 0.00 ? 83  TRP A CD1  4  
ATOM 5147  C CD2  . TRP A 1 60  ? -18.032 -8.517  -2.532  1.00 0.00 ? 83  TRP A CD2  4  
ATOM 5148  N NE1  . TRP A 1 60  ? -19.851 -7.288  -2.801  1.00 0.00 ? 83  TRP A NE1  4  
ATOM 5149  C CE2  . TRP A 1 60  ? -19.220 -8.402  -3.311  1.00 0.00 ? 83  TRP A CE2  4  
ATOM 5150  C CE3  . TRP A 1 60  ? -17.169 -9.591  -2.834  1.00 0.00 ? 83  TRP A CE3  4  
ATOM 5151  C CZ2  . TRP A 1 60  ? -19.537 -9.302  -4.340  1.00 0.00 ? 83  TRP A CZ2  4  
ATOM 5152  C CZ3  . TRP A 1 60  ? -17.485 -10.513 -3.852  1.00 0.00 ? 83  TRP A CZ3  4  
ATOM 5153  C CH2  . TRP A 1 60  ? -18.665 -10.372 -4.605  1.00 0.00 ? 83  TRP A CH2  4  
ATOM 5154  H H    . TRP A 1 60  ? -17.548 -4.724  -1.000  1.00 0.00 ? 83  TRP A H    4  
ATOM 5155  H HA   . TRP A 1 60  ? -15.217 -6.026  0.012   1.00 0.00 ? 83  TRP A HA   4  
ATOM 5156  H HB2  . TRP A 1 60  ? -16.465 -8.080  -0.287  1.00 0.00 ? 83  TRP A HB2  4  
ATOM 5157  H HB3  . TRP A 1 60  ? -17.492 -6.843  0.401   1.00 0.00 ? 83  TRP A HB3  4  
ATOM 5158  H HD1  . TRP A 1 60  ? -19.378 -5.749  -1.351  1.00 0.00 ? 83  TRP A HD1  4  
ATOM 5159  H HE1  . TRP A 1 60  ? -20.812 -7.000  -2.976  1.00 0.00 ? 83  TRP A HE1  4  
ATOM 5160  H HE3  . TRP A 1 60  ? -16.259 -9.699  -2.262  1.00 0.00 ? 83  TRP A HE3  4  
ATOM 5161  H HZ2  . TRP A 1 60  ? -20.434 -9.166  -4.931  1.00 0.00 ? 83  TRP A HZ2  4  
ATOM 5162  H HZ3  . TRP A 1 60  ? -16.818 -11.337 -4.067  1.00 0.00 ? 83  TRP A HZ3  4  
ATOM 5163  H HH2  . TRP A 1 60  ? -18.885 -11.076 -5.398  1.00 0.00 ? 83  TRP A HH2  4  
ATOM 5164  N N    . GLN A 1 61  ? -15.272 -5.738  -3.172  1.00 0.00 ? 84  GLN A N    4  
ATOM 5165  C CA   . GLN A 1 61  ? -14.606 -5.942  -4.447  1.00 0.00 ? 84  GLN A CA   4  
ATOM 5166  C C    . GLN A 1 61  ? -13.226 -5.261  -4.475  1.00 0.00 ? 84  GLN A C    4  
ATOM 5167  O O    . GLN A 1 61  ? -12.657 -5.101  -5.546  1.00 0.00 ? 84  GLN A O    4  
ATOM 5168  C CB   . GLN A 1 61  ? -15.547 -5.466  -5.563  1.00 0.00 ? 84  GLN A CB   4  
ATOM 5169  C CG   . GLN A 1 61  ? -16.851 -6.290  -5.581  1.00 0.00 ? 84  GLN A CG   4  
ATOM 5170  C CD   . GLN A 1 61  ? -16.817 -7.378  -6.656  1.00 0.00 ? 84  GLN A CD   4  
ATOM 5171  O OE1  . GLN A 1 61  ? -16.928 -7.113  -7.850  1.00 0.00 ? 84  GLN A OE1  4  
ATOM 5172  N NE2  . GLN A 1 61  ? -16.681 -8.631  -6.270  1.00 0.00 ? 84  GLN A NE2  4  
ATOM 5173  H H    . GLN A 1 61  ? -15.952 -4.984  -3.150  1.00 0.00 ? 84  GLN A H    4  
ATOM 5174  H HA   . GLN A 1 61  ? -14.458 -7.006  -4.607  1.00 0.00 ? 84  GLN A HA   4  
ATOM 5175  H HB2  . GLN A 1 61  ? -15.772 -4.409  -5.418  1.00 0.00 ? 84  GLN A HB2  4  
ATOM 5176  H HB3  . GLN A 1 61  ? -15.053 -5.572  -6.527  1.00 0.00 ? 84  GLN A HB3  4  
ATOM 5177  H HG2  . GLN A 1 61  ? -17.026 -6.754  -4.613  1.00 0.00 ? 84  GLN A HG2  4  
ATOM 5178  H HG3  . GLN A 1 61  ? -17.689 -5.617  -5.746  1.00 0.00 ? 84  GLN A HG3  4  
ATOM 5179  H HE21 . GLN A 1 61  ? -16.729 -8.906  -5.300  1.00 0.00 ? 84  GLN A HE21 4  
ATOM 5180  H HE22 . GLN A 1 61  ? -16.587 -9.334  -7.002  1.00 0.00 ? 84  GLN A HE22 4  
ATOM 5181  N N    . PHE A 1 62  ? -12.657 -4.865  -3.329  1.00 0.00 ? 85  PHE A N    4  
ATOM 5182  C CA   . PHE A 1 62  ? -11.426 -4.074  -3.229  1.00 0.00 ? 85  PHE A CA   4  
ATOM 5183  C C    . PHE A 1 62  ? -10.398 -4.787  -2.339  1.00 0.00 ? 85  PHE A C    4  
ATOM 5184  O O    . PHE A 1 62  ? -10.765 -5.737  -1.647  1.00 0.00 ? 85  PHE A O    4  
ATOM 5185  C CB   . PHE A 1 62  ? -11.781 -2.692  -2.664  1.00 0.00 ? 85  PHE A CB   4  
ATOM 5186  C CG   . PHE A 1 62  ? -12.618 -1.838  -3.597  1.00 0.00 ? 85  PHE A CG   4  
ATOM 5187  C CD1  . PHE A 1 62  ? -13.985 -2.113  -3.757  1.00 0.00 ? 85  PHE A CD1  4  
ATOM 5188  C CD2  . PHE A 1 62  ? -12.039 -0.790  -4.333  1.00 0.00 ? 85  PHE A CD2  4  
ATOM 5189  C CE1  . PHE A 1 62  ? -14.774 -1.352  -4.623  1.00 0.00 ? 85  PHE A CE1  4  
ATOM 5190  C CE2  . PHE A 1 62  ? -12.837 -0.009  -5.186  1.00 0.00 ? 85  PHE A CE2  4  
ATOM 5191  C CZ   . PHE A 1 62  ? -14.208 -0.278  -5.324  1.00 0.00 ? 85  PHE A CZ   4  
ATOM 5192  H H    . PHE A 1 62  ? -13.137 -5.006  -2.451  1.00 0.00 ? 85  PHE A H    4  
ATOM 5193  H HA   . PHE A 1 62  ? -10.995 -3.938  -4.220  1.00 0.00 ? 85  PHE A HA   4  
ATOM 5194  H HB2  . PHE A 1 62  ? -12.318 -2.825  -1.727  1.00 0.00 ? 85  PHE A HB2  4  
ATOM 5195  H HB3  . PHE A 1 62  ? -10.872 -2.154  -2.411  1.00 0.00 ? 85  PHE A HB3  4  
ATOM 5196  H HD1  . PHE A 1 62  ? -14.445 -2.934  -3.242  1.00 0.00 ? 85  PHE A HD1  4  
ATOM 5197  H HD2  . PHE A 1 62  ? -10.982 -0.587  -4.258  1.00 0.00 ? 85  PHE A HD2  4  
ATOM 5198  H HE1  . PHE A 1 62  ? -15.802 -1.641  -4.741  1.00 0.00 ? 85  PHE A HE1  4  
ATOM 5199  H HE2  . PHE A 1 62  ? -12.386 0.787   -5.751  1.00 0.00 ? 85  PHE A HE2  4  
ATOM 5200  H HZ   . PHE A 1 62  ? -14.814 0.324   -5.980  1.00 0.00 ? 85  PHE A HZ   4  
ATOM 5201  N N    . PRO A 1 63  ? -9.111  -4.401  -2.368  1.00 0.00 ? 86  PRO A N    4  
ATOM 5202  C CA   . PRO A 1 63  ? -8.112  -4.830  -1.397  1.00 0.00 ? 86  PRO A CA   4  
ATOM 5203  C C    . PRO A 1 63  ? -8.309  -4.136  -0.044  1.00 0.00 ? 86  PRO A C    4  
ATOM 5204  O O    . PRO A 1 63  ? -8.988  -3.116  0.028   1.00 0.00 ? 86  PRO A O    4  
ATOM 5205  C CB   . PRO A 1 63  ? -6.781  -4.381  -1.960  1.00 0.00 ? 86  PRO A CB   4  
ATOM 5206  C CG   . PRO A 1 63  ? -7.109  -3.195  -2.849  1.00 0.00 ? 86  PRO A CG   4  
ATOM 5207  C CD   . PRO A 1 63  ? -8.517  -3.505  -3.340  1.00 0.00 ? 86  PRO A CD   4  
ATOM 5208  H HA   . PRO A 1 63  ? -8.080  -5.915  -1.321  1.00 0.00 ? 86  PRO A HA   4  
ATOM 5209  H HB2  . PRO A 1 63  ? -6.120  -4.082  -1.153  1.00 0.00 ? 86  PRO A HB2  4  
ATOM 5210  H HB3  . PRO A 1 63  ? -6.349  -5.183  -2.546  1.00 0.00 ? 86  PRO A HB3  4  
ATOM 5211  H HG2  . PRO A 1 63  ? -7.114  -2.286  -2.252  1.00 0.00 ? 86  PRO A HG2  4  
ATOM 5212  H HG3  . PRO A 1 63  ? -6.404  -3.106  -3.671  1.00 0.00 ? 86  PRO A HG3  4  
ATOM 5213  H HD2  . PRO A 1 63  ? -9.080  -2.580  -3.419  1.00 0.00 ? 86  PRO A HD2  4  
ATOM 5214  H HD3  . PRO A 1 63  ? -8.472  -4.005  -4.307  1.00 0.00 ? 86  PRO A HD3  4  
ATOM 5215  N N    . ASP A 1 64  ? -7.577  -4.589  0.985   1.00 0.00 ? 87  ASP A N    4  
ATOM 5216  C CA   . ASP A 1 64  ? -7.548  -3.935  2.298   1.00 0.00 ? 87  ASP A CA   4  
ATOM 5217  C C    . ASP A 1 64  ? -6.115  -3.766  2.834   1.00 0.00 ? 87  ASP A C    4  
ATOM 5218  O O    . ASP A 1 64  ? -5.931  -3.463  4.015   1.00 0.00 ? 87  ASP A O    4  
ATOM 5219  C CB   . ASP A 1 64  ? -8.451  -4.669  3.308   1.00 0.00 ? 87  ASP A CB   4  
ATOM 5220  C CG   . ASP A 1 64  ? -9.880  -4.876  2.809   1.00 0.00 ? 87  ASP A CG   4  
ATOM 5221  O OD1  . ASP A 1 64  ? -10.672 -3.909  2.836   1.00 0.00 ? 87  ASP A OD1  4  
ATOM 5222  O OD2  . ASP A 1 64  ? -10.208 -6.026  2.437   1.00 0.00 ? 87  ASP A OD2  4  
ATOM 5223  H H    . ASP A 1 64  ? -7.060  -5.445  0.905   1.00 0.00 ? 87  ASP A H    4  
ATOM 5224  H HA   . ASP A 1 64  ? -7.951  -2.934  2.180   1.00 0.00 ? 87  ASP A HA   4  
ATOM 5225  H HB2  . ASP A 1 64  ? -8.015  -5.635  3.554   1.00 0.00 ? 87  ASP A HB2  4  
ATOM 5226  H HB3  . ASP A 1 64  ? -8.496  -4.088  4.231   1.00 0.00 ? 87  ASP A HB3  4  
ATOM 5227  N N    . GLY A 1 65  ? -5.089  -3.971  1.997   1.00 0.00 ? 88  GLY A N    4  
ATOM 5228  C CA   . GLY A 1 65  ? -3.679  -3.864  2.372   1.00 0.00 ? 88  GLY A CA   4  
ATOM 5229  C C    . GLY A 1 65  ? -2.740  -4.272  1.234   1.00 0.00 ? 88  GLY A C    4  
ATOM 5230  O O    . GLY A 1 65  ? -3.116  -5.098  0.397   1.00 0.00 ? 88  GLY A O    4  
ATOM 5231  H H    . GLY A 1 65  ? -5.283  -4.169  1.029   1.00 0.00 ? 88  GLY A H    4  
ATOM 5232  H HA2  . GLY A 1 65  ? -3.461  -2.844  2.665   1.00 0.00 ? 88  GLY A HA2  4  
ATOM 5233  H HA3  . GLY A 1 65  ? -3.498  -4.500  3.234   1.00 0.00 ? 88  GLY A HA3  4  
ATOM 5234  N N    . ILE A 1 66  ? -1.540  -3.690  1.154   1.00 0.00 ? 89  ILE A N    4  
ATOM 5235  C CA   . ILE A 1 66  ? -0.517  -3.973  0.147   1.00 0.00 ? 89  ILE A CA   4  
ATOM 5236  C C    . ILE A 1 66  ? 0.721   -4.593  0.827   1.00 0.00 ? 89  ILE A C    4  
ATOM 5237  O O    . ILE A 1 66  ? 0.979   -4.348  2.008   1.00 0.00 ? 89  ILE A O    4  
ATOM 5238  C CB   . ILE A 1 66  ? -0.180  -2.639  -0.577  1.00 0.00 ? 89  ILE A CB   4  
ATOM 5239  C CG1  . ILE A 1 66  ? -1.281  -2.186  -1.553  1.00 0.00 ? 89  ILE A CG1  4  
ATOM 5240  C CG2  . ILE A 1 66  ? 1.140   -2.651  -1.355  1.00 0.00 ? 89  ILE A CG2  4  
ATOM 5241  C CD1  . ILE A 1 66  ? -1.337  -3.018  -2.847  1.00 0.00 ? 89  ILE A CD1  4  
ATOM 5242  H H    . ILE A 1 66  ? -1.278  -3.017  1.865   1.00 0.00 ? 89  ILE A H    4  
ATOM 5243  H HA   . ILE A 1 66  ? -0.925  -4.705  -0.561  1.00 0.00 ? 89  ILE A HA   4  
ATOM 5244  H HB   . ILE A 1 66  ? -0.081  -1.863  0.185   1.00 0.00 ? 89  ILE A HB   4  
ATOM 5245  H HG12 . ILE A 1 66  ? -2.245  -2.224  -1.051  1.00 0.00 ? 89  ILE A HG12 4  
ATOM 5246  H HG13 . ILE A 1 66  ? -1.097  -1.143  -1.814  1.00 0.00 ? 89  ILE A HG13 4  
ATOM 5247  H HG21 . ILE A 1 66  ? 1.199   -1.766  -1.989  1.00 0.00 ? 89  ILE A HG21 4  
ATOM 5248  H HG22 . ILE A 1 66  ? 1.974   -2.643  -0.656  1.00 0.00 ? 89  ILE A HG22 4  
ATOM 5249  H HG23 . ILE A 1 66  ? 1.187   -3.549  -1.973  1.00 0.00 ? 89  ILE A HG23 4  
ATOM 5250  H HD11 . ILE A 1 66  ? -2.222  -2.748  -3.419  1.00 0.00 ? 89  ILE A HD11 4  
ATOM 5251  H HD12 . ILE A 1 66  ? -0.465  -2.827  -3.468  1.00 0.00 ? 89  ILE A HD12 4  
ATOM 5252  H HD13 . ILE A 1 66  ? -1.374  -4.080  -2.604  1.00 0.00 ? 89  ILE A HD13 4  
ATOM 5253  N N    . HIS A 1 67  ? 1.531   -5.325  0.052   1.00 0.00 ? 90  HIS A N    4  
ATOM 5254  C CA   . HIS A 1 67  ? 2.699   -6.094  0.486   1.00 0.00 ? 90  HIS A CA   4  
ATOM 5255  C C    . HIS A 1 67  ? 3.939   -5.491  -0.187  1.00 0.00 ? 90  HIS A C    4  
ATOM 5256  O O    . HIS A 1 67  ? 4.506   -6.045  -1.135  1.00 0.00 ? 90  HIS A O    4  
ATOM 5257  C CB   . HIS A 1 67  ? 2.504   -7.587  0.142   1.00 0.00 ? 90  HIS A CB   4  
ATOM 5258  C CG   . HIS A 1 67  ? 1.121   -8.107  0.438   1.00 0.00 ? 90  HIS A CG   4  
ATOM 5259  N ND1  . HIS A 1 67  ? 0.001   -7.803  -0.296  1.00 0.00 ? 90  HIS A ND1  4  
ATOM 5260  C CD2  . HIS A 1 67  ? 0.754   -8.997  1.409   1.00 0.00 ? 90  HIS A CD2  4  
ATOM 5261  C CE1  . HIS A 1 67  ? -1.020  -8.490  0.221   1.00 0.00 ? 90  HIS A CE1  4  
ATOM 5262  N NE2  . HIS A 1 67  ? -0.625  -9.217  1.279   1.00 0.00 ? 90  HIS A NE2  4  
ATOM 5263  H H    . HIS A 1 67  ? 1.267   -5.475  -0.914  1.00 0.00 ? 90  HIS A H    4  
ATOM 5264  H HA   . HIS A 1 67  ? 2.807   -6.014  1.569   1.00 0.00 ? 90  HIS A HA   4  
ATOM 5265  H HB2  . HIS A 1 67  ? 2.677   -7.745  -0.924  1.00 0.00 ? 90  HIS A HB2  4  
ATOM 5266  H HB3  . HIS A 1 67  ? 3.242   -8.178  0.686   1.00 0.00 ? 90  HIS A HB3  4  
ATOM 5267  H HD1  . HIS A 1 67  ? 0.000   -7.257  -1.151  1.00 0.00 ? 90  HIS A HD1  4  
ATOM 5268  H HD2  . HIS A 1 67  ? 1.414   -9.460  2.127   1.00 0.00 ? 90  HIS A HD2  4  
ATOM 5269  H HE1  . HIS A 1 67  ? -2.020  -8.429  -0.171  1.00 0.00 ? 90  HIS A HE1  4  
ATOM 5270  N N    . TYR A 1 68  ? 4.303   -4.271  0.209   1.00 0.00 ? 91  TYR A N    4  
ATOM 5271  C CA   . TYR A 1 68  ? 5.366   -3.501  -0.427  1.00 0.00 ? 91  TYR A CA   4  
ATOM 5272  C C    . TYR A 1 68  ? 5.819   -2.432  0.564   1.00 0.00 ? 91  TYR A C    4  
ATOM 5273  O O    . TYR A 1 68  ? 5.249   -1.340  0.598   1.00 0.00 ? 91  TYR A O    4  
ATOM 5274  C CB   . TYR A 1 68  ? 4.841   -2.910  -1.751  1.00 0.00 ? 91  TYR A CB   4  
ATOM 5275  C CG   . TYR A 1 68  ? 5.873   -2.220  -2.620  1.00 0.00 ? 91  TYR A CG   4  
ATOM 5276  C CD1  . TYR A 1 68  ? 6.590   -2.939  -3.595  1.00 0.00 ? 91  TYR A CD1  4  
ATOM 5277  C CD2  . TYR A 1 68  ? 6.078   -0.837  -2.488  1.00 0.00 ? 91  TYR A CD2  4  
ATOM 5278  C CE1  . TYR A 1 68  ? 7.506   -2.274  -4.434  1.00 0.00 ? 91  TYR A CE1  4  
ATOM 5279  C CE2  . TYR A 1 68  ? 7.005   -0.167  -3.302  1.00 0.00 ? 91  TYR A CE2  4  
ATOM 5280  C CZ   . TYR A 1 68  ? 7.725   -0.880  -4.287  1.00 0.00 ? 91  TYR A CZ   4  
ATOM 5281  O OH   . TYR A 1 68  ? 8.644   -0.211  -5.043  1.00 0.00 ? 91  TYR A OH   4  
ATOM 5282  H H    . TYR A 1 68  ? 3.809   -3.827  0.973   1.00 0.00 ? 91  TYR A H    4  
ATOM 5283  H HA   . TYR A 1 68  ? 6.209   -4.156  -0.648  1.00 0.00 ? 91  TYR A HA   4  
ATOM 5284  H HB2  . TYR A 1 68  ? 4.397   -3.708  -2.344  1.00 0.00 ? 91  TYR A HB2  4  
ATOM 5285  H HB3  . TYR A 1 68  ? 4.045   -2.197  -1.533  1.00 0.00 ? 91  TYR A HB3  4  
ATOM 5286  H HD1  . TYR A 1 68  ? 6.456   -4.007  -3.698  1.00 0.00 ? 91  TYR A HD1  4  
ATOM 5287  H HD2  . TYR A 1 68  ? 5.517   -0.275  -1.756  1.00 0.00 ? 91  TYR A HD2  4  
ATOM 5288  H HE1  . TYR A 1 68  ? 8.037   -2.865  -5.166  1.00 0.00 ? 91  TYR A HE1  4  
ATOM 5289  H HE2  . TYR A 1 68  ? 7.145   0.897   -3.164  1.00 0.00 ? 91  TYR A HE2  4  
ATOM 5290  H HH   . TYR A 1 68  ? 8.946   -0.665  -5.854  1.00 0.00 ? 91  TYR A HH   4  
ATOM 5291  N N    . ASN A 1 69  ? 6.793   -2.754  1.420   1.00 0.00 ? 92  ASN A N    4  
ATOM 5292  C CA   . ASN A 1 69  ? 7.422   -1.753  2.281   1.00 0.00 ? 92  ASN A CA   4  
ATOM 5293  C C    . ASN A 1 69  ? 8.508   -1.081  1.458   1.00 0.00 ? 92  ASN A C    4  
ATOM 5294  O O    . ASN A 1 69  ? 9.679   -1.464  1.518   1.00 0.00 ? 92  ASN A O    4  
ATOM 5295  C CB   . ASN A 1 69  ? 7.969   -2.350  3.587   1.00 0.00 ? 92  ASN A CB   4  
ATOM 5296  C CG   . ASN A 1 69  ? 6.832   -2.557  4.569   1.00 0.00 ? 92  ASN A CG   4  
ATOM 5297  O OD1  . ASN A 1 69  ? 6.337   -1.603  5.159   1.00 0.00 ? 92  ASN A OD1  4  
ATOM 5298  N ND2  . ASN A 1 69  ? 6.350   -3.777  4.711   1.00 0.00 ? 92  ASN A ND2  4  
ATOM 5299  H H    . ASN A 1 69  ? 7.241   -3.657  1.349   1.00 0.00 ? 92  ASN A H    4  
ATOM 5300  H HA   . ASN A 1 69  ? 6.687   -0.994  2.558   1.00 0.00 ? 92  ASN A HA   4  
ATOM 5301  H HB2  . ASN A 1 69  ? 8.514   -3.273  3.397   1.00 0.00 ? 92  ASN A HB2  4  
ATOM 5302  H HB3  . ASN A 1 69  ? 8.661   -1.635  4.036   1.00 0.00 ? 92  ASN A HB3  4  
ATOM 5303  H HD21 . ASN A 1 69  ? 6.754   -4.583  4.248   1.00 0.00 ? 92  ASN A HD21 4  
ATOM 5304  H HD22 . ASN A 1 69  ? 5.522   -3.903  5.286   1.00 0.00 ? 92  ASN A HD22 4  
ATOM 5305  N N    . GLY A 1 70  ? 8.114   -0.124  0.628   1.00 0.00 ? 93  GLY A N    4  
ATOM 5306  C CA   . GLY A 1 70  ? 9.037   0.802   0.002   1.00 0.00 ? 93  GLY A CA   4  
ATOM 5307  C C    . GLY A 1 70  ? 9.327   1.857   1.050   1.00 0.00 ? 93  GLY A C    4  
ATOM 5308  O O    . GLY A 1 70  ? 8.541   2.791   1.199   1.00 0.00 ? 93  GLY A O    4  
ATOM 5309  H H    . GLY A 1 70  ? 7.146   0.168   0.706   1.00 0.00 ? 93  GLY A H    4  
ATOM 5310  H HA2  . GLY A 1 70  ? 9.957   0.302   -0.303  1.00 0.00 ? 93  GLY A HA2  4  
ATOM 5311  H HA3  . GLY A 1 70  ? 8.576   1.272   -0.863  1.00 0.00 ? 93  GLY A HA3  4  
ATOM 5312  N N    . CYS A 1 71  ? 10.359  1.644   1.861   1.00 0.00 ? 94  CYS A N    4  
ATOM 5313  C CA   . CYS A 1 71  ? 10.813  2.669   2.790   1.00 0.00 ? 94  CYS A CA   4  
ATOM 5314  C C    . CYS A 1 71  ? 12.307  2.944   2.702   1.00 0.00 ? 94  CYS A C    4  
ATOM 5315  O O    . CYS A 1 71  ? 12.767  3.933   3.274   1.00 0.00 ? 94  CYS A O    4  
ATOM 5316  C CB   . CYS A 1 71  ? 10.351  2.353   4.218   1.00 0.00 ? 94  CYS A CB   4  
ATOM 5317  S SG   . CYS A 1 71  ? 8.673   2.942   4.588   1.00 0.00 ? 94  CYS A SG   4  
ATOM 5318  H H    . CYS A 1 71  ? 10.861  0.768   1.795   1.00 0.00 ? 94  CYS A H    4  
ATOM 5319  H HA   . CYS A 1 71  ? 10.357  3.607   2.493   1.00 0.00 ? 94  CYS A HA   4  
ATOM 5320  H HB2  . CYS A 1 71  ? 10.410  1.277   4.382   1.00 0.00 ? 94  CYS A HB2  4  
ATOM 5321  H HB3  . CYS A 1 71  ? 11.029  2.844   4.921   1.00 0.00 ? 94  CYS A HB3  4  
ATOM 5322  N N    . SER A 1 72  ? 13.055  2.150   1.946   1.00 0.00 ? 95  SER A N    4  
ATOM 5323  C CA   . SER A 1 72  ? 14.503  2.195   1.936   1.00 0.00 ? 95  SER A CA   4  
ATOM 5324  C C    . SER A 1 72  ? 15.069  3.300   1.031   1.00 0.00 ? 95  SER A C    4  
ATOM 5325  O O    . SER A 1 72  ? 16.264  3.609   1.103   1.00 0.00 ? 95  SER A O    4  
ATOM 5326  C CB   . SER A 1 72  ? 15.005  0.814   1.522   1.00 0.00 ? 95  SER A CB   4  
ATOM 5327  O OG   . SER A 1 72  ? 14.173  -0.225  2.027   1.00 0.00 ? 95  SER A OG   4  
ATOM 5328  H H    . SER A 1 72  ? 12.658  1.353   1.472   1.00 0.00 ? 95  SER A H    4  
ATOM 5329  H HA   . SER A 1 72  ? 14.844  2.381   2.956   1.00 0.00 ? 95  SER A HA   4  
ATOM 5330  H HB2  . SER A 1 72  ? 15.047  0.744   0.437   1.00 0.00 ? 95  SER A HB2  4  
ATOM 5331  H HB3  . SER A 1 72  ? 16.005  0.720   1.921   1.00 0.00 ? 95  SER A HB3  4  
ATOM 5332  H HG   . SER A 1 72  ? 14.645  -1.072  1.951   1.00 0.00 ? 95  SER A HG   4  
ATOM 5333  N N    . GLU A 1 73  ? 14.241  3.925   0.190   1.00 0.00 ? 96  GLU A N    4  
ATOM 5334  C CA   . GLU A 1 73  ? 14.601  5.119   -0.561  1.00 0.00 ? 96  GLU A CA   4  
ATOM 5335  C C    . GLU A 1 73  ? 14.842  6.297   0.389   1.00 0.00 ? 96  GLU A C    4  
ATOM 5336  O O    . GLU A 1 73  ? 14.559  6.248   1.590   1.00 0.00 ? 96  GLU A O    4  
ATOM 5337  C CB   . GLU A 1 73  ? 13.531  5.490   -1.607  1.00 0.00 ? 96  GLU A CB   4  
ATOM 5338  C CG   . GLU A 1 73  ? 13.048  4.321   -2.478  1.00 0.00 ? 96  GLU A CG   4  
ATOM 5339  C CD   . GLU A 1 73  ? 11.669  3.813   -2.049  1.00 0.00 ? 96  GLU A CD   4  
ATOM 5340  O OE1  . GLU A 1 73  ? 11.480  3.573   -0.833  1.00 0.00 ? 96  GLU A OE1  4  
ATOM 5341  O OE2  . GLU A 1 73  ? 10.801  3.709   -2.953  1.00 0.00 ? 96  GLU A OE2  4  
ATOM 5342  H H    . GLU A 1 73  ? 13.285  3.606   0.118   1.00 0.00 ? 96  GLU A H    4  
ATOM 5343  H HA   . GLU A 1 73  ? 15.529  4.917   -1.091  1.00 0.00 ? 96  GLU A HA   4  
ATOM 5344  H HB2  . GLU A 1 73  ? 12.679  5.958   -1.116  1.00 0.00 ? 96  GLU A HB2  4  
ATOM 5345  H HB3  . GLU A 1 73  ? 13.954  6.244   -2.271  1.00 0.00 ? 96  GLU A HB3  4  
ATOM 5346  H HG2  . GLU A 1 73  ? 12.992  4.664   -3.511  1.00 0.00 ? 96  GLU A HG2  4  
ATOM 5347  H HG3  . GLU A 1 73  ? 13.772  3.509   -2.463  1.00 0.00 ? 96  GLU A HG3  4  
ATOM 5348  N N    . ALA A 1 74  ? 15.352  7.384   -0.177  1.00 0.00 ? 97  ALA A N    4  
ATOM 5349  C CA   . ALA A 1 74  ? 15.718  8.614   0.516   1.00 0.00 ? 97  ALA A CA   4  
ATOM 5350  C C    . ALA A 1 74  ? 15.223  9.865   -0.217  1.00 0.00 ? 97  ALA A C    4  
ATOM 5351  O O    . ALA A 1 74  ? 15.601  10.971  0.165   1.00 0.00 ? 97  ALA A O    4  
ATOM 5352  C CB   . ALA A 1 74  ? 17.240  8.656   0.691   1.00 0.00 ? 97  ALA A CB   4  
ATOM 5353  H H    . ALA A 1 74  ? 15.579  7.284   -1.160  1.00 0.00 ? 97  ALA A H    4  
ATOM 5354  H HA   . ALA A 1 74  ? 15.262  8.616   1.508   1.00 0.00 ? 97  ALA A HA   4  
ATOM 5355  H HB1  . ALA A 1 74  ? 17.591  7.748   1.183   1.00 0.00 ? 97  ALA A HB1  4  
ATOM 5356  H HB2  . ALA A 1 74  ? 17.721  8.760   -0.282  1.00 0.00 ? 97  ALA A HB2  4  
ATOM 5357  H HB3  . ALA A 1 74  ? 17.508  9.516   1.303   1.00 0.00 ? 97  ALA A HB3  4  
ATOM 5358  N N    . ASN A 1 75  ? 14.424  9.732   -1.284  1.00 0.00 ? 98  ASN A N    4  
ATOM 5359  C CA   . ASN A 1 75  ? 13.914  10.881  -2.042  1.00 0.00 ? 98  ASN A CA   4  
ATOM 5360  C C    . ASN A 1 75  ? 12.553  10.544  -2.644  1.00 0.00 ? 98  ASN A C    4  
ATOM 5361  O O    . ASN A 1 75  ? 12.433  10.376  -3.861  1.00 0.00 ? 98  ASN A O    4  
ATOM 5362  C CB   . ASN A 1 75  ? 14.919  11.315  -3.132  1.00 0.00 ? 98  ASN A CB   4  
ATOM 5363  C CG   . ASN A 1 75  ? 16.038  12.182  -2.582  1.00 0.00 ? 98  ASN A CG   4  
ATOM 5364  O OD1  . ASN A 1 75  ? 17.203  11.800  -2.576  1.00 0.00 ? 98  ASN A OD1  4  
ATOM 5365  N ND2  . ASN A 1 75  ? 15.724  13.371  -2.107  1.00 0.00 ? 98  ASN A ND2  4  
ATOM 5366  H H    . ASN A 1 75  ? 14.142  8.801   -1.563  1.00 0.00 ? 98  ASN A H    4  
ATOM 5367  H HA   . ASN A 1 75  ? 13.765  11.721  -1.362  1.00 0.00 ? 98  ASN A HA   4  
ATOM 5368  H HB2  . ASN A 1 75  ? 15.335  10.439  -3.634  1.00 0.00 ? 98  ASN A HB2  4  
ATOM 5369  H HB3  . ASN A 1 75  ? 14.404  11.912  -3.887  1.00 0.00 ? 98  ASN A HB3  4  
ATOM 5370  H HD21 . ASN A 1 75  ? 14.758  13.673  -2.043  1.00 0.00 ? 98  ASN A HD21 4  
ATOM 5371  H HD22 . ASN A 1 75  ? 16.472  13.985  -1.791  1.00 0.00 ? 98  ASN A HD22 4  
ATOM 5372  N N    . VAL A 1 76  ? 11.521  10.410  -1.807  1.00 0.00 ? 99  VAL A N    4  
ATOM 5373  C CA   . VAL A 1 76  ? 10.194  10.011  -2.255  1.00 0.00 ? 99  VAL A CA   4  
ATOM 5374  C C    . VAL A 1 76  ? 9.100   10.813  -1.544  1.00 0.00 ? 99  VAL A C    4  
ATOM 5375  O O    . VAL A 1 76  ? 9.375   11.543  -0.592  1.00 0.00 ? 99  VAL A O    4  
ATOM 5376  C CB   . VAL A 1 76  ? 10.016  8.501   -2.036  1.00 0.00 ? 99  VAL A CB   4  
ATOM 5377  C CG1  . VAL A 1 76  ? 10.919  7.649   -2.926  1.00 0.00 ? 99  VAL A CG1  4  
ATOM 5378  C CG2  . VAL A 1 76  ? 10.218  8.096   -0.577  1.00 0.00 ? 99  VAL A CG2  4  
ATOM 5379  H H    . VAL A 1 76  ? 11.596  10.528  -0.803  1.00 0.00 ? 99  VAL A H    4  
ATOM 5380  H HA   . VAL A 1 76  ? 10.101  10.220  -3.321  1.00 0.00 ? 99  VAL A HA   4  
ATOM 5381  H HB   . VAL A 1 76  ? 8.997   8.275   -2.309  1.00 0.00 ? 99  VAL A HB   4  
ATOM 5382  H HG11 . VAL A 1 76  ? 10.682  6.595   -2.777  1.00 0.00 ? 99  VAL A HG11 4  
ATOM 5383  H HG12 . VAL A 1 76  ? 10.741  7.908   -3.968  1.00 0.00 ? 99  VAL A HG12 4  
ATOM 5384  H HG13 . VAL A 1 76  ? 11.967  7.812   -2.684  1.00 0.00 ? 99  VAL A HG13 4  
ATOM 5385  H HG21 . VAL A 1 76  ? 11.259  8.223   -0.284  1.00 0.00 ? 99  VAL A HG21 4  
ATOM 5386  H HG22 . VAL A 1 76  ? 9.598   8.723   0.055   1.00 0.00 ? 99  VAL A HG22 4  
ATOM 5387  H HG23 . VAL A 1 76  ? 9.921   7.057   -0.434  1.00 0.00 ? 99  VAL A HG23 4  
ATOM 5388  N N    . THR A 1 77  ? 7.861   10.665  -2.016  1.00 0.00 ? 100 THR A N    4  
ATOM 5389  C CA   . THR A 1 77  ? 6.665   11.357  -1.555  1.00 0.00 ? 100 THR A CA   4  
ATOM 5390  C C    . THR A 1 77  ? 5.452   10.422  -1.733  1.00 0.00 ? 100 THR A C    4  
ATOM 5391  O O    . THR A 1 77  ? 5.583   9.336   -2.312  1.00 0.00 ? 100 THR A O    4  
ATOM 5392  C CB   . THR A 1 77  ? 6.501   12.652  -2.376  1.00 0.00 ? 100 THR A CB   4  
ATOM 5393  O OG1  . THR A 1 77  ? 6.425   12.335  -3.756  1.00 0.00 ? 100 THR A OG1  4  
ATOM 5394  C CG2  . THR A 1 77  ? 7.649   13.643  -2.169  1.00 0.00 ? 100 THR A CG2  4  
ATOM 5395  H H    . THR A 1 77  ? 7.680   10.028  -2.774  1.00 0.00 ? 100 THR A H    4  
ATOM 5396  H HA   . THR A 1 77  ? 6.776   11.601  -0.498  1.00 0.00 ? 100 THR A HA   4  
ATOM 5397  H HB   . THR A 1 77  ? 5.574   13.142  -2.077  1.00 0.00 ? 100 THR A HB   4  
ATOM 5398  H HG1  . THR A 1 77  ? 6.925   13.016  -4.253  1.00 0.00 ? 100 THR A HG1  4  
ATOM 5399  H HG21 . THR A 1 77  ? 7.796   13.823  -1.104  1.00 0.00 ? 100 THR A HG21 4  
ATOM 5400  H HG22 . THR A 1 77  ? 8.574   13.268  -2.608  1.00 0.00 ? 100 THR A HG22 4  
ATOM 5401  H HG23 . THR A 1 77  ? 7.405   14.584  -2.650  1.00 0.00 ? 100 THR A HG23 4  
ATOM 5402  N N    . LYS A 1 78  ? 4.247   10.855  -1.325  1.00 0.00 ? 101 LYS A N    4  
ATOM 5403  C CA   . LYS A 1 78  ? 2.999   10.143  -1.635  1.00 0.00 ? 101 LYS A CA   4  
ATOM 5404  C C    . LYS A 1 78  ? 2.628   10.232  -3.117  1.00 0.00 ? 101 LYS A C    4  
ATOM 5405  O O    . LYS A 1 78  ? 1.654   9.599   -3.529  1.00 0.00 ? 101 LYS A O    4  
ATOM 5406  C CB   . LYS A 1 78  ? 1.830   10.624  -0.748  1.00 0.00 ? 101 LYS A CB   4  
ATOM 5407  C CG   . LYS A 1 78  ? 1.674   9.763   0.513   1.00 0.00 ? 101 LYS A CG   4  
ATOM 5408  C CD   . LYS A 1 78  ? 0.399   10.089  1.293   1.00 0.00 ? 101 LYS A CD   4  
ATOM 5409  C CE   . LYS A 1 78  ? -0.810  9.356   0.699   1.00 0.00 ? 101 LYS A CE   4  
ATOM 5410  N NZ   . LYS A 1 78  ? -2.064  9.781   1.339   1.00 0.00 ? 101 LYS A NZ   4  
ATOM 5411  H H    . LYS A 1 78  ? 4.174   11.755  -0.874  1.00 0.00 ? 101 LYS A H    4  
ATOM 5412  H HA   . LYS A 1 78  ? 3.169   9.086   -1.438  1.00 0.00 ? 101 LYS A HA   4  
ATOM 5413  H HB2  . LYS A 1 78  ? 1.967   11.670  -0.470  1.00 0.00 ? 101 LYS A HB2  4  
ATOM 5414  H HB3  . LYS A 1 78  ? 0.898   10.550  -1.308  1.00 0.00 ? 101 LYS A HB3  4  
ATOM 5415  H HG2  . LYS A 1 78  ? 1.671   8.709   0.242   1.00 0.00 ? 101 LYS A HG2  4  
ATOM 5416  H HG3  . LYS A 1 78  ? 2.518   9.931   1.169   1.00 0.00 ? 101 LYS A HG3  4  
ATOM 5417  H HD2  . LYS A 1 78  ? 0.534   9.767   2.327   1.00 0.00 ? 101 LYS A HD2  4  
ATOM 5418  H HD3  . LYS A 1 78  ? 0.235   11.166  1.294   1.00 0.00 ? 101 LYS A HD3  4  
ATOM 5419  H HE2  . LYS A 1 78  ? -0.870  9.543   -0.374  1.00 0.00 ? 101 LYS A HE2  4  
ATOM 5420  H HE3  . LYS A 1 78  ? -0.682  8.287   0.855   1.00 0.00 ? 101 LYS A HE3  4  
ATOM 5421  H HZ1  . LYS A 1 78  ? -2.814  9.112   1.167   1.00 0.00 ? 101 LYS A HZ1  4  
ATOM 5422  H HZ2  . LYS A 1 78  ? -1.963  9.781   2.354   1.00 0.00 ? 101 LYS A HZ2  4  
ATOM 5423  H HZ3  . LYS A 1 78  ? -2.344  10.691  1.010   1.00 0.00 ? 101 LYS A HZ3  4  
ATOM 5424  N N    . GLU A 1 79  ? 3.363   10.999  -3.923  1.00 0.00 ? 102 GLU A N    4  
ATOM 5425  C CA   . GLU A 1 79  ? 3.429   10.750  -5.342  1.00 0.00 ? 102 GLU A CA   4  
ATOM 5426  C C    . GLU A 1 79  ? 4.416   9.602   -5.527  1.00 0.00 ? 102 GLU A C    4  
ATOM 5427  O O    . GLU A 1 79  ? 3.988   8.471   -5.740  1.00 0.00 ? 102 GLU A O    4  
ATOM 5428  C CB   . GLU A 1 79  ? 3.855   12.023  -6.090  1.00 0.00 ? 102 GLU A CB   4  
ATOM 5429  C CG   . GLU A 1 79  ? 2.740   13.063  -6.269  1.00 0.00 ? 102 GLU A CG   4  
ATOM 5430  C CD   . GLU A 1 79  ? 1.442   12.493  -6.828  1.00 0.00 ? 102 GLU A CD   4  
ATOM 5431  O OE1  . GLU A 1 79  ? 1.382   12.227  -8.049  1.00 0.00 ? 102 GLU A OE1  4  
ATOM 5432  O OE2  . GLU A 1 79  ? 0.495   12.324  -6.024  1.00 0.00 ? 102 GLU A OE2  4  
ATOM 5433  H H    . GLU A 1 79  ? 4.158   11.497  -3.559  1.00 0.00 ? 102 GLU A H    4  
ATOM 5434  H HA   . GLU A 1 79  ? 2.460   10.410  -5.711  1.00 0.00 ? 102 GLU A HA   4  
ATOM 5435  H HB2  . GLU A 1 79  ? 4.677   12.505  -5.567  1.00 0.00 ? 102 GLU A HB2  4  
ATOM 5436  H HB3  . GLU A 1 79  ? 4.238   11.738  -7.059  1.00 0.00 ? 102 GLU A HB3  4  
ATOM 5437  H HG2  . GLU A 1 79  ? 2.544   13.534  -5.304  1.00 0.00 ? 102 GLU A HG2  4  
ATOM 5438  H HG3  . GLU A 1 79  ? 3.096   13.832  -6.953  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 5439  N N    . ALA A 1 80  ? 5.717   9.883   -5.425  1.00 0.00 ? 103 ALA A N    4  
ATOM 5440  C CA   . ALA A 1 80  ? 6.779   9.069   -5.997  1.00 0.00 ? 103 ALA A CA   4  
ATOM 5441  C C    . ALA A 1 80  ? 6.750   7.616   -5.522  1.00 0.00 ? 103 ALA A C    4  
ATOM 5442  O O    . ALA A 1 80  ? 6.650   6.696   -6.332  1.00 0.00 ? 103 ALA A O    4  
ATOM 5443  C CB   . ALA A 1 80  ? 8.122   9.724   -5.663  1.00 0.00 ? 103 ALA A CB   4  
ATOM 5444  H H    . ALA A 1 80  ? 5.982   10.820  -5.145  1.00 0.00 ? 103 ALA A H    4  
ATOM 5445  H HA   . ALA A 1 80  ? 6.661   9.073   -7.082  1.00 0.00 ? 103 ALA A HA   4  
ATOM 5446  H HB1  . ALA A 1 80  ? 8.898   9.271   -6.277  1.00 0.00 ? 103 ALA A HB1  4  
ATOM 5447  H HB2  . ALA A 1 80  ? 8.077   10.792  -5.868  1.00 0.00 ? 103 ALA A HB2  4  
ATOM 5448  H HB3  . ALA A 1 80  ? 8.370   9.582   -4.615  1.00 0.00 ? 103 ALA A HB3  4  
ATOM 5449  N N    . PHE A 1 81  ? 6.857   7.409   -4.209  1.00 0.00 ? 104 PHE A N    4  
ATOM 5450  C CA   . PHE A 1 81  ? 6.964   6.080   -3.626  1.00 0.00 ? 104 PHE A CA   4  
ATOM 5451  C C    . PHE A 1 81  ? 5.675   5.308   -3.905  1.00 0.00 ? 104 PHE A C    4  
ATOM 5452  O O    . PHE A 1 81  ? 5.730   4.200   -4.433  1.00 0.00 ? 104 PHE A O    4  
ATOM 5453  C CB   . PHE A 1 81  ? 7.301   6.181   -2.128  1.00 0.00 ? 104 PHE A CB   4  
ATOM 5454  C CG   . PHE A 1 81  ? 6.535   5.230   -1.243  1.00 0.00 ? 104 PHE A CG   4  
ATOM 5455  C CD1  . PHE A 1 81  ? 6.874   3.868   -1.205  1.00 0.00 ? 104 PHE A CD1  4  
ATOM 5456  C CD2  . PHE A 1 81  ? 5.433   5.705   -0.515  1.00 0.00 ? 104 PHE A CD2  4  
ATOM 5457  C CE1  . PHE A 1 81  ? 6.103   2.991   -0.426  1.00 0.00 ? 104 PHE A CE1  4  
ATOM 5458  C CE2  . PHE A 1 81  ? 4.676   4.828   0.273   1.00 0.00 ? 104 PHE A CE2  4  
ATOM 5459  C CZ   . PHE A 1 81  ? 5.016   3.469   0.321   1.00 0.00 ? 104 PHE A CZ   4  
ATOM 5460  H H    . PHE A 1 81  ? 6.764   8.200   -3.584  1.00 0.00 ? 104 PHE A H    4  
ATOM 5461  H HA   . PHE A 1 81  ? 7.778   5.545   -4.118  1.00 0.00 ? 104 PHE A HA   4  
ATOM 5462  H HB2  . PHE A 1 81  ? 8.364   5.978   -2.001  1.00 0.00 ? 104 PHE A HB2  4  
ATOM 5463  H HB3  . PHE A 1 81  ? 7.107   7.192   -1.767  1.00 0.00 ? 104 PHE A HB3  4  
ATOM 5464  H HD1  . PHE A 1 81  ? 7.723   3.498   -1.763  1.00 0.00 ? 104 PHE A HD1  4  
ATOM 5465  H HD2  . PHE A 1 81  ? 5.167   6.753   -0.550  1.00 0.00 ? 104 PHE A HD2  4  
ATOM 5466  H HE1  . PHE A 1 81  ? 6.346   1.942   -0.388  1.00 0.00 ? 104 PHE A HE1  4  
ATOM 5467  H HE2  . PHE A 1 81  ? 3.839   5.209   0.836   1.00 0.00 ? 104 PHE A HE2  4  
ATOM 5468  H HZ   . PHE A 1 81  ? 4.452   2.776   0.928   1.00 0.00 ? 104 PHE A HZ   4  
ATOM 5469  N N    . VAL A 1 82  ? 4.518   5.904   -3.598  1.00 0.00 ? 105 VAL A N    4  
ATOM 5470  C CA   . VAL A 1 82  ? 3.230   5.242   -3.752  1.00 0.00 ? 105 VAL A CA   4  
ATOM 5471  C C    . VAL A 1 82  ? 2.999   4.868   -5.226  1.00 0.00 ? 105 VAL A C    4  
ATOM 5472  O O    . VAL A 1 82  ? 2.503   3.782   -5.519  1.00 0.00 ? 105 VAL A O    4  
ATOM 5473  C CB   . VAL A 1 82  ? 2.120   6.119   -3.146  1.00 0.00 ? 105 VAL A CB   4  
ATOM 5474  C CG1  . VAL A 1 82  ? 0.733   5.538   -3.392  1.00 0.00 ? 105 VAL A CG1  4  
ATOM 5475  C CG2  . VAL A 1 82  ? 2.265   6.310   -1.632  1.00 0.00 ? 105 VAL A CG2  4  
ATOM 5476  H H    . VAL A 1 82  ? 4.549   6.826   -3.190  1.00 0.00 ? 105 VAL A H    4  
ATOM 5477  H HA   . VAL A 1 82  ? 3.263   4.321   -3.179  1.00 0.00 ? 105 VAL A HA   4  
ATOM 5478  H HB   . VAL A 1 82  ? 2.165   7.100   -3.597  1.00 0.00 ? 105 VAL A HB   4  
ATOM 5479  H HG11 . VAL A 1 82  ? -0.013  6.205   -2.961  1.00 0.00 ? 105 VAL A HG11 4  
ATOM 5480  H HG12 . VAL A 1 82  ? 0.544   5.447   -4.459  1.00 0.00 ? 105 VAL A HG12 4  
ATOM 5481  H HG13 . VAL A 1 82  ? 0.656   4.552   -2.930  1.00 0.00 ? 105 VAL A HG13 4  
ATOM 5482  H HG21 . VAL A 1 82  ? 2.309   5.341   -1.133  1.00 0.00 ? 105 VAL A HG21 4  
ATOM 5483  H HG22 . VAL A 1 82  ? 3.167   6.873   -1.419  1.00 0.00 ? 105 VAL A HG22 4  
ATOM 5484  H HG23 . VAL A 1 82  ? 1.418   6.874   -1.244  1.00 0.00 ? 105 VAL A HG23 4  
ATOM 5485  N N    . THR A 1 83  ? 3.392   5.723   -6.168  1.00 0.00 ? 106 THR A N    4  
ATOM 5486  C CA   . THR A 1 83  ? 3.359   5.443   -7.590  1.00 0.00 ? 106 THR A CA   4  
ATOM 5487  C C    . THR A 1 83  ? 4.253   4.245   -7.938  1.00 0.00 ? 106 THR A C    4  
ATOM 5488  O O    . THR A 1 83  ? 3.826   3.392   -8.718  1.00 0.00 ? 106 THR A O    4  
ATOM 5489  C CB   . THR A 1 83  ? 3.759   6.710   -8.356  1.00 0.00 ? 106 THR A CB   4  
ATOM 5490  O OG1  . THR A 1 83  ? 2.882   7.772   -8.026  1.00 0.00 ? 106 THR A OG1  4  
ATOM 5491  C CG2  . THR A 1 83  ? 3.672   6.462   -9.850  1.00 0.00 ? 106 THR A CG2  4  
ATOM 5492  H H    . THR A 1 83  ? 3.783   6.612   -5.902  1.00 0.00 ? 106 THR A H    4  
ATOM 5493  H HA   . THR A 1 83  ? 2.335   5.195   -7.860  1.00 0.00 ? 106 THR A HA   4  
ATOM 5494  H HB   . THR A 1 83  ? 4.780   6.995   -8.102  1.00 0.00 ? 106 THR A HB   4  
ATOM 5495  H HG1  . THR A 1 83  ? 3.183   8.086   -7.151  1.00 0.00 ? 106 THR A HG1  4  
ATOM 5496  H HG21 . THR A 1 83  ? 2.654   6.184   -10.109 1.00 0.00 ? 106 THR A HG21 4  
ATOM 5497  H HG22 . THR A 1 83  ? 3.954   7.371   -10.376 1.00 0.00 ? 106 THR A HG22 4  
ATOM 5498  H HG23 . THR A 1 83  ? 4.360   5.656   -10.115 1.00 0.00 ? 106 THR A HG23 4  
ATOM 5499  N N    . GLY A 1 84  ? 5.451   4.143   -7.357  1.00 0.00 ? 107 GLY A N    4  
ATOM 5500  C CA   . GLY A 1 84  ? 6.302   2.970   -7.505  1.00 0.00 ? 107 GLY A CA   4  
ATOM 5501  C C    . GLY A 1 84  ? 5.636   1.718   -6.938  1.00 0.00 ? 107 GLY A C    4  
ATOM 5502  O O    . GLY A 1 84  ? 5.781   0.634   -7.500  1.00 0.00 ? 107 GLY A O    4  
ATOM 5503  H H    . GLY A 1 84  ? 5.780   4.880   -6.740  1.00 0.00 ? 107 GLY A H    4  
ATOM 5504  H HA2  . GLY A 1 84  ? 6.506   2.809   -8.560  1.00 0.00 ? 107 GLY A HA2  4  
ATOM 5505  H HA3  . GLY A 1 84  ? 7.245   3.137   -6.984  1.00 0.00 ? 107 GLY A HA3  4  
ATOM 5506  N N    . CYS A 1 85  ? 4.838   1.864   -5.878  1.00 0.00 ? 108 CYS A N    4  
ATOM 5507  C CA   . CYS A 1 85  ? 4.078   0.741   -5.339  1.00 0.00 ? 108 CYS A CA   4  
ATOM 5508  C C    . CYS A 1 85  ? 3.056   0.290   -6.375  1.00 0.00 ? 108 CYS A C    4  
ATOM 5509  O O    . CYS A 1 85  ? 2.887   -0.906  -6.617  1.00 0.00 ? 108 CYS A O    4  
ATOM 5510  C CB   . CYS A 1 85  ? 3.306   1.072   -4.059  1.00 0.00 ? 108 CYS A CB   4  
ATOM 5511  S SG   . CYS A 1 85  ? 4.136   1.893   -2.707  1.00 0.00 ? 108 CYS A SG   4  
ATOM 5512  H H    . CYS A 1 85  ? 4.709   2.817   -5.546  1.00 0.00 ? 108 CYS A H    4  
ATOM 5513  H HA   . CYS A 1 85  ? 4.774   -0.073  -5.135  1.00 0.00 ? 108 CYS A HA   4  
ATOM 5514  H HB2  . CYS A 1 85  ? 2.427   1.658   -4.300  1.00 0.00 ? 108 CYS A HB2  4  
ATOM 5515  H HB3  . CYS A 1 85  ? 2.941   0.131   -3.664  1.00 0.00 ? 108 CYS A HB3  4  
ATOM 5516  N N    . ILE A 1 86  ? 2.357   1.256   -6.959  1.00 0.00 ? 109 ILE A N    4  
ATOM 5517  C CA   . ILE A 1 86  ? 1.311   1.063   -7.942  1.00 0.00 ? 109 ILE A CA   4  
ATOM 5518  C C    . ILE A 1 86  ? 1.868   0.415   -9.194  1.00 0.00 ? 109 ILE A C    4  
ATOM 5519  O O    . ILE A 1 86  ? 1.209   -0.461  -9.737  1.00 0.00 ? 109 ILE A O    4  
ATOM 5520  C CB   . ILE A 1 86  ? 0.652   2.422   -8.201  1.00 0.00 ? 109 ILE A CB   4  
ATOM 5521  C CG1  . ILE A 1 86  ? -0.431  2.577   -7.131  1.00 0.00 ? 109 ILE A CG1  4  
ATOM 5522  C CG2  . ILE A 1 86  ? 0.065   2.647   -9.596  1.00 0.00 ? 109 ILE A CG2  4  
ATOM 5523  C CD1  . ILE A 1 86  ? -0.689  4.054   -6.867  1.00 0.00 ? 109 ILE A CD1  4  
ATOM 5524  H H    . ILE A 1 86  ? 2.530   2.207   -6.648  1.00 0.00 ? 109 ILE A H    4  
ATOM 5525  H HA   . ILE A 1 86  ? 0.567   0.393   -7.503  1.00 0.00 ? 109 ILE A HA   4  
ATOM 5526  H HB   . ILE A 1 86  ? 1.405   3.192   -8.061  1.00 0.00 ? 109 ILE A HB   4  
ATOM 5527  H HG12 . ILE A 1 86  ? -1.349  2.083   -7.450  1.00 0.00 ? 109 ILE A HG12 4  
ATOM 5528  H HG13 . ILE A 1 86  ? -0.106  2.091   -6.212  1.00 0.00 ? 109 ILE A HG13 4  
ATOM 5529  H HG21 . ILE A 1 86  ? 0.852   2.572   -10.342 1.00 0.00 ? 109 ILE A HG21 4  
ATOM 5530  H HG22 . ILE A 1 86  ? -0.705  1.903   -9.793  1.00 0.00 ? 109 ILE A HG22 4  
ATOM 5531  H HG23 . ILE A 1 86  ? -0.349  3.655   -9.653  1.00 0.00 ? 109 ILE A HG23 4  
ATOM 5532  H HD11 . ILE A 1 86  ? -1.231  4.475   -7.715  1.00 0.00 ? 109 ILE A HD11 4  
ATOM 5533  H HD12 . ILE A 1 86  ? -1.275  4.135   -5.956  1.00 0.00 ? 109 ILE A HD12 4  
ATOM 5534  H HD13 . ILE A 1 86  ? 0.256   4.579   -6.742  1.00 0.00 ? 109 ILE A HD13 4  
ATOM 5535  N N    . ASN A 1 87  ? 3.073   0.789   -9.629  1.00 0.00 ? 110 ASN A N    4  
ATOM 5536  C CA   . ASN A 1 87  ? 3.741   0.115   -10.743 1.00 0.00 ? 110 ASN A CA   4  
ATOM 5537  C C    . ASN A 1 87  ? 3.879   -1.381  -10.439 1.00 0.00 ? 110 ASN A C    4  
ATOM 5538  O O    . ASN A 1 87  ? 3.762   -2.222  -11.329 1.00 0.00 ? 110 ASN A O    4  
ATOM 5539  C CB   . ASN A 1 87  ? 5.132   0.707   -11.026 1.00 0.00 ? 110 ASN A CB   4  
ATOM 5540  C CG   . ASN A 1 87  ? 5.130   2.139   -11.532 1.00 0.00 ? 110 ASN A CG   4  
ATOM 5541  O OD1  . ASN A 1 87  ? 4.254   2.563   -12.281 1.00 0.00 ? 110 ASN A OD1  4  
ATOM 5542  N ND2  . ASN A 1 87  ? 6.112   2.929   -11.136 1.00 0.00 ? 110 ASN A ND2  4  
ATOM 5543  H H    . ASN A 1 87  ? 3.505   1.585   -9.168  1.00 0.00 ? 110 ASN A H    4  
ATOM 5544  H HA   . ASN A 1 87  ? 3.128   0.227   -11.637 1.00 0.00 ? 110 ASN A HA   4  
ATOM 5545  H HB2  . ASN A 1 87  ? 5.742   0.634   -10.126 1.00 0.00 ? 110 ASN A HB2  4  
ATOM 5546  H HB3  . ASN A 1 87  ? 5.600   0.100   -11.802 1.00 0.00 ? 110 ASN A HB3  4  
ATOM 5547  H HD21 . ASN A 1 87  ? 6.840   2.557   -10.524 1.00 0.00 ? 110 ASN A HD21 4  
ATOM 5548  H HD22 . ASN A 1 87  ? 6.160   3.884   -11.460 1.00 0.00 ? 110 ASN A HD22 4  
ATOM 5549  N N    . ALA A 1 88  ? 4.086   -1.753  -9.175  1.00 0.00 ? 111 ALA A N    4  
ATOM 5550  C CA   . ALA A 1 88  ? 4.171   -3.145  -8.788  1.00 0.00 ? 111 ALA A CA   4  
ATOM 5551  C C    . ALA A 1 88  ? 2.767   -3.768  -8.739  1.00 0.00 ? 111 ALA A C    4  
ATOM 5552  O O    . ALA A 1 88  ? 2.546   -4.818  -9.348  1.00 0.00 ? 111 ALA A O    4  
ATOM 5553  C CB   . ALA A 1 88  ? 4.961   -3.253  -7.478  1.00 0.00 ? 111 ALA A CB   4  
ATOM 5554  H H    . ALA A 1 88  ? 4.117   -1.049  -8.449  1.00 0.00 ? 111 ALA A H    4  
ATOM 5555  H HA   . ALA A 1 88  ? 4.732   -3.666  -9.562  1.00 0.00 ? 111 ALA A HA   4  
ATOM 5556  H HB1  . ALA A 1 88  ? 5.335   -4.270  -7.371  1.00 0.00 ? 111 ALA A HB1  4  
ATOM 5557  H HB2  . ALA A 1 88  ? 5.813   -2.567  -7.512  1.00 0.00 ? 111 ALA A HB2  4  
ATOM 5558  H HB3  . ALA A 1 88  ? 4.327   -3.009  -6.627  1.00 0.00 ? 111 ALA A HB3  4  
ATOM 5559  N N    . THR A 1 89  ? 1.807   -3.143  -8.051  1.00 0.00 ? 112 THR A N    4  
ATOM 5560  C CA   . THR A 1 89  ? 0.482   -3.737  -7.853  1.00 0.00 ? 112 THR A CA   4  
ATOM 5561  C C    . THR A 1 89  ? -0.314  -3.826  -9.165  1.00 0.00 ? 112 THR A C    4  
ATOM 5562  O O    . THR A 1 89  ? -1.069  -4.782  -9.340  1.00 0.00 ? 112 THR A O    4  
ATOM 5563  C CB   . THR A 1 89  ? -0.293  -3.011  -6.737  1.00 0.00 ? 112 THR A CB   4  
ATOM 5564  O OG1  . THR A 1 89  ? -1.299  -3.837  -6.198  1.00 0.00 ? 112 THR A OG1  4  
ATOM 5565  C CG2  . THR A 1 89  ? -0.986  -1.754  -7.253  1.00 0.00 ? 112 THR A CG2  4  
ATOM 5566  H H    . THR A 1 89  ? 2.040   -2.254  -7.618  1.00 0.00 ? 112 THR A H    4  
ATOM 5567  H HA   . THR A 1 89  ? 0.652   -4.754  -7.510  1.00 0.00 ? 112 THR A HA   4  
ATOM 5568  H HB   . THR A 1 89  ? 0.390   -2.748  -5.933  1.00 0.00 ? 112 THR A HB   4  
ATOM 5569  H HG1  . THR A 1 89  ? -0.945  -4.409  -5.509  1.00 0.00 ? 112 THR A HG1  4  
ATOM 5570  H HG21 . THR A 1 89  ? -1.109  -1.038  -6.448  1.00 0.00 ? 112 THR A HG21 4  
ATOM 5571  H HG22 . THR A 1 89  ? -0.398  -1.301  -8.037  1.00 0.00 ? 112 THR A HG22 4  
ATOM 5572  H HG23 . THR A 1 89  ? -1.952  -2.013  -7.678  1.00 0.00 ? 112 THR A HG23 4  
ATOM 5573  N N    . GLN A 1 90  ? -0.136  -2.888  -10.109 1.00 0.00 ? 113 GLN A N    4  
ATOM 5574  C CA   . GLN A 1 90  ? -0.851  -2.942  -11.387 1.00 0.00 ? 113 GLN A CA   4  
ATOM 5575  C C    . GLN A 1 90  ? -0.548  -4.271  -12.082 1.00 0.00 ? 113 GLN A C    4  
ATOM 5576  O O    . GLN A 1 90  ? -1.463  -4.948  -12.547 1.00 0.00 ? 113 GLN A O    4  
ATOM 5577  C CB   . GLN A 1 90  ? -0.584  -1.704  -12.273 1.00 0.00 ? 113 GLN A CB   4  
ATOM 5578  C CG   . GLN A 1 90  ? 0.878   -1.580  -12.729 1.00 0.00 ? 113 GLN A CG   4  
ATOM 5579  C CD   . GLN A 1 90  ? 1.274   -0.311  -13.480 1.00 0.00 ? 113 GLN A CD   4  
ATOM 5580  O OE1  . GLN A 1 90  ? 2.263   -0.324  -14.207 1.00 0.00 ? 113 GLN A OE1  4  
ATOM 5581  N NE2  . GLN A 1 90  ? 0.600   0.814   -13.288 1.00 0.00 ? 113 GLN A NE2  4  
ATOM 5582  H H    . GLN A 1 90  ? 0.441   -2.071  -9.896  1.00 0.00 ? 113 GLN A H    4  
ATOM 5583  H HA   . GLN A 1 90  ? -1.913  -2.935  -11.161 1.00 0.00 ? 113 GLN A HA   4  
ATOM 5584  H HB2  . GLN A 1 90  ? -1.221  -1.760  -13.156 1.00 0.00 ? 113 GLN A HB2  4  
ATOM 5585  H HB3  . GLN A 1 90  ? -0.864  -0.816  -11.708 1.00 0.00 ? 113 GLN A HB3  4  
ATOM 5586  H HG2  . GLN A 1 90  ? 1.494   -1.628  -11.848 1.00 0.00 ? 113 GLN A HG2  4  
ATOM 5587  H HG3  . GLN A 1 90  ? 1.125   -2.426  -13.370 1.00 0.00 ? 113 GLN A HG3  4  
ATOM 5588  H HE21 . GLN A 1 90  ? -0.172  0.898   -12.643 1.00 0.00 ? 113 GLN A HE21 4  
ATOM 5589  H HE22 . GLN A 1 90  ? 0.782   1.503   -14.018 1.00 0.00 ? 113 GLN A HE22 4  
ATOM 5590  N N    . ALA A 1 91  ? 0.719   -4.696  -12.070 1.00 0.00 ? 114 ALA A N    4  
ATOM 5591  C CA   . ALA A 1 91  ? 1.137   -5.978  -12.609 1.00 0.00 ? 114 ALA A CA   4  
ATOM 5592  C C    . ALA A 1 91  ? 0.840   -7.129  -11.644 1.00 0.00 ? 114 ALA A C    4  
ATOM 5593  O O    . ALA A 1 91  ? 0.786   -8.273  -12.090 1.00 0.00 ? 114 ALA A O    4  
ATOM 5594  C CB   . ALA A 1 91  ? 2.631   -5.918  -12.938 1.00 0.00 ? 114 ALA A CB   4  
ATOM 5595  H H    . ALA A 1 91  ? 1.414   -4.133  -11.601 1.00 0.00 ? 114 ALA A H    4  
ATOM 5596  H HA   . ALA A 1 91  ? 0.592   -6.173  -13.534 1.00 0.00 ? 114 ALA A HA   4  
ATOM 5597  H HB1  . ALA A 1 91  ? 2.829   -5.102  -13.634 1.00 0.00 ? 114 ALA A HB1  4  
ATOM 5598  H HB2  . ALA A 1 91  ? 3.213   -5.766  -12.030 1.00 0.00 ? 114 ALA A HB2  4  
ATOM 5599  H HB3  . ALA A 1 91  ? 2.933   -6.855  -13.404 1.00 0.00 ? 114 ALA A HB3  4  
ATOM 5600  N N    . ALA A 1 92  ? 0.642   -6.871  -10.344 1.00 0.00 ? 115 ALA A N    4  
ATOM 5601  C CA   . ALA A 1 92  ? 0.230   -7.917  -9.415  1.00 0.00 ? 115 ALA A CA   4  
ATOM 5602  C C    . ALA A 1 92  ? -1.187  -8.388  -9.742  1.00 0.00 ? 115 ALA A C    4  
ATOM 5603  O O    . ALA A 1 92  ? -1.478  -9.571  -9.570  1.00 0.00 ? 115 ALA A O    4  
ATOM 5604  C CB   . ALA A 1 92  ? 0.313   -7.449  -7.956  1.00 0.00 ? 115 ALA A CB   4  
ATOM 5605  H H    . ALA A 1 92  ? 0.637   -5.908  -10.019 1.00 0.00 ? 115 ALA A H    4  
ATOM 5606  H HA   . ALA A 1 92  ? 0.906   -8.764  -9.534  1.00 0.00 ? 115 ALA A HA   4  
ATOM 5607  H HB1  . ALA A 1 92  ? 0.142   -8.309  -7.310  1.00 0.00 ? 115 ALA A HB1  4  
ATOM 5608  H HB2  . ALA A 1 92  ? 1.297   -7.030  -7.750  1.00 0.00 ? 115 ALA A HB2  4  
ATOM 5609  H HB3  . ALA A 1 92  ? -0.462  -6.714  -7.732  1.00 0.00 ? 115 ALA A HB3  4  
ATOM 5610  N N    . ASN A 1 93  ? -2.055  -7.483  -10.209 1.00 0.00 ? 116 ASN A N    4  
ATOM 5611  C CA   . ASN A 1 93  ? -3.482  -7.732  -10.364 1.00 0.00 ? 116 ASN A CA   4  
ATOM 5612  C C    . ASN A 1 93  ? -3.965  -7.131  -11.688 1.00 0.00 ? 116 ASN A C    4  
ATOM 5613  O O    . ASN A 1 93  ? -4.869  -6.295  -11.705 1.00 0.00 ? 116 ASN A O    4  
ATOM 5614  C CB   . ASN A 1 93  ? -4.281  -7.186  -9.160  1.00 0.00 ? 116 ASN A CB   4  
ATOM 5615  C CG   . ASN A 1 93  ? -3.621  -7.339  -7.804  1.00 0.00 ? 116 ASN A CG   4  
ATOM 5616  O OD1  . ASN A 1 93  ? -3.577  -8.423  -7.223  1.00 0.00 ? 116 ASN A OD1  4  
ATOM 5617  N ND2  . ASN A 1 93  ? -3.106  -6.234  -7.304  1.00 0.00 ? 116 ASN A ND2  4  
ATOM 5618  H H    . ASN A 1 93  ? -1.738  -6.523  -10.302 1.00 0.00 ? 116 ASN A H    4  
ATOM 5619  H HA   . ASN A 1 93  ? -3.650  -8.808  -10.401 1.00 0.00 ? 116 ASN A HA   4  
ATOM 5620  H HB2  . ASN A 1 93  ? -4.512  -6.131  -9.312  1.00 0.00 ? 116 ASN A HB2  4  
ATOM 5621  H HB3  . ASN A 1 93  ? -5.218  -7.725  -9.115  1.00 0.00 ? 116 ASN A HB3  4  
ATOM 5622  H HD21 . ASN A 1 93  ? -3.247  -5.375  -7.822  1.00 0.00 ? 116 ASN A HD21 4  
ATOM 5623  H HD22 . ASN A 1 93  ? -2.725  -6.193  -6.362  1.00 0.00 ? 116 ASN A HD22 4  
ATOM 5624  N N    . GLN A 1 94  ? -3.377  -7.538  -12.817 1.00 0.00 ? 117 GLN A N    4  
ATOM 5625  C CA   . GLN A 1 94  ? -3.768  -7.025  -14.135 1.00 0.00 ? 117 GLN A CA   4  
ATOM 5626  C C    . GLN A 1 94  ? -5.256  -7.261  -14.395 1.00 0.00 ? 117 GLN A C    4  
ATOM 5627  O O    . GLN A 1 94  ? -5.955  -6.348  -14.826 1.00 0.00 ? 117 GLN A O    4  
ATOM 5628  C CB   . GLN A 1 94  ? -2.918  -7.680  -15.232 1.00 0.00 ? 117 GLN A CB   4  
ATOM 5629  C CG   . GLN A 1 94  ? -1.506  -7.112  -15.325 1.00 0.00 ? 117 GLN A CG   4  
ATOM 5630  C CD   . GLN A 1 94  ? -1.441  -5.767  -16.043 1.00 0.00 ? 117 GLN A CD   4  
ATOM 5631  O OE1  . GLN A 1 94  ? -1.168  -5.718  -17.241 1.00 0.00 ? 117 GLN A OE1  4  
ATOM 5632  N NE2  . GLN A 1 94  ? -1.646  -4.669  -15.340 1.00 0.00 ? 117 GLN A NE2  4  
ATOM 5633  H H    . GLN A 1 94  ? -2.656  -8.244  -12.775 1.00 0.00 ? 117 GLN A H    4  
ATOM 5634  H HA   . GLN A 1 94  ? -3.613  -5.946  -14.149 1.00 0.00 ? 117 GLN A HA   4  
ATOM 5635  H HB2  . GLN A 1 94  ? -2.812  -8.738  -15.007 1.00 0.00 ? 117 GLN A HB2  4  
ATOM 5636  H HB3  . GLN A 1 94  ? -3.408  -7.569  -16.201 1.00 0.00 ? 117 GLN A HB3  4  
ATOM 5637  H HG2  . GLN A 1 94  ? -1.086  -7.041  -14.327 1.00 0.00 ? 117 GLN A HG2  4  
ATOM 5638  H HG3  . GLN A 1 94  ? -0.910  -7.825  -15.887 1.00 0.00 ? 117 GLN A HG3  4  
ATOM 5639  H HE21 . GLN A 1 94  ? -1.819  -4.736  -14.342 1.00 0.00 ? 117 GLN A HE21 4  
ATOM 5640  H HE22 . GLN A 1 94  ? -1.649  -3.744  -15.778 1.00 0.00 ? 117 GLN A HE22 4  
ATOM 5641  N N    . GLY A 1 95  ? -5.754  -8.453  -14.058 1.00 0.00 ? 118 GLY A N    4  
ATOM 5642  C CA   . GLY A 1 95  ? -7.163  -8.786  -14.201 1.00 0.00 ? 118 GLY A CA   4  
ATOM 5643  C C    . GLY A 1 95  ? -8.071  -8.067  -13.202 1.00 0.00 ? 118 GLY A C    4  
ATOM 5644  O O    . GLY A 1 95  ? -9.272  -8.331  -13.183 1.00 0.00 ? 118 GLY A O    4  
ATOM 5645  H H    . GLY A 1 95  ? -5.119  -9.171  -13.738 1.00 0.00 ? 118 GLY A H    4  
ATOM 5646  H HA2  . GLY A 1 95  ? -7.489  -8.520  -15.207 1.00 0.00 ? 118 GLY A HA2  4  
ATOM 5647  H HA3  . GLY A 1 95  ? -7.281  -9.860  -14.076 1.00 0.00 ? 118 GLY A HA3  4  
ATOM 5648  N N    . GLU A 1 96  ? -7.545  -7.229  -12.307 1.00 0.00 ? 119 GLU A N    4  
ATOM 5649  C CA   . GLU A 1 96  ? -8.292  -6.263  -11.533 1.00 0.00 ? 119 GLU A CA   4  
ATOM 5650  C C    . GLU A 1 96  ? -8.403  -4.971  -12.332 1.00 0.00 ? 119 GLU A C    4  
ATOM 5651  O O    . GLU A 1 96  ? -9.486  -4.685  -12.837 1.00 0.00 ? 119 GLU A O    4  
ATOM 5652  C CB   . GLU A 1 96  ? -7.571  -6.067  -10.193 1.00 0.00 ? 119 GLU A CB   4  
ATOM 5653  C CG   . GLU A 1 96  ? -8.549  -6.127  -9.044  1.00 0.00 ? 119 GLU A CG   4  
ATOM 5654  C CD   . GLU A 1 96  ? -9.676  -5.103  -9.158  1.00 0.00 ? 119 GLU A CD   4  
ATOM 5655  O OE1  . GLU A 1 96  ? -9.445  -3.997  -9.687  1.00 0.00 ? 119 GLU A OE1  4  
ATOM 5656  O OE2  . GLU A 1 96  ? -10.796 -5.470  -8.743  1.00 0.00 ? 119 GLU A OE2  4  
ATOM 5657  H H    . GLU A 1 96  ? -6.552  -7.059  -12.244 1.00 0.00 ? 119 GLU A H    4  
ATOM 5658  H HA   . GLU A 1 96  ? -9.305  -6.631  -11.368 1.00 0.00 ? 119 GLU A HA   4  
ATOM 5659  H HB2  . GLU A 1 96  ? -6.887  -6.893  -10.044 1.00 0.00 ? 119 GLU A HB2  4  
ATOM 5660  H HB3  . GLU A 1 96  ? -6.999  -5.140  -10.151 1.00 0.00 ? 119 GLU A HB3  4  
ATOM 5661  H HG2  . GLU A 1 96  ? -8.963  -7.130  -9.040  1.00 0.00 ? 119 GLU A HG2  4  
ATOM 5662  H HG3  . GLU A 1 96  ? -7.989  -5.997  -8.127  1.00 0.00 ? 119 GLU A HG3  4  
ATOM 5663  N N    . PHE A 1 97  ? -7.281  -4.261  -12.527 1.00 0.00 ? 120 PHE A N    4  
ATOM 5664  C CA   . PHE A 1 97  ? -7.160  -2.937  -13.147 1.00 0.00 ? 120 PHE A CA   4  
ATOM 5665  C C    . PHE A 1 97  ? -7.543  -2.882  -14.636 1.00 0.00 ? 120 PHE A C    4  
ATOM 5666  O O    . PHE A 1 97  ? -7.166  -1.938  -15.342 1.00 0.00 ? 120 PHE A O    4  
ATOM 5667  C CB   . PHE A 1 97  ? -5.729  -2.427  -12.933 1.00 0.00 ? 120 PHE A CB   4  
ATOM 5668  C CG   . PHE A 1 97  ? -5.341  -2.172  -11.492 1.00 0.00 ? 120 PHE A CG   4  
ATOM 5669  C CD1  . PHE A 1 97  ? -5.825  -1.024  -10.838 1.00 0.00 ? 120 PHE A CD1  4  
ATOM 5670  C CD2  . PHE A 1 97  ? -4.457  -3.038  -10.823 1.00 0.00 ? 120 PHE A CD2  4  
ATOM 5671  C CE1  . PHE A 1 97  ? -5.391  -0.722  -9.536  1.00 0.00 ? 120 PHE A CE1  4  
ATOM 5672  C CE2  . PHE A 1 97  ? -4.024  -2.734  -9.520  1.00 0.00 ? 120 PHE A CE2  4  
ATOM 5673  C CZ   . PHE A 1 97  ? -4.470  -1.560  -8.889  1.00 0.00 ? 120 PHE A CZ   4  
ATOM 5674  H H    . PHE A 1 97  ? -6.430  -4.622  -12.115 1.00 0.00 ? 120 PHE A H    4  
ATOM 5675  H HA   . PHE A 1 97  ? -7.838  -2.259  -12.632 1.00 0.00 ? 120 PHE A HA   4  
ATOM 5676  H HB2  . PHE A 1 97  ? -5.025  -3.124  -13.392 1.00 0.00 ? 120 PHE A HB2  4  
ATOM 5677  H HB3  . PHE A 1 97  ? -5.627  -1.471  -13.443 1.00 0.00 ? 120 PHE A HB3  4  
ATOM 5678  H HD1  . PHE A 1 97  ? -6.534  -0.372  -11.332 1.00 0.00 ? 120 PHE A HD1  4  
ATOM 5679  H HD2  . PHE A 1 97  ? -4.090  -3.926  -11.317 1.00 0.00 ? 120 PHE A HD2  4  
ATOM 5680  H HE1  . PHE A 1 97  ? -5.772  0.155   -9.034  1.00 0.00 ? 120 PHE A HE1  4  
ATOM 5681  H HE2  . PHE A 1 97  ? -3.344  -3.401  -9.011  1.00 0.00 ? 120 PHE A HE2  4  
ATOM 5682  H HZ   . PHE A 1 97  ? -4.135  -1.307  -7.892  1.00 0.00 ? 120 PHE A HZ   4  
ATOM 5683  N N    . GLN A 1 98  ? -8.258  -3.897  -15.118 1.00 0.00 ? 121 GLN A N    4  
ATOM 5684  C CA   . GLN A 1 98  ? -8.911  -3.997  -16.397 1.00 0.00 ? 121 GLN A CA   4  
ATOM 5685  C C    . GLN A 1 98  ? -10.318 -4.595  -16.190 1.00 0.00 ? 121 GLN A C    4  
ATOM 5686  O O    . GLN A 1 98  ? -10.571 -5.726  -16.617 1.00 0.00 ? 121 GLN A O    4  
ATOM 5687  C CB   . GLN A 1 98  ? -8.056  -4.871  -17.343 1.00 0.00 ? 121 GLN A CB   4  
ATOM 5688  C CG   . GLN A 1 98  ? -6.802  -4.195  -17.919 1.00 0.00 ? 121 GLN A CG   4  
ATOM 5689  C CD   . GLN A 1 98  ? -6.992  -3.907  -19.403 1.00 0.00 ? 121 GLN A CD   4  
ATOM 5690  O OE1  . GLN A 1 98  ? -6.749  -4.752  -20.260 1.00 0.00 ? 121 GLN A OE1  4  
ATOM 5691  N NE2  . GLN A 1 98  ? -7.488  -2.740  -19.767 1.00 0.00 ? 121 GLN A NE2  4  
ATOM 5692  H H    . GLN A 1 98  ? -8.543  -4.581  -14.430 1.00 0.00 ? 121 GLN A H    4  
ATOM 5693  H HA   . GLN A 1 98  ? -9.002  -2.993  -16.795 1.00 0.00 ? 121 GLN A HA   4  
ATOM 5694  H HB2  . GLN A 1 98  ? -7.755  -5.776  -16.812 1.00 0.00 ? 121 GLN A HB2  4  
ATOM 5695  H HB3  . GLN A 1 98  ? -8.676  -5.193  -18.180 1.00 0.00 ? 121 GLN A HB3  4  
ATOM 5696  H HG2  . GLN A 1 98  ? -6.571  -3.275  -17.389 1.00 0.00 ? 121 GLN A HG2  4  
ATOM 5697  H HG3  . GLN A 1 98  ? -5.952  -4.867  -17.797 1.00 0.00 ? 121 GLN A HG3  4  
ATOM 5698  H HE21 . GLN A 1 98  ? -7.532  -1.962  -19.105 1.00 0.00 ? 121 GLN A HE21 4  
ATOM 5699  H HE22 . GLN A 1 98  ? -7.524  -2.505  -20.759 1.00 0.00 ? 121 GLN A HE22 4  
ATOM 5700  N N    . LYS A 1 99  ? -11.279 -3.883  -15.591 1.00 0.00 ? 122 LYS A N    4  
ATOM 5701  C CA   . LYS A 1 99  ? -12.700 -4.263  -15.699 1.00 0.00 ? 122 LYS A CA   4  
ATOM 5702  C C    . LYS A 1 99  ? -13.354 -3.538  -16.871 1.00 0.00 ? 122 LYS A C    4  
ATOM 5703  O O    . LYS A 1 99  ? -12.870 -2.482  -17.286 1.00 0.00 ? 122 LYS A O    4  
ATOM 5704  C CB   . LYS A 1 99  ? -13.480 -3.985  -14.394 1.00 0.00 ? 122 LYS A CB   4  
ATOM 5705  C CG   . LYS A 1 99  ? -12.926 -4.716  -13.168 1.00 0.00 ? 122 LYS A CG   4  
ATOM 5706  C CD   . LYS A 1 99  ? -12.741 -6.206  -13.444 1.00 0.00 ? 122 LYS A CD   4  
ATOM 5707  C CE   . LYS A 1 99  ? -12.386 -6.951  -12.168 1.00 0.00 ? 122 LYS A CE   4  
ATOM 5708  N NZ   . LYS A 1 99  ? -12.010 -8.338  -12.483 1.00 0.00 ? 122 LYS A NZ   4  
ATOM 5709  H H    . LYS A 1 99  ? -11.070 -2.977  -15.180 1.00 0.00 ? 122 LYS A H    4  
ATOM 5710  H HA   . LYS A 1 99  ? -12.764 -5.328  -15.911 1.00 0.00 ? 122 LYS A HA   4  
ATOM 5711  H HB2  . LYS A 1 99  ? -13.517 -2.917  -14.193 1.00 0.00 ? 122 LYS A HB2  4  
ATOM 5712  H HB3  . LYS A 1 99  ? -14.513 -4.303  -14.517 1.00 0.00 ? 122 LYS A HB3  4  
ATOM 5713  H HG2  . LYS A 1 99  ? -11.966 -4.287  -12.893 1.00 0.00 ? 122 LYS A HG2  4  
ATOM 5714  H HG3  . LYS A 1 99  ? -13.624 -4.583  -12.341 1.00 0.00 ? 122 LYS A HG3  4  
ATOM 5715  H HD2  . LYS A 1 99  ? -13.666 -6.609  -13.859 1.00 0.00 ? 122 LYS A HD2  4  
ATOM 5716  H HD3  . LYS A 1 99  ? -11.926 -6.341  -14.154 1.00 0.00 ? 122 LYS A HD3  4  
ATOM 5717  H HE2  . LYS A 1 99  ? -11.555 -6.445  -11.671 1.00 0.00 ? 122 LYS A HE2  4  
ATOM 5718  H HE3  . LYS A 1 99  ? -13.245 -6.941  -11.495 1.00 0.00 ? 122 LYS A HE3  4  
ATOM 5719  H HZ1  . LYS A 1 99  ? -11.137 -8.346  -13.004 1.00 0.00 ? 122 LYS A HZ1  4  
ATOM 5720  H HZ2  . LYS A 1 99  ? -11.867 -8.873  -11.638 1.00 0.00 ? 122 LYS A HZ2  4  
ATOM 5721  H HZ3  . LYS A 1 99  ? -12.720 -8.788  -13.058 1.00 0.00 ? 122 LYS A HZ3  4  
ATOM 5722  N N    . PRO A 1 100 ? -14.489 -4.051  -17.375 1.00 0.00 ? 123 PRO A N    4  
ATOM 5723  C CA   . PRO A 1 100 ? -15.307 -3.317  -18.330 1.00 0.00 ? 123 PRO A CA   4  
ATOM 5724  C C    . PRO A 1 100 ? -15.931 -2.056  -17.720 1.00 0.00 ? 123 PRO A C    4  
ATOM 5725  O O    . PRO A 1 100 ? -16.317 -1.154  -18.462 1.00 0.00 ? 123 PRO A O    4  
ATOM 5726  C CB   . PRO A 1 100 ? -16.359 -4.321  -18.810 1.00 0.00 ? 123 PRO A CB   4  
ATOM 5727  C CG   . PRO A 1 100 ? -16.482 -5.318  -17.664 1.00 0.00 ? 123 PRO A CG   4  
ATOM 5728  C CD   . PRO A 1 100 ? -15.060 -5.371  -17.120 1.00 0.00 ? 123 PRO A CD   4  
ATOM 5729  H HA   . PRO A 1 100 ? -14.692 -3.008  -19.169 1.00 0.00 ? 123 PRO A HA   4  
ATOM 5730  H HB2  . PRO A 1 100 ? -17.315 -3.846  -19.028 1.00 0.00 ? 123 PRO A HB2  4  
ATOM 5731  H HB3  . PRO A 1 100 ? -15.978 -4.841  -19.690 1.00 0.00 ? 123 PRO A HB3  4  
ATOM 5732  H HG2  . PRO A 1 100 ? -17.154 -4.927  -16.899 1.00 0.00 ? 123 PRO A HG2  4  
ATOM 5733  H HG3  . PRO A 1 100 ? -16.818 -6.294  -18.015 1.00 0.00 ? 123 PRO A HG3  4  
ATOM 5734  H HD2  . PRO A 1 100 ? -15.085 -5.628  -16.064 1.00 0.00 ? 123 PRO A HD2  4  
ATOM 5735  H HD3  . PRO A 1 100 ? -14.487 -6.120  -17.669 1.00 0.00 ? 123 PRO A HD3  4  
ATOM 5736  N N    . ASP A 1 101 ? -16.013 -1.976  -16.389 1.00 0.00 ? 124 ASP A N    4  
ATOM 5737  C CA   . ASP A 1 101 ? -16.562 -0.823  -15.680 1.00 0.00 ? 124 ASP A CA   4  
ATOM 5738  C C    . ASP A 1 101 ? -15.605 0.353   -15.803 1.00 0.00 ? 124 ASP A C    4  
ATOM 5739  O O    . ASP A 1 101 ? -16.000 1.408   -16.290 1.00 0.00 ? 124 ASP A O    4  
ATOM 5740  C CB   . ASP A 1 101 ? -16.814 -1.128  -14.191 1.00 0.00 ? 124 ASP A CB   4  
ATOM 5741  C CG   . ASP A 1 101 ? -18.208 -1.699  -13.957 1.00 0.00 ? 124 ASP A CG   4  
ATOM 5742  O OD1  . ASP A 1 101 ? -18.486 -2.799  -14.487 1.00 0.00 ? 124 ASP A OD1  4  
ATOM 5743  O OD2  . ASP A 1 101 ? -19.021 -1.057  -13.253 1.00 0.00 ? 124 ASP A OD2  4  
ATOM 5744  H H    . ASP A 1 101 ? -15.765 -2.800  -15.872 1.00 0.00 ? 124 ASP A H    4  
ATOM 5745  H HA   . ASP A 1 101 ? -17.511 -0.541  -16.141 1.00 0.00 ? 124 ASP A HA   4  
ATOM 5746  H HB2  . ASP A 1 101 ? -16.060 -1.821  -13.814 1.00 0.00 ? 124 ASP A HB2  4  
ATOM 5747  H HB3  . ASP A 1 101 ? -16.729 -0.203  -13.615 1.00 0.00 ? 124 ASP A HB3  4  
ATOM 5748  N N    . ASN A 1 102 ? -14.371 0.187   -15.302 1.00 0.00 ? 125 ASN A N    4  
ATOM 5749  C CA   . ASN A 1 102 ? -13.332 1.210   -15.132 1.00 0.00 ? 125 ASN A CA   4  
ATOM 5750  C C    . ASN A 1 102 ? -13.908 2.612   -14.931 1.00 0.00 ? 125 ASN A C    4  
ATOM 5751  O O    . ASN A 1 102 ? -13.606 3.545   -15.682 1.00 0.00 ? 125 ASN A O    4  
ATOM 5752  C CB   . ASN A 1 102 ? -12.322 1.136   -16.286 1.00 0.00 ? 125 ASN A CB   4  
ATOM 5753  C CG   . ASN A 1 102 ? -10.991 1.825   -15.989 1.00 0.00 ? 125 ASN A CG   4  
ATOM 5754  O OD1  . ASN A 1 102 ? -10.861 2.726   -15.161 1.00 0.00 ? 125 ASN A OD1  4  
ATOM 5755  N ND2  . ASN A 1 102 ? -9.958  1.394   -16.687 1.00 0.00 ? 125 ASN A ND2  4  
ATOM 5756  H H    . ASN A 1 102 ? -14.118 -0.742  -14.999 1.00 0.00 ? 125 ASN A H    4  
ATOM 5757  H HA   . ASN A 1 102 ? -12.796 0.975   -14.215 1.00 0.00 ? 125 ASN A HA   4  
ATOM 5758  H HB2  . ASN A 1 102 ? -12.119 0.084   -16.491 1.00 0.00 ? 125 ASN A HB2  4  
ATOM 5759  H HB3  . ASN A 1 102 ? -12.762 1.580   -17.178 1.00 0.00 ? 125 ASN A HB3  4  
ATOM 5760  H HD21 . ASN A 1 102 ? -10.090 0.677   -17.387 1.00 0.00 ? 125 ASN A HD21 4  
ATOM 5761  H HD22 . ASN A 1 102 ? -9.035  1.794   -16.572 1.00 0.00 ? 125 ASN A HD22 4  
ATOM 5762  N N    . LYS A 1 103 ? -14.803 2.745   -13.943 1.00 0.00 ? 126 LYS A N    4  
ATOM 5763  C CA   . LYS A 1 103 ? -15.389 4.029   -13.602 1.00 0.00 ? 126 LYS A CA   4  
ATOM 5764  C C    . LYS A 1 103 ? -15.059 4.359   -12.166 1.00 0.00 ? 126 LYS A C    4  
ATOM 5765  O O    . LYS A 1 103 ? -13.926 4.730   -11.866 1.00 0.00 ? 126 LYS A O    4  
ATOM 5766  C CB   . LYS A 1 103 ? -16.891 4.089   -13.996 1.00 0.00 ? 126 LYS A CB   4  
ATOM 5767  C CG   . LYS A 1 103 ? -17.145 5.374   -14.780 1.00 0.00 ? 126 LYS A CG   4  
ATOM 5768  C CD   . LYS A 1 103 ? -16.924 6.638   -13.929 1.00 0.00 ? 126 LYS A CD   4  
ATOM 5769  C CE   . LYS A 1 103 ? -16.940 7.869   -14.833 1.00 0.00 ? 126 LYS A CE   4  
ATOM 5770  N NZ   . LYS A 1 103 ? -15.790 7.918   -15.764 1.00 0.00 ? 126 LYS A NZ   4  
ATOM 5771  H H    . LYS A 1 103 ? -15.132 1.911   -13.485 1.00 0.00 ? 126 LYS A H    4  
ATOM 5772  H HA   . LYS A 1 103 ? -14.866 4.783   -14.189 1.00 0.00 ? 126 LYS A HA   4  
ATOM 5773  H HB2  . LYS A 1 103 ? -17.135 3.252   -14.652 1.00 0.00 ? 126 LYS A HB2  4  
ATOM 5774  H HB3  . LYS A 1 103 ? -17.587 4.053   -13.148 1.00 0.00 ? 126 LYS A HB3  4  
ATOM 5775  H HG2  . LYS A 1 103 ? -16.488 5.379   -15.650 1.00 0.00 ? 126 LYS A HG2  4  
ATOM 5776  H HG3  . LYS A 1 103 ? -18.173 5.363   -15.142 1.00 0.00 ? 126 LYS A HG3  4  
ATOM 5777  H HD2  . LYS A 1 103 ? -17.759 6.723   -13.237 1.00 0.00 ? 126 LYS A HD2  4  
ATOM 5778  H HD3  . LYS A 1 103 ? -15.995 6.609   -13.336 1.00 0.00 ? 126 LYS A HD3  4  
ATOM 5779  H HE2  . LYS A 1 103 ? -17.871 7.849   -15.403 1.00 0.00 ? 126 LYS A HE2  4  
ATOM 5780  H HE3  . LYS A 1 103 ? -16.932 8.753   -14.197 1.00 0.00 ? 126 LYS A HE3  4  
ATOM 5781  H HZ1  . LYS A 1 103 ? -15.883 7.233   -16.506 1.00 0.00 ? 126 LYS A HZ1  4  
ATOM 5782  H HZ2  . LYS A 1 103 ? -15.737 8.820   -16.230 1.00 0.00 ? 126 LYS A HZ2  4  
ATOM 5783  H HZ3  . LYS A 1 103 ? -14.907 7.755   -15.288 1.00 0.00 ? 126 LYS A HZ3  4  
ATOM 5784  N N    . LEU A 1 104 ? -15.995 4.159   -11.245 1.00 0.00 ? 127 LEU A N    4  
ATOM 5785  C CA   . LEU A 1 104 ? -15.752 4.531   -9.861  1.00 0.00 ? 127 LEU A CA   4  
ATOM 5786  C C    . LEU A 1 104 ? -14.994 3.423   -9.177  1.00 0.00 ? 127 LEU A C    4  
ATOM 5787  O O    . LEU A 1 104 ? -14.151 3.731   -8.357  1.00 0.00 ? 127 LEU A O    4  
ATOM 5788  C CB   . LEU A 1 104 ? -17.027 4.855   -9.085  1.00 0.00 ? 127 LEU A CB   4  
ATOM 5789  C CG   . LEU A 1 104 ? -17.452 6.330   -9.057  1.00 0.00 ? 127 LEU A CG   4  
ATOM 5790  C CD1  . LEU A 1 104 ? -16.335 7.314   -8.693  1.00 0.00 ? 127 LEU A CD1  4  
ATOM 5791  C CD2  . LEU A 1 104 ? -18.002 6.764   -10.402 1.00 0.00 ? 127 LEU A CD2  4  
ATOM 5792  H H    . LEU A 1 104 ? -16.845 3.690   -11.518 1.00 0.00 ? 127 LEU A H    4  
ATOM 5793  H HA   . LEU A 1 104 ? -15.105 5.401   -9.837  1.00 0.00 ? 127 LEU A HA   4  
ATOM 5794  H HB2  . LEU A 1 104 ? -17.839 4.254   -9.485  1.00 0.00 ? 127 LEU A HB2  4  
ATOM 5795  H HB3  . LEU A 1 104 ? -16.863 4.566   -8.047  1.00 0.00 ? 127 LEU A HB3  4  
ATOM 5796  H HG   . LEU A 1 104 ? -18.249 6.418   -8.322  1.00 0.00 ? 127 LEU A HG   4  
ATOM 5797  H HD11 . LEU A 1 104 ? -15.616 7.409   -9.498  1.00 0.00 ? 127 LEU A HD11 4  
ATOM 5798  H HD12 . LEU A 1 104 ? -16.755 8.312   -8.546  1.00 0.00 ? 127 LEU A HD12 4  
ATOM 5799  H HD13 . LEU A 1 104 ? -15.806 6.981   -7.803  1.00 0.00 ? 127 LEU A HD13 4  
ATOM 5800  H HD21 . LEU A 1 104 ? -17.202 6.718   -11.134 1.00 0.00 ? 127 LEU A HD21 4  
ATOM 5801  H HD22 . LEU A 1 104 ? -18.836 6.123   -10.685 1.00 0.00 ? 127 LEU A HD22 4  
ATOM 5802  H HD23 . LEU A 1 104 ? -18.364 7.789   -10.323 1.00 0.00 ? 127 LEU A HD23 4  
ATOM 5803  N N    . HIS A 1 105 ? -15.227 2.163   -9.542  1.00 0.00 ? 128 HIS A N    4  
ATOM 5804  C CA   . HIS A 1 105 ? -14.440 1.041   -9.063  1.00 0.00 ? 128 HIS A CA   4  
ATOM 5805  C C    . HIS A 1 105 ? -12.940 1.355   -9.172  1.00 0.00 ? 128 HIS A C    4  
ATOM 5806  O O    . HIS A 1 105 ? -12.234 1.324   -8.167  1.00 0.00 ? 128 HIS A O    4  
ATOM 5807  C CB   . HIS A 1 105 ? -14.910 -0.233  -9.785  1.00 0.00 ? 128 HIS A CB   4  
ATOM 5808  C CG   . HIS A 1 105 ? -13.832 -1.172  -10.241 1.00 0.00 ? 128 HIS A CG   4  
ATOM 5809  N ND1  . HIS A 1 105 ? -13.421 -2.327  -9.619  1.00 0.00 ? 128 HIS A ND1  4  
ATOM 5810  C CD2  . HIS A 1 105 ? -13.116 -1.030  -11.390 1.00 0.00 ? 128 HIS A CD2  4  
ATOM 5811  C CE1  . HIS A 1 105 ? -12.432 -2.848  -10.364 1.00 0.00 ? 128 HIS A CE1  4  
ATOM 5812  N NE2  . HIS A 1 105 ? -12.209 -2.083  -11.452 1.00 0.00 ? 128 HIS A NE2  4  
ATOM 5813  H H    . HIS A 1 105 ? -15.990 1.972   -10.172 1.00 0.00 ? 128 HIS A H    4  
ATOM 5814  H HA   . HIS A 1 105 ? -14.656 0.918   -8.006  1.00 0.00 ? 128 HIS A HA   4  
ATOM 5815  H HB2  . HIS A 1 105 ? -15.559 -0.770  -9.102  1.00 0.00 ? 128 HIS A HB2  4  
ATOM 5816  H HB3  . HIS A 1 105 ? -15.504 0.026   -10.665 1.00 0.00 ? 128 HIS A HB3  4  
ATOM 5817  H HD1  . HIS A 1 105 ? -13.875 -2.793  -8.832  1.00 0.00 ? 128 HIS A HD1  4  
ATOM 5818  H HD2  . HIS A 1 105 ? -13.234 -0.221  -12.095 1.00 0.00 ? 128 HIS A HD2  4  
ATOM 5819  H HE1  . HIS A 1 105 ? -11.917 -3.773  -10.139 1.00 0.00 ? 128 HIS A HE1  4  
ATOM 5820  N N    . GLN A 1 106 ? -12.463 1.750   -10.355 1.00 0.00 ? 129 GLN A N    4  
ATOM 5821  C CA   . GLN A 1 106 ? -11.041 1.947   -10.574 1.00 0.00 ? 129 GLN A CA   4  
ATOM 5822  C C    . GLN A 1 106 ? -10.558 3.254   -9.945  1.00 0.00 ? 129 GLN A C    4  
ATOM 5823  O O    . GLN A 1 106 ? -9.485  3.294   -9.350  1.00 0.00 ? 129 GLN A O    4  
ATOM 5824  C CB   . GLN A 1 106 ? -10.740 1.852   -12.073 1.00 0.00 ? 129 GLN A CB   4  
ATOM 5825  C CG   . GLN A 1 106 ? -9.222  1.838   -12.316 1.00 0.00 ? 129 GLN A CG   4  
ATOM 5826  C CD   . GLN A 1 106 ? -8.713  0.808   -13.340 1.00 0.00 ? 129 GLN A CD   4  
ATOM 5827  O OE1  . GLN A 1 106 ? -9.422  -0.083  -13.784 1.00 0.00 ? 129 GLN A OE1  4  
ATOM 5828  N NE2  . GLN A 1 106 ? -7.471  0.899   -13.781 1.00 0.00 ? 129 GLN A NE2  4  
ATOM 5829  H H    . GLN A 1 106 ? -13.086 1.843   -11.137 1.00 0.00 ? 129 GLN A H    4  
ATOM 5830  H HA   . GLN A 1 106 ? -10.512 1.137   -10.074 1.00 0.00 ? 129 GLN A HA   4  
ATOM 5831  H HB2  . GLN A 1 106 ? -11.188 0.937   -12.452 1.00 0.00 ? 129 GLN A HB2  4  
ATOM 5832  H HB3  . GLN A 1 106 ? -11.189 2.700   -12.589 1.00 0.00 ? 129 GLN A HB3  4  
ATOM 5833  H HG2  . GLN A 1 106 ? -8.928  2.824   -12.646 1.00 0.00 ? 129 GLN A HG2  4  
ATOM 5834  H HG3  . GLN A 1 106 ? -8.743  1.687   -11.356 1.00 0.00 ? 129 GLN A HG3  4  
ATOM 5835  H HE21 . GLN A 1 106 ? -6.830  1.628   -13.462 1.00 0.00 ? 129 GLN A HE21 4  
ATOM 5836  H HE22 . GLN A 1 106 ? -7.190  0.196   -14.449 1.00 0.00 ? 129 GLN A HE22 4  
ATOM 5837  N N    . GLN A 1 107 ? -11.336 4.326   -10.065 1.00 0.00 ? 130 GLN A N    4  
ATOM 5838  C CA   . GLN A 1 107 ? -11.067 5.595   -9.399  1.00 0.00 ? 130 GLN A CA   4  
ATOM 5839  C C    . GLN A 1 107 ? -10.944 5.472   -7.869  1.00 0.00 ? 130 GLN A C    4  
ATOM 5840  O O    . GLN A 1 107 ? -10.008 6.018   -7.278  1.00 0.00 ? 130 GLN A O    4  
ATOM 5841  C CB   . GLN A 1 107 ? -12.143 6.622   -9.791  1.00 0.00 ? 130 GLN A CB   4  
ATOM 5842  C CG   . GLN A 1 107 ? -11.811 7.283   -11.122 1.00 0.00 ? 130 GLN A CG   4  
ATOM 5843  C CD   . GLN A 1 107 ? -12.714 8.484   -11.353 1.00 0.00 ? 130 GLN A CD   4  
ATOM 5844  O OE1  . GLN A 1 107 ? -12.249 9.612   -11.517 1.00 0.00 ? 130 GLN A OE1  4  
ATOM 5845  N NE2  . GLN A 1 107 ? -14.015 8.279   -11.435 1.00 0.00 ? 130 GLN A NE2  4  
ATOM 5846  H H    . GLN A 1 107 ? -12.078 4.272   -10.746 1.00 0.00 ? 130 GLN A H    4  
ATOM 5847  H HA   . GLN A 1 107 ? -10.095 5.932   -9.756  1.00 0.00 ? 130 GLN A HA   4  
ATOM 5848  H HB2  . GLN A 1 107 ? -13.141 6.177   -9.893  1.00 0.00 ? 130 GLN A HB2  4  
ATOM 5849  H HB3  . GLN A 1 107 ? -12.173 7.397   -9.026  1.00 0.00 ? 130 GLN A HB3  4  
ATOM 5850  H HG2  . GLN A 1 107 ? -10.775 7.605   -11.101 1.00 0.00 ? 130 GLN A HG2  4  
ATOM 5851  H HG3  . GLN A 1 107 ? -11.931 6.568   -11.932 1.00 0.00 ? 130 GLN A HG3  4  
ATOM 5852  H HE21 . GLN A 1 107 ? -14.334 7.329   -11.346 1.00 0.00 ? 130 GLN A HE21 4  
ATOM 5853  H HE22 . GLN A 1 107 ? -14.665 9.056   -11.315 1.00 0.00 ? 130 GLN A HE22 4  
ATOM 5854  N N    . VAL A 1 108 ? -11.869 4.766   -7.222  1.00 0.00 ? 131 VAL A N    4  
ATOM 5855  C CA   . VAL A 1 108 ? -11.835 4.453   -5.798  1.00 0.00 ? 131 VAL A CA   4  
ATOM 5856  C C    . VAL A 1 108 ? -10.601 3.608   -5.528  1.00 0.00 ? 131 VAL A C    4  
ATOM 5857  O O    . VAL A 1 108 ? -9.815  3.976   -4.661  1.00 0.00 ? 131 VAL A O    4  
ATOM 5858  C CB   . VAL A 1 108 ? -13.133 3.737   -5.374  1.00 0.00 ? 131 VAL A CB   4  
ATOM 5859  C CG1  . VAL A 1 108 ? -13.096 3.148   -3.954  1.00 0.00 ? 131 VAL A CG1  4  
ATOM 5860  C CG2  . VAL A 1 108 ? -14.316 4.712   -5.436  1.00 0.00 ? 131 VAL A CG2  4  
ATOM 5861  H H    . VAL A 1 108 ? -12.625 4.350   -7.753  1.00 0.00 ? 131 VAL A H    4  
ATOM 5862  H HA   . VAL A 1 108 ? -11.741 5.382   -5.233  1.00 0.00 ? 131 VAL A HA   4  
ATOM 5863  H HB   . VAL A 1 108 ? -13.321 2.915   -6.064  1.00 0.00 ? 131 VAL A HB   4  
ATOM 5864  H HG11 . VAL A 1 108 ? -12.270 2.443   -3.833  1.00 0.00 ? 131 VAL A HG11 4  
ATOM 5865  H HG12 . VAL A 1 108 ? -12.983 3.941   -3.219  1.00 0.00 ? 131 VAL A HG12 4  
ATOM 5866  H HG13 . VAL A 1 108 ? -14.026 2.619   -3.755  1.00 0.00 ? 131 VAL A HG13 4  
ATOM 5867  H HG21 . VAL A 1 108 ? -14.220 5.444   -4.634  1.00 0.00 ? 131 VAL A HG21 4  
ATOM 5868  H HG22 . VAL A 1 108 ? -14.358 5.245   -6.388  1.00 0.00 ? 131 VAL A HG22 4  
ATOM 5869  H HG23 . VAL A 1 108 ? -15.239 4.149   -5.313  1.00 0.00 ? 131 VAL A HG23 4  
ATOM 5870  N N    . LEU A 1 109 ? -10.400 2.515   -6.275  1.00 0.00 ? 132 LEU A N    4  
ATOM 5871  C CA   . LEU A 1 109 ? -9.270  1.617   -6.076  1.00 0.00 ? 132 LEU A CA   4  
ATOM 5872  C C    . LEU A 1 109 ? -7.955  2.385   -6.163  1.00 0.00 ? 132 LEU A C    4  
ATOM 5873  O O    . LEU A 1 109 ? -7.032  2.077   -5.418  1.00 0.00 ? 132 LEU A O    4  
ATOM 5874  C CB   . LEU A 1 109 ? -9.323  0.447   -7.074  1.00 0.00 ? 132 LEU A CB   4  
ATOM 5875  C CG   . LEU A 1 109 ? -8.208  -0.588  -6.920  1.00 0.00 ? 132 LEU A CG   4  
ATOM 5876  C CD1  . LEU A 1 109 ? -8.363  -1.385  -5.634  1.00 0.00 ? 132 LEU A CD1  4  
ATOM 5877  C CD2  . LEU A 1 109 ? -8.302  -1.523  -8.118  1.00 0.00 ? 132 LEU A CD2  4  
ATOM 5878  H H    . LEU A 1 109 ? -11.077 2.263   -6.991  1.00 0.00 ? 132 LEU A H    4  
ATOM 5879  H HA   . LEU A 1 109 ? -9.360  1.214   -5.070  1.00 0.00 ? 132 LEU A HA   4  
ATOM 5880  H HB2  . LEU A 1 109 ? -10.286 -0.057  -6.987  1.00 0.00 ? 132 LEU A HB2  4  
ATOM 5881  H HB3  . LEU A 1 109 ? -9.229  0.811   -8.088  1.00 0.00 ? 132 LEU A HB3  4  
ATOM 5882  H HG   . LEU A 1 109 ? -7.232  -0.104  -6.933  1.00 0.00 ? 132 LEU A HG   4  
ATOM 5883  H HD11 . LEU A 1 109 ? -7.497  -2.026  -5.518  1.00 0.00 ? 132 LEU A HD11 4  
ATOM 5884  H HD12 . LEU A 1 109 ? -8.405  -0.721  -4.774  1.00 0.00 ? 132 LEU A HD12 4  
ATOM 5885  H HD13 . LEU A 1 109 ? -9.264  -1.999  -5.692  1.00 0.00 ? 132 LEU A HD13 4  
ATOM 5886  H HD21 . LEU A 1 109 ? -9.301  -1.960  -8.180  1.00 0.00 ? 132 LEU A HD21 4  
ATOM 5887  H HD22 . LEU A 1 109 ? -8.126  -0.957  -9.031  1.00 0.00 ? 132 LEU A HD22 4  
ATOM 5888  H HD23 . LEU A 1 109 ? -7.568  -2.320  -8.075  1.00 0.00 ? 132 LEU A HD23 4  
ATOM 5889  N N    . TRP A 1 110 ? -7.874  3.417   -7.006  1.00 0.00 ? 133 TRP A N    4  
ATOM 5890  C CA   . TRP A 1 110 ? -6.704  4.271   -7.089  1.00 0.00 ? 133 TRP A CA   4  
ATOM 5891  C C    . TRP A 1 110 ? -6.435  4.967   -5.756  1.00 0.00 ? 133 TRP A C    4  
ATOM 5892  O O    . TRP A 1 110 ? -5.347  4.804   -5.209  1.00 0.00 ? 133 TRP A O    4  
ATOM 5893  C CB   . TRP A 1 110 ? -6.813  5.265   -8.255  1.00 0.00 ? 133 TRP A CB   4  
ATOM 5894  C CG   . TRP A 1 110 ? -5.579  5.412   -9.095  1.00 0.00 ? 133 TRP A CG   4  
ATOM 5895  C CD1  . TRP A 1 110 ? -5.064  6.589   -9.512  1.00 0.00 ? 133 TRP A CD1  4  
ATOM 5896  C CD2  . TRP A 1 110 ? -4.745  4.376   -9.710  1.00 0.00 ? 133 TRP A CD2  4  
ATOM 5897  N NE1  . TRP A 1 110 ? -3.999  6.358   -10.357 1.00 0.00 ? 133 TRP A NE1  4  
ATOM 5898  C CE2  . TRP A 1 110 ? -3.768  5.012   -10.531 1.00 0.00 ? 133 TRP A CE2  4  
ATOM 5899  C CE3  . TRP A 1 110 ? -4.721  2.964   -9.683  1.00 0.00 ? 133 TRP A CE3  4  
ATOM 5900  C CZ2  . TRP A 1 110 ? -2.852  4.288   -11.309 1.00 0.00 ? 133 TRP A CZ2  4  
ATOM 5901  C CZ3  . TRP A 1 110 ? -3.770  2.231   -10.419 1.00 0.00 ? 133 TRP A CZ3  4  
ATOM 5902  C CH2  . TRP A 1 110 ? -2.843  2.887   -11.244 1.00 0.00 ? 133 TRP A CH2  4  
ATOM 5903  H H    . TRP A 1 110 ? -8.649  3.582   -7.636  1.00 0.00 ? 133 TRP A H    4  
ATOM 5904  H HA   . TRP A 1 110 ? -5.876  3.598   -7.282  1.00 0.00 ? 133 TRP A HA   4  
ATOM 5905  H HB2  . TRP A 1 110 ? -7.608  4.946   -8.924  1.00 0.00 ? 133 TRP A HB2  4  
ATOM 5906  H HB3  . TRP A 1 110 ? -7.107  6.246   -7.877  1.00 0.00 ? 133 TRP A HB3  4  
ATOM 5907  H HD1  . TRP A 1 110 ? -5.462  7.565   -9.262  1.00 0.00 ? 133 TRP A HD1  4  
ATOM 5908  H HE1  . TRP A 1 110 ? -3.508  7.104   -10.843 1.00 0.00 ? 133 TRP A HE1  4  
ATOM 5909  H HE3  . TRP A 1 110 ? -5.445  2.432   -9.084  1.00 0.00 ? 133 TRP A HE3  4  
ATOM 5910  H HZ2  . TRP A 1 110 ? -2.145  4.805   -11.938 1.00 0.00 ? 133 TRP A HZ2  4  
ATOM 5911  H HZ3  . TRP A 1 110 ? -3.747  1.151   -10.362 1.00 0.00 ? 133 TRP A HZ3  4  
ATOM 5912  H HH2  . TRP A 1 110 ? -2.119  2.307   -11.807 1.00 0.00 ? 133 TRP A HH2  4  
ATOM 5913  N N    . ARG A 1 111 ? -7.408  5.709   -5.215  1.00 0.00 ? 134 ARG A N    4  
ATOM 5914  C CA   . ARG A 1 111 ? -7.300  6.366   -3.907  1.00 0.00 ? 134 ARG A CA   4  
ATOM 5915  C C    . ARG A 1 111 ? -6.960  5.349   -2.822  1.00 0.00 ? 134 ARG A C    4  
ATOM 5916  O O    . ARG A 1 111 ? -6.098  5.599   -1.982  1.00 0.00 ? 134 ARG A O    4  
ATOM 5917  C CB   . ARG A 1 111 ? -8.631  7.086   -3.604  1.00 0.00 ? 134 ARG A CB   4  
ATOM 5918  C CG   . ARG A 1 111 ? -8.745  7.715   -2.199  1.00 0.00 ? 134 ARG A CG   4  
ATOM 5919  C CD   . ARG A 1 111 ? -7.831  8.927   -2.106  1.00 0.00 ? 134 ARG A CD   4  
ATOM 5920  N NE   . ARG A 1 111 ? -8.033  9.718   -0.880  1.00 0.00 ? 134 ARG A NE   4  
ATOM 5921  C CZ   . ARG A 1 111 ? -7.201  10.677  -0.450  1.00 0.00 ? 134 ARG A CZ   4  
ATOM 5922  N NH1  . ARG A 1 111 ? -6.031  10.883  -1.038  1.00 0.00 ? 134 ARG A NH1  4  
ATOM 5923  N NH2  . ARG A 1 111 ? -7.553  11.468  0.551   1.00 0.00 ? 134 ARG A NH2  4  
ATOM 5924  H H    . ARG A 1 111 ? -8.294  5.754   -5.705  1.00 0.00 ? 134 ARG A H    4  
ATOM 5925  H HA   . ARG A 1 111 ? -6.488  7.094   -3.944  1.00 0.00 ? 134 ARG A HA   4  
ATOM 5926  H HB2  . ARG A 1 111 ? -8.780  7.867   -4.351  1.00 0.00 ? 134 ARG A HB2  4  
ATOM 5927  H HB3  . ARG A 1 111 ? -9.447  6.378   -3.725  1.00 0.00 ? 134 ARG A HB3  4  
ATOM 5928  H HG2  . ARG A 1 111 ? -9.769  8.056   -2.052  1.00 0.00 ? 134 ARG A HG2  4  
ATOM 5929  H HG3  . ARG A 1 111 ? -8.505  6.995   -1.416  1.00 0.00 ? 134 ARG A HG3  4  
ATOM 5930  H HD2  . ARG A 1 111 ? -6.794  8.604   -2.178  1.00 0.00 ? 134 ARG A HD2  4  
ATOM 5931  H HD3  . ARG A 1 111 ? -8.077  9.545   -2.962  1.00 0.00 ? 134 ARG A HD3  4  
ATOM 5932  H HE   . ARG A 1 111 ? -8.879  9.546   -0.355  1.00 0.00 ? 134 ARG A HE   4  
ATOM 5933  H HH11 . ARG A 1 111 ? -5.721  10.293  -1.811  1.00 0.00 ? 134 ARG A HH11 4  
ATOM 5934  H HH12 . ARG A 1 111 ? -5.390  11.620  -0.751  1.00 0.00 ? 134 ARG A HH12 4  
ATOM 5935  H HH21 . ARG A 1 111 ? -8.448  11.406  1.032   1.00 0.00 ? 134 ARG A HH21 4  
ATOM 5936  H HH22 . ARG A 1 111 ? -6.913  12.181  0.905   1.00 0.00 ? 134 ARG A HH22 4  
ATOM 5937  N N    . LEU A 1 112 ? -7.668  4.224   -2.842  1.00 0.00 ? 135 LEU A N    4  
ATOM 5938  C CA   . LEU A 1 112 ? -7.606  3.164   -1.857  1.00 0.00 ? 135 LEU A CA   4  
ATOM 5939  C C    . LEU A 1 112 ? -6.185  2.602   -1.842  1.00 0.00 ? 135 LEU A C    4  
ATOM 5940  O O    . LEU A 1 112 ? -5.506  2.716   -0.830  1.00 0.00 ? 135 LEU A O    4  
ATOM 5941  C CB   . LEU A 1 112 ? -8.722  2.145   -2.175  1.00 0.00 ? 135 LEU A CB   4  
ATOM 5942  C CG   . LEU A 1 112 ? -9.204  1.302   -0.986  1.00 0.00 ? 135 LEU A CG   4  
ATOM 5943  C CD1  . LEU A 1 112 ? -10.591 0.715   -1.251  1.00 0.00 ? 135 LEU A CD1  4  
ATOM 5944  C CD2  . LEU A 1 112 ? -8.264  0.146   -0.724  1.00 0.00 ? 135 LEU A CD2  4  
ATOM 5945  H H    . LEU A 1 112 ? -8.342  4.113   -3.592  1.00 0.00 ? 135 LEU A H    4  
ATOM 5946  H HA   . LEU A 1 112 ? -7.807  3.607   -0.880  1.00 0.00 ? 135 LEU A HA   4  
ATOM 5947  H HB2  . LEU A 1 112 ? -9.587  2.705   -2.507  1.00 0.00 ? 135 LEU A HB2  4  
ATOM 5948  H HB3  . LEU A 1 112 ? -8.428  1.500   -2.999  1.00 0.00 ? 135 LEU A HB3  4  
ATOM 5949  H HG   . LEU A 1 112 ? -9.254  1.930   -0.103  1.00 0.00 ? 135 LEU A HG   4  
ATOM 5950  H HD11 . LEU A 1 112 ? -10.550 0.050   -2.106  1.00 0.00 ? 135 LEU A HD11 4  
ATOM 5951  H HD12 . LEU A 1 112 ? -10.919 0.151   -0.377  1.00 0.00 ? 135 LEU A HD12 4  
ATOM 5952  H HD13 . LEU A 1 112 ? -11.320 1.497   -1.457  1.00 0.00 ? 135 LEU A HD13 4  
ATOM 5953  H HD21 . LEU A 1 112 ? -8.625  -0.441  0.122   1.00 0.00 ? 135 LEU A HD21 4  
ATOM 5954  H HD22 . LEU A 1 112 ? -8.214  -0.489  -1.605  1.00 0.00 ? 135 LEU A HD22 4  
ATOM 5955  H HD23 . LEU A 1 112 ? -7.289  0.546   -0.488  1.00 0.00 ? 135 LEU A HD23 4  
ATOM 5956  N N    . VAL A 1 113 ? -5.685  2.061   -2.953  1.00 0.00 ? 136 VAL A N    4  
ATOM 5957  C CA   . VAL A 1 113 ? -4.348  1.469   -3.008  1.00 0.00 ? 136 VAL A CA   4  
ATOM 5958  C C    . VAL A 1 113 ? -3.248  2.519   -2.809  1.00 0.00 ? 136 VAL A C    4  
ATOM 5959  O O    . VAL A 1 113 ? -2.218  2.189   -2.209  1.00 0.00 ? 136 VAL A O    4  
ATOM 5960  C CB   . VAL A 1 113 ? -4.159  0.652   -4.299  1.00 0.00 ? 136 VAL A CB   4  
ATOM 5961  C CG1  . VAL A 1 113 ? -2.776  -0.011  -4.356  1.00 0.00 ? 136 VAL A CG1  4  
ATOM 5962  C CG2  . VAL A 1 113 ? -5.179  -0.482  -4.403  1.00 0.00 ? 136 VAL A CG2  4  
ATOM 5963  H H    . VAL A 1 113 ? -6.245  2.034   -3.800  1.00 0.00 ? 136 VAL A H    4  
ATOM 5964  H HA   . VAL A 1 113 ? -4.273  0.776   -2.177  1.00 0.00 ? 136 VAL A HA   4  
ATOM 5965  H HB   . VAL A 1 113 ? -4.288  1.295   -5.164  1.00 0.00 ? 136 VAL A HB   4  
ATOM 5966  H HG11 . VAL A 1 113 ? -2.019  0.732   -4.619  1.00 0.00 ? 136 VAL A HG11 4  
ATOM 5967  H HG12 . VAL A 1 113 ? -2.523  -0.457  -3.395  1.00 0.00 ? 136 VAL A HG12 4  
ATOM 5968  H HG13 . VAL A 1 113 ? -2.782  -0.799  -5.105  1.00 0.00 ? 136 VAL A HG13 4  
ATOM 5969  H HG21 . VAL A 1 113 ? -4.987  -1.231  -3.636  1.00 0.00 ? 136 VAL A HG21 4  
ATOM 5970  H HG22 . VAL A 1 113 ? -6.190  -0.101  -4.302  1.00 0.00 ? 136 VAL A HG22 4  
ATOM 5971  H HG23 . VAL A 1 113 ? -5.083  -0.931  -5.391  1.00 0.00 ? 136 VAL A HG23 4  
ATOM 5972  N N    . GLN A 1 114 ? -3.465  3.782   -3.210  1.00 0.00 ? 137 GLN A N    4  
ATOM 5973  C CA   . GLN A 1 114 ? -2.541  4.852   -2.858  1.00 0.00 ? 137 GLN A CA   4  
ATOM 5974  C C    . GLN A 1 114 ? -2.388  4.912   -1.334  1.00 0.00 ? 137 GLN A C    4  
ATOM 5975  O O    . GLN A 1 114 ? -1.267  5.011   -0.825  1.00 0.00 ? 137 GLN A O    4  
ATOM 5976  C CB   . GLN A 1 114 ? -2.967  6.225   -3.422  1.00 0.00 ? 137 GLN A CB   4  
ATOM 5977  C CG   . GLN A 1 114 ? -2.569  6.461   -4.890  1.00 0.00 ? 137 GLN A CG   4  
ATOM 5978  C CD   . GLN A 1 114 ? -2.908  7.873   -5.370  1.00 0.00 ? 137 GLN A CD   4  
ATOM 5979  O OE1  . GLN A 1 114 ? -3.991  8.398   -5.127  1.00 0.00 ? 137 GLN A OE1  4  
ATOM 5980  N NE2  . GLN A 1 114 ? -1.994  8.531   -6.067  1.00 0.00 ? 137 GLN A NE2  4  
ATOM 5981  H H    . GLN A 1 114 ? -4.313  4.021   -3.708  1.00 0.00 ? 137 GLN A H    4  
ATOM 5982  H HA   . GLN A 1 114 ? -1.581  4.577   -3.280  1.00 0.00 ? 137 GLN A HA   4  
ATOM 5983  H HB2  . GLN A 1 114 ? -4.042  6.351   -3.313  1.00 0.00 ? 137 GLN A HB2  4  
ATOM 5984  H HB3  . GLN A 1 114 ? -2.481  7.001   -2.830  1.00 0.00 ? 137 GLN A HB3  4  
ATOM 5985  H HG2  . GLN A 1 114 ? -1.497  6.311   -4.988  1.00 0.00 ? 137 GLN A HG2  4  
ATOM 5986  H HG3  . GLN A 1 114 ? -3.068  5.743   -5.534  1.00 0.00 ? 137 GLN A HG3  4  
ATOM 5987  H HE21 . GLN A 1 114 ? -1.128  8.092   -6.330  1.00 0.00 ? 137 GLN A HE21 4  
ATOM 5988  H HE22 . GLN A 1 114 ? -2.198  9.474   -6.402  1.00 0.00 ? 137 GLN A HE22 4  
ATOM 5989  N N    . GLU A 1 115 ? -3.501  4.818   -0.601  1.00 0.00 ? 138 GLU A N    4  
ATOM 5990  C CA   . GLU A 1 115 ? -3.465  4.876   0.848   1.00 0.00 ? 138 GLU A CA   4  
ATOM 5991  C C    . GLU A 1 115 ? -2.895  3.605   1.462   1.00 0.00 ? 138 GLU A C    4  
ATOM 5992  O O    . GLU A 1 115 ? -2.162  3.691   2.438   1.00 0.00 ? 138 GLU A O    4  
ATOM 5993  C CB   . GLU A 1 115 ? -4.848  5.208   1.439   1.00 0.00 ? 138 GLU A CB   4  
ATOM 5994  C CG   . GLU A 1 115 ? -4.704  6.088   2.689   1.00 0.00 ? 138 GLU A CG   4  
ATOM 5995  C CD   . GLU A 1 115 ? -3.862  7.339   2.388   1.00 0.00 ? 138 GLU A CD   4  
ATOM 5996  O OE1  . GLU A 1 115 ? -4.218  8.103   1.461   1.00 0.00 ? 138 GLU A OE1  4  
ATOM 5997  O OE2  . GLU A 1 115 ? -2.751  7.477   2.957   1.00 0.00 ? 138 GLU A OE2  4  
ATOM 5998  H H    . GLU A 1 115 ? -4.403  4.691   -1.049  1.00 0.00 ? 138 GLU A H    4  
ATOM 5999  H HA   . GLU A 1 115 ? -2.771  5.675   1.081   1.00 0.00 ? 138 GLU A HA   4  
ATOM 6000  H HB2  . GLU A 1 115 ? -5.452  5.743   0.706   1.00 0.00 ? 138 GLU A HB2  4  
ATOM 6001  H HB3  . GLU A 1 115 ? -5.372  4.288   1.709   1.00 0.00 ? 138 GLU A HB3  4  
ATOM 6002  H HG2  . GLU A 1 115 ? -5.692  6.375   3.044   1.00 0.00 ? 138 GLU A HG2  4  
ATOM 6003  H HG3  . GLU A 1 115 ? -4.244  5.493   3.478   1.00 0.00 ? 138 GLU A HG3  4  
ATOM 6004  N N    . LEU A 1 116 ? -3.175  2.434   0.890   1.00 0.00 ? 139 LEU A N    4  
ATOM 6005  C CA   . LEU A 1 116 ? -2.676  1.167   1.420   1.00 0.00 ? 139 LEU A CA   4  
ATOM 6006  C C    . LEU A 1 116 ? -1.152  1.091   1.357   1.00 0.00 ? 139 LEU A C    4  
ATOM 6007  O O    . LEU A 1 116 ? -0.560  0.454   2.219   1.00 0.00 ? 139 LEU A O    4  
ATOM 6008  C CB   . LEU A 1 116 ? -3.285  -0.019  0.660   1.00 0.00 ? 139 LEU A CB   4  
ATOM 6009  C CG   . LEU A 1 116 ? -4.661  -0.522  1.145   1.00 0.00 ? 139 LEU A CG   4  
ATOM 6010  C CD1  . LEU A 1 116 ? -5.614  0.513   1.742   1.00 0.00 ? 139 LEU A CD1  4  
ATOM 6011  C CD2  . LEU A 1 116 ? -5.338  -1.284  0.000   1.00 0.00 ? 139 LEU A CD2  4  
ATOM 6012  H H    . LEU A 1 116 ? -3.823  2.436   0.110   1.00 0.00 ? 139 LEU A H    4  
ATOM 6013  H HA   . LEU A 1 116 ? -2.947  1.088   2.474   1.00 0.00 ? 139 LEU A HA   4  
ATOM 6014  H HB2  . LEU A 1 116 ? -3.313  0.233   -0.396  1.00 0.00 ? 139 LEU A HB2  4  
ATOM 6015  H HB3  . LEU A 1 116 ? -2.601  -0.862  0.767   1.00 0.00 ? 139 LEU A HB3  4  
ATOM 6016  H HG   . LEU A 1 116 ? -4.482  -1.228  1.944   1.00 0.00 ? 139 LEU A HG   4  
ATOM 6017  H HD11 . LEU A 1 116 ? -6.533  0.026   2.068   1.00 0.00 ? 139 LEU A HD11 4  
ATOM 6018  H HD12 . LEU A 1 116 ? -5.148  0.976   2.607   1.00 0.00 ? 139 LEU A HD12 4  
ATOM 6019  H HD13 . LEU A 1 116 ? -5.849  1.289   1.027   1.00 0.00 ? 139 LEU A HD13 4  
ATOM 6020  H HD21 . LEU A 1 116 ? -6.305  -1.670  0.326   1.00 0.00 ? 139 LEU A HD21 4  
ATOM 6021  H HD22 . LEU A 1 116 ? -5.498  -0.624  -0.852  1.00 0.00 ? 139 LEU A HD22 4  
ATOM 6022  H HD23 . LEU A 1 116 ? -4.711  -2.114  -0.313  1.00 0.00 ? 139 LEU A HD23 4  
ATOM 6023  N N    . CYS A 1 117 ? -0.496  1.701   0.360   1.00 0.00 ? 140 CYS A N    4  
ATOM 6024  C CA   . CYS A 1 117 ? 0.965   1.745   0.398   1.00 0.00 ? 140 CYS A CA   4  
ATOM 6025  C C    . CYS A 1 117 ? 1.445   2.774   1.429   1.00 0.00 ? 140 CYS A C    4  
ATOM 6026  O O    . CYS A 1 117 ? 2.322   2.461   2.226   1.00 0.00 ? 140 CYS A O    4  
ATOM 6027  C CB   . CYS A 1 117 ? 1.582   1.997   -0.981  1.00 0.00 ? 140 CYS A CB   4  
ATOM 6028  S SG   . CYS A 1 117 ? 3.151   1.102   -1.115  1.00 0.00 ? 140 CYS A SG   4  
ATOM 6029  H H    . CYS A 1 117 ? -1.022  2.197   -0.348  1.00 0.00 ? 140 CYS A H    4  
ATOM 6030  H HA   . CYS A 1 117 ? 1.312   0.764   0.730   1.00 0.00 ? 140 CYS A HA   4  
ATOM 6031  H HB2  . CYS A 1 117 ? 0.911   1.642   -1.763  1.00 0.00 ? 140 CYS A HB2  4  
ATOM 6032  H HB3  . CYS A 1 117 ? 1.757   3.064   -1.118  1.00 0.00 ? 140 CYS A HB3  4  
ATOM 6033  N N    . SER A 1 118 ? 0.868   3.983   1.392   1.00 0.00 ? 141 SER A N    4  
ATOM 6034  C CA   . SER A 1 118 ? 1.120   5.101   2.298   1.00 0.00 ? 141 SER A CA   4  
ATOM 6035  C C    . SER A 1 118 ? 1.045   4.688   3.771   1.00 0.00 ? 141 SER A C    4  
ATOM 6036  O O    . SER A 1 118 ? 2.045   4.734   4.480   1.00 0.00 ? 141 SER A O    4  
ATOM 6037  C CB   . SER A 1 118 ? 0.095   6.187   1.938   1.00 0.00 ? 141 SER A CB   4  
ATOM 6038  O OG   . SER A 1 118 ? -0.043  7.243   2.867   1.00 0.00 ? 141 SER A OG   4  
ATOM 6039  H H    . SER A 1 118 ? 0.167   4.147   0.681   1.00 0.00 ? 141 SER A H    4  
ATOM 6040  H HA   . SER A 1 118 ? 2.122   5.489   2.121   1.00 0.00 ? 141 SER A HA   4  
ATOM 6041  H HB2  . SER A 1 118 ? 0.359   6.597   0.964   1.00 0.00 ? 141 SER A HB2  4  
ATOM 6042  H HB3  . SER A 1 118 ? -0.878  5.717   1.854   1.00 0.00 ? 141 SER A HB3  4  
ATOM 6043  H HG   . SER A 1 118 ? -1.007  7.371   3.016   1.00 0.00 ? 141 SER A HG   4  
ATOM 6044  N N    . LEU A 1 119 ? -0.152  4.329   4.238   1.00 0.00 ? 142 LEU A N    4  
ATOM 6045  C CA   . LEU A 1 119 ? -0.632  4.336   5.610   1.00 0.00 ? 142 LEU A CA   4  
ATOM 6046  C C    . LEU A 1 119 ? -0.294  5.607   6.389   1.00 0.00 ? 142 LEU A C    4  
ATOM 6047  O O    . LEU A 1 119 ? -1.199  6.394   6.679   1.00 0.00 ? 142 LEU A O    4  
ATOM 6048  C CB   . LEU A 1 119 ? -0.256  3.020   6.304   1.00 0.00 ? 142 LEU A CB   4  
ATOM 6049  C CG   . LEU A 1 119 ? -1.468  2.104   6.529   1.00 0.00 ? 142 LEU A CG   4  
ATOM 6050  C CD1  . LEU A 1 119 ? -2.339  2.639   7.673   1.00 0.00 ? 142 LEU A CD1  4  
ATOM 6051  C CD2  . LEU A 1 119 ? -2.316  1.858   5.269   1.00 0.00 ? 142 LEU A CD2  4  
ATOM 6052  H H    . LEU A 1 119 ? -0.876  4.124   3.564   1.00 0.00 ? 142 LEU A H    4  
ATOM 6053  H HA   . LEU A 1 119 ? -1.713  4.372   5.525   1.00 0.00 ? 142 LEU A HA   4  
ATOM 6054  H HB2  . LEU A 1 119 ? 0.482   2.476   5.710   1.00 0.00 ? 142 LEU A HB2  4  
ATOM 6055  H HB3  . LEU A 1 119 ? 0.207   3.234   7.266   1.00 0.00 ? 142 LEU A HB3  4  
ATOM 6056  H HG   . LEU A 1 119 ? -1.065  1.142   6.830   1.00 0.00 ? 142 LEU A HG   4  
ATOM 6057  H HD11 . LEU A 1 119 ? -3.088  1.893   7.933   1.00 0.00 ? 142 LEU A HD11 4  
ATOM 6058  H HD12 . LEU A 1 119 ? -1.719  2.815   8.553   1.00 0.00 ? 142 LEU A HD12 4  
ATOM 6059  H HD13 . LEU A 1 119 ? -2.829  3.569   7.388   1.00 0.00 ? 142 LEU A HD13 4  
ATOM 6060  H HD21 . LEU A 1 119 ? -2.911  2.730   4.977   1.00 0.00 ? 142 LEU A HD21 4  
ATOM 6061  H HD22 . LEU A 1 119 ? -1.658  1.584   4.443   1.00 0.00 ? 142 LEU A HD22 4  
ATOM 6062  H HD23 . LEU A 1 119 ? -2.993  1.030   5.456   1.00 0.00 ? 142 LEU A HD23 4  
ATOM 6063  N N    . LYS A 1 120 ? 0.973   5.841   6.703   1.00 0.00 ? 143 LYS A N    4  
ATOM 6064  C CA   . LYS A 1 120 ? 1.499   7.075   7.258   1.00 0.00 ? 143 LYS A CA   4  
ATOM 6065  C C    . LYS A 1 120 ? 2.734   7.396   6.431   1.00 0.00 ? 143 LYS A C    4  
ATOM 6066  O O    . LYS A 1 120 ? 3.800   6.906   6.783   1.00 0.00 ? 143 LYS A O    4  
ATOM 6067  C CB   . LYS A 1 120 ? 1.849   6.863   8.742   1.00 0.00 ? 143 LYS A CB   4  
ATOM 6068  C CG   . LYS A 1 120 ? 0.646   6.954   9.690   1.00 0.00 ? 143 LYS A CG   4  
ATOM 6069  C CD   . LYS A 1 120 ? 0.712   5.907   10.810  1.00 0.00 ? 143 LYS A CD   4  
ATOM 6070  C CE   . LYS A 1 120 ? -0.137  6.299   12.025  1.00 0.00 ? 143 LYS A CE   4  
ATOM 6071  N NZ   . LYS A 1 120 ? -1.557  6.529   11.695  1.00 0.00 ? 143 LYS A NZ   4  
ATOM 6072  H H    . LYS A 1 120 ? 1.657   5.193   6.313   1.00 0.00 ? 143 LYS A H    4  
ATOM 6073  H HA   . LYS A 1 120 ? 0.775   7.881   7.151   1.00 0.00 ? 143 LYS A HA   4  
ATOM 6074  H HB2  . LYS A 1 120 ? 2.332   5.890   8.842   1.00 0.00 ? 143 LYS A HB2  4  
ATOM 6075  H HB3  . LYS A 1 120 ? 2.572   7.617   9.054   1.00 0.00 ? 143 LYS A HB3  4  
ATOM 6076  H HG2  . LYS A 1 120 ? 0.635   7.953   10.125  1.00 0.00 ? 143 LYS A HG2  4  
ATOM 6077  H HG3  . LYS A 1 120 ? -0.282  6.813   9.141   1.00 0.00 ? 143 LYS A HG3  4  
ATOM 6078  H HD2  . LYS A 1 120 ? 0.389   4.939   10.423  1.00 0.00 ? 143 LYS A HD2  4  
ATOM 6079  H HD3  . LYS A 1 120 ? 1.744   5.807   11.148  1.00 0.00 ? 143 LYS A HD3  4  
ATOM 6080  H HE2  . LYS A 1 120 ? -0.070  5.500   12.763  1.00 0.00 ? 143 LYS A HE2  4  
ATOM 6081  H HE3  . LYS A 1 120 ? 0.283   7.205   12.467  1.00 0.00 ? 143 LYS A HE3  4  
ATOM 6082  H HZ1  . LYS A 1 120 ? -1.675  7.330   11.081  1.00 0.00 ? 143 LYS A HZ1  4  
ATOM 6083  H HZ2  . LYS A 1 120 ? -1.966  5.705   11.264  1.00 0.00 ? 143 LYS A HZ2  4  
ATOM 6084  H HZ3  . LYS A 1 120 ? -2.079  6.716   12.548  1.00 0.00 ? 143 LYS A HZ3  4  
ATOM 6085  N N    . HIS A 1 121 ? 2.601   8.232   5.390   1.00 0.00 ? 144 HIS A N    4  
ATOM 6086  C CA   . HIS A 1 121 ? 3.669   8.635   4.461   1.00 0.00 ? 144 HIS A CA   4  
ATOM 6087  C C    . HIS A 1 121 ? 4.571   7.438   4.116   1.00 0.00 ? 144 HIS A C    4  
ATOM 6088  O O    . HIS A 1 121 ? 4.211   6.637   3.254   1.00 0.00 ? 144 HIS A O    4  
ATOM 6089  C CB   . HIS A 1 121 ? 4.425   9.909   4.941   1.00 0.00 ? 144 HIS A CB   4  
ATOM 6090  C CG   . HIS A 1 121 ? 4.786   9.926   6.412   1.00 0.00 ? 144 HIS A CG   4  
ATOM 6091  N ND1  . HIS A 1 121 ? 3.914   10.024  7.477   1.00 0.00 ? 144 HIS A ND1  4  
ATOM 6092  C CD2  . HIS A 1 121 ? 6.029   9.672   6.924   1.00 0.00 ? 144 HIS A CD2  4  
ATOM 6093  C CE1  . HIS A 1 121 ? 4.602   9.725   8.590   1.00 0.00 ? 144 HIS A CE1  4  
ATOM 6094  N NE2  . HIS A 1 121 ? 5.888   9.513   8.300   1.00 0.00 ? 144 HIS A NE2  4  
ATOM 6095  H H    . HIS A 1 121 ? 1.677   8.590   5.180   1.00 0.00 ? 144 HIS A H    4  
ATOM 6096  H HA   . HIS A 1 121 ? 3.181   8.904   3.527   1.00 0.00 ? 144 HIS A HA   4  
ATOM 6097  H HB2  . HIS A 1 121 ? 5.349   9.996   4.370   1.00 0.00 ? 144 HIS A HB2  4  
ATOM 6098  H HB3  . HIS A 1 121 ? 3.846   10.800  4.696   1.00 0.00 ? 144 HIS A HB3  4  
ATOM 6099  H HD1  . HIS A 1 121 ? 2.911   10.199  7.438   1.00 0.00 ? 144 HIS A HD1  4  
ATOM 6100  H HD2  . HIS A 1 121 ? 6.961   9.580   6.384   1.00 0.00 ? 144 HIS A HD2  4  
ATOM 6101  H HE1  . HIS A 1 121 ? 4.200   9.646   9.587   1.00 0.00 ? 144 HIS A HE1  4  
ATOM 6102  N N    . CYS A 1 122 ? 5.713   7.319   4.792   1.00 0.00 ? 145 CYS A N    4  
ATOM 6103  C CA   . CYS A 1 122 ? 6.385   6.073   5.103   1.00 0.00 ? 145 CYS A CA   4  
ATOM 6104  C C    . CYS A 1 122 ? 7.266   6.402   6.315   1.00 0.00 ? 145 CYS A C    4  
ATOM 6105  O O    . CYS A 1 122 ? 6.908   6.061   7.437   1.00 0.00 ? 145 CYS A O    4  
ATOM 6106  C CB   . CYS A 1 122 ? 7.130   5.519   3.875   1.00 0.00 ? 145 CYS A CB   4  
ATOM 6107  S SG   . CYS A 1 122 ? 8.814   4.908   4.091   1.00 0.00 ? 145 CYS A SG   4  
ATOM 6108  H H    . CYS A 1 122 ? 5.836   7.994   5.531   1.00 0.00 ? 145 CYS A H    4  
ATOM 6109  H HA   . CYS A 1 122 ? 5.643   5.332   5.412   1.00 0.00 ? 145 CYS A HA   4  
ATOM 6110  H HB2  . CYS A 1 122 ? 6.534   4.727   3.428   1.00 0.00 ? 145 CYS A HB2  4  
ATOM 6111  H HB3  . CYS A 1 122 ? 7.189   6.298   3.130   1.00 0.00 ? 145 CYS A HB3  4  
ATOM 6112  N N    . GLU A 1 123 ? 8.390   7.103   6.114   1.00 0.00 ? 146 GLU A N    4  
ATOM 6113  C CA   . GLU A 1 123 ? 9.365   7.458   7.142   1.00 0.00 ? 146 GLU A CA   4  
ATOM 6114  C C    . GLU A 1 123 ? 10.036  8.778   6.719   1.00 0.00 ? 146 GLU A C    4  
ATOM 6115  O O    . GLU A 1 123 ? 9.303   9.733   6.515   1.00 0.00 ? 146 GLU A O    4  
ATOM 6116  C CB   . GLU A 1 123 ? 10.361  6.295   7.366   1.00 0.00 ? 146 GLU A CB   4  
ATOM 6117  C CG   . GLU A 1 123 ? 9.736   5.109   8.117   1.00 0.00 ? 146 GLU A CG   4  
ATOM 6118  C CD   . GLU A 1 123 ? 10.752  4.047   8.522   1.00 0.00 ? 146 GLU A CD   4  
ATOM 6119  O OE1  . GLU A 1 123 ? 11.415  4.200   9.574   1.00 0.00 ? 146 GLU A OE1  4  
ATOM 6120  O OE2  . GLU A 1 123 ? 10.822  3.010   7.819   1.00 0.00 ? 146 GLU A OE2  4  
ATOM 6121  H H    . GLU A 1 123 ? 8.616   7.392   5.176   1.00 0.00 ? 146 GLU A H    4  
ATOM 6122  H HA   . GLU A 1 123 ? 8.807   7.655   8.062   1.00 0.00 ? 146 GLU A HA   4  
ATOM 6123  H HB2  . GLU A 1 123 ? 10.749  5.954   6.404   1.00 0.00 ? 146 GLU A HB2  4  
ATOM 6124  H HB3  . GLU A 1 123 ? 11.194  6.668   7.955   1.00 0.00 ? 146 GLU A HB3  4  
ATOM 6125  H HG2  . GLU A 1 123 ? 9.240   5.474   9.017   1.00 0.00 ? 146 GLU A HG2  4  
ATOM 6126  H HG3  . GLU A 1 123 ? 8.996   4.625   7.482   1.00 0.00 ? 146 GLU A HG3  4  
ATOM 6127  N N    . PHE A 1 124 ? 11.372  8.844   6.577   1.00 0.00 ? 147 PHE A N    4  
ATOM 6128  C CA   . PHE A 1 124 ? 12.244  9.955   6.139   1.00 0.00 ? 147 PHE A CA   4  
ATOM 6129  C C    . PHE A 1 124 ? 11.531  11.271  5.777   1.00 0.00 ? 147 PHE A C    4  
ATOM 6130  O O    . PHE A 1 124 ? 11.752  12.291  6.435   1.00 0.00 ? 147 PHE A O    4  
ATOM 6131  C CB   . PHE A 1 124 ? 13.092  9.461   4.955   1.00 0.00 ? 147 PHE A CB   4  
ATOM 6132  C CG   . PHE A 1 124 ? 13.645  10.574  4.075   1.00 0.00 ? 147 PHE A CG   4  
ATOM 6133  C CD1  . PHE A 1 124 ? 14.572  11.497  4.597   1.00 0.00 ? 147 PHE A CD1  4  
ATOM 6134  C CD2  . PHE A 1 124 ? 13.135  10.766  2.775   1.00 0.00 ? 147 PHE A CD2  4  
ATOM 6135  C CE1  . PHE A 1 124 ? 14.978  12.594  3.814   1.00 0.00 ? 147 PHE A CE1  4  
ATOM 6136  C CE2  . PHE A 1 124 ? 13.521  11.876  2.010   1.00 0.00 ? 147 PHE A CE2  4  
ATOM 6137  C CZ   . PHE A 1 124 ? 14.459  12.787  2.522   1.00 0.00 ? 147 PHE A CZ   4  
ATOM 6138  H H    . PHE A 1 124 ? 11.859  7.971   6.727   1.00 0.00 ? 147 PHE A H    4  
ATOM 6139  H HA   . PHE A 1 124 ? 12.931  10.186  6.955   1.00 0.00 ? 147 PHE A HA   4  
ATOM 6140  H HB2  . PHE A 1 124 ? 13.917  8.855   5.332   1.00 0.00 ? 147 PHE A HB2  4  
ATOM 6141  H HB3  . PHE A 1 124 ? 12.457  8.815   4.351   1.00 0.00 ? 147 PHE A HB3  4  
ATOM 6142  H HD1  . PHE A 1 124 ? 14.964  11.379  5.601   1.00 0.00 ? 147 PHE A HD1  4  
ATOM 6143  H HD2  . PHE A 1 124 ? 12.421  10.079  2.350   1.00 0.00 ? 147 PHE A HD2  4  
ATOM 6144  H HE1  . PHE A 1 124 ? 15.690  13.301  4.202   1.00 0.00 ? 147 PHE A HE1  4  
ATOM 6145  H HE2  . PHE A 1 124 ? 13.112  11.999  1.017   1.00 0.00 ? 147 PHE A HE2  4  
ATOM 6146  H HZ   . PHE A 1 124 ? 14.788  13.629  1.925   1.00 0.00 ? 147 PHE A HZ   4  
ATOM 6147  N N    . TRP A 1 125 ? 10.693  11.257  4.742   1.00 0.00 ? 148 TRP A N    4  
ATOM 6148  C CA   . TRP A 1 125 ? 9.905   12.339  4.174   1.00 0.00 ? 148 TRP A CA   4  
ATOM 6149  C C    . TRP A 1 125 ? 8.668   12.574  5.055   1.00 0.00 ? 148 TRP A C    4  
ATOM 6150  O O    . TRP A 1 125 ? 7.509   12.514  4.635   1.00 0.00 ? 148 TRP A O    4  
ATOM 6151  C CB   . TRP A 1 125 ? 9.552   11.888  2.752   1.00 0.00 ? 148 TRP A CB   4  
ATOM 6152  C CG   . TRP A 1 125 ? 8.927   10.526  2.609   1.00 0.00 ? 148 TRP A CG   4  
ATOM 6153  C CD1  . TRP A 1 125 ? 9.541   9.323   2.744   1.00 0.00 ? 148 TRP A CD1  4  
ATOM 6154  C CD2  . TRP A 1 125 ? 7.551   10.219  2.246   1.00 0.00 ? 148 TRP A CD2  4  
ATOM 6155  N NE1  . TRP A 1 125 ? 8.675   8.313   2.396   1.00 0.00 ? 148 TRP A NE1  4  
ATOM 6156  C CE2  . TRP A 1 125 ? 7.454   8.819   2.021   1.00 0.00 ? 148 TRP A CE2  4  
ATOM 6157  C CE3  . TRP A 1 125 ? 6.372   10.974  2.078   1.00 0.00 ? 148 TRP A CE3  4  
ATOM 6158  C CZ2  . TRP A 1 125 ? 6.290   8.226   1.533   1.00 0.00 ? 148 TRP A CZ2  4  
ATOM 6159  C CZ3  . TRP A 1 125 ? 5.183   10.382  1.631   1.00 0.00 ? 148 TRP A CZ3  4  
ATOM 6160  C CH2  . TRP A 1 125 ? 5.147   9.009   1.326   1.00 0.00 ? 148 TRP A CH2  4  
ATOM 6161  H H    . TRP A 1 125 ? 10.539  10.368  4.291   1.00 0.00 ? 148 TRP A H    4  
ATOM 6162  H HA   . TRP A 1 125 ? 10.497  13.255  4.130   1.00 0.00 ? 148 TRP A HA   4  
ATOM 6163  H HB2  . TRP A 1 125 ? 8.881   12.620  2.306   1.00 0.00 ? 148 TRP A HB2  4  
ATOM 6164  H HB3  . TRP A 1 125 ? 10.459  11.899  2.147   1.00 0.00 ? 148 TRP A HB3  4  
ATOM 6165  H HD1  . TRP A 1 125 ? 10.572  9.135   3.004   1.00 0.00 ? 148 TRP A HD1  4  
ATOM 6166  H HE1  . TRP A 1 125 ? 8.973   7.348   2.301   1.00 0.00 ? 148 TRP A HE1  4  
ATOM 6167  H HE3  . TRP A 1 125 ? 6.363   12.018  2.337   1.00 0.00 ? 148 TRP A HE3  4  
ATOM 6168  H HZ2  . TRP A 1 125 ? 6.273   7.162   1.371   1.00 0.00 ? 148 TRP A HZ2  4  
ATOM 6169  H HZ3  . TRP A 1 125 ? 4.305   11.003  1.543   1.00 0.00 ? 148 TRP A HZ3  4  
ATOM 6170  H HH2  . TRP A 1 125 ? 4.244   8.527   0.986   1.00 0.00 ? 148 TRP A HH2  4  
ATOM 6171  N N    . LEU A 1 126 ? 8.953   12.802  6.328   1.00 0.00 ? 149 LEU A N    4  
ATOM 6172  C CA   . LEU A 1 126 ? 8.064   12.617  7.452   1.00 0.00 ? 149 LEU A CA   4  
ATOM 6173  C C    . LEU A 1 126 ? 7.058   13.753  7.491   1.00 0.00 ? 149 LEU A C    4  
ATOM 6174  O O    . LEU A 1 126 ? 7.447   14.923  7.494   1.00 0.00 ? 149 LEU A O    4  
ATOM 6175  C CB   . LEU A 1 126 ? 8.938   12.562  8.704   1.00 0.00 ? 149 LEU A CB   4  
ATOM 6176  C CG   . LEU A 1 126 ? 8.450   11.703  9.872   1.00 0.00 ? 149 LEU A CG   4  
ATOM 6177  C CD1  . LEU A 1 126 ? 6.991   11.924  10.248  1.00 0.00 ? 149 LEU A CD1  4  
ATOM 6178  C CD2  . LEU A 1 126 ? 8.820   10.245  9.617   1.00 0.00 ? 149 LEU A CD2  4  
ATOM 6179  H H    . LEU A 1 126 ? 9.942   12.829  6.541   1.00 0.00 ? 149 LEU A H    4  
ATOM 6180  H HA   . LEU A 1 126 ? 7.562   11.665  7.325   1.00 0.00 ? 149 LEU A HA   4  
ATOM 6181  H HB2  . LEU A 1 126 ? 9.880   12.130  8.393   1.00 0.00 ? 149 LEU A HB2  4  
ATOM 6182  H HB3  . LEU A 1 126 ? 9.135   13.572  9.048   1.00 0.00 ? 149 LEU A HB3  4  
ATOM 6183  H HG   . LEU A 1 126 ? 9.016   11.997  10.740  1.00 0.00 ? 149 LEU A HG   4  
ATOM 6184  H HD11 . LEU A 1 126 ? 6.737   11.242  11.057  1.00 0.00 ? 149 LEU A HD11 4  
ATOM 6185  H HD12 . LEU A 1 126 ? 6.844   12.947  10.585  1.00 0.00 ? 149 LEU A HD12 4  
ATOM 6186  H HD13 . LEU A 1 126 ? 6.328   11.722  9.418   1.00 0.00 ? 149 LEU A HD13 4  
ATOM 6187  H HD21 . LEU A 1 126 ? 8.255   9.851   8.780   1.00 0.00 ? 149 LEU A HD21 4  
ATOM 6188  H HD22 . LEU A 1 126 ? 9.881   10.160  9.385   1.00 0.00 ? 149 LEU A HD22 4  
ATOM 6189  H HD23 . LEU A 1 126 ? 8.607   9.669   10.508  1.00 0.00 ? 149 LEU A HD23 4  
ATOM 6190  N N    . GLU A 1 127 ? 5.768   13.434  7.514   1.00 0.00 ? 150 GLU A N    4  
ATOM 6191  C CA   . GLU A 1 127 ? 4.711   14.397  7.705   1.00 0.00 ? 150 GLU A CA   4  
ATOM 6192  C C    . GLU A 1 127 ? 4.749   14.867  9.169   1.00 0.00 ? 150 GLU A C    4  
ATOM 6193  O O    . GLU A 1 127 ? 4.088   14.302  10.044  1.00 0.00 ? 150 GLU A O    4  
ATOM 6194  C CB   . GLU A 1 127 ? 3.383   13.747  7.285   1.00 0.00 ? 150 GLU A CB   4  
ATOM 6195  C CG   . GLU A 1 127 ? 3.095   13.935  5.783   1.00 0.00 ? 150 GLU A CG   4  
ATOM 6196  C CD   . GLU A 1 127 ? 1.670   13.532  5.374   1.00 0.00 ? 150 GLU A CD   4  
ATOM 6197  O OE1  . GLU A 1 127 ? 0.698   14.211  5.785   1.00 0.00 ? 150 GLU A OE1  4  
ATOM 6198  O OE2  . GLU A 1 127 ? 1.507   12.564  4.594   1.00 0.00 ? 150 GLU A OE2  4  
ATOM 6199  H H    . GLU A 1 127 ? 5.465   12.475  7.594   1.00 0.00 ? 150 GLU A H    4  
ATOM 6200  H HA   . GLU A 1 127 ? 4.895   15.266  7.071   1.00 0.00 ? 150 GLU A HA   4  
ATOM 6201  H HB2  . GLU A 1 127 ? 3.384   12.686  7.532   1.00 0.00 ? 150 GLU A HB2  4  
ATOM 6202  H HB3  . GLU A 1 127 ? 2.604   14.202  7.868   1.00 0.00 ? 150 GLU A HB3  4  
ATOM 6203  H HG2  . GLU A 1 127 ? 3.236   14.984  5.520   1.00 0.00 ? 150 GLU A HG2  4  
ATOM 6204  H HG3  . GLU A 1 127 ? 3.821   13.356  5.210   1.00 0.00 ? 150 GLU A HG3  4  
ATOM 6205  N N    . ALA A 1 29  ? 1.688   -15.797 -4.758  1.00 0.00 ? 52  ALA A N    5  
ATOM 6206  C CA   . ALA A 1 29  ? 1.602   -14.636 -5.629  1.00 0.00 ? 52  ALA A CA   5  
ATOM 6207  C C    . ALA A 1 29  ? 1.280   -13.379 -4.819  1.00 0.00 ? 52  ALA A C    5  
ATOM 6208  O O    . ALA A 1 29  ? 1.502   -12.261 -5.279  1.00 0.00 ? 52  ALA A O    5  
ATOM 6209  C CB   . ALA A 1 29  ? 0.535   -14.879 -6.691  1.00 0.00 ? 52  ALA A CB   5  
ATOM 6210  H H    . ALA A 1 29  ? 0.872   -16.381 -4.648  1.00 0.00 ? 52  ALA A H    5  
ATOM 6211  H HA   . ALA A 1 29  ? 2.565   -14.498 -6.117  1.00 0.00 ? 52  ALA A HA   5  
ATOM 6212  H HB1  . ALA A 1 29  ? 0.771   -15.776 -7.264  1.00 0.00 ? 52  ALA A HB1  5  
ATOM 6213  H HB2  . ALA A 1 29  ? -0.438  -14.989 -6.216  1.00 0.00 ? 52  ALA A HB2  5  
ATOM 6214  H HB3  . ALA A 1 29  ? 0.510   -14.023 -7.361  1.00 0.00 ? 52  ALA A HB3  5  
ATOM 6215  N N    . GLU A 1 30  ? 0.790   -13.556 -3.592  1.00 0.00 ? 53  GLU A N    5  
ATOM 6216  C CA   . GLU A 1 30  ? 0.498   -12.459 -2.683  1.00 0.00 ? 53  GLU A CA   5  
ATOM 6217  C C    . GLU A 1 30  ? 1.804   -11.831 -2.169  1.00 0.00 ? 53  GLU A C    5  
ATOM 6218  O O    . GLU A 1 30  ? 1.841   -10.661 -1.824  1.00 0.00 ? 53  GLU A O    5  
ATOM 6219  C CB   . GLU A 1 30  ? -0.405  -12.941 -1.537  1.00 0.00 ? 53  GLU A CB   5  
ATOM 6220  C CG   . GLU A 1 30  ? -1.563  -13.831 -2.042  1.00 0.00 ? 53  GLU A CG   5  
ATOM 6221  C CD   . GLU A 1 30  ? -2.700  -14.010 -1.036  1.00 0.00 ? 53  GLU A CD   5  
ATOM 6222  O OE1  . GLU A 1 30  ? -2.512  -13.719 0.164   1.00 0.00 ? 53  GLU A OE1  5  
ATOM 6223  O OE2  . GLU A 1 30  ? -3.817  -14.425 -1.447  1.00 0.00 ? 53  GLU A OE2  5  
ATOM 6224  H H    . GLU A 1 30  ? 0.627   -14.492 -3.258  1.00 0.00 ? 53  GLU A H    5  
ATOM 6225  H HA   . GLU A 1 30  ? -0.049  -11.704 -3.243  1.00 0.00 ? 53  GLU A HA   5  
ATOM 6226  H HB2  . GLU A 1 30  ? 0.190   -13.508 -0.822  1.00 0.00 ? 53  GLU A HB2  5  
ATOM 6227  H HB3  . GLU A 1 30  ? -0.815  -12.060 -1.039  1.00 0.00 ? 53  GLU A HB3  5  
ATOM 6228  H HG2  . GLU A 1 30  ? -1.975  -13.381 -2.944  1.00 0.00 ? 53  GLU A HG2  5  
ATOM 6229  H HG3  . GLU A 1 30  ? -1.174  -14.816 -2.318  1.00 0.00 ? 53  GLU A HG3  5  
ATOM 6230  N N    . ASN A 1 31  ? 2.915   -12.571 -2.207  1.00 0.00 ? 54  ASN A N    5  
ATOM 6231  C CA   . ASN A 1 31  ? 4.240   -12.151 -1.746  1.00 0.00 ? 54  ASN A CA   5  
ATOM 6232  C C    . ASN A 1 31  ? 4.851   -10.996 -2.539  1.00 0.00 ? 54  ASN A C    5  
ATOM 6233  O O    . ASN A 1 31  ? 5.965   -10.550 -2.238  1.00 0.00 ? 54  ASN A O    5  
ATOM 6234  C CB   . ASN A 1 31  ? 5.202   -13.346 -1.843  1.00 0.00 ? 54  ASN A CB   5  
ATOM 6235  C CG   . ASN A 1 31  ? 5.712   -13.697 -0.473  1.00 0.00 ? 54  ASN A CG   5  
ATOM 6236  O OD1  . ASN A 1 31  ? 6.667   -13.095 0.012   1.00 0.00 ? 54  ASN A OD1  5  
ATOM 6237  N ND2  . ASN A 1 31  ? 5.091   -14.667 0.158   1.00 0.00 ? 54  ASN A ND2  5  
ATOM 6238  H H    . ASN A 1 31  ? 2.799   -13.541 -2.475  1.00 0.00 ? 54  ASN A H    5  
ATOM 6239  H HA   . ASN A 1 31  ? 4.149   -11.834 -0.705  1.00 0.00 ? 54  ASN A HA   5  
ATOM 6240  H HB2  . ASN A 1 31  ? 4.720   -14.214 -2.281  1.00 0.00 ? 54  ASN A HB2  5  
ATOM 6241  H HB3  . ASN A 1 31  ? 6.053   -13.112 -2.481  1.00 0.00 ? 54  ASN A HB3  5  
ATOM 6242  H HD21 . ASN A 1 31  ? 4.260   -15.094 -0.252  1.00 0.00 ? 54  ASN A HD21 5  
ATOM 6243  H HD22 . ASN A 1 31  ? 5.409   -14.873 1.101   1.00 0.00 ? 54  ASN A HD22 5  
ATOM 6244  N N    . ARG A 1 32  ? 4.191   -10.589 -3.617  1.00 0.00 ? 55  ARG A N    5  
ATOM 6245  C CA   . ARG A 1 32  ? 4.721   -9.713  -4.637  1.00 0.00 ? 55  ARG A CA   5  
ATOM 6246  C C    . ARG A 1 32  ? 4.796   -8.275  -4.165  1.00 0.00 ? 55  ARG A C    5  
ATOM 6247  O O    . ARG A 1 32  ? 3.925   -7.809  -3.429  1.00 0.00 ? 55  ARG A O    5  
ATOM 6248  C CB   . ARG A 1 32  ? 3.778   -9.802  -5.830  1.00 0.00 ? 55  ARG A CB   5  
ATOM 6249  C CG   . ARG A 1 32  ? 4.062   -11.020 -6.699  1.00 0.00 ? 55  ARG A CG   5  
ATOM 6250  C CD   . ARG A 1 32  ? 3.281   -10.939 -8.012  1.00 0.00 ? 55  ARG A CD   5  
ATOM 6251  N NE   . ARG A 1 32  ? 4.153   -10.371 -9.051  1.00 0.00 ? 55  ARG A NE   5  
ATOM 6252  C CZ   . ARG A 1 32  ? 5.081   -11.064 -9.728  1.00 0.00 ? 55  ARG A CZ   5  
ATOM 6253  N NH1  . ARG A 1 32  ? 5.113   -12.393 -9.671  1.00 0.00 ? 55  ARG A NH1  5  
ATOM 6254  N NH2  . ARG A 1 32  ? 5.993   -10.412 -10.440 1.00 0.00 ? 55  ARG A NH2  5  
ATOM 6255  H H    . ARG A 1 32  ? 3.242   -10.922 -3.736  1.00 0.00 ? 55  ARG A H    5  
ATOM 6256  H HA   . ARG A 1 32  ? 5.721   -10.047 -4.907  1.00 0.00 ? 55  ARG A HA   5  
ATOM 6257  H HB2  . ARG A 1 32  ? 2.785   -9.903  -5.452  1.00 0.00 ? 55  ARG A HB2  5  
ATOM 6258  H HB3  . ARG A 1 32  ? 3.761   -8.882  -6.398  1.00 0.00 ? 55  ARG A HB3  5  
ATOM 6259  H HG2  . ARG A 1 32  ? 5.128   -11.068 -6.907  1.00 0.00 ? 55  ARG A HG2  5  
ATOM 6260  H HG3  . ARG A 1 32  ? 3.781   -11.916 -6.152  1.00 0.00 ? 55  ARG A HG3  5  
ATOM 6261  H HD2  . ARG A 1 32  ? 2.945   -11.936 -8.299  1.00 0.00 ? 55  ARG A HD2  5  
ATOM 6262  H HD3  . ARG A 1 32  ? 2.395   -10.314 -7.881  1.00 0.00 ? 55  ARG A HD3  5  
ATOM 6263  H HE   . ARG A 1 32  ? 4.080   -9.364  -9.166  1.00 0.00 ? 55  ARG A HE   5  
ATOM 6264  H HH11 . ARG A 1 32  ? 4.428   -12.921 -9.151  1.00 0.00 ? 55  ARG A HH11 5  
ATOM 6265  H HH12 . ARG A 1 32  ? 5.739   -12.952 -10.249 1.00 0.00 ? 55  ARG A HH12 5  
ATOM 6266  H HH21 . ARG A 1 32  ? 5.998   -9.394  -10.426 1.00 0.00 ? 55  ARG A HH21 5  
ATOM 6267  H HH22 . ARG A 1 32  ? 6.678   -10.844 -11.052 1.00 0.00 ? 55  ARG A HH22 5  
ATOM 6268  N N    . PRO A 1 33  ? 5.738   -7.501  -4.711  1.00 0.00 ? 56  PRO A N    5  
ATOM 6269  C CA   . PRO A 1 33  ? 5.696   -6.071  -4.556  1.00 0.00 ? 56  PRO A CA   5  
ATOM 6270  C C    . PRO A 1 33  ? 4.412   -5.620  -5.252  1.00 0.00 ? 56  PRO A C    5  
ATOM 6271  O O    . PRO A 1 33  ? 4.187   -5.940  -6.421  1.00 0.00 ? 56  PRO A O    5  
ATOM 6272  C CB   . PRO A 1 33  ? 6.976   -5.547  -5.200  1.00 0.00 ? 56  PRO A CB   5  
ATOM 6273  C CG   . PRO A 1 33  ? 7.461   -6.655  -6.134  1.00 0.00 ? 56  PRO A CG   5  
ATOM 6274  C CD   . PRO A 1 33  ? 6.662   -7.900  -5.756  1.00 0.00 ? 56  PRO A CD   5  
ATOM 6275  H HA   . PRO A 1 33  ? 5.677   -5.811  -3.496  1.00 0.00 ? 56  PRO A HA   5  
ATOM 6276  H HB2  . PRO A 1 33  ? 6.788   -4.639  -5.760  1.00 0.00 ? 56  PRO A HB2  5  
ATOM 6277  H HB3  . PRO A 1 33  ? 7.725   -5.371  -4.426  1.00 0.00 ? 56  PRO A HB3  5  
ATOM 6278  H HG2  . PRO A 1 33  ? 7.251   -6.387  -7.167  1.00 0.00 ? 56  PRO A HG2  5  
ATOM 6279  H HG3  . PRO A 1 33  ? 8.526   -6.813  -5.999  1.00 0.00 ? 56  PRO A HG3  5  
ATOM 6280  H HD2  . PRO A 1 33  ? 6.110   -8.248  -6.631  1.00 0.00 ? 56  PRO A HD2  5  
ATOM 6281  H HD3  . PRO A 1 33  ? 7.292   -8.703  -5.385  1.00 0.00 ? 56  PRO A HD3  5  
ATOM 6282  N N    . GLY A 1 34  ? 3.538   -4.921  -4.535  1.00 0.00 ? 57  GLY A N    5  
ATOM 6283  C CA   . GLY A 1 34  ? 2.297   -4.432  -5.111  1.00 0.00 ? 57  GLY A CA   5  
ATOM 6284  C C    . GLY A 1 34  ? 1.126   -5.402  -5.010  1.00 0.00 ? 57  GLY A C    5  
ATOM 6285  O O    . GLY A 1 34  ? 0.028   -4.980  -5.354  1.00 0.00 ? 57  GLY A O    5  
ATOM 6286  H H    . GLY A 1 34  ? 3.698   -4.789  -3.548  1.00 0.00 ? 57  GLY A H    5  
ATOM 6287  H HA2  . GLY A 1 34  ? 2.008   -3.504  -4.633  1.00 0.00 ? 57  GLY A HA2  5  
ATOM 6288  H HA3  . GLY A 1 34  ? 2.452   -4.209  -6.164  1.00 0.00 ? 57  GLY A HA3  5  
ATOM 6289  N N    . ALA A 1 35  ? 1.301   -6.649  -4.560  1.00 0.00 ? 58  ALA A N    5  
ATOM 6290  C CA   . ALA A 1 35  ? 0.172   -7.566  -4.445  1.00 0.00 ? 58  ALA A CA   5  
ATOM 6291  C C    . ALA A 1 35  ? -0.897  -7.058  -3.459  1.00 0.00 ? 58  ALA A C    5  
ATOM 6292  O O    . ALA A 1 35  ? -0.595  -6.305  -2.527  1.00 0.00 ? 58  ALA A O    5  
ATOM 6293  C CB   . ALA A 1 35  ? 0.682   -8.952  -4.077  1.00 0.00 ? 58  ALA A CB   5  
ATOM 6294  H H    . ALA A 1 35  ? 2.209   -7.004  -4.281  1.00 0.00 ? 58  ALA A H    5  
ATOM 6295  H HA   . ALA A 1 35  ? -0.285  -7.647  -5.429  1.00 0.00 ? 58  ALA A HA   5  
ATOM 6296  H HB1  . ALA A 1 35  ? 1.621   -8.885  -3.530  1.00 0.00 ? 58  ALA A HB1  5  
ATOM 6297  H HB2  . ALA A 1 35  ? -0.049  -9.478  -3.464  1.00 0.00 ? 58  ALA A HB2  5  
ATOM 6298  H HB3  . ALA A 1 35  ? 0.850   -9.503  -5.002  1.00 0.00 ? 58  ALA A HB3  5  
ATOM 6299  N N    . PHE A 1 36  ? -2.143  -7.497  -3.657  1.00 0.00 ? 59  PHE A N    5  
ATOM 6300  C CA   . PHE A 1 36  ? -3.347  -6.964  -3.028  1.00 0.00 ? 59  PHE A CA   5  
ATOM 6301  C C    . PHE A 1 36  ? -3.702  -7.810  -1.795  1.00 0.00 ? 59  PHE A C    5  
ATOM 6302  O O    . PHE A 1 36  ? -4.030  -8.983  -1.960  1.00 0.00 ? 59  PHE A O    5  
ATOM 6303  C CB   . PHE A 1 36  ? -4.528  -6.967  -4.042  1.00 0.00 ? 59  PHE A CB   5  
ATOM 6304  C CG   . PHE A 1 36  ? -4.751  -5.745  -4.937  1.00 0.00 ? 59  PHE A CG   5  
ATOM 6305  C CD1  . PHE A 1 36  ? -3.894  -4.626  -4.883  1.00 0.00 ? 59  PHE A CD1  5  
ATOM 6306  C CD2  . PHE A 1 36  ? -5.879  -5.690  -5.792  1.00 0.00 ? 59  PHE A CD2  5  
ATOM 6307  C CE1  . PHE A 1 36  ? -4.205  -3.456  -5.591  1.00 0.00 ? 59  PHE A CE1  5  
ATOM 6308  C CE2  . PHE A 1 36  ? -6.171  -4.518  -6.519  1.00 0.00 ? 59  PHE A CE2  5  
ATOM 6309  C CZ   . PHE A 1 36  ? -5.344  -3.391  -6.401  1.00 0.00 ? 59  PHE A CZ   5  
ATOM 6310  H H    . PHE A 1 36  ? -2.276  -8.131  -4.433  1.00 0.00 ? 59  PHE A H    5  
ATOM 6311  H HA   . PHE A 1 36  ? -3.129  -5.946  -2.727  1.00 0.00 ? 59  PHE A HA   5  
ATOM 6312  H HB2  . PHE A 1 36  ? -4.459  -7.857  -4.670  1.00 0.00 ? 59  PHE A HB2  5  
ATOM 6313  H HB3  . PHE A 1 36  ? -5.447  -7.067  -3.470  1.00 0.00 ? 59  PHE A HB3  5  
ATOM 6314  H HD1  . PHE A 1 36  ? -2.988  -4.627  -4.300  1.00 0.00 ? 59  PHE A HD1  5  
ATOM 6315  H HD2  . PHE A 1 36  ? -6.560  -6.527  -5.913  1.00 0.00 ? 59  PHE A HD2  5  
ATOM 6316  H HE1  . PHE A 1 36  ? -3.556  -2.600  -5.518  1.00 0.00 ? 59  PHE A HE1  5  
ATOM 6317  H HE2  . PHE A 1 36  ? -7.045  -4.473  -7.157  1.00 0.00 ? 59  PHE A HE2  5  
ATOM 6318  H HZ   . PHE A 1 36  ? -5.573  -2.469  -6.915  1.00 0.00 ? 59  PHE A HZ   5  
ATOM 6319  N N    . ILE A 1 37  ? -3.663  -7.252  -0.574  1.00 0.00 ? 60  ILE A N    5  
ATOM 6320  C CA   . ILE A 1 37  ? -4.046  -7.985  0.649   1.00 0.00 ? 60  ILE A CA   5  
ATOM 6321  C C    . ILE A 1 37  ? -5.530  -8.413  0.614   1.00 0.00 ? 60  ILE A C    5  
ATOM 6322  O O    . ILE A 1 37  ? -5.851  -9.522  1.030   1.00 0.00 ? 60  ILE A O    5  
ATOM 6323  C CB   . ILE A 1 37  ? -3.666  -7.161  1.909   1.00 0.00 ? 60  ILE A CB   5  
ATOM 6324  C CG1  . ILE A 1 37  ? -2.133  -7.167  2.108   1.00 0.00 ? 60  ILE A CG1  5  
ATOM 6325  C CG2  . ILE A 1 37  ? -4.375  -7.650  3.177   1.00 0.00 ? 60  ILE A CG2  5  
ATOM 6326  C CD1  . ILE A 1 37  ? -1.619  -6.359  3.306   1.00 0.00 ? 60  ILE A CD1  5  
ATOM 6327  H H    . ILE A 1 37  ? -3.290  -6.313  -0.469  1.00 0.00 ? 60  ILE A H    5  
ATOM 6328  H HA   . ILE A 1 37  ? -3.471  -8.912  0.685   1.00 0.00 ? 60  ILE A HA   5  
ATOM 6329  H HB   . ILE A 1 37  ? -3.994  -6.139  1.749   1.00 0.00 ? 60  ILE A HB   5  
ATOM 6330  H HG12 . ILE A 1 37  ? -1.797  -8.197  2.235   1.00 0.00 ? 60  ILE A HG12 5  
ATOM 6331  H HG13 . ILE A 1 37  ? -1.660  -6.760  1.215   1.00 0.00 ? 60  ILE A HG13 5  
ATOM 6332  H HG21 . ILE A 1 37  ? -4.107  -8.688  3.383   1.00 0.00 ? 60  ILE A HG21 5  
ATOM 6333  H HG22 . ILE A 1 37  ? -4.115  -7.034  4.038   1.00 0.00 ? 60  ILE A HG22 5  
ATOM 6334  H HG23 . ILE A 1 37  ? -5.448  -7.570  3.035   1.00 0.00 ? 60  ILE A HG23 5  
ATOM 6335  H HD11 . ILE A 1 37  ? -1.824  -6.889  4.236   1.00 0.00 ? 60  ILE A HD11 5  
ATOM 6336  H HD12 . ILE A 1 37  ? -0.541  -6.226  3.212   1.00 0.00 ? 60  ILE A HD12 5  
ATOM 6337  H HD13 . ILE A 1 37  ? -2.096  -5.382  3.338   1.00 0.00 ? 60  ILE A HD13 5  
ATOM 6338  N N    . LYS A 1 38  ? -6.429  -7.562  0.098   1.00 0.00 ? 61  LYS A N    5  
ATOM 6339  C CA   . LYS A 1 38  ? -7.793  -7.914  -0.310  1.00 0.00 ? 61  LYS A CA   5  
ATOM 6340  C C    . LYS A 1 38  ? -8.585  -8.745  0.718   1.00 0.00 ? 61  LYS A C    5  
ATOM 6341  O O    . LYS A 1 38  ? -9.252  -9.713  0.353   1.00 0.00 ? 61  LYS A O    5  
ATOM 6342  C CB   . LYS A 1 38  ? -7.686  -8.556  -1.713  1.00 0.00 ? 61  LYS A CB   5  
ATOM 6343  C CG   . LYS A 1 38  ? -8.707  -8.077  -2.751  1.00 0.00 ? 61  LYS A CG   5  
ATOM 6344  C CD   . LYS A 1 38  ? -10.179 -8.415  -2.475  1.00 0.00 ? 61  LYS A CD   5  
ATOM 6345  C CE   . LYS A 1 38  ? -10.588 -9.830  -2.913  1.00 0.00 ? 61  LYS A CE   5  
ATOM 6346  N NZ   . LYS A 1 38  ? -10.002 -10.906 -2.086  1.00 0.00 ? 61  LYS A NZ   5  
ATOM 6347  H H    . LYS A 1 38  ? -6.076  -6.702  -0.279  1.00 0.00 ? 61  LYS A H    5  
ATOM 6348  H HA   . LYS A 1 38  ? -8.349  -6.987  -0.402  1.00 0.00 ? 61  LYS A HA   5  
ATOM 6349  H HB2  . LYS A 1 38  ? -6.713  -8.315  -2.136  1.00 0.00 ? 61  LYS A HB2  5  
ATOM 6350  H HB3  . LYS A 1 38  ? -7.704  -9.635  -1.624  1.00 0.00 ? 61  LYS A HB3  5  
ATOM 6351  H HG2  . LYS A 1 38  ? -8.609  -6.999  -2.845  1.00 0.00 ? 61  LYS A HG2  5  
ATOM 6352  H HG3  . LYS A 1 38  ? -8.427  -8.494  -3.714  1.00 0.00 ? 61  LYS A HG3  5  
ATOM 6353  H HD2  . LYS A 1 38  ? -10.412 -8.242  -1.425  1.00 0.00 ? 61  LYS A HD2  5  
ATOM 6354  H HD3  . LYS A 1 38  ? -10.784 -7.719  -3.057  1.00 0.00 ? 61  LYS A HD3  5  
ATOM 6355  H HE2  . LYS A 1 38  ? -11.676 -9.900  -2.849  1.00 0.00 ? 61  LYS A HE2  5  
ATOM 6356  H HE3  . LYS A 1 38  ? -10.284 -9.972  -3.956  1.00 0.00 ? 61  LYS A HE3  5  
ATOM 6357  H HZ1  . LYS A 1 38  ? -9.005  -11.009 -2.264  1.00 0.00 ? 61  LYS A HZ1  5  
ATOM 6358  H HZ2  . LYS A 1 38  ? -10.105 -10.733 -1.090  1.00 0.00 ? 61  LYS A HZ2  5  
ATOM 6359  H HZ3  . LYS A 1 38  ? -10.381 -11.816 -2.328  1.00 0.00 ? 61  LYS A HZ3  5  
ATOM 6360  N N    . GLN A 1 39  ? -8.567  -8.326  1.988   1.00 0.00 ? 62  GLN A N    5  
ATOM 6361  C CA   . GLN A 1 39  ? -9.210  -9.033  3.103   1.00 0.00 ? 62  GLN A CA   5  
ATOM 6362  C C    . GLN A 1 39  ? -10.744 -9.100  3.014   1.00 0.00 ? 62  GLN A C    5  
ATOM 6363  O O    . GLN A 1 39  ? -11.377 -9.755  3.840   1.00 0.00 ? 62  GLN A O    5  
ATOM 6364  C CB   . GLN A 1 39  ? -8.789  -8.396  4.438   1.00 0.00 ? 62  GLN A CB   5  
ATOM 6365  C CG   . GLN A 1 39  ? -7.299  -8.654  4.716   1.00 0.00 ? 62  GLN A CG   5  
ATOM 6366  C CD   . GLN A 1 39  ? -7.032  -9.533  5.934   1.00 0.00 ? 62  GLN A CD   5  
ATOM 6367  O OE1  . GLN A 1 39  ? -7.460  -9.224  7.041   1.00 0.00 ? 62  GLN A OE1  5  
ATOM 6368  N NE2  . GLN A 1 39  ? -6.321  -10.638 5.776   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 6369  H H    . GLN A 1 39  ? -8.028  -7.507  2.213   1.00 0.00 ? 62  GLN A H    5  
ATOM 6370  H HA   . GLN A 1 39  ? -8.833  -10.054 3.107   1.00 0.00 ? 62  GLN A HA   5  
ATOM 6371  H HB2  . GLN A 1 39  ? -8.985  -7.321  4.413   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 6372  H HB3  . GLN A 1 39  ? -9.386  -8.810  5.251   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 6373  H HG2  . GLN A 1 39  ? -6.826  -9.108  3.847   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 6374  H HG3  . GLN A 1 39  ? -6.829  -7.696  4.881   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 6375  H HE21 . GLN A 1 39  ? -5.884  -10.852 4.871   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 6376  H HE22 . GLN A 1 39  ? -6.130  -11.250 6.562   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 6377  N N    . GLY A 1 40  ? -11.383 -8.395  2.079   1.00 0.00 ? 63  GLY A N    5  
ATOM 6378  C CA   . GLY A 1 40  ? -12.836 -8.366  1.976   1.00 0.00 ? 63  GLY A CA   5  
ATOM 6379  C C    . GLY A 1 40  ? -13.475 -7.382  2.959   1.00 0.00 ? 63  GLY A C    5  
ATOM 6380  O O    . GLY A 1 40  ? -14.687 -7.426  3.167   1.00 0.00 ? 63  GLY A O    5  
ATOM 6381  H H    . GLY A 1 40  ? -10.866 -7.772  1.474   1.00 0.00 ? 63  GLY A H    5  
ATOM 6382  H HA2  . GLY A 1 40  ? -13.106 -8.099  0.959   1.00 0.00 ? 63  GLY A HA2  5  
ATOM 6383  H HA3  . GLY A 1 40  ? -13.234 -9.360  2.177   1.00 0.00 ? 63  GLY A HA3  5  
ATOM 6384  N N    . ARG A 1 41  ? -12.678 -6.517  3.591   1.00 0.00 ? 64  ARG A N    5  
ATOM 6385  C CA   . ARG A 1 41  ? -13.127 -5.568  4.611   1.00 0.00 ? 64  ARG A CA   5  
ATOM 6386  C C    . ARG A 1 41  ? -13.610 -4.256  3.998   1.00 0.00 ? 64  ARG A C    5  
ATOM 6387  O O    . ARG A 1 41  ? -13.305 -3.960  2.839   1.00 0.00 ? 64  ARG A O    5  
ATOM 6388  C CB   . ARG A 1 41  ? -12.019 -5.327  5.646   1.00 0.00 ? 64  ARG A CB   5  
ATOM 6389  C CG   . ARG A 1 41  ? -10.819 -4.619  5.028   1.00 0.00 ? 64  ARG A CG   5  
ATOM 6390  C CD   . ARG A 1 41  ? -9.557  -4.690  5.883   1.00 0.00 ? 64  ARG A CD   5  
ATOM 6391  N NE   . ARG A 1 41  ? -9.761  -4.381  7.303   1.00 0.00 ? 64  ARG A NE   5  
ATOM 6392  C CZ   . ARG A 1 41  ? -8.794  -4.458  8.229   1.00 0.00 ? 64  ARG A CZ   5  
ATOM 6393  N NH1  . ARG A 1 41  ? -7.584  -4.910  7.920   1.00 0.00 ? 64  ARG A NH1  5  
ATOM 6394  N NH2  . ARG A 1 41  ? -9.029  -4.100  9.483   1.00 0.00 ? 64  ARG A NH2  5  
ATOM 6395  H H    . ARG A 1 41  ? -11.727 -6.456  3.260   1.00 0.00 ? 64  ARG A H    5  
ATOM 6396  H HA   . ARG A 1 41  ? -13.957 -6.015  5.140   1.00 0.00 ? 64  ARG A HA   5  
ATOM 6397  H HB2  . ARG A 1 41  ? -12.397 -4.672  6.430   1.00 0.00 ? 64  ARG A HB2  5  
ATOM 6398  H HB3  . ARG A 1 41  ? -11.715 -6.283  6.079   1.00 0.00 ? 64  ARG A HB3  5  
ATOM 6399  H HG2  . ARG A 1 41  ? -10.609 -5.082  4.068   1.00 0.00 ? 64  ARG A HG2  5  
ATOM 6400  H HG3  . ARG A 1 41  ? -11.076 -3.574  4.865   1.00 0.00 ? 64  ARG A HG3  5  
ATOM 6401  H HD2  . ARG A 1 41  ? -9.118  -5.683  5.802   1.00 0.00 ? 64  ARG A HD2  5  
ATOM 6402  H HD3  . ARG A 1 41  ? -8.873  -3.949  5.486   1.00 0.00 ? 64  ARG A HD3  5  
ATOM 6403  H HE   . ARG A 1 41  ? -10.695 -4.110  7.566   1.00 0.00 ? 64  ARG A HE   5  
ATOM 6404  H HH11 . ARG A 1 41  ? -7.306  -5.089  6.951   1.00 0.00 ? 64  ARG A HH11 5  
ATOM 6405  H HH12 . ARG A 1 41  ? -6.854  -4.940  8.628   1.00 0.00 ? 64  ARG A HH12 5  
ATOM 6406  H HH21 . ARG A 1 41  ? -9.803  -3.475  9.723   1.00 0.00 ? 64  ARG A HH21 5  
ATOM 6407  H HH22 . ARG A 1 41  ? -8.243  -4.120  10.129  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 6408  N N    . LYS A 1 42  ? -14.279 -3.439  4.810   1.00 0.00 ? 65  LYS A N    5  
ATOM 6409  C CA   . LYS A 1 42  ? -14.590 -2.045  4.545   1.00 0.00 ? 65  LYS A CA   5  
ATOM 6410  C C    . LYS A 1 42  ? -13.658 -1.217  5.423   1.00 0.00 ? 65  LYS A C    5  
ATOM 6411  O O    . LYS A 1 42  ? -13.764 -1.301  6.646   1.00 0.00 ? 65  LYS A O    5  
ATOM 6412  C CB   . LYS A 1 42  ? -16.066 -1.775  4.895   1.00 0.00 ? 65  LYS A CB   5  
ATOM 6413  C CG   . LYS A 1 42  ? -16.588 -0.518  4.188   1.00 0.00 ? 65  LYS A CG   5  
ATOM 6414  C CD   . LYS A 1 42  ? -17.896 0.027   4.772   1.00 0.00 ? 65  LYS A CD   5  
ATOM 6415  C CE   . LYS A 1 42  ? -18.989 -1.020  4.969   1.00 0.00 ? 65  LYS A CE   5  
ATOM 6416  N NZ   . LYS A 1 42  ? -20.062 -0.475  5.816   1.00 0.00 ? 65  LYS A NZ   5  
ATOM 6417  H H    . LYS A 1 42  ? -14.442 -3.734  5.772   1.00 0.00 ? 65  LYS A H    5  
ATOM 6418  H HA   . LYS A 1 42  ? -14.412 -1.815  3.496   1.00 0.00 ? 65  LYS A HA   5  
ATOM 6419  H HB2  . LYS A 1 42  ? -16.677 -2.624  4.593   1.00 0.00 ? 65  LYS A HB2  5  
ATOM 6420  H HB3  . LYS A 1 42  ? -16.174 -1.661  5.975   1.00 0.00 ? 65  LYS A HB3  5  
ATOM 6421  H HG2  . LYS A 1 42  ? -15.838 0.263   4.264   1.00 0.00 ? 65  LYS A HG2  5  
ATOM 6422  H HG3  . LYS A 1 42  ? -16.732 -0.722  3.133   1.00 0.00 ? 65  LYS A HG3  5  
ATOM 6423  H HD2  . LYS A 1 42  ? -17.663 0.499   5.729   1.00 0.00 ? 65  LYS A HD2  5  
ATOM 6424  H HD3  . LYS A 1 42  ? -18.293 0.779   4.091   1.00 0.00 ? 65  LYS A HD3  5  
ATOM 6425  H HE2  . LYS A 1 42  ? -19.394 -1.306  4.000   1.00 0.00 ? 65  LYS A HE2  5  
ATOM 6426  H HE3  . LYS A 1 42  ? -18.565 -1.899  5.444   1.00 0.00 ? 65  LYS A HE3  5  
ATOM 6427  H HZ1  . LYS A 1 42  ? -19.672 -0.107  6.679   1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 6428  H HZ2  . LYS A 1 42  ? -20.496 0.324   5.352   1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 6429  H HZ3  . LYS A 1 42  ? -20.753 -1.171  6.049   1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 6430  N N    . LEU A 1 43  ? -12.696 -0.491  4.850   1.00 0.00 ? 66  LEU A N    5  
ATOM 6431  C CA   . LEU A 1 43  ? -12.026 0.585   5.565   1.00 0.00 ? 66  LEU A CA   5  
ATOM 6432  C C    . LEU A 1 43  ? -12.923 1.821   5.543   1.00 0.00 ? 66  LEU A C    5  
ATOM 6433  O O    . LEU A 1 43  ? -14.077 1.799   5.120   1.00 0.00 ? 66  LEU A O    5  
ATOM 6434  C CB   . LEU A 1 43  ? -10.666 0.953   4.943   1.00 0.00 ? 66  LEU A CB   5  
ATOM 6435  C CG   . LEU A 1 43  ? -9.624  -0.145  4.780   1.00 0.00 ? 66  LEU A CG   5  
ATOM 6436  C CD1  . LEU A 1 43  ? -9.392  -0.973  6.049   1.00 0.00 ? 66  LEU A CD1  5  
ATOM 6437  C CD2  . LEU A 1 43  ? -9.929  -1.013  3.581   1.00 0.00 ? 66  LEU A CD2  5  
ATOM 6438  H H    . LEU A 1 43  ? -12.508 -0.526  3.856   1.00 0.00 ? 66  LEU A H    5  
ATOM 6439  H HA   . LEU A 1 43  ? -11.866 0.290   6.603   1.00 0.00 ? 66  LEU A HA   5  
ATOM 6440  H HB2  . LEU A 1 43  ? -10.840 1.424   3.976   1.00 0.00 ? 66  LEU A HB2  5  
ATOM 6441  H HB3  . LEU A 1 43  ? -10.180 1.697   5.577   1.00 0.00 ? 66  LEU A HB3  5  
ATOM 6442  H HG   . LEU A 1 43  ? -8.726  0.383   4.511   1.00 0.00 ? 66  LEU A HG   5  
ATOM 6443  H HD11 . LEU A 1 43  ? -10.283 -1.541  6.316   1.00 0.00 ? 66  LEU A HD11 5  
ATOM 6444  H HD12 . LEU A 1 43  ? -8.551  -1.649  5.901   1.00 0.00 ? 66  LEU A HD12 5  
ATOM 6445  H HD13 . LEU A 1 43  ? -9.143  -0.305  6.871   1.00 0.00 ? 66  LEU A HD13 5  
ATOM 6446  H HD21 . LEU A 1 43  ? -10.179 -0.326  2.769   1.00 0.00 ? 66  LEU A HD21 5  
ATOM 6447  H HD22 . LEU A 1 43  ? -9.045  -1.586  3.324   1.00 0.00 ? 66  LEU A HD22 5  
ATOM 6448  H HD23 . LEU A 1 43  ? -10.750 -1.688  3.804   1.00 0.00 ? 66  LEU A HD23 5  
ATOM 6449  N N    . ASP A 1 44  ? -12.333 2.920   5.973   1.00 0.00 ? 67  ASP A N    5  
ATOM 6450  C CA   . ASP A 1 44  ? -12.859 4.268   5.952   1.00 0.00 ? 67  ASP A CA   5  
ATOM 6451  C C    . ASP A 1 44  ? -11.767 5.142   5.339   1.00 0.00 ? 67  ASP A C    5  
ATOM 6452  O O    . ASP A 1 44  ? -10.770 5.471   5.990   1.00 0.00 ? 67  ASP A O    5  
ATOM 6453  C CB   . ASP A 1 44  ? -13.235 4.677   7.374   1.00 0.00 ? 67  ASP A CB   5  
ATOM 6454  C CG   . ASP A 1 44  ? -13.559 6.159   7.454   1.00 0.00 ? 67  ASP A CG   5  
ATOM 6455  O OD1  . ASP A 1 44  ? -14.570 6.588   6.859   1.00 0.00 ? 67  ASP A OD1  5  
ATOM 6456  O OD2  . ASP A 1 44  ? -12.836 6.863   8.198   1.00 0.00 ? 67  ASP A OD2  5  
ATOM 6457  H H    . ASP A 1 44  ? -11.350 2.800   6.187   1.00 0.00 ? 67  ASP A H    5  
ATOM 6458  H HA   . ASP A 1 44  ? -13.759 4.322   5.333   1.00 0.00 ? 67  ASP A HA   5  
ATOM 6459  H HB2  . ASP A 1 44  ? -14.102 4.102   7.702   1.00 0.00 ? 67  ASP A HB2  5  
ATOM 6460  H HB3  . ASP A 1 44  ? -12.411 4.445   8.051   1.00 0.00 ? 67  ASP A HB3  5  
ATOM 6461  N N    . ILE A 1 45  ? -11.902 5.422   4.046   1.00 0.00 ? 68  ILE A N    5  
ATOM 6462  C CA   . ILE A 1 45  ? -10.977 6.206   3.238   1.00 0.00 ? 68  ILE A CA   5  
ATOM 6463  C C    . ILE A 1 45  ? -11.838 7.276   2.556   1.00 0.00 ? 68  ILE A C    5  
ATOM 6464  O O    . ILE A 1 45  ? -12.796 6.935   1.866   1.00 0.00 ? 68  ILE A O    5  
ATOM 6465  C CB   . ILE A 1 45  ? -10.223 5.310   2.214   1.00 0.00 ? 68  ILE A CB   5  
ATOM 6466  C CG1  . ILE A 1 45  ? -9.871  3.882   2.727   1.00 0.00 ? 68  ILE A CG1  5  
ATOM 6467  C CG2  . ILE A 1 45  ? -8.998  6.066   1.665   1.00 0.00 ? 68  ILE A CG2  5  
ATOM 6468  C CD1  . ILE A 1 45  ? -8.659  3.215   2.064   1.00 0.00 ? 68  ILE A CD1  5  
ATOM 6469  H H    . ILE A 1 45  ? -12.743 5.097   3.573   1.00 0.00 ? 68  ILE A H    5  
ATOM 6470  H HA   . ILE A 1 45  ? -10.251 6.689   3.894   1.00 0.00 ? 68  ILE A HA   5  
ATOM 6471  H HB   . ILE A 1 45  ? -10.890 5.164   1.366   1.00 0.00 ? 68  ILE A HB   5  
ATOM 6472  H HG12 . ILE A 1 45  ? -9.692  3.865   3.801   1.00 0.00 ? 68  ILE A HG12 5  
ATOM 6473  H HG13 . ILE A 1 45  ? -10.740 3.252   2.537   1.00 0.00 ? 68  ILE A HG13 5  
ATOM 6474  H HG21 . ILE A 1 45  ? -8.688  5.623   0.714   1.00 0.00 ? 68  ILE A HG21 5  
ATOM 6475  H HG22 . ILE A 1 45  ? -9.247  7.107   1.476   1.00 0.00 ? 68  ILE A HG22 5  
ATOM 6476  H HG23 . ILE A 1 45  ? -8.179  6.036   2.384   1.00 0.00 ? 68  ILE A HG23 5  
ATOM 6477  H HD11 . ILE A 1 45  ? -8.644  2.152   2.304   1.00 0.00 ? 68  ILE A HD11 5  
ATOM 6478  H HD12 . ILE A 1 45  ? -8.708  3.350   0.988   1.00 0.00 ? 68  ILE A HD12 5  
ATOM 6479  H HD13 . ILE A 1 45  ? -7.740  3.665   2.438   1.00 0.00 ? 68  ILE A HD13 5  
ATOM 6480  N N    . ASP A 1 46  ? -11.543 8.558   2.758   1.00 0.00 ? 69  ASP A N    5  
ATOM 6481  C CA   . ASP A 1 46  ? -12.352 9.657   2.231   1.00 0.00 ? 69  ASP A CA   5  
ATOM 6482  C C    . ASP A 1 46  ? -12.015 9.868   0.757   1.00 0.00 ? 69  ASP A C    5  
ATOM 6483  O O    . ASP A 1 46  ? -10.947 10.399  0.433   1.00 0.00 ? 69  ASP A O    5  
ATOM 6484  C CB   . ASP A 1 46  ? -12.079 10.927  3.041   1.00 0.00 ? 69  ASP A CB   5  
ATOM 6485  C CG   . ASP A 1 46  ? -13.047 12.064  2.728   1.00 0.00 ? 69  ASP A CG   5  
ATOM 6486  O OD1  . ASP A 1 46  ? -13.711 12.107  1.665   1.00 0.00 ? 69  ASP A OD1  5  
ATOM 6487  O OD2  . ASP A 1 46  ? -13.199 12.906  3.643   1.00 0.00 ? 69  ASP A OD2  5  
ATOM 6488  H H    . ASP A 1 46  ? -10.778 8.819   3.373   1.00 0.00 ? 69  ASP A H    5  
ATOM 6489  H HA   . ASP A 1 46  ? -13.412 9.414   2.337   1.00 0.00 ? 69  ASP A HA   5  
ATOM 6490  H HB2  . ASP A 1 46  ? -12.168 10.690  4.105   1.00 0.00 ? 69  ASP A HB2  5  
ATOM 6491  H HB3  . ASP A 1 46  ? -11.061 11.276  2.874   1.00 0.00 ? 69  ASP A HB3  5  
ATOM 6492  N N    . PHE A 1 47  ? -12.850 9.358   -0.147  1.00 0.00 ? 70  PHE A N    5  
ATOM 6493  C CA   . PHE A 1 47  ? -12.632 9.406   -1.592  1.00 0.00 ? 70  PHE A CA   5  
ATOM 6494  C C    . PHE A 1 47  ? -13.023 10.738  -2.221  1.00 0.00 ? 70  PHE A C    5  
ATOM 6495  O O    . PHE A 1 47  ? -12.463 11.100  -3.260  1.00 0.00 ? 70  PHE A O    5  
ATOM 6496  C CB   . PHE A 1 47  ? -13.437 8.295   -2.276  1.00 0.00 ? 70  PHE A CB   5  
ATOM 6497  C CG   . PHE A 1 47  ? -12.857 6.916   -2.055  1.00 0.00 ? 70  PHE A CG   5  
ATOM 6498  C CD1  . PHE A 1 47  ? -11.811 6.474   -2.883  1.00 0.00 ? 70  PHE A CD1  5  
ATOM 6499  C CD2  . PHE A 1 47  ? -13.291 6.109   -0.989  1.00 0.00 ? 70  PHE A CD2  5  
ATOM 6500  C CE1  . PHE A 1 47  ? -11.123 5.288   -2.585  1.00 0.00 ? 70  PHE A CE1  5  
ATOM 6501  C CE2  . PHE A 1 47  ? -12.634 4.898   -0.718  1.00 0.00 ? 70  PHE A CE2  5  
ATOM 6502  C CZ   . PHE A 1 47  ? -11.528 4.507   -1.491  1.00 0.00 ? 70  PHE A CZ   5  
ATOM 6503  H H    . PHE A 1 47  ? -13.682 8.889   0.210   1.00 0.00 ? 70  PHE A H    5  
ATOM 6504  H HA   . PHE A 1 47  ? -11.578 9.247   -1.805  1.00 0.00 ? 70  PHE A HA   5  
ATOM 6505  H HB2  . PHE A 1 47  ? -14.468 8.332   -1.931  1.00 0.00 ? 70  PHE A HB2  5  
ATOM 6506  H HB3  . PHE A 1 47  ? -13.440 8.493   -3.348  1.00 0.00 ? 70  PHE A HB3  5  
ATOM 6507  H HD1  . PHE A 1 47  ? -11.514 7.071   -3.728  1.00 0.00 ? 70  PHE A HD1  5  
ATOM 6508  H HD2  . PHE A 1 47  ? -14.093 6.431   -0.340  1.00 0.00 ? 70  PHE A HD2  5  
ATOM 6509  H HE1  . PHE A 1 47  ? -10.271 4.999   -3.180  1.00 0.00 ? 70  PHE A HE1  5  
ATOM 6510  H HE2  . PHE A 1 47  ? -12.947 4.297   0.124   1.00 0.00 ? 70  PHE A HE2  5  
ATOM 6511  H HZ   . PHE A 1 47  ? -10.986 3.613   -1.229  1.00 0.00 ? 70  PHE A HZ   5  
ATOM 6512  N N    . GLY A 1 48  ? -13.998 11.436  -1.643  1.00 0.00 ? 71  GLY A N    5  
ATOM 6513  C CA   . GLY A 1 48  ? -14.738 12.473  -2.334  1.00 0.00 ? 71  GLY A CA   5  
ATOM 6514  C C    . GLY A 1 48  ? -16.195 12.379  -1.925  1.00 0.00 ? 71  GLY A C    5  
ATOM 6515  O O    . GLY A 1 48  ? -16.497 12.630  -0.759  1.00 0.00 ? 71  GLY A O    5  
ATOM 6516  H H    . GLY A 1 48  ? -14.333 11.154  -0.730  1.00 0.00 ? 71  GLY A H    5  
ATOM 6517  H HA2  . GLY A 1 48  ? -14.344 13.455  -2.070  1.00 0.00 ? 71  GLY A HA2  5  
ATOM 6518  H HA3  . GLY A 1 48  ? -14.650 12.320  -3.407  1.00 0.00 ? 71  GLY A HA3  5  
ATOM 6519  N N    . ALA A 1 49  ? -17.110 12.077  -2.852  1.00 0.00 ? 72  ALA A N    5  
ATOM 6520  C CA   . ALA A 1 49  ? -18.501 11.737  -2.544  1.00 0.00 ? 72  ALA A CA   5  
ATOM 6521  C C    . ALA A 1 49  ? -18.815 10.346  -3.085  1.00 0.00 ? 72  ALA A C    5  
ATOM 6522  O O    . ALA A 1 49  ? -18.948 9.398   -2.308  1.00 0.00 ? 72  ALA A O    5  
ATOM 6523  C CB   . ALA A 1 49  ? -19.491 12.810  -3.023  1.00 0.00 ? 72  ALA A CB   5  
ATOM 6524  H H    . ALA A 1 49  ? -16.773 11.804  -3.771  1.00 0.00 ? 72  ALA A H    5  
ATOM 6525  H HA   . ALA A 1 49  ? -18.606 11.681  -1.461  1.00 0.00 ? 72  ALA A HA   5  
ATOM 6526  H HB1  . ALA A 1 49  ? -19.595 12.802  -4.106  1.00 0.00 ? 72  ALA A HB1  5  
ATOM 6527  H HB2  . ALA A 1 49  ? -20.469 12.614  -2.583  1.00 0.00 ? 72  ALA A HB2  5  
ATOM 6528  H HB3  . ALA A 1 49  ? -19.160 13.796  -2.705  1.00 0.00 ? 72  ALA A HB3  5  
ATOM 6529  N N    . GLU A 1 50  ? -18.899 10.215  -4.419  1.00 0.00 ? 73  GLU A N    5  
ATOM 6530  C CA   . GLU A 1 50  ? -19.271 8.954   -5.057  1.00 0.00 ? 73  GLU A CA   5  
ATOM 6531  C C    . GLU A 1 50  ? -18.375 7.817   -4.620  1.00 0.00 ? 73  GLU A C    5  
ATOM 6532  O O    . GLU A 1 50  ? -18.847 6.691   -4.524  1.00 0.00 ? 73  GLU A O    5  
ATOM 6533  C CB   . GLU A 1 50  ? -19.146 8.965   -6.584  1.00 0.00 ? 73  GLU A CB   5  
ATOM 6534  C CG   . GLU A 1 50  ? -20.167 9.763   -7.335  1.00 0.00 ? 73  GLU A CG   5  
ATOM 6535  C CD   . GLU A 1 50  ? -20.651 9.108   -8.630  1.00 0.00 ? 73  GLU A CD   5  
ATOM 6536  O OE1  . GLU A 1 50  ? -21.249 8.012   -8.561  1.00 0.00 ? 73  GLU A OE1  5  
ATOM 6537  O OE2  . GLU A 1 50  ? -20.449 9.662   -9.737  1.00 0.00 ? 73  GLU A OE2  5  
ATOM 6538  H H    . GLU A 1 50  ? -18.749 11.034  -5.004  1.00 0.00 ? 73  GLU A H    5  
ATOM 6539  H HA   . GLU A 1 50  ? -20.296 8.705   -4.785  1.00 0.00 ? 73  GLU A HA   5  
ATOM 6540  H HB2  . GLU A 1 50  ? -18.153 9.308   -6.871  1.00 0.00 ? 73  GLU A HB2  5  
ATOM 6541  H HB3  . GLU A 1 50  ? -19.310 7.935   -6.891  1.00 0.00 ? 73  GLU A HB3  5  
ATOM 6542  H HG2  . GLU A 1 50  ? -20.986 9.763   -6.656  1.00 0.00 ? 73  GLU A HG2  5  
ATOM 6543  H HG3  . GLU A 1 50  ? -19.734 10.738  -7.522  1.00 0.00 ? 73  GLU A HG3  5  
ATOM 6544  N N    . GLY A 1 51  ? -17.082 8.081   -4.443  1.00 0.00 ? 74  GLY A N    5  
ATOM 6545  C CA   . GLY A 1 51  ? -16.131 7.021   -4.209  1.00 0.00 ? 74  GLY A CA   5  
ATOM 6546  C C    . GLY A 1 51  ? -16.440 6.313   -2.892  1.00 0.00 ? 74  GLY A C    5  
ATOM 6547  O O    . GLY A 1 51  ? -16.382 5.089   -2.838  1.00 0.00 ? 74  GLY A O    5  
ATOM 6548  H H    . GLY A 1 51  ? -16.753 9.035   -4.556  1.00 0.00 ? 74  GLY A H    5  
ATOM 6549  H HA2  . GLY A 1 51  ? -16.215 6.326   -5.042  1.00 0.00 ? 74  GLY A HA2  5  
ATOM 6550  H HA3  . GLY A 1 51  ? -15.126 7.423   -4.204  1.00 0.00 ? 74  GLY A HA3  5  
ATOM 6551  N N    . ASN A 1 52  ? -16.860 7.066   -1.869  1.00 0.00 ? 75  ASN A N    5  
ATOM 6552  C CA   . ASN A 1 52  ? -17.276 6.521   -0.579  1.00 0.00 ? 75  ASN A CA   5  
ATOM 6553  C C    . ASN A 1 52  ? -18.484 5.629   -0.816  1.00 0.00 ? 75  ASN A C    5  
ATOM 6554  O O    . ASN A 1 52  ? -18.486 4.458   -0.453  1.00 0.00 ? 75  ASN A O    5  
ATOM 6555  C CB   . ASN A 1 52  ? -17.653 7.626   0.425   1.00 0.00 ? 75  ASN A CB   5  
ATOM 6556  C CG   . ASN A 1 52  ? -16.633 8.746   0.512   1.00 0.00 ? 75  ASN A CG   5  
ATOM 6557  O OD1  . ASN A 1 52  ? -15.446 8.518   0.687   1.00 0.00 ? 75  ASN A OD1  5  
ATOM 6558  N ND2  . ASN A 1 52  ? -17.083 9.970   0.330   1.00 0.00 ? 75  ASN A ND2  5  
ATOM 6559  H H    . ASN A 1 52  ? -16.973 8.056   -2.036  1.00 0.00 ? 75  ASN A H    5  
ATOM 6560  H HA   . ASN A 1 52  ? -16.460 5.922   -0.169  1.00 0.00 ? 75  ASN A HA   5  
ATOM 6561  H HB2  . ASN A 1 52  ? -18.624 8.051   0.163   1.00 0.00 ? 75  ASN A HB2  5  
ATOM 6562  H HB3  . ASN A 1 52  ? -17.743 7.172   1.412   1.00 0.00 ? 75  ASN A HB3  5  
ATOM 6563  H HD21 . ASN A 1 52  ? -18.078 10.119  0.176   1.00 0.00 ? 75  ASN A HD21 5  
ATOM 6564  H HD22 . ASN A 1 52  ? -16.491 10.776  0.502   1.00 0.00 ? 75  ASN A HD22 5  
ATOM 6565  N N    . ARG A 1 53  ? -19.515 6.193   -1.455  1.00 0.00 ? 76  ARG A N    5  
ATOM 6566  C CA   . ARG A 1 53  ? -20.769 5.504   -1.776  1.00 0.00 ? 76  ARG A CA   5  
ATOM 6567  C C    . ARG A 1 53  ? -20.557 4.207   -2.563  1.00 0.00 ? 76  ARG A C    5  
ATOM 6568  O O    . ARG A 1 53  ? -21.165 3.181   -2.246  1.00 0.00 ? 76  ARG A O    5  
ATOM 6569  C CB   . ARG A 1 53  ? -21.683 6.478   -2.539  1.00 0.00 ? 76  ARG A CB   5  
ATOM 6570  C CG   . ARG A 1 53  ? -22.556 7.310   -1.585  1.00 0.00 ? 76  ARG A CG   5  
ATOM 6571  C CD   . ARG A 1 53  ? -23.768 6.513   -1.078  1.00 0.00 ? 76  ARG A CD   5  
ATOM 6572  N NE   . ARG A 1 53  ? -24.657 6.131   -2.185  1.00 0.00 ? 76  ARG A NE   5  
ATOM 6573  C CZ   . ARG A 1 53  ? -25.438 6.973   -2.870  1.00 0.00 ? 76  ARG A CZ   5  
ATOM 6574  N NH1  . ARG A 1 53  ? -25.796 8.151   -2.371  1.00 0.00 ? 76  ARG A NH1  5  
ATOM 6575  N NH2  . ARG A 1 53  ? -25.842 6.657   -4.090  1.00 0.00 ? 76  ARG A NH2  5  
ATOM 6576  H H    . ARG A 1 53  ? -19.410 7.182   -1.679  1.00 0.00 ? 76  ARG A H    5  
ATOM 6577  H HA   . ARG A 1 53  ? -21.242 5.217   -0.837  1.00 0.00 ? 76  ARG A HA   5  
ATOM 6578  H HB2  . ARG A 1 53  ? -21.074 7.159   -3.132  1.00 0.00 ? 76  ARG A HB2  5  
ATOM 6579  H HB3  . ARG A 1 53  ? -22.314 5.927   -3.238  1.00 0.00 ? 76  ARG A HB3  5  
ATOM 6580  H HG2  . ARG A 1 53  ? -21.955 7.643   -0.736  1.00 0.00 ? 76  ARG A HG2  5  
ATOM 6581  H HG3  . ARG A 1 53  ? -22.911 8.196   -2.112  1.00 0.00 ? 76  ARG A HG3  5  
ATOM 6582  H HD2  . ARG A 1 53  ? -23.417 5.606   -0.589  1.00 0.00 ? 76  ARG A HD2  5  
ATOM 6583  H HD3  . ARG A 1 53  ? -24.319 7.103   -0.346  1.00 0.00 ? 76  ARG A HD3  5  
ATOM 6584  H HE   . ARG A 1 53  ? -24.506 5.180   -2.534  1.00 0.00 ? 76  ARG A HE   5  
ATOM 6585  H HH11 . ARG A 1 53  ? -25.550 8.444   -1.425  1.00 0.00 ? 76  ARG A HH11 5  
ATOM 6586  H HH12 . ARG A 1 53  ? -26.282 8.812   -2.975  1.00 0.00 ? 76  ARG A HH12 5  
ATOM 6587  H HH21 . ARG A 1 53  ? -25.442 5.847   -4.562  1.00 0.00 ? 76  ARG A HH21 5  
ATOM 6588  H HH22 . ARG A 1 53  ? -26.372 7.318   -4.642  1.00 0.00 ? 76  ARG A HH22 5  
ATOM 6589  N N    . TYR A 1 54  ? -19.739 4.239   -3.611  1.00 0.00 ? 77  TYR A N    5  
ATOM 6590  C CA   . TYR A 1 54  ? -19.409 3.069   -4.411  1.00 0.00 ? 77  TYR A CA   5  
ATOM 6591  C C    . TYR A 1 54  ? -18.566 2.071   -3.611  1.00 0.00 ? 77  TYR A C    5  
ATOM 6592  O O    . TYR A 1 54  ? -18.726 0.870   -3.826  1.00 0.00 ? 77  TYR A O    5  
ATOM 6593  C CB   . TYR A 1 54  ? -18.684 3.533   -5.663  1.00 0.00 ? 77  TYR A CB   5  
ATOM 6594  C CG   . TYR A 1 54  ? -18.774 2.489   -6.747  1.00 0.00 ? 77  TYR A CG   5  
ATOM 6595  C CD1  . TYR A 1 54  ? -17.934 1.364   -6.721  1.00 0.00 ? 77  TYR A CD1  5  
ATOM 6596  C CD2  . TYR A 1 54  ? -19.731 2.636   -7.767  1.00 0.00 ? 77  TYR A CD2  5  
ATOM 6597  C CE1  . TYR A 1 54  ? -18.108 0.357   -7.678  1.00 0.00 ? 77  TYR A CE1  5  
ATOM 6598  C CE2  . TYR A 1 54  ? -19.817 1.695   -8.798  1.00 0.00 ? 77  TYR A CE2  5  
ATOM 6599  C CZ   . TYR A 1 54  ? -19.045 0.514   -8.721  1.00 0.00 ? 77  TYR A CZ   5  
ATOM 6600  O OH   . TYR A 1 54  ? -19.244 -0.498  -9.595  1.00 0.00 ? 77  TYR A OH   5  
ATOM 6601  H H    . TYR A 1 54  ? -19.334 5.127   -3.905  1.00 0.00 ? 77  TYR A H    5  
ATOM 6602  H HA   . TYR A 1 54  ? -20.310 2.552   -4.773  1.00 0.00 ? 77  TYR A HA   5  
ATOM 6603  H HB2  . TYR A 1 54  ? -19.158 4.448   -6.022  1.00 0.00 ? 77  TYR A HB2  5  
ATOM 6604  H HB3  . TYR A 1 54  ? -17.644 3.756   -5.431  1.00 0.00 ? 77  TYR A HB3  5  
ATOM 6605  H HD1  . TYR A 1 54  ? -17.196 1.245   -5.937  1.00 0.00 ? 77  TYR A HD1  5  
ATOM 6606  H HD2  . TYR A 1 54  ? -20.362 3.512   -7.800  1.00 0.00 ? 77  TYR A HD2  5  
ATOM 6607  H HE1  . TYR A 1 54  ? -17.528 -0.543  -7.607  1.00 0.00 ? 77  TYR A HE1  5  
ATOM 6608  H HE2  . TYR A 1 54  ? -20.473 1.921   -9.628  1.00 0.00 ? 77  TYR A HE2  5  
ATOM 6609  H HH   . TYR A 1 54  ? -20.060 -0.304  -10.093 1.00 0.00 ? 77  TYR A HH   5  
ATOM 6610  N N    . TYR A 1 55  ? -17.683 2.515   -2.705  1.00 0.00 ? 78  TYR A N    5  
ATOM 6611  C CA   . TYR A 1 55  ? -16.931 1.605   -1.847  1.00 0.00 ? 78  TYR A CA   5  
ATOM 6612  C C    . TYR A 1 55  ? -17.918 0.886   -0.930  1.00 0.00 ? 78  TYR A C    5  
ATOM 6613  O O    . TYR A 1 55  ? -18.010 -0.336  -1.004  1.00 0.00 ? 78  TYR A O    5  
ATOM 6614  C CB   . TYR A 1 55  ? -15.840 2.341   -1.051  1.00 0.00 ? 78  TYR A CB   5  
ATOM 6615  C CG   . TYR A 1 55  ? -14.834 1.451   -0.339  1.00 0.00 ? 78  TYR A CG   5  
ATOM 6616  C CD1  . TYR A 1 55  ? -14.299 0.305   -0.959  1.00 0.00 ? 78  TYR A CD1  5  
ATOM 6617  C CD2  . TYR A 1 55  ? -14.417 1.783   0.964   1.00 0.00 ? 78  TYR A CD2  5  
ATOM 6618  C CE1  . TYR A 1 55  ? -13.482 -0.572  -0.225  1.00 0.00 ? 78  TYR A CE1  5  
ATOM 6619  C CE2  . TYR A 1 55  ? -13.551 0.943   1.686   1.00 0.00 ? 78  TYR A CE2  5  
ATOM 6620  C CZ   . TYR A 1 55  ? -13.142 -0.277  1.112   1.00 0.00 ? 78  TYR A CZ   5  
ATOM 6621  O OH   . TYR A 1 55  ? -12.463 -1.185  1.861   1.00 0.00 ? 78  TYR A OH   5  
ATOM 6622  H H    . TYR A 1 55  ? -17.540 3.513   -2.565  1.00 0.00 ? 78  TYR A H    5  
ATOM 6623  H HA   . TYR A 1 55  ? -16.455 0.869   -2.494  1.00 0.00 ? 78  TYR A HA   5  
ATOM 6624  H HB2  . TYR A 1 55  ? -15.286 3.004   -1.714  1.00 0.00 ? 78  TYR A HB2  5  
ATOM 6625  H HB3  . TYR A 1 55  ? -16.343 2.939   -0.292  1.00 0.00 ? 78  TYR A HB3  5  
ATOM 6626  H HD1  . TYR A 1 55  ? -14.531 0.070   -1.985  1.00 0.00 ? 78  TYR A HD1  5  
ATOM 6627  H HD2  . TYR A 1 55  ? -14.784 2.686   1.428   1.00 0.00 ? 78  TYR A HD2  5  
ATOM 6628  H HE1  . TYR A 1 55  ? -13.120 -1.476  -0.681  1.00 0.00 ? 78  TYR A HE1  5  
ATOM 6629  H HE2  . TYR A 1 55  ? -13.226 1.218   2.683   1.00 0.00 ? 78  TYR A HE2  5  
ATOM 6630  H HH   . TYR A 1 55  ? -12.468 -2.073  1.488   1.00 0.00 ? 78  TYR A HH   5  
ATOM 6631  N N    . GLU A 1 56  ? -18.732 1.627   -0.168  1.00 0.00 ? 79  GLU A N    5  
ATOM 6632  C CA   . GLU A 1 56  ? -19.820 1.157   0.687   1.00 0.00 ? 79  GLU A CA   5  
ATOM 6633  C C    . GLU A 1 56  ? -20.689 0.087   0.030   1.00 0.00 ? 79  GLU A C    5  
ATOM 6634  O O    . GLU A 1 56  ? -21.218 -0.794  0.711   1.00 0.00 ? 79  GLU A O    5  
ATOM 6635  C CB   . GLU A 1 56  ? -20.732 2.358   0.971   1.00 0.00 ? 79  GLU A CB   5  
ATOM 6636  C CG   . GLU A 1 56  ? -20.574 2.898   2.380   1.00 0.00 ? 79  GLU A CG   5  
ATOM 6637  C CD   . GLU A 1 56  ? -21.393 2.097   3.404   1.00 0.00 ? 79  GLU A CD   5  
ATOM 6638  O OE1  . GLU A 1 56  ? -22.576 1.757   3.150   1.00 0.00 ? 79  GLU A OE1  5  
ATOM 6639  O OE2  . GLU A 1 56  ? -20.889 1.731   4.481   1.00 0.00 ? 79  GLU A OE2  5  
ATOM 6640  H H    . GLU A 1 56  ? -18.612 2.640   -0.167  1.00 0.00 ? 79  GLU A H    5  
ATOM 6641  H HA   . GLU A 1 56  ? -19.388 0.765   1.616   1.00 0.00 ? 79  GLU A HA   5  
ATOM 6642  H HB2  . GLU A 1 56  ? -20.510 3.168   0.282   1.00 0.00 ? 79  GLU A HB2  5  
ATOM 6643  H HB3  . GLU A 1 56  ? -21.779 2.102   0.795   1.00 0.00 ? 79  GLU A HB3  5  
ATOM 6644  H HG2  . GLU A 1 56  ? -19.516 2.911   2.650   1.00 0.00 ? 79  GLU A HG2  5  
ATOM 6645  H HG3  . GLU A 1 56  ? -20.929 3.921   2.324   1.00 0.00 ? 79  GLU A HG3  5  
ATOM 6646  N N    . ALA A 1 57  ? -20.861 0.190   -1.285  1.00 0.00 ? 80  ALA A N    5  
ATOM 6647  C CA   . ALA A 1 57  ? -21.700 -0.727  -2.034  1.00 0.00 ? 80  ALA A CA   5  
ATOM 6648  C C    . ALA A 1 57  ? -21.127 -2.131  -2.245  1.00 0.00 ? 80  ALA A C    5  
ATOM 6649  O O    . ALA A 1 57  ? -21.895 -3.051  -2.549  1.00 0.00 ? 80  ALA A O    5  
ATOM 6650  C CB   . ALA A 1 57  ? -22.053 -0.114  -3.403  1.00 0.00 ? 80  ALA A CB   5  
ATOM 6651  H H    . ALA A 1 57  ? -20.518 1.055   -1.686  1.00 0.00 ? 80  ALA A H    5  
ATOM 6652  H HA   . ALA A 1 57  ? -22.573 -0.853  -1.409  1.00 0.00 ? 80  ALA A HA   5  
ATOM 6653  H HB1  . ALA A 1 57  ? -22.485 0.877   -3.284  1.00 0.00 ? 80  ALA A HB1  5  
ATOM 6654  H HB2  . ALA A 1 57  ? -21.158 -0.030  -4.023  1.00 0.00 ? 80  ALA A HB2  5  
ATOM 6655  H HB3  . ALA A 1 57  ? -22.763 -0.749  -3.936  1.00 0.00 ? 80  ALA A HB3  5  
ATOM 6656  N N    . ASN A 1 58  ? -19.805 -2.310  -2.181  1.00 0.00 ? 81  ASN A N    5  
ATOM 6657  C CA   . ASN A 1 58  ? -19.109 -3.505  -2.680  1.00 0.00 ? 81  ASN A CA   5  
ATOM 6658  C C    . ASN A 1 58  ? -17.634 -3.470  -2.278  1.00 0.00 ? 81  ASN A C    5  
ATOM 6659  O O    . ASN A 1 58  ? -16.742 -3.762  -3.071  1.00 0.00 ? 81  ASN A O    5  
ATOM 6660  C CB   . ASN A 1 58  ? -19.286 -3.648  -4.209  1.00 0.00 ? 81  ASN A CB   5  
ATOM 6661  C CG   . ASN A 1 58  ? -19.113 -2.350  -4.976  1.00 0.00 ? 81  ASN A CG   5  
ATOM 6662  O OD1  . ASN A 1 58  ? -20.004 -1.941  -5.719  1.00 0.00 ? 81  ASN A OD1  5  
ATOM 6663  N ND2  . ASN A 1 58  ? -18.006 -1.667  -4.794  1.00 0.00 ? 81  ASN A ND2  5  
ATOM 6664  H H    . ASN A 1 58  ? -19.242 -1.506  -1.907  1.00 0.00 ? 81  ASN A H    5  
ATOM 6665  H HA   . ASN A 1 58  ? -19.547 -4.381  -2.205  1.00 0.00 ? 81  ASN A HA   5  
ATOM 6666  H HB2  . ASN A 1 58  ? -18.610 -4.399  -4.611  1.00 0.00 ? 81  ASN A HB2  5  
ATOM 6667  H HB3  . ASN A 1 58  ? -20.297 -3.992  -4.379  1.00 0.00 ? 81  ASN A HB3  5  
ATOM 6668  H HD21 . ASN A 1 58  ? -17.294 -2.041  -4.181  1.00 0.00 ? 81  ASN A HD21 5  
ATOM 6669  H HD22 . ASN A 1 58  ? -18.054 -0.670  -4.963  1.00 0.00 ? 81  ASN A HD22 5  
ATOM 6670  N N    . TYR A 1 59  ? -17.359 -3.063  -1.050  1.00 0.00 ? 82  TYR A N    5  
ATOM 6671  C CA   . TYR A 1 59  ? -16.030 -2.769  -0.521  1.00 0.00 ? 82  TYR A CA   5  
ATOM 6672  C C    . TYR A 1 59  ? -15.141 -4.009  -0.474  1.00 0.00 ? 82  TYR A C    5  
ATOM 6673  O O    . TYR A 1 59  ? -13.940 -3.939  -0.724  1.00 0.00 ? 82  TYR A O    5  
ATOM 6674  C CB   . TYR A 1 59  ? -16.196 -2.192  0.893   1.00 0.00 ? 82  TYR A CB   5  
ATOM 6675  C CG   . TYR A 1 59  ? -17.304 -2.867  1.687   1.00 0.00 ? 82  TYR A CG   5  
ATOM 6676  C CD1  . TYR A 1 59  ? -17.036 -4.054  2.395   1.00 0.00 ? 82  TYR A CD1  5  
ATOM 6677  C CD2  . TYR A 1 59  ? -18.619 -2.360  1.633   1.00 0.00 ? 82  TYR A CD2  5  
ATOM 6678  C CE1  . TYR A 1 59  ? -18.075 -4.754  3.028   1.00 0.00 ? 82  TYR A CE1  5  
ATOM 6679  C CE2  . TYR A 1 59  ? -19.652 -3.040  2.299   1.00 0.00 ? 82  TYR A CE2  5  
ATOM 6680  C CZ   . TYR A 1 59  ? -19.393 -4.253  2.969   1.00 0.00 ? 82  TYR A CZ   5  
ATOM 6681  O OH   . TYR A 1 59  ? -20.420 -4.970  3.498   1.00 0.00 ? 82  TYR A OH   5  
ATOM 6682  H H    . TYR A 1 59  ? -18.131 -2.788  -0.456  1.00 0.00 ? 82  TYR A H    5  
ATOM 6683  H HA   . TYR A 1 59  ? -15.560 -2.034  -1.175  1.00 0.00 ? 82  TYR A HA   5  
ATOM 6684  H HB2  . TYR A 1 59  ? -15.254 -2.285  1.434   1.00 0.00 ? 82  TYR A HB2  5  
ATOM 6685  H HB3  . TYR A 1 59  ? -16.413 -1.127  0.820   1.00 0.00 ? 82  TYR A HB3  5  
ATOM 6686  H HD1  . TYR A 1 59  ? -16.029 -4.437  2.453   1.00 0.00 ? 82  TYR A HD1  5  
ATOM 6687  H HD2  . TYR A 1 59  ? -18.869 -1.476  1.045   1.00 0.00 ? 82  TYR A HD2  5  
ATOM 6688  H HE1  . TYR A 1 59  ? -17.860 -5.670  3.557   1.00 0.00 ? 82  TYR A HE1  5  
ATOM 6689  H HE2  . TYR A 1 59  ? -20.656 -2.651  2.258   1.00 0.00 ? 82  TYR A HE2  5  
ATOM 6690  H HH   . TYR A 1 59  ? -20.531 -5.791  2.973   1.00 0.00 ? 82  TYR A HH   5  
ATOM 6691  N N    . TRP A 1 60  ? -15.746 -5.166  -0.215  1.00 0.00 ? 83  TRP A N    5  
ATOM 6692  C CA   . TRP A 1 60  ? -15.079 -6.455  -0.132  1.00 0.00 ? 83  TRP A CA   5  
ATOM 6693  C C    . TRP A 1 60  ? -14.377 -6.846  -1.436  1.00 0.00 ? 83  TRP A C    5  
ATOM 6694  O O    . TRP A 1 60  ? -13.533 -7.739  -1.449  1.00 0.00 ? 83  TRP A O    5  
ATOM 6695  C CB   . TRP A 1 60  ? -16.127 -7.497  0.269   1.00 0.00 ? 83  TRP A CB   5  
ATOM 6696  C CG   . TRP A 1 60  ? -17.292 -7.616  -0.666  1.00 0.00 ? 83  TRP A CG   5  
ATOM 6697  C CD1  . TRP A 1 60  ? -18.391 -6.830  -0.665  1.00 0.00 ? 83  TRP A CD1  5  
ATOM 6698  C CD2  . TRP A 1 60  ? -17.501 -8.584  -1.730  1.00 0.00 ? 83  TRP A CD2  5  
ATOM 6699  N NE1  . TRP A 1 60  ? -19.265 -7.243  -1.650  1.00 0.00 ? 83  TRP A NE1  5  
ATOM 6700  C CE2  . TRP A 1 60  ? -18.755 -8.311  -2.353  1.00 0.00 ? 83  TRP A CE2  5  
ATOM 6701  C CE3  . TRP A 1 60  ? -16.745 -9.661  -2.236  1.00 0.00 ? 83  TRP A CE3  5  
ATOM 6702  C CZ2  . TRP A 1 60  ? -19.232 -9.063  -3.434  1.00 0.00 ? 83  TRP A CZ2  5  
ATOM 6703  C CZ3  . TRP A 1 60  ? -17.211 -10.421 -3.327  1.00 0.00 ? 83  TRP A CZ3  5  
ATOM 6704  C CH2  . TRP A 1 60  ? -18.447 -10.116 -3.928  1.00 0.00 ? 83  TRP A CH2  5  
ATOM 6705  H H    . TRP A 1 60  ? -16.733 -5.147  -0.012  1.00 0.00 ? 83  TRP A H    5  
ATOM 6706  H HA   . TRP A 1 60  ? -14.324 -6.393  0.643   1.00 0.00 ? 83  TRP A HA   5  
ATOM 6707  H HB2  . TRP A 1 60  ? -15.642 -8.471  0.355   1.00 0.00 ? 83  TRP A HB2  5  
ATOM 6708  H HB3  . TRP A 1 60  ? -16.513 -7.238  1.254   1.00 0.00 ? 83  TRP A HB3  5  
ATOM 6709  H HD1  . TRP A 1 60  ? -18.573 -6.023  0.028   1.00 0.00 ? 83  TRP A HD1  5  
ATOM 6710  H HE1  . TRP A 1 60  ? -20.195 -6.849  -1.773  1.00 0.00 ? 83  TRP A HE1  5  
ATOM 6711  H HE3  . TRP A 1 60  ? -15.796 -9.882  -1.765  1.00 0.00 ? 83  TRP A HE3  5  
ATOM 6712  H HZ2  . TRP A 1 60  ? -20.190 -8.841  -3.879  1.00 0.00 ? 83  TRP A HZ2  5  
ATOM 6713  H HZ3  . TRP A 1 60  ? -16.626 -11.245 -3.715  1.00 0.00 ? 83  TRP A HZ3  5  
ATOM 6714  H HH2  . TRP A 1 60  ? -18.794 -10.693 -4.775  1.00 0.00 ? 83  TRP A HH2  5  
ATOM 6715  N N    . GLN A 1 61  ? -14.711 -6.179  -2.538  1.00 0.00 ? 84  GLN A N    5  
ATOM 6716  C CA   . GLN A 1 61  ? -14.189 -6.475  -3.855  1.00 0.00 ? 84  GLN A CA   5  
ATOM 6717  C C    . GLN A 1 61  ? -12.836 -5.787  -4.131  1.00 0.00 ? 84  GLN A C    5  
ATOM 6718  O O    . GLN A 1 61  ? -12.366 -5.866  -5.267  1.00 0.00 ? 84  GLN A O    5  
ATOM 6719  C CB   . GLN A 1 61  ? -15.272 -6.117  -4.889  1.00 0.00 ? 84  GLN A CB   5  
ATOM 6720  C CG   . GLN A 1 61  ? -16.636 -6.789  -4.606  1.00 0.00 ? 84  GLN A CG   5  
ATOM 6721  C CD   . GLN A 1 61  ? -17.377 -7.241  -5.866  1.00 0.00 ? 84  GLN A CD   5  
ATOM 6722  O OE1  . GLN A 1 61  ? -16.786 -7.832  -6.763  1.00 0.00 ? 84  GLN A OE1  5  
ATOM 6723  N NE2  . GLN A 1 61  ? -18.671 -6.971  -6.014  1.00 0.00 ? 84  GLN A NE2  5  
ATOM 6724  H H    . GLN A 1 61  ? -15.390 -5.433  -2.467  1.00 0.00 ? 84  GLN A H    5  
ATOM 6725  H HA   . GLN A 1 61  ? -14.013 -7.549  -3.922  1.00 0.00 ? 84  GLN A HA   5  
ATOM 6726  H HB2  . GLN A 1 61  ? -15.400 -5.036  -4.947  1.00 0.00 ? 84  GLN A HB2  5  
ATOM 6727  H HB3  . GLN A 1 61  ? -14.907 -6.457  -5.846  1.00 0.00 ? 84  GLN A HB3  5  
ATOM 6728  H HG2  . GLN A 1 61  ? -16.469 -7.676  -4.002  1.00 0.00 ? 84  GLN A HG2  5  
ATOM 6729  H HG3  . GLN A 1 61  ? -17.255 -6.102  -4.031  1.00 0.00 ? 84  GLN A HG3  5  
ATOM 6730  H HE21 . GLN A 1 61  ? -19.245 -6.611  -5.258  1.00 0.00 ? 84  GLN A HE21 5  
ATOM 6731  H HE22 . GLN A 1 61  ? -19.151 -7.382  -6.810  1.00 0.00 ? 84  GLN A HE22 5  
ATOM 6732  N N    . PHE A 1 62  ? -12.227 -5.121  -3.137  1.00 0.00 ? 85  PHE A N    5  
ATOM 6733  C CA   . PHE A 1 62  ? -11.065 -4.227  -3.260  1.00 0.00 ? 85  PHE A CA   5  
ATOM 6734  C C    . PHE A 1 62  ? -9.936  -4.647  -2.300  1.00 0.00 ? 85  PHE A C    5  
ATOM 6735  O O    . PHE A 1 62  ? -10.188 -5.445  -1.388  1.00 0.00 ? 85  PHE A O    5  
ATOM 6736  C CB   . PHE A 1 62  ? -11.519 -2.799  -2.909  1.00 0.00 ? 85  PHE A CB   5  
ATOM 6737  C CG   . PHE A 1 62  ? -12.426 -2.136  -3.926  1.00 0.00 ? 85  PHE A CG   5  
ATOM 6738  C CD1  . PHE A 1 62  ? -13.773 -2.519  -4.026  1.00 0.00 ? 85  PHE A CD1  5  
ATOM 6739  C CD2  . PHE A 1 62  ? -11.930 -1.129  -4.775  1.00 0.00 ? 85  PHE A CD2  5  
ATOM 6740  C CE1  . PHE A 1 62  ? -14.604 -1.932  -4.990  1.00 0.00 ? 85  PHE A CE1  5  
ATOM 6741  C CE2  . PHE A 1 62  ? -12.769 -0.531  -5.732  1.00 0.00 ? 85  PHE A CE2  5  
ATOM 6742  C CZ   . PHE A 1 62  ? -14.112 -0.927  -5.839  1.00 0.00 ? 85  PHE A CZ   5  
ATOM 6743  H H    . PHE A 1 62  ? -12.646 -5.143  -2.215  1.00 0.00 ? 85  PHE A H    5  
ATOM 6744  H HA   . PHE A 1 62  ? -10.687 -4.247  -4.282  1.00 0.00 ? 85  PHE A HA   5  
ATOM 6745  H HB2  . PHE A 1 62  ? -12.018 -2.829  -1.946  1.00 0.00 ? 85  PHE A HB2  5  
ATOM 6746  H HB3  . PHE A 1 62  ? -10.654 -2.161  -2.758  1.00 0.00 ? 85  PHE A HB3  5  
ATOM 6747  H HD1  . PHE A 1 62  ? -14.174 -3.281  -3.375  1.00 0.00 ? 85  PHE A HD1  5  
ATOM 6748  H HD2  . PHE A 1 62  ? -10.903 -0.809  -4.691  1.00 0.00 ? 85  PHE A HD2  5  
ATOM 6749  H HE1  . PHE A 1 62  ? -15.616 -2.282  -5.072  1.00 0.00 ? 85  PHE A HE1  5  
ATOM 6750  H HE2  . PHE A 1 62  ? -12.382 0.238   -6.382  1.00 0.00 ? 85  PHE A HE2  5  
ATOM 6751  H HZ   . PHE A 1 62  ? -14.758 -0.456  -6.565  1.00 0.00 ? 85  PHE A HZ   5  
ATOM 6752  N N    . PRO A 1 63  ? -8.701  -4.116  -2.448  1.00 0.00 ? 86  PRO A N    5  
ATOM 6753  C CA   . PRO A 1 63  ? -7.587  -4.381  -1.535  1.00 0.00 ? 86  PRO A CA   5  
ATOM 6754  C C    . PRO A 1 63  ? -7.796  -3.793  -0.128  1.00 0.00 ? 86  PRO A C    5  
ATOM 6755  O O    . PRO A 1 63  ? -8.846  -3.231  0.183   1.00 0.00 ? 86  PRO A O    5  
ATOM 6756  C CB   . PRO A 1 63  ? -6.330  -3.852  -2.236  1.00 0.00 ? 86  PRO A CB   5  
ATOM 6757  C CG   . PRO A 1 63  ? -6.865  -2.772  -3.165  1.00 0.00 ? 86  PRO A CG   5  
ATOM 6758  C CD   . PRO A 1 63  ? -8.225  -3.325  -3.578  1.00 0.00 ? 86  PRO A CD   5  
ATOM 6759  H HA   . PRO A 1 63  ? -7.474  -5.454  -1.439  1.00 0.00 ? 86  PRO A HA   5  
ATOM 6760  H HB2  . PRO A 1 63  ? -5.577  -3.462  -1.552  1.00 0.00 ? 86  PRO A HB2  5  
ATOM 6761  H HB3  . PRO A 1 63  ? -5.900  -4.655  -2.828  1.00 0.00 ? 86  PRO A HB3  5  
ATOM 6762  H HG2  . PRO A 1 63  ? -6.985  -1.847  -2.614  1.00 0.00 ? 86  PRO A HG2  5  
ATOM 6763  H HG3  . PRO A 1 63  ? -6.215  -2.603  -4.017  1.00 0.00 ? 86  PRO A HG3  5  
ATOM 6764  H HD2  . PRO A 1 63  ? -8.892  -2.506  -3.835  1.00 0.00 ? 86  PRO A HD2  5  
ATOM 6765  H HD3  . PRO A 1 63  ? -8.090  -3.980  -4.436  1.00 0.00 ? 86  PRO A HD3  5  
ATOM 6766  N N    . ASP A 1 64  ? -6.781  -3.963  0.725   1.00 0.00 ? 87  ASP A N    5  
ATOM 6767  C CA   . ASP A 1 64  ? -6.734  -3.485  2.111   1.00 0.00 ? 87  ASP A CA   5  
ATOM 6768  C C    . ASP A 1 64  ? -5.388  -2.820  2.378   1.00 0.00 ? 87  ASP A C    5  
ATOM 6769  O O    . ASP A 1 64  ? -5.337  -1.665  2.775   1.00 0.00 ? 87  ASP A O    5  
ATOM 6770  C CB   . ASP A 1 64  ? -6.964  -4.650  3.083   1.00 0.00 ? 87  ASP A CB   5  
ATOM 6771  C CG   . ASP A 1 64  ? -6.644  -4.313  4.547   1.00 0.00 ? 87  ASP A CG   5  
ATOM 6772  O OD1  . ASP A 1 64  ? -6.614  -3.134  4.954   1.00 0.00 ? 87  ASP A OD1  5  
ATOM 6773  O OD2  . ASP A 1 64  ? -6.510  -5.264  5.345   1.00 0.00 ? 87  ASP A OD2  5  
ATOM 6774  H H    . ASP A 1 64  ? -5.921  -4.337  0.358   1.00 0.00 ? 87  ASP A H    5  
ATOM 6775  H HA   . ASP A 1 64  ? -7.510  -2.738  2.271   1.00 0.00 ? 87  ASP A HA   5  
ATOM 6776  H HB2  . ASP A 1 64  ? -8.006  -4.965  3.010   1.00 0.00 ? 87  ASP A HB2  5  
ATOM 6777  H HB3  . ASP A 1 64  ? -6.335  -5.486  2.777   1.00 0.00 ? 87  ASP A HB3  5  
ATOM 6778  N N    . GLY A 1 65  ? -4.291  -3.521  2.109   1.00 0.00 ? 88  GLY A N    5  
ATOM 6779  C CA   . GLY A 1 65  ? -2.939  -2.988  2.141   1.00 0.00 ? 88  GLY A CA   5  
ATOM 6780  C C    . GLY A 1 65  ? -2.128  -3.653  1.035   1.00 0.00 ? 88  GLY A C    5  
ATOM 6781  O O    . GLY A 1 65  ? -2.676  -4.469  0.276   1.00 0.00 ? 88  GLY A O    5  
ATOM 6782  H H    . GLY A 1 65  ? -4.353  -4.470  1.784   1.00 0.00 ? 88  GLY A H    5  
ATOM 6783  H HA2  . GLY A 1 65  ? -2.957  -1.909  1.984   1.00 0.00 ? 88  GLY A HA2  5  
ATOM 6784  H HA3  . GLY A 1 65  ? -2.486  -3.201  3.108   1.00 0.00 ? 88  GLY A HA3  5  
ATOM 6785  N N    . ILE A 1 66  ? -0.853  -3.277  0.927   1.00 0.00 ? 89  ILE A N    5  
ATOM 6786  C CA   . ILE A 1 66  ? 0.038   -3.692  -0.154  1.00 0.00 ? 89  ILE A CA   5  
ATOM 6787  C C    . ILE A 1 66  ? 1.370   -4.211  0.410   1.00 0.00 ? 89  ILE A C    5  
ATOM 6788  O O    . ILE A 1 66  ? 2.084   -3.503  1.119   1.00 0.00 ? 89  ILE A O    5  
ATOM 6789  C CB   . ILE A 1 66  ? 0.253   -2.527  -1.145  1.00 0.00 ? 89  ILE A CB   5  
ATOM 6790  C CG1  . ILE A 1 66  ? -1.051  -1.894  -1.686  1.00 0.00 ? 89  ILE A CG1  5  
ATOM 6791  C CG2  . ILE A 1 66  ? 1.102   -3.030  -2.317  1.00 0.00 ? 89  ILE A CG2  5  
ATOM 6792  C CD1  . ILE A 1 66  ? -1.908  -2.792  -2.589  1.00 0.00 ? 89  ILE A CD1  5  
ATOM 6793  H H    . ILE A 1 66  ? -0.548  -2.538  1.558   1.00 0.00 ? 89  ILE A H    5  
ATOM 6794  H HA   . ILE A 1 66  ? -0.438  -4.500  -0.709  1.00 0.00 ? 89  ILE A HA   5  
ATOM 6795  H HB   . ILE A 1 66  ? 0.809   -1.741  -0.634  1.00 0.00 ? 89  ILE A HB   5  
ATOM 6796  H HG12 . ILE A 1 66  ? -1.661  -1.564  -0.848  1.00 0.00 ? 89  ILE A HG12 5  
ATOM 6797  H HG13 . ILE A 1 66  ? -0.788  -1.003  -2.253  1.00 0.00 ? 89  ILE A HG13 5  
ATOM 6798  H HG21 . ILE A 1 66  ? 0.612   -3.898  -2.762  1.00 0.00 ? 89  ILE A HG21 5  
ATOM 6799  H HG22 . ILE A 1 66  ? 1.227   -2.232  -3.049  1.00 0.00 ? 89  ILE A HG22 5  
ATOM 6800  H HG23 . ILE A 1 66  ? 2.085   -3.338  -1.974  1.00 0.00 ? 89  ILE A HG23 5  
ATOM 6801  H HD11 . ILE A 1 66  ? -1.412  -2.936  -3.549  1.00 0.00 ? 89  ILE A HD11 5  
ATOM 6802  H HD12 . ILE A 1 66  ? -2.077  -3.759  -2.122  1.00 0.00 ? 89  ILE A HD12 5  
ATOM 6803  H HD13 . ILE A 1 66  ? -2.876  -2.320  -2.758  1.00 0.00 ? 89  ILE A HD13 5  
ATOM 6804  N N    . HIS A 1 67  ? 1.746   -5.418  -0.016  1.00 0.00 ? 90  HIS A N    5  
ATOM 6805  C CA   . HIS A 1 67  ? 2.941   -6.200  0.329   1.00 0.00 ? 90  HIS A CA   5  
ATOM 6806  C C    . HIS A 1 67  ? 4.264   -5.608  -0.219  1.00 0.00 ? 90  HIS A C    5  
ATOM 6807  O O    . HIS A 1 67  ? 5.225   -6.335  -0.476  1.00 0.00 ? 90  HIS A O    5  
ATOM 6808  C CB   . HIS A 1 67  ? 2.751   -7.622  -0.230  1.00 0.00 ? 90  HIS A CB   5  
ATOM 6809  C CG   . HIS A 1 67  ? 1.447   -8.304  0.096   1.00 0.00 ? 90  HIS A CG   5  
ATOM 6810  N ND1  . HIS A 1 67  ? 0.232   -8.057  -0.498  1.00 0.00 ? 90  HIS A ND1  5  
ATOM 6811  C CD2  . HIS A 1 67  ? 1.313   -9.453  0.824   1.00 0.00 ? 90  HIS A CD2  5  
ATOM 6812  C CE1  . HIS A 1 67  ? -0.612  -9.021  -0.111  1.00 0.00 ? 90  HIS A CE1  5  
ATOM 6813  N NE2  . HIS A 1 67  ? -0.018  -9.875  0.736   1.00 0.00 ? 90  HIS A NE2  5  
ATOM 6814  H H    . HIS A 1 67  ? 1.083   -5.899  -0.602  1.00 0.00 ? 90  HIS A H    5  
ATOM 6815  H HA   . HIS A 1 67  ? 3.016   -6.263  1.417   1.00 0.00 ? 90  HIS A HA   5  
ATOM 6816  H HB2  . HIS A 1 67  ? 2.819   -7.574  -1.311  1.00 0.00 ? 90  HIS A HB2  5  
ATOM 6817  H HB3  . HIS A 1 67  ? 3.569   -8.253  0.123   1.00 0.00 ? 90  HIS A HB3  5  
ATOM 6818  H HD1  . HIS A 1 67  ? 0.015   -7.367  -1.207  1.00 0.00 ? 90  HIS A HD1  5  
ATOM 6819  H HD2  . HIS A 1 67  ? 2.129   -9.998  1.265   1.00 0.00 ? 90  HIS A HD2  5  
ATOM 6820  H HE1  . HIS A 1 67  ? -1.624  -9.083  -0.472  1.00 0.00 ? 90  HIS A HE1  5  
ATOM 6821  N N    . TYR A 1 68  ? 4.319   -4.301  -0.485  1.00 0.00 ? 91  TYR A N    5  
ATOM 6822  C CA   . TYR A 1 68  ? 5.439   -3.608  -1.130  1.00 0.00 ? 91  TYR A CA   5  
ATOM 6823  C C    . TYR A 1 68  ? 6.609   -3.314  -0.168  1.00 0.00 ? 91  TYR A C    5  
ATOM 6824  O O    . TYR A 1 68  ? 7.592   -2.696  -0.582  1.00 0.00 ? 91  TYR A O    5  
ATOM 6825  C CB   . TYR A 1 68  ? 4.873   -2.336  -1.784  1.00 0.00 ? 91  TYR A CB   5  
ATOM 6826  C CG   . TYR A 1 68  ? 5.816   -1.550  -2.669  1.00 0.00 ? 91  TYR A CG   5  
ATOM 6827  C CD1  . TYR A 1 68  ? 6.211   -2.068  -3.916  1.00 0.00 ? 91  TYR A CD1  5  
ATOM 6828  C CD2  . TYR A 1 68  ? 6.255   -0.278  -2.264  1.00 0.00 ? 91  TYR A CD2  5  
ATOM 6829  C CE1  . TYR A 1 68  ? 7.058   -1.314  -4.751  1.00 0.00 ? 91  TYR A CE1  5  
ATOM 6830  C CE2  . TYR A 1 68  ? 7.086   0.489   -3.097  1.00 0.00 ? 91  TYR A CE2  5  
ATOM 6831  C CZ   . TYR A 1 68  ? 7.493   -0.028  -4.349  1.00 0.00 ? 91  TYR A CZ   5  
ATOM 6832  O OH   . TYR A 1 68  ? 8.311   0.695   -5.161  1.00 0.00 ? 91  TYR A OH   5  
ATOM 6833  H H    . TYR A 1 68  ? 3.553   -3.736  -0.135  1.00 0.00 ? 91  TYR A H    5  
ATOM 6834  H HA   . TYR A 1 68  ? 5.835   -4.247  -1.917  1.00 0.00 ? 91  TYR A HA   5  
ATOM 6835  H HB2  . TYR A 1 68  ? 4.039   -2.619  -2.421  1.00 0.00 ? 91  TYR A HB2  5  
ATOM 6836  H HB3  . TYR A 1 68  ? 4.482   -1.687  -1.000  1.00 0.00 ? 91  TYR A HB3  5  
ATOM 6837  H HD1  . TYR A 1 68  ? 5.851   -3.041  -4.224  1.00 0.00 ? 91  TYR A HD1  5  
ATOM 6838  H HD2  . TYR A 1 68  ? 5.931   0.117   -1.309  1.00 0.00 ? 91  TYR A HD2  5  
ATOM 6839  H HE1  . TYR A 1 68  ? 7.366   -1.711  -5.708  1.00 0.00 ? 91  TYR A HE1  5  
ATOM 6840  H HE2  . TYR A 1 68  ? 7.386   1.474   -2.760  1.00 0.00 ? 91  TYR A HE2  5  
ATOM 6841  H HH   . TYR A 1 68  ? 8.586   1.526   -4.723  1.00 0.00 ? 91  TYR A HH   5  
ATOM 6842  N N    . ASN A 1 69  ? 6.511   -3.760  1.089   1.00 0.00 ? 92  ASN A N    5  
ATOM 6843  C CA   . ASN A 1 69  ? 7.332   -3.417  2.255   1.00 0.00 ? 92  ASN A CA   5  
ATOM 6844  C C    . ASN A 1 69  ? 6.888   -2.076  2.831   1.00 0.00 ? 92  ASN A C    5  
ATOM 6845  O O    . ASN A 1 69  ? 6.395   -1.216  2.101   1.00 0.00 ? 92  ASN A O    5  
ATOM 6846  C CB   . ASN A 1 69  ? 8.842   -3.413  1.980   1.00 0.00 ? 92  ASN A CB   5  
ATOM 6847  C CG   . ASN A 1 69  ? 9.622   -3.549  3.275   1.00 0.00 ? 92  ASN A CG   5  
ATOM 6848  O OD1  . ASN A 1 69  ? 9.575   -4.584  3.926   1.00 0.00 ? 92  ASN A OD1  5  
ATOM 6849  N ND2  . ASN A 1 69  ? 10.339  -2.529  3.701   1.00 0.00 ? 92  ASN A ND2  5  
ATOM 6850  H H    . ASN A 1 69  ? 5.668   -4.263  1.316   1.00 0.00 ? 92  ASN A H    5  
ATOM 6851  H HA   . ASN A 1 69  ? 7.148   -4.186  3.000   1.00 0.00 ? 92  ASN A HA   5  
ATOM 6852  H HB2  . ASN A 1 69  ? 9.094   -4.262  1.356   1.00 0.00 ? 92  ASN A HB2  5  
ATOM 6853  H HB3  . ASN A 1 69  ? 9.125   -2.499  1.458   1.00 0.00 ? 92  ASN A HB3  5  
ATOM 6854  H HD21 . ASN A 1 69  ? 10.462  -1.701  3.128   1.00 0.00 ? 92  ASN A HD21 5  
ATOM 6855  H HD22 . ASN A 1 69  ? 10.939  -2.668  4.505   1.00 0.00 ? 92  ASN A HD22 5  
ATOM 6856  N N    . GLY A 1 70  ? 7.085   -1.872  4.134   1.00 0.00 ? 93  GLY A N    5  
ATOM 6857  C CA   . GLY A 1 70  ? 6.567   -0.689  4.806   1.00 0.00 ? 93  GLY A CA   5  
ATOM 6858  C C    . GLY A 1 70  ? 7.229   0.606   4.357   1.00 0.00 ? 93  GLY A C    5  
ATOM 6859  O O    . GLY A 1 70  ? 6.585   1.657   4.426   1.00 0.00 ? 93  GLY A O    5  
ATOM 6860  H H    . GLY A 1 70  ? 7.491   -2.601  4.707   1.00 0.00 ? 93  GLY A H    5  
ATOM 6861  H HA2  . GLY A 1 70  ? 5.502   -0.603  4.587   1.00 0.00 ? 93  GLY A HA2  5  
ATOM 6862  H HA3  . GLY A 1 70  ? 6.704   -0.797  5.880   1.00 0.00 ? 93  GLY A HA3  5  
ATOM 6863  N N    . CYS A 1 71  ? 8.480   0.572   3.892   1.00 0.00 ? 94  CYS A N    5  
ATOM 6864  C CA   . CYS A 1 71  ? 9.162   1.700   3.322   1.00 0.00 ? 94  CYS A CA   5  
ATOM 6865  C C    . CYS A 1 71  ? 10.316  1.171   2.470   1.00 0.00 ? 94  CYS A C    5  
ATOM 6866  O O    . CYS A 1 71  ? 10.698  -0.001  2.549   1.00 0.00 ? 94  CYS A O    5  
ATOM 6867  C CB   . CYS A 1 71  ? 9.639   2.625   4.450   1.00 0.00 ? 94  CYS A CB   5  
ATOM 6868  S SG   . CYS A 1 71  ? 9.759   4.363   3.986   1.00 0.00 ? 94  CYS A SG   5  
ATOM 6869  H H    . CYS A 1 71  ? 8.999   -0.273  3.728   1.00 0.00 ? 94  CYS A H    5  
ATOM 6870  H HA   . CYS A 1 71  ? 8.459   2.220   2.674   1.00 0.00 ? 94  CYS A HA   5  
ATOM 6871  H HB2  . CYS A 1 71  ? 8.944   2.568   5.287   1.00 0.00 ? 94  CYS A HB2  5  
ATOM 6872  H HB3  . CYS A 1 71  ? 10.609  2.277   4.796   1.00 0.00 ? 94  CYS A HB3  5  
ATOM 6873  N N    . SER A 1 72  ? 10.853  2.055   1.653   1.00 0.00 ? 95  SER A N    5  
ATOM 6874  C CA   . SER A 1 72  ? 11.829  1.804   0.605   1.00 0.00 ? 95  SER A CA   5  
ATOM 6875  C C    . SER A 1 72  ? 12.992  2.790   0.753   1.00 0.00 ? 95  SER A C    5  
ATOM 6876  O O    . SER A 1 72  ? 14.151  2.373   0.819   1.00 0.00 ? 95  SER A O    5  
ATOM 6877  C CB   . SER A 1 72  ? 11.095  1.933   -0.738  1.00 0.00 ? 95  SER A CB   5  
ATOM 6878  O OG   . SER A 1 72  ? 11.976  1.869   -1.836  1.00 0.00 ? 95  SER A OG   5  
ATOM 6879  H H    . SER A 1 72  ? 10.440  2.969   1.729   1.00 0.00 ? 95  SER A H    5  
ATOM 6880  H HA   . SER A 1 72  ? 12.218  0.789   0.695   1.00 0.00 ? 95  SER A HA   5  
ATOM 6881  H HB2  . SER A 1 72  ? 10.353  1.136   -0.822  1.00 0.00 ? 95  SER A HB2  5  
ATOM 6882  H HB3  . SER A 1 72  ? 10.577  2.890   -0.772  1.00 0.00 ? 95  SER A HB3  5  
ATOM 6883  H HG   . SER A 1 72  ? 12.054  0.925   -2.084  1.00 0.00 ? 95  SER A HG   5  
ATOM 6884  N N    . GLU A 1 73  ? 12.675  4.084   0.813   1.00 0.00 ? 96  GLU A N    5  
ATOM 6885  C CA   . GLU A 1 73  ? 13.589  5.192   1.043   1.00 0.00 ? 96  GLU A CA   5  
ATOM 6886  C C    . GLU A 1 73  ? 12.915  6.247   1.919   1.00 0.00 ? 96  GLU A C    5  
ATOM 6887  O O    . GLU A 1 73  ? 11.684  6.321   2.009   1.00 0.00 ? 96  GLU A O    5  
ATOM 6888  C CB   . GLU A 1 73  ? 13.995  5.821   -0.297  1.00 0.00 ? 96  GLU A CB   5  
ATOM 6889  C CG   . GLU A 1 73  ? 14.971  4.941   -1.088  1.00 0.00 ? 96  GLU A CG   5  
ATOM 6890  C CD   . GLU A 1 73  ? 16.172  5.719   -1.617  1.00 0.00 ? 96  GLU A CD   5  
ATOM 6891  O OE1  . GLU A 1 73  ? 16.919  6.259   -0.765  1.00 0.00 ? 96  GLU A OE1  5  
ATOM 6892  O OE2  . GLU A 1 73  ? 16.371  5.744   -2.850  1.00 0.00 ? 96  GLU A OE2  5  
ATOM 6893  H H    . GLU A 1 73  ? 11.700  4.336   0.712   1.00 0.00 ? 96  GLU A H    5  
ATOM 6894  H HA   . GLU A 1 73  ? 14.480  4.835   1.562   1.00 0.00 ? 96  GLU A HA   5  
ATOM 6895  H HB2  . GLU A 1 73  ? 13.103  6.006   -0.896  1.00 0.00 ? 96  GLU A HB2  5  
ATOM 6896  H HB3  . GLU A 1 73  ? 14.455  6.786   -0.103  1.00 0.00 ? 96  GLU A HB3  5  
ATOM 6897  H HG2  . GLU A 1 73  ? 15.371  4.160   -0.444  1.00 0.00 ? 96  GLU A HG2  5  
ATOM 6898  H HG3  . GLU A 1 73  ? 14.426  4.471   -1.906  1.00 0.00 ? 96  GLU A HG3  5  
ATOM 6899  N N    . ALA A 1 74  ? 13.730  7.127   2.496   1.00 0.00 ? 97  ALA A N    5  
ATOM 6900  C CA   . ALA A 1 74  ? 13.335  8.104   3.498   1.00 0.00 ? 97  ALA A CA   5  
ATOM 6901  C C    . ALA A 1 74  ? 13.585  9.524   2.988   1.00 0.00 ? 97  ALA A C    5  
ATOM 6902  O O    . ALA A 1 74  ? 13.817  10.445  3.776   1.00 0.00 ? 97  ALA A O    5  
ATOM 6903  C CB   . ALA A 1 74  ? 14.123  7.821   4.769   1.00 0.00 ? 97  ALA A CB   5  
ATOM 6904  H H    . ALA A 1 74  ? 14.727  7.056   2.334   1.00 0.00 ? 97  ALA A H    5  
ATOM 6905  H HA   . ALA A 1 74  ? 12.273  7.992   3.726   1.00 0.00 ? 97  ALA A HA   5  
ATOM 6906  H HB1  . ALA A 1 74  ? 15.166  8.086   4.610   1.00 0.00 ? 97  ALA A HB1  5  
ATOM 6907  H HB2  . ALA A 1 74  ? 13.710  8.403   5.591   1.00 0.00 ? 97  ALA A HB2  5  
ATOM 6908  H HB3  . ALA A 1 74  ? 14.070  6.764   5.017   1.00 0.00 ? 97  ALA A HB3  5  
ATOM 6909  N N    . ASN A 1 75  ? 13.585  9.694   1.664   1.00 0.00 ? 98  ASN A N    5  
ATOM 6910  C CA   . ASN A 1 75  ? 13.845  10.946  0.947   1.00 0.00 ? 98  ASN A CA   5  
ATOM 6911  C C    . ASN A 1 75  ? 12.930  11.117  -0.277  1.00 0.00 ? 98  ASN A C    5  
ATOM 6912  O O    . ASN A 1 75  ? 13.221  11.938  -1.145  1.00 0.00 ? 98  ASN A O    5  
ATOM 6913  C CB   . ASN A 1 75  ? 15.327  11.036  0.534   1.00 0.00 ? 98  ASN A CB   5  
ATOM 6914  C CG   . ASN A 1 75  ? 15.696  9.961   -0.474  1.00 0.00 ? 98  ASN A CG   5  
ATOM 6915  O OD1  . ASN A 1 75  ? 15.542  10.138  -1.678  1.00 0.00 ? 98  ASN A OD1  5  
ATOM 6916  N ND2  . ASN A 1 75  ? 16.157  8.825   0.016   1.00 0.00 ? 98  ASN A ND2  5  
ATOM 6917  H H    . ASN A 1 75  ? 13.518  8.837   1.127   1.00 0.00 ? 98  ASN A H    5  
ATOM 6918  H HA   . ASN A 1 75  ? 13.642  11.774  1.621   1.00 0.00 ? 98  ASN A HA   5  
ATOM 6919  H HB2  . ASN A 1 75  ? 15.520  12.015  0.088   1.00 0.00 ? 98  ASN A HB2  5  
ATOM 6920  H HB3  . ASN A 1 75  ? 15.967  10.946  1.412   1.00 0.00 ? 98  ASN A HB3  5  
ATOM 6921  H HD21 . ASN A 1 75  ? 16.345  8.739   1.014   1.00 0.00 ? 98  ASN A HD21 5  
ATOM 6922  H HD22 . ASN A 1 75  ? 16.422  8.022   -0.557  1.00 0.00 ? 98  ASN A HD22 5  
ATOM 6923  N N    . VAL A 1 76  ? 11.831  10.367  -0.370  1.00 0.00 ? 99  VAL A N    5  
ATOM 6924  C CA   . VAL A 1 76  ? 10.991  10.241  -1.565  1.00 0.00 ? 99  VAL A CA   5  
ATOM 6925  C C    . VAL A 1 76  ? 9.716   11.072  -1.433  1.00 0.00 ? 99  VAL A C    5  
ATOM 6926  O O    . VAL A 1 76  ? 9.516   11.751  -0.426  1.00 0.00 ? 99  VAL A O    5  
ATOM 6927  C CB   . VAL A 1 76  ? 10.708  8.750   -1.849  1.00 0.00 ? 99  VAL A CB   5  
ATOM 6928  C CG1  . VAL A 1 76  ? 11.927  8.112   -2.516  1.00 0.00 ? 99  VAL A CG1  5  
ATOM 6929  C CG2  . VAL A 1 76  ? 10.289  7.992   -0.581  1.00 0.00 ? 99  VAL A CG2  5  
ATOM 6930  H H    . VAL A 1 76  ? 11.481  9.901   0.453   1.00 0.00 ? 99  VAL A H    5  
ATOM 6931  H HA   . VAL A 1 76  ? 11.527  10.644  -2.422  1.00 0.00 ? 99  VAL A HA   5  
ATOM 6932  H HB   . VAL A 1 76  ? 9.892   8.668   -2.566  1.00 0.00 ? 99  VAL A HB   5  
ATOM 6933  H HG11 . VAL A 1 76  ? 12.117  8.610   -3.468  1.00 0.00 ? 99  VAL A HG11 5  
ATOM 6934  H HG12 . VAL A 1 76  ? 12.810  8.195   -1.883  1.00 0.00 ? 99  VAL A HG12 5  
ATOM 6935  H HG13 . VAL A 1 76  ? 11.717  7.063   -2.723  1.00 0.00 ? 99  VAL A HG13 5  
ATOM 6936  H HG21 . VAL A 1 76  ? 10.094  6.950   -0.823  1.00 0.00 ? 99  VAL A HG21 5  
ATOM 6937  H HG22 . VAL A 1 76  ? 11.076  8.018   0.169   1.00 0.00 ? 99  VAL A HG22 5  
ATOM 6938  H HG23 . VAL A 1 76  ? 9.383   8.445   -0.179  1.00 0.00 ? 99  VAL A HG23 5  
ATOM 6939  N N    . THR A 1 77  ? 8.857   11.029  -2.452  1.00 0.00 ? 100 THR A N    5  
ATOM 6940  C CA   . THR A 1 77  ? 7.646   11.829  -2.512  1.00 0.00 ? 100 THR A CA   5  
ATOM 6941  C C    . THR A 1 77  ? 6.426   10.934  -2.716  1.00 0.00 ? 100 THR A C    5  
ATOM 6942  O O    . THR A 1 77  ? 6.534   9.797   -3.170  1.00 0.00 ? 100 THR A O    5  
ATOM 6943  C CB   . THR A 1 77  ? 7.775   12.872  -3.637  1.00 0.00 ? 100 THR A CB   5  
ATOM 6944  O OG1  . THR A 1 77  ? 7.870   12.199  -4.877  1.00 0.00 ? 100 THR A OG1  5  
ATOM 6945  C CG2  . THR A 1 77  ? 8.991   13.787  -3.477  1.00 0.00 ? 100 THR A CG2  5  
ATOM 6946  H H    . THR A 1 77  ? 9.044   10.480  -3.274  1.00 0.00 ? 100 THR A H    5  
ATOM 6947  H HA   . THR A 1 77  ? 7.531   12.340  -1.570  1.00 0.00 ? 100 THR A HA   5  
ATOM 6948  H HB   . THR A 1 77  ? 6.878   13.492  -3.642  1.00 0.00 ? 100 THR A HB   5  
ATOM 6949  H HG1  . THR A 1 77  ? 8.216   12.813  -5.545  1.00 0.00 ? 100 THR A HG1  5  
ATOM 6950  H HG21 . THR A 1 77  ? 9.919   13.219  -3.516  1.00 0.00 ? 100 THR A HG21 5  
ATOM 6951  H HG22 . THR A 1 77  ? 9.001   14.514  -4.285  1.00 0.00 ? 100 THR A HG22 5  
ATOM 6952  H HG23 . THR A 1 77  ? 8.931   14.319  -2.525  1.00 0.00 ? 100 THR A HG23 5  
ATOM 6953  N N    . LYS A 1 78  ? 5.238   11.511  -2.476  1.00 0.00 ? 101 LYS A N    5  
ATOM 6954  C CA   . LYS A 1 78  ? 3.952   10.949  -2.873  1.00 0.00 ? 101 LYS A CA   5  
ATOM 6955  C C    . LYS A 1 78  ? 3.761   10.821  -4.378  1.00 0.00 ? 101 LYS A C    5  
ATOM 6956  O O    . LYS A 1 78  ? 2.673   10.416  -4.790  1.00 0.00 ? 101 LYS A O    5  
ATOM 6957  C CB   . LYS A 1 78  ? 2.791   11.730  -2.239  1.00 0.00 ? 101 LYS A CB   5  
ATOM 6958  C CG   . LYS A 1 78  ? 2.129   10.854  -1.180  1.00 0.00 ? 101 LYS A CG   5  
ATOM 6959  C CD   . LYS A 1 78  ? 0.868   11.498  -0.595  1.00 0.00 ? 101 LYS A CD   5  
ATOM 6960  C CE   . LYS A 1 78  ? -0.328  11.021  -1.425  1.00 0.00 ? 101 LYS A CE   5  
ATOM 6961  N NZ   . LYS A 1 78  ? -1.598  11.648  -1.018  1.00 0.00 ? 101 LYS A NZ   5  
ATOM 6962  H H    . LYS A 1 78  ? 5.222   12.422  -2.036  1.00 0.00 ? 101 LYS A H    5  
ATOM 6963  H HA   . LYS A 1 78  ? 3.940   9.917   -2.503  1.00 0.00 ? 101 LYS A HA   5  
ATOM 6964  H HB2  . LYS A 1 78  ? 3.147   12.656  -1.783  1.00 0.00 ? 101 LYS A HB2  5  
ATOM 6965  H HB3  . LYS A 1 78  ? 2.040   11.993  -2.986  1.00 0.00 ? 101 LYS A HB3  5  
ATOM 6966  H HG2  . LYS A 1 78  ? 1.882   9.880   -1.602  1.00 0.00 ? 101 LYS A HG2  5  
ATOM 6967  H HG3  . LYS A 1 78  ? 2.858   10.689  -0.403  1.00 0.00 ? 101 LYS A HG3  5  
ATOM 6968  H HD2  . LYS A 1 78  ? 0.744   11.180  0.441   1.00 0.00 ? 101 LYS A HD2  5  
ATOM 6969  H HD3  . LYS A 1 78  ? 0.956   12.584  -0.617  1.00 0.00 ? 101 LYS A HD3  5  
ATOM 6970  H HE2  . LYS A 1 78  ? -0.146  11.226  -2.482  1.00 0.00 ? 101 LYS A HE2  5  
ATOM 6971  H HE3  . LYS A 1 78  ? -0.421  9.940   -1.302  1.00 0.00 ? 101 LYS A HE3  5  
ATOM 6972  H HZ1  . LYS A 1 78  ? -1.559  12.652  -1.180  1.00 0.00 ? 101 LYS A HZ1  5  
ATOM 6973  H HZ2  . LYS A 1 78  ? -2.361  11.234  -1.531  1.00 0.00 ? 101 LYS A HZ2  5  
ATOM 6974  H HZ3  . LYS A 1 78  ? -1.774  11.542  -0.020  1.00 0.00 ? 101 LYS A HZ3  5  
ATOM 6975  N N    . GLU A 1 79  ? 4.729   11.218  -5.212  1.00 0.00 ? 102 GLU A N    5  
ATOM 6976  C CA   . GLU A 1 79  ? 4.693   10.975  -6.649  1.00 0.00 ? 102 GLU A CA   5  
ATOM 6977  C C    . GLU A 1 79  ? 5.822   10.052  -7.132  1.00 0.00 ? 102 GLU A C    5  
ATOM 6978  O O    . GLU A 1 79  ? 5.841   9.699   -8.316  1.00 0.00 ? 102 GLU A O    5  
ATOM 6979  C CB   . GLU A 1 79  ? 4.708   12.323  -7.376  1.00 0.00 ? 102 GLU A CB   5  
ATOM 6980  C CG   . GLU A 1 79  ? 3.283   12.854  -7.639  1.00 0.00 ? 102 GLU A CG   5  
ATOM 6981  C CD   . GLU A 1 79  ? 2.494   12.029  -8.663  1.00 0.00 ? 102 GLU A CD   5  
ATOM 6982  O OE1  . GLU A 1 79  ? 1.816   11.054  -8.269  1.00 0.00 ? 102 GLU A OE1  5  
ATOM 6983  O OE2  . GLU A 1 79  ? 2.533   12.352  -9.870  1.00 0.00 ? 102 GLU A OE2  5  
ATOM 6984  H H    . GLU A 1 79  ? 5.592   11.614  -4.871  1.00 0.00 ? 102 GLU A H    5  
ATOM 6985  H HA   . GLU A 1 79  ? 3.769   10.444  -6.886  1.00 0.00 ? 102 GLU A HA   5  
ATOM 6986  H HB2  . GLU A 1 79  ? 5.258   13.042  -6.769  1.00 0.00 ? 102 GLU A HB2  5  
ATOM 6987  H HB3  . GLU A 1 79  ? 5.268   12.229  -8.302  1.00 0.00 ? 102 GLU A HB3  5  
ATOM 6988  H HG2  . GLU A 1 79  ? 2.731   12.861  -6.698  1.00 0.00 ? 102 GLU A HG2  5  
ATOM 6989  H HG3  . GLU A 1 79  ? 3.342   13.878  -8.005  1.00 0.00 ? 102 GLU A HG3  5  
ATOM 6990  N N    . ALA A 1 80  ? 6.700   9.598   -6.233  1.00 0.00 ? 103 ALA A N    5  
ATOM 6991  C CA   . ALA A 1 80  ? 7.770   8.661   -6.517  1.00 0.00 ? 103 ALA A CA   5  
ATOM 6992  C C    . ALA A 1 80  ? 7.431   7.289   -5.924  1.00 0.00 ? 103 ALA A C    5  
ATOM 6993  O O    . ALA A 1 80  ? 7.354   6.295   -6.647  1.00 0.00 ? 103 ALA A O    5  
ATOM 6994  C CB   . ALA A 1 80  ? 9.065   9.250   -5.947  1.00 0.00 ? 103 ALA A CB   5  
ATOM 6995  H H    . ALA A 1 80  ? 6.615   9.883   -5.266  1.00 0.00 ? 103 ALA A H    5  
ATOM 6996  H HA   . ALA A 1 80  ? 7.890   8.550   -7.596  1.00 0.00 ? 103 ALA A HA   5  
ATOM 6997  H HB1  . ALA A 1 80  ? 9.248   10.213  -6.427  1.00 0.00 ? 103 ALA A HB1  5  
ATOM 6998  H HB2  . ALA A 1 80  ? 8.986   9.401   -4.870  1.00 0.00 ? 103 ALA A HB2  5  
ATOM 6999  H HB3  . ALA A 1 80  ? 9.899   8.579   -6.148  1.00 0.00 ? 103 ALA A HB3  5  
ATOM 7000  N N    . PHE A 1 81  ? 7.226   7.227   -4.606  1.00 0.00 ? 104 PHE A N    5  
ATOM 7001  C CA   . PHE A 1 81  ? 7.193   5.979   -3.845  1.00 0.00 ? 104 PHE A CA   5  
ATOM 7002  C C    . PHE A 1 81  ? 5.846   5.245   -3.967  1.00 0.00 ? 104 PHE A C    5  
ATOM 7003  O O    . PHE A 1 81  ? 5.821   4.023   -4.126  1.00 0.00 ? 104 PHE A O    5  
ATOM 7004  C CB   . PHE A 1 81  ? 7.593   6.289   -2.388  1.00 0.00 ? 104 PHE A CB   5  
ATOM 7005  C CG   . PHE A 1 81  ? 6.835   5.530   -1.324  1.00 0.00 ? 104 PHE A CG   5  
ATOM 7006  C CD1  . PHE A 1 81  ? 5.597   6.039   -0.896  1.00 0.00 ? 104 PHE A CD1  5  
ATOM 7007  C CD2  . PHE A 1 81  ? 7.331   4.324   -0.792  1.00 0.00 ? 104 PHE A CD2  5  
ATOM 7008  C CE1  . PHE A 1 81  ? 4.828   5.319   0.024   1.00 0.00 ? 104 PHE A CE1  5  
ATOM 7009  C CE2  . PHE A 1 81  ? 6.587   3.636   0.186   1.00 0.00 ? 104 PHE A CE2  5  
ATOM 7010  C CZ   . PHE A 1 81  ? 5.326   4.123   0.575   1.00 0.00 ? 104 PHE A CZ   5  
ATOM 7011  H H    . PHE A 1 81  ? 7.205   8.094   -4.081  1.00 0.00 ? 104 PHE A H    5  
ATOM 7012  H HA   . PHE A 1 81  ? 7.952   5.308   -4.253  1.00 0.00 ? 104 PHE A HA   5  
ATOM 7013  H HB2  . PHE A 1 81  ? 8.655   6.082   -2.270  1.00 0.00 ? 104 PHE A HB2  5  
ATOM 7014  H HB3  . PHE A 1 81  ? 7.455   7.353   -2.189  1.00 0.00 ? 104 PHE A HB3  5  
ATOM 7015  H HD1  . PHE A 1 81  ? 5.227   6.982   -1.282  1.00 0.00 ? 104 PHE A HD1  5  
ATOM 7016  H HD2  . PHE A 1 81  ? 8.285   3.931   -1.129  1.00 0.00 ? 104 PHE A HD2  5  
ATOM 7017  H HE1  . PHE A 1 81  ? 3.852   5.703   0.282   1.00 0.00 ? 104 PHE A HE1  5  
ATOM 7018  H HE2  . PHE A 1 81  ? 6.947   2.709   0.617   1.00 0.00 ? 104 PHE A HE2  5  
ATOM 7019  H HZ   . PHE A 1 81  ? 4.731   3.547   1.268   1.00 0.00 ? 104 PHE A HZ   5  
ATOM 7020  N N    . VAL A 1 82  ? 4.711   5.953   -3.921  1.00 0.00 ? 105 VAL A N    5  
ATOM 7021  C CA   . VAL A 1 82  ? 3.396   5.332   -4.127  1.00 0.00 ? 105 VAL A CA   5  
ATOM 7022  C C    . VAL A 1 82  ? 3.320   4.847   -5.588  1.00 0.00 ? 105 VAL A C    5  
ATOM 7023  O O    . VAL A 1 82  ? 2.723   3.815   -5.879  1.00 0.00 ? 105 VAL A O    5  
ATOM 7024  C CB   . VAL A 1 82  ? 2.262   6.320   -3.742  1.00 0.00 ? 105 VAL A CB   5  
ATOM 7025  C CG1  . VAL A 1 82  ? 0.854   5.783   -4.019  1.00 0.00 ? 105 VAL A CG1  5  
ATOM 7026  C CG2  . VAL A 1 82  ? 2.350   6.818   -2.297  1.00 0.00 ? 105 VAL A CG2  5  
ATOM 7027  H H    . VAL A 1 82  ? 4.761   6.965   -3.927  1.00 0.00 ? 105 VAL A H    5  
ATOM 7028  H HA   . VAL A 1 82  ? 3.319   4.457   -3.479  1.00 0.00 ? 105 VAL A HA   5  
ATOM 7029  H HB   . VAL A 1 82  ? 2.360   7.219   -4.320  1.00 0.00 ? 105 VAL A HB   5  
ATOM 7030  H HG11 . VAL A 1 82  ? 0.747   5.550   -5.077  1.00 0.00 ? 105 VAL A HG11 5  
ATOM 7031  H HG12 . VAL A 1 82  ? 0.657   4.887   -3.440  1.00 0.00 ? 105 VAL A HG12 5  
ATOM 7032  H HG13 . VAL A 1 82  ? 0.118   6.548   -3.775  1.00 0.00 ? 105 VAL A HG13 5  
ATOM 7033  H HG21 . VAL A 1 82  ? 3.249   7.422   -2.186  1.00 0.00 ? 105 VAL A HG21 5  
ATOM 7034  H HG22 . VAL A 1 82  ? 1.503   7.472   -2.088  1.00 0.00 ? 105 VAL A HG22 5  
ATOM 7035  H HG23 . VAL A 1 82  ? 2.360   5.978   -1.605  1.00 0.00 ? 105 VAL A HG23 5  
ATOM 7036  N N    . THR A 1 83  ? 3.987   5.539   -6.508  1.00 0.00 ? 106 THR A N    5  
ATOM 7037  C CA   . THR A 1 83  ? 4.050   5.244   -7.920  1.00 0.00 ? 106 THR A CA   5  
ATOM 7038  C C    . THR A 1 83  ? 4.817   3.944   -8.151  1.00 0.00 ? 106 THR A C    5  
ATOM 7039  O O    . THR A 1 83  ? 4.377   3.133   -8.960  1.00 0.00 ? 106 THR A O    5  
ATOM 7040  C CB   . THR A 1 83  ? 4.701   6.427   -8.655  1.00 0.00 ? 106 THR A CB   5  
ATOM 7041  O OG1  . THR A 1 83  ? 4.062   7.643   -8.333  1.00 0.00 ? 106 THR A OG1  5  
ATOM 7042  C CG2  . THR A 1 83  ? 4.627   6.218   -10.154 1.00 0.00 ? 106 THR A CG2  5  
ATOM 7043  H H    . THR A 1 83  ? 4.395   6.412   -6.217  1.00 0.00 ? 106 THR A H    5  
ATOM 7044  H HA   . THR A 1 83  ? 3.029   5.124   -8.286  1.00 0.00 ? 106 THR A HA   5  
ATOM 7045  H HB   . THR A 1 83  ? 5.748   6.507   -8.377  1.00 0.00 ? 106 THR A HB   5  
ATOM 7046  H HG1  . THR A 1 83  ? 4.636   8.366   -8.644  1.00 0.00 ? 106 THR A HG1  5  
ATOM 7047  H HG21 . THR A 1 83  ? 5.060   7.071   -10.676 1.00 0.00 ? 106 THR A HG21 5  
ATOM 7048  H HG22 . THR A 1 83  ? 5.192   5.319   -10.393 1.00 0.00 ? 106 THR A HG22 5  
ATOM 7049  H HG23 . THR A 1 83  ? 3.589   6.084   -10.459 1.00 0.00 ? 106 THR A HG23 5  
ATOM 7050  N N    . GLY A 1 84  ? 5.941   3.707   -7.467  1.00 0.00 ? 107 GLY A N    5  
ATOM 7051  C CA   . GLY A 1 84  ? 6.643   2.432   -7.580  1.00 0.00 ? 107 GLY A CA   5  
ATOM 7052  C C    . GLY A 1 84  ? 5.772   1.285   -7.067  1.00 0.00 ? 107 GLY A C    5  
ATOM 7053  O O    . GLY A 1 84  ? 5.803   0.185   -7.617  1.00 0.00 ? 107 GLY A O    5  
ATOM 7054  H H    . GLY A 1 84  ? 6.313   4.405   -6.831  1.00 0.00 ? 107 GLY A H    5  
ATOM 7055  H HA2  . GLY A 1 84  ? 6.903   2.239   -8.624  1.00 0.00 ? 107 GLY A HA2  5  
ATOM 7056  H HA3  . GLY A 1 84  ? 7.558   2.475   -6.992  1.00 0.00 ? 107 GLY A HA3  5  
ATOM 7057  N N    . CYS A 1 85  ? 4.947   1.567   -6.054  1.00 0.00 ? 108 CYS A N    5  
ATOM 7058  C CA   . CYS A 1 85  ? 3.971   0.622   -5.513  1.00 0.00 ? 108 CYS A CA   5  
ATOM 7059  C C    . CYS A 1 85  ? 2.930   0.315   -6.591  1.00 0.00 ? 108 CYS A C    5  
ATOM 7060  O O    . CYS A 1 85  ? 2.588   -0.845  -6.836  1.00 0.00 ? 108 CYS A O    5  
ATOM 7061  C CB   . CYS A 1 85  ? 3.361   1.171   -4.205  1.00 0.00 ? 108 CYS A CB   5  
ATOM 7062  S SG   . CYS A 1 85  ? 1.555   1.119   -3.994  1.00 0.00 ? 108 CYS A SG   5  
ATOM 7063  H H    . CYS A 1 85  ? 4.921   2.542   -5.779  1.00 0.00 ? 108 CYS A H    5  
ATOM 7064  H HA   . CYS A 1 85  ? 4.487   -0.308  -5.279  1.00 0.00 ? 108 CYS A HA   5  
ATOM 7065  H HB2  . CYS A 1 85  ? 3.813   0.631   -3.371  1.00 0.00 ? 108 CYS A HB2  5  
ATOM 7066  H HB3  . CYS A 1 85  ? 3.654   2.212   -4.090  1.00 0.00 ? 108 CYS A HB3  5  
ATOM 7067  N N    . ILE A 1 86  ? 2.431   1.356   -7.254  1.00 0.00 ? 109 ILE A N    5  
ATOM 7068  C CA   . ILE A 1 86  ? 1.411   1.248   -8.276  1.00 0.00 ? 109 ILE A CA   5  
ATOM 7069  C C    . ILE A 1 86  ? 1.936   0.525   -9.490  1.00 0.00 ? 109 ILE A C    5  
ATOM 7070  O O    . ILE A 1 86  ? 1.284   -0.398  -9.932  1.00 0.00 ? 109 ILE A O    5  
ATOM 7071  C CB   . ILE A 1 86  ? 0.811   2.628   -8.571  1.00 0.00 ? 109 ILE A CB   5  
ATOM 7072  C CG1  . ILE A 1 86  ? -0.382  2.739   -7.613  1.00 0.00 ? 109 ILE A CG1  5  
ATOM 7073  C CG2  . ILE A 1 86  ? 0.381   2.892   -10.023 1.00 0.00 ? 109 ILE A CG2  5  
ATOM 7074  C CD1  . ILE A 1 86  ? -0.759  4.192   -7.423  1.00 0.00 ? 109 ILE A CD1  5  
ATOM 7075  H H    . ILE A 1 86  ? 2.685   2.286   -6.940  1.00 0.00 ? 109 ILE A H    5  
ATOM 7076  H HA   . ILE A 1 86  ? 0.634   0.617   -7.861  1.00 0.00 ? 109 ILE A HA   5  
ATOM 7077  H HB   . ILE A 1 86  ? 1.561   3.380   -8.325  1.00 0.00 ? 109 ILE A HB   5  
ATOM 7078  H HG12 . ILE A 1 86  ? -1.239  2.184   -7.996  1.00 0.00 ? 109 ILE A HG12 5  
ATOM 7079  H HG13 . ILE A 1 86  ? -0.113  2.314   -6.646  1.00 0.00 ? 109 ILE A HG13 5  
ATOM 7080  H HG21 . ILE A 1 86  ? -0.073  3.877   -10.112 1.00 0.00 ? 109 ILE A HG21 5  
ATOM 7081  H HG22 . ILE A 1 86  ? 1.259   2.891   -10.665 1.00 0.00 ? 109 ILE A HG22 5  
ATOM 7082  H HG23 . ILE A 1 86  ? -0.325  2.135   -10.374 1.00 0.00 ? 109 ILE A HG23 5  
ATOM 7083  H HD11 . ILE A 1 86  ? 0.149   4.768   -7.251  1.00 0.00 ? 109 ILE A HD11 5  
ATOM 7084  H HD12 . ILE A 1 86  ? -1.249  4.551   -8.327  1.00 0.00 ? 109 ILE A HD12 5  
ATOM 7085  H HD13 . ILE A 1 86  ? -1.420  4.250   -6.563  1.00 0.00 ? 109 ILE A HD13 5  
ATOM 7086  N N    . ASN A 1 87  ? 3.109   0.865   -10.004 1.00 0.00 ? 110 ASN A N    5  
ATOM 7087  C CA   . ASN A 1 87  ? 3.707   0.120   -11.122 1.00 0.00 ? 110 ASN A CA   5  
ATOM 7088  C C    . ASN A 1 87  ? 3.779   -1.373  -10.817 1.00 0.00 ? 110 ASN A C    5  
ATOM 7089  O O    . ASN A 1 87  ? 3.633   -2.205  -11.709 1.00 0.00 ? 110 ASN A O    5  
ATOM 7090  C CB   . ASN A 1 87  ? 5.112   0.626   -11.459 1.00 0.00 ? 110 ASN A CB   5  
ATOM 7091  C CG   . ASN A 1 87  ? 5.029   1.875   -12.306 1.00 0.00 ? 110 ASN A CG   5  
ATOM 7092  O OD1  . ASN A 1 87  ? 4.844   1.817   -13.518 1.00 0.00 ? 110 ASN A OD1  5  
ATOM 7093  N ND2  . ASN A 1 87  ? 5.105   3.022   -11.674 1.00 0.00 ? 110 ASN A ND2  5  
ATOM 7094  H H    . ASN A 1 87  ? 3.501   1.714   -9.609  1.00 0.00 ? 110 ASN A H    5  
ATOM 7095  H HA   . ASN A 1 87  ? 3.075   0.245   -12.003 1.00 0.00 ? 110 ASN A HA   5  
ATOM 7096  H HB2  . ASN A 1 87  ? 5.680   0.806   -10.546 1.00 0.00 ? 110 ASN A HB2  5  
ATOM 7097  H HB3  . ASN A 1 87  ? 5.646   -0.134  -12.029 1.00 0.00 ? 110 ASN A HB3  5  
ATOM 7098  H HD21 . ASN A 1 87  ? 5.115   3.009   -10.659 1.00 0.00 ? 110 ASN A HD21 5  
ATOM 7099  H HD22 . ASN A 1 87  ? 5.008   3.892   -12.200 1.00 0.00 ? 110 ASN A HD22 5  
ATOM 7100  N N    . ALA A 1 88  ? 3.985   -1.721  -9.549  1.00 0.00 ? 111 ALA A N    5  
ATOM 7101  C CA   . ALA A 1 88  ? 4.059   -3.096  -9.114  1.00 0.00 ? 111 ALA A CA   5  
ATOM 7102  C C    . ALA A 1 88  ? 2.660   -3.731  -9.035  1.00 0.00 ? 111 ALA A C    5  
ATOM 7103  O O    . ALA A 1 88  ? 2.486   -4.860  -9.496  1.00 0.00 ? 111 ALA A O    5  
ATOM 7104  C CB   . ALA A 1 88  ? 4.817   -3.114  -7.785  1.00 0.00 ? 111 ALA A CB   5  
ATOM 7105  H H    . ALA A 1 88  ? 4.044   -1.006  -8.838  1.00 0.00 ? 111 ALA A H    5  
ATOM 7106  H HA   . ALA A 1 88  ? 4.644   -3.647  -9.853  1.00 0.00 ? 111 ALA A HA   5  
ATOM 7107  H HB1  . ALA A 1 88  ? 5.268   -4.093  -7.645  1.00 0.00 ? 111 ALA A HB1  5  
ATOM 7108  H HB2  . ALA A 1 88  ? 5.617   -2.374  -7.807  1.00 0.00 ? 111 ALA A HB2  5  
ATOM 7109  H HB3  . ALA A 1 88  ? 4.154   -2.873  -6.958  1.00 0.00 ? 111 ALA A HB3  5  
ATOM 7110  N N    . THR A 1 89  ? 1.658   -3.027  -8.493  1.00 0.00 ? 112 THR A N    5  
ATOM 7111  C CA   . THR A 1 89  ? 0.289   -3.544  -8.394  1.00 0.00 ? 112 THR A CA   5  
ATOM 7112  C C    . THR A 1 89  ? -0.390  -3.597  -9.766  1.00 0.00 ? 112 THR A C    5  
ATOM 7113  O O    . THR A 1 89  ? -1.143  -4.516  -10.069 1.00 0.00 ? 112 THR A O    5  
ATOM 7114  C CB   . THR A 1 89  ? -0.533  -2.734  -7.377  1.00 0.00 ? 112 THR A CB   5  
ATOM 7115  O OG1  . THR A 1 89  ? -1.549  -3.547  -6.860  1.00 0.00 ? 112 THR A OG1  5  
ATOM 7116  C CG2  . THR A 1 89  ? -1.237  -1.512  -7.961  1.00 0.00 ? 112 THR A CG2  5  
ATOM 7117  H H    . THR A 1 89  ? 1.872   -2.105  -8.123  1.00 0.00 ? 112 THR A H    5  
ATOM 7118  H HA   . THR A 1 89  ? 0.366   -4.561  -8.019  1.00 0.00 ? 112 THR A HA   5  
ATOM 7119  H HB   . THR A 1 89  ? 0.114   -2.427  -6.557  1.00 0.00 ? 112 THR A HB   5  
ATOM 7120  H HG1  . THR A 1 89  ? -1.117  -4.214  -6.286  1.00 0.00 ? 112 THR A HG1  5  
ATOM 7121  H HG21 . THR A 1 89  ? -0.534  -0.900  -8.498  1.00 0.00 ? 112 THR A HG21 5  
ATOM 7122  H HG22 . THR A 1 89  ? -1.996  -1.836  -8.665  1.00 0.00 ? 112 THR A HG22 5  
ATOM 7123  H HG23 . THR A 1 89  ? -1.694  -0.926  -7.174  1.00 0.00 ? 112 THR A HG23 5  
ATOM 7124  N N    . GLN A 1 90  ? -0.116  -2.619  -10.624 1.00 0.00 ? 113 GLN A N    5  
ATOM 7125  C CA   . GLN A 1 90  ? -0.568  -2.521  -11.996 1.00 0.00 ? 113 GLN A CA   5  
ATOM 7126  C C    . GLN A 1 90  ? -0.289  -3.846  -12.691 1.00 0.00 ? 113 GLN A C    5  
ATOM 7127  O O    . GLN A 1 90  ? -1.185  -4.420  -13.308 1.00 0.00 ? 113 GLN A O    5  
ATOM 7128  C CB   . GLN A 1 90  ? 0.210   -1.346  -12.600 1.00 0.00 ? 113 GLN A CB   5  
ATOM 7129  C CG   . GLN A 1 90  ? 0.013   -1.048  -14.075 1.00 0.00 ? 113 GLN A CG   5  
ATOM 7130  C CD   . GLN A 1 90  ? -1.321  -0.373  -14.345 1.00 0.00 ? 113 GLN A CD   5  
ATOM 7131  O OE1  . GLN A 1 90  ? -2.229  -0.968  -14.919 1.00 0.00 ? 113 GLN A OE1  5  
ATOM 7132  N NE2  . GLN A 1 90  ? -1.457  0.883   -13.959 1.00 0.00 ? 113 GLN A NE2  5  
ATOM 7133  H H    . GLN A 1 90  ? 0.471   -1.852  -10.311 1.00 0.00 ? 113 GLN A H    5  
ATOM 7134  H HA   . GLN A 1 90  ? -1.640  -2.320  -12.025 1.00 0.00 ? 113 GLN A HA   5  
ATOM 7135  H HB2  . GLN A 1 90  ? -0.066  -0.452  -12.051 1.00 0.00 ? 113 GLN A HB2  5  
ATOM 7136  H HB3  . GLN A 1 90  ? 1.274   -1.514  -12.451 1.00 0.00 ? 113 GLN A HB3  5  
ATOM 7137  H HG2  . GLN A 1 90  ? 0.810   -0.365  -14.362 1.00 0.00 ? 113 GLN A HG2  5  
ATOM 7138  H HG3  . GLN A 1 90  ? 0.114   -1.964  -14.652 1.00 0.00 ? 113 GLN A HG3  5  
ATOM 7139  H HE21 . GLN A 1 90  ? -0.682  1.352   -13.485 1.00 0.00 ? 113 GLN A HE21 5  
ATOM 7140  H HE22 . GLN A 1 90  ? -2.311  1.403   -14.132 1.00 0.00 ? 113 GLN A HE22 5  
ATOM 7141  N N    . ALA A 1 91  ? 0.931   -4.359  -12.540 1.00 0.00 ? 114 ALA A N    5  
ATOM 7142  C CA   . ALA A 1 91  ? 1.317   -5.642  -13.089 1.00 0.00 ? 114 ALA A CA   5  
ATOM 7143  C C    . ALA A 1 91  ? 0.813   -6.818  -12.248 1.00 0.00 ? 114 ALA A C    5  
ATOM 7144  O O    . ALA A 1 91  ? 0.644   -7.907  -12.792 1.00 0.00 ? 114 ALA A O    5  
ATOM 7145  C CB   . ALA A 1 91  ? 2.832   -5.687  -13.205 1.00 0.00 ? 114 ALA A CB   5  
ATOM 7146  H H    . ALA A 1 91  ? 1.618   -3.860  -11.991 1.00 0.00 ? 114 ALA A H    5  
ATOM 7147  H HA   . ALA A 1 91  ? 0.908   -5.735  -14.095 1.00 0.00 ? 114 ALA A HA   5  
ATOM 7148  H HB1  . ALA A 1 91  ? 3.187   -4.805  -13.734 1.00 0.00 ? 114 ALA A HB1  5  
ATOM 7149  H HB2  . ALA A 1 91  ? 3.292   -5.728  -12.217 1.00 0.00 ? 114 ALA A HB2  5  
ATOM 7150  H HB3  . ALA A 1 91  ? 3.089   -6.576  -13.778 1.00 0.00 ? 114 ALA A HB3  5  
ATOM 7151  N N    . ALA A 1 92  ? 0.544   -6.618  -10.949 1.00 0.00 ? 115 ALA A N    5  
ATOM 7152  C CA   . ALA A 1 92  ? -0.081  -7.645  -10.122 1.00 0.00 ? 115 ALA A CA   5  
ATOM 7153  C C    . ALA A 1 92  ? -1.462  -7.994  -10.708 1.00 0.00 ? 115 ALA A C    5  
ATOM 7154  O O    . ALA A 1 92  ? -1.823  -9.173  -10.770 1.00 0.00 ? 115 ALA A O    5  
ATOM 7155  C CB   . ALA A 1 92  ? -0.151  -7.226  -8.637  1.00 0.00 ? 115 ALA A CB   5  
ATOM 7156  H H    . ALA A 1 92  ? 0.631   -5.687  -10.558 1.00 0.00 ? 115 ALA A H    5  
ATOM 7157  H HA   . ALA A 1 92  ? 0.553   -8.528  -10.172 1.00 0.00 ? 115 ALA A HA   5  
ATOM 7158  H HB1  . ALA A 1 92  ? -0.862  -6.416  -8.490  1.00 0.00 ? 115 ALA A HB1  5  
ATOM 7159  H HB2  . ALA A 1 92  ? -0.478  -8.067  -8.020  1.00 0.00 ? 115 ALA A HB2  5  
ATOM 7160  H HB3  . ALA A 1 92  ? 0.825   -6.905  -8.274  1.00 0.00 ? 115 ALA A HB3  5  
ATOM 7161  N N    . ASN A 1 93  ? -2.205  -6.988  -11.196 1.00 0.00 ? 116 ASN A N    5  
ATOM 7162  C CA   . ASN A 1 93  ? -3.623  -7.098  -11.546 1.00 0.00 ? 116 ASN A CA   5  
ATOM 7163  C C    . ASN A 1 93  ? -3.913  -6.476  -12.923 1.00 0.00 ? 116 ASN A C    5  
ATOM 7164  O O    . ASN A 1 93  ? -4.854  -5.688  -13.054 1.00 0.00 ? 116 ASN A O    5  
ATOM 7165  C CB   . ASN A 1 93  ? -4.536  -6.518  -10.432 1.00 0.00 ? 116 ASN A CB   5  
ATOM 7166  C CG   . ASN A 1 93  ? -3.951  -6.518  -9.040  1.00 0.00 ? 116 ASN A CG   5  
ATOM 7167  O OD1  . ASN A 1 93  ? -3.771  -7.572  -8.441  1.00 0.00 ? 116 ASN A OD1  5  
ATOM 7168  N ND2  . ASN A 1 93  ? -3.619  -5.355  -8.510  1.00 0.00 ? 116 ASN A ND2  5  
ATOM 7169  H H    . ASN A 1 93  ? -1.813  -6.055  -11.115 1.00 0.00 ? 116 ASN A H    5  
ATOM 7170  H HA   . ASN A 1 93  ? -3.868  -8.156  -11.619 1.00 0.00 ? 116 ASN A HA   5  
ATOM 7171  H HB2  . ASN A 1 93  ? -4.858  -5.506  -10.667 1.00 0.00 ? 116 ASN A HB2  5  
ATOM 7172  H HB3  . ASN A 1 93  ? -5.418  -7.142  -10.368 1.00 0.00 ? 116 ASN A HB3  5  
ATOM 7173  H HD21 . ASN A 1 93  ? -3.800  -4.502  -9.010  1.00 0.00 ? 116 ASN A HD21 5  
ATOM 7174  H HD22 . ASN A 1 93  ? -3.127  -5.313  -7.623  1.00 0.00 ? 116 ASN A HD22 5  
ATOM 7175  N N    . GLN A 1 94  ? -3.130  -6.808  -13.962 1.00 0.00 ? 117 GLN A N    5  
ATOM 7176  C CA   . GLN A 1 94  ? -3.315  -6.266  -15.314 1.00 0.00 ? 117 GLN A CA   5  
ATOM 7177  C C    . GLN A 1 94  ? -4.774  -6.400  -15.760 1.00 0.00 ? 117 GLN A C    5  
ATOM 7178  O O    . GLN A 1 94  ? -5.465  -5.388  -15.914 1.00 0.00 ? 117 GLN A O    5  
ATOM 7179  C CB   . GLN A 1 94  ? -2.368  -6.945  -16.322 1.00 0.00 ? 117 GLN A CB   5  
ATOM 7180  C CG   . GLN A 1 94  ? -0.906  -6.490  -16.269 1.00 0.00 ? 117 GLN A CG   5  
ATOM 7181  C CD   . GLN A 1 94  ? -0.689  -5.078  -16.820 1.00 0.00 ? 117 GLN A CD   5  
ATOM 7182  O OE1  . GLN A 1 94  ? -0.302  -4.877  -17.967 1.00 0.00 ? 117 GLN A OE1  5  
ATOM 7183  N NE2  . GLN A 1 94  ? -0.927  -4.042  -16.041 1.00 0.00 ? 117 GLN A NE2  5  
ATOM 7184  H H    . GLN A 1 94  ? -2.364  -7.452  -13.817 1.00 0.00 ? 117 GLN A H    5  
ATOM 7185  H HA   . GLN A 1 94  ? -3.106  -5.200  -15.273 1.00 0.00 ? 117 GLN A HA   5  
ATOM 7186  H HB2  . GLN A 1 94  ? -2.389  -8.018  -16.143 1.00 0.00 ? 117 GLN A HB2  5  
ATOM 7187  H HB3  . GLN A 1 94  ? -2.739  -6.769  -17.329 1.00 0.00 ? 117 GLN A HB3  5  
ATOM 7188  H HG2  . GLN A 1 94  ? -0.560  -6.562  -15.243 1.00 0.00 ? 117 GLN A HG2  5  
ATOM 7189  H HG3  . GLN A 1 94  ? -0.315  -7.181  -16.871 1.00 0.00 ? 117 GLN A HG3  5  
ATOM 7190  H HE21 . GLN A 1 94  ? -1.199  -4.194  -15.072 1.00 0.00 ? 117 GLN A HE21 5  
ATOM 7191  H HE22 . GLN A 1 94  ? -0.773  -3.108  -16.394 1.00 0.00 ? 117 GLN A HE22 5  
ATOM 7192  N N    . GLY A 1 95  ? -5.261  -7.635  -15.889 1.00 0.00 ? 118 GLY A N    5  
ATOM 7193  C CA   . GLY A 1 95  ? -6.656  -7.937  -16.167 1.00 0.00 ? 118 GLY A CA   5  
ATOM 7194  C C    . GLY A 1 95  ? -7.531  -7.813  -14.920 1.00 0.00 ? 118 GLY A C    5  
ATOM 7195  O O    . GLY A 1 95  ? -8.402  -8.657  -14.699 1.00 0.00 ? 118 GLY A O    5  
ATOM 7196  H H    . GLY A 1 95  ? -4.625  -8.417  -15.810 1.00 0.00 ? 118 GLY A H    5  
ATOM 7197  H HA2  . GLY A 1 95  ? -7.029  -7.252  -16.931 1.00 0.00 ? 118 GLY A HA2  5  
ATOM 7198  H HA3  . GLY A 1 95  ? -6.734  -8.946  -16.567 1.00 0.00 ? 118 GLY A HA3  5  
ATOM 7199  N N    . GLU A 1 96  ? -7.322  -6.793  -14.087 1.00 0.00 ? 119 GLU A N    5  
ATOM 7200  C CA   . GLU A 1 96  ? -8.292  -6.399  -13.074 1.00 0.00 ? 119 GLU A CA   5  
ATOM 7201  C C    . GLU A 1 96  ? -8.668  -4.930  -13.195 1.00 0.00 ? 119 GLU A C    5  
ATOM 7202  O O    . GLU A 1 96  ? -9.863  -4.628  -13.241 1.00 0.00 ? 119 GLU A O    5  
ATOM 7203  C CB   . GLU A 1 96  ? -7.961  -6.955  -11.681 1.00 0.00 ? 119 GLU A CB   5  
ATOM 7204  C CG   . GLU A 1 96  ? -8.147  -5.952  -10.537 1.00 0.00 ? 119 GLU A CG   5  
ATOM 7205  C CD   . GLU A 1 96  ? -8.228  -6.571  -9.140  1.00 0.00 ? 119 GLU A CD   5  
ATOM 7206  O OE1  . GLU A 1 96  ? -7.713  -7.686  -8.893  1.00 0.00 ? 119 GLU A OE1  5  
ATOM 7207  O OE2  . GLU A 1 96  ? -8.902  -5.941  -8.295  1.00 0.00 ? 119 GLU A OE2  5  
ATOM 7208  H H    . GLU A 1 96  ? -6.555  -6.151  -14.277 1.00 0.00 ? 119 GLU A H    5  
ATOM 7209  H HA   . GLU A 1 96  ? -9.208  -6.880  -13.314 1.00 0.00 ? 119 GLU A HA   5  
ATOM 7210  H HB2  . GLU A 1 96  ? -8.618  -7.804  -11.501 1.00 0.00 ? 119 GLU A HB2  5  
ATOM 7211  H HB3  . GLU A 1 96  ? -6.947  -7.338  -11.693 1.00 0.00 ? 119 GLU A HB3  5  
ATOM 7212  H HG2  . GLU A 1 96  ? -7.346  -5.228  -10.597 1.00 0.00 ? 119 GLU A HG2  5  
ATOM 7213  H HG3  . GLU A 1 96  ? -9.077  -5.408  -10.674 1.00 0.00 ? 119 GLU A HG3  5  
ATOM 7214  N N    . PHE A 1 97  ? -7.688  -4.034  -13.321 1.00 0.00 ? 120 PHE A N    5  
ATOM 7215  C CA   . PHE A 1 97  ? -7.995  -2.614  -13.451 1.00 0.00 ? 120 PHE A CA   5  
ATOM 7216  C C    . PHE A 1 97  ? -8.699  -2.290  -14.773 1.00 0.00 ? 120 PHE A C    5  
ATOM 7217  O O    . PHE A 1 97  ? -9.408  -1.290  -14.829 1.00 0.00 ? 120 PHE A O    5  
ATOM 7218  C CB   . PHE A 1 97  ? -6.729  -1.774  -13.297 1.00 0.00 ? 120 PHE A CB   5  
ATOM 7219  C CG   . PHE A 1 97  ? -6.037  -1.932  -11.959 1.00 0.00 ? 120 PHE A CG   5  
ATOM 7220  C CD1  . PHE A 1 97  ? -6.531  -1.275  -10.815 1.00 0.00 ? 120 PHE A CD1  5  
ATOM 7221  C CD2  . PHE A 1 97  ? -4.876  -2.721  -11.863 1.00 0.00 ? 120 PHE A CD2  5  
ATOM 7222  C CE1  . PHE A 1 97  ? -5.811  -1.335  -9.611  1.00 0.00 ? 120 PHE A CE1  5  
ATOM 7223  C CE2  . PHE A 1 97  ? -4.179  -2.803  -10.645 1.00 0.00 ? 120 PHE A CE2  5  
ATOM 7224  C CZ   . PHE A 1 97  ? -4.639  -2.100  -9.519  1.00 0.00 ? 120 PHE A CZ   5  
ATOM 7225  H H    . PHE A 1 97  ? -6.723  -4.332  -13.244 1.00 0.00 ? 120 PHE A H    5  
ATOM 7226  H HA   . PHE A 1 97  ? -8.677  -2.338  -12.644 1.00 0.00 ? 120 PHE A HA   5  
ATOM 7227  H HB2  . PHE A 1 97  ? -6.033  -2.026  -14.099 1.00 0.00 ? 120 PHE A HB2  5  
ATOM 7228  H HB3  . PHE A 1 97  ? -6.995  -0.722  -13.415 1.00 0.00 ? 120 PHE A HB3  5  
ATOM 7229  H HD1  . PHE A 1 97  ? -7.466  -0.727  -10.834 1.00 0.00 ? 120 PHE A HD1  5  
ATOM 7230  H HD2  . PHE A 1 97  ? -4.526  -3.277  -12.721 1.00 0.00 ? 120 PHE A HD2  5  
ATOM 7231  H HE1  . PHE A 1 97  ? -6.158  -0.776  -8.758  1.00 0.00 ? 120 PHE A HE1  5  
ATOM 7232  H HE2  . PHE A 1 97  ? -3.284  -3.398  -10.586 1.00 0.00 ? 120 PHE A HE2  5  
ATOM 7233  H HZ   . PHE A 1 97  ? -4.106  -2.137  -8.579  1.00 0.00 ? 120 PHE A HZ   5  
ATOM 7234  N N    . GLN A 1 98  ? -8.560  -3.123  -15.810 1.00 0.00 ? 121 GLN A N    5  
ATOM 7235  C CA   . GLN A 1 98  ? -9.416  -3.081  -16.986 1.00 0.00 ? 121 GLN A CA   5  
ATOM 7236  C C    . GLN A 1 98  ? -10.588 -4.018  -16.717 1.00 0.00 ? 121 GLN A C    5  
ATOM 7237  O O    . GLN A 1 98  ? -10.563 -5.200  -17.058 1.00 0.00 ? 121 GLN A O    5  
ATOM 7238  C CB   . GLN A 1 98  ? -8.662  -3.451  -18.273 1.00 0.00 ? 121 GLN A CB   5  
ATOM 7239  C CG   . GLN A 1 98  ? -7.653  -2.367  -18.684 1.00 0.00 ? 121 GLN A CG   5  
ATOM 7240  C CD   . GLN A 1 98  ? -7.189  -2.486  -20.138 1.00 0.00 ? 121 GLN A CD   5  
ATOM 7241  O OE1  . GLN A 1 98  ? -7.748  -3.211  -20.957 1.00 0.00 ? 121 GLN A OE1  5  
ATOM 7242  N NE2  . GLN A 1 98  ? -6.184  -1.723  -20.532 1.00 0.00 ? 121 GLN A NE2  5  
ATOM 7243  H H    . GLN A 1 98  ? -8.076  -3.987  -15.652 1.00 0.00 ? 121 GLN A H    5  
ATOM 7244  H HA   . GLN A 1 98  ? -9.816  -2.072  -17.115 1.00 0.00 ? 121 GLN A HA   5  
ATOM 7245  H HB2  . GLN A 1 98  ? -8.144  -4.402  -18.150 1.00 0.00 ? 121 GLN A HB2  5  
ATOM 7246  H HB3  . GLN A 1 98  ? -9.407  -3.557  -19.065 1.00 0.00 ? 121 GLN A HB3  5  
ATOM 7247  H HG2  . GLN A 1 98  ? -8.123  -1.391  -18.562 1.00 0.00 ? 121 GLN A HG2  5  
ATOM 7248  H HG3  . GLN A 1 98  ? -6.788  -2.415  -18.022 1.00 0.00 ? 121 GLN A HG3  5  
ATOM 7249  H HE21 . GLN A 1 98  ? -5.855  -1.011  -19.885 1.00 0.00 ? 121 GLN A HE21 5  
ATOM 7250  H HE22 . GLN A 1 98  ? -5.988  -1.620  -21.524 1.00 0.00 ? 121 GLN A HE22 5  
ATOM 7251  N N    . LYS A 1 99  ? -11.610 -3.478  -16.065 1.00 0.00 ? 122 LYS A N    5  
ATOM 7252  C CA   . LYS A 1 99  ? -12.972 -4.007  -16.120 1.00 0.00 ? 122 LYS A CA   5  
ATOM 7253  C C    . LYS A 1 99  ? -13.663 -3.430  -17.368 1.00 0.00 ? 122 LYS A C    5  
ATOM 7254  O O    . LYS A 1 99  ? -13.067 -2.621  -18.083 1.00 0.00 ? 122 LYS A O    5  
ATOM 7255  C CB   . LYS A 1 99  ? -13.694 -3.638  -14.807 1.00 0.00 ? 122 LYS A CB   5  
ATOM 7256  C CG   . LYS A 1 99  ? -14.124 -4.864  -13.982 1.00 0.00 ? 122 LYS A CG   5  
ATOM 7257  C CD   . LYS A 1 99  ? -13.881 -4.630  -12.492 1.00 0.00 ? 122 LYS A CD   5  
ATOM 7258  C CE   . LYS A 1 99  ? -14.255 -5.861  -11.673 1.00 0.00 ? 122 LYS A CE   5  
ATOM 7259  N NZ   . LYS A 1 99  ? -14.028 -5.628  -10.239 1.00 0.00 ? 122 LYS A NZ   5  
ATOM 7260  H H    . LYS A 1 99  ? -11.493 -2.504  -15.806 1.00 0.00 ? 122 LYS A H    5  
ATOM 7261  H HA   . LYS A 1 99  ? -12.914 -5.090  -16.244 1.00 0.00 ? 122 LYS A HA   5  
ATOM 7262  H HB2  . LYS A 1 99  ? -13.019 -3.043  -14.214 1.00 0.00 ? 122 LYS A HB2  5  
ATOM 7263  H HB3  . LYS A 1 99  ? -14.556 -3.001  -14.997 1.00 0.00 ? 122 LYS A HB3  5  
ATOM 7264  H HG2  . LYS A 1 99  ? -15.183 -5.060  -14.132 1.00 0.00 ? 122 LYS A HG2  5  
ATOM 7265  H HG3  . LYS A 1 99  ? -13.560 -5.739  -14.295 1.00 0.00 ? 122 LYS A HG3  5  
ATOM 7266  H HD2  . LYS A 1 99  ? -12.823 -4.418  -12.336 1.00 0.00 ? 122 LYS A HD2  5  
ATOM 7267  H HD3  . LYS A 1 99  ? -14.479 -3.780  -12.162 1.00 0.00 ? 122 LYS A HD3  5  
ATOM 7268  H HE2  . LYS A 1 99  ? -15.306 -6.095  -11.837 1.00 0.00 ? 122 LYS A HE2  5  
ATOM 7269  H HE3  . LYS A 1 99  ? -13.648 -6.709  -11.997 1.00 0.00 ? 122 LYS A HE3  5  
ATOM 7270  H HZ1  . LYS A 1 99  ? -14.414 -6.391  -9.689  1.00 0.00 ? 122 LYS A HZ1  5  
ATOM 7271  H HZ2  . LYS A 1 99  ? -13.036 -5.585  -10.004 1.00 0.00 ? 122 LYS A HZ2  5  
ATOM 7272  H HZ3  . LYS A 1 99  ? -14.500 -4.790  -9.924  1.00 0.00 ? 122 LYS A HZ3  5  
ATOM 7273  N N    . PRO A 1 100 ? -14.917 -3.819  -17.655 1.00 0.00 ? 123 PRO A N    5  
ATOM 7274  C CA   . PRO A 1 100 ? -15.697 -3.201  -18.716 1.00 0.00 ? 123 PRO A CA   5  
ATOM 7275  C C    . PRO A 1 100 ? -16.233 -1.837  -18.257 1.00 0.00 ? 123 PRO A C    5  
ATOM 7276  O O    . PRO A 1 100 ? -16.258 -0.886  -19.039 1.00 0.00 ? 123 PRO A O    5  
ATOM 7277  C CB   . PRO A 1 100 ? -16.809 -4.208  -19.020 1.00 0.00 ? 123 PRO A CB   5  
ATOM 7278  C CG   . PRO A 1 100 ? -17.021 -4.971  -17.708 1.00 0.00 ? 123 PRO A CG   5  
ATOM 7279  C CD   . PRO A 1 100 ? -15.731 -4.763  -16.907 1.00 0.00 ? 123 PRO A CD   5  
ATOM 7280  H HA   . PRO A 1 100 ? -15.080 -3.070  -19.599 1.00 0.00 ? 123 PRO A HA   5  
ATOM 7281  H HB2  . PRO A 1 100 ? -17.724 -3.716  -19.355 1.00 0.00 ? 123 PRO A HB2  5  
ATOM 7282  H HB3  . PRO A 1 100 ? -16.456 -4.904  -19.784 1.00 0.00 ? 123 PRO A HB3  5  
ATOM 7283  H HG2  . PRO A 1 100 ? -17.860 -4.535  -17.163 1.00 0.00 ? 123 PRO A HG2  5  
ATOM 7284  H HG3  . PRO A 1 100 ? -17.210 -6.028  -17.890 1.00 0.00 ? 123 PRO A HG3  5  
ATOM 7285  H HD2  . PRO A 1 100 ? -16.018 -4.329  -15.952 1.00 0.00 ? 123 PRO A HD2  5  
ATOM 7286  H HD3  . PRO A 1 100 ? -15.168 -5.677  -16.726 1.00 0.00 ? 123 PRO A HD3  5  
ATOM 7287  N N    . ASP A 1 101 ? -16.612 -1.766  -16.976 1.00 0.00 ? 124 ASP A N    5  
ATOM 7288  C CA   . ASP A 1 101 ? -17.106 -0.608  -16.240 1.00 0.00 ? 124 ASP A CA   5  
ATOM 7289  C C    . ASP A 1 101 ? -16.094 0.535   -16.294 1.00 0.00 ? 124 ASP A C    5  
ATOM 7290  O O    . ASP A 1 101 ? -16.228 1.450   -17.105 1.00 0.00 ? 124 ASP A O    5  
ATOM 7291  C CB   . ASP A 1 101 ? -17.423 -1.017  -14.789 1.00 0.00 ? 124 ASP A CB   5  
ATOM 7292  C CG   . ASP A 1 101 ? -17.598 0.211   -13.892 1.00 0.00 ? 124 ASP A CG   5  
ATOM 7293  O OD1  . ASP A 1 101 ? -18.579 0.952   -14.093 1.00 0.00 ? 124 ASP A OD1  5  
ATOM 7294  O OD2  . ASP A 1 101 ? -16.697 0.484   -13.071 1.00 0.00 ? 124 ASP A OD2  5  
ATOM 7295  H H    . ASP A 1 101 ? -16.516 -2.627  -16.465 1.00 0.00 ? 124 ASP A H    5  
ATOM 7296  H HA   . ASP A 1 101 ? -18.023 -0.254  -16.702 1.00 0.00 ? 124 ASP A HA   5  
ATOM 7297  H HB2  . ASP A 1 101 ? -18.337 -1.605  -14.770 1.00 0.00 ? 124 ASP A HB2  5  
ATOM 7298  H HB3  . ASP A 1 101 ? -16.621 -1.643  -14.395 1.00 0.00 ? 124 ASP A HB3  5  
ATOM 7299  N N    . ASN A 1 102 ? -15.056 0.457   -15.463 1.00 0.00 ? 125 ASN A N    5  
ATOM 7300  C CA   . ASN A 1 102 ? -14.065 1.498   -15.196 1.00 0.00 ? 125 ASN A CA   5  
ATOM 7301  C C    . ASN A 1 102 ? -14.663 2.861   -14.811 1.00 0.00 ? 125 ASN A C    5  
ATOM 7302  O O    . ASN A 1 102 ? -13.977 3.877   -14.951 1.00 0.00 ? 125 ASN A O    5  
ATOM 7303  C CB   . ASN A 1 102 ? -13.040 1.594   -16.342 1.00 0.00 ? 125 ASN A CB   5  
ATOM 7304  C CG   . ASN A 1 102 ? -12.397 0.253   -16.656 1.00 0.00 ? 125 ASN A CG   5  
ATOM 7305  O OD1  . ASN A 1 102 ? -12.243 -0.603  -15.787 1.00 0.00 ? 125 ASN A OD1  5  
ATOM 7306  N ND2  . ASN A 1 102 ? -12.061 0.028   -17.910 1.00 0.00 ? 125 ASN A ND2  5  
ATOM 7307  H H    . ASN A 1 102 ? -15.025 -0.333  -14.836 1.00 0.00 ? 125 ASN A H    5  
ATOM 7308  H HA   . ASN A 1 102 ? -13.529 1.168   -14.313 1.00 0.00 ? 125 ASN A HA   5  
ATOM 7309  H HB2  . ASN A 1 102 ? -13.547 1.984   -17.224 1.00 0.00 ? 125 ASN A HB2  5  
ATOM 7310  H HB3  . ASN A 1 102 ? -12.265 2.308   -16.072 1.00 0.00 ? 125 ASN A HB3  5  
ATOM 7311  H HD21 . ASN A 1 102 ? -12.161 0.754   -18.610 1.00 0.00 ? 125 ASN A HD21 5  
ATOM 7312  H HD22 . ASN A 1 102 ? -11.978 -0.945  -18.178 1.00 0.00 ? 125 ASN A HD22 5  
ATOM 7313  N N    . LYS A 1 103 ? -15.922 2.920   -14.340 1.00 0.00 ? 126 LYS A N    5  
ATOM 7314  C CA   . LYS A 1 103 ? -16.560 4.164   -13.908 1.00 0.00 ? 126 LYS A CA   5  
ATOM 7315  C C    . LYS A 1 103 ? -16.071 4.460   -12.496 1.00 0.00 ? 126 LYS A C    5  
ATOM 7316  O O    . LYS A 1 103 ? -14.936 4.891   -12.278 1.00 0.00 ? 126 LYS A O    5  
ATOM 7317  C CB   . LYS A 1 103 ? -18.105 4.051   -14.043 1.00 0.00 ? 126 LYS A CB   5  
ATOM 7318  C CG   . LYS A 1 103 ? -18.853 5.388   -14.175 1.00 0.00 ? 126 LYS A CG   5  
ATOM 7319  C CD   . LYS A 1 103 ? -18.840 6.315   -12.952 1.00 0.00 ? 126 LYS A CD   5  
ATOM 7320  C CE   . LYS A 1 103 ? -19.478 7.642   -13.375 1.00 0.00 ? 126 LYS A CE   5  
ATOM 7321  N NZ   . LYS A 1 103 ? -19.636 8.608   -12.271 1.00 0.00 ? 126 LYS A NZ   5  
ATOM 7322  H H    . LYS A 1 103 ? -16.410 2.049   -14.137 1.00 0.00 ? 126 LYS A H    5  
ATOM 7323  H HA   . LYS A 1 103 ? -16.213 4.964   -14.561 1.00 0.00 ? 126 LYS A HA   5  
ATOM 7324  H HB2  . LYS A 1 103 ? -18.296 3.504   -14.962 1.00 0.00 ? 126 LYS A HB2  5  
ATOM 7325  H HB3  . LYS A 1 103 ? -18.554 3.453   -13.241 1.00 0.00 ? 126 LYS A HB3  5  
ATOM 7326  H HG2  . LYS A 1 103 ? -18.443 5.922   -15.027 1.00 0.00 ? 126 LYS A HG2  5  
ATOM 7327  H HG3  . LYS A 1 103 ? -19.893 5.157   -14.409 1.00 0.00 ? 126 LYS A HG3  5  
ATOM 7328  H HD2  . LYS A 1 103 ? -19.406 5.847   -12.149 1.00 0.00 ? 126 LYS A HD2  5  
ATOM 7329  H HD3  . LYS A 1 103 ? -17.820 6.496   -12.613 1.00 0.00 ? 126 LYS A HD3  5  
ATOM 7330  H HE2  . LYS A 1 103 ? -18.863 8.092   -14.157 1.00 0.00 ? 126 LYS A HE2  5  
ATOM 7331  H HE3  . LYS A 1 103 ? -20.460 7.430   -13.792 1.00 0.00 ? 126 LYS A HE3  5  
ATOM 7332  H HZ1  . LYS A 1 103 ? -20.299 8.280   -11.572 1.00 0.00 ? 126 LYS A HZ1  5  
ATOM 7333  H HZ2  . LYS A 1 103 ? -18.767 8.819   -11.812 1.00 0.00 ? 126 LYS A HZ2  5  
ATOM 7334  H HZ3  . LYS A 1 103 ? -20.023 9.473   -12.629 1.00 0.00 ? 126 LYS A HZ3  5  
ATOM 7335  N N    . LEU A 1 104 ? -16.898 4.154   -11.500 1.00 0.00 ? 127 LEU A N    5  
ATOM 7336  C CA   . LEU A 1 104 ? -16.599 4.527   -10.139 1.00 0.00 ? 127 LEU A CA   5  
ATOM 7337  C C    . LEU A 1 104 ? -15.697 3.479   -9.545  1.00 0.00 ? 127 LEU A C    5  
ATOM 7338  O O    . LEU A 1 104 ? -14.843 3.853   -8.761  1.00 0.00 ? 127 LEU A O    5  
ATOM 7339  C CB   . LEU A 1 104 ? -17.864 4.649   -9.297  1.00 0.00 ? 127 LEU A CB   5  
ATOM 7340  C CG   . LEU A 1 104 ? -18.094 5.986   -8.596  1.00 0.00 ? 127 LEU A CG   5  
ATOM 7341  C CD1  . LEU A 1 104 ? -17.075 6.396   -7.552  1.00 0.00 ? 127 LEU A CD1  5  
ATOM 7342  C CD2  . LEU A 1 104 ? -18.198 7.144   -9.565  1.00 0.00 ? 127 LEU A CD2  5  
ATOM 7343  H H    . LEU A 1 104 ? -17.759 3.670   -11.707 1.00 0.00 ? 127 LEU A H    5  
ATOM 7344  H HA   . LEU A 1 104 ? -16.064 5.476   -10.130 1.00 0.00 ? 127 LEU A HA   5  
ATOM 7345  H HB2  . LEU A 1 104 ? -18.747 4.404   -9.890  1.00 0.00 ? 127 LEU A HB2  5  
ATOM 7346  H HB3  . LEU A 1 104 ? -17.778 3.916   -8.512  1.00 0.00 ? 127 LEU A HB3  5  
ATOM 7347  H HG   . LEU A 1 104 ? -19.034 5.877   -8.071  1.00 0.00 ? 127 LEU A HG   5  
ATOM 7348  H HD11 . LEU A 1 104 ? -17.380 7.362   -7.132  1.00 0.00 ? 127 LEU A HD11 5  
ATOM 7349  H HD12 . LEU A 1 104 ? -17.096 5.657   -6.762  1.00 0.00 ? 127 LEU A HD12 5  
ATOM 7350  H HD13 . LEU A 1 104 ? -16.078 6.472   -7.972  1.00 0.00 ? 127 LEU A HD13 5  
ATOM 7351  H HD21 . LEU A 1 104 ? -19.105 6.991   -10.139 1.00 0.00 ? 127 LEU A HD21 5  
ATOM 7352  H HD22 . LEU A 1 104 ? -18.287 8.058   -8.987  1.00 0.00 ? 127 LEU A HD22 5  
ATOM 7353  H HD23 . LEU A 1 104 ? -17.319 7.201   -10.200 1.00 0.00 ? 127 LEU A HD23 5  
ATOM 7354  N N    . HIS A 1 105 ? -15.840 2.196   -9.901  1.00 0.00 ? 128 HIS A N    5  
ATOM 7355  C CA   . HIS A 1 105 ? -14.953 1.185   -9.346  1.00 0.00 ? 128 HIS A CA   5  
ATOM 7356  C C    . HIS A 1 105 ? -13.496 1.565   -9.640  1.00 0.00 ? 128 HIS A C    5  
ATOM 7357  O O    . HIS A 1 105 ? -12.666 1.368   -8.765  1.00 0.00 ? 128 HIS A O    5  
ATOM 7358  C CB   . HIS A 1 105 ? -15.345 -0.233  -9.801  1.00 0.00 ? 128 HIS A CB   5  
ATOM 7359  C CG   . HIS A 1 105 ? -14.206 -1.028  -10.377 1.00 0.00 ? 128 HIS A CG   5  
ATOM 7360  N ND1  . HIS A 1 105 ? -13.344 -1.865  -9.700  1.00 0.00 ? 128 HIS A ND1  5  
ATOM 7361  C CD2  . HIS A 1 105 ? -13.780 -0.935  -11.668 1.00 0.00 ? 128 HIS A CD2  5  
ATOM 7362  C CE1  . HIS A 1 105 ? -12.414 -2.272  -10.580 1.00 0.00 ? 128 HIS A CE1  5  
ATOM 7363  N NE2  . HIS A 1 105 ? -12.632 -1.722  -11.788 1.00 0.00 ? 128 HIS A NE2  5  
ATOM 7364  H H    . HIS A 1 105 ? -16.540 1.910   -10.573 1.00 0.00 ? 128 HIS A H    5  
ATOM 7365  H HA   . HIS A 1 105 ? -15.067 1.211   -8.261  1.00 0.00 ? 128 HIS A HA   5  
ATOM 7366  H HB2  . HIS A 1 105 ? -15.735 -0.776  -8.942  1.00 0.00 ? 128 HIS A HB2  5  
ATOM 7367  H HB3  . HIS A 1 105 ? -16.142 -0.186  -10.544 1.00 0.00 ? 128 HIS A HB3  5  
ATOM 7368  H HD1  . HIS A 1 105 ? -13.409 -2.148  -8.728  1.00 0.00 ? 128 HIS A HD1  5  
ATOM 7369  H HD2  . HIS A 1 105 ? -14.248 -0.310  -12.415 1.00 0.00 ? 128 HIS A HD2  5  
ATOM 7370  H HE1  . HIS A 1 105 ? -11.610 -2.962  -10.354 1.00 0.00 ? 128 HIS A HE1  5  
ATOM 7371  N N    . GLN A 1 106 ? -13.189 2.188   -10.787 1.00 0.00 ? 129 GLN A N    5  
ATOM 7372  C CA   . GLN A 1 106 ? -11.852 2.690   -11.092 1.00 0.00 ? 129 GLN A CA   5  
ATOM 7373  C C    . GLN A 1 106 ? -11.505 3.914   -10.238 1.00 0.00 ? 129 GLN A C    5  
ATOM 7374  O O    . GLN A 1 106 ? -10.459 3.942   -9.585  1.00 0.00 ? 129 GLN A O    5  
ATOM 7375  C CB   . GLN A 1 106 ? -11.749 3.003   -12.589 1.00 0.00 ? 129 GLN A CB   5  
ATOM 7376  C CG   . GLN A 1 106 ? -10.325 3.409   -12.962 1.00 0.00 ? 129 GLN A CG   5  
ATOM 7377  C CD   . GLN A 1 106 ? -9.957  3.135   -14.420 1.00 0.00 ? 129 GLN A CD   5  
ATOM 7378  O OE1  . GLN A 1 106 ? -9.670  4.053   -15.184 1.00 0.00 ? 129 GLN A OE1  5  
ATOM 7379  N NE2  . GLN A 1 106 ? -9.919  1.885   -14.838 1.00 0.00 ? 129 GLN A NE2  5  
ATOM 7380  H H    . GLN A 1 106 ? -13.929 2.368   -11.447 1.00 0.00 ? 129 GLN A H    5  
ATOM 7381  H HA   . GLN A 1 106 ? -11.134 1.904   -10.858 1.00 0.00 ? 129 GLN A HA   5  
ATOM 7382  H HB2  . GLN A 1 106 ? -12.023 2.117   -13.147 1.00 0.00 ? 129 GLN A HB2  5  
ATOM 7383  H HB3  . GLN A 1 106 ? -12.429 3.806   -12.854 1.00 0.00 ? 129 GLN A HB3  5  
ATOM 7384  H HG2  . GLN A 1 106 ? -10.205 4.468   -12.754 1.00 0.00 ? 129 GLN A HG2  5  
ATOM 7385  H HG3  . GLN A 1 106 ? -9.653  2.859   -12.315 1.00 0.00 ? 129 GLN A HG3  5  
ATOM 7386  H HE21 . GLN A 1 106 ? -10.119 1.130   -14.183 1.00 0.00 ? 129 GLN A HE21 5  
ATOM 7387  H HE22 . GLN A 1 106 ? -9.593  1.665   -15.769 1.00 0.00 ? 129 GLN A HE22 5  
ATOM 7388  N N    . GLN A 1 107 ? -12.376 4.927   -10.242 1.00 0.00 ? 130 GLN A N    5  
ATOM 7389  C CA   . GLN A 1 107 ? -12.234 6.130   -9.415  1.00 0.00 ? 130 GLN A CA   5  
ATOM 7390  C C    . GLN A 1 107 ? -12.213 5.837   -7.898  1.00 0.00 ? 130 GLN A C    5  
ATOM 7391  O O    . GLN A 1 107 ? -11.826 6.719   -7.127  1.00 0.00 ? 130 GLN A O    5  
ATOM 7392  C CB   . GLN A 1 107 ? -13.304 7.186   -9.767  1.00 0.00 ? 130 GLN A CB   5  
ATOM 7393  C CG   . GLN A 1 107 ? -12.990 7.996   -11.037 1.00 0.00 ? 130 GLN A CG   5  
ATOM 7394  C CD   . GLN A 1 107 ? -13.719 9.344   -11.027 1.00 0.00 ? 130 GLN A CD   5  
ATOM 7395  O OE1  . GLN A 1 107 ? -13.200 10.349  -10.546 1.00 0.00 ? 130 GLN A OE1  5  
ATOM 7396  N NE2  . GLN A 1 107 ? -14.963 9.414   -11.473 1.00 0.00 ? 130 GLN A NE2  5  
ATOM 7397  H H    . GLN A 1 107 ? -13.134 4.858   -10.906 1.00 0.00 ? 130 GLN A H    5  
ATOM 7398  H HA   . GLN A 1 107 ? -11.259 6.557   -9.641  1.00 0.00 ? 130 GLN A HA   5  
ATOM 7399  H HB2  . GLN A 1 107 ? -14.288 6.723   -9.873  1.00 0.00 ? 130 GLN A HB2  5  
ATOM 7400  H HB3  . GLN A 1 107 ? -13.352 7.891   -8.939  1.00 0.00 ? 130 GLN A HB3  5  
ATOM 7401  H HG2  . GLN A 1 107 ? -11.918 8.190   -11.079 1.00 0.00 ? 130 GLN A HG2  5  
ATOM 7402  H HG3  . GLN A 1 107 ? -13.269 7.422   -11.920 1.00 0.00 ? 130 GLN A HG3  5  
ATOM 7403  H HE21 . GLN A 1 107 ? -15.306 8.664   -12.081 1.00 0.00 ? 130 GLN A HE21 5  
ATOM 7404  H HE22 . GLN A 1 107 ? -15.429 10.322  -11.542 1.00 0.00 ? 130 GLN A HE22 5  
ATOM 7405  N N    . VAL A 1 108 ? -12.589 4.630   -7.464  1.00 0.00 ? 131 VAL A N    5  
ATOM 7406  C CA   . VAL A 1 108 ? -12.315 4.080   -6.146  1.00 0.00 ? 131 VAL A CA   5  
ATOM 7407  C C    . VAL A 1 108 ? -10.953 3.384   -6.200  1.00 0.00 ? 131 VAL A C    5  
ATOM 7408  O O    . VAL A 1 108 ? -10.060 3.819   -5.489  1.00 0.00 ? 131 VAL A O    5  
ATOM 7409  C CB   . VAL A 1 108 ? -13.449 3.144   -5.670  1.00 0.00 ? 131 VAL A CB   5  
ATOM 7410  C CG1  . VAL A 1 108 ? -13.131 2.522   -4.300  1.00 0.00 ? 131 VAL A CG1  5  
ATOM 7411  C CG2  . VAL A 1 108 ? -14.788 3.873   -5.504  1.00 0.00 ? 131 VAL A CG2  5  
ATOM 7412  H H    . VAL A 1 108 ? -13.035 4.011   -8.129  1.00 0.00 ? 131 VAL A H    5  
ATOM 7413  H HA   . VAL A 1 108 ? -12.243 4.897   -5.428  1.00 0.00 ? 131 VAL A HA   5  
ATOM 7414  H HB   . VAL A 1 108 ? -13.585 2.348   -6.399  1.00 0.00 ? 131 VAL A HB   5  
ATOM 7415  H HG11 . VAL A 1 108 ? -13.931 1.846   -4.000  1.00 0.00 ? 131 VAL A HG11 5  
ATOM 7416  H HG12 . VAL A 1 108 ? -12.208 1.948   -4.337  1.00 0.00 ? 131 VAL A HG12 5  
ATOM 7417  H HG13 . VAL A 1 108 ? -13.024 3.307   -3.548  1.00 0.00 ? 131 VAL A HG13 5  
ATOM 7418  H HG21 . VAL A 1 108 ? -15.114 4.355   -6.423  1.00 0.00 ? 131 VAL A HG21 5  
ATOM 7419  H HG22 . VAL A 1 108 ? -15.547 3.158   -5.188  1.00 0.00 ? 131 VAL A HG22 5  
ATOM 7420  H HG23 . VAL A 1 108 ? -14.679 4.638   -4.741  1.00 0.00 ? 131 VAL A HG23 5  
ATOM 7421  N N    . LEU A 1 109 ? -10.771 2.321   -7.001  1.00 0.00 ? 132 LEU A N    5  
ATOM 7422  C CA   . LEU A 1 109 ? -9.668  1.362   -6.871  1.00 0.00 ? 132 LEU A CA   5  
ATOM 7423  C C    . LEU A 1 109 ? -8.338  2.083   -6.833  1.00 0.00 ? 132 LEU A C    5  
ATOM 7424  O O    . LEU A 1 109 ? -7.583  1.885   -5.884  1.00 0.00 ? 132 LEU A O    5  
ATOM 7425  C CB   . LEU A 1 109 ? -9.622  0.285   -7.987  1.00 0.00 ? 132 LEU A CB   5  
ATOM 7426  C CG   . LEU A 1 109 ? -9.387  -1.144  -7.464  1.00 0.00 ? 132 LEU A CG   5  
ATOM 7427  C CD1  . LEU A 1 109 ? -9.259  -2.134  -8.622  1.00 0.00 ? 132 LEU A CD1  5  
ATOM 7428  C CD2  . LEU A 1 109 ? -8.202  -1.280  -6.492  1.00 0.00 ? 132 LEU A CD2  5  
ATOM 7429  H H    . LEU A 1 109 ? -11.520 2.068   -7.635  1.00 0.00 ? 132 LEU A H    5  
ATOM 7430  H HA   . LEU A 1 109 ? -9.811  0.870   -5.911  1.00 0.00 ? 132 LEU A HA   5  
ATOM 7431  H HB2  . LEU A 1 109 ? -10.554 0.279   -8.543  1.00 0.00 ? 132 LEU A HB2  5  
ATOM 7432  H HB3  . LEU A 1 109 ? -8.821  0.507   -8.695  1.00 0.00 ? 132 LEU A HB3  5  
ATOM 7433  H HG   . LEU A 1 109 ? -10.284 -1.435  -6.942  1.00 0.00 ? 132 LEU A HG   5  
ATOM 7434  H HD11 . LEU A 1 109 ? -8.251  -2.138  -9.017  1.00 0.00 ? 132 LEU A HD11 5  
ATOM 7435  H HD12 . LEU A 1 109 ? -9.490  -3.142  -8.273  1.00 0.00 ? 132 LEU A HD12 5  
ATOM 7436  H HD13 . LEU A 1 109 ? -9.952  -1.869  -9.420  1.00 0.00 ? 132 LEU A HD13 5  
ATOM 7437  H HD21 . LEU A 1 109 ? -8.021  -2.334  -6.288  1.00 0.00 ? 132 LEU A HD21 5  
ATOM 7438  H HD22 . LEU A 1 109 ? -7.296  -0.834  -6.901  1.00 0.00 ? 132 LEU A HD22 5  
ATOM 7439  H HD23 . LEU A 1 109 ? -8.418  -0.786  -5.546  1.00 0.00 ? 132 LEU A HD23 5  
ATOM 7440  N N    . TRP A 1 110 ? -8.066  2.916   -7.843  1.00 0.00 ? 133 TRP A N    5  
ATOM 7441  C CA   . TRP A 1 110 ? -6.796  3.613   -7.922  1.00 0.00 ? 133 TRP A CA   5  
ATOM 7442  C C    . TRP A 1 110 ? -6.620  4.529   -6.723  1.00 0.00 ? 133 TRP A C    5  
ATOM 7443  O O    . TRP A 1 110 ? -5.574  4.476   -6.086  1.00 0.00 ? 133 TRP A O    5  
ATOM 7444  C CB   . TRP A 1 110 ? -6.632  4.357   -9.249  1.00 0.00 ? 133 TRP A CB   5  
ATOM 7445  C CG   . TRP A 1 110 ? -6.261  3.470   -10.398 1.00 0.00 ? 133 TRP A CG   5  
ATOM 7446  C CD1  . TRP A 1 110 ? -6.881  3.432   -11.597 1.00 0.00 ? 133 TRP A CD1  5  
ATOM 7447  C CD2  . TRP A 1 110 ? -5.165  2.504   -10.482 1.00 0.00 ? 133 TRP A CD2  5  
ATOM 7448  N NE1  . TRP A 1 110 ? -6.284  2.478   -12.395 1.00 0.00 ? 133 TRP A NE1  5  
ATOM 7449  C CE2  . TRP A 1 110 ? -5.220  1.875   -11.760 1.00 0.00 ? 133 TRP A CE2  5  
ATOM 7450  C CE3  . TRP A 1 110 ? -4.126  2.097   -9.610  1.00 0.00 ? 133 TRP A CE3  5  
ATOM 7451  C CZ2  . TRP A 1 110 ? -4.295  0.897   -12.152 1.00 0.00 ? 133 TRP A CZ2  5  
ATOM 7452  C CZ3  . TRP A 1 110 ? -3.201  1.108   -9.990  1.00 0.00 ? 133 TRP A CZ3  5  
ATOM 7453  C CH2  . TRP A 1 110 ? -3.285  0.512   -11.257 1.00 0.00 ? 133 TRP A CH2  5  
ATOM 7454  H H    . TRP A 1 110 ? -8.756  3.050   -8.574  1.00 0.00 ? 133 TRP A H    5  
ATOM 7455  H HA   . TRP A 1 110 ? -6.014  2.863   -7.861  1.00 0.00 ? 133 TRP A HA   5  
ATOM 7456  H HB2  . TRP A 1 110 ? -7.546  4.907   -9.476  1.00 0.00 ? 133 TRP A HB2  5  
ATOM 7457  H HB3  . TRP A 1 110 ? -5.824  5.079   -9.135  1.00 0.00 ? 133 TRP A HB3  5  
ATOM 7458  H HD1  . TRP A 1 110 ? -7.719  4.049   -11.890 1.00 0.00 ? 133 TRP A HD1  5  
ATOM 7459  H HE1  . TRP A 1 110 ? -6.604  2.262   -13.344 1.00 0.00 ? 133 TRP A HE1  5  
ATOM 7460  H HE3  . TRP A 1 110 ? -4.036  2.540   -8.630  1.00 0.00 ? 133 TRP A HE3  5  
ATOM 7461  H HZ2  . TRP A 1 110 ? -4.347  0.432   -13.125 1.00 0.00 ? 133 TRP A HZ2  5  
ATOM 7462  H HZ3  . TRP A 1 110 ? -2.430  0.787   -9.305  1.00 0.00 ? 133 TRP A HZ3  5  
ATOM 7463  H HH2  . TRP A 1 110 ? -2.584  -0.257  -11.540 1.00 0.00 ? 133 TRP A HH2  5  
ATOM 7464  N N    . ARG A 1 111 ? -7.633  5.323   -6.365  1.00 0.00 ? 134 ARG A N    5  
ATOM 7465  C CA   . ARG A 1 111 ? -7.546  6.183   -5.190  1.00 0.00 ? 134 ARG A CA   5  
ATOM 7466  C C    . ARG A 1 111 ? -7.289  5.365   -3.919  1.00 0.00 ? 134 ARG A C    5  
ATOM 7467  O O    . ARG A 1 111 ? -6.543  5.814   -3.055  1.00 0.00 ? 134 ARG A O    5  
ATOM 7468  C CB   . ARG A 1 111 ? -8.812  7.056   -5.083  1.00 0.00 ? 134 ARG A CB   5  
ATOM 7469  C CG   . ARG A 1 111 ? -8.873  7.897   -3.796  1.00 0.00 ? 134 ARG A CG   5  
ATOM 7470  C CD   . ARG A 1 111 ? -7.719  8.894   -3.674  1.00 0.00 ? 134 ARG A CD   5  
ATOM 7471  N NE   . ARG A 1 111 ? -7.459  9.241   -2.277  1.00 0.00 ? 134 ARG A NE   5  
ATOM 7472  C CZ   . ARG A 1 111 ? -6.257  9.412   -1.727  1.00 0.00 ? 134 ARG A CZ   5  
ATOM 7473  N NH1  . ARG A 1 111 ? -5.171  9.505   -2.489  1.00 0.00 ? 134 ARG A NH1  5  
ATOM 7474  N NH2  . ARG A 1 111 ? -6.143  9.477   -0.410  1.00 0.00 ? 134 ARG A NH2  5  
ATOM 7475  H H    . ARG A 1 111 ? -8.517  5.235   -6.843  1.00 0.00 ? 134 ARG A H    5  
ATOM 7476  H HA   . ARG A 1 111 ? -6.681  6.829   -5.337  1.00 0.00 ? 134 ARG A HA   5  
ATOM 7477  H HB2  . ARG A 1 111 ? -8.859  7.717   -5.947  1.00 0.00 ? 134 ARG A HB2  5  
ATOM 7478  H HB3  . ARG A 1 111 ? -9.690  6.412   -5.109  1.00 0.00 ? 134 ARG A HB3  5  
ATOM 7479  H HG2  . ARG A 1 111 ? -9.812  8.446   -3.762  1.00 0.00 ? 134 ARG A HG2  5  
ATOM 7480  H HG3  . ARG A 1 111 ? -8.868  7.222   -2.941  1.00 0.00 ? 134 ARG A HG3  5  
ATOM 7481  H HD2  . ARG A 1 111 ? -6.826  8.434   -4.083  1.00 0.00 ? 134 ARG A HD2  5  
ATOM 7482  H HD3  . ARG A 1 111 ? -7.960  9.803   -4.217  1.00 0.00 ? 134 ARG A HD3  5  
ATOM 7483  H HE   . ARG A 1 111 ? -8.254  9.118   -1.651  1.00 0.00 ? 134 ARG A HE   5  
ATOM 7484  H HH11 . ARG A 1 111 ? -5.223  9.556   -3.497  1.00 0.00 ? 134 ARG A HH11 5  
ATOM 7485  H HH12 . ARG A 1 111 ? -4.229  9.459   -2.111  1.00 0.00 ? 134 ARG A HH12 5  
ATOM 7486  H HH21 . ARG A 1 111 ? -6.948  9.415   0.218   1.00 0.00 ? 134 ARG A HH21 5  
ATOM 7487  H HH22 . ARG A 1 111 ? -5.214  9.458   0.020   1.00 0.00 ? 134 ARG A HH22 5  
ATOM 7488  N N    . LEU A 1 112 ? -7.890  4.179   -3.812  1.00 0.00 ? 135 LEU A N    5  
ATOM 7489  C CA   . LEU A 1 112 ? -7.766  3.287   -2.674  1.00 0.00 ? 135 LEU A CA   5  
ATOM 7490  C C    . LEU A 1 112 ? -6.293  2.915   -2.564  1.00 0.00 ? 135 LEU A C    5  
ATOM 7491  O O    . LEU A 1 112 ? -5.652  3.321   -1.602  1.00 0.00 ? 135 LEU A O    5  
ATOM 7492  C CB   . LEU A 1 112 ? -8.738  2.088   -2.807  1.00 0.00 ? 135 LEU A CB   5  
ATOM 7493  C CG   . LEU A 1 112 ? -9.176  1.447   -1.481  1.00 0.00 ? 135 LEU A CG   5  
ATOM 7494  C CD1  . LEU A 1 112 ? -10.602 0.888   -1.522  1.00 0.00 ? 135 LEU A CD1  5  
ATOM 7495  C CD2  . LEU A 1 112 ? -8.261  0.306   -1.112  1.00 0.00 ? 135 LEU A CD2  5  
ATOM 7496  H H    . LEU A 1 112 ? -8.489  3.892   -4.576  1.00 0.00 ? 135 LEU A H    5  
ATOM 7497  H HA   . LEU A 1 112 ? -8.036  3.861   -1.787  1.00 0.00 ? 135 LEU A HA   5  
ATOM 7498  H HB2  . LEU A 1 112 ? -9.635  2.439   -3.274  1.00 0.00 ? 135 LEU A HB2  5  
ATOM 7499  H HB3  . LEU A 1 112 ? -8.339  1.336   -3.471  1.00 0.00 ? 135 LEU A HB3  5  
ATOM 7500  H HG   . LEU A 1 112 ? -9.112  2.180   -0.694  1.00 0.00 ? 135 LEU A HG   5  
ATOM 7501  H HD11 . LEU A 1 112 ? -11.317 1.653   -1.813  1.00 0.00 ? 135 LEU A HD11 5  
ATOM 7502  H HD12 . LEU A 1 112 ? -10.668 0.068   -2.231  1.00 0.00 ? 135 LEU A HD12 5  
ATOM 7503  H HD13 . LEU A 1 112 ? -10.874 0.544   -0.524  1.00 0.00 ? 135 LEU A HD13 5  
ATOM 7504  H HD21 . LEU A 1 112 ? -7.246  0.678   -1.182  1.00 0.00 ? 135 LEU A HD21 5  
ATOM 7505  H HD22 . LEU A 1 112 ? -8.460  -0.018  -0.089  1.00 0.00 ? 135 LEU A HD22 5  
ATOM 7506  H HD23 . LEU A 1 112 ? -8.420  -0.527  -1.793  1.00 0.00 ? 135 LEU A HD23 5  
ATOM 7507  N N    . VAL A 1 113 ? -5.730  2.209   -3.552  1.00 0.00 ? 136 VAL A N    5  
ATOM 7508  C CA   . VAL A 1 113 ? -4.334  1.753   -3.535  1.00 0.00 ? 136 VAL A CA   5  
ATOM 7509  C C    . VAL A 1 113 ? -3.325  2.904   -3.435  1.00 0.00 ? 136 VAL A C    5  
ATOM 7510  O O    . VAL A 1 113 ? -2.301  2.763   -2.760  1.00 0.00 ? 136 VAL A O    5  
ATOM 7511  C CB   . VAL A 1 113 ? -4.060  0.763   -4.682  1.00 0.00 ? 136 VAL A CB   5  
ATOM 7512  C CG1  . VAL A 1 113 ? -4.265  1.332   -6.074  1.00 0.00 ? 136 VAL A CG1  5  
ATOM 7513  C CG2  . VAL A 1 113 ? -2.647  0.187   -4.601  1.00 0.00 ? 136 VAL A CG2  5  
ATOM 7514  H H    . VAL A 1 113 ? -6.302  1.970   -4.358  1.00 0.00 ? 136 VAL A H    5  
ATOM 7515  H HA   . VAL A 1 113 ? -4.197  1.170   -2.636  1.00 0.00 ? 136 VAL A HA   5  
ATOM 7516  H HB   . VAL A 1 113 ? -4.765  -0.059  -4.585  1.00 0.00 ? 136 VAL A HB   5  
ATOM 7517  H HG11 . VAL A 1 113 ? -5.232  1.810   -6.099  1.00 0.00 ? 136 VAL A HG11 5  
ATOM 7518  H HG12 . VAL A 1 113 ? -3.493  2.071   -6.284  1.00 0.00 ? 136 VAL A HG12 5  
ATOM 7519  H HG13 . VAL A 1 113 ? -4.243  0.507   -6.794  1.00 0.00 ? 136 VAL A HG13 5  
ATOM 7520  H HG21 . VAL A 1 113 ? -2.591  -0.691  -5.237  1.00 0.00 ? 136 VAL A HG21 5  
ATOM 7521  H HG22 . VAL A 1 113 ? -1.913  0.931   -4.928  1.00 0.00 ? 136 VAL A HG22 5  
ATOM 7522  H HG23 . VAL A 1 113 ? -2.435  -0.108  -3.576  1.00 0.00 ? 136 VAL A HG23 5  
ATOM 7523  N N    . GLN A 1 114 ? -3.628  4.059   -4.036  1.00 0.00 ? 137 GLN A N    5  
ATOM 7524  C CA   . GLN A 1 114 ? -2.841  5.272   -3.862  1.00 0.00 ? 137 GLN A CA   5  
ATOM 7525  C C    . GLN A 1 114 ? -2.731  5.620   -2.377  1.00 0.00 ? 137 GLN A C    5  
ATOM 7526  O O    . GLN A 1 114 ? -1.654  6.020   -1.929  1.00 0.00 ? 137 GLN A O    5  
ATOM 7527  C CB   . GLN A 1 114 ? -3.474  6.449   -4.612  1.00 0.00 ? 137 GLN A CB   5  
ATOM 7528  C CG   . GLN A 1 114 ? -3.223  6.454   -6.129  1.00 0.00 ? 137 GLN A CG   5  
ATOM 7529  C CD   . GLN A 1 114 ? -4.149  7.431   -6.855  1.00 0.00 ? 137 GLN A CD   5  
ATOM 7530  O OE1  . GLN A 1 114 ? -4.777  8.296   -6.251  1.00 0.00 ? 137 GLN A OE1  5  
ATOM 7531  N NE2  . GLN A 1 114 ? -4.264  7.337   -8.167  1.00 0.00 ? 137 GLN A NE2  5  
ATOM 7532  H H    . GLN A 1 114 ? -4.476  4.112   -4.591  1.00 0.00 ? 137 GLN A H    5  
ATOM 7533  H HA   . GLN A 1 114 ? -1.836  5.098   -4.247  1.00 0.00 ? 137 GLN A HA   5  
ATOM 7534  H HB2  . GLN A 1 114 ? -4.543  6.445   -4.418  1.00 0.00 ? 137 GLN A HB2  5  
ATOM 7535  H HB3  . GLN A 1 114 ? -3.072  7.374   -4.202  1.00 0.00 ? 137 GLN A HB3  5  
ATOM 7536  H HG2  . GLN A 1 114 ? -2.185  6.726   -6.321  1.00 0.00 ? 137 GLN A HG2  5  
ATOM 7537  H HG3  . GLN A 1 114 ? -3.381  5.457   -6.531  1.00 0.00 ? 137 GLN A HG3  5  
ATOM 7538  H HE21 . GLN A 1 114 ? -3.757  6.655   -8.709  1.00 0.00 ? 137 GLN A HE21 5  
ATOM 7539  H HE22 . GLN A 1 114 ? -4.854  8.011   -8.641  1.00 0.00 ? 137 GLN A HE22 5  
ATOM 7540  N N    . GLU A 1 115 ? -3.807  5.493   -1.595  1.00 0.00 ? 138 GLU A N    5  
ATOM 7541  C CA   . GLU A 1 115 ? -3.712  5.727   -0.161  1.00 0.00 ? 138 GLU A CA   5  
ATOM 7542  C C    . GLU A 1 115 ? -3.099  4.544   0.590   1.00 0.00 ? 138 GLU A C    5  
ATOM 7543  O O    . GLU A 1 115 ? -2.364  4.768   1.548   1.00 0.00 ? 138 GLU A O    5  
ATOM 7544  C CB   . GLU A 1 115 ? -5.035  6.200   0.455   1.00 0.00 ? 138 GLU A CB   5  
ATOM 7545  C CG   . GLU A 1 115 ? -4.788  6.978   1.769   1.00 0.00 ? 138 GLU A CG   5  
ATOM 7546  C CD   . GLU A 1 115 ? -3.815  8.167   1.638   1.00 0.00 ? 138 GLU A CD   5  
ATOM 7547  O OE1  . GLU A 1 115 ? -3.688  8.754   0.538   1.00 0.00 ? 138 GLU A OE1  5  
ATOM 7548  O OE2  . GLU A 1 115 ? -3.134  8.535   2.620   1.00 0.00 ? 138 GLU A OE2  5  
ATOM 7549  H H    . GLU A 1 115 ? -4.695  5.172   -1.973  1.00 0.00 ? 138 GLU A H    5  
ATOM 7550  H HA   . GLU A 1 115 ? -3.023  6.546   -0.062  1.00 0.00 ? 138 GLU A HA   5  
ATOM 7551  H HB2  . GLU A 1 115 ? -5.546  6.851   -0.252  1.00 0.00 ? 138 GLU A HB2  5  
ATOM 7552  H HB3  . GLU A 1 115 ? -5.684  5.345   0.650   1.00 0.00 ? 138 GLU A HB3  5  
ATOM 7553  H HG2  . GLU A 1 115 ? -5.746  7.350   2.128   1.00 0.00 ? 138 GLU A HG2  5  
ATOM 7554  H HG3  . GLU A 1 115 ? -4.404  6.290   2.522   1.00 0.00 ? 138 GLU A HG3  5  
ATOM 7555  N N    . LEU A 1 116 ? -3.308  3.304   0.131   1.00 0.00 ? 139 LEU A N    5  
ATOM 7556  C CA   . LEU A 1 116 ? -2.797  2.108   0.811   1.00 0.00 ? 139 LEU A CA   5  
ATOM 7557  C C    . LEU A 1 116 ? -1.286  2.150   0.987   1.00 0.00 ? 139 LEU A C    5  
ATOM 7558  O O    . LEU A 1 116 ? -0.786  1.696   2.015   1.00 0.00 ? 139 LEU A O    5  
ATOM 7559  C CB   . LEU A 1 116 ? -3.178  0.801   0.087   1.00 0.00 ? 139 LEU A CB   5  
ATOM 7560  C CG   . LEU A 1 116 ? -4.688  0.569   -0.066  1.00 0.00 ? 139 LEU A CG   5  
ATOM 7561  C CD1  . LEU A 1 116 ? -5.031  -0.816  -0.619  1.00 0.00 ? 139 LEU A CD1  5  
ATOM 7562  C CD2  . LEU A 1 116 ? -5.455  0.911   1.199   1.00 0.00 ? 139 LEU A CD2  5  
ATOM 7563  H H    . LEU A 1 116 ? -3.930  3.202   -0.664  1.00 0.00 ? 139 LEU A H    5  
ATOM 7564  H HA   . LEU A 1 116 ? -3.222  2.097   1.815   1.00 0.00 ? 139 LEU A HA   5  
ATOM 7565  H HB2  . LEU A 1 116 ? -2.707  0.779   -0.897  1.00 0.00 ? 139 LEU A HB2  5  
ATOM 7566  H HB3  . LEU A 1 116 ? -2.765  -0.024  0.667   1.00 0.00 ? 139 LEU A HB3  5  
ATOM 7567  H HG   . LEU A 1 116 ? -5.054  1.254   -0.799  1.00 0.00 ? 139 LEU A HG   5  
ATOM 7568  H HD11 . LEU A 1 116 ? -4.748  -0.860  -1.670  1.00 0.00 ? 139 LEU A HD11 5  
ATOM 7569  H HD12 . LEU A 1 116 ? -4.530  -1.593  -0.049  1.00 0.00 ? 139 LEU A HD12 5  
ATOM 7570  H HD13 . LEU A 1 116 ? -6.111  -0.966  -0.580  1.00 0.00 ? 139 LEU A HD13 5  
ATOM 7571  H HD21 . LEU A 1 116 ? -5.585  1.993   1.227   1.00 0.00 ? 139 LEU A HD21 5  
ATOM 7572  H HD22 . LEU A 1 116 ? -6.436  0.445   1.182   1.00 0.00 ? 139 LEU A HD22 5  
ATOM 7573  H HD23 . LEU A 1 116 ? -4.887  0.570   2.063   1.00 0.00 ? 139 LEU A HD23 5  
ATOM 7574  N N    . CYS A 1 117 ? -0.570  2.686   0.000   1.00 0.00 ? 140 CYS A N    5  
ATOM 7575  C CA   . CYS A 1 117 ? 0.868   2.880   0.087   1.00 0.00 ? 140 CYS A CA   5  
ATOM 7576  C C    . CYS A 1 117 ? 1.210   4.225   0.755   1.00 0.00 ? 140 CYS A C    5  
ATOM 7577  O O    . CYS A 1 117 ? 2.211   4.327   1.450   1.00 0.00 ? 140 CYS A O    5  
ATOM 7578  C CB   . CYS A 1 117 ? 1.443   2.737   -1.325  1.00 0.00 ? 140 CYS A CB   5  
ATOM 7579  S SG   . CYS A 1 117 ? 1.263   1.047   -1.976  1.00 0.00 ? 140 CYS A SG   5  
ATOM 7580  H H    . CYS A 1 117 ? -1.058  2.958   -0.843  1.00 0.00 ? 140 CYS A H    5  
ATOM 7581  H HA   . CYS A 1 117 ? 1.304   2.090   0.703   1.00 0.00 ? 140 CYS A HA   5  
ATOM 7582  H HB2  . CYS A 1 117 ? 0.928   3.427   -1.986  1.00 0.00 ? 140 CYS A HB2  5  
ATOM 7583  H HB3  . CYS A 1 117 ? 2.497   3.001   -1.300  1.00 0.00 ? 140 CYS A HB3  5  
ATOM 7584  N N    . SER A 1 118 ? 0.386   5.266   0.598   1.00 0.00 ? 141 SER A N    5  
ATOM 7585  C CA   . SER A 1 118 ? 0.566   6.584   1.220   1.00 0.00 ? 141 SER A CA   5  
ATOM 7586  C C    . SER A 1 118 ? 0.329   6.624   2.741   1.00 0.00 ? 141 SER A C    5  
ATOM 7587  O O    . SER A 1 118 ? 0.539   7.677   3.347   1.00 0.00 ? 141 SER A O    5  
ATOM 7588  C CB   . SER A 1 118 ? -0.396  7.539   0.501   1.00 0.00 ? 141 SER A CB   5  
ATOM 7589  O OG   . SER A 1 118 ? -0.366  8.891   0.898   1.00 0.00 ? 141 SER A OG   5  
ATOM 7590  H H    . SER A 1 118 ? -0.437  5.144   0.022   1.00 0.00 ? 141 SER A H    5  
ATOM 7591  H HA   . SER A 1 118 ? 1.592   6.892   1.057   1.00 0.00 ? 141 SER A HA   5  
ATOM 7592  H HB2  . SER A 1 118 ? -0.200  7.498   -0.570  1.00 0.00 ? 141 SER A HB2  5  
ATOM 7593  H HB3  . SER A 1 118 ? -1.396  7.181   0.698   1.00 0.00 ? 141 SER A HB3  5  
ATOM 7594  H HG   . SER A 1 118 ? -1.202  9.066   1.361   1.00 0.00 ? 141 SER A HG   5  
ATOM 7595  N N    . LEU A 1 119 ? -0.138  5.534   3.345   1.00 0.00 ? 142 LEU A N    5  
ATOM 7596  C CA   . LEU A 1 119 ? -0.782  5.415   4.655   1.00 0.00 ? 142 LEU A CA   5  
ATOM 7597  C C    . LEU A 1 119 ? -0.079  6.197   5.784   1.00 0.00 ? 142 LEU A C    5  
ATOM 7598  O O    . LEU A 1 119 ? 0.827   5.669   6.427   1.00 0.00 ? 142 LEU A O    5  
ATOM 7599  C CB   . LEU A 1 119 ? -0.903  3.905   4.945   1.00 0.00 ? 142 LEU A CB   5  
ATOM 7600  C CG   . LEU A 1 119 ? -2.128  3.473   5.771   1.00 0.00 ? 142 LEU A CG   5  
ATOM 7601  C CD1  . LEU A 1 119 ? -2.310  4.274   7.064   1.00 0.00 ? 142 LEU A CD1  5  
ATOM 7602  C CD2  . LEU A 1 119 ? -3.412  3.534   4.934   1.00 0.00 ? 142 LEU A CD2  5  
ATOM 7603  H H    . LEU A 1 119 ? -0.284  4.741   2.739   1.00 0.00 ? 142 LEU A H    5  
ATOM 7604  H HA   . LEU A 1 119 ? -1.787  5.819   4.539   1.00 0.00 ? 142 LEU A HA   5  
ATOM 7605  H HB2  . LEU A 1 119 ? -0.933  3.383   3.987   1.00 0.00 ? 142 LEU A HB2  5  
ATOM 7606  H HB3  . LEU A 1 119 ? 0.000   3.553   5.445   1.00 0.00 ? 142 LEU A HB3  5  
ATOM 7607  H HG   . LEU A 1 119 ? -1.976  2.430   6.048   1.00 0.00 ? 142 LEU A HG   5  
ATOM 7608  H HD11 . LEU A 1 119 ? -3.105  3.829   7.660   1.00 0.00 ? 142 LEU A HD11 5  
ATOM 7609  H HD12 . LEU A 1 119 ? -1.391  4.256   7.651   1.00 0.00 ? 142 LEU A HD12 5  
ATOM 7610  H HD13 . LEU A 1 119 ? -2.583  5.307   6.849   1.00 0.00 ? 142 LEU A HD13 5  
ATOM 7611  H HD21 . LEU A 1 119 ? -4.244  3.144   5.518   1.00 0.00 ? 142 LEU A HD21 5  
ATOM 7612  H HD22 . LEU A 1 119 ? -3.634  4.560   4.639   1.00 0.00 ? 142 LEU A HD22 5  
ATOM 7613  H HD23 . LEU A 1 119 ? -3.295  2.926   4.037   1.00 0.00 ? 142 LEU A HD23 5  
ATOM 7614  N N    . LYS A 1 120 ? -0.508  7.448   6.023   1.00 0.00 ? 143 LYS A N    5  
ATOM 7615  C CA   . LYS A 1 120 ? 0.203   8.498   6.772   1.00 0.00 ? 143 LYS A CA   5  
ATOM 7616  C C    . LYS A 1 120 ? 1.721   8.364   6.658   1.00 0.00 ? 143 LYS A C    5  
ATOM 7617  O O    . LYS A 1 120 ? 2.419   8.137   7.648   1.00 0.00 ? 143 LYS A O    5  
ATOM 7618  C CB   . LYS A 1 120 ? -0.290  8.652   8.220   1.00 0.00 ? 143 LYS A CB   5  
ATOM 7619  C CG   . LYS A 1 120 ? -1.559  9.510   8.329   1.00 0.00 ? 143 LYS A CG   5  
ATOM 7620  C CD   . LYS A 1 120 ? -1.727  10.018  9.770   1.00 0.00 ? 143 LYS A CD   5  
ATOM 7621  C CE   . LYS A 1 120 ? -3.063  10.729  10.008  1.00 0.00 ? 143 LYS A CE   5  
ATOM 7622  N NZ   . LYS A 1 120 ? -4.197  9.789   9.939   1.00 0.00 ? 143 LYS A NZ   5  
ATOM 7623  H H    . LYS A 1 120 ? -1.258  7.786   5.436   1.00 0.00 ? 143 LYS A H    5  
ATOM 7624  H HA   . LYS A 1 120 ? -0.023  9.441   6.277   1.00 0.00 ? 143 LYS A HA   5  
ATOM 7625  H HB2  . LYS A 1 120 ? -0.463  7.671   8.654   1.00 0.00 ? 143 LYS A HB2  5  
ATOM 7626  H HB3  . LYS A 1 120 ? 0.487   9.151   8.802   1.00 0.00 ? 143 LYS A HB3  5  
ATOM 7627  H HG2  . LYS A 1 120 ? -1.473  10.377  7.677   1.00 0.00 ? 143 LYS A HG2  5  
ATOM 7628  H HG3  . LYS A 1 120 ? -2.419  8.922   8.013   1.00 0.00 ? 143 LYS A HG3  5  
ATOM 7629  H HD2  . LYS A 1 120 ? -1.631  9.185   10.468  1.00 0.00 ? 143 LYS A HD2  5  
ATOM 7630  H HD3  . LYS A 1 120 ? -0.924  10.727  9.982   1.00 0.00 ? 143 LYS A HD3  5  
ATOM 7631  H HE2  . LYS A 1 120 ? -3.046  11.180  11.002  1.00 0.00 ? 143 LYS A HE2  5  
ATOM 7632  H HE3  . LYS A 1 120 ? -3.192  11.524  9.272   1.00 0.00 ? 143 LYS A HE3  5  
ATOM 7633  H HZ1  . LYS A 1 120 ? -5.064  10.241  10.211  1.00 0.00 ? 143 LYS A HZ1  5  
ATOM 7634  H HZ2  . LYS A 1 120 ? -4.300  9.382   9.022   1.00 0.00 ? 143 LYS A HZ2  5  
ATOM 7635  H HZ3  . LYS A 1 120 ? -4.051  9.020   10.586  1.00 0.00 ? 143 LYS A HZ3  5  
ATOM 7636  N N    . HIS A 1 121 ? 2.183   8.634   5.438   1.00 0.00 ? 144 HIS A N    5  
ATOM 7637  C CA   . HIS A 1 121 ? 3.539   8.699   4.917   1.00 0.00 ? 144 HIS A CA   5  
ATOM 7638  C C    . HIS A 1 121 ? 4.421   7.496   5.248   1.00 0.00 ? 144 HIS A C    5  
ATOM 7639  O O    . HIS A 1 121 ? 4.005   6.515   5.865   1.00 0.00 ? 144 HIS A O    5  
ATOM 7640  C CB   . HIS A 1 121 ? 4.200   10.064  5.198   1.00 0.00 ? 144 HIS A CB   5  
ATOM 7641  C CG   . HIS A 1 121 ? 4.924   10.216  6.513   1.00 0.00 ? 144 HIS A CG   5  
ATOM 7642  N ND1  . HIS A 1 121 ? 4.378   10.072  7.763   1.00 0.00 ? 144 HIS A ND1  5  
ATOM 7643  C CD2  . HIS A 1 121 ? 6.221   10.625  6.678   1.00 0.00 ? 144 HIS A CD2  5  
ATOM 7644  C CE1  . HIS A 1 121 ? 5.309   10.413  8.662   1.00 0.00 ? 144 HIS A CE1  5  
ATOM 7645  N NE2  . HIS A 1 121 ? 6.458   10.760  8.052   1.00 0.00 ? 144 HIS A NE2  5  
ATOM 7646  H H    . HIS A 1 121 ? 1.473   8.666   4.721   1.00 0.00 ? 144 HIS A H    5  
ATOM 7647  H HA   . HIS A 1 121 ? 3.403   8.658   3.837   1.00 0.00 ? 144 HIS A HA   5  
ATOM 7648  H HB2  . HIS A 1 121 ? 4.938   10.237  4.417   1.00 0.00 ? 144 HIS A HB2  5  
ATOM 7649  H HB3  . HIS A 1 121 ? 3.454   10.856  5.113   1.00 0.00 ? 144 HIS A HB3  5  
ATOM 7650  H HD1  . HIS A 1 121 ? 3.476   9.653   7.977   1.00 0.00 ? 144 HIS A HD1  5  
ATOM 7651  H HD2  . HIS A 1 121 ? 6.917   10.850  5.883   1.00 0.00 ? 144 HIS A HD2  5  
ATOM 7652  H HE1  . HIS A 1 121 ? 5.129   10.437  9.728   1.00 0.00 ? 144 HIS A HE1  5  
ATOM 7653  N N    . CYS A 1 122 ? 5.649   7.562   4.741   1.00 0.00 ? 145 CYS A N    5  
ATOM 7654  C CA   . CYS A 1 122 ? 6.711   6.632   5.056   1.00 0.00 ? 145 CYS A CA   5  
ATOM 7655  C C    . CYS A 1 122 ? 7.415   7.203   6.287   1.00 0.00 ? 145 CYS A C    5  
ATOM 7656  O O    . CYS A 1 122 ? 7.018   6.917   7.413   1.00 0.00 ? 145 CYS A O    5  
ATOM 7657  C CB   . CYS A 1 122 ? 7.599   6.465   3.809   1.00 0.00 ? 145 CYS A CB   5  
ATOM 7658  S SG   . CYS A 1 122 ? 7.891   4.772   3.292   1.00 0.00 ? 145 CYS A SG   5  
ATOM 7659  H H    . CYS A 1 122 ? 5.898   8.408   4.252   1.00 0.00 ? 145 CYS A H    5  
ATOM 7660  H HA   . CYS A 1 122 ? 6.278   5.665   5.315   1.00 0.00 ? 145 CYS A HA   5  
ATOM 7661  H HB2  . CYS A 1 122 ? 7.099   6.939   2.971   1.00 0.00 ? 145 CYS A HB2  5  
ATOM 7662  H HB3  . CYS A 1 122 ? 8.566   6.952   3.925   1.00 0.00 ? 145 CYS A HB3  5  
ATOM 7663  N N    . GLU A 1 123 ? 8.398   8.071   6.063   1.00 0.00 ? 146 GLU A N    5  
ATOM 7664  C CA   . GLU A 1 123 ? 9.215   8.765   7.042   1.00 0.00 ? 146 GLU A CA   5  
ATOM 7665  C C    . GLU A 1 123 ? 9.699   10.045  6.359   1.00 0.00 ? 146 GLU A C    5  
ATOM 7666  O O    . GLU A 1 123 ? 9.680   10.121  5.128   1.00 0.00 ? 146 GLU A O    5  
ATOM 7667  C CB   . GLU A 1 123 ? 10.422  7.891   7.409   1.00 0.00 ? 146 GLU A CB   5  
ATOM 7668  C CG   . GLU A 1 123 ? 10.125  6.999   8.627   1.00 0.00 ? 146 GLU A CG   5  
ATOM 7669  C CD   . GLU A 1 123 ? 11.278  6.084   9.038   1.00 0.00 ? 146 GLU A CD   5  
ATOM 7670  O OE1  . GLU A 1 123 ? 12.382  6.147   8.444   1.00 0.00 ? 146 GLU A OE1  5  
ATOM 7671  O OE2  . GLU A 1 123 ? 11.091  5.256   9.959   1.00 0.00 ? 146 GLU A OE2  5  
ATOM 7672  H H    . GLU A 1 123 ? 8.626   8.367   5.124   1.00 0.00 ? 146 GLU A H    5  
ATOM 7673  H HA   . GLU A 1 123 ? 8.632   9.017   7.930   1.00 0.00 ? 146 GLU A HA   5  
ATOM 7674  H HB2  . GLU A 1 123 ? 10.697  7.275   6.550   1.00 0.00 ? 146 GLU A HB2  5  
ATOM 7675  H HB3  . GLU A 1 123 ? 11.265  8.547   7.622   1.00 0.00 ? 146 GLU A HB3  5  
ATOM 7676  H HG2  . GLU A 1 123 ? 9.853   7.623   9.479   1.00 0.00 ? 146 GLU A HG2  5  
ATOM 7677  H HG3  . GLU A 1 123 ? 9.275   6.363   8.395   1.00 0.00 ? 146 GLU A HG3  5  
ATOM 7678  N N    . PHE A 1 124 ? 10.164  11.017  7.143   1.00 0.00 ? 147 PHE A N    5  
ATOM 7679  C CA   . PHE A 1 124 ? 10.531  12.389  6.794   1.00 0.00 ? 147 PHE A CA   5  
ATOM 7680  C C    . PHE A 1 124 ? 9.372   13.197  6.190   1.00 0.00 ? 147 PHE A C    5  
ATOM 7681  O O    . PHE A 1 124 ? 9.028   14.239  6.755   1.00 0.00 ? 147 PHE A O    5  
ATOM 7682  C CB   . PHE A 1 124 ? 11.852  12.463  5.996   1.00 0.00 ? 147 PHE A CB   5  
ATOM 7683  C CG   . PHE A 1 124 ? 11.776  13.168  4.654   1.00 0.00 ? 147 PHE A CG   5  
ATOM 7684  C CD1  . PHE A 1 124 ? 11.807  14.573  4.573   1.00 0.00 ? 147 PHE A CD1  5  
ATOM 7685  C CD2  . PHE A 1 124 ? 11.566  12.412  3.491   1.00 0.00 ? 147 PHE A CD2  5  
ATOM 7686  C CE1  . PHE A 1 124 ? 11.583  15.205  3.335   1.00 0.00 ? 147 PHE A CE1  5  
ATOM 7687  C CE2  . PHE A 1 124 ? 11.339  13.042  2.259   1.00 0.00 ? 147 PHE A CE2  5  
ATOM 7688  C CZ   . PHE A 1 124 ? 11.328  14.442  2.185   1.00 0.00 ? 147 PHE A CZ   5  
ATOM 7689  H H    . PHE A 1 124 ? 10.176  10.804  8.137   1.00 0.00 ? 147 PHE A H    5  
ATOM 7690  H HA   . PHE A 1 124 ? 10.750  12.865  7.751   1.00 0.00 ? 147 PHE A HA   5  
ATOM 7691  H HB2  . PHE A 1 124 ? 12.579  12.993  6.605   1.00 0.00 ? 147 PHE A HB2  5  
ATOM 7692  H HB3  . PHE A 1 124 ? 12.243  11.456  5.848   1.00 0.00 ? 147 PHE A HB3  5  
ATOM 7693  H HD1  . PHE A 1 124 ? 11.953  15.159  5.469   1.00 0.00 ? 147 PHE A HD1  5  
ATOM 7694  H HD2  . PHE A 1 124 ? 11.533  11.337  3.568   1.00 0.00 ? 147 PHE A HD2  5  
ATOM 7695  H HE1  . PHE A 1 124 ? 11.543  16.278  3.249   1.00 0.00 ? 147 PHE A HE1  5  
ATOM 7696  H HE2  . PHE A 1 124 ? 11.111  12.452  1.381   1.00 0.00 ? 147 PHE A HE2  5  
ATOM 7697  H HZ   . PHE A 1 124 ? 11.093  14.936  1.250   1.00 0.00 ? 147 PHE A HZ   5  
ATOM 7698  N N    . TRP A 1 125 ? 8.787   12.764  5.066   1.00 0.00 ? 148 TRP A N    5  
ATOM 7699  C CA   . TRP A 1 125 ? 7.798   13.517  4.303   1.00 0.00 ? 148 TRP A CA   5  
ATOM 7700  C C    . TRP A 1 125 ? 6.398   13.432  4.921   1.00 0.00 ? 148 TRP A C    5  
ATOM 7701  O O    . TRP A 1 125 ? 5.460   12.979  4.266   1.00 0.00 ? 148 TRP A O    5  
ATOM 7702  C CB   . TRP A 1 125 ? 7.800   13.066  2.828   1.00 0.00 ? 148 TRP A CB   5  
ATOM 7703  C CG   . TRP A 1 125 ? 7.652   11.601  2.480   1.00 0.00 ? 148 TRP A CG   5  
ATOM 7704  C CD1  . TRP A 1 125 ? 8.644   10.682  2.485   1.00 0.00 ? 148 TRP A CD1  5  
ATOM 7705  C CD2  . TRP A 1 125 ? 6.462   10.861  2.059   1.00 0.00 ? 148 TRP A CD2  5  
ATOM 7706  N NE1  . TRP A 1 125 ? 8.181   9.466   2.038   1.00 0.00 ? 148 TRP A NE1  5  
ATOM 7707  C CE2  . TRP A 1 125 ? 6.836   9.514   1.769   1.00 0.00 ? 148 TRP A CE2  5  
ATOM 7708  C CE3  . TRP A 1 125 ? 5.093   11.170  1.931   1.00 0.00 ? 148 TRP A CE3  5  
ATOM 7709  C CZ2  . TRP A 1 125 ? 5.917   8.546   1.343   1.00 0.00 ? 148 TRP A CZ2  5  
ATOM 7710  C CZ3  . TRP A 1 125 ? 4.145   10.170  1.650   1.00 0.00 ? 148 TRP A CZ3  5  
ATOM 7711  C CH2  . TRP A 1 125 ? 4.552   8.869   1.314   1.00 0.00 ? 148 TRP A CH2  5  
ATOM 7712  H H    . TRP A 1 125 ? 9.130   11.900  4.651   1.00 0.00 ? 148 TRP A H    5  
ATOM 7713  H HA   . TRP A 1 125 ? 8.089   14.568  4.320   1.00 0.00 ? 148 TRP A HA   5  
ATOM 7714  H HB2  . TRP A 1 125 ? 7.000   13.613  2.337   1.00 0.00 ? 148 TRP A HB2  5  
ATOM 7715  H HB3  . TRP A 1 125 ? 8.711   13.425  2.362   1.00 0.00 ? 148 TRP A HB3  5  
ATOM 7716  H HD1  . TRP A 1 125 ? 9.659   10.852  2.800   1.00 0.00 ? 148 TRP A HD1  5  
ATOM 7717  H HE1  . TRP A 1 125 ? 8.780   8.657   1.946   1.00 0.00 ? 148 TRP A HE1  5  
ATOM 7718  H HE3  . TRP A 1 125 ? 4.761   12.174  2.154   1.00 0.00 ? 148 TRP A HE3  5  
ATOM 7719  H HZ2  . TRP A 1 125 ? 6.256   7.553   1.086   1.00 0.00 ? 148 TRP A HZ2  5  
ATOM 7720  H HZ3  . TRP A 1 125 ? 3.092   10.416  1.692   1.00 0.00 ? 148 TRP A HZ3  5  
ATOM 7721  H HH2  . TRP A 1 125 ? 3.819   8.117   1.056   1.00 0.00 ? 148 TRP A HH2  5  
ATOM 7722  N N    . LEU A 1 126 ? 6.208   13.847  6.171   1.00 0.00 ? 149 LEU A N    5  
ATOM 7723  C CA   . LEU A 1 126 ? 4.876   13.895  6.735   1.00 0.00 ? 149 LEU A CA   5  
ATOM 7724  C C    . LEU A 1 126 ? 3.964   14.846  5.949   1.00 0.00 ? 149 LEU A C    5  
ATOM 7725  O O    . LEU A 1 126 ? 4.398   15.892  5.443   1.00 0.00 ? 149 LEU A O    5  
ATOM 7726  C CB   . LEU A 1 126 ? 4.881   14.061  8.242   1.00 0.00 ? 149 LEU A CB   5  
ATOM 7727  C CG   . LEU A 1 126 ? 5.393   15.321  8.913   1.00 0.00 ? 149 LEU A CG   5  
ATOM 7728  C CD1  . LEU A 1 126 ? 6.898   15.485  8.741   1.00 0.00 ? 149 LEU A CD1  5  
ATOM 7729  C CD2  . LEU A 1 126 ? 4.649   16.606  8.563   1.00 0.00 ? 149 LEU A CD2  5  
ATOM 7730  H H    . LEU A 1 126 ? 6.962   14.201  6.743   1.00 0.00 ? 149 LEU A H    5  
ATOM 7731  H HA   . LEU A 1 126 ? 4.477   12.901  6.652   1.00 0.00 ? 149 LEU A HA   5  
ATOM 7732  H HB2  . LEU A 1 126 ? 3.863   13.936  8.565   1.00 0.00 ? 149 LEU A HB2  5  
ATOM 7733  H HB3  . LEU A 1 126 ? 5.428   13.219  8.666   1.00 0.00 ? 149 LEU A HB3  5  
ATOM 7734  H HG   . LEU A 1 126 ? 5.192   15.098  9.946   1.00 0.00 ? 149 LEU A HG   5  
ATOM 7735  H HD11 . LEU A 1 126 ? 7.276   16.191  9.478   1.00 0.00 ? 149 LEU A HD11 5  
ATOM 7736  H HD12 . LEU A 1 126 ? 7.369   14.520  8.917   1.00 0.00 ? 149 LEU A HD12 5  
ATOM 7737  H HD13 . LEU A 1 126 ? 7.129   15.816  7.729   1.00 0.00 ? 149 LEU A HD13 5  
ATOM 7738  H HD21 . LEU A 1 126 ? 3.579   16.415  8.606   1.00 0.00 ? 149 LEU A HD21 5  
ATOM 7739  H HD22 . LEU A 1 126 ? 4.908   17.374  9.288   1.00 0.00 ? 149 LEU A HD22 5  
ATOM 7740  H HD23 . LEU A 1 126 ? 4.934   16.947  7.572   1.00 0.00 ? 149 LEU A HD23 5  
ATOM 7741  N N    . GLU A 1 127 ? 2.689   14.470  5.858   1.00 0.00 ? 150 GLU A N    5  
ATOM 7742  C CA   . GLU A 1 127 ? 1.613   15.304  5.349   1.00 0.00 ? 150 GLU A CA   5  
ATOM 7743  C C    . GLU A 1 127 ? 0.948   15.921  6.578   1.00 0.00 ? 150 GLU A C    5  
ATOM 7744  O O    . GLU A 1 127 ? 0.596   15.220  7.533   1.00 0.00 ? 150 GLU A O    5  
ATOM 7745  C CB   . GLU A 1 127 ? 0.647   14.489  4.469   1.00 0.00 ? 150 GLU A CB   5  
ATOM 7746  C CG   . GLU A 1 127 ? -0.563  15.332  4.014   1.00 0.00 ? 150 GLU A CG   5  
ATOM 7747  C CD   . GLU A 1 127 ? -1.101  14.965  2.625   1.00 0.00 ? 150 GLU A CD   5  
ATOM 7748  O OE1  . GLU A 1 127 ? -0.307  14.905  1.660   1.00 0.00 ? 150 GLU A OE1  5  
ATOM 7749  O OE2  . GLU A 1 127 ? -2.341  14.909  2.425   1.00 0.00 ? 150 GLU A OE2  5  
ATOM 7750  H H    . GLU A 1 127 ? 2.407   13.635  6.362   1.00 0.00 ? 150 GLU A H    5  
ATOM 7751  H HA   . GLU A 1 127 ? 2.044   16.090  4.729   1.00 0.00 ? 150 GLU A HA   5  
ATOM 7752  H HB2  . GLU A 1 127 ? 1.206   14.124  3.603   1.00 0.00 ? 150 GLU A HB2  5  
ATOM 7753  H HB3  . GLU A 1 127 ? 0.286   13.633  5.033   1.00 0.00 ? 150 GLU A HB3  5  
ATOM 7754  H HG2  . GLU A 1 127 ? -1.361  15.246  4.755   1.00 0.00 ? 150 GLU A HG2  5  
ATOM 7755  H HG3  . GLU A 1 127 ? -0.264  16.379  3.968   1.00 0.00 ? 150 GLU A HG3  5  
ATOM 7756  N N    . ALA A 1 29  ? 1.331   -15.231 -2.843  1.00 0.00 ? 52  ALA A N    6  
ATOM 7757  C CA   . ALA A 1 29  ? 0.685   -14.031 -3.338  1.00 0.00 ? 52  ALA A CA   6  
ATOM 7758  C C    . ALA A 1 29  ? 1.391   -12.754 -2.875  1.00 0.00 ? 52  ALA A C    6  
ATOM 7759  O O    . ALA A 1 29  ? 1.889   -12.014 -3.722  1.00 0.00 ? 52  ALA A O    6  
ATOM 7760  C CB   . ALA A 1 29  ? -0.809  -14.066 -3.026  1.00 0.00 ? 52  ALA A CB   6  
ATOM 7761  H H    . ALA A 1 29  ? 1.850   -15.780 -3.508  1.00 0.00 ? 52  ALA A H    6  
ATOM 7762  H HA   . ALA A 1 29  ? 0.772   -14.070 -4.419  1.00 0.00 ? 52  ALA A HA   6  
ATOM 7763  H HB1  . ALA A 1 29  ? -0.975  -13.887 -1.965  1.00 0.00 ? 52  ALA A HB1  6  
ATOM 7764  H HB2  . ALA A 1 29  ? -1.319  -13.310 -3.617  1.00 0.00 ? 52  ALA A HB2  6  
ATOM 7765  H HB3  . ALA A 1 29  ? -1.200  -15.052 -3.279  1.00 0.00 ? 52  ALA A HB3  6  
ATOM 7766  N N    . GLU A 1 30  ? 1.487   -12.527 -1.567  1.00 0.00 ? 53  GLU A N    6  
ATOM 7767  C CA   . GLU A 1 30  ? 2.054   -11.355 -0.879  1.00 0.00 ? 53  GLU A CA   6  
ATOM 7768  C C    . GLU A 1 30  ? 3.489   -11.001 -1.316  1.00 0.00 ? 53  GLU A C    6  
ATOM 7769  O O    . GLU A 1 30  ? 3.919   -9.859  -1.156  1.00 0.00 ? 53  GLU A O    6  
ATOM 7770  C CB   . GLU A 1 30  ? 1.995   -11.585 0.648   1.00 0.00 ? 53  GLU A CB   6  
ATOM 7771  C CG   . GLU A 1 30  ? 2.797   -12.818 1.051   1.00 0.00 ? 53  GLU A CG   6  
ATOM 7772  C CD   . GLU A 1 30  ? 2.747   -13.197 2.537   1.00 0.00 ? 53  GLU A CD   6  
ATOM 7773  O OE1  . GLU A 1 30  ? 1.681   -13.609 3.047   1.00 0.00 ? 53  GLU A OE1  6  
ATOM 7774  O OE2  . GLU A 1 30  ? 3.826   -13.208 3.182   1.00 0.00 ? 53  GLU A OE2  6  
ATOM 7775  H H    . GLU A 1 30  ? 1.107   -13.273 -0.987  1.00 0.00 ? 53  GLU A H    6  
ATOM 7776  H HA   . GLU A 1 30  ? 1.424   -10.497 -1.101  1.00 0.00 ? 53  GLU A HA   6  
ATOM 7777  H HB2  . GLU A 1 30  ? 2.414   -10.722 1.160   1.00 0.00 ? 53  GLU A HB2  6  
ATOM 7778  H HB3  . GLU A 1 30  ? 0.956   -11.721 0.951   1.00 0.00 ? 53  GLU A HB3  6  
ATOM 7779  H HG2  . GLU A 1 30  ? 2.399   -13.643 0.480   1.00 0.00 ? 53  GLU A HG2  6  
ATOM 7780  H HG3  . GLU A 1 30  ? 3.827   -12.654 0.737   1.00 0.00 ? 53  GLU A HG3  6  
ATOM 7781  N N    . ASN A 1 31  ? 4.220   -11.968 -1.886  1.00 0.00 ? 54  ASN A N    6  
ATOM 7782  C CA   . ASN A 1 31  ? 5.590   -11.805 -2.379  1.00 0.00 ? 54  ASN A CA   6  
ATOM 7783  C C    . ASN A 1 31  ? 5.655   -10.830 -3.564  1.00 0.00 ? 54  ASN A C    6  
ATOM 7784  O O    . ASN A 1 31  ? 6.722   -10.310 -3.888  1.00 0.00 ? 54  ASN A O    6  
ATOM 7785  C CB   . ASN A 1 31  ? 6.145   -13.188 -2.775  1.00 0.00 ? 54  ASN A CB   6  
ATOM 7786  C CG   . ASN A 1 31  ? 7.669   -13.281 -2.837  1.00 0.00 ? 54  ASN A CG   6  
ATOM 7787  O OD1  . ASN A 1 31  ? 8.259   -14.097 -2.135  1.00 0.00 ? 54  ASN A OD1  6  
ATOM 7788  N ND2  . ASN A 1 31  ? 8.352   -12.496 -3.644  1.00 0.00 ? 54  ASN A ND2  6  
ATOM 7789  H H    . ASN A 1 31  ? 3.772   -12.867 -1.966  1.00 0.00 ? 54  ASN A H    6  
ATOM 7790  H HA   . ASN A 1 31  ? 6.199   -11.400 -1.568  1.00 0.00 ? 54  ASN A HA   6  
ATOM 7791  H HB2  . ASN A 1 31  ? 5.826   -13.906 -2.022  1.00 0.00 ? 54  ASN A HB2  6  
ATOM 7792  H HB3  . ASN A 1 31  ? 5.727   -13.496 -3.733  1.00 0.00 ? 54  ASN A HB3  6  
ATOM 7793  H HD21 . ASN A 1 31  ? 7.902   -11.734 -4.144  1.00 0.00 ? 54  ASN A HD21 6  
ATOM 7794  H HD22 . ASN A 1 31  ? 9.363   -12.448 -3.546  1.00 0.00 ? 54  ASN A HD22 6  
ATOM 7795  N N    . ARG A 1 32  ? 4.544   -10.578 -4.262  1.00 0.00 ? 55  ARG A N    6  
ATOM 7796  C CA   . ARG A 1 32  ? 4.476   -9.503  -5.230  1.00 0.00 ? 55  ARG A CA   6  
ATOM 7797  C C    . ARG A 1 32  ? 4.637   -8.172  -4.498  1.00 0.00 ? 55  ARG A C    6  
ATOM 7798  O O    . ARG A 1 32  ? 3.890   -7.919  -3.550  1.00 0.00 ? 55  ARG A O    6  
ATOM 7799  C CB   . ARG A 1 32  ? 3.120   -9.544  -5.914  1.00 0.00 ? 55  ARG A CB   6  
ATOM 7800  C CG   . ARG A 1 32  ? 3.119   -10.386 -7.184  1.00 0.00 ? 55  ARG A CG   6  
ATOM 7801  C CD   . ARG A 1 32  ? 1.668   -10.706 -7.542  1.00 0.00 ? 55  ARG A CD   6  
ATOM 7802  N NE   . ARG A 1 32  ? 1.468   -11.032 -8.962  1.00 0.00 ? 55  ARG A NE   6  
ATOM 7803  C CZ   . ARG A 1 32  ? 0.262   -11.237 -9.511  1.00 0.00 ? 55  ARG A CZ   6  
ATOM 7804  N NH1  . ARG A 1 32  ? -0.813  -11.397 -8.746  1.00 0.00 ? 55  ARG A NH1  6  
ATOM 7805  N NH2  . ARG A 1 32  ? 0.121   -11.235 -10.829 1.00 0.00 ? 55  ARG A NH2  6  
ATOM 7806  H H    . ARG A 1 32  ? 3.654   -10.992 -4.017  1.00 0.00 ? 55  ARG A H    6  
ATOM 7807  H HA   . ARG A 1 32  ? 5.265   -9.657  -5.961  1.00 0.00 ? 55  ARG A HA   6  
ATOM 7808  H HB2  . ARG A 1 32  ? 2.448   -9.972  -5.205  1.00 0.00 ? 55  ARG A HB2  6  
ATOM 7809  H HB3  . ARG A 1 32  ? 2.745   -8.544  -6.129  1.00 0.00 ? 55  ARG A HB3  6  
ATOM 7810  H HG2  . ARG A 1 32  ? 3.612   -9.814  -7.958  1.00 0.00 ? 55  ARG A HG2  6  
ATOM 7811  H HG3  . ARG A 1 32  ? 3.664   -11.314 -7.022  1.00 0.00 ? 55  ARG A HG3  6  
ATOM 7812  H HD2  . ARG A 1 32  ? 1.360   -11.544 -6.921  1.00 0.00 ? 55  ARG A HD2  6  
ATOM 7813  H HD3  . ARG A 1 32  ? 1.039   -9.848  -7.299  1.00 0.00 ? 55  ARG A HD3  6  
ATOM 7814  H HE   . ARG A 1 32  ? 2.288   -10.918 -9.558  1.00 0.00 ? 55  ARG A HE   6  
ATOM 7815  H HH11 . ARG A 1 32  ? -0.735  -11.487 -7.735  1.00 0.00 ? 55  ARG A HH11 6  
ATOM 7816  H HH12 . ARG A 1 32  ? -1.746  -11.410 -9.140  1.00 0.00 ? 55  ARG A HH12 6  
ATOM 7817  H HH21 . ARG A 1 32  ? 0.923   -11.168 -11.445 1.00 0.00 ? 55  ARG A HH21 6  
ATOM 7818  H HH22 . ARG A 1 32  ? -0.800  -11.297 -11.270 1.00 0.00 ? 55  ARG A HH22 6  
ATOM 7819  N N    . PRO A 1 33  ? 5.453   -7.253  -5.028  1.00 0.00 ? 56  PRO A N    6  
ATOM 7820  C CA   . PRO A 1 33  ? 5.679   -5.908  -4.506  1.00 0.00 ? 56  PRO A CA   6  
ATOM 7821  C C    . PRO A 1 33  ? 4.448   -4.995  -4.689  1.00 0.00 ? 56  PRO A C    6  
ATOM 7822  O O    . PRO A 1 33  ? 4.538   -3.776  -4.687  1.00 0.00 ? 56  PRO A O    6  
ATOM 7823  C CB   . PRO A 1 33  ? 6.937   -5.435  -5.240  1.00 0.00 ? 56  PRO A CB   6  
ATOM 7824  C CG   . PRO A 1 33  ? 6.968   -6.203  -6.556  1.00 0.00 ? 56  PRO A CG   6  
ATOM 7825  C CD   . PRO A 1 33  ? 6.110   -7.432  -6.308  1.00 0.00 ? 56  PRO A CD   6  
ATOM 7826  H HA   . PRO A 1 33  ? 5.915   -5.945  -3.443  1.00 0.00 ? 56  PRO A HA   6  
ATOM 7827  H HB2  . PRO A 1 33  ? 6.933   -4.367  -5.427  1.00 0.00 ? 56  PRO A HB2  6  
ATOM 7828  H HB3  . PRO A 1 33  ? 7.811   -5.712  -4.651  1.00 0.00 ? 56  PRO A HB3  6  
ATOM 7829  H HG2  . PRO A 1 33  ? 6.505   -5.605  -7.337  1.00 0.00 ? 56  PRO A HG2  6  
ATOM 7830  H HG3  . PRO A 1 33  ? 7.987   -6.475  -6.833  1.00 0.00 ? 56  PRO A HG3  6  
ATOM 7831  H HD2  . PRO A 1 33  ? 5.369   -7.523  -7.102  1.00 0.00 ? 56  PRO A HD2  6  
ATOM 7832  H HD3  . PRO A 1 33  ? 6.698   -8.344  -6.268  1.00 0.00 ? 56  PRO A HD3  6  
ATOM 7833  N N    . GLY A 1 34  ? 3.266   -5.565  -4.868  1.00 0.00 ? 57  GLY A N    6  
ATOM 7834  C CA   . GLY A 1 34  ? 2.021   -4.885  -5.128  1.00 0.00 ? 57  GLY A CA   6  
ATOM 7835  C C    . GLY A 1 34  ? 0.845   -5.849  -5.077  1.00 0.00 ? 57  GLY A C    6  
ATOM 7836  O O    . GLY A 1 34  ? -0.179  -5.563  -5.693  1.00 0.00 ? 57  GLY A O    6  
ATOM 7837  H H    . GLY A 1 34  ? 3.246   -6.558  -4.720  1.00 0.00 ? 57  GLY A H    6  
ATOM 7838  H HA2  . GLY A 1 34  ? 1.877   -4.102  -4.385  1.00 0.00 ? 57  GLY A HA2  6  
ATOM 7839  H HA3  . GLY A 1 34  ? 2.075   -4.423  -6.110  1.00 0.00 ? 57  GLY A HA3  6  
ATOM 7840  N N    . ALA A 1 35  ? 0.969   -6.999  -4.398  1.00 0.00 ? 58  ALA A N    6  
ATOM 7841  C CA   . ALA A 1 35  ? -0.181  -7.865  -4.179  1.00 0.00 ? 58  ALA A CA   6  
ATOM 7842  C C    . ALA A 1 35  ? -1.283  -7.078  -3.453  1.00 0.00 ? 58  ALA A C    6  
ATOM 7843  O O    . ALA A 1 35  ? -0.989  -6.187  -2.649  1.00 0.00 ? 58  ALA A O    6  
ATOM 7844  C CB   . ALA A 1 35  ? 0.260   -9.123  -3.418  1.00 0.00 ? 58  ALA A CB   6  
ATOM 7845  H H    . ALA A 1 35  ? 1.818   -7.218  -3.890  1.00 0.00 ? 58  ALA A H    6  
ATOM 7846  H HA   . ALA A 1 35  ? -0.572  -8.175  -5.150  1.00 0.00 ? 58  ALA A HA   6  
ATOM 7847  H HB1  . ALA A 1 35  ? -0.593  -9.602  -2.948  1.00 0.00 ? 58  ALA A HB1  6  
ATOM 7848  H HB2  . ALA A 1 35  ? 0.687   -9.823  -4.122  1.00 0.00 ? 58  ALA A HB2  6  
ATOM 7849  H HB3  . ALA A 1 35  ? 1.010   -8.919  -2.651  1.00 0.00 ? 58  ALA A HB3  6  
ATOM 7850  N N    . PHE A 1 36  ? -2.544  -7.414  -3.718  1.00 0.00 ? 59  PHE A N    6  
ATOM 7851  C CA   . PHE A 1 36  ? -3.702  -6.825  -3.058  1.00 0.00 ? 59  PHE A CA   6  
ATOM 7852  C C    . PHE A 1 36  ? -3.967  -7.614  -1.780  1.00 0.00 ? 59  PHE A C    6  
ATOM 7853  O O    . PHE A 1 36  ? -4.359  -8.778  -1.872  1.00 0.00 ? 59  PHE A O    6  
ATOM 7854  C CB   . PHE A 1 36  ? -4.912  -6.872  -4.013  1.00 0.00 ? 59  PHE A CB   6  
ATOM 7855  C CG   . PHE A 1 36  ? -5.119  -5.677  -4.928  1.00 0.00 ? 59  PHE A CG   6  
ATOM 7856  C CD1  . PHE A 1 36  ? -4.158  -4.652  -5.063  1.00 0.00 ? 59  PHE A CD1  6  
ATOM 7857  C CD2  . PHE A 1 36  ? -6.332  -5.579  -5.638  1.00 0.00 ? 59  PHE A CD2  6  
ATOM 7858  C CE1  . PHE A 1 36  ? -4.454  -3.509  -5.828  1.00 0.00 ? 59  PHE A CE1  6  
ATOM 7859  C CE2  . PHE A 1 36  ? -6.617  -4.448  -6.415  1.00 0.00 ? 59  PHE A CE2  6  
ATOM 7860  C CZ   . PHE A 1 36  ? -5.686  -3.404  -6.492  1.00 0.00 ? 59  PHE A CZ   6  
ATOM 7861  H H    . PHE A 1 36  ? -2.729  -8.184  -4.349  1.00 0.00 ? 59  PHE A H    6  
ATOM 7862  H HA   . PHE A 1 36  ? -3.505  -5.788  -2.787  1.00 0.00 ? 59  PHE A HA   6  
ATOM 7863  H HB2  . PHE A 1 36  ? -4.868  -7.772  -4.628  1.00 0.00 ? 59  PHE A HB2  6  
ATOM 7864  H HB3  . PHE A 1 36  ? -5.810  -6.953  -3.401  1.00 0.00 ? 59  PHE A HB3  6  
ATOM 7865  H HD1  . PHE A 1 36  ? -3.184  -4.719  -4.595  1.00 0.00 ? 59  PHE A HD1  6  
ATOM 7866  H HD2  . PHE A 1 36  ? -7.056  -6.379  -5.620  1.00 0.00 ? 59  PHE A HD2  6  
ATOM 7867  H HE1  . PHE A 1 36  ? -3.725  -2.716  -5.914  1.00 0.00 ? 59  PHE A HE1  6  
ATOM 7868  H HE2  . PHE A 1 36  ? -7.546  -4.395  -6.966  1.00 0.00 ? 59  PHE A HE2  6  
ATOM 7869  H HZ   . PHE A 1 36  ? -5.916  -2.535  -7.085  1.00 0.00 ? 59  PHE A HZ   6  
ATOM 7870  N N    . ILE A 1 37  ? -3.766  -7.010  -0.601  1.00 0.00 ? 60  ILE A N    6  
ATOM 7871  C CA   . ILE A 1 37  ? -4.012  -7.682  0.679   1.00 0.00 ? 60  ILE A CA   6  
ATOM 7872  C C    . ILE A 1 37  ? -5.456  -8.203  0.718   1.00 0.00 ? 60  ILE A C    6  
ATOM 7873  O O    . ILE A 1 37  ? -5.660  -9.371  1.047   1.00 0.00 ? 60  ILE A O    6  
ATOM 7874  C CB   . ILE A 1 37  ? -3.666  -6.752  1.867   1.00 0.00 ? 60  ILE A CB   6  
ATOM 7875  C CG1  . ILE A 1 37  ? -2.149  -6.465  1.894   1.00 0.00 ? 60  ILE A CG1  6  
ATOM 7876  C CG2  . ILE A 1 37  ? -4.098  -7.367  3.204   1.00 0.00 ? 60  ILE A CG2  6  
ATOM 7877  C CD1  . ILE A 1 37  ? -1.674  -5.575  3.043   1.00 0.00 ? 60  ILE A CD1  6  
ATOM 7878  H H    . ILE A 1 37  ? -3.408  -6.061  -0.570  1.00 0.00 ? 60  ILE A H    6  
ATOM 7879  H HA   . ILE A 1 37  ? -3.356  -8.553  0.737   1.00 0.00 ? 60  ILE A HA   6  
ATOM 7880  H HB   . ILE A 1 37  ? -4.212  -5.818  1.743   1.00 0.00 ? 60  ILE A HB   6  
ATOM 7881  H HG12 . ILE A 1 37  ? -1.622  -7.407  1.993   1.00 0.00 ? 60  ILE A HG12 6  
ATOM 7882  H HG13 . ILE A 1 37  ? -1.849  -5.996  0.958   1.00 0.00 ? 60  ILE A HG13 6  
ATOM 7883  H HG21 . ILE A 1 37  ? -5.145  -7.645  3.179   1.00 0.00 ? 60  ILE A HG21 6  
ATOM 7884  H HG22 . ILE A 1 37  ? -3.505  -8.255  3.423   1.00 0.00 ? 60  ILE A HG22 6  
ATOM 7885  H HG23 . ILE A 1 37  ? -3.973  -6.638  4.005   1.00 0.00 ? 60  ILE A HG23 6  
ATOM 7886  H HD11 . ILE A 1 37  ? -2.429  -4.837  3.271   1.00 0.00 ? 60  ILE A HD11 6  
ATOM 7887  H HD12 . ILE A 1 37  ? -1.521  -6.171  3.936   1.00 0.00 ? 60  ILE A HD12 6  
ATOM 7888  H HD13 . ILE A 1 37  ? -0.735  -5.092  2.774   1.00 0.00 ? 60  ILE A HD13 6  
ATOM 7889  N N    . LYS A 1 38  ? -6.431  -7.370  0.318   1.00 0.00 ? 61  LYS A N    6  
ATOM 7890  C CA   . LYS A 1 38  ? -7.844  -7.728  0.139   1.00 0.00 ? 61  LYS A CA   6  
ATOM 7891  C C    . LYS A 1 38  ? -8.364  -8.622  1.272   1.00 0.00 ? 61  LYS A C    6  
ATOM 7892  O O    . LYS A 1 38  ? -8.637  -9.813  1.083   1.00 0.00 ? 61  LYS A O    6  
ATOM 7893  C CB   . LYS A 1 38  ? -8.012  -8.320  -1.278  1.00 0.00 ? 61  LYS A CB   6  
ATOM 7894  C CG   . LYS A 1 38  ? -8.632  -7.357  -2.296  1.00 0.00 ? 61  LYS A CG   6  
ATOM 7895  C CD   . LYS A 1 38  ? -8.860  -8.117  -3.599  1.00 0.00 ? 61  LYS A CD   6  
ATOM 7896  C CE   . LYS A 1 38  ? -9.643  -7.265  -4.596  1.00 0.00 ? 61  LYS A CE   6  
ATOM 7897  N NZ   . LYS A 1 38  ? -9.643  -7.819  -5.962  1.00 0.00 ? 61  LYS A NZ   6  
ATOM 7898  H H    . LYS A 1 38  ? -6.120  -6.485  -0.046  1.00 0.00 ? 61  LYS A H    6  
ATOM 7899  H HA   . LYS A 1 38  ? -8.459  -6.831  0.206   1.00 0.00 ? 61  LYS A HA   6  
ATOM 7900  H HB2  . LYS A 1 38  ? -7.033  -8.610  -1.659  1.00 0.00 ? 61  LYS A HB2  6  
ATOM 7901  H HB3  . LYS A 1 38  ? -8.640  -9.209  -1.239  1.00 0.00 ? 61  LYS A HB3  6  
ATOM 7902  H HG2  . LYS A 1 38  ? -9.585  -6.989  -1.927  1.00 0.00 ? 61  LYS A HG2  6  
ATOM 7903  H HG3  . LYS A 1 38  ? -7.962  -6.520  -2.487  1.00 0.00 ? 61  LYS A HG3  6  
ATOM 7904  H HD2  . LYS A 1 38  ? -7.887  -8.381  -4.010  1.00 0.00 ? 61  LYS A HD2  6  
ATOM 7905  H HD3  . LYS A 1 38  ? -9.439  -9.013  -3.369  1.00 0.00 ? 61  LYS A HD3  6  
ATOM 7906  H HE2  . LYS A 1 38  ? -10.674 -7.187  -4.251  1.00 0.00 ? 61  LYS A HE2  6  
ATOM 7907  H HE3  . LYS A 1 38  ? -9.225  -6.258  -4.636  1.00 0.00 ? 61  LYS A HE3  6  
ATOM 7908  H HZ1  . LYS A 1 38  ? -8.781  -7.628  -6.477  1.00 0.00 ? 61  LYS A HZ1  6  
ATOM 7909  H HZ2  . LYS A 1 38  ? -9.841  -8.806  -6.026  1.00 0.00 ? 61  LYS A HZ2  6  
ATOM 7910  H HZ3  . LYS A 1 38  ? -10.308 -7.313  -6.547  1.00 0.00 ? 61  LYS A HZ3  6  
ATOM 7911  N N    . GLN A 1 39  ? -8.491  -8.041  2.467   1.00 0.00 ? 62  GLN A N    6  
ATOM 7912  C CA   . GLN A 1 39  ? -9.123  -8.714  3.599   1.00 0.00 ? 62  GLN A CA   6  
ATOM 7913  C C    . GLN A 1 39  ? -10.649 -8.739  3.452   1.00 0.00 ? 62  GLN A C    6  
ATOM 7914  O O    . GLN A 1 39  ? -11.299 -9.466  4.197   1.00 0.00 ? 62  GLN A O    6  
ATOM 7915  C CB   . GLN A 1 39  ? -8.771  -8.018  4.923   1.00 0.00 ? 62  GLN A CB   6  
ATOM 7916  C CG   . GLN A 1 39  ? -7.277  -8.032  5.281   1.00 0.00 ? 62  GLN A CG   6  
ATOM 7917  C CD   . GLN A 1 39  ? -7.001  -7.437  6.663   1.00 0.00 ? 62  GLN A CD   6  
ATOM 7918  O OE1  . GLN A 1 39  ? -7.922  -7.114  7.413   1.00 0.00 ? 62  GLN A OE1  6  
ATOM 7919  N NE2  . GLN A 1 39  ? -5.747  -7.277  7.042   1.00 0.00 ? 62  GLN A NE2  6  
ATOM 7920  H H    . GLN A 1 39  ? -8.340  -7.047  2.554   1.00 0.00 ? 62  GLN A H    6  
ATOM 7921  H HA   . GLN A 1 39  ? -8.770  -9.746  3.649   1.00 0.00 ? 62  GLN A HA   6  
ATOM 7922  H HB2  . GLN A 1 39  ? -9.117  -6.986  4.886   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 7923  H HB3  . GLN A 1 39  ? -9.312  -8.529  5.720   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 7924  H HG2  . GLN A 1 39  ? -6.902  -9.056  5.257   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 7925  H HG3  . GLN A 1 39  ? -6.745  -7.438  4.548   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 7926  H HE21 . GLN A 1 39  ? -4.947  -7.514  6.450   1.00 0.00 ? 62  GLN A HE21 6  
ATOM 7927  H HE22 . GLN A 1 39  ? -5.545  -6.821  7.915   1.00 0.00 ? 62  GLN A HE22 6  
ATOM 7928  N N    . GLY A 1 40  ? -11.232 -7.981  2.515   1.00 0.00 ? 63  GLY A N    6  
ATOM 7929  C CA   . GLY A 1 40  ? -12.663 -7.729  2.468   1.00 0.00 ? 63  GLY A CA   6  
ATOM 7930  C C    . GLY A 1 40  ? -13.074 -6.895  3.677   1.00 0.00 ? 63  GLY A C    6  
ATOM 7931  O O    . GLY A 1 40  ? -13.523 -7.442  4.684   1.00 0.00 ? 63  GLY A O    6  
ATOM 7932  H H    . GLY A 1 40  ? -10.671 -7.464  1.846   1.00 0.00 ? 63  GLY A H    6  
ATOM 7933  H HA2  . GLY A 1 40  ? -12.913 -7.195  1.553   1.00 0.00 ? 63  GLY A HA2  6  
ATOM 7934  H HA3  . GLY A 1 40  ? -13.204 -8.675  2.479   1.00 0.00 ? 63  GLY A HA3  6  
ATOM 7935  N N    . ARG A 1 41  ? -12.895 -5.571  3.616   1.00 0.00 ? 64  ARG A N    6  
ATOM 7936  C CA   . ARG A 1 41  ? -13.386 -4.665  4.658   1.00 0.00 ? 64  ARG A CA   6  
ATOM 7937  C C    . ARG A 1 41  ? -13.757 -3.307  4.088   1.00 0.00 ? 64  ARG A C    6  
ATOM 7938  O O    . ARG A 1 41  ? -13.234 -2.903  3.044   1.00 0.00 ? 64  ARG A O    6  
ATOM 7939  C CB   . ARG A 1 41  ? -12.406 -4.545  5.837   1.00 0.00 ? 64  ARG A CB   6  
ATOM 7940  C CG   . ARG A 1 41  ? -10.938 -4.423  5.421   1.00 0.00 ? 64  ARG A CG   6  
ATOM 7941  C CD   . ARG A 1 41  ? -9.996  -4.310  6.625   1.00 0.00 ? 64  ARG A CD   6  
ATOM 7942  N NE   . ARG A 1 41  ? -10.145 -5.420  7.582   1.00 0.00 ? 64  ARG A NE   6  
ATOM 7943  C CZ   . ARG A 1 41  ? -10.813 -5.397  8.742   1.00 0.00 ? 64  ARG A CZ   6  
ATOM 7944  N NH1  . ARG A 1 41  ? -11.395 -4.291  9.182   1.00 0.00 ? 64  ARG A NH1  6  
ATOM 7945  N NH2  . ARG A 1 41  ? -10.898 -6.502  9.470   1.00 0.00 ? 64  ARG A NH2  6  
ATOM 7946  H H    . ARG A 1 41  ? -12.503 -5.145  2.787   1.00 0.00 ? 64  ARG A H    6  
ATOM 7947  H HA   . ARG A 1 41  ? -14.293 -5.108  5.060   1.00 0.00 ? 64  ARG A HA   6  
ATOM 7948  H HB2  . ARG A 1 41  ? -12.676 -3.690  6.458   1.00 0.00 ? 64  ARG A HB2  6  
ATOM 7949  H HB3  . ARG A 1 41  ? -12.526 -5.443  6.442   1.00 0.00 ? 64  ARG A HB3  6  
ATOM 7950  H HG2  . ARG A 1 41  ? -10.684 -5.302  4.838   1.00 0.00 ? 64  ARG A HG2  6  
ATOM 7951  H HG3  . ARG A 1 41  ? -10.806 -3.544  4.791   1.00 0.00 ? 64  ARG A HG3  6  
ATOM 7952  H HD2  . ARG A 1 41  ? -8.973  -4.316  6.263   1.00 0.00 ? 64  ARG A HD2  6  
ATOM 7953  H HD3  . ARG A 1 41  ? -10.167 -3.359  7.120   1.00 0.00 ? 64  ARG A HD3  6  
ATOM 7954  H HE   . ARG A 1 41  ? -9.602  -6.253  7.361   1.00 0.00 ? 64  ARG A HE   6  
ATOM 7955  H HH11 . ARG A 1 41  ? -11.298 -3.389  8.714   1.00 0.00 ? 64  ARG A HH11 6  
ATOM 7956  H HH12 . ARG A 1 41  ? -11.997 -4.269  10.008  1.00 0.00 ? 64  ARG A HH12 6  
ATOM 7957  H HH21 . ARG A 1 41  ? -10.556 -7.389  9.103   1.00 0.00 ? 64  ARG A HH21 6  
ATOM 7958  H HH22 . ARG A 1 41  ? -11.317 -6.502  10.389  1.00 0.00 ? 64  ARG A HH22 6  
ATOM 7959  N N    . LYS A 1 42  ? -14.653 -2.601  4.784   1.00 0.00 ? 65  LYS A N    6  
ATOM 7960  C CA   . LYS A 1 42  ? -15.159 -1.293  4.356   1.00 0.00 ? 65  LYS A CA   6  
ATOM 7961  C C    . LYS A 1 42  ? -14.244 -0.138  4.778   1.00 0.00 ? 65  LYS A C    6  
ATOM 7962  O O    . LYS A 1 42  ? -14.426 0.981   4.291   1.00 0.00 ? 65  LYS A O    6  
ATOM 7963  C CB   . LYS A 1 42  ? -16.644 -1.107  4.740   1.00 0.00 ? 65  LYS A CB   6  
ATOM 7964  C CG   . LYS A 1 42  ? -17.302 -0.017  3.867   1.00 0.00 ? 65  LYS A CG   6  
ATOM 7965  C CD   . LYS A 1 42  ? -18.831 0.017   3.803   1.00 0.00 ? 65  LYS A CD   6  
ATOM 7966  C CE   . LYS A 1 42  ? -19.586 -0.141  5.115   1.00 0.00 ? 65  LYS A CE   6  
ATOM 7967  N NZ   . LYS A 1 42  ? -20.034 1.137   5.691   1.00 0.00 ? 65  LYS A NZ   6  
ATOM 7968  H H    . LYS A 1 42  ? -14.956 -2.994  5.670   1.00 0.00 ? 65  LYS A H    6  
ATOM 7969  H HA   . LYS A 1 42  ? -15.114 -1.305  3.275   1.00 0.00 ? 65  LYS A HA   6  
ATOM 7970  H HB2  . LYS A 1 42  ? -17.174 -2.046  4.573   1.00 0.00 ? 65  LYS A HB2  6  
ATOM 7971  H HB3  . LYS A 1 42  ? -16.725 -0.842  5.796   1.00 0.00 ? 65  LYS A HB3  6  
ATOM 7972  H HG2  . LYS A 1 42  ? -16.967 0.953   4.196   1.00 0.00 ? 65  LYS A HG2  6  
ATOM 7973  H HG3  . LYS A 1 42  ? -16.952 -0.125  2.843   1.00 0.00 ? 65  LYS A HG3  6  
ATOM 7974  H HD2  . LYS A 1 42  ? -19.108 0.960   3.346   1.00 0.00 ? 65  LYS A HD2  6  
ATOM 7975  H HD3  . LYS A 1 42  ? -19.174 -0.783  3.159   1.00 0.00 ? 65  LYS A HD3  6  
ATOM 7976  H HE2  . LYS A 1 42  ? -20.479 -0.742  4.928   1.00 0.00 ? 65  LYS A HE2  6  
ATOM 7977  H HE3  . LYS A 1 42  ? -18.953 -0.672  5.806   1.00 0.00 ? 65  LYS A HE3  6  
ATOM 7978  H HZ1  . LYS A 1 42  ? -20.594 0.947   6.515   1.00 0.00 ? 65  LYS A HZ1  6  
ATOM 7979  H HZ2  . LYS A 1 42  ? -19.275 1.761   5.939   1.00 0.00 ? 65  LYS A HZ2  6  
ATOM 7980  H HZ3  . LYS A 1 42  ? -20.637 1.619   5.021   1.00 0.00 ? 65  LYS A HZ3  6  
ATOM 7981  N N    . LEU A 1 43  ? -13.180 -0.432  5.531   1.00 0.00 ? 66  LEU A N    6  
ATOM 7982  C CA   . LEU A 1 43  ? -12.091 0.490   5.859   1.00 0.00 ? 66  LEU A CA   6  
ATOM 7983  C C    . LEU A 1 43  ? -12.644 1.791   6.449   1.00 0.00 ? 66  LEU A C    6  
ATOM 7984  O O    . LEU A 1 43  ? -13.742 1.810   7.001   1.00 0.00 ? 66  LEU A O    6  
ATOM 7985  C CB   . LEU A 1 43  ? -11.165 0.699   4.640   1.00 0.00 ? 66  LEU A CB   6  
ATOM 7986  C CG   . LEU A 1 43  ? -10.413 -0.555  4.182   1.00 0.00 ? 66  LEU A CG   6  
ATOM 7987  C CD1  . LEU A 1 43  ? -9.783  -0.342  2.806   1.00 0.00 ? 66  LEU A CD1  6  
ATOM 7988  C CD2  . LEU A 1 43  ? -9.294  -0.902  5.167   1.00 0.00 ? 66  LEU A CD2  6  
ATOM 7989  H H    . LEU A 1 43  ? -13.182 -1.342  5.961   1.00 0.00 ? 66  LEU A H    6  
ATOM 7990  H HA   . LEU A 1 43  ? -11.495 0.038   6.642   1.00 0.00 ? 66  LEU A HA   6  
ATOM 7991  H HB2  . LEU A 1 43  ? -11.770 1.070   3.814   1.00 0.00 ? 66  LEU A HB2  6  
ATOM 7992  H HB3  . LEU A 1 43  ? -10.410 1.444   4.884   1.00 0.00 ? 66  LEU A HB3  6  
ATOM 7993  H HG   . LEU A 1 43  ? -11.122 -1.375  4.104   1.00 0.00 ? 66  LEU A HG   6  
ATOM 7994  H HD11 . LEU A 1 43  ? -9.582  -1.311  2.357   1.00 0.00 ? 66  LEU A HD11 6  
ATOM 7995  H HD12 . LEU A 1 43  ? -10.450 0.215   2.150   1.00 0.00 ? 66  LEU A HD12 6  
ATOM 7996  H HD13 . LEU A 1 43  ? -8.840  0.196   2.897   1.00 0.00 ? 66  LEU A HD13 6  
ATOM 7997  H HD21 . LEU A 1 43  ? -8.726  -1.761  4.817   1.00 0.00 ? 66  LEU A HD21 6  
ATOM 7998  H HD22 . LEU A 1 43  ? -8.613  -0.050  5.249   1.00 0.00 ? 66  LEU A HD22 6  
ATOM 7999  H HD23 . LEU A 1 43  ? -9.697  -1.138  6.149   1.00 0.00 ? 66  LEU A HD23 6  
ATOM 8000  N N    . ASP A 1 44  ? -11.850 2.854   6.402   1.00 0.00 ? 67  ASP A N    6  
ATOM 8001  C CA   . ASP A 1 44  ? -12.215 4.197   6.836   1.00 0.00 ? 67  ASP A CA   6  
ATOM 8002  C C    . ASP A 1 44  ? -11.646 5.206   5.826   1.00 0.00 ? 67  ASP A C    6  
ATOM 8003  O O    . ASP A 1 44  ? -11.269 6.325   6.173   1.00 0.00 ? 67  ASP A O    6  
ATOM 8004  C CB   . ASP A 1 44  ? -11.709 4.401   8.271   1.00 0.00 ? 67  ASP A CB   6  
ATOM 8005  C CG   . ASP A 1 44  ? -12.521 5.445   9.038   1.00 0.00 ? 67  ASP A CG   6  
ATOM 8006  O OD1  . ASP A 1 44  ? -13.746 5.225   9.219   1.00 0.00 ? 67  ASP A OD1  6  
ATOM 8007  O OD2  . ASP A 1 44  ? -11.937 6.420   9.565   1.00 0.00 ? 67  ASP A OD2  6  
ATOM 8008  H H    . ASP A 1 44  ? -10.931 2.764   5.998   1.00 0.00 ? 67  ASP A H    6  
ATOM 8009  H HA   . ASP A 1 44  ? -13.303 4.287   6.836   1.00 0.00 ? 67  ASP A HA   6  
ATOM 8010  H HB2  . ASP A 1 44  ? -11.797 3.461   8.819   1.00 0.00 ? 67  ASP A HB2  6  
ATOM 8011  H HB3  . ASP A 1 44  ? -10.653 4.669   8.243   1.00 0.00 ? 67  ASP A HB3  6  
ATOM 8012  N N    . ILE A 1 45  ? -11.511 4.776   4.561   1.00 0.00 ? 68  ILE A N    6  
ATOM 8013  C CA   . ILE A 1 45  ? -10.987 5.566   3.452   1.00 0.00 ? 68  ILE A CA   6  
ATOM 8014  C C    . ILE A 1 45  ? -12.146 6.457   3.016   1.00 0.00 ? 68  ILE A C    6  
ATOM 8015  O O    . ILE A 1 45  ? -13.039 6.009   2.295   1.00 0.00 ? 68  ILE A O    6  
ATOM 8016  C CB   . ILE A 1 45  ? -10.450 4.679   2.289   1.00 0.00 ? 68  ILE A CB   6  
ATOM 8017  C CG1  . ILE A 1 45  ? -9.551  3.545   2.825   1.00 0.00 ? 68  ILE A CG1  6  
ATOM 8018  C CG2  . ILE A 1 45  ? -9.705  5.551   1.265   1.00 0.00 ? 68  ILE A CG2  6  
ATOM 8019  C CD1  . ILE A 1 45  ? -8.563  2.875   1.863   1.00 0.00 ? 68  ILE A CD1  6  
ATOM 8020  H H    . ILE A 1 45  ? -11.941 3.891   4.346   1.00 0.00 ? 68  ILE A H    6  
ATOM 8021  H HA   . ILE A 1 45  ? -10.171 6.188   3.823   1.00 0.00 ? 68  ILE A HA   6  
ATOM 8022  H HB   . ILE A 1 45  ? -11.291 4.210   1.775   1.00 0.00 ? 68  ILE A HB   6  
ATOM 8023  H HG12 . ILE A 1 45  ? -8.973  3.906   3.678   1.00 0.00 ? 68  ILE A HG12 6  
ATOM 8024  H HG13 . ILE A 1 45  ? -10.217 2.766   3.180   1.00 0.00 ? 68  ILE A HG13 6  
ATOM 8025  H HG21 . ILE A 1 45  ? -8.771  5.916   1.692   1.00 0.00 ? 68  ILE A HG21 6  
ATOM 8026  H HG22 . ILE A 1 45  ? -9.485  4.977   0.367   1.00 0.00 ? 68  ILE A HG22 6  
ATOM 8027  H HG23 . ILE A 1 45  ? -10.330 6.392   0.974   1.00 0.00 ? 68  ILE A HG23 6  
ATOM 8028  H HD11 . ILE A 1 45  ? -7.972  2.197   2.471   1.00 0.00 ? 68  ILE A HD11 6  
ATOM 8029  H HD12 . ILE A 1 45  ? -9.059  2.282   1.083   1.00 0.00 ? 68  ILE A HD12 6  
ATOM 8030  H HD13 . ILE A 1 45  ? -7.888  3.609   1.416   1.00 0.00 ? 68  ILE A HD13 6  
ATOM 8031  N N    . ASP A 1 46  ? -12.171 7.696   3.499   1.00 0.00 ? 69  ASP A N    6  
ATOM 8032  C CA   . ASP A 1 46  ? -13.286 8.594   3.260   1.00 0.00 ? 69  ASP A CA   6  
ATOM 8033  C C    . ASP A 1 46  ? -13.167 9.199   1.862   1.00 0.00 ? 69  ASP A C    6  
ATOM 8034  O O    . ASP A 1 46  ? -12.295 10.039  1.619   1.00 0.00 ? 69  ASP A O    6  
ATOM 8035  C CB   . ASP A 1 46  ? -13.346 9.682   4.333   1.00 0.00 ? 69  ASP A CB   6  
ATOM 8036  C CG   . ASP A 1 46  ? -14.567 10.554  4.077   1.00 0.00 ? 69  ASP A CG   6  
ATOM 8037  O OD1  . ASP A 1 46  ? -15.692 10.017  4.197   1.00 0.00 ? 69  ASP A OD1  6  
ATOM 8038  O OD2  . ASP A 1 46  ? -14.430 11.732  3.681   1.00 0.00 ? 69  ASP A OD2  6  
ATOM 8039  H H    . ASP A 1 46  ? -11.454 8.002   4.146   1.00 0.00 ? 69  ASP A H    6  
ATOM 8040  H HA   . ASP A 1 46  ? -14.205 8.014   3.326   1.00 0.00 ? 69  ASP A HA   6  
ATOM 8041  H HB2  . ASP A 1 46  ? -13.443 9.216   5.315   1.00 0.00 ? 69  ASP A HB2  6  
ATOM 8042  H HB3  . ASP A 1 46  ? -12.439 10.287  4.316   1.00 0.00 ? 69  ASP A HB3  6  
ATOM 8043  N N    . PHE A 1 47  ? -13.975 8.731   0.908   1.00 0.00 ? 70  PHE A N    6  
ATOM 8044  C CA   . PHE A 1 47  ? -13.928 9.210   -0.475  1.00 0.00 ? 70  PHE A CA   6  
ATOM 8045  C C    . PHE A 1 47  ? -14.803 10.453  -0.700  1.00 0.00 ? 70  PHE A C    6  
ATOM 8046  O O    . PHE A 1 47  ? -14.519 11.221  -1.622  1.00 0.00 ? 70  PHE A O    6  
ATOM 8047  C CB   . PHE A 1 47  ? -14.335 8.090   -1.440  1.00 0.00 ? 70  PHE A CB   6  
ATOM 8048  C CG   . PHE A 1 47  ? -13.299 7.012   -1.682  1.00 0.00 ? 70  PHE A CG   6  
ATOM 8049  C CD1  . PHE A 1 47  ? -13.264 5.860   -0.865  1.00 0.00 ? 70  PHE A CD1  6  
ATOM 8050  C CD2  . PHE A 1 47  ? -12.410 7.126   -2.772  1.00 0.00 ? 70  PHE A CD2  6  
ATOM 8051  C CE1  . PHE A 1 47  ? -12.316 4.848   -1.106  1.00 0.00 ? 70  PHE A CE1  6  
ATOM 8052  C CE2  . PHE A 1 47  ? -11.493 6.096   -3.016  1.00 0.00 ? 70  PHE A CE2  6  
ATOM 8053  C CZ   . PHE A 1 47  ? -11.420 4.995   -2.167  1.00 0.00 ? 70  PHE A CZ   6  
ATOM 8054  H H    . PHE A 1 47  ? -14.610 7.983   1.161   1.00 0.00 ? 70  PHE A H    6  
ATOM 8055  H HA   . PHE A 1 47  ? -12.904 9.497   -0.720  1.00 0.00 ? 70  PHE A HA   6  
ATOM 8056  H HB2  . PHE A 1 47  ? -15.228 7.612   -1.055  1.00 0.00 ? 70  PHE A HB2  6  
ATOM 8057  H HB3  . PHE A 1 47  ? -14.585 8.534   -2.404  1.00 0.00 ? 70  PHE A HB3  6  
ATOM 8058  H HD1  . PHE A 1 47  ? -13.960 5.740   -0.047  1.00 0.00 ? 70  PHE A HD1  6  
ATOM 8059  H HD2  . PHE A 1 47  ? -12.423 7.979   -3.441  1.00 0.00 ? 70  PHE A HD2  6  
ATOM 8060  H HE1  . PHE A 1 47  ? -12.257 3.941   -0.514  1.00 0.00 ? 70  PHE A HE1  6  
ATOM 8061  H HE2  . PHE A 1 47  ? -10.840 6.100   -3.865  1.00 0.00 ? 70  PHE A HE2  6  
ATOM 8062  H HZ   . PHE A 1 47  ? -10.685 4.248   -2.374  1.00 0.00 ? 70  PHE A HZ   6  
ATOM 8063  N N    . GLY A 1 48  ? -15.846 10.687  0.106   1.00 0.00 ? 71  GLY A N    6  
ATOM 8064  C CA   . GLY A 1 48  ? -16.680 11.886  0.032   1.00 0.00 ? 71  GLY A CA   6  
ATOM 8065  C C    . GLY A 1 48  ? -18.078 11.622  -0.518  1.00 0.00 ? 71  GLY A C    6  
ATOM 8066  O O    . GLY A 1 48  ? -19.030 11.491  0.251   1.00 0.00 ? 71  GLY A O    6  
ATOM 8067  H H    . GLY A 1 48  ? -16.044 10.052  0.867   1.00 0.00 ? 71  GLY A H    6  
ATOM 8068  H HA2  . GLY A 1 48  ? -16.769 12.302  1.028   1.00 0.00 ? 71  GLY A HA2  6  
ATOM 8069  H HA3  . GLY A 1 48  ? -16.213 12.643  -0.590  1.00 0.00 ? 71  GLY A HA3  6  
ATOM 8070  N N    . ALA A 1 49  ? -18.215 11.553  -1.841  1.00 0.00 ? 72  ALA A N    6  
ATOM 8071  C CA   . ALA A 1 49  ? -19.489 11.418  -2.539  1.00 0.00 ? 72  ALA A CA   6  
ATOM 8072  C C    . ALA A 1 49  ? -19.511 10.138  -3.377  1.00 0.00 ? 72  ALA A C    6  
ATOM 8073  O O    . ALA A 1 49  ? -19.816 9.072   -2.848  1.00 0.00 ? 72  ALA A O    6  
ATOM 8074  C CB   . ALA A 1 49  ? -19.755 12.672  -3.376  1.00 0.00 ? 72  ALA A CB   6  
ATOM 8075  H H    . ALA A 1 49  ? -17.383 11.639  -2.415  1.00 0.00 ? 72  ALA A H    6  
ATOM 8076  H HA   . ALA A 1 49  ? -20.297 11.342  -1.809  1.00 0.00 ? 72  ALA A HA   6  
ATOM 8077  H HB1  . ALA A 1 49  ? -20.692 12.545  -3.921  1.00 0.00 ? 72  ALA A HB1  6  
ATOM 8078  H HB2  . ALA A 1 49  ? -19.843 13.540  -2.724  1.00 0.00 ? 72  ALA A HB2  6  
ATOM 8079  H HB3  . ALA A 1 49  ? -18.936 12.827  -4.080  1.00 0.00 ? 72  ALA A HB3  6  
ATOM 8080  N N    . GLU A 1 50  ? -19.191 10.223  -4.672  1.00 0.00 ? 73  GLU A N    6  
ATOM 8081  C CA   . GLU A 1 50  ? -19.426 9.134   -5.610  1.00 0.00 ? 73  GLU A CA   6  
ATOM 8082  C C    . GLU A 1 50  ? -18.560 7.930   -5.306  1.00 0.00 ? 73  GLU A C    6  
ATOM 8083  O O    . GLU A 1 50  ? -19.084 6.816   -5.267  1.00 0.00 ? 73  GLU A O    6  
ATOM 8084  C CB   . GLU A 1 50  ? -19.342 9.599   -7.066  1.00 0.00 ? 73  GLU A CB   6  
ATOM 8085  C CG   . GLU A 1 50  ? -18.014 10.202  -7.544  1.00 0.00 ? 73  GLU A CG   6  
ATOM 8086  C CD   . GLU A 1 50  ? -18.138 10.771  -8.965  1.00 0.00 ? 73  GLU A CD   6  
ATOM 8087  O OE1  . GLU A 1 50  ? -19.231 11.210  -9.389  1.00 0.00 ? 73  GLU A OE1  6  
ATOM 8088  O OE2  . GLU A 1 50  ? -17.125 10.829  -9.698  1.00 0.00 ? 73  GLU A OE2  6  
ATOM 8089  H H    . GLU A 1 50  ? -18.879 11.112  -5.031  1.00 0.00 ? 73  GLU A H    6  
ATOM 8090  H HA   . GLU A 1 50  ? -20.443 8.785   -5.466  1.00 0.00 ? 73  GLU A HA   6  
ATOM 8091  H HB2  . GLU A 1 50  ? -19.565 8.740   -7.699  1.00 0.00 ? 73  GLU A HB2  6  
ATOM 8092  H HB3  . GLU A 1 50  ? -20.128 10.342  -7.196  1.00 0.00 ? 73  GLU A HB3  6  
ATOM 8093  H HG2  . GLU A 1 50  ? -17.712 11.002  -6.868  1.00 0.00 ? 73  GLU A HG2  6  
ATOM 8094  H HG3  . GLU A 1 50  ? -17.250 9.424   -7.537  1.00 0.00 ? 73  GLU A HG3  6  
ATOM 8095  N N    . GLY A 1 51  ? -17.269 8.145   -5.049  1.00 0.00 ? 74  GLY A N    6  
ATOM 8096  C CA   . GLY A 1 51  ? -16.371 7.069   -4.679  1.00 0.00 ? 74  GLY A CA   6  
ATOM 8097  C C    . GLY A 1 51  ? -16.785 6.437   -3.358  1.00 0.00 ? 74  GLY A C    6  
ATOM 8098  O O    . GLY A 1 51  ? -16.645 5.231   -3.191  1.00 0.00 ? 74  GLY A O    6  
ATOM 8099  H H    . GLY A 1 51  ? -16.884 9.076   -5.168  1.00 0.00 ? 74  GLY A H    6  
ATOM 8100  H HA2  . GLY A 1 51  ? -16.409 6.308   -5.453  1.00 0.00 ? 74  GLY A HA2  6  
ATOM 8101  H HA3  . GLY A 1 51  ? -15.353 7.449   -4.599  1.00 0.00 ? 74  GLY A HA3  6  
ATOM 8102  N N    . ASN A 1 52  ? -17.333 7.240   -2.443  1.00 0.00 ? 75  ASN A N    6  
ATOM 8103  C CA   . ASN A 1 52  ? -17.828 6.806   -1.141  1.00 0.00 ? 75  ASN A CA   6  
ATOM 8104  C C    . ASN A 1 52  ? -19.017 5.877   -1.342  1.00 0.00 ? 75  ASN A C    6  
ATOM 8105  O O    . ASN A 1 52  ? -18.954 4.721   -0.939  1.00 0.00 ? 75  ASN A O    6  
ATOM 8106  C CB   . ASN A 1 52  ? -18.130 8.034   -0.259  1.00 0.00 ? 75  ASN A CB   6  
ATOM 8107  C CG   . ASN A 1 52  ? -19.407 7.911   0.568   1.00 0.00 ? 75  ASN A CG   6  
ATOM 8108  O OD1  . ASN A 1 52  ? -19.662 6.908   1.220   1.00 0.00 ? 75  ASN A OD1  6  
ATOM 8109  N ND2  . ASN A 1 52  ? -20.260 8.915   0.538   1.00 0.00 ? 75  ASN A ND2  6  
ATOM 8110  H H    . ASN A 1 52  ? -17.524 8.188   -2.733  1.00 0.00 ? 75  ASN A H    6  
ATOM 8111  H HA   . ASN A 1 52  ? -17.056 6.217   -0.645  1.00 0.00 ? 75  ASN A HA   6  
ATOM 8112  H HB2  . ASN A 1 52  ? -17.290 8.185   0.411   1.00 0.00 ? 75  ASN A HB2  6  
ATOM 8113  H HB3  . ASN A 1 52  ? -18.206 8.917   -0.885  1.00 0.00 ? 75  ASN A HB3  6  
ATOM 8114  H HD21 . ASN A 1 52  ? -19.970 9.823   0.179   1.00 0.00 ? 75  ASN A HD21 6  
ATOM 8115  H HD22 . ASN A 1 52  ? -21.140 8.828   1.010   1.00 0.00 ? 75  ASN A HD22 6  
ATOM 8116  N N    . ARG A 1 53  ? -20.087 6.350   -1.984  1.00 0.00 ? 76  ARG A N    6  
ATOM 8117  C CA   . ARG A 1 53  ? -21.276 5.543   -2.216  1.00 0.00 ? 76  ARG A CA   6  
ATOM 8118  C C    . ARG A 1 53  ? -20.960 4.280   -3.007  1.00 0.00 ? 76  ARG A C    6  
ATOM 8119  O O    . ARG A 1 53  ? -21.546 3.234   -2.718  1.00 0.00 ? 76  ARG A O    6  
ATOM 8120  C CB   . ARG A 1 53  ? -22.339 6.400   -2.909  1.00 0.00 ? 76  ARG A CB   6  
ATOM 8121  C CG   . ARG A 1 53  ? -23.016 7.349   -1.911  1.00 0.00 ? 76  ARG A CG   6  
ATOM 8122  C CD   . ARG A 1 53  ? -24.018 6.642   -0.977  1.00 0.00 ? 76  ARG A CD   6  
ATOM 8123  N NE   . ARG A 1 53  ? -25.287 6.301   -1.647  1.00 0.00 ? 76  ARG A NE   6  
ATOM 8124  C CZ   . ARG A 1 53  ? -26.328 7.124   -1.855  1.00 0.00 ? 76  ARG A CZ   6  
ATOM 8125  N NH1  . ARG A 1 53  ? -26.319 8.368   -1.377  1.00 0.00 ? 76  ARG A NH1  6  
ATOM 8126  N NH2  . ARG A 1 53  ? -27.376 6.705   -2.564  1.00 0.00 ? 76  ARG A NH2  6  
ATOM 8127  H H    . ARG A 1 53  ? -20.106 7.336   -2.232  1.00 0.00 ? 76  ARG A H    6  
ATOM 8128  H HA   . ARG A 1 53  ? -21.644 5.225   -1.243  1.00 0.00 ? 76  ARG A HA   6  
ATOM 8129  H HB2  . ARG A 1 53  ? -21.873 6.982   -3.706  1.00 0.00 ? 76  ARG A HB2  6  
ATOM 8130  H HB3  . ARG A 1 53  ? -23.090 5.758   -3.362  1.00 0.00 ? 76  ARG A HB3  6  
ATOM 8131  H HG2  . ARG A 1 53  ? -22.255 7.842   -1.305  1.00 0.00 ? 76  ARG A HG2  6  
ATOM 8132  H HG3  . ARG A 1 53  ? -23.524 8.118   -2.481  1.00 0.00 ? 76  ARG A HG3  6  
ATOM 8133  H HD2  . ARG A 1 53  ? -23.577 5.730   -0.575  1.00 0.00 ? 76  ARG A HD2  6  
ATOM 8134  H HD3  . ARG A 1 53  ? -24.220 7.287   -0.131  1.00 0.00 ? 76  ARG A HD3  6  
ATOM 8135  H HE   . ARG A 1 53  ? -25.312 5.361   -2.032  1.00 0.00 ? 76  ARG A HE   6  
ATOM 8136  H HH11 . ARG A 1 53  ? -25.585 8.700   -0.749  1.00 0.00 ? 76  ARG A HH11 6  
ATOM 8137  H HH12 . ARG A 1 53  ? -27.027 9.049   -1.629  1.00 0.00 ? 76  ARG A HH12 6  
ATOM 8138  H HH21 . ARG A 1 53  ? -27.431 5.764   -2.948  1.00 0.00 ? 76  ARG A HH21 6  
ATOM 8139  H HH22 . ARG A 1 53  ? -28.134 7.336   -2.798  1.00 0.00 ? 76  ARG A HH22 6  
ATOM 8140  N N    . TYR A 1 54  ? -20.056 4.342   -3.986  1.00 0.00 ? 77  TYR A N    6  
ATOM 8141  C CA   . TYR A 1 54  ? -19.573 3.136   -4.650  1.00 0.00 ? 77  TYR A CA   6  
ATOM 8142  C C    . TYR A 1 54  ? -18.826 2.215   -3.676  1.00 0.00 ? 77  TYR A C    6  
ATOM 8143  O O    . TYR A 1 54  ? -19.055 1.010   -3.705  1.00 0.00 ? 77  TYR A O    6  
ATOM 8144  C CB   . TYR A 1 54  ? -18.710 3.522   -5.858  1.00 0.00 ? 77  TYR A CB   6  
ATOM 8145  C CG   . TYR A 1 54  ? -18.959 2.700   -7.105  1.00 0.00 ? 77  TYR A CG   6  
ATOM 8146  C CD1  . TYR A 1 54  ? -20.182 2.836   -7.789  1.00 0.00 ? 77  TYR A CD1  6  
ATOM 8147  C CD2  . TYR A 1 54  ? -17.966 1.850   -7.624  1.00 0.00 ? 77  TYR A CD2  6  
ATOM 8148  C CE1  . TYR A 1 54  ? -20.456 2.066   -8.930  1.00 0.00 ? 77  TYR A CE1  6  
ATOM 8149  C CE2  . TYR A 1 54  ? -18.245 1.057   -8.751  1.00 0.00 ? 77  TYR A CE2  6  
ATOM 8150  C CZ   . TYR A 1 54  ? -19.502 1.136   -9.381  1.00 0.00 ? 77  TYR A CZ   6  
ATOM 8151  O OH   . TYR A 1 54  ? -19.803 0.271   -10.382 1.00 0.00 ? 77  TYR A OH   6  
ATOM 8152  H H    . TYR A 1 54  ? -19.717 5.251   -4.300  1.00 0.00 ? 77  TYR A H    6  
ATOM 8153  H HA   . TYR A 1 54  ? -20.446 2.579   -5.002  1.00 0.00 ? 77  TYR A HA   6  
ATOM 8154  H HB2  . TYR A 1 54  ? -18.946 4.544   -6.122  1.00 0.00 ? 77  TYR A HB2  6  
ATOM 8155  H HB3  . TYR A 1 54  ? -17.656 3.493   -5.584  1.00 0.00 ? 77  TYR A HB3  6  
ATOM 8156  H HD1  . TYR A 1 54  ? -20.922 3.539   -7.445  1.00 0.00 ? 77  TYR A HD1  6  
ATOM 8157  H HD2  . TYR A 1 54  ? -16.979 1.842   -7.188  1.00 0.00 ? 77  TYR A HD2  6  
ATOM 8158  H HE1  . TYR A 1 54  ? -21.392 2.180   -9.459  1.00 0.00 ? 77  TYR A HE1  6  
ATOM 8159  H HE2  . TYR A 1 54  ? -17.517 0.370   -9.144  1.00 0.00 ? 77  TYR A HE2  6  
ATOM 8160  H HH   . TYR A 1 54  ? -20.756 0.117   -10.419 1.00 0.00 ? 77  TYR A HH   6  
ATOM 8161  N N    . TYR A 1 55  ? -17.949 2.732   -2.803  1.00 0.00 ? 78  TYR A N    6  
ATOM 8162  C CA   . TYR A 1 55  ? -17.265 1.913   -1.802  1.00 0.00 ? 78  TYR A CA   6  
ATOM 8163  C C    . TYR A 1 55  ? -18.287 1.238   -0.897  1.00 0.00 ? 78  TYR A C    6  
ATOM 8164  O O    . TYR A 1 55  ? -18.311 0.019   -0.858  1.00 0.00 ? 78  TYR A O    6  
ATOM 8165  C CB   . TYR A 1 55  ? -16.230 2.698   -0.978  1.00 0.00 ? 78  TYR A CB   6  
ATOM 8166  C CG   . TYR A 1 55  ? -15.079 1.821   -0.532  1.00 0.00 ? 78  TYR A CG   6  
ATOM 8167  C CD1  . TYR A 1 55  ? -14.165 1.375   -1.499  1.00 0.00 ? 78  TYR A CD1  6  
ATOM 8168  C CD2  . TYR A 1 55  ? -14.923 1.417   0.809   1.00 0.00 ? 78  TYR A CD2  6  
ATOM 8169  C CE1  . TYR A 1 55  ? -13.149 0.475   -1.157  1.00 0.00 ? 78  TYR A CE1  6  
ATOM 8170  C CE2  . TYR A 1 55  ? -13.891 0.522   1.152   1.00 0.00 ? 78  TYR A CE2  6  
ATOM 8171  C CZ   . TYR A 1 55  ? -13.024 0.014   0.167   1.00 0.00 ? 78  TYR A CZ   6  
ATOM 8172  O OH   . TYR A 1 55  ? -12.079 -0.910  0.481   1.00 0.00 ? 78  TYR A OH   6  
ATOM 8173  H H    . TYR A 1 55  ? -17.779 3.733   -2.777  1.00 0.00 ? 78  TYR A H    6  
ATOM 8174  H HA   . TYR A 1 55  ? -16.738 1.120   -2.337  1.00 0.00 ? 78  TYR A HA   6  
ATOM 8175  H HB2  . TYR A 1 55  ? -15.813 3.508   -1.573  1.00 0.00 ? 78  TYR A HB2  6  
ATOM 8176  H HB3  . TYR A 1 55  ? -16.716 3.121   -0.102  1.00 0.00 ? 78  TYR A HB3  6  
ATOM 8177  H HD1  . TYR A 1 55  ? -14.244 1.716   -2.513  1.00 0.00 ? 78  TYR A HD1  6  
ATOM 8178  H HD2  . TYR A 1 55  ? -15.596 1.774   1.577   1.00 0.00 ? 78  TYR A HD2  6  
ATOM 8179  H HE1  . TYR A 1 55  ? -12.452 0.148   -1.905  1.00 0.00 ? 78  TYR A HE1  6  
ATOM 8180  H HE2  . TYR A 1 55  ? -13.746 0.204   2.166   1.00 0.00 ? 78  TYR A HE2  6  
ATOM 8181  H HH   . TYR A 1 55  ? -12.256 -1.399  1.293   1.00 0.00 ? 78  TYR A HH   6  
ATOM 8182  N N    . GLU A 1 56  ? -19.180 1.991   -0.250  1.00 0.00 ? 79  GLU A N    6  
ATOM 8183  C CA   . GLU A 1 56  ? -20.299 1.485   0.550   1.00 0.00 ? 79  GLU A CA   6  
ATOM 8184  C C    . GLU A 1 56  ? -21.014 0.332   -0.153  1.00 0.00 ? 79  GLU A C    6  
ATOM 8185  O O    . GLU A 1 56  ? -21.411 -0.626  0.504   1.00 0.00 ? 79  GLU A O    6  
ATOM 8186  C CB   . GLU A 1 56  ? -21.305 2.625   0.777   1.00 0.00 ? 79  GLU A CB   6  
ATOM 8187  C CG   . GLU A 1 56  ? -20.911 3.595   1.894   1.00 0.00 ? 79  GLU A CG   6  
ATOM 8188  C CD   . GLU A 1 56  ? -21.055 3.000   3.303   1.00 0.00 ? 79  GLU A CD   6  
ATOM 8189  O OE1  . GLU A 1 56  ? -21.524 1.850   3.457   1.00 0.00 ? 79  GLU A OE1  6  
ATOM 8190  O OE2  . GLU A 1 56  ? -20.651 3.646   4.296   1.00 0.00 ? 79  GLU A OE2  6  
ATOM 8191  H H    . GLU A 1 56  ? -19.105 2.999   -0.365  1.00 0.00 ? 79  GLU A H    6  
ATOM 8192  H HA   . GLU A 1 56  ? -19.939 1.106   1.513   1.00 0.00 ? 79  GLU A HA   6  
ATOM 8193  H HB2  . GLU A 1 56  ? -21.410 3.192   -0.146  1.00 0.00 ? 79  GLU A HB2  6  
ATOM 8194  H HB3  . GLU A 1 56  ? -22.291 2.215   0.999   1.00 0.00 ? 79  GLU A HB3  6  
ATOM 8195  H HG2  . GLU A 1 56  ? -19.883 3.927   1.743   1.00 0.00 ? 79  GLU A HG2  6  
ATOM 8196  H HG3  . GLU A 1 56  ? -21.567 4.457   1.798   1.00 0.00 ? 79  GLU A HG3  6  
ATOM 8197  N N    . ALA A 1 57  ? -21.176 0.422   -1.474  1.00 0.00 ? 80  ALA A N    6  
ATOM 8198  C CA   . ALA A 1 57  ? -21.862 -0.596  -2.248  1.00 0.00 ? 80  ALA A CA   6  
ATOM 8199  C C    . ALA A 1 57  ? -21.104 -1.905  -2.445  1.00 0.00 ? 80  ALA A C    6  
ATOM 8200  O O    . ALA A 1 57  ? -21.744 -2.947  -2.602  1.00 0.00 ? 80  ALA A O    6  
ATOM 8201  C CB   . ALA A 1 57  ? -22.223 -0.040  -3.634  1.00 0.00 ? 80  ALA A CB   6  
ATOM 8202  H H    . ALA A 1 57  ? -20.852 1.275   -1.910  1.00 0.00 ? 80  ALA A H    6  
ATOM 8203  H HA   . ALA A 1 57  ? -22.738 -0.852  -1.671  1.00 0.00 ? 80  ALA A HA   6  
ATOM 8204  H HB1  . ALA A 1 57  ? -22.860 -0.751  -4.153  1.00 0.00 ? 80  ALA A HB1  6  
ATOM 8205  H HB2  . ALA A 1 57  ? -22.746 0.909   -3.541  1.00 0.00 ? 80  ALA A HB2  6  
ATOM 8206  H HB3  . ALA A 1 57  ? -21.317 0.083   -4.236  1.00 0.00 ? 80  ALA A HB3  6  
ATOM 8207  N N    . ASN A 1 58  ? -19.778 -1.859  -2.565  1.00 0.00 ? 81  ASN A N    6  
ATOM 8208  C CA   . ASN A 1 58  ? -18.996 -2.977  -3.091  1.00 0.00 ? 81  ASN A CA   6  
ATOM 8209  C C    . ASN A 1 58  ? -17.526 -2.880  -2.665  1.00 0.00 ? 81  ASN A C    6  
ATOM 8210  O O    . ASN A 1 58  ? -16.606 -3.127  -3.443  1.00 0.00 ? 81  ASN A O    6  
ATOM 8211  C CB   . ASN A 1 58  ? -19.199 -3.116  -4.616  1.00 0.00 ? 81  ASN A CB   6  
ATOM 8212  C CG   . ASN A 1 58  ? -18.981 -1.845  -5.429  1.00 0.00 ? 81  ASN A CG   6  
ATOM 8213  O OD1  . ASN A 1 58  ? -19.838 -1.423  -6.202  1.00 0.00 ? 81  ASN A OD1  6  
ATOM 8214  N ND2  . ASN A 1 58  ? -17.822 -1.230  -5.308  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 8215  H H    . ASN A 1 58  ? -19.321 -0.964  -2.409  1.00 0.00 ? 81  ASN A H    6  
ATOM 8216  H HA   . ASN A 1 58  ? -19.388 -3.889  -2.643  1.00 0.00 ? 81  ASN A HA   6  
ATOM 8217  H HB2  . ASN A 1 58  ? -18.537 -3.897  -4.986  1.00 0.00 ? 81  ASN A HB2  6  
ATOM 8218  H HB3  . ASN A 1 58  ? -20.219 -3.460  -4.794  1.00 0.00 ? 81  ASN A HB3  6  
ATOM 8219  H HD21 . ASN A 1 58  ? -17.211 -1.565  -4.579  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 8220  H HD22 . ASN A 1 58  ? -17.720 -0.281  -5.650  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 8221  N N    . TYR A 1 59  ? -17.298 -2.485  -1.416  1.00 0.00 ? 82  TYR A N    6  
ATOM 8222  C CA   . TYR A 1 59  ? -16.005 -2.294  -0.764  1.00 0.00 ? 82  TYR A CA   6  
ATOM 8223  C C    . TYR A 1 59  ? -15.175 -3.576  -0.734  1.00 0.00 ? 82  TYR A C    6  
ATOM 8224  O O    . TYR A 1 59  ? -13.954 -3.541  -0.853  1.00 0.00 ? 82  TYR A O    6  
ATOM 8225  C CB   . TYR A 1 59  ? -16.256 -1.829  0.677   1.00 0.00 ? 82  TYR A CB   6  
ATOM 8226  C CG   . TYR A 1 59  ? -17.281 -2.652  1.446   1.00 0.00 ? 82  TYR A CG   6  
ATOM 8227  C CD1  . TYR A 1 59  ? -18.663 -2.389  1.329   1.00 0.00 ? 82  TYR A CD1  6  
ATOM 8228  C CD2  . TYR A 1 59  ? -16.844 -3.710  2.262   1.00 0.00 ? 82  TYR A CD2  6  
ATOM 8229  C CE1  . TYR A 1 59  ? -19.592 -3.209  1.996   1.00 0.00 ? 82  TYR A CE1  6  
ATOM 8230  C CE2  . TYR A 1 59  ? -17.766 -4.516  2.952   1.00 0.00 ? 82  TYR A CE2  6  
ATOM 8231  C CZ   . TYR A 1 59  ? -19.151 -4.276  2.811   1.00 0.00 ? 82  TYR A CZ   6  
ATOM 8232  O OH   . TYR A 1 59  ? -20.060 -5.040  3.477   1.00 0.00 ? 82  TYR A OH   6  
ATOM 8233  H H    . TYR A 1 59  ? -18.098 -2.197  -0.867  1.00 0.00 ? 82  TYR A H    6  
ATOM 8234  H HA   . TYR A 1 59  ? -15.442 -1.525  -1.295  1.00 0.00 ? 82  TYR A HA   6  
ATOM 8235  H HB2  . TYR A 1 59  ? -15.304 -1.861  1.204   1.00 0.00 ? 82  TYR A HB2  6  
ATOM 8236  H HB3  . TYR A 1 59  ? -16.575 -0.791  0.667   1.00 0.00 ? 82  TYR A HB3  6  
ATOM 8237  H HD1  . TYR A 1 59  ? -19.045 -1.536  0.771   1.00 0.00 ? 82  TYR A HD1  6  
ATOM 8238  H HD2  . TYR A 1 59  ? -15.789 -3.903  2.366   1.00 0.00 ? 82  TYR A HD2  6  
ATOM 8239  H HE1  . TYR A 1 59  ? -20.652 -3.019  1.891   1.00 0.00 ? 82  TYR A HE1  6  
ATOM 8240  H HE2  . TYR A 1 59  ? -17.408 -5.322  3.578   1.00 0.00 ? 82  TYR A HE2  6  
ATOM 8241  H HH   . TYR A 1 59  ? -19.679 -5.630  4.149   1.00 0.00 ? 82  TYR A HH   6  
ATOM 8242  N N    . TRP A 1 60  ? -15.846 -4.721  -0.614  1.00 0.00 ? 83  TRP A N    6  
ATOM 8243  C CA   . TRP A 1 60  ? -15.275 -6.058  -0.526  1.00 0.00 ? 83  TRP A CA   6  
ATOM 8244  C C    . TRP A 1 60  ? -14.395 -6.436  -1.726  1.00 0.00 ? 83  TRP A C    6  
ATOM 8245  O O    . TRP A 1 60  ? -13.684 -7.445  -1.685  1.00 0.00 ? 83  TRP A O    6  
ATOM 8246  C CB   . TRP A 1 60  ? -16.441 -7.032  -0.345  1.00 0.00 ? 83  TRP A CB   6  
ATOM 8247  C CG   . TRP A 1 60  ? -17.446 -7.103  -1.452  1.00 0.00 ? 83  TRP A CG   6  
ATOM 8248  C CD1  . TRP A 1 60  ? -18.475 -6.250  -1.646  1.00 0.00 ? 83  TRP A CD1  6  
ATOM 8249  C CD2  . TRP A 1 60  ? -17.616 -8.154  -2.440  1.00 0.00 ? 83  TRP A CD2  6  
ATOM 8250  N NE1  . TRP A 1 60  ? -19.278 -6.707  -2.674  1.00 0.00 ? 83  TRP A NE1  6  
ATOM 8251  C CE2  . TRP A 1 60  ? -18.796 -7.891  -3.194  1.00 0.00 ? 83  TRP A CE2  6  
ATOM 8252  C CE3  . TRP A 1 60  ? -16.905 -9.330  -2.737  1.00 0.00 ? 83  TRP A CE3  6  
ATOM 8253  C CZ2  . TRP A 1 60  ? -19.251 -8.772  -4.186  1.00 0.00 ? 83  TRP A CZ2  6  
ATOM 8254  C CZ3  . TRP A 1 60  ? -17.354 -10.223 -3.725  1.00 0.00 ? 83  TRP A CZ3  6  
ATOM 8255  C CH2  . TRP A 1 60  ? -18.535 -9.954  -4.440  1.00 0.00 ? 83  TRP A CH2  6  
ATOM 8256  H H    . TRP A 1 60  ? -16.843 -4.657  -0.475  1.00 0.00 ? 83  TRP A H    6  
ATOM 8257  H HA   . TRP A 1 60  ? -14.658 -6.116  0.369   1.00 0.00 ? 83  TRP A HA   6  
ATOM 8258  H HB2  . TRP A 1 60  ? -16.038 -8.032  -0.175  1.00 0.00 ? 83  TRP A HB2  6  
ATOM 8259  H HB3  . TRP A 1 60  ? -16.987 -6.745  0.553   1.00 0.00 ? 83  TRP A HB3  6  
ATOM 8260  H HD1  . TRP A 1 60  ? -18.694 -5.400  -1.014  1.00 0.00 ? 83  TRP A HD1  6  
ATOM 8261  H HE1  . TRP A 1 60  ? -20.192 -6.309  -2.876  1.00 0.00 ? 83  TRP A HE1  6  
ATOM 8262  H HE3  . TRP A 1 60  ? -16.024 -9.558  -2.155  1.00 0.00 ? 83  TRP A HE3  6  
ATOM 8263  H HZ2  . TRP A 1 60  ? -20.156 -8.558  -4.735  1.00 0.00 ? 83  TRP A HZ2  6  
ATOM 8264  H HZ3  . TRP A 1 60  ? -16.798 -11.131 -3.903  1.00 0.00 ? 83  TRP A HZ3  6  
ATOM 8265  H HH2  . TRP A 1 60  ? -18.895 -10.653 -5.183  1.00 0.00 ? 83  TRP A HH2  6  
ATOM 8266  N N    . GLN A 1 61  ? -14.420 -5.638  -2.796  1.00 0.00 ? 84  GLN A N    6  
ATOM 8267  C CA   . GLN A 1 61  ? -13.665 -5.866  -4.018  1.00 0.00 ? 84  GLN A CA   6  
ATOM 8268  C C    . GLN A 1 61  ? -12.333 -5.105  -4.028  1.00 0.00 ? 84  GLN A C    6  
ATOM 8269  O O    . GLN A 1 61  ? -11.617 -5.157  -5.024  1.00 0.00 ? 84  GLN A O    6  
ATOM 8270  C CB   . GLN A 1 61  ? -14.551 -5.552  -5.237  1.00 0.00 ? 84  GLN A CB   6  
ATOM 8271  C CG   . GLN A 1 61  ? -15.929 -6.241  -5.135  1.00 0.00 ? 84  GLN A CG   6  
ATOM 8272  C CD   . GLN A 1 61  ? -16.363 -6.944  -6.412  1.00 0.00 ? 84  GLN A CD   6  
ATOM 8273  O OE1  . GLN A 1 61  ? -16.199 -6.460  -7.530  1.00 0.00 ? 84  GLN A OE1  6  
ATOM 8274  N NE2  . GLN A 1 61  ? -16.963 -8.110  -6.282  1.00 0.00 ? 84  GLN A NE2  6  
ATOM 8275  H H    . GLN A 1 61  ? -15.027 -4.830  -2.775  1.00 0.00 ? 84  GLN A H    6  
ATOM 8276  H HA   . GLN A 1 61  ? -13.414 -6.920  -4.074  1.00 0.00 ? 84  GLN A HA   6  
ATOM 8277  H HB2  . GLN A 1 61  ? -14.696 -4.475  -5.327  1.00 0.00 ? 84  GLN A HB2  6  
ATOM 8278  H HB3  . GLN A 1 61  ? -14.030 -5.901  -6.130  1.00 0.00 ? 84  GLN A HB3  6  
ATOM 8279  H HG2  . GLN A 1 61  ? -15.903 -6.998  -4.351  1.00 0.00 ? 84  GLN A HG2  6  
ATOM 8280  H HG3  . GLN A 1 61  ? -16.683 -5.503  -4.863  1.00 0.00 ? 84  GLN A HG3  6  
ATOM 8281  H HE21 . GLN A 1 61  ? -17.158 -8.491  -5.360  1.00 0.00 ? 84  GLN A HE21 6  
ATOM 8282  H HE22 . GLN A 1 61  ? -17.232 -8.648  -7.093  1.00 0.00 ? 84  GLN A HE22 6  
ATOM 8283  N N    . PHE A 1 62  ? -11.963 -4.415  -2.943  1.00 0.00 ? 85  PHE A N    6  
ATOM 8284  C CA   . PHE A 1 62  ? -10.795 -3.548  -2.889  1.00 0.00 ? 85  PHE A CA   6  
ATOM 8285  C C    . PHE A 1 62  ? -9.841  -4.017  -1.779  1.00 0.00 ? 85  PHE A C    6  
ATOM 8286  O O    . PHE A 1 62  ? -10.268 -4.731  -0.866  1.00 0.00 ? 85  PHE A O    6  
ATOM 8287  C CB   . PHE A 1 62  ? -11.288 -2.119  -2.664  1.00 0.00 ? 85  PHE A CB   6  
ATOM 8288  C CG   . PHE A 1 62  ? -12.102 -1.533  -3.807  1.00 0.00 ? 85  PHE A CG   6  
ATOM 8289  C CD1  . PHE A 1 62  ? -13.440 -1.929  -4.000  1.00 0.00 ? 85  PHE A CD1  6  
ATOM 8290  C CD2  . PHE A 1 62  ? -11.547 -0.545  -4.643  1.00 0.00 ? 85  PHE A CD2  6  
ATOM 8291  C CE1  . PHE A 1 62  ? -14.204 -1.362  -5.029  1.00 0.00 ? 85  PHE A CE1  6  
ATOM 8292  C CE2  . PHE A 1 62  ? -12.320 0.030   -5.667  1.00 0.00 ? 85  PHE A CE2  6  
ATOM 8293  C CZ   . PHE A 1 62  ? -13.644 -0.385  -5.863  1.00 0.00 ? 85  PHE A CZ   6  
ATOM 8294  H H    . PHE A 1 62  ? -12.555 -4.353  -2.121  1.00 0.00 ? 85  PHE A H    6  
ATOM 8295  H HA   . PHE A 1 62  ? -10.273 -3.583  -3.844  1.00 0.00 ? 85  PHE A HA   6  
ATOM 8296  H HB2  . PHE A 1 62  ? -11.903 -2.116  -1.767  1.00 0.00 ? 85  PHE A HB2  6  
ATOM 8297  H HB3  . PHE A 1 62  ? -10.439 -1.471  -2.464  1.00 0.00 ? 85  PHE A HB3  6  
ATOM 8298  H HD1  . PHE A 1 62  ? -13.891 -2.676  -3.362  1.00 0.00 ? 85  PHE A HD1  6  
ATOM 8299  H HD2  . PHE A 1 62  ? -10.531 -0.215  -4.493  1.00 0.00 ? 85  PHE A HD2  6  
ATOM 8300  H HE1  . PHE A 1 62  ? -15.228 -1.669  -5.164  1.00 0.00 ? 85  PHE A HE1  6  
ATOM 8301  H HE2  . PHE A 1 62  ? -11.906 0.798   -6.304  1.00 0.00 ? 85  PHE A HE2  6  
ATOM 8302  H HZ   . PHE A 1 62  ? -14.242 0.063   -6.638  1.00 0.00 ? 85  PHE A HZ   6  
ATOM 8303  N N    . PRO A 1 63  ? -8.541  -3.682  -1.859  1.00 0.00 ? 86  PRO A N    6  
ATOM 8304  C CA   . PRO A 1 63  ? -7.546  -4.155  -0.902  1.00 0.00 ? 86  PRO A CA   6  
ATOM 8305  C C    . PRO A 1 63  ? -7.699  -3.472  0.465   1.00 0.00 ? 86  PRO A C    6  
ATOM 8306  O O    . PRO A 1 63  ? -8.327  -2.425  0.558   1.00 0.00 ? 86  PRO A O    6  
ATOM 8307  C CB   . PRO A 1 63  ? -6.194  -3.924  -1.566  1.00 0.00 ? 86  PRO A CB   6  
ATOM 8308  C CG   . PRO A 1 63  ? -6.438  -2.858  -2.638  1.00 0.00 ? 86  PRO A CG   6  
ATOM 8309  C CD   . PRO A 1 63  ? -7.949  -2.777  -2.832  1.00 0.00 ? 86  PRO A CD   6  
ATOM 8310  H HA   . PRO A 1 63  ? -7.652  -5.222  -0.771  1.00 0.00 ? 86  PRO A HA   6  
ATOM 8311  H HB2  . PRO A 1 63  ? -5.443  -3.599  -0.849  1.00 0.00 ? 86  PRO A HB2  6  
ATOM 8312  H HB3  . PRO A 1 63  ? -5.887  -4.863  -2.036  1.00 0.00 ? 86  PRO A HB3  6  
ATOM 8313  H HG2  . PRO A 1 63  ? -6.069  -1.893  -2.315  1.00 0.00 ? 86  PRO A HG2  6  
ATOM 8314  H HG3  . PRO A 1 63  ? -5.947  -3.134  -3.568  1.00 0.00 ? 86  PRO A HG3  6  
ATOM 8315  H HD2  . PRO A 1 63  ? -8.294  -1.752  -2.637  1.00 0.00 ? 86  PRO A HD2  6  
ATOM 8316  H HD3  . PRO A 1 63  ? -8.196  -3.082  -3.849  1.00 0.00 ? 86  PRO A HD3  6  
ATOM 8317  N N    . ASP A 1 64  ? -7.154  -4.080  1.527   1.00 0.00 ? 87  ASP A N    6  
ATOM 8318  C CA   . ASP A 1 64  ? -7.023  -3.454  2.857   1.00 0.00 ? 87  ASP A CA   6  
ATOM 8319  C C    . ASP A 1 64  ? -5.799  -2.544  2.874   1.00 0.00 ? 87  ASP A C    6  
ATOM 8320  O O    . ASP A 1 64  ? -5.887  -1.385  3.266   1.00 0.00 ? 87  ASP A O    6  
ATOM 8321  C CB   . ASP A 1 64  ? -6.890  -4.522  3.959   1.00 0.00 ? 87  ASP A CB   6  
ATOM 8322  C CG   . ASP A 1 64  ? -6.138  -4.020  5.208   1.00 0.00 ? 87  ASP A CG   6  
ATOM 8323  O OD1  . ASP A 1 64  ? -6.761  -3.436  6.124   1.00 0.00 ? 87  ASP A OD1  6  
ATOM 8324  O OD2  . ASP A 1 64  ? -4.909  -4.238  5.258   1.00 0.00 ? 87  ASP A OD2  6  
ATOM 8325  H H    . ASP A 1 64  ? -6.698  -4.965  1.392   1.00 0.00 ? 87  ASP A H    6  
ATOM 8326  H HA   . ASP A 1 64  ? -7.898  -2.841  3.067   1.00 0.00 ? 87  ASP A HA   6  
ATOM 8327  H HB2  . ASP A 1 64  ? -7.885  -4.872  4.234   1.00 0.00 ? 87  ASP A HB2  6  
ATOM 8328  H HB3  . ASP A 1 64  ? -6.343  -5.374  3.552   1.00 0.00 ? 87  ASP A HB3  6  
ATOM 8329  N N    . GLY A 1 65  ? -4.673  -3.097  2.430   1.00 0.00 ? 88  GLY A N    6  
ATOM 8330  C CA   . GLY A 1 65  ? -3.353  -2.509  2.358   1.00 0.00 ? 88  GLY A CA   6  
ATOM 8331  C C    . GLY A 1 65  ? -2.717  -2.960  1.051   1.00 0.00 ? 88  GLY A C    6  
ATOM 8332  O O    . GLY A 1 65  ? -3.236  -3.849  0.356   1.00 0.00 ? 88  GLY A O    6  
ATOM 8333  H H    . GLY A 1 65  ? -4.702  -4.058  2.142   1.00 0.00 ? 88  GLY A H    6  
ATOM 8334  H HA2  . GLY A 1 65  ? -3.365  -1.435  2.448   1.00 0.00 ? 88  GLY A HA2  6  
ATOM 8335  H HA3  . GLY A 1 65  ? -2.756  -2.849  3.197   1.00 0.00 ? 88  GLY A HA3  6  
ATOM 8336  N N    . ILE A 1 66  ? -1.566  -2.386  0.729   1.00 0.00 ? 89  ILE A N    6  
ATOM 8337  C CA   . ILE A 1 66  ? -0.642  -2.945  -0.243  1.00 0.00 ? 89  ILE A CA   6  
ATOM 8338  C C    . ILE A 1 66  ? 0.557   -3.399  0.570   1.00 0.00 ? 89  ILE A C    6  
ATOM 8339  O O    . ILE A 1 66  ? 0.980   -2.688  1.486   1.00 0.00 ? 89  ILE A O    6  
ATOM 8340  C CB   . ILE A 1 66  ? -0.291  -1.897  -1.316  1.00 0.00 ? 89  ILE A CB   6  
ATOM 8341  C CG1  . ILE A 1 66  ? -1.507  -1.522  -2.186  1.00 0.00 ? 89  ILE A CG1  6  
ATOM 8342  C CG2  . ILE A 1 66  ? 0.869   -2.351  -2.217  1.00 0.00 ? 89  ILE A CG2  6  
ATOM 8343  C CD1  . ILE A 1 66  ? -2.103  -2.666  -3.020  1.00 0.00 ? 89  ILE A CD1  6  
ATOM 8344  H H    . ILE A 1 66  ? -1.179  -1.689  1.353   1.00 0.00 ? 89  ILE A H    6  
ATOM 8345  H HA   . ILE A 1 66  ? -1.079  -3.818  -0.726  1.00 0.00 ? 89  ILE A HA   6  
ATOM 8346  H HB   . ILE A 1 66  ? 0.029   -0.994  -0.796  1.00 0.00 ? 89  ILE A HB   6  
ATOM 8347  H HG12 . ILE A 1 66  ? -2.295  -1.119  -1.554  1.00 0.00 ? 89  ILE A HG12 6  
ATOM 8348  H HG13 . ILE A 1 66  ? -1.192  -0.725  -2.858  1.00 0.00 ? 89  ILE A HG13 6  
ATOM 8349  H HG21 . ILE A 1 66  ? 0.948   -1.688  -3.082  1.00 0.00 ? 89  ILE A HG21 6  
ATOM 8350  H HG22 . ILE A 1 66  ? 1.805   -2.276  -1.660  1.00 0.00 ? 89  ILE A HG22 6  
ATOM 8351  H HG23 . ILE A 1 66  ? 0.711   -3.378  -2.550  1.00 0.00 ? 89  ILE A HG23 6  
ATOM 8352  H HD11 . ILE A 1 66  ? -1.368  -3.044  -3.730  1.00 0.00 ? 89  ILE A HD11 6  
ATOM 8353  H HD12 . ILE A 1 66  ? -2.441  -3.476  -2.376  1.00 0.00 ? 89  ILE A HD12 6  
ATOM 8354  H HD13 . ILE A 1 66  ? -2.965  -2.295  -3.571  1.00 0.00 ? 89  ILE A HD13 6  
ATOM 8355  N N    . HIS A 1 67  ? 1.064   -4.586  0.240   1.00 0.00 ? 90  HIS A N    6  
ATOM 8356  C CA   . HIS A 1 67  ? 2.254   -5.162  0.838   1.00 0.00 ? 90  HIS A CA   6  
ATOM 8357  C C    . HIS A 1 67  ? 3.427   -4.241  0.487   1.00 0.00 ? 90  HIS A C    6  
ATOM 8358  O O    . HIS A 1 67  ? 3.760   -3.359  1.271   1.00 0.00 ? 90  HIS A O    6  
ATOM 8359  C CB   . HIS A 1 67  ? 2.450   -6.619  0.368   1.00 0.00 ? 90  HIS A CB   6  
ATOM 8360  C CG   . HIS A 1 67  ? 1.216   -7.489  0.395   1.00 0.00 ? 90  HIS A CG   6  
ATOM 8361  N ND1  . HIS A 1 67  ? 0.216   -7.476  -0.549  1.00 0.00 ? 90  HIS A ND1  6  
ATOM 8362  C CD2  . HIS A 1 67  ? 0.951   -8.519  1.259   1.00 0.00 ? 90  HIS A CD2  6  
ATOM 8363  C CE1  . HIS A 1 67  ? -0.617  -8.487  -0.279  1.00 0.00 ? 90  HIS A CE1  6  
ATOM 8364  N NE2  . HIS A 1 67  ? -0.206  -9.166  0.800   1.00 0.00 ? 90  HIS A NE2  6  
ATOM 8365  H H    . HIS A 1 67  ? 0.611   -5.111  -0.488  1.00 0.00 ? 90  HIS A H    6  
ATOM 8366  H HA   . HIS A 1 67  ? 2.129   -5.160  1.922   1.00 0.00 ? 90  HIS A HA   6  
ATOM 8367  H HB2  . HIS A 1 67  ? 2.819   -6.637  -0.657  1.00 0.00 ? 90  HIS A HB2  6  
ATOM 8368  H HB3  . HIS A 1 67  ? 3.212   -7.075  0.997   1.00 0.00 ? 90  HIS A HB3  6  
ATOM 8369  H HD1  . HIS A 1 67  ? 0.091   -6.851  -1.341  1.00 0.00 ? 90  HIS A HD1  6  
ATOM 8370  H HD2  . HIS A 1 67  ? 1.569   -8.825  2.092   1.00 0.00 ? 90  HIS A HD2  6  
ATOM 8371  H HE1  . HIS A 1 67  ? -1.489  -8.710  -0.874  1.00 0.00 ? 90  HIS A HE1  6  
ATOM 8372  N N    . TYR A 1 68  ? 3.977   -4.368  -0.728  1.00 0.00 ? 91  TYR A N    6  
ATOM 8373  C CA   . TYR A 1 68  ? 5.134   -3.620  -1.216  1.00 0.00 ? 91  TYR A CA   6  
ATOM 8374  C C    . TYR A 1 68  ? 6.239   -3.572  -0.154  1.00 0.00 ? 91  TYR A C    6  
ATOM 8375  O O    . TYR A 1 68  ? 6.765   -2.511  0.178   1.00 0.00 ? 91  TYR A O    6  
ATOM 8376  C CB   . TYR A 1 68  ? 4.697   -2.236  -1.727  1.00 0.00 ? 91  TYR A CB   6  
ATOM 8377  C CG   . TYR A 1 68  ? 5.741   -1.412  -2.464  1.00 0.00 ? 91  TYR A CG   6  
ATOM 8378  C CD1  . TYR A 1 68  ? 6.548   -1.992  -3.458  1.00 0.00 ? 91  TYR A CD1  6  
ATOM 8379  C CD2  . TYR A 1 68  ? 5.814   -0.025  -2.247  1.00 0.00 ? 91  TYR A CD2  6  
ATOM 8380  C CE1  . TYR A 1 68  ? 7.350   -1.202  -4.290  1.00 0.00 ? 91  TYR A CE1  6  
ATOM 8381  C CE2  . TYR A 1 68  ? 6.666   0.774   -3.036  1.00 0.00 ? 91  TYR A CE2  6  
ATOM 8382  C CZ   . TYR A 1 68  ? 7.433   0.190   -4.070  1.00 0.00 ? 91  TYR A CZ   6  
ATOM 8383  O OH   . TYR A 1 68  ? 8.212   0.958   -4.878  1.00 0.00 ? 91  TYR A OH   6  
ATOM 8384  H H    . TYR A 1 68  ? 3.670   -5.136  -1.300  1.00 0.00 ? 91  TYR A H    6  
ATOM 8385  H HA   . TYR A 1 68  ? 5.520   -4.177  -2.070  1.00 0.00 ? 91  TYR A HA   6  
ATOM 8386  H HB2  . TYR A 1 68  ? 3.879   -2.384  -2.429  1.00 0.00 ? 91  TYR A HB2  6  
ATOM 8387  H HB3  . TYR A 1 68  ? 4.313   -1.657  -0.885  1.00 0.00 ? 91  TYR A HB3  6  
ATOM 8388  H HD1  . TYR A 1 68  ? 6.533   -3.051  -3.629  1.00 0.00 ? 91  TYR A HD1  6  
ATOM 8389  H HD2  . TYR A 1 68  ? 5.167   0.417   -1.501  1.00 0.00 ? 91  TYR A HD2  6  
ATOM 8390  H HE1  . TYR A 1 68  ? 7.884   -1.682  -5.098  1.00 0.00 ? 91  TYR A HE1  6  
ATOM 8391  H HE2  . TYR A 1 68  ? 6.698   1.843   -2.894  1.00 0.00 ? 91  TYR A HE2  6  
ATOM 8392  H HH   . TYR A 1 68  ? 8.572   1.752   -4.444  1.00 0.00 ? 91  TYR A HH   6  
ATOM 8393  N N    . ASN A 1 69  ? 6.572   -4.748  0.386   1.00 0.00 ? 92  ASN A N    6  
ATOM 8394  C CA   . ASN A 1 69  ? 7.552   -4.934  1.448   1.00 0.00 ? 92  ASN A CA   6  
ATOM 8395  C C    . ASN A 1 69  ? 7.354   -3.933  2.599   1.00 0.00 ? 92  ASN A C    6  
ATOM 8396  O O    . ASN A 1 69  ? 6.229   -3.693  3.038   1.00 0.00 ? 92  ASN A O    6  
ATOM 8397  C CB   . ASN A 1 69  ? 8.970   -4.872  0.850   1.00 0.00 ? 92  ASN A CB   6  
ATOM 8398  C CG   . ASN A 1 69  ? 9.867   -5.877  1.561   1.00 0.00 ? 92  ASN A CG   6  
ATOM 8399  O OD1  . ASN A 1 69  ? 9.810   -6.039  2.777   1.00 0.00 ? 92  ASN A OD1  6  
ATOM 8400  N ND2  . ASN A 1 69  ? 10.679  -6.594  0.816   1.00 0.00 ? 92  ASN A ND2  6  
ATOM 8401  H H    . ASN A 1 69  ? 6.070   -5.568  0.073   1.00 0.00 ? 92  ASN A H    6  
ATOM 8402  H HA   . ASN A 1 69  ? 7.389   -5.934  1.852   1.00 0.00 ? 92  ASN A HA   6  
ATOM 8403  H HB2  . ASN A 1 69  ? 8.938   -5.111  -0.214  1.00 0.00 ? 92  ASN A HB2  6  
ATOM 8404  H HB3  . ASN A 1 69  ? 9.360   -3.846  0.955   1.00 0.00 ? 92  ASN A HB3  6  
ATOM 8405  H HD21 . ASN A 1 69  ? 10.786  -6.417  -0.178  1.00 0.00 ? 92  ASN A HD21 6  
ATOM 8406  H HD22 . ASN A 1 69  ? 11.240  -7.326  1.239   1.00 0.00 ? 92  ASN A HD22 6  
ATOM 8407  N N    . GLY A 1 70  ? 8.439   -3.363  3.116   1.00 0.00 ? 93  GLY A N    6  
ATOM 8408  C CA   . GLY A 1 70  ? 8.479   -1.992  3.567   1.00 0.00 ? 93  GLY A CA   6  
ATOM 8409  C C    . GLY A 1 70  ? 9.218   -1.133  2.540   1.00 0.00 ? 93  GLY A C    6  
ATOM 8410  O O    . GLY A 1 70  ? 9.537   -1.547  1.424   1.00 0.00 ? 93  GLY A O    6  
ATOM 8411  H H    . GLY A 1 70  ? 9.328   -3.692  2.770   1.00 0.00 ? 93  GLY A H    6  
ATOM 8412  H HA2  . GLY A 1 70  ? 7.469   -1.596  3.676   1.00 0.00 ? 93  GLY A HA2  6  
ATOM 8413  H HA3  . GLY A 1 70  ? 8.985   -1.942  4.531   1.00 0.00 ? 93  GLY A HA3  6  
ATOM 8414  N N    . CYS A 1 71  ? 9.548   0.065   2.961   1.00 0.00 ? 94  CYS A N    6  
ATOM 8415  C CA   . CYS A 1 71  ? 10.091  1.174   2.215   1.00 0.00 ? 94  CYS A CA   6  
ATOM 8416  C C    . CYS A 1 71  ? 11.166  1.829   3.065   1.00 0.00 ? 94  CYS A C    6  
ATOM 8417  O O    . CYS A 1 71  ? 10.944  2.183   4.221   1.00 0.00 ? 94  CYS A O    6  
ATOM 8418  C CB   . CYS A 1 71  ? 9.018   2.204   1.887   1.00 0.00 ? 94  CYS A CB   6  
ATOM 8419  S SG   . CYS A 1 71  ? 9.659   3.586   0.898   1.00 0.00 ? 94  CYS A SG   6  
ATOM 8420  H H    . CYS A 1 71  ? 9.535   0.121   3.952   1.00 0.00 ? 94  CYS A H    6  
ATOM 8421  H HA   . CYS A 1 71  ? 10.508  0.795   1.286   1.00 0.00 ? 94  CYS A HA   6  
ATOM 8422  H HB2  . CYS A 1 71  ? 8.211   1.714   1.347   1.00 0.00 ? 94  CYS A HB2  6  
ATOM 8423  H HB3  . CYS A 1 71  ? 8.620   2.593   2.826   1.00 0.00 ? 94  CYS A HB3  6  
ATOM 8424  N N    . SER A 1 72  ? 12.326  2.002   2.454   1.00 0.00 ? 95  SER A N    6  
ATOM 8425  C CA   . SER A 1 72  ? 13.562  2.372   3.116   1.00 0.00 ? 95  SER A CA   6  
ATOM 8426  C C    . SER A 1 72  ? 14.379  3.374   2.307   1.00 0.00 ? 95  SER A C    6  
ATOM 8427  O O    . SER A 1 72  ? 15.549  3.603   2.602   1.00 0.00 ? 95  SER A O    6  
ATOM 8428  C CB   . SER A 1 72  ? 14.347  1.098   3.400   1.00 0.00 ? 95  SER A CB   6  
ATOM 8429  O OG   . SER A 1 72  ? 13.561  0.225   4.197   1.00 0.00 ? 95  SER A OG   6  
ATOM 8430  H H    . SER A 1 72  ? 12.392  1.654   1.510   1.00 0.00 ? 95  SER A H    6  
ATOM 8431  H HA   . SER A 1 72  ? 13.316  2.859   4.056   1.00 0.00 ? 95  SER A HA   6  
ATOM 8432  H HB2  . SER A 1 72  ? 14.577  0.605   2.460   1.00 0.00 ? 95  SER A HB2  6  
ATOM 8433  H HB3  . SER A 1 72  ? 15.265  1.372   3.904   1.00 0.00 ? 95  SER A HB3  6  
ATOM 8434  H HG   . SER A 1 72  ? 14.062  -0.607  4.357   1.00 0.00 ? 95  SER A HG   6  
ATOM 8435  N N    . GLU A 1 73  ? 13.746  4.003   1.323   1.00 0.00 ? 96  GLU A N    6  
ATOM 8436  C CA   . GLU A 1 73  ? 14.182  5.294   0.828   1.00 0.00 ? 96  GLU A CA   6  
ATOM 8437  C C    . GLU A 1 73  ? 14.202  6.288   1.996   1.00 0.00 ? 96  GLU A C    6  
ATOM 8438  O O    . GLU A 1 73  ? 13.552  6.085   3.029   1.00 0.00 ? 96  GLU A O    6  
ATOM 8439  C CB   . GLU A 1 73  ? 13.222  5.795   -0.267  1.00 0.00 ? 96  GLU A CB   6  
ATOM 8440  C CG   . GLU A 1 73  ? 13.345  5.073   -1.616  1.00 0.00 ? 96  GLU A CG   6  
ATOM 8441  C CD   . GLU A 1 73  ? 14.733  5.243   -2.236  1.00 0.00 ? 96  GLU A CD   6  
ATOM 8442  O OE1  . GLU A 1 73  ? 15.073  6.363   -2.685  1.00 0.00 ? 96  GLU A OE1  6  
ATOM 8443  O OE2  . GLU A 1 73  ? 15.527  4.278   -2.169  1.00 0.00 ? 96  GLU A OE2  6  
ATOM 8444  H H    . GLU A 1 73  ? 12.774  3.782   1.251   1.00 0.00 ? 96  GLU A H    6  
ATOM 8445  H HA   . GLU A 1 73  ? 15.193  5.196   0.428   1.00 0.00 ? 96  GLU A HA   6  
ATOM 8446  H HB2  . GLU A 1 73  ? 12.196  5.699   0.094   1.00 0.00 ? 96  GLU A HB2  6  
ATOM 8447  H HB3  . GLU A 1 73  ? 13.417  6.852   -0.439  1.00 0.00 ? 96  GLU A HB3  6  
ATOM 8448  H HG2  . GLU A 1 73  ? 13.125  4.014   -1.476  1.00 0.00 ? 96  GLU A HG2  6  
ATOM 8449  H HG3  . GLU A 1 73  ? 12.600  5.482   -2.298  1.00 0.00 ? 96  GLU A HG3  6  
ATOM 8450  N N    . ALA A 1 74  ? 14.915  7.386   1.780   1.00 0.00 ? 97  ALA A N    6  
ATOM 8451  C CA   . ALA A 1 74  ? 15.087  8.507   2.688   1.00 0.00 ? 97  ALA A CA   6  
ATOM 8452  C C    . ALA A 1 74  ? 14.796  9.847   2.012   1.00 0.00 ? 97  ALA A C    6  
ATOM 8453  O O    . ALA A 1 74  ? 14.643  10.862  2.688   1.00 0.00 ? 97  ALA A O    6  
ATOM 8454  C CB   . ALA A 1 74  ? 16.528  8.489   3.198   1.00 0.00 ? 97  ALA A CB   6  
ATOM 8455  H H    . ALA A 1 74  ? 15.424  7.417   0.905   1.00 0.00 ? 97  ALA A H    6  
ATOM 8456  H HA   . ALA A 1 74  ? 14.401  8.403   3.524   1.00 0.00 ? 97  ALA A HA   6  
ATOM 8457  H HB1  . ALA A 1 74  ? 17.225  8.563   2.363   1.00 0.00 ? 97  ALA A HB1  6  
ATOM 8458  H HB2  . ALA A 1 74  ? 16.683  9.341   3.852   1.00 0.00 ? 97  ALA A HB2  6  
ATOM 8459  H HB3  . ALA A 1 74  ? 16.720  7.568   3.748   1.00 0.00 ? 97  ALA A HB3  6  
ATOM 8460  N N    . ASN A 1 75  ? 14.731  9.872   0.682   1.00 0.00 ? 98  ASN A N    6  
ATOM 8461  C CA   . ASN A 1 75  ? 14.728  11.081  -0.135  1.00 0.00 ? 98  ASN A CA   6  
ATOM 8462  C C    . ASN A 1 75  ? 13.650  10.928  -1.206  1.00 0.00 ? 98  ASN A C    6  
ATOM 8463  O O    . ASN A 1 75  ? 13.939  11.037  -2.401  1.00 0.00 ? 98  ASN A O    6  
ATOM 8464  C CB   . ASN A 1 75  ? 16.124  11.311  -0.760  1.00 0.00 ? 98  ASN A CB   6  
ATOM 8465  C CG   . ASN A 1 75  ? 17.256  11.348  0.256   1.00 0.00 ? 98  ASN A CG   6  
ATOM 8466  O OD1  . ASN A 1 75  ? 17.992  10.380  0.405   1.00 0.00 ? 98  ASN A OD1  6  
ATOM 8467  N ND2  . ASN A 1 75  ? 17.419  12.438  0.982   1.00 0.00 ? 98  ASN A ND2  6  
ATOM 8468  H H    . ASN A 1 75  ? 14.933  8.994   0.214   1.00 0.00 ? 98  ASN A H    6  
ATOM 8469  H HA   . ASN A 1 75  ? 14.484  11.947  0.483   1.00 0.00 ? 98  ASN A HA   6  
ATOM 8470  H HB2  . ASN A 1 75  ? 16.337  10.513  -1.473  1.00 0.00 ? 98  ASN A HB2  6  
ATOM 8471  H HB3  . ASN A 1 75  ? 16.119  12.254  -1.304  1.00 0.00 ? 98  ASN A HB3  6  
ATOM 8472  H HD21 . ASN A 1 75  ? 16.818  13.248  0.859   1.00 0.00 ? 98  ASN A HD21 6  
ATOM 8473  H HD22 . ASN A 1 75  ? 18.060  12.397  1.766   1.00 0.00 ? 98  ASN A HD22 6  
ATOM 8474  N N    . VAL A 1 76  ? 12.403  10.661  -0.814  1.00 0.00 ? 99  VAL A N    6  
ATOM 8475  C CA   . VAL A 1 76  ? 11.340  10.245  -1.721  1.00 0.00 ? 99  VAL A CA   6  
ATOM 8476  C C    . VAL A 1 76  ? 10.093  11.093  -1.475  1.00 0.00 ? 99  VAL A C    6  
ATOM 8477  O O    . VAL A 1 76  ? 9.956   11.751  -0.439  1.00 0.00 ? 99  VAL A O    6  
ATOM 8478  C CB   . VAL A 1 76  ? 11.130  8.728   -1.529  1.00 0.00 ? 99  VAL A CB   6  
ATOM 8479  C CG1  . VAL A 1 76  ? 10.496  8.400   -0.167  1.00 0.00 ? 99  VAL A CG1  6  
ATOM 8480  C CG2  . VAL A 1 76  ? 10.349  8.041   -2.650  1.00 0.00 ? 99  VAL A CG2  6  
ATOM 8481  H H    . VAL A 1 76  ? 12.147  10.664  0.161   1.00 0.00 ? 99  VAL A H    6  
ATOM 8482  H HA   . VAL A 1 76  ? 11.663  10.411  -2.751  1.00 0.00 ? 99  VAL A HA   6  
ATOM 8483  H HB   . VAL A 1 76  ? 12.116  8.284   -1.566  1.00 0.00 ? 99  VAL A HB   6  
ATOM 8484  H HG11 . VAL A 1 76  ? 10.478  7.320   -0.018  1.00 0.00 ? 99  VAL A HG11 6  
ATOM 8485  H HG12 . VAL A 1 76  ? 11.073  8.867   0.634   1.00 0.00 ? 99  VAL A HG12 6  
ATOM 8486  H HG13 . VAL A 1 76  ? 9.473   8.778   -0.138  1.00 0.00 ? 99  VAL A HG13 6  
ATOM 8487  H HG21 . VAL A 1 76  ? 10.366  6.961   -2.498  1.00 0.00 ? 99  VAL A HG21 6  
ATOM 8488  H HG22 . VAL A 1 76  ? 9.316   8.377   -2.669  1.00 0.00 ? 99  VAL A HG22 6  
ATOM 8489  H HG23 . VAL A 1 76  ? 10.834  8.245   -3.605  1.00 0.00 ? 99  VAL A HG23 6  
ATOM 8490  N N    . THR A 1 77  ? 9.169   11.049  -2.424  1.00 0.00 ? 100 THR A N    6  
ATOM 8491  C CA   . THR A 1 77  ? 7.937   11.825  -2.409  1.00 0.00 ? 100 THR A CA   6  
ATOM 8492  C C    . THR A 1 77  ? 6.739   10.899  -2.557  1.00 0.00 ? 100 THR A C    6  
ATOM 8493  O O    . THR A 1 77  ? 6.856   9.750   -3.000  1.00 0.00 ? 100 THR A O    6  
ATOM 8494  C CB   . THR A 1 77  ? 7.961   12.867  -3.543  1.00 0.00 ? 100 THR A CB   6  
ATOM 8495  O OG1  . THR A 1 77  ? 8.271   12.248  -4.777  1.00 0.00 ? 100 THR A OG1  6  
ATOM 8496  C CG2  . THR A 1 77  ? 8.982   13.963  -3.280  1.00 0.00 ? 100 THR A CG2  6  
ATOM 8497  H H    . THR A 1 77  ? 9.336   10.448  -3.217  1.00 0.00 ? 100 THR A H    6  
ATOM 8498  H HA   . THR A 1 77  ? 7.841   12.349  -1.456  1.00 0.00 ? 100 THR A HA   6  
ATOM 8499  H HB   . THR A 1 77  ? 6.978   13.334  -3.617  1.00 0.00 ? 100 THR A HB   6  
ATOM 8500  H HG1  . THR A 1 77  ? 8.117   12.915  -5.492  1.00 0.00 ? 100 THR A HG1  6  
ATOM 8501  H HG21 . THR A 1 77  ? 8.734   14.455  -2.344  1.00 0.00 ? 100 THR A HG21 6  
ATOM 8502  H HG22 . THR A 1 77  ? 9.983   13.544  -3.199  1.00 0.00 ? 100 THR A HG22 6  
ATOM 8503  H HG23 . THR A 1 77  ? 8.955   14.694  -4.088  1.00 0.00 ? 100 THR A HG23 6  
ATOM 8504  N N    . LYS A 1 78  ? 5.548   11.434  -2.288  1.00 0.00 ? 101 LYS A N    6  
ATOM 8505  C CA   . LYS A 1 78  ? 4.288   10.792  -2.632  1.00 0.00 ? 101 LYS A CA   6  
ATOM 8506  C C    . LYS A 1 78  ? 4.037   10.712  -4.135  1.00 0.00 ? 101 LYS A C    6  
ATOM 8507  O O    . LYS A 1 78  ? 3.012   10.158  -4.525  1.00 0.00 ? 101 LYS A O    6  
ATOM 8508  C CB   . LYS A 1 78  ? 3.128   11.456  -1.874  1.00 0.00 ? 101 LYS A CB   6  
ATOM 8509  C CG   . LYS A 1 78  ? 2.823   10.613  -0.628  1.00 0.00 ? 101 LYS A CG   6  
ATOM 8510  C CD   . LYS A 1 78  ? 1.807   11.262  0.318   1.00 0.00 ? 101 LYS A CD   6  
ATOM 8511  C CE   . LYS A 1 78  ? 0.470   11.559  -0.374  1.00 0.00 ? 101 LYS A CE   6  
ATOM 8512  N NZ   . LYS A 1 78  ? -0.168  12.764  0.183   1.00 0.00 ? 101 LYS A NZ   6  
ATOM 8513  H H    . LYS A 1 78  ? 5.511   12.370  -1.890  1.00 0.00 ? 101 LYS A H    6  
ATOM 8514  H HA   . LYS A 1 78  ? 4.367   9.755   -2.304  1.00 0.00 ? 101 LYS A HA   6  
ATOM 8515  H HB2  . LYS A 1 78  ? 3.379   12.479  -1.591  1.00 0.00 ? 101 LYS A HB2  6  
ATOM 8516  H HB3  . LYS A 1 78  ? 2.245   11.485  -2.511  1.00 0.00 ? 101 LYS A HB3  6  
ATOM 8517  H HG2  . LYS A 1 78  ? 2.459   9.643   -0.965  1.00 0.00 ? 101 LYS A HG2  6  
ATOM 8518  H HG3  . LYS A 1 78  ? 3.749   10.460  -0.075  1.00 0.00 ? 101 LYS A HG3  6  
ATOM 8519  H HD2  . LYS A 1 78  ? 1.625   10.598  1.164   1.00 0.00 ? 101 LYS A HD2  6  
ATOM 8520  H HD3  . LYS A 1 78  ? 2.251   12.183  0.700   1.00 0.00 ? 101 LYS A HD3  6  
ATOM 8521  H HE2  . LYS A 1 78  ? 0.638   11.722  -1.437  1.00 0.00 ? 101 LYS A HE2  6  
ATOM 8522  H HE3  . LYS A 1 78  ? -0.193  10.698  -0.267  1.00 0.00 ? 101 LYS A HE3  6  
ATOM 8523  H HZ1  . LYS A 1 78  ? 0.491   13.538  0.189   1.00 0.00 ? 101 LYS A HZ1  6  
ATOM 8524  H HZ2  . LYS A 1 78  ? -0.968  13.062  -0.364  1.00 0.00 ? 101 LYS A HZ2  6  
ATOM 8525  H HZ3  . LYS A 1 78  ? -0.506  12.603  1.128   1.00 0.00 ? 101 LYS A HZ3  6  
ATOM 8526  N N    . GLU A 1 79  ? 4.928   11.192  -4.998  1.00 0.00 ? 102 GLU A N    6  
ATOM 8527  C CA   . GLU A 1 79  ? 4.891   10.944  -6.440  1.00 0.00 ? 102 GLU A CA   6  
ATOM 8528  C C    . GLU A 1 79  ? 6.001   9.985   -6.906  1.00 0.00 ? 102 GLU A C    6  
ATOM 8529  O O    . GLU A 1 79  ? 6.018   9.601   -8.073  1.00 0.00 ? 102 GLU A O    6  
ATOM 8530  C CB   . GLU A 1 79  ? 4.916   12.286  -7.174  1.00 0.00 ? 102 GLU A CB   6  
ATOM 8531  C CG   . GLU A 1 79  ? 3.523   12.914  -7.360  1.00 0.00 ? 102 GLU A CG   6  
ATOM 8532  C CD   . GLU A 1 79  ? 2.531   12.061  -8.174  1.00 0.00 ? 102 GLU A CD   6  
ATOM 8533  O OE1  . GLU A 1 79  ? 1.867   11.176  -7.584  1.00 0.00 ? 102 GLU A OE1  6  
ATOM 8534  O OE2  . GLU A 1 79  ? 2.264   12.387  -9.351  1.00 0.00 ? 102 GLU A OE2  6  
ATOM 8535  H H    . GLU A 1 79  ? 5.748   11.663  -4.667  1.00 0.00 ? 102 GLU A H    6  
ATOM 8536  H HA   . GLU A 1 79  ? 3.966   10.437  -6.702  1.00 0.00 ? 102 GLU A HA   6  
ATOM 8537  H HB2  . GLU A 1 79  ? 5.515   12.981  -6.592  1.00 0.00 ? 102 GLU A HB2  6  
ATOM 8538  H HB3  . GLU A 1 79  ? 5.419   12.159  -8.124  1.00 0.00 ? 102 GLU A HB3  6  
ATOM 8539  H HG2  . GLU A 1 79  ? 3.094   13.109  -6.372  1.00 0.00 ? 102 GLU A HG2  6  
ATOM 8540  H HG3  . GLU A 1 79  ? 3.647   13.882  -7.855  1.00 0.00 ? 102 GLU A HG3  6  
ATOM 8541  N N    . ALA A 1 80  ? 6.858   9.511   -5.996  1.00 0.00 ? 103 ALA A N    6  
ATOM 8542  C CA   . ALA A 1 80  ? 7.884   8.521   -6.286  1.00 0.00 ? 103 ALA A CA   6  
ATOM 8543  C C    . ALA A 1 80  ? 7.578   7.171   -5.614  1.00 0.00 ? 103 ALA A C    6  
ATOM 8544  O O    . ALA A 1 80  ? 7.631   6.132   -6.272  1.00 0.00 ? 103 ALA A O    6  
ATOM 8545  C CB   . ALA A 1 80  ? 9.234   9.112   -5.870  1.00 0.00 ? 103 ALA A CB   6  
ATOM 8546  H H    . ALA A 1 80  ? 6.753   9.797   -5.034  1.00 0.00 ? 103 ALA A H    6  
ATOM 8547  H HA   . ALA A 1 80  ? 7.929   8.345   -7.362  1.00 0.00 ? 103 ALA A HA   6  
ATOM 8548  H HB1  . ALA A 1 80  ? 10.030  8.386   -6.037  1.00 0.00 ? 103 ALA A HB1  6  
ATOM 8549  H HB2  . ALA A 1 80  ? 9.427   10.001  -6.473  1.00 0.00 ? 103 ALA A HB2  6  
ATOM 8550  H HB3  . ALA A 1 80  ? 9.220   9.402   -4.820  1.00 0.00 ? 103 ALA A HB3  6  
ATOM 8551  N N    . PHE A 1 81  ? 7.276   7.156   -4.313  1.00 0.00 ? 104 PHE A N    6  
ATOM 8552  C CA   . PHE A 1 81  ? 7.114   5.926   -3.534  1.00 0.00 ? 104 PHE A CA   6  
ATOM 8553  C C    . PHE A 1 81  ? 5.862   5.137   -3.943  1.00 0.00 ? 104 PHE A C    6  
ATOM 8554  O O    . PHE A 1 81  ? 5.952   3.997   -4.393  1.00 0.00 ? 104 PHE A O    6  
ATOM 8555  C CB   . PHE A 1 81  ? 7.095   6.273   -2.033  1.00 0.00 ? 104 PHE A CB   6  
ATOM 8556  C CG   . PHE A 1 81  ? 6.488   5.201   -1.149  1.00 0.00 ? 104 PHE A CG   6  
ATOM 8557  C CD1  . PHE A 1 81  ? 7.028   3.903   -1.124  1.00 0.00 ? 104 PHE A CD1  6  
ATOM 8558  C CD2  . PHE A 1 81  ? 5.342   5.490   -0.389  1.00 0.00 ? 104 PHE A CD2  6  
ATOM 8559  C CE1  . PHE A 1 81  ? 6.411   2.900   -0.356  1.00 0.00 ? 104 PHE A CE1  6  
ATOM 8560  C CE2  . PHE A 1 81  ? 4.748   4.494   0.400   1.00 0.00 ? 104 PHE A CE2  6  
ATOM 8561  C CZ   . PHE A 1 81  ? 5.266   3.190   0.402   1.00 0.00 ? 104 PHE A CZ   6  
ATOM 8562  H H    . PHE A 1 81  ? 7.196   8.044   -3.834  1.00 0.00 ? 104 PHE A H    6  
ATOM 8563  H HA   . PHE A 1 81  ? 7.973   5.280   -3.722  1.00 0.00 ? 104 PHE A HA   6  
ATOM 8564  H HB2  . PHE A 1 81  ? 8.113   6.456   -1.696  1.00 0.00 ? 104 PHE A HB2  6  
ATOM 8565  H HB3  . PHE A 1 81  ? 6.529   7.196   -1.892  1.00 0.00 ? 104 PHE A HB3  6  
ATOM 8566  H HD1  . PHE A 1 81  ? 7.909   3.667   -1.705  1.00 0.00 ? 104 PHE A HD1  6  
ATOM 8567  H HD2  . PHE A 1 81  ? 4.917   6.482   -0.410  1.00 0.00 ? 104 PHE A HD2  6  
ATOM 8568  H HE1  . PHE A 1 81  ? 6.820   1.898   -0.346  1.00 0.00 ? 104 PHE A HE1  6  
ATOM 8569  H HE2  . PHE A 1 81  ? 3.895   4.739   1.011   1.00 0.00 ? 104 PHE A HE2  6  
ATOM 8570  H HZ   . PHE A 1 81  ? 4.796   2.409   0.987   1.00 0.00 ? 104 PHE A HZ   6  
ATOM 8571  N N    . VAL A 1 82  ? 4.682   5.716   -3.733  1.00 0.00 ? 105 VAL A N    6  
ATOM 8572  C CA   . VAL A 1 82  ? 3.393   5.049   -3.898  1.00 0.00 ? 105 VAL A CA   6  
ATOM 8573  C C    . VAL A 1 82  ? 3.159   4.672   -5.372  1.00 0.00 ? 105 VAL A C    6  
ATOM 8574  O O    . VAL A 1 82  ? 2.623   3.620   -5.695  1.00 0.00 ? 105 VAL A O    6  
ATOM 8575  C CB   . VAL A 1 82  ? 2.296   5.903   -3.210  1.00 0.00 ? 105 VAL A CB   6  
ATOM 8576  C CG1  . VAL A 1 82  ? 2.417   7.433   -3.191  1.00 0.00 ? 105 VAL A CG1  6  
ATOM 8577  C CG2  . VAL A 1 82  ? 0.885   5.613   -3.703  1.00 0.00 ? 105 VAL A CG2  6  
ATOM 8578  H H    . VAL A 1 82  ? 4.680   6.697   -3.499  1.00 0.00 ? 105 VAL A H    6  
ATOM 8579  H HA   . VAL A 1 82  ? 3.449   4.103   -3.357  1.00 0.00 ? 105 VAL A HA   6  
ATOM 8580  H HB   . VAL A 1 82  ? 2.353   5.614   -2.171  1.00 0.00 ? 105 VAL A HB   6  
ATOM 8581  H HG11 . VAL A 1 82  ? 3.403   7.756   -2.865  1.00 0.00 ? 105 VAL A HG11 6  
ATOM 8582  H HG12 . VAL A 1 82  ? 2.181   7.821   -4.180  1.00 0.00 ? 105 VAL A HG12 6  
ATOM 8583  H HG13 . VAL A 1 82  ? 1.690   7.849   -2.489  1.00 0.00 ? 105 VAL A HG13 6  
ATOM 8584  H HG21 . VAL A 1 82  ? 0.662   4.572   -3.522  1.00 0.00 ? 105 VAL A HG21 6  
ATOM 8585  H HG22 . VAL A 1 82  ? 0.169   6.229   -3.163  1.00 0.00 ? 105 VAL A HG22 6  
ATOM 8586  H HG23 . VAL A 1 82  ? 0.791   5.823   -4.770  1.00 0.00 ? 105 VAL A HG23 6  
ATOM 8587  N N    . THR A 1 83  ? 3.669   5.491   -6.269  1.00 0.00 ? 106 THR A N    6  
ATOM 8588  C CA   . THR A 1 83  ? 3.839   5.281   -7.690  1.00 0.00 ? 106 THR A CA   6  
ATOM 8589  C C    . THR A 1 83  ? 4.620   3.987   -7.962  1.00 0.00 ? 106 THR A C    6  
ATOM 8590  O O    . THR A 1 83  ? 4.167   3.178   -8.769  1.00 0.00 ? 106 THR A O    6  
ATOM 8591  C CB   . THR A 1 83  ? 4.511   6.546   -8.250  1.00 0.00 ? 106 THR A CB   6  
ATOM 8592  O OG1  . THR A 1 83  ? 3.596   7.635   -8.137  1.00 0.00 ? 106 THR A OG1  6  
ATOM 8593  C CG2  . THR A 1 83  ? 4.960   6.378   -9.691  1.00 0.00 ? 106 THR A CG2  6  
ATOM 8594  H H    . THR A 1 83  ? 4.032   6.333   -5.859  1.00 0.00 ? 106 THR A H    6  
ATOM 8595  H HA   . THR A 1 83  ? 2.854   5.178   -8.146  1.00 0.00 ? 106 THR A HA   6  
ATOM 8596  H HB   . THR A 1 83  ? 5.398   6.771   -7.659  1.00 0.00 ? 106 THR A HB   6  
ATOM 8597  H HG1  . THR A 1 83  ? 3.803   8.283   -8.852  1.00 0.00 ? 106 THR A HG1  6  
ATOM 8598  H HG21 . THR A 1 83  ? 5.394   7.309   -10.054 1.00 0.00 ? 106 THR A HG21 6  
ATOM 8599  H HG22 . THR A 1 83  ? 5.704   5.583   -9.735  1.00 0.00 ? 106 THR A HG22 6  
ATOM 8600  H HG23 . THR A 1 83  ? 4.117   6.105   -10.313 1.00 0.00 ? 106 THR A HG23 6  
ATOM 8601  N N    . GLY A 1 84  ? 5.758   3.738   -7.307  1.00 0.00 ? 107 GLY A N    6  
ATOM 8602  C CA   . GLY A 1 84  ? 6.476   2.473   -7.460  1.00 0.00 ? 107 GLY A CA   6  
ATOM 8603  C C    . GLY A 1 84  ? 5.601   1.291   -7.035  1.00 0.00 ? 107 GLY A C    6  
ATOM 8604  O O    . GLY A 1 84  ? 5.578   0.256   -7.714  1.00 0.00 ? 107 GLY A O    6  
ATOM 8605  H H    . GLY A 1 84  ? 6.123   4.391   -6.622  1.00 0.00 ? 107 GLY A H    6  
ATOM 8606  H HA2  . GLY A 1 84  ? 6.770   2.344   -8.503  1.00 0.00 ? 107 GLY A HA2  6  
ATOM 8607  H HA3  . GLY A 1 84  ? 7.376   2.494   -6.845  1.00 0.00 ? 107 GLY A HA3  6  
ATOM 8608  N N    . CYS A 1 85  ? 4.811   1.476   -5.969  1.00 0.00 ? 108 CYS A N    6  
ATOM 8609  C CA   . CYS A 1 85  ? 3.883   0.451   -5.486  1.00 0.00 ? 108 CYS A CA   6  
ATOM 8610  C C    . CYS A 1 85  ? 2.764   0.206   -6.513  1.00 0.00 ? 108 CYS A C    6  
ATOM 8611  O O    . CYS A 1 85  ? 2.307   -0.924  -6.690  1.00 0.00 ? 108 CYS A O    6  
ATOM 8612  C CB   . CYS A 1 85  ? 3.376   0.760   -4.056  1.00 0.00 ? 108 CYS A CB   6  
ATOM 8613  S SG   . CYS A 1 85  ? 1.715   1.446   -3.807  1.00 0.00 ? 108 CYS A SG   6  
ATOM 8614  H H    . CYS A 1 85  ? 4.852   2.393   -5.538  1.00 0.00 ? 108 CYS A H    6  
ATOM 8615  H HA   . CYS A 1 85  ? 4.460   -0.474  -5.414  1.00 0.00 ? 108 CYS A HA   6  
ATOM 8616  H HB2  . CYS A 1 85  ? 3.391   -0.188  -3.519  1.00 0.00 ? 108 CYS A HB2  6  
ATOM 8617  H HB3  . CYS A 1 85  ? 4.086   1.425   -3.566  1.00 0.00 ? 108 CYS A HB3  6  
ATOM 8618  N N    . ILE A 1 86  ? 2.349   1.240   -7.249  1.00 0.00 ? 109 ILE A N    6  
ATOM 8619  C CA   . ILE A 1 86  ? 1.382   1.143   -8.339  1.00 0.00 ? 109 ILE A CA   6  
ATOM 8620  C C    . ILE A 1 86  ? 1.966   0.416   -9.539  1.00 0.00 ? 109 ILE A C    6  
ATOM 8621  O O    . ILE A 1 86  ? 1.316   -0.449  -10.117 1.00 0.00 ? 109 ILE A O    6  
ATOM 8622  C CB   . ILE A 1 86  ? 0.850   2.545   -8.698  1.00 0.00 ? 109 ILE A CB   6  
ATOM 8623  C CG1  . ILE A 1 86  ? -0.455  2.724   -7.920  1.00 0.00 ? 109 ILE A CG1  6  
ATOM 8624  C CG2  . ILE A 1 86  ? 0.604   2.793   -10.194 1.00 0.00 ? 109 ILE A CG2  6  
ATOM 8625  C CD1  . ILE A 1 86  ? -0.740  4.205   -7.676  1.00 0.00 ? 109 ILE A CD1  6  
ATOM 8626  H H    . ILE A 1 86  ? 2.690   2.161   -6.994  1.00 0.00 ? 109 ILE A H    6  
ATOM 8627  H HA   . ILE A 1 86  ? 0.556   0.544   -7.969  1.00 0.00 ? 109 ILE A HA   6  
ATOM 8628  H HB   . ILE A 1 86  ? 1.572   3.288   -8.361  1.00 0.00 ? 109 ILE A HB   6  
ATOM 8629  H HG12 . ILE A 1 86  ? -1.286  2.246   -8.431  1.00 0.00 ? 109 ILE A HG12 6  
ATOM 8630  H HG13 . ILE A 1 86  ? -0.359  2.203   -6.976  1.00 0.00 ? 109 ILE A HG13 6  
ATOM 8631  H HG21 . ILE A 1 86  ? 1.556   2.798   -10.721 1.00 0.00 ? 109 ILE A HG21 6  
ATOM 8632  H HG22 . ILE A 1 86  ? -0.051  2.016   -10.596 1.00 0.00 ? 109 ILE A HG22 6  
ATOM 8633  H HG23 . ILE A 1 86  ? 0.161   3.777   -10.347 1.00 0.00 ? 109 ILE A HG23 6  
ATOM 8634  H HD11 . ILE A 1 86  ? -0.903  4.711   -8.625  1.00 0.00 ? 109 ILE A HD11 6  
ATOM 8635  H HD12 . ILE A 1 86  ? -1.627  4.304   -7.053  1.00 0.00 ? 109 ILE A HD12 6  
ATOM 8636  H HD13 . ILE A 1 86  ? 0.121   4.649   -7.173  1.00 0.00 ? 109 ILE A HD13 6  
ATOM 8637  N N    . ASN A 1 87  ? 3.180   0.763   -9.946  1.00 0.00 ? 110 ASN A N    6  
ATOM 8638  C CA   . ASN A 1 87  ? 3.835   0.070   -11.059 1.00 0.00 ? 110 ASN A CA   6  
ATOM 8639  C C    . ASN A 1 87  ? 3.943   -1.414  -10.775 1.00 0.00 ? 110 ASN A C    6  
ATOM 8640  O O    . ASN A 1 87  ? 3.804   -2.228  -11.687 1.00 0.00 ? 110 ASN A O    6  
ATOM 8641  C CB   . ASN A 1 87  ? 5.210   0.661   -11.364 1.00 0.00 ? 110 ASN A CB   6  
ATOM 8642  C CG   . ASN A 1 87  ? 5.009   1.941   -12.128 1.00 0.00 ? 110 ASN A CG   6  
ATOM 8643  O OD1  . ASN A 1 87  ? 4.697   1.918   -13.314 1.00 0.00 ? 110 ASN A OD1  6  
ATOM 8644  N ND2  . ASN A 1 87  ? 5.083   3.055   -11.436 1.00 0.00 ? 110 ASN A ND2  6  
ATOM 8645  H H    . ASN A 1 87  ? 3.573   1.579   -9.481  1.00 0.00 ? 110 ASN A H    6  
ATOM 8646  H HA   . ASN A 1 87  ? 3.217   0.164   -11.953 1.00 0.00 ? 110 ASN A HA   6  
ATOM 8647  H HB2  . ASN A 1 87  ? 5.764   0.839   -10.444 1.00 0.00 ? 110 ASN A HB2  6  
ATOM 8648  H HB3  . ASN A 1 87  ? 5.783   -0.027  -11.986 1.00 0.00 ? 110 ASN A HB3  6  
ATOM 8649  H HD21 . ASN A 1 87  ? 5.188   2.956   -10.429 1.00 0.00 ? 110 ASN A HD21 6  
ATOM 8650  H HD22 . ASN A 1 87  ? 4.556   3.857   -11.785 1.00 0.00 ? 110 ASN A HD22 6  
ATOM 8651  N N    . ALA A 1 88  ? 4.121   -1.779  -9.509  1.00 0.00 ? 111 ALA A N    6  
ATOM 8652  C CA   . ALA A 1 88  ? 4.127   -3.150  -9.076  1.00 0.00 ? 111 ALA A CA   6  
ATOM 8653  C C    . ALA A 1 88  ? 2.706   -3.722  -9.128  1.00 0.00 ? 111 ALA A C    6  
ATOM 8654  O O    . ALA A 1 88  ? 2.479   -4.765  -9.747  1.00 0.00 ? 111 ALA A O    6  
ATOM 8655  C CB   . ALA A 1 88  ? 4.765   -3.171  -7.689  1.00 0.00 ? 111 ALA A CB   6  
ATOM 8656  H H    . ALA A 1 88  ? 4.144   -1.071  -8.786  1.00 0.00 ? 111 ALA A H    6  
ATOM 8657  H HA   . ALA A 1 88  ? 4.740   -3.733  -9.755  1.00 0.00 ? 111 ALA A HA   6  
ATOM 8658  H HB1  . ALA A 1 88  ? 5.784   -2.776  -7.735  1.00 0.00 ? 111 ALA A HB1  6  
ATOM 8659  H HB2  . ALA A 1 88  ? 4.206   -2.540  -7.003  1.00 0.00 ? 111 ALA A HB2  6  
ATOM 8660  H HB3  . ALA A 1 88  ? 4.780   -4.190  -7.318  1.00 0.00 ? 111 ALA A HB3  6  
ATOM 8661  N N    . THR A 1 89  ? 1.736   -3.051  -8.507  1.00 0.00 ? 112 THR A N    6  
ATOM 8662  C CA   . THR A 1 89  ? 0.384   -3.591  -8.374  1.00 0.00 ? 112 THR A CA   6  
ATOM 8663  C C    . THR A 1 89  ? -0.341  -3.697  -9.718  1.00 0.00 ? 112 THR A C    6  
ATOM 8664  O O    . THR A 1 89  ? -1.125  -4.624  -9.901  1.00 0.00 ? 112 THR A O    6  
ATOM 8665  C CB   . THR A 1 89  ? -0.416  -2.788  -7.335  1.00 0.00 ? 112 THR A CB   6  
ATOM 8666  O OG1  . THR A 1 89  ? -1.449  -3.562  -6.777  1.00 0.00 ? 112 THR A OG1  6  
ATOM 8667  C CG2  . THR A 1 89  ? -1.075  -1.530  -7.903  1.00 0.00 ? 112 THR A CG2  6  
ATOM 8668  H H    . THR A 1 89  ? 1.987   -2.192  -8.020  1.00 0.00 ? 112 THR A H    6  
ATOM 8669  H HA   . THR A 1 89  ? 0.493   -4.605  -7.989  1.00 0.00 ? 112 THR A HA   6  
ATOM 8670  H HB   . THR A 1 89  ? 0.257   -2.528  -6.523  1.00 0.00 ? 112 THR A HB   6  
ATOM 8671  H HG1  . THR A 1 89  ? -1.032  -4.326  -6.331  1.00 0.00 ? 112 THR A HG1  6  
ATOM 8672  H HG21 . THR A 1 89  ? -2.017  -1.791  -8.377  1.00 0.00 ? 112 THR A HG21 6  
ATOM 8673  H HG22 . THR A 1 89  ? -1.234  -0.808  -7.108  1.00 0.00 ? 112 THR A HG22 6  
ATOM 8674  H HG23 . THR A 1 89  ? -0.458  -1.077  -8.665  1.00 0.00 ? 112 THR A HG23 6  
ATOM 8675  N N    . GLN A 1 90  ? -0.090  -2.810  -10.688 1.00 0.00 ? 113 GLN A N    6  
ATOM 8676  C CA   . GLN A 1 90  ? -0.830  -2.867  -11.950 1.00 0.00 ? 113 GLN A CA   6  
ATOM 8677  C C    . GLN A 1 90  ? -0.587  -4.194  -12.667 1.00 0.00 ? 113 GLN A C    6  
ATOM 8678  O O    . GLN A 1 90  ? -1.516  -4.776  -13.221 1.00 0.00 ? 113 GLN A O    6  
ATOM 8679  C CB   . GLN A 1 90  ? -0.586  -1.643  -12.835 1.00 0.00 ? 113 GLN A CB   6  
ATOM 8680  C CG   . GLN A 1 90  ? 0.838   -1.454  -13.363 1.00 0.00 ? 113 GLN A CG   6  
ATOM 8681  C CD   . GLN A 1 90  ? 0.849   -0.250  -14.291 1.00 0.00 ? 113 GLN A CD   6  
ATOM 8682  O OE1  . GLN A 1 90  ? 0.573   -0.379  -15.481 1.00 0.00 ? 113 GLN A OE1  6  
ATOM 8683  N NE2  . GLN A 1 90  ? 1.078   0.942   -13.767 1.00 0.00 ? 113 GLN A NE2  6  
ATOM 8684  H H    . GLN A 1 90  ? 0.538   -2.033  -10.489 1.00 0.00 ? 113 GLN A H    6  
ATOM 8685  H HA   . GLN A 1 90  ? -1.886  -2.839  -11.706 1.00 0.00 ? 113 GLN A HA   6  
ATOM 8686  H HB2  . GLN A 1 90  ? -1.254  -1.721  -13.693 1.00 0.00 ? 113 GLN A HB2  6  
ATOM 8687  H HB3  . GLN A 1 90  ? -0.868  -0.750  -12.274 1.00 0.00 ? 113 GLN A HB3  6  
ATOM 8688  H HG2  . GLN A 1 90  ? 1.519   -1.290  -12.535 1.00 0.00 ? 113 GLN A HG2  6  
ATOM 8689  H HG3  . GLN A 1 90  ? 1.158   -2.334  -13.921 1.00 0.00 ? 113 GLN A HG3  6  
ATOM 8690  H HE21 . GLN A 1 90  ? 1.261   1.065   -12.785 1.00 0.00 ? 113 GLN A HE21 6  
ATOM 8691  H HE22 . GLN A 1 90  ? 0.898   1.750   -14.360 1.00 0.00 ? 113 GLN A HE22 6  
ATOM 8692  N N    . ALA A 1 91  ? 0.635   -4.720  -12.571 1.00 0.00 ? 114 ALA A N    6  
ATOM 8693  C CA   . ALA A 1 91  ? 0.982   -6.029  -13.088 1.00 0.00 ? 114 ALA A CA   6  
ATOM 8694  C C    . ALA A 1 91  ? 0.598   -7.165  -12.126 1.00 0.00 ? 114 ALA A C    6  
ATOM 8695  O O    . ALA A 1 91  ? 0.693   -8.329  -12.528 1.00 0.00 ? 114 ALA A O    6  
ATOM 8696  C CB   . ALA A 1 91  ? 2.479   -6.040  -13.379 1.00 0.00 ? 114 ALA A CB   6  
ATOM 8697  H H    . ALA A 1 91  ? 1.331   -4.230  -12.027 1.00 0.00 ? 114 ALA A H    6  
ATOM 8698  H HA   . ALA A 1 91  ? 0.450   -6.189  -14.027 1.00 0.00 ? 114 ALA A HA   6  
ATOM 8699  H HB1  . ALA A 1 91  ? 2.728   -6.926  -13.960 1.00 0.00 ? 114 ALA A HB1  6  
ATOM 8700  H HB2  . ALA A 1 91  ? 2.753   -5.150  -13.952 1.00 0.00 ? 114 ALA A HB2  6  
ATOM 8701  H HB3  . ALA A 1 91  ? 3.028   -6.056  -12.438 1.00 0.00 ? 114 ALA A HB3  6  
ATOM 8702  N N    . ALA A 1 92  ? 0.169   -6.865  -10.890 1.00 0.00 ? 115 ALA A N    6  
ATOM 8703  C CA   . ALA A 1 92  ? -0.417  -7.846  -9.983  1.00 0.00 ? 115 ALA A CA   6  
ATOM 8704  C C    . ALA A 1 92  ? -1.866  -8.168  -10.384 1.00 0.00 ? 115 ALA A C    6  
ATOM 8705  O O    . ALA A 1 92  ? -2.309  -9.300  -10.179 1.00 0.00 ? 115 ALA A O    6  
ATOM 8706  C CB   . ALA A 1 92  ? -0.340  -7.390  -8.507  1.00 0.00 ? 115 ALA A CB   6  
ATOM 8707  H H    . ALA A 1 92  ? 0.063   -5.890  -10.624 1.00 0.00 ? 115 ALA A H    6  
ATOM 8708  H HA   . ALA A 1 92  ? 0.173   -8.752  -10.070 1.00 0.00 ? 115 ALA A HA   6  
ATOM 8709  H HB1  . ALA A 1 92  ? -0.695  -8.192  -7.856  1.00 0.00 ? 115 ALA A HB1  6  
ATOM 8710  H HB2  . ALA A 1 92  ? 0.687   -7.151  -8.228  1.00 0.00 ? 115 ALA A HB2  6  
ATOM 8711  H HB3  . ALA A 1 92  ? -0.969  -6.520  -8.317  1.00 0.00 ? 115 ALA A HB3  6  
ATOM 8712  N N    . ASN A 1 93  ? -2.610  -7.200  -10.942 1.00 0.00 ? 116 ASN A N    6  
ATOM 8713  C CA   . ASN A 1 93  ? -4.064  -7.307  -11.114 1.00 0.00 ? 116 ASN A CA   6  
ATOM 8714  C C    . ASN A 1 93  ? -4.514  -6.717  -12.461 1.00 0.00 ? 116 ASN A C    6  
ATOM 8715  O O    . ASN A 1 93  ? -5.489  -5.961  -12.515 1.00 0.00 ? 116 ASN A O    6  
ATOM 8716  C CB   . ASN A 1 93  ? -4.833  -6.680  -9.917  1.00 0.00 ? 116 ASN A CB   6  
ATOM 8717  C CG   . ASN A 1 93  ? -4.120  -6.697  -8.572  1.00 0.00 ? 116 ASN A CG   6  
ATOM 8718  O OD1  . ASN A 1 93  ? -3.946  -7.736  -7.942  1.00 0.00 ? 116 ASN A OD1  6  
ATOM 8719  N ND2  . ASN A 1 93  ? -3.663  -5.543  -8.131  1.00 0.00 ? 116 ASN A ND2  6  
ATOM 8720  H H    . ASN A 1 93  ? -2.186  -6.292  -11.084 1.00 0.00 ? 116 ASN A H    6  
ATOM 8721  H HA   . ASN A 1 93  ? -4.323  -8.365  -11.143 1.00 0.00 ? 116 ASN A HA   6  
ATOM 8722  H HB2  . ASN A 1 93  ? -5.099  -5.648  -10.144 1.00 0.00 ? 116 ASN A HB2  6  
ATOM 8723  H HB3  . ASN A 1 93  ? -5.764  -7.227  -9.789  1.00 0.00 ? 116 ASN A HB3  6  
ATOM 8724  H HD21 . ASN A 1 93  ? -3.884  -4.701  -8.638  1.00 0.00 ? 116 ASN A HD21 6  
ATOM 8725  H HD22 . ASN A 1 93  ? -3.240  -5.490  -7.216  1.00 0.00 ? 116 ASN A HD22 6  
ATOM 8726  N N    . GLN A 1 94  ? -3.818  -7.024  -13.566 1.00 0.00 ? 117 GLN A N    6  
ATOM 8727  C CA   . GLN A 1 94  ? -4.129  -6.442  -14.877 1.00 0.00 ? 117 GLN A CA   6  
ATOM 8728  C C    . GLN A 1 94  ? -5.599  -6.637  -15.263 1.00 0.00 ? 117 GLN A C    6  
ATOM 8729  O O    . GLN A 1 94  ? -6.248  -5.687  -15.698 1.00 0.00 ? 117 GLN A O    6  
ATOM 8730  C CB   . GLN A 1 94  ? -3.254  -7.054  -15.976 1.00 0.00 ? 117 GLN A CB   6  
ATOM 8731  C CG   . GLN A 1 94  ? -1.836  -6.495  -16.031 1.00 0.00 ? 117 GLN A CG   6  
ATOM 8732  C CD   . GLN A 1 94  ? -1.717  -5.034  -16.472 1.00 0.00 ? 117 GLN A CD   6  
ATOM 8733  O OE1  . GLN A 1 94  ? -2.690  -4.323  -16.726 1.00 0.00 ? 117 GLN A OE1  6  
ATOM 8734  N NE2  . GLN A 1 94  ? -0.496  -4.577  -16.667 1.00 0.00 ? 117 GLN A NE2  6  
ATOM 8735  H H    . GLN A 1 94  ? -3.059  -7.698  -13.516 1.00 0.00 ? 117 GLN A H    6  
ATOM 8736  H HA   . GLN A 1 94  ? -3.934  -5.370  -14.828 1.00 0.00 ? 117 GLN A HA   6  
ATOM 8737  H HB2  . GLN A 1 94  ? -3.189  -8.131  -15.821 1.00 0.00 ? 117 GLN A HB2  6  
ATOM 8738  H HB3  . GLN A 1 94  ? -3.720  -6.881  -16.944 1.00 0.00 ? 117 GLN A HB3  6  
ATOM 8739  H HG2  . GLN A 1 94  ? -1.365  -6.627  -15.061 1.00 0.00 ? 117 GLN A HG2  6  
ATOM 8740  H HG3  . GLN A 1 94  ? -1.311  -7.105  -16.762 1.00 0.00 ? 117 GLN A HG3  6  
ATOM 8741  H HE21 . GLN A 1 94  ? 0.289   -5.173  -16.438 1.00 0.00 ? 117 GLN A HE21 6  
ATOM 8742  H HE22 . GLN A 1 94  ? -0.338  -3.613  -16.955 1.00 0.00 ? 117 GLN A HE22 6  
ATOM 8743  N N    . GLY A 1 95  ? -6.131  -7.846  -15.072 1.00 0.00 ? 118 GLY A N    6  
ATOM 8744  C CA   . GLY A 1 95  ? -7.506  -8.213  -15.396 1.00 0.00 ? 118 GLY A CA   6  
ATOM 8745  C C    . GLY A 1 95  ? -8.520  -7.712  -14.365 1.00 0.00 ? 118 GLY A C    6  
ATOM 8746  O O    . GLY A 1 95  ? -9.689  -8.093  -14.411 1.00 0.00 ? 118 GLY A O    6  
ATOM 8747  H H    . GLY A 1 95  ? -5.553  -8.560  -14.642 1.00 0.00 ? 118 GLY A H    6  
ATOM 8748  H HA2  . GLY A 1 95  ? -7.766  -7.792  -16.367 1.00 0.00 ? 118 GLY A HA2  6  
ATOM 8749  H HA3  . GLY A 1 95  ? -7.583  -9.298  -15.468 1.00 0.00 ? 118 GLY A HA3  6  
ATOM 8750  N N    . GLU A 1 96  ? -8.091  -6.889  -13.408 1.00 0.00 ? 119 GLU A N    6  
ATOM 8751  C CA   . GLU A 1 96  ? -8.945  -6.209  -12.450 1.00 0.00 ? 119 GLU A CA   6  
ATOM 8752  C C    . GLU A 1 96  ? -8.934  -4.712  -12.726 1.00 0.00 ? 119 GLU A C    6  
ATOM 8753  O O    . GLU A 1 96  ? -9.978  -4.073  -12.643 1.00 0.00 ? 119 GLU A O    6  
ATOM 8754  C CB   . GLU A 1 96  ? -8.558  -6.647  -11.034 1.00 0.00 ? 119 GLU A CB   6  
ATOM 8755  C CG   . GLU A 1 96  ? -8.912  -5.636  -9.943  1.00 0.00 ? 119 GLU A CG   6  
ATOM 8756  C CD   . GLU A 1 96  ? -9.123  -6.328  -8.602  1.00 0.00 ? 119 GLU A CD   6  
ATOM 8757  O OE1  . GLU A 1 96  ? -8.158  -6.861  -8.011  1.00 0.00 ? 119 GLU A OE1  6  
ATOM 8758  O OE2  . GLU A 1 96  ? -10.287 -6.371  -8.138  1.00 0.00 ? 119 GLU A OE2  6  
ATOM 8759  H H    . GLU A 1 96  ? -7.115  -6.618  -13.367 1.00 0.00 ? 119 GLU A H    6  
ATOM 8760  H HA   . GLU A 1 96  ? -9.970  -6.504  -12.592 1.00 0.00 ? 119 GLU A HA   6  
ATOM 8761  H HB2  . GLU A 1 96  ? -9.056  -7.597  -10.831 1.00 0.00 ? 119 GLU A HB2  6  
ATOM 8762  H HB3  . GLU A 1 96  ? -7.488  -6.823  -10.995 1.00 0.00 ? 119 GLU A HB3  6  
ATOM 8763  H HG2  . GLU A 1 96  ? -8.106  -4.902  -9.888  1.00 0.00 ? 119 GLU A HG2  6  
ATOM 8764  H HG3  . GLU A 1 96  ? -9.837  -5.119  -10.190 1.00 0.00 ? 119 GLU A HG3  6  
ATOM 8765  N N    . PHE A 1 97  ? -7.801  -4.155  -13.144 1.00 0.00 ? 120 PHE A N    6  
ATOM 8766  C CA   . PHE A 1 97  ? -7.756  -2.786  -13.619 1.00 0.00 ? 120 PHE A CA   6  
ATOM 8767  C C    . PHE A 1 97  ? -8.319  -2.651  -15.044 1.00 0.00 ? 120 PHE A C    6  
ATOM 8768  O O    . PHE A 1 97  ? -9.368  -2.033  -15.234 1.00 0.00 ? 120 PHE A O    6  
ATOM 8769  C CB   . PHE A 1 97  ? -6.321  -2.296  -13.490 1.00 0.00 ? 120 PHE A CB   6  
ATOM 8770  C CG   . PHE A 1 97  ? -5.804  -2.276  -12.058 1.00 0.00 ? 120 PHE A CG   6  
ATOM 8771  C CD1  . PHE A 1 97  ? -6.445  -1.532  -11.040 1.00 0.00 ? 120 PHE A CD1  6  
ATOM 8772  C CD2  . PHE A 1 97  ? -4.660  -3.028  -11.735 1.00 0.00 ? 120 PHE A CD2  6  
ATOM 8773  C CE1  . PHE A 1 97  ? -5.829  -1.405  -9.782  1.00 0.00 ? 120 PHE A CE1  6  
ATOM 8774  C CE2  . PHE A 1 97  ? -4.108  -2.966  -10.444 1.00 0.00 ? 120 PHE A CE2  6  
ATOM 8775  C CZ   . PHE A 1 97  ? -4.659  -2.111  -9.482  1.00 0.00 ? 120 PHE A CZ   6  
ATOM 8776  H H    . PHE A 1 97  ? -6.935  -4.683  -13.073 1.00 0.00 ? 120 PHE A H    6  
ATOM 8777  H HA   . PHE A 1 97  ? -8.382  -2.173  -12.970 1.00 0.00 ? 120 PHE A HA   6  
ATOM 8778  H HB2  . PHE A 1 97  ? -5.674  -2.928  -14.101 1.00 0.00 ? 120 PHE A HB2  6  
ATOM 8779  H HB3  . PHE A 1 97  ? -6.264  -1.295  -13.907 1.00 0.00 ? 120 PHE A HB3  6  
ATOM 8780  H HD1  . PHE A 1 97  ? -7.418  -1.058  -11.165 1.00 0.00 ? 120 PHE A HD1  6  
ATOM 8781  H HD2  . PHE A 1 97  ? -4.217  -3.669  -12.482 1.00 0.00 ? 120 PHE A HD2  6  
ATOM 8782  H HE1  . PHE A 1 97  ? -6.265  -0.760  -9.034  1.00 0.00 ? 120 PHE A HE1  6  
ATOM 8783  H HE2  . PHE A 1 97  ? -3.242  -3.553  -10.201 1.00 0.00 ? 120 PHE A HE2  6  
ATOM 8784  H HZ   . PHE A 1 97  ? -4.209  -2.004  -8.506  1.00 0.00 ? 120 PHE A HZ   6  
ATOM 8785  N N    . GLN A 1 98  ? -7.653  -3.222  -16.057 1.00 0.00 ? 121 GLN A N    6  
ATOM 8786  C CA   . GLN A 1 98  ? -8.010  -3.086  -17.476 1.00 0.00 ? 121 GLN A CA   6  
ATOM 8787  C C    . GLN A 1 98  ? -9.080  -4.103  -17.909 1.00 0.00 ? 121 GLN A C    6  
ATOM 8788  O O    . GLN A 1 98  ? -9.121  -4.550  -19.062 1.00 0.00 ? 121 GLN A O    6  
ATOM 8789  C CB   . GLN A 1 98  ? -6.756  -3.150  -18.369 1.00 0.00 ? 121 GLN A CB   6  
ATOM 8790  C CG   . GLN A 1 98  ? -5.779  -2.009  -18.124 1.00 0.00 ? 121 GLN A CG   6  
ATOM 8791  C CD   . GLN A 1 98  ? -4.864  -1.760  -19.326 1.00 0.00 ? 121 GLN A CD   6  
ATOM 8792  O OE1  . GLN A 1 98  ? -4.198  -2.662  -19.831 1.00 0.00 ? 121 GLN A OE1  6  
ATOM 8793  N NE2  . GLN A 1 98  ? -4.795  -0.543  -19.838 1.00 0.00 ? 121 GLN A NE2  6  
ATOM 8794  H H    . GLN A 1 98  ? -6.902  -3.868  -15.832 1.00 0.00 ? 121 GLN A H    6  
ATOM 8795  H HA   . GLN A 1 98  ? -8.461  -2.103  -17.616 1.00 0.00 ? 121 GLN A HA   6  
ATOM 8796  H HB2  . GLN A 1 98  ? -6.216  -4.059  -18.176 1.00 0.00 ? 121 GLN A HB2  6  
ATOM 8797  H HB3  . GLN A 1 98  ? -7.061  -3.121  -19.416 1.00 0.00 ? 121 GLN A HB3  6  
ATOM 8798  H HG2  . GLN A 1 98  ? -6.379  -1.139  -17.932 1.00 0.00 ? 121 GLN A HG2  6  
ATOM 8799  H HG3  . GLN A 1 98  ? -5.182  -2.226  -17.240 1.00 0.00 ? 121 GLN A HG3  6  
ATOM 8800  H HE21 . GLN A 1 98  ? -5.328  0.242   -19.486 1.00 0.00 ? 121 GLN A HE21 6  
ATOM 8801  H HE22 . GLN A 1 98  ? -4.230  -0.420  -20.666 1.00 0.00 ? 121 GLN A HE22 6  
ATOM 8802  N N    . LYS A 1 99  ? -9.966  -4.479  -16.989 1.00 0.00 ? 122 LYS A N    6  
ATOM 8803  C CA   . LYS A 1 99  ? -11.240 -5.106  -17.322 1.00 0.00 ? 122 LYS A CA   6  
ATOM 8804  C C    . LYS A 1 99  ? -12.112 -4.105  -18.109 1.00 0.00 ? 122 LYS A C    6  
ATOM 8805  O O    . LYS A 1 99  ? -11.829 -2.906  -18.087 1.00 0.00 ? 122 LYS A O    6  
ATOM 8806  C CB   . LYS A 1 99  ? -11.907 -5.562  -16.015 1.00 0.00 ? 122 LYS A CB   6  
ATOM 8807  C CG   . LYS A 1 99  ? -12.236 -4.377  -15.105 1.00 0.00 ? 122 LYS A CG   6  
ATOM 8808  C CD   . LYS A 1 99  ? -13.186 -4.734  -13.971 1.00 0.00 ? 122 LYS A CD   6  
ATOM 8809  C CE   . LYS A 1 99  ? -12.655 -5.797  -13.011 1.00 0.00 ? 122 LYS A CE   6  
ATOM 8810  N NZ   . LYS A 1 99  ? -13.540 -5.924  -11.842 1.00 0.00 ? 122 LYS A NZ   6  
ATOM 8811  H H    . LYS A 1 99  ? -9.899  -4.003  -16.100 1.00 0.00 ? 122 LYS A H    6  
ATOM 8812  H HA   . LYS A 1 99  ? -11.045 -5.979  -17.947 1.00 0.00 ? 122 LYS A HA   6  
ATOM 8813  H HB2  . LYS A 1 99  ? -12.819 -6.107  -16.241 1.00 0.00 ? 122 LYS A HB2  6  
ATOM 8814  H HB3  . LYS A 1 99  ? -11.240 -6.232  -15.483 1.00 0.00 ? 122 LYS A HB3  6  
ATOM 8815  H HG2  . LYS A 1 99  ? -11.324 -3.941  -14.708 1.00 0.00 ? 122 LYS A HG2  6  
ATOM 8816  H HG3  . LYS A 1 99  ? -12.738 -3.627  -15.703 1.00 0.00 ? 122 LYS A HG3  6  
ATOM 8817  H HD2  . LYS A 1 99  ? -13.398 -3.833  -13.400 1.00 0.00 ? 122 LYS A HD2  6  
ATOM 8818  H HD3  . LYS A 1 99  ? -14.108 -5.075  -14.429 1.00 0.00 ? 122 LYS A HD3  6  
ATOM 8819  H HE2  . LYS A 1 99  ? -12.578 -6.754  -13.529 1.00 0.00 ? 122 LYS A HE2  6  
ATOM 8820  H HE3  . LYS A 1 99  ? -11.670 -5.493  -12.663 1.00 0.00 ? 122 LYS A HE3  6  
ATOM 8821  H HZ1  . LYS A 1 99  ? -14.502 -6.081  -12.129 1.00 0.00 ? 122 LYS A HZ1  6  
ATOM 8822  H HZ2  . LYS A 1 99  ? -13.254 -6.678  -11.226 1.00 0.00 ? 122 LYS A HZ2  6  
ATOM 8823  H HZ3  . LYS A 1 99  ? -13.523 -5.068  -11.292 1.00 0.00 ? 122 LYS A HZ3  6  
ATOM 8824  N N    . PRO A 1 100 ? -13.198 -4.543  -18.760 1.00 0.00 ? 123 PRO A N    6  
ATOM 8825  C CA   . PRO A 1 100 ? -14.058 -3.676  -19.566 1.00 0.00 ? 123 PRO A CA   6  
ATOM 8826  C C    . PRO A 1 100 ? -15.256 -3.091  -18.803 1.00 0.00 ? 123 PRO A C    6  
ATOM 8827  O O    . PRO A 1 100 ? -16.089 -2.427  -19.415 1.00 0.00 ? 123 PRO A O    6  
ATOM 8828  C CB   . PRO A 1 100 ? -14.545 -4.599  -20.677 1.00 0.00 ? 123 PRO A CB   6  
ATOM 8829  C CG   . PRO A 1 100 ? -14.733 -5.913  -19.927 1.00 0.00 ? 123 PRO A CG   6  
ATOM 8830  C CD   . PRO A 1 100 ? -13.540 -5.937  -18.987 1.00 0.00 ? 123 PRO A CD   6  
ATOM 8831  H HA   . PRO A 1 100 ? -13.490 -2.860  -20.008 1.00 0.00 ? 123 PRO A HA   6  
ATOM 8832  H HB2  . PRO A 1 100 ? -15.470 -4.257  -21.141 1.00 0.00 ? 123 PRO A HB2  6  
ATOM 8833  H HB3  . PRO A 1 100 ? -13.756 -4.705  -21.423 1.00 0.00 ? 123 PRO A HB3  6  
ATOM 8834  H HG2  . PRO A 1 100 ? -15.655 -5.886  -19.347 1.00 0.00 ? 123 PRO A HG2  6  
ATOM 8835  H HG3  . PRO A 1 100 ? -14.716 -6.760  -20.602 1.00 0.00 ? 123 PRO A HG3  6  
ATOM 8836  H HD2  . PRO A 1 100 ? -13.809 -6.455  -18.069 1.00 0.00 ? 123 PRO A HD2  6  
ATOM 8837  H HD3  . PRO A 1 100 ? -12.702 -6.428  -19.475 1.00 0.00 ? 123 PRO A HD3  6  
ATOM 8838  N N    . ASP A 1 101 ? -15.407 -3.379  -17.509 1.00 0.00 ? 124 ASP A N    6  
ATOM 8839  C CA   . ASP A 1 101 ? -16.646 -3.173  -16.760 1.00 0.00 ? 124 ASP A CA   6  
ATOM 8840  C C    . ASP A 1 101 ? -16.261 -2.636  -15.388 1.00 0.00 ? 124 ASP A C    6  
ATOM 8841  O O    . ASP A 1 101 ? -16.169 -3.374  -14.400 1.00 0.00 ? 124 ASP A O    6  
ATOM 8842  C CB   . ASP A 1 101 ? -17.423 -4.497  -16.702 1.00 0.00 ? 124 ASP A CB   6  
ATOM 8843  C CG   . ASP A 1 101 ? -18.856 -4.304  -16.207 1.00 0.00 ? 124 ASP A CG   6  
ATOM 8844  O OD1  . ASP A 1 101 ? -19.087 -3.912  -15.050 1.00 0.00 ? 124 ASP A OD1  6  
ATOM 8845  O OD2  . ASP A 1 101 ? -19.778 -4.651  -16.993 1.00 0.00 ? 124 ASP A OD2  6  
ATOM 8846  H H    . ASP A 1 101 ? -14.672 -3.855  -17.019 1.00 0.00 ? 124 ASP A H    6  
ATOM 8847  H HA   . ASP A 1 101 ? -17.276 -2.435  -17.263 1.00 0.00 ? 124 ASP A HA   6  
ATOM 8848  H HB2  . ASP A 1 101 ? -17.461 -4.922  -17.706 1.00 0.00 ? 124 ASP A HB2  6  
ATOM 8849  H HB3  . ASP A 1 101 ? -16.908 -5.216  -16.062 1.00 0.00 ? 124 ASP A HB3  6  
ATOM 8850  N N    . ASN A 1 102 ? -15.870 -1.362  -15.365 1.00 0.00 ? 125 ASN A N    6  
ATOM 8851  C CA   . ASN A 1 102 ? -15.110 -0.759  -14.272 1.00 0.00 ? 125 ASN A CA   6  
ATOM 8852  C C    . ASN A 1 102 ? -15.482 0.676   -13.902 1.00 0.00 ? 125 ASN A C    6  
ATOM 8853  O O    . ASN A 1 102 ? -14.806 1.206   -13.017 1.00 0.00 ? 125 ASN A O    6  
ATOM 8854  C CB   . ASN A 1 102 ? -13.593 -0.898  -14.509 1.00 0.00 ? 125 ASN A CB   6  
ATOM 8855  C CG   . ASN A 1 102 ? -13.072 -0.277  -15.796 1.00 0.00 ? 125 ASN A CG   6  
ATOM 8856  O OD1  . ASN A 1 102 ? -13.794 0.430   -16.489 1.00 0.00 ? 125 ASN A OD1  6  
ATOM 8857  N ND2  . ASN A 1 102 ? -11.820 -0.533  -16.143 1.00 0.00 ? 125 ASN A ND2  6  
ATOM 8858  H H    . ASN A 1 102 ? -15.933 -0.845  -16.237 1.00 0.00 ? 125 ASN A H    6  
ATOM 8859  H HA   . ASN A 1 102 ? -15.330 -1.330  -13.383 1.00 0.00 ? 125 ASN A HA   6  
ATOM 8860  H HB2  . ASN A 1 102 ? -13.055 -0.469  -13.667 1.00 0.00 ? 125 ASN A HB2  6  
ATOM 8861  H HB3  . ASN A 1 102 ? -13.359 -1.949  -14.520 1.00 0.00 ? 125 ASN A HB3  6  
ATOM 8862  H HD21 . ASN A 1 102 ? -11.186 -1.117  -15.600 1.00 0.00 ? 125 ASN A HD21 6  
ATOM 8863  H HD22 . ASN A 1 102 ? -11.483 -0.163  -17.020 1.00 0.00 ? 125 ASN A HD22 6  
ATOM 8864  N N    . LYS A 1 103 ? -16.533 1.293   -14.475 1.00 0.00 ? 126 LYS A N    6  
ATOM 8865  C CA   . LYS A 1 103 ? -16.862 2.736   -14.412 1.00 0.00 ? 126 LYS A CA   6  
ATOM 8866  C C    . LYS A 1 103 ? -16.203 3.466   -13.265 1.00 0.00 ? 126 LYS A C    6  
ATOM 8867  O O    . LYS A 1 103 ? -15.327 4.307   -13.511 1.00 0.00 ? 126 LYS A O    6  
ATOM 8868  C CB   . LYS A 1 103 ? -18.383 3.021   -14.360 1.00 0.00 ? 126 LYS A CB   6  
ATOM 8869  C CG   . LYS A 1 103 ? -18.731 4.477   -14.748 1.00 0.00 ? 126 LYS A CG   6  
ATOM 8870  C CD   . LYS A 1 103 ? -18.514 5.613   -13.717 1.00 0.00 ? 126 LYS A CD   6  
ATOM 8871  C CE   . LYS A 1 103 ? -18.872 6.913   -14.459 1.00 0.00 ? 126 LYS A CE   6  
ATOM 8872  N NZ   . LYS A 1 103 ? -19.073 8.102   -13.603 1.00 0.00 ? 126 LYS A NZ   6  
ATOM 8873  H H    . LYS A 1 103 ? -16.982 0.777   -15.229 1.00 0.00 ? 126 LYS A H    6  
ATOM 8874  H HA   . LYS A 1 103 ? -16.478 3.167   -15.338 1.00 0.00 ? 126 LYS A HA   6  
ATOM 8875  H HB2  . LYS A 1 103 ? -18.875 2.389   -15.087 1.00 0.00 ? 126 LYS A HB2  6  
ATOM 8876  H HB3  . LYS A 1 103 ? -18.818 2.771   -13.383 1.00 0.00 ? 126 LYS A HB3  6  
ATOM 8877  H HG2  . LYS A 1 103 ? -18.189 4.724   -15.662 1.00 0.00 ? 126 LYS A HG2  6  
ATOM 8878  H HG3  . LYS A 1 103 ? -19.793 4.485   -15.002 1.00 0.00 ? 126 LYS A HG3  6  
ATOM 8879  H HD2  . LYS A 1 103 ? -19.188 5.450   -12.876 1.00 0.00 ? 126 LYS A HD2  6  
ATOM 8880  H HD3  . LYS A 1 103 ? -17.483 5.676   -13.349 1.00 0.00 ? 126 LYS A HD3  6  
ATOM 8881  H HE2  . LYS A 1 103 ? -18.098 7.126   -15.198 1.00 0.00 ? 126 LYS A HE2  6  
ATOM 8882  H HE3  . LYS A 1 103 ? -19.807 6.737   -14.994 1.00 0.00 ? 126 LYS A HE3  6  
ATOM 8883  H HZ1  . LYS A 1 103 ? -18.218 8.461   -13.197 1.00 0.00 ? 126 LYS A HZ1  6  
ATOM 8884  H HZ2  . LYS A 1 103 ? -19.491 8.840   -14.168 1.00 0.00 ? 126 LYS A HZ2  6  
ATOM 8885  H HZ3  . LYS A 1 103 ? -19.739 7.899   -12.864 1.00 0.00 ? 126 LYS A HZ3  6  
ATOM 8886  N N    . LEU A 1 104 ? -16.690 3.221   -12.046 1.00 0.00 ? 127 LEU A N    6  
ATOM 8887  C CA   . LEU A 1 104 ? -16.256 3.963   -10.878 1.00 0.00 ? 127 LEU A CA   6  
ATOM 8888  C C    . LEU A 1 104 ? -15.358 3.098   -10.017 1.00 0.00 ? 127 LEU A C    6  
ATOM 8889  O O    . LEU A 1 104 ? -14.608 3.646   -9.226  1.00 0.00 ? 127 LEU A O    6  
ATOM 8890  C CB   . LEU A 1 104 ? -17.436 4.522   -10.033 1.00 0.00 ? 127 LEU A CB   6  
ATOM 8891  C CG   . LEU A 1 104 ? -17.227 5.861   -9.399  1.00 0.00 ? 127 LEU A CG   6  
ATOM 8892  C CD1  . LEU A 1 104 ? -17.901 7.040   -10.109 1.00 0.00 ? 127 LEU A CD1  6  
ATOM 8893  C CD2  . LEU A 1 104 ? -17.517 5.999   -7.918  1.00 0.00 ? 127 LEU A CD2  6  
ATOM 8894  H H    . LEU A 1 104 ? -17.280 2.403   -11.929 1.00 0.00 ? 127 LEU A H    6  
ATOM 8895  H HA   . LEU A 1 104 ? -15.677 4.805   -11.227 1.00 0.00 ? 127 LEU A HA   6  
ATOM 8896  H HB2  . LEU A 1 104 ? -18.242 4.714   -10.671 1.00 0.00 ? 127 LEU A HB2  6  
ATOM 8897  H HB3  . LEU A 1 104 ? -17.633 3.848   -9.226  1.00 0.00 ? 127 LEU A HB3  6  
ATOM 8898  H HG   . LEU A 1 104 ? -16.204 5.875   -9.549  1.00 0.00 ? 127 LEU A HG   6  
ATOM 8899  H HD11 . LEU A 1 104 ? -18.944 7.084   -9.798  1.00 0.00 ? 127 LEU A HD11 6  
ATOM 8900  H HD12 . LEU A 1 104 ? -17.421 7.969   -9.793  1.00 0.00 ? 127 LEU A HD12 6  
ATOM 8901  H HD13 . LEU A 1 104 ? -17.828 6.915   -11.186 1.00 0.00 ? 127 LEU A HD13 6  
ATOM 8902  H HD21 . LEU A 1 104 ? -17.128 6.960   -7.563  1.00 0.00 ? 127 LEU A HD21 6  
ATOM 8903  H HD22 . LEU A 1 104 ? -18.587 5.965   -7.752  1.00 0.00 ? 127 LEU A HD22 6  
ATOM 8904  H HD23 . LEU A 1 104 ? -17.026 5.191   -7.379  1.00 0.00 ? 127 LEU A HD23 6  
ATOM 8905  N N    . HIS A 1 105 ? -15.384 1.774   -10.178 1.00 0.00 ? 128 HIS A N    6  
ATOM 8906  C CA   . HIS A 1 105 ? -14.550 0.890   -9.389  1.00 0.00 ? 128 HIS A CA   6  
ATOM 8907  C C    . HIS A 1 105 ? -13.078 1.147   -9.715  1.00 0.00 ? 128 HIS A C    6  
ATOM 8908  O O    . HIS A 1 105 ? -12.299 1.248   -8.775  1.00 0.00 ? 128 HIS A O    6  
ATOM 8909  C CB   . HIS A 1 105 ? -15.024 -0.570  -9.513  1.00 0.00 ? 128 HIS A CB   6  
ATOM 8910  C CG   . HIS A 1 105 ? -13.966 -1.617  -9.736  1.00 0.00 ? 128 HIS A CG   6  
ATOM 8911  N ND1  . HIS A 1 105 ? -13.104 -2.168  -8.809  1.00 0.00 ? 128 HIS A ND1  6  
ATOM 8912  C CD2  . HIS A 1 105 ? -13.814 -2.304  -10.904 1.00 0.00 ? 128 HIS A CD2  6  
ATOM 8913  C CE1  . HIS A 1 105 ? -12.447 -3.171  -9.423  1.00 0.00 ? 128 HIS A CE1  6  
ATOM 8914  N NE2  . HIS A 1 105 ? -12.843 -3.286  -10.702 1.00 0.00 ? 128 HIS A NE2  6  
ATOM 8915  H H    . HIS A 1 105 ? -15.933 1.368   -10.920 1.00 0.00 ? 128 HIS A H    6  
ATOM 8916  H HA   . HIS A 1 105 ? -14.692 1.185   -8.351  1.00 0.00 ? 128 HIS A HA   6  
ATOM 8917  H HB2  . HIS A 1 105 ? -15.573 -0.835  -8.608  1.00 0.00 ? 128 HIS A HB2  6  
ATOM 8918  H HB3  . HIS A 1 105 ? -15.731 -0.648  -10.340 1.00 0.00 ? 128 HIS A HB3  6  
ATOM 8919  H HD1  . HIS A 1 105 ? -12.998 -1.924  -7.832  1.00 0.00 ? 128 HIS A HD1  6  
ATOM 8920  H HD2  . HIS A 1 105 ? -14.401 -2.119  -11.789 1.00 0.00 ? 128 HIS A HD2  6  
ATOM 8921  H HE1  . HIS A 1 105 ? -11.715 -3.816  -8.950  1.00 0.00 ? 128 HIS A HE1  6  
ATOM 8922  N N    . GLN A 1 106 ? -12.699 1.373   -10.983 1.00 0.00 ? 129 GLN A N    6  
ATOM 8923  C CA   . GLN A 1 106 ? -11.346 1.837   -11.297 1.00 0.00 ? 129 GLN A CA   6  
ATOM 8924  C C    . GLN A 1 106 ? -11.065 3.229   -10.733 1.00 0.00 ? 129 GLN A C    6  
ATOM 8925  O O    . GLN A 1 106 ? -9.979  3.468   -10.207 1.00 0.00 ? 129 GLN A O    6  
ATOM 8926  C CB   . GLN A 1 106 ? -10.988 1.730   -12.772 1.00 0.00 ? 129 GLN A CB   6  
ATOM 8927  C CG   . GLN A 1 106 ? -11.685 2.722   -13.676 1.00 0.00 ? 129 GLN A CG   6  
ATOM 8928  C CD   . GLN A 1 106 ? -11.287 2.539   -15.138 1.00 0.00 ? 129 GLN A CD   6  
ATOM 8929  O OE1  . GLN A 1 106 ? -10.173 2.113   -15.449 1.00 0.00 ? 129 GLN A OE1  6  
ATOM 8930  N NE2  . GLN A 1 106 ? -12.187 2.844   -16.056 1.00 0.00 ? 129 GLN A NE2  6  
ATOM 8931  H H    . GLN A 1 106 ? -13.387 1.297   -11.723 1.00 0.00 ? 129 GLN A H    6  
ATOM 8932  H HA   . GLN A 1 106 ? -10.645 1.171   -10.837 1.00 0.00 ? 129 GLN A HA   6  
ATOM 8933  H HB2  . GLN A 1 106 ? -9.929  1.964   -12.839 1.00 0.00 ? 129 GLN A HB2  6  
ATOM 8934  H HB3  . GLN A 1 106 ? -11.167 0.717   -13.121 1.00 0.00 ? 129 GLN A HB3  6  
ATOM 8935  H HG2  . GLN A 1 106 ? -12.758 2.633   -13.556 1.00 0.00 ? 129 GLN A HG2  6  
ATOM 8936  H HG3  . GLN A 1 106 ? -11.353 3.690   -13.330 1.00 0.00 ? 129 GLN A HG3  6  
ATOM 8937  H HE21 . GLN A 1 106 ? -13.132 3.077   -15.803 1.00 0.00 ? 129 GLN A HE21 6  
ATOM 8938  H HE22 . GLN A 1 106 ? -11.980 2.702   -17.034 1.00 0.00 ? 129 GLN A HE22 6  
ATOM 8939  N N    . GLN A 1 107 ? -12.038 4.141   -10.833 1.00 0.00 ? 130 GLN A N    6  
ATOM 8940  C CA   . GLN A 1 107 ? -11.847 5.518   -10.407 1.00 0.00 ? 130 GLN A CA   6  
ATOM 8941  C C    . GLN A 1 107 ? -11.557 5.567   -8.895  1.00 0.00 ? 130 GLN A C    6  
ATOM 8942  O O    . GLN A 1 107 ? -10.622 6.240   -8.461  1.00 0.00 ? 130 GLN A O    6  
ATOM 8943  C CB   . GLN A 1 107 ? -13.071 6.377   -10.798 1.00 0.00 ? 130 GLN A CB   6  
ATOM 8944  C CG   . GLN A 1 107 ? -13.150 6.664   -12.307 1.00 0.00 ? 130 GLN A CG   6  
ATOM 8945  C CD   . GLN A 1 107 ? -14.328 7.567   -12.707 1.00 0.00 ? 130 GLN A CD   6  
ATOM 8946  O OE1  . GLN A 1 107 ? -14.475 7.948   -13.868 1.00 0.00 ? 130 GLN A OE1  6  
ATOM 8947  N NE2  . GLN A 1 107 ? -15.210 7.951   -11.797 1.00 0.00 ? 130 GLN A NE2  6  
ATOM 8948  H H    . GLN A 1 107 ? -12.895 3.880   -11.291 1.00 0.00 ? 130 GLN A H    6  
ATOM 8949  H HA   . GLN A 1 107 ? -10.958 5.875   -10.934 1.00 0.00 ? 130 GLN A HA   6  
ATOM 8950  H HB2  . GLN A 1 107 ? -14.006 5.887   -10.513 1.00 0.00 ? 130 GLN A HB2  6  
ATOM 8951  H HB3  . GLN A 1 107 ? -12.997 7.330   -10.269 1.00 0.00 ? 130 GLN A HB3  6  
ATOM 8952  H HG2  . GLN A 1 107 ? -12.222 7.141   -12.618 1.00 0.00 ? 130 GLN A HG2  6  
ATOM 8953  H HG3  . GLN A 1 107 ? -13.233 5.722   -12.847 1.00 0.00 ? 130 GLN A HG3  6  
ATOM 8954  H HE21 . GLN A 1 107 ? -15.081 7.684   -10.833 1.00 0.00 ? 130 GLN A HE21 6  
ATOM 8955  H HE22 . GLN A 1 107 ? -15.950 8.611   -12.016 1.00 0.00 ? 130 GLN A HE22 6  
ATOM 8956  N N    . VAL A 1 108 ? -12.320 4.805   -8.108  1.00 0.00 ? 131 VAL A N    6  
ATOM 8957  C CA   . VAL A 1 108 ? -12.088 4.557   -6.692  1.00 0.00 ? 131 VAL A CA   6  
ATOM 8958  C C    . VAL A 1 108 ? -10.729 3.887   -6.519  1.00 0.00 ? 131 VAL A C    6  
ATOM 8959  O O    . VAL A 1 108 ? -9.961  4.325   -5.669  1.00 0.00 ? 131 VAL A O    6  
ATOM 8960  C CB   . VAL A 1 108 ? -13.225 3.676   -6.128  1.00 0.00 ? 131 VAL A CB   6  
ATOM 8961  C CG1  . VAL A 1 108 ? -13.007 3.195   -4.685  1.00 0.00 ? 131 VAL A CG1  6  
ATOM 8962  C CG2  . VAL A 1 108 ? -14.560 4.427   -6.120  1.00 0.00 ? 131 VAL A CG2  6  
ATOM 8963  H H    . VAL A 1 108 ? -13.083 4.299   -8.539  1.00 0.00 ? 131 VAL A H    6  
ATOM 8964  H HA   . VAL A 1 108 ? -12.073 5.513   -6.167  1.00 0.00 ? 131 VAL A HA   6  
ATOM 8965  H HB   . VAL A 1 108 ? -13.333 2.795   -6.761  1.00 0.00 ? 131 VAL A HB   6  
ATOM 8966  H HG11 . VAL A 1 108 ? -13.060 4.034   -3.993  1.00 0.00 ? 131 VAL A HG11 6  
ATOM 8967  H HG12 . VAL A 1 108 ? -13.794 2.494   -4.431  1.00 0.00 ? 131 VAL A HG12 6  
ATOM 8968  H HG13 . VAL A 1 108 ? -12.046 2.693   -4.567  1.00 0.00 ? 131 VAL A HG13 6  
ATOM 8969  H HG21 . VAL A 1 108 ? -14.507 5.231   -5.383  1.00 0.00 ? 131 VAL A HG21 6  
ATOM 8970  H HG22 . VAL A 1 108 ? -14.784 4.847   -7.097  1.00 0.00 ? 131 VAL A HG22 6  
ATOM 8971  H HG23 . VAL A 1 108 ? -15.356 3.736   -5.853  1.00 0.00 ? 131 VAL A HG23 6  
ATOM 8972  N N    . LEU A 1 109 ? -10.445 2.814   -7.273  1.00 0.00 ? 132 LEU A N    6  
ATOM 8973  C CA   . LEU A 1 109 ? -9.276  1.957   -7.077  1.00 0.00 ? 132 LEU A CA   6  
ATOM 8974  C C    . LEU A 1 109 ? -8.004  2.785   -7.076  1.00 0.00 ? 132 LEU A C    6  
ATOM 8975  O O    . LEU A 1 109 ? -7.136  2.535   -6.250  1.00 0.00 ? 132 LEU A O    6  
ATOM 8976  C CB   . LEU A 1 109 ? -9.157  0.861   -8.164  1.00 0.00 ? 132 LEU A CB   6  
ATOM 8977  C CG   . LEU A 1 109 ? -9.368  -0.584  -7.690  1.00 0.00 ? 132 LEU A CG   6  
ATOM 8978  C CD1  . LEU A 1 109 ? -9.296  -1.598  -8.825  1.00 0.00 ? 132 LEU A CD1  6  
ATOM 8979  C CD2  . LEU A 1 109 ? -8.355  -0.972  -6.610  1.00 0.00 ? 132 LEU A CD2  6  
ATOM 8980  H H    . LEU A 1 109 ? -11.119 2.510   -7.968  1.00 0.00 ? 132 LEU A H    6  
ATOM 8981  H HA   . LEU A 1 109 ? -9.380  1.504   -6.090  1.00 0.00 ? 132 LEU A HA   6  
ATOM 8982  H HB2  . LEU A 1 109 ? -9.878  1.066   -8.939  1.00 0.00 ? 132 LEU A HB2  6  
ATOM 8983  H HB3  . LEU A 1 109 ? -8.174  0.917   -8.629  1.00 0.00 ? 132 LEU A HB3  6  
ATOM 8984  H HG   . LEU A 1 109 ? -10.368 -0.674  -7.317  1.00 0.00 ? 132 LEU A HG   6  
ATOM 8985  H HD11 . LEU A 1 109 ? -9.929  -1.284  -9.656  1.00 0.00 ? 132 LEU A HD11 6  
ATOM 8986  H HD12 . LEU A 1 109 ? -8.274  -1.699  -9.155  1.00 0.00 ? 132 LEU A HD12 6  
ATOM 8987  H HD13 . LEU A 1 109 ? -9.635  -2.571  -8.469  1.00 0.00 ? 132 LEU A HD13 6  
ATOM 8988  H HD21 . LEU A 1 109 ? -7.356  -0.756  -6.984  1.00 0.00 ? 132 LEU A HD21 6  
ATOM 8989  H HD22 . LEU A 1 109 ? -8.514  -0.402  -5.699  1.00 0.00 ? 132 LEU A HD22 6  
ATOM 8990  H HD23 . LEU A 1 109 ? -8.444  -2.032  -6.373  1.00 0.00 ? 132 LEU A HD23 6  
ATOM 8991  N N    . TRP A 1 110 ? -7.893  3.783   -7.952  1.00 0.00 ? 133 TRP A N    6  
ATOM 8992  C CA   . TRP A 1 110 ? -6.721  4.636   -7.971  1.00 0.00 ? 133 TRP A CA   6  
ATOM 8993  C C    . TRP A 1 110 ? -6.521  5.366   -6.647  1.00 0.00 ? 133 TRP A C    6  
ATOM 8994  O O    . TRP A 1 110 ? -5.462  5.232   -6.040  1.00 0.00 ? 133 TRP A O    6  
ATOM 8995  C CB   . TRP A 1 110 ? -6.786  5.600   -9.151  1.00 0.00 ? 133 TRP A CB   6  
ATOM 8996  C CG   . TRP A 1 110 ? -6.404  4.984   -10.458 1.00 0.00 ? 133 TRP A CG   6  
ATOM 8997  C CD1  . TRP A 1 110 ? -7.197  4.894   -11.544 1.00 0.00 ? 133 TRP A CD1  6  
ATOM 8998  C CD2  . TRP A 1 110 ? -5.158  4.314   -10.819 1.00 0.00 ? 133 TRP A CD2  6  
ATOM 8999  N NE1  . TRP A 1 110 ? -6.483  4.343   -12.588 1.00 0.00 ? 133 TRP A NE1  6  
ATOM 9000  C CE2  . TRP A 1 110 ? -5.198  4.017   -12.213 1.00 0.00 ? 133 TRP A CE2  6  
ATOM 9001  C CE3  . TRP A 1 110 ? -4.033  3.842   -10.103 1.00 0.00 ? 133 TRP A CE3  6  
ATOM 9002  C CZ2  . TRP A 1 110 ? -4.122  3.425   -12.888 1.00 0.00 ? 133 TRP A CZ2  6  
ATOM 9003  C CZ3  . TRP A 1 110 ? -2.959  3.236   -10.778 1.00 0.00 ? 133 TRP A CZ3  6  
ATOM 9004  C CH2  . TRP A 1 110 ? -2.981  3.049   -12.167 1.00 0.00 ? 133 TRP A CH2  6  
ATOM 9005  H H    . TRP A 1 110 ? -8.610  3.894   -8.661  1.00 0.00 ? 133 TRP A H    6  
ATOM 9006  H HA   . TRP A 1 110 ? -5.864  3.980   -8.091  1.00 0.00 ? 133 TRP A HA   6  
ATOM 9007  H HB2  . TRP A 1 110 ? -7.787  6.029   -9.219  1.00 0.00 ? 133 TRP A HB2  6  
ATOM 9008  H HB3  . TRP A 1 110 ? -6.094  6.422   -8.966  1.00 0.00 ? 133 TRP A HB3  6  
ATOM 9009  H HD1  . TRP A 1 110 ? -8.230  5.219   -11.588 1.00 0.00 ? 133 TRP A HD1  6  
ATOM 9010  H HE1  . TRP A 1 110 ? -6.906  4.075   -13.479 1.00 0.00 ? 133 TRP A HE1  6  
ATOM 9011  H HE3  . TRP A 1 110 ? -4.009  3.877   -9.020  1.00 0.00 ? 133 TRP A HE3  6  
ATOM 9012  H HZ2  . TRP A 1 110 ? -4.174  3.226   -13.945 1.00 0.00 ? 133 TRP A HZ2  6  
ATOM 9013  H HZ3  . TRP A 1 110 ? -2.110  2.890   -10.225 1.00 0.00 ? 133 TRP A HZ3  6  
ATOM 9014  H HH2  . TRP A 1 110 ? -2.147  2.574   -12.669 1.00 0.00 ? 133 TRP A HH2  6  
ATOM 9015  N N    . ARG A 1 111 ? -7.515  6.128   -6.185  1.00 0.00 ? 134 ARG A N    6  
ATOM 9016  C CA   . ARG A 1 111 ? -7.435  6.841   -4.908  1.00 0.00 ? 134 ARG A CA   6  
ATOM 9017  C C    . ARG A 1 111 ? -7.213  5.850   -3.761  1.00 0.00 ? 134 ARG A C    6  
ATOM 9018  O O    . ARG A 1 111 ? -6.404  6.134   -2.879  1.00 0.00 ? 134 ARG A O    6  
ATOM 9019  C CB   . ARG A 1 111 ? -8.707  7.697   -4.742  1.00 0.00 ? 134 ARG A CB   6  
ATOM 9020  C CG   . ARG A 1 111 ? -8.980  8.263   -3.337  1.00 0.00 ? 134 ARG A CG   6  
ATOM 9021  C CD   . ARG A 1 111 ? -7.996  9.368   -2.953  1.00 0.00 ? 134 ARG A CD   6  
ATOM 9022  N NE   . ARG A 1 111 ? -7.991  9.596   -1.500  1.00 0.00 ? 134 ARG A NE   6  
ATOM 9023  C CZ   . ARG A 1 111 ? -6.992  10.184  -0.840  1.00 0.00 ? 134 ARG A CZ   6  
ATOM 9024  N NH1  . ARG A 1 111 ? -6.170  11.008  -1.483  1.00 0.00 ? 134 ARG A NH1  6  
ATOM 9025  N NH2  . ARG A 1 111 ? -6.804  9.919   0.440   1.00 0.00 ? 134 ARG A NH2  6  
ATOM 9026  H H    . ARG A 1 111 ? -8.384  6.148   -6.704  1.00 0.00 ? 134 ARG A H    6  
ATOM 9027  H HA   . ARG A 1 111 ? -6.567  7.502   -4.944  1.00 0.00 ? 134 ARG A HA   6  
ATOM 9028  H HB2  . ARG A 1 111 ? -8.668  8.530   -5.431  1.00 0.00 ? 134 ARG A HB2  6  
ATOM 9029  H HB3  . ARG A 1 111 ? -9.560  7.110   -5.063  1.00 0.00 ? 134 ARG A HB3  6  
ATOM 9030  H HG2  . ARG A 1 111 ? -9.985  8.685   -3.316  1.00 0.00 ? 134 ARG A HG2  6  
ATOM 9031  H HG3  . ARG A 1 111 ? -8.940  7.462   -2.601  1.00 0.00 ? 134 ARG A HG3  6  
ATOM 9032  H HD2  . ARG A 1 111 ? -6.994  9.063   -3.252  1.00 0.00 ? 134 ARG A HD2  6  
ATOM 9033  H HD3  . ARG A 1 111 ? -8.254  10.285  -3.483  1.00 0.00 ? 134 ARG A HD3  6  
ATOM 9034  H HE   . ARG A 1 111 ? -8.728  9.145   -0.955  1.00 0.00 ? 134 ARG A HE   6  
ATOM 9035  H HH11 . ARG A 1 111 ? -6.393  11.284  -2.426  1.00 0.00 ? 134 ARG A HH11 6  
ATOM 9036  H HH12 . ARG A 1 111 ? -5.495  11.582  -0.978  1.00 0.00 ? 134 ARG A HH12 6  
ATOM 9037  H HH21 . ARG A 1 111 ? -7.439  9.343   0.982   1.00 0.00 ? 134 ARG A HH21 6  
ATOM 9038  H HH22 . ARG A 1 111 ? -5.886  10.055  0.876   1.00 0.00 ? 134 ARG A HH22 6  
ATOM 9039  N N    . LEU A 1 112 ? -7.910  4.709   -3.787  1.00 0.00 ? 135 LEU A N    6  
ATOM 9040  C CA   . LEU A 1 112 ? -7.821  3.630   -2.809  1.00 0.00 ? 135 LEU A CA   6  
ATOM 9041  C C    . LEU A 1 112 ? -6.362  3.176   -2.714  1.00 0.00 ? 135 LEU A C    6  
ATOM 9042  O O    . LEU A 1 112 ? -5.716  3.363   -1.688  1.00 0.00 ? 135 LEU A O    6  
ATOM 9043  C CB   . LEU A 1 112 ? -8.782  2.476   -3.201  1.00 0.00 ? 135 LEU A CB   6  
ATOM 9044  C CG   . LEU A 1 112 ? -9.188  1.510   -2.070  1.00 0.00 ? 135 LEU A CG   6  
ATOM 9045  C CD1  . LEU A 1 112 ? -8.017  0.864   -1.370  1.00 0.00 ? 135 LEU A CD1  6  
ATOM 9046  C CD2  . LEU A 1 112 ? -10.253 2.024   -1.141  1.00 0.00 ? 135 LEU A CD2  6  
ATOM 9047  H H    . LEU A 1 112 ? -8.540  4.574   -4.571  1.00 0.00 ? 135 LEU A H    6  
ATOM 9048  H HA   . LEU A 1 112 ? -8.121  4.028   -1.839  1.00 0.00 ? 135 LEU A HA   6  
ATOM 9049  H HB2  . LEU A 1 112 ? -9.695  2.881   -3.627  1.00 0.00 ? 135 LEU A HB2  6  
ATOM 9050  H HB3  . LEU A 1 112 ? -8.335  1.890   -3.999  1.00 0.00 ? 135 LEU A HB3  6  
ATOM 9051  H HG   . LEU A 1 112 ? -9.725  0.700   -2.485  1.00 0.00 ? 135 LEU A HG   6  
ATOM 9052  H HD11 . LEU A 1 112 ? -8.369  0.073   -0.705  1.00 0.00 ? 135 LEU A HD11 6  
ATOM 9053  H HD12 . LEU A 1 112 ? -7.352  0.435   -2.117  1.00 0.00 ? 135 LEU A HD12 6  
ATOM 9054  H HD13 . LEU A 1 112 ? -7.503  1.615   -0.789  1.00 0.00 ? 135 LEU A HD13 6  
ATOM 9055  H HD21 . LEU A 1 112 ? -10.453 1.247   -0.400  1.00 0.00 ? 135 LEU A HD21 6  
ATOM 9056  H HD22 . LEU A 1 112 ? -9.947  2.957   -0.684  1.00 0.00 ? 135 LEU A HD22 6  
ATOM 9057  H HD23 . LEU A 1 112 ? -11.161 2.168   -1.722  1.00 0.00 ? 135 LEU A HD23 6  
ATOM 9058  N N    . VAL A 1 113 ? -5.831  2.584   -3.784  1.00 0.00 ? 136 VAL A N    6  
ATOM 9059  C CA   . VAL A 1 113 ? -4.516  1.960   -3.791  1.00 0.00 ? 136 VAL A CA   6  
ATOM 9060  C C    . VAL A 1 113 ? -3.432  3.012   -3.529  1.00 0.00 ? 136 VAL A C    6  
ATOM 9061  O O    . VAL A 1 113 ? -2.457  2.692   -2.841  1.00 0.00 ? 136 VAL A O    6  
ATOM 9062  C CB   . VAL A 1 113 ? -4.321  1.133   -5.087  1.00 0.00 ? 136 VAL A CB   6  
ATOM 9063  C CG1  . VAL A 1 113 ? -2.973  0.403   -5.131  1.00 0.00 ? 136 VAL A CG1  6  
ATOM 9064  C CG2  . VAL A 1 113 ? -5.368  0.022   -5.202  1.00 0.00 ? 136 VAL A CG2  6  
ATOM 9065  H H    . VAL A 1 113 ? -6.375  2.522   -4.638  1.00 0.00 ? 136 VAL A H    6  
ATOM 9066  H HA   . VAL A 1 113 ? -4.486  1.265   -2.953  1.00 0.00 ? 136 VAL A HA   6  
ATOM 9067  H HB   . VAL A 1 113 ? -4.423  1.760   -5.974  1.00 0.00 ? 136 VAL A HB   6  
ATOM 9068  H HG11 . VAL A 1 113 ? -2.168  1.098   -5.346  1.00 0.00 ? 136 VAL A HG11 6  
ATOM 9069  H HG12 . VAL A 1 113 ? -2.783  -0.076  -4.175  1.00 0.00 ? 136 VAL A HG12 6  
ATOM 9070  H HG13 . VAL A 1 113 ? -2.980  -0.362  -5.904  1.00 0.00 ? 136 VAL A HG13 6  
ATOM 9071  H HG21 . VAL A 1 113 ? -5.265  -0.436  -6.185  1.00 0.00 ? 136 VAL A HG21 6  
ATOM 9072  H HG22 . VAL A 1 113 ? -5.224  -0.724  -4.423  1.00 0.00 ? 136 VAL A HG22 6  
ATOM 9073  H HG23 . VAL A 1 113 ? -6.369  0.431   -5.125  1.00 0.00 ? 136 VAL A HG23 6  
ATOM 9074  N N    . GLN A 1 114 ? -3.599  4.261   -3.997  1.00 0.00 ? 137 GLN A N    6  
ATOM 9075  C CA   . GLN A 1 114 ? -2.696  5.350   -3.638  1.00 0.00 ? 137 GLN A CA   6  
ATOM 9076  C C    . GLN A 1 114 ? -2.640  5.498   -2.122  1.00 0.00 ? 137 GLN A C    6  
ATOM 9077  O O    . GLN A 1 114 ? -1.551  5.454   -1.538  1.00 0.00 ? 137 GLN A O    6  
ATOM 9078  C CB   . GLN A 1 114 ? -3.079  6.691   -4.288  1.00 0.00 ? 137 GLN A CB   6  
ATOM 9079  C CG   . GLN A 1 114 ? -2.575  6.843   -5.731  1.00 0.00 ? 137 GLN A CG   6  
ATOM 9080  C CD   . GLN A 1 114 ? -2.790  8.266   -6.247  1.00 0.00 ? 137 GLN A CD   6  
ATOM 9081  O OE1  . GLN A 1 114 ? -3.858  8.854   -6.101  1.00 0.00 ? 137 GLN A OE1  6  
ATOM 9082  N NE2  . GLN A 1 114 ? -1.778  8.909   -6.809  1.00 0.00 ? 137 GLN A NE2  6  
ATOM 9083  H H    . GLN A 1 114 ? -4.406  4.478   -4.572  1.00 0.00 ? 137 GLN A H    6  
ATOM 9084  H HA   . GLN A 1 114 ? -1.699  5.090   -3.977  1.00 0.00 ? 137 GLN A HA   6  
ATOM 9085  H HB2  . GLN A 1 114 ? -4.158  6.833   -4.254  1.00 0.00 ? 137 GLN A HB2  6  
ATOM 9086  H HB3  . GLN A 1 114 ? -2.622  7.493   -3.706  1.00 0.00 ? 137 GLN A HB3  6  
ATOM 9087  H HG2  . GLN A 1 114 ? -1.512  6.609   -5.760  1.00 0.00 ? 137 GLN A HG2  6  
ATOM 9088  H HG3  . GLN A 1 114 ? -3.093  6.143   -6.383  1.00 0.00 ? 137 GLN A HG3  6  
ATOM 9089  H HE21 . GLN A 1 114 ? -0.840  8.513   -6.870  1.00 0.00 ? 137 GLN A HE21 6  
ATOM 9090  H HE22 . GLN A 1 114 ? -1.940  9.839   -7.191  1.00 0.00 ? 137 GLN A HE22 6  
ATOM 9091  N N    . GLU A 1 115 ? -3.795  5.700   -1.478  1.00 0.00 ? 138 GLU A N    6  
ATOM 9092  C CA   . GLU A 1 115 ? -3.794  5.930   -0.043  1.00 0.00 ? 138 GLU A CA   6  
ATOM 9093  C C    . GLU A 1 115 ? -3.243  4.721   0.704   1.00 0.00 ? 138 GLU A C    6  
ATOM 9094  O O    . GLU A 1 115 ? -2.551  4.903   1.688   1.00 0.00 ? 138 GLU A O    6  
ATOM 9095  C CB   . GLU A 1 115 ? -5.168  6.354   0.490   1.00 0.00 ? 138 GLU A CB   6  
ATOM 9096  C CG   . GLU A 1 115 ? -5.034  6.989   1.889   1.00 0.00 ? 138 GLU A CG   6  
ATOM 9097  C CD   . GLU A 1 115 ? -4.081  8.206   1.902   1.00 0.00 ? 138 GLU A CD   6  
ATOM 9098  O OE1  . GLU A 1 115 ? -4.290  9.138   1.088   1.00 0.00 ? 138 GLU A OE1  6  
ATOM 9099  O OE2  . GLU A 1 115 ? -3.040  8.185   2.600   1.00 0.00 ? 138 GLU A OE2  6  
ATOM 9100  H H    . GLU A 1 115 ? -4.690  5.651   -1.962  1.00 0.00 ? 138 GLU A H    6  
ATOM 9101  H HA   . GLU A 1 115 ? -3.107  6.752   0.132   1.00 0.00 ? 138 GLU A HA   6  
ATOM 9102  H HB2  . GLU A 1 115 ? -5.607  7.089   -0.185  1.00 0.00 ? 138 GLU A HB2  6  
ATOM 9103  H HB3  . GLU A 1 115 ? -5.833  5.490   0.539   1.00 0.00 ? 138 GLU A HB3  6  
ATOM 9104  H HG2  . GLU A 1 115 ? -6.032  7.270   2.221   1.00 0.00 ? 138 GLU A HG2  6  
ATOM 9105  H HG3  . GLU A 1 115 ? -4.675  6.236   2.590   1.00 0.00 ? 138 GLU A HG3  6  
ATOM 9106  N N    . LEU A 1 116 ? -3.439  3.495   0.224   1.00 0.00 ? 139 LEU A N    6  
ATOM 9107  C CA   . LEU A 1 116 ? -2.940  2.300   0.901   1.00 0.00 ? 139 LEU A CA   6  
ATOM 9108  C C    . LEU A 1 116 ? -1.428  2.271   1.077   1.00 0.00 ? 139 LEU A C    6  
ATOM 9109  O O    . LEU A 1 116 ? -0.966  1.712   2.073   1.00 0.00 ? 139 LEU A O    6  
ATOM 9110  C CB   . LEU A 1 116 ? -3.408  1.054   0.155   1.00 0.00 ? 139 LEU A CB   6  
ATOM 9111  C CG   . LEU A 1 116 ? -4.679  0.451   0.761   1.00 0.00 ? 139 LEU A CG   6  
ATOM 9112  C CD1  . LEU A 1 116 ? -5.762  1.429   1.186   1.00 0.00 ? 139 LEU A CD1  6  
ATOM 9113  C CD2  . LEU A 1 116 ? -5.217  -0.583  -0.222  1.00 0.00 ? 139 LEU A CD2  6  
ATOM 9114  H H    . LEU A 1 116 ? -4.037  3.396   -0.590  1.00 0.00 ? 139 LEU A H    6  
ATOM 9115  H HA   . LEU A 1 116 ? -3.350  2.282   1.907   1.00 0.00 ? 139 LEU A HA   6  
ATOM 9116  H HB2  . LEU A 1 116 ? -3.559  1.293   -0.896  1.00 0.00 ? 139 LEU A HB2  6  
ATOM 9117  H HB3  . LEU A 1 116 ? -2.628  0.295   0.211   1.00 0.00 ? 139 LEU A HB3  6  
ATOM 9118  H HG   . LEU A 1 116 ? -4.403  -0.041  1.672   1.00 0.00 ? 139 LEU A HG   6  
ATOM 9119  H HD11 . LEU A 1 116 ? -6.692  0.877   1.316   1.00 0.00 ? 139 LEU A HD11 6  
ATOM 9120  H HD12 . LEU A 1 116 ? -5.504  1.871   2.147   1.00 0.00 ? 139 LEU A HD12 6  
ATOM 9121  H HD13 . LEU A 1 116 ? -5.882  2.225   0.461   1.00 0.00 ? 139 LEU A HD13 6  
ATOM 9122  H HD21 . LEU A 1 116 ? -5.442  -0.089  -1.164  1.00 0.00 ? 139 LEU A HD21 6  
ATOM 9123  H HD22 . LEU A 1 116 ? -4.476  -1.360  -0.393  1.00 0.00 ? 139 LEU A HD22 6  
ATOM 9124  H HD23 . LEU A 1 116 ? -6.124  -1.036  0.175   1.00 0.00 ? 139 LEU A HD23 6  
ATOM 9125  N N    . CYS A 1 117 ? -0.663  2.855   0.154   1.00 0.00 ? 140 CYS A N    6  
ATOM 9126  C CA   . CYS A 1 117 ? 0.771   3.024   0.347   1.00 0.00 ? 140 CYS A CA   6  
ATOM 9127  C C    . CYS A 1 117 ? 1.024   4.324   1.130   1.00 0.00 ? 140 CYS A C    6  
ATOM 9128  O O    . CYS A 1 117 ? 1.803   4.323   2.079   1.00 0.00 ? 140 CYS A O    6  
ATOM 9129  C CB   . CYS A 1 117 ? 1.481   2.945   -1.014  1.00 0.00 ? 140 CYS A CB   6  
ATOM 9130  S SG   . CYS A 1 117 ? 1.291   1.312   -1.807  1.00 0.00 ? 140 CYS A SG   6  
ATOM 9131  H H    . CYS A 1 117 ? -1.113  3.293   -0.640  1.00 0.00 ? 140 CYS A H    6  
ATOM 9132  H HA   . CYS A 1 117 ? 1.153   2.199   0.951   1.00 0.00 ? 140 CYS A HA   6  
ATOM 9133  H HB2  . CYS A 1 117 ? 1.057   3.706   -1.659  1.00 0.00 ? 140 CYS A HB2  6  
ATOM 9134  H HB3  . CYS A 1 117 ? 2.542   3.148   -0.875  1.00 0.00 ? 140 CYS A HB3  6  
ATOM 9135  N N    . SER A 1 118 ? 0.340   5.427   0.795   1.00 0.00 ? 141 SER A N    6  
ATOM 9136  C CA   . SER A 1 118 ? 0.458   6.729   1.474   1.00 0.00 ? 141 SER A CA   6  
ATOM 9137  C C    . SER A 1 118 ? 0.078   6.698   2.970   1.00 0.00 ? 141 SER A C    6  
ATOM 9138  O O    . SER A 1 118 ? 0.471   7.576   3.741   1.00 0.00 ? 141 SER A O    6  
ATOM 9139  C CB   . SER A 1 118 ? -0.325  7.757   0.632   1.00 0.00 ? 141 SER A CB   6  
ATOM 9140  O OG   . SER A 1 118 ? -0.851  8.872   1.323   1.00 0.00 ? 141 SER A OG   6  
ATOM 9141  H H    . SER A 1 118 ? -0.349  5.365   0.052   1.00 0.00 ? 141 SER A H    6  
ATOM 9142  H HA   . SER A 1 118 ? 1.507   7.002   1.457   1.00 0.00 ? 141 SER A HA   6  
ATOM 9143  H HB2  . SER A 1 118 ? 0.333   8.116   -0.159  1.00 0.00 ? 141 SER A HB2  6  
ATOM 9144  H HB3  . SER A 1 118 ? -1.161  7.261   0.154   1.00 0.00 ? 141 SER A HB3  6  
ATOM 9145  H HG   . SER A 1 118 ? -1.618  8.551   1.864   1.00 0.00 ? 141 SER A HG   6  
ATOM 9146  N N    . LEU A 1 119 ? -0.613  5.648   3.398   1.00 0.00 ? 142 LEU A N    6  
ATOM 9147  C CA   . LEU A 1 119 ? -0.955  5.281   4.762   1.00 0.00 ? 142 LEU A CA   6  
ATOM 9148  C C    . LEU A 1 119 ? 0.281   5.044   5.622   1.00 0.00 ? 142 LEU A C    6  
ATOM 9149  O O    . LEU A 1 119 ? 0.172   5.107   6.846   1.00 0.00 ? 142 LEU A O    6  
ATOM 9150  C CB   . LEU A 1 119 ? -1.820  4.009   4.705   1.00 0.00 ? 142 LEU A CB   6  
ATOM 9151  C CG   . LEU A 1 119 ? -3.268  4.274   5.154   1.00 0.00 ? 142 LEU A CG   6  
ATOM 9152  C CD1  . LEU A 1 119 ? -4.241  3.277   4.519   1.00 0.00 ? 142 LEU A CD1  6  
ATOM 9153  C CD2  . LEU A 1 119 ? -3.367  4.157   6.676   1.00 0.00 ? 142 LEU A CD2  6  
ATOM 9154  H H    . LEU A 1 119 ? -1.010  5.065   2.674   1.00 0.00 ? 142 LEU A H    6  
ATOM 9155  H HA   . LEU A 1 119 ? -1.522  6.102   5.202   1.00 0.00 ? 142 LEU A HA   6  
ATOM 9156  H HB2  . LEU A 1 119 ? -1.805  3.636   3.683   1.00 0.00 ? 142 LEU A HB2  6  
ATOM 9157  H HB3  . LEU A 1 119 ? -1.383  3.224   5.325   1.00 0.00 ? 142 LEU A HB3  6  
ATOM 9158  H HG   . LEU A 1 119 ? -3.573  5.275   4.851   1.00 0.00 ? 142 LEU A HG   6  
ATOM 9159  H HD11 . LEU A 1 119 ? -4.304  3.485   3.453   1.00 0.00 ? 142 LEU A HD11 6  
ATOM 9160  H HD12 . LEU A 1 119 ? -3.900  2.255   4.680   1.00 0.00 ? 142 LEU A HD12 6  
ATOM 9161  H HD13 . LEU A 1 119 ? -5.235  3.399   4.947   1.00 0.00 ? 142 LEU A HD13 6  
ATOM 9162  H HD21 . LEU A 1 119 ? -2.648  4.838   7.135   1.00 0.00 ? 142 LEU A HD21 6  
ATOM 9163  H HD22 . LEU A 1 119 ? -4.374  4.427   6.994   1.00 0.00 ? 142 LEU A HD22 6  
ATOM 9164  H HD23 . LEU A 1 119 ? -3.139  3.133   6.975   1.00 0.00 ? 142 LEU A HD23 6  
ATOM 9165  N N    . LYS A 1 120 ? 1.455   4.841   5.016   1.00 0.00 ? 143 LYS A N    6  
ATOM 9166  C CA   . LYS A 1 120 ? 2.736   4.910   5.702   1.00 0.00 ? 143 LYS A CA   6  
ATOM 9167  C C    . LYS A 1 120 ? 3.669   5.865   4.961   1.00 0.00 ? 143 LYS A C    6  
ATOM 9168  O O    . LYS A 1 120 ? 3.247   6.589   4.061   1.00 0.00 ? 143 LYS A O    6  
ATOM 9169  C CB   . LYS A 1 120 ? 3.299   3.490   5.945   1.00 0.00 ? 143 LYS A CB   6  
ATOM 9170  C CG   . LYS A 1 120 ? 3.114   3.067   7.412   1.00 0.00 ? 143 LYS A CG   6  
ATOM 9171  C CD   . LYS A 1 120 ? 4.012   3.882   8.365   1.00 0.00 ? 143 LYS A CD   6  
ATOM 9172  C CE   . LYS A 1 120 ? 3.660   3.651   9.835   1.00 0.00 ? 143 LYS A CE   6  
ATOM 9173  N NZ   . LYS A 1 120 ? 3.979   2.283   10.268  1.00 0.00 ? 143 LYS A NZ   6  
ATOM 9174  H H    . LYS A 1 120 ? 1.504   4.853   3.999   1.00 0.00 ? 143 LYS A H    6  
ATOM 9175  H HA   . LYS A 1 120 ? 2.544   5.394   6.657   1.00 0.00 ? 143 LYS A HA   6  
ATOM 9176  H HB2  . LYS A 1 120 ? 2.782   2.774   5.302   1.00 0.00 ? 143 LYS A HB2  6  
ATOM 9177  H HB3  . LYS A 1 120 ? 4.360   3.435   5.697   1.00 0.00 ? 143 LYS A HB3  6  
ATOM 9178  H HG2  . LYS A 1 120 ? 2.067   3.194   7.694   1.00 0.00 ? 143 LYS A HG2  6  
ATOM 9179  H HG3  . LYS A 1 120 ? 3.368   2.009   7.503   1.00 0.00 ? 143 LYS A HG3  6  
ATOM 9180  H HD2  . LYS A 1 120 ? 5.061   3.629   8.187   1.00 0.00 ? 143 LYS A HD2  6  
ATOM 9181  H HD3  . LYS A 1 120 ? 3.885   4.948   8.187   1.00 0.00 ? 143 LYS A HD3  6  
ATOM 9182  H HE2  . LYS A 1 120 ? 4.242   4.347   10.440  1.00 0.00 ? 143 LYS A HE2  6  
ATOM 9183  H HE3  . LYS A 1 120 ? 2.600   3.857   9.999   1.00 0.00 ? 143 LYS A HE3  6  
ATOM 9184  H HZ1  . LYS A 1 120 ? 3.295   1.618   9.916   1.00 0.00 ? 143 LYS A HZ1  6  
ATOM 9185  H HZ2  . LYS A 1 120 ? 4.918   2.031   9.971   1.00 0.00 ? 143 LYS A HZ2  6  
ATOM 9186  H HZ3  . LYS A 1 120 ? 3.976   2.229   11.284  1.00 0.00 ? 143 LYS A HZ3  6  
ATOM 9187  N N    . HIS A 1 121 ? 4.907   5.955   5.435   1.00 0.00 ? 144 HIS A N    6  
ATOM 9188  C CA   . HIS A 1 121 ? 5.950   6.812   4.902   1.00 0.00 ? 144 HIS A CA   6  
ATOM 9189  C C    . HIS A 1 121 ? 7.280   6.090   5.070   1.00 0.00 ? 144 HIS A C    6  
ATOM 9190  O O    . HIS A 1 121 ? 7.372   5.145   5.862   1.00 0.00 ? 144 HIS A O    6  
ATOM 9191  C CB   . HIS A 1 121 ? 5.976   8.180   5.608   1.00 0.00 ? 144 HIS A CB   6  
ATOM 9192  C CG   . HIS A 1 121 ? 6.358   8.096   7.075   1.00 0.00 ? 144 HIS A CG   6  
ATOM 9193  N ND1  . HIS A 1 121 ? 5.992   7.089   7.941   1.00 0.00 ? 144 HIS A ND1  6  
ATOM 9194  C CD2  . HIS A 1 121 ? 7.267   8.884   7.732   1.00 0.00 ? 144 HIS A CD2  6  
ATOM 9195  C CE1  . HIS A 1 121 ? 6.694   7.233   9.070   1.00 0.00 ? 144 HIS A CE1  6  
ATOM 9196  N NE2  . HIS A 1 121 ? 7.479   8.318   9.003   1.00 0.00 ? 144 HIS A NE2  6  
ATOM 9197  H H    . HIS A 1 121 ? 5.281   5.175   5.956   1.00 0.00 ? 144 HIS A H    6  
ATOM 9198  H HA   . HIS A 1 121 ? 5.745   6.952   3.849   1.00 0.00 ? 144 HIS A HA   6  
ATOM 9199  H HB2  . HIS A 1 121 ? 6.687   8.833   5.097   1.00 0.00 ? 144 HIS A HB2  6  
ATOM 9200  H HB3  . HIS A 1 121 ? 5.002   8.638   5.476   1.00 0.00 ? 144 HIS A HB3  6  
ATOM 9201  H HD1  . HIS A 1 121 ? 5.393   6.314   7.707   1.00 0.00 ? 144 HIS A HD1  6  
ATOM 9202  H HD2  . HIS A 1 121 ? 7.760   9.759   7.324   1.00 0.00 ? 144 HIS A HD2  6  
ATOM 9203  H HE1  . HIS A 1 121 ? 6.637   6.567   9.918   1.00 0.00 ? 144 HIS A HE1  6  
ATOM 9204  N N    . CYS A 1 122 ? 8.313   6.593   4.399   1.00 0.00 ? 145 CYS A N    6  
ATOM 9205  C CA   . CYS A 1 122 ? 9.674   6.088   4.475   1.00 0.00 ? 145 CYS A CA   6  
ATOM 9206  C C    . CYS A 1 122 ? 10.502  7.208   5.102   1.00 0.00 ? 145 CYS A C    6  
ATOM 9207  O O    . CYS A 1 122 ? 11.226  7.919   4.407   1.00 0.00 ? 145 CYS A O    6  
ATOM 9208  C CB   . CYS A 1 122 ? 10.178  5.623   3.093   1.00 0.00 ? 145 CYS A CB   6  
ATOM 9209  S SG   . CYS A 1 122 ? 8.911   5.211   1.855   1.00 0.00 ? 145 CYS A SG   6  
ATOM 9210  H H    . CYS A 1 122 ? 8.178   7.445   3.872   1.00 0.00 ? 145 CYS A H    6  
ATOM 9211  H HA   . CYS A 1 122 ? 9.700   5.222   5.139   1.00 0.00 ? 145 CYS A HA   6  
ATOM 9212  H HB2  . CYS A 1 122 ? 10.823  6.386   2.660   1.00 0.00 ? 145 CYS A HB2  6  
ATOM 9213  H HB3  . CYS A 1 122 ? 10.808  4.749   3.256   1.00 0.00 ? 145 CYS A HB3  6  
ATOM 9214  N N    . GLU A 1 123 ? 10.327  7.400   6.417   1.00 0.00 ? 146 GLU A N    6  
ATOM 9215  C CA   . GLU A 1 123 ? 10.876  8.498   7.198   1.00 0.00 ? 146 GLU A CA   6  
ATOM 9216  C C    . GLU A 1 123 ? 10.669  9.855   6.514   1.00 0.00 ? 146 GLU A C    6  
ATOM 9217  O O    . GLU A 1 123 ? 9.707   9.964   5.760   1.00 0.00 ? 146 GLU A O    6  
ATOM 9218  C CB   . GLU A 1 123 ? 12.318  8.126   7.520   1.00 0.00 ? 146 GLU A CB   6  
ATOM 9219  C CG   . GLU A 1 123 ? 12.361  7.420   8.872   1.00 0.00 ? 146 GLU A CG   6  
ATOM 9220  C CD   . GLU A 1 123 ? 13.783  6.992   9.193   1.00 0.00 ? 146 GLU A CD   6  
ATOM 9221  O OE1  . GLU A 1 123 ? 14.150  5.856   8.807   1.00 0.00 ? 146 GLU A OE1  6  
ATOM 9222  O OE2  . GLU A 1 123 ? 14.495  7.789   9.837   1.00 0.00 ? 146 GLU A OE2  6  
ATOM 9223  H H    . GLU A 1 123 ? 9.789   6.751   6.948   1.00 0.00 ? 146 GLU A H    6  
ATOM 9224  H HA   . GLU A 1 123 ? 10.312  8.558   8.129   1.00 0.00 ? 146 GLU A HA   6  
ATOM 9225  H HB2  . GLU A 1 123 ? 12.748  7.492   6.745   1.00 0.00 ? 146 GLU A HB2  6  
ATOM 9226  H HB3  . GLU A 1 123 ? 12.908  9.019   7.555   1.00 0.00 ? 146 GLU A HB3  6  
ATOM 9227  H HG2  . GLU A 1 123 ? 12.001  8.100   9.645   1.00 0.00 ? 146 GLU A HG2  6  
ATOM 9228  H HG3  . GLU A 1 123 ? 11.709  6.547   8.853   1.00 0.00 ? 146 GLU A HG3  6  
ATOM 9229  N N    . PHE A 1 124 ? 11.493  10.874  6.824   1.00 0.00 ? 147 PHE A N    6  
ATOM 9230  C CA   . PHE A 1 124 ? 11.629  12.184  6.178   1.00 0.00 ? 147 PHE A CA   6  
ATOM 9231  C C    . PHE A 1 124 ? 10.297  12.929  6.050   1.00 0.00 ? 147 PHE A C    6  
ATOM 9232  O O    . PHE A 1 124 ? 10.014  13.827  6.843   1.00 0.00 ? 147 PHE A O    6  
ATOM 9233  C CB   . PHE A 1 124 ? 12.419  12.012  4.862   1.00 0.00 ? 147 PHE A CB   6  
ATOM 9234  C CG   . PHE A 1 124 ? 12.213  13.058  3.776   1.00 0.00 ? 147 PHE A CG   6  
ATOM 9235  C CD1  . PHE A 1 124 ? 12.146  14.434  4.077   1.00 0.00 ? 147 PHE A CD1  6  
ATOM 9236  C CD2  . PHE A 1 124 ? 12.062  12.632  2.443   1.00 0.00 ? 147 PHE A CD2  6  
ATOM 9237  C CE1  . PHE A 1 124 ? 11.870  15.362  3.059   1.00 0.00 ? 147 PHE A CE1  6  
ATOM 9238  C CE2  . PHE A 1 124 ? 11.827  13.563  1.420   1.00 0.00 ? 147 PHE A CE2  6  
ATOM 9239  C CZ   . PHE A 1 124 ? 11.710  14.928  1.730   1.00 0.00 ? 147 PHE A CZ   6  
ATOM 9240  H H    . PHE A 1 124 ? 12.205  10.702  7.521   1.00 0.00 ? 147 PHE A H    6  
ATOM 9241  H HA   . PHE A 1 124 ? 12.252  12.800  6.831   1.00 0.00 ? 147 PHE A HA   6  
ATOM 9242  H HB2  . PHE A 1 124 ? 13.481  11.978  5.109   1.00 0.00 ? 147 PHE A HB2  6  
ATOM 9243  H HB3  . PHE A 1 124 ? 12.170  11.041  4.431   1.00 0.00 ? 147 PHE A HB3  6  
ATOM 9244  H HD1  . PHE A 1 124 ? 12.270  14.789  5.091   1.00 0.00 ? 147 PHE A HD1  6  
ATOM 9245  H HD2  . PHE A 1 124 ? 12.125  11.583  2.198   1.00 0.00 ? 147 PHE A HD2  6  
ATOM 9246  H HE1  . PHE A 1 124 ? 11.750  16.409  3.309   1.00 0.00 ? 147 PHE A HE1  6  
ATOM 9247  H HE2  . PHE A 1 124 ? 11.711  13.214  0.403   1.00 0.00 ? 147 PHE A HE2  6  
ATOM 9248  H HZ   . PHE A 1 124 ? 11.474  15.641  0.951   1.00 0.00 ? 147 PHE A HZ   6  
ATOM 9249  N N    . TRP A 1 125 ? 9.448   12.505  5.123   1.00 0.00 ? 148 TRP A N    6  
ATOM 9250  C CA   . TRP A 1 125 ? 8.102   12.970  4.875   1.00 0.00 ? 148 TRP A CA   6  
ATOM 9251  C C    . TRP A 1 125 ? 7.132   12.356  5.901   1.00 0.00 ? 148 TRP A C    6  
ATOM 9252  O O    . TRP A 1 125 ? 6.106   11.745  5.589   1.00 0.00 ? 148 TRP A O    6  
ATOM 9253  C CB   . TRP A 1 125 ? 7.778   12.616  3.421   1.00 0.00 ? 148 TRP A CB   6  
ATOM 9254  C CG   . TRP A 1 125 ? 7.834   11.167  3.007   1.00 0.00 ? 148 TRP A CG   6  
ATOM 9255  C CD1  . TRP A 1 125 ? 8.938   10.386  2.885   1.00 0.00 ? 148 TRP A CD1  6  
ATOM 9256  C CD2  . TRP A 1 125 ? 6.708   10.312  2.659   1.00 0.00 ? 148 TRP A CD2  6  
ATOM 9257  N NE1  . TRP A 1 125 ? 8.571   9.146   2.401   1.00 0.00 ? 148 TRP A NE1  6  
ATOM 9258  C CE2  . TRP A 1 125 ? 7.207   9.056   2.215   1.00 0.00 ? 148 TRP A CE2  6  
ATOM 9259  C CE3  . TRP A 1 125 ? 5.307   10.456  2.733   1.00 0.00 ? 148 TRP A CE3  6  
ATOM 9260  C CZ2  . TRP A 1 125 ? 6.356   8.030   1.783   1.00 0.00 ? 148 TRP A CZ2  6  
ATOM 9261  C CZ3  . TRP A 1 125 ? 4.446   9.411   2.353   1.00 0.00 ? 148 TRP A CZ3  6  
ATOM 9262  C CH2  . TRP A 1 125 ? 4.965   8.212   1.847   1.00 0.00 ? 148 TRP A CH2  6  
ATOM 9263  H H    . TRP A 1 125 ? 9.701   11.650  4.646   1.00 0.00 ? 148 TRP A H    6  
ATOM 9264  H HA   . TRP A 1 125 ? 8.074   14.056  4.983   1.00 0.00 ? 148 TRP A HA   6  
ATOM 9265  H HB2  . TRP A 1 125 ? 6.789   13.011  3.185   1.00 0.00 ? 148 TRP A HB2  6  
ATOM 9266  H HB3  . TRP A 1 125 ? 8.489   13.153  2.800   1.00 0.00 ? 148 TRP A HB3  6  
ATOM 9267  H HD1  . TRP A 1 125 ? 9.961   10.656  3.141   1.00 0.00 ? 148 TRP A HD1  6  
ATOM 9268  H HE1  . TRP A 1 125 ? 9.264   8.436   2.203   1.00 0.00 ? 148 TRP A HE1  6  
ATOM 9269  H HE3  . TRP A 1 125 ? 4.916   11.366  3.161   1.00 0.00 ? 148 TRP A HE3  6  
ATOM 9270  H HZ2  . TRP A 1 125 ? 6.752   7.070   1.511   1.00 0.00 ? 148 TRP A HZ2  6  
ATOM 9271  H HZ3  . TRP A 1 125 ? 3.380   9.504   2.481   1.00 0.00 ? 148 TRP A HZ3  6  
ATOM 9272  H HH2  . TRP A 1 125 ? 4.293   7.400   1.606   1.00 0.00 ? 148 TRP A HH2  6  
ATOM 9273  N N    . LEU A 1 126 ? 7.440   12.601  7.178   1.00 0.00 ? 149 LEU A N    6  
ATOM 9274  C CA   . LEU A 1 126 ? 6.436   12.701  8.227   1.00 0.00 ? 149 LEU A CA   6  
ATOM 9275  C C    . LEU A 1 126 ? 5.522   13.893  7.909   1.00 0.00 ? 149 LEU A C    6  
ATOM 9276  O O    . LEU A 1 126 ? 5.739   14.620  6.938   1.00 0.00 ? 149 LEU A O    6  
ATOM 9277  C CB   . LEU A 1 126 ? 7.107   12.846  9.608   1.00 0.00 ? 149 LEU A CB   6  
ATOM 9278  C CG   . LEU A 1 126 ? 7.512   11.488  10.207  1.00 0.00 ? 149 LEU A CG   6  
ATOM 9279  C CD1  . LEU A 1 126 ? 8.974   11.139  9.910   1.00 0.00 ? 149 LEU A CD1  6  
ATOM 9280  C CD2  . LEU A 1 126 ? 7.273   11.461  11.716  1.00 0.00 ? 149 LEU A CD2  6  
ATOM 9281  H H    . LEU A 1 126 ? 8.287   13.142  7.317   1.00 0.00 ? 149 LEU A H    6  
ATOM 9282  H HA   . LEU A 1 126 ? 5.823   11.797  8.214   1.00 0.00 ? 149 LEU A HA   6  
ATOM 9283  H HB2  . LEU A 1 126 ? 7.974   13.501  9.532   1.00 0.00 ? 149 LEU A HB2  6  
ATOM 9284  H HB3  . LEU A 1 126 ? 6.405   13.321  10.291  1.00 0.00 ? 149 LEU A HB3  6  
ATOM 9285  H HG   . LEU A 1 126 ? 6.869   10.722  9.783   1.00 0.00 ? 149 LEU A HG   6  
ATOM 9286  H HD11 . LEU A 1 126 ? 9.205   10.142  10.283  1.00 0.00 ? 149 LEU A HD11 6  
ATOM 9287  H HD12 . LEU A 1 126 ? 9.152   11.169  8.837   1.00 0.00 ? 149 LEU A HD12 6  
ATOM 9288  H HD13 . LEU A 1 126 ? 9.633   11.860  10.396  1.00 0.00 ? 149 LEU A HD13 6  
ATOM 9289  H HD21 . LEU A 1 126 ? 7.840   12.265  12.179  1.00 0.00 ? 149 LEU A HD21 6  
ATOM 9290  H HD22 . LEU A 1 126 ? 6.211   11.605  11.922  1.00 0.00 ? 149 LEU A HD22 6  
ATOM 9291  H HD23 . LEU A 1 126 ? 7.586   10.504  12.133  1.00 0.00 ? 149 LEU A HD23 6  
ATOM 9292  N N    . GLU A 1 127 ? 4.484   14.085  8.723   1.00 0.00 ? 150 GLU A N    6  
ATOM 9293  C CA   . GLU A 1 127 ? 3.377   14.997  8.501   1.00 0.00 ? 150 GLU A CA   6  
ATOM 9294  C C    . GLU A 1 127 ? 2.940   14.996  7.025   1.00 0.00 ? 150 GLU A C    6  
ATOM 9295  O O    . GLU A 1 127 ? 2.976   16.004  6.318   1.00 0.00 ? 150 GLU A O    6  
ATOM 9296  C CB   . GLU A 1 127 ? 3.738   16.358  9.096   1.00 0.00 ? 150 GLU A CB   6  
ATOM 9297  C CG   . GLU A 1 127 ? 2.507   17.264  9.225   1.00 0.00 ? 150 GLU A CG   6  
ATOM 9298  C CD   . GLU A 1 127 ? 2.871   18.686  9.634   1.00 0.00 ? 150 GLU A CD   6  
ATOM 9299  O OE1  . GLU A 1 127 ? 3.536   18.879  10.679  1.00 0.00 ? 150 GLU A OE1  6  
ATOM 9300  O OE2  . GLU A 1 127 ? 2.445   19.624  8.926   1.00 0.00 ? 150 GLU A OE2  6  
ATOM 9301  H H    . GLU A 1 127 ? 4.487   13.664  9.638   1.00 0.00 ? 150 GLU A H    6  
ATOM 9302  H HA   . GLU A 1 127 ? 2.535   14.624  9.079   1.00 0.00 ? 150 GLU A HA   6  
ATOM 9303  H HB2  . GLU A 1 127 ? 4.155   16.210  10.094  1.00 0.00 ? 150 GLU A HB2  6  
ATOM 9304  H HB3  . GLU A 1 127 ? 4.508   16.800  8.474   1.00 0.00 ? 150 GLU A HB3  6  
ATOM 9305  H HG2  . GLU A 1 127 ? 1.960   17.296  8.283   1.00 0.00 ? 150 GLU A HG2  6  
ATOM 9306  H HG3  . GLU A 1 127 ? 1.840   16.843  9.975   1.00 0.00 ? 150 GLU A HG3  6  
ATOM 9307  N N    . ALA A 1 29  ? 1.096   -15.976 -4.270  1.00 0.00 ? 52  ALA A N    7  
ATOM 9308  C CA   . ALA A 1 29  ? 1.002   -14.784 -5.088  1.00 0.00 ? 52  ALA A CA   7  
ATOM 9309  C C    . ALA A 1 29  ? 1.097   -13.553 -4.197  1.00 0.00 ? 52  ALA A C    7  
ATOM 9310  O O    . ALA A 1 29  ? 1.590   -12.523 -4.634  1.00 0.00 ? 52  ALA A O    7  
ATOM 9311  C CB   . ALA A 1 29  ? -0.355  -14.795 -5.789  1.00 0.00 ? 52  ALA A CB   7  
ATOM 9312  H H    . ALA A 1 29  ? 0.226   -16.457 -4.095  1.00 0.00 ? 52  ALA A H    7  
ATOM 9313  H HA   . ALA A 1 29  ? 1.805   -14.767 -5.827  1.00 0.00 ? 52  ALA A HA   7  
ATOM 9314  H HB1  . ALA A 1 29  ? -0.369  -15.579 -6.542  1.00 0.00 ? 52  ALA A HB1  7  
ATOM 9315  H HB2  . ALA A 1 29  ? -1.148  -14.975 -5.058  1.00 0.00 ? 52  ALA A HB2  7  
ATOM 9316  H HB3  . ALA A 1 29  ? -0.536  -13.835 -6.270  1.00 0.00 ? 52  ALA A HB3  7  
ATOM 9317  N N    . GLU A 1 30  ? 0.679   -13.683 -2.941  1.00 0.00 ? 53  GLU A N    7  
ATOM 9318  C CA   . GLU A 1 30  ? 0.617   -12.596 -1.971  1.00 0.00 ? 53  GLU A CA   7  
ATOM 9319  C C    . GLU A 1 30  ? 2.026   -12.102 -1.613  1.00 0.00 ? 53  GLU A C    7  
ATOM 9320  O O    . GLU A 1 30  ? 2.273   -10.930 -1.343  1.00 0.00 ? 53  GLU A O    7  
ATOM 9321  C CB   . GLU A 1 30  ? -0.100  -13.160 -0.748  1.00 0.00 ? 53  GLU A CB   7  
ATOM 9322  C CG   . GLU A 1 30  ? -1.440  -13.827 -1.083  1.00 0.00 ? 53  GLU A CG   7  
ATOM 9323  C CD   . GLU A 1 30  ? -2.358  -12.922 -1.900  1.00 0.00 ? 53  GLU A CD   7  
ATOM 9324  O OE1  . GLU A 1 30  ? -2.908  -11.971 -1.310  1.00 0.00 ? 53  GLU A OE1  7  
ATOM 9325  O OE2  . GLU A 1 30  ? -2.461  -13.115 -3.138  1.00 0.00 ? 53  GLU A OE2  7  
ATOM 9326  H H    . GLU A 1 30  ? 0.270   -14.565 -2.642  1.00 0.00 ? 53  GLU A H    7  
ATOM 9327  H HA   . GLU A 1 30  ? 0.035   -11.772 -2.377  1.00 0.00 ? 53  GLU A HA   7  
ATOM 9328  H HB2  . GLU A 1 30  ? 0.545   -13.905 -0.297  1.00 0.00 ? 53  GLU A HB2  7  
ATOM 9329  H HB3  . GLU A 1 30  ? -0.263  -12.380 -0.020  1.00 0.00 ? 53  GLU A HB3  7  
ATOM 9330  H HG2  . GLU A 1 30  ? -1.262  -14.772 -1.619  1.00 0.00 ? 53  GLU A HG2  7  
ATOM 9331  H HG3  . GLU A 1 30  ? -1.917  -14.058 -0.133  1.00 0.00 ? 53  GLU A HG3  7  
ATOM 9332  N N    . ASN A 1 31  ? 2.989   -13.010 -1.741  1.00 0.00 ? 54  ASN A N    7  
ATOM 9333  C CA   . ASN A 1 31  ? 4.422   -12.802 -1.600  1.00 0.00 ? 54  ASN A CA   7  
ATOM 9334  C C    . ASN A 1 31  ? 5.010   -11.949 -2.742  1.00 0.00 ? 54  ASN A C    7  
ATOM 9335  O O    . ASN A 1 31  ? 6.227   -11.867 -2.891  1.00 0.00 ? 54  ASN A O    7  
ATOM 9336  C CB   . ASN A 1 31  ? 5.040   -14.204 -1.553  1.00 0.00 ? 54  ASN A CB   7  
ATOM 9337  C CG   . ASN A 1 31  ? 6.379   -14.315 -0.851  1.00 0.00 ? 54  ASN A CG   7  
ATOM 9338  O OD1  . ASN A 1 31  ? 7.031   -13.338 -0.514  1.00 0.00 ? 54  ASN A OD1  7  
ATOM 9339  N ND2  . ASN A 1 31  ? 6.806   -15.544 -0.614  1.00 0.00 ? 54  ASN A ND2  7  
ATOM 9340  H H    . ASN A 1 31  ? 2.678   -13.926 -2.025  1.00 0.00 ? 54  ASN A H    7  
ATOM 9341  H HA   . ASN A 1 31  ? 4.615   -12.295 -0.655  1.00 0.00 ? 54  ASN A HA   7  
ATOM 9342  H HB2  . ASN A 1 31  ? 4.355   -14.864 -1.035  1.00 0.00 ? 54  ASN A HB2  7  
ATOM 9343  H HB3  . ASN A 1 31  ? 5.156   -14.564 -2.567  1.00 0.00 ? 54  ASN A HB3  7  
ATOM 9344  H HD21 . ASN A 1 31  ? 6.269   -16.361 -0.873  1.00 0.00 ? 54  ASN A HD21 7  
ATOM 9345  H HD22 . ASN A 1 31  ? 7.732   -15.640 -0.207  1.00 0.00 ? 54  ASN A HD22 7  
ATOM 9346  N N    . ARG A 1 32  ? 4.178   -11.372 -3.620  1.00 0.00 ? 55  ARG A N    7  
ATOM 9347  C CA   . ARG A 1 32  ? 4.590   -10.399 -4.628  1.00 0.00 ? 55  ARG A CA   7  
ATOM 9348  C C    . ARG A 1 32  ? 4.797   -9.035  -3.989  1.00 0.00 ? 55  ARG A C    7  
ATOM 9349  O O    . ARG A 1 32  ? 4.036   -8.657  -3.090  1.00 0.00 ? 55  ARG A O    7  
ATOM 9350  C CB   . ARG A 1 32  ? 3.496   -10.252 -5.696  1.00 0.00 ? 55  ARG A CB   7  
ATOM 9351  C CG   . ARG A 1 32  ? 3.588   -11.312 -6.778  1.00 0.00 ? 55  ARG A CG   7  
ATOM 9352  C CD   . ARG A 1 32  ? 2.389   -11.234 -7.732  1.00 0.00 ? 55  ARG A CD   7  
ATOM 9353  N NE   . ARG A 1 32  ? 2.620   -12.063 -8.922  1.00 0.00 ? 55  ARG A NE   7  
ATOM 9354  C CZ   . ARG A 1 32  ? 1.964   -13.144 -9.346  1.00 0.00 ? 55  ARG A CZ   7  
ATOM 9355  N NH1  . ARG A 1 32  ? 0.946   -13.656 -8.661  1.00 0.00 ? 55  ARG A NH1  7  
ATOM 9356  N NH2  . ARG A 1 32  ? 2.357   -13.711 -10.480 1.00 0.00 ? 55  ARG A NH2  7  
ATOM 9357  H H    . ARG A 1 32  ? 3.183   -11.469 -3.459  1.00 0.00 ? 55  ARG A H    7  
ATOM 9358  H HA   . ARG A 1 32  ? 5.528   -10.722 -5.075  1.00 0.00 ? 55  ARG A HA   7  
ATOM 9359  H HB2  . ARG A 1 32  ? 2.541   -10.361 -5.235  1.00 0.00 ? 55  ARG A HB2  7  
ATOM 9360  H HB3  . ARG A 1 32  ? 3.488   -9.250  -6.116  1.00 0.00 ? 55  ARG A HB3  7  
ATOM 9361  H HG2  . ARG A 1 32  ? 4.523   -11.176 -7.313  1.00 0.00 ? 55  ARG A HG2  7  
ATOM 9362  H HG3  . ARG A 1 32  ? 3.584   -12.280 -6.291  1.00 0.00 ? 55  ARG A HG3  7  
ATOM 9363  H HD2  . ARG A 1 32  ? 1.484   -11.540 -7.207  1.00 0.00 ? 55  ARG A HD2  7  
ATOM 9364  H HD3  . ARG A 1 32  ? 2.265   -10.202 -8.059  1.00 0.00 ? 55  ARG A HD3  7  
ATOM 9365  H HE   . ARG A 1 32  ? 3.445   -11.805 -9.460  1.00 0.00 ? 55  ARG A HE   7  
ATOM 9366  H HH11 . ARG A 1 32  ? 0.526   -13.154 -7.895  1.00 0.00 ? 55  ARG A HH11 7  
ATOM 9367  H HH12 . ARG A 1 32  ? 0.477   -14.513 -8.960  1.00 0.00 ? 55  ARG A HH12 7  
ATOM 9368  H HH21 . ARG A 1 32  ? 2.951   -13.163 -11.105 1.00 0.00 ? 55  ARG A HH21 7  
ATOM 9369  H HH22 . ARG A 1 32  ? 1.711   -14.356 -10.932 1.00 0.00 ? 55  ARG A HH22 7  
ATOM 9370  N N    . PRO A 1 33  ? 5.701   -8.219  -4.544  1.00 0.00 ? 56  PRO A N    7  
ATOM 9371  C CA   . PRO A 1 33  ? 5.749   -6.814  -4.230  1.00 0.00 ? 56  PRO A CA   7  
ATOM 9372  C C    . PRO A 1 33  ? 4.489   -6.197  -4.826  1.00 0.00 ? 56  PRO A C    7  
ATOM 9373  O O    . PRO A 1 33  ? 4.270   -6.256  -6.039  1.00 0.00 ? 56  PRO A O    7  
ATOM 9374  C CB   . PRO A 1 33  ? 7.034   -6.284  -4.860  1.00 0.00 ? 56  PRO A CB   7  
ATOM 9375  C CG   . PRO A 1 33  ? 7.440   -7.310  -5.915  1.00 0.00 ? 56  PRO A CG   7  
ATOM 9376  C CD   . PRO A 1 33  ? 6.532   -8.520  -5.695  1.00 0.00 ? 56  PRO A CD   7  
ATOM 9377  H HA   . PRO A 1 33  ? 5.779   -6.669  -3.149  1.00 0.00 ? 56  PRO A HA   7  
ATOM 9378  H HB2  . PRO A 1 33  ? 6.870   -5.315  -5.320  1.00 0.00 ? 56  PRO A HB2  7  
ATOM 9379  H HB3  . PRO A 1 33  ? 7.812   -6.220  -4.097  1.00 0.00 ? 56  PRO A HB3  7  
ATOM 9380  H HG2  . PRO A 1 33  ? 7.289   -6.904  -6.914  1.00 0.00 ? 56  PRO A HG2  7  
ATOM 9381  H HG3  . PRO A 1 33  ? 8.485   -7.573  -5.782  1.00 0.00 ? 56  PRO A HG3  7  
ATOM 9382  H HD2  . PRO A 1 33  ? 5.903   -8.667  -6.574  1.00 0.00 ? 56  PRO A HD2  7  
ATOM 9383  H HD3  . PRO A 1 33  ? 7.101   -9.424  -5.505  1.00 0.00 ? 56  PRO A HD3  7  
ATOM 9384  N N    . GLY A 1 34  ? 3.631   -5.636  -3.979  1.00 0.00 ? 57  GLY A N    7  
ATOM 9385  C CA   . GLY A 1 34  ? 2.422   -4.978  -4.445  1.00 0.00 ? 57  GLY A CA   7  
ATOM 9386  C C    . GLY A 1 34  ? 1.212   -5.898  -4.518  1.00 0.00 ? 57  GLY A C    7  
ATOM 9387  O O    . GLY A 1 34  ? 0.179   -5.432  -4.989  1.00 0.00 ? 57  GLY A O    7  
ATOM 9388  H H    . GLY A 1 34  ? 3.811   -5.699  -2.986  1.00 0.00 ? 57  GLY A H    7  
ATOM 9389  H HA2  . GLY A 1 34  ? 2.175   -4.154  -3.784  1.00 0.00 ? 57  GLY A HA2  7  
ATOM 9390  H HA3  . GLY A 1 34  ? 2.592   -4.554  -5.435  1.00 0.00 ? 57  GLY A HA3  7  
ATOM 9391  N N    . ALA A 1 35  ? 1.282   -7.160  -4.080  1.00 0.00 ? 58  ALA A N    7  
ATOM 9392  C CA   . ALA A 1 35  ? 0.088   -7.999  -4.049  1.00 0.00 ? 58  ALA A CA   7  
ATOM 9393  C C    . ALA A 1 35  ? -1.035  -7.363  -3.207  1.00 0.00 ? 58  ALA A C    7  
ATOM 9394  O O    . ALA A 1 35  ? -0.757  -6.607  -2.266  1.00 0.00 ? 58  ALA A O    7  
ATOM 9395  C CB   . ALA A 1 35  ? 0.472   -9.391  -3.553  1.00 0.00 ? 58  ALA A CB   7  
ATOM 9396  H H    . ALA A 1 35  ? 2.154   -7.593  -3.791  1.00 0.00 ? 58  ALA A H    7  
ATOM 9397  H HA   . ALA A 1 35  ? -0.264  -8.086  -5.074  1.00 0.00 ? 58  ALA A HA   7  
ATOM 9398  H HB1  . ALA A 1 35  ? 1.529   -9.572  -3.728  1.00 0.00 ? 58  ALA A HB1  7  
ATOM 9399  H HB2  . ALA A 1 35  ? 0.303   -9.484  -2.486  1.00 0.00 ? 58  ALA A HB2  7  
ATOM 9400  H HB3  . ALA A 1 35  ? -0.121  -10.142 -4.075  1.00 0.00 ? 58  ALA A HB3  7  
ATOM 9401  N N    . PHE A 1 36  ? -2.289  -7.681  -3.525  1.00 0.00 ? 59  PHE A N    7  
ATOM 9402  C CA   . PHE A 1 36  ? -3.499  -7.177  -2.876  1.00 0.00 ? 59  PHE A CA   7  
ATOM 9403  C C    . PHE A 1 36  ? -3.879  -8.085  -1.698  1.00 0.00 ? 59  PHE A C    7  
ATOM 9404  O O    . PHE A 1 36  ? -4.274  -9.221  -1.937  1.00 0.00 ? 59  PHE A O    7  
ATOM 9405  C CB   . PHE A 1 36  ? -4.650  -7.162  -3.905  1.00 0.00 ? 59  PHE A CB   7  
ATOM 9406  C CG   . PHE A 1 36  ? -4.934  -5.862  -4.638  1.00 0.00 ? 59  PHE A CG   7  
ATOM 9407  C CD1  . PHE A 1 36  ? -3.968  -4.845  -4.781  1.00 0.00 ? 59  PHE A CD1  7  
ATOM 9408  C CD2  . PHE A 1 36  ? -6.225  -5.659  -5.163  1.00 0.00 ? 59  PHE A CD2  7  
ATOM 9409  C CE1  . PHE A 1 36  ? -4.293  -3.644  -5.427  1.00 0.00 ? 59  PHE A CE1  7  
ATOM 9410  C CE2  . PHE A 1 36  ? -6.530  -4.469  -5.847  1.00 0.00 ? 59  PHE A CE2  7  
ATOM 9411  C CZ   . PHE A 1 36  ? -5.571  -3.450  -5.963  1.00 0.00 ? 59  PHE A CZ   7  
ATOM 9412  H H    . PHE A 1 36  ? -2.419  -8.375  -4.255  1.00 0.00 ? 59  PHE A H    7  
ATOM 9413  H HA   . PHE A 1 36  ? -3.330  -6.165  -2.516  1.00 0.00 ? 59  PHE A HA   7  
ATOM 9414  H HB2  . PHE A 1 36  ? -4.496  -7.951  -4.643  1.00 0.00 ? 59  PHE A HB2  7  
ATOM 9415  H HB3  . PHE A 1 36  ? -5.568  -7.420  -3.380  1.00 0.00 ? 59  PHE A HB3  7  
ATOM 9416  H HD1  . PHE A 1 36  ? -2.955  -4.953  -4.434  1.00 0.00 ? 59  PHE A HD1  7  
ATOM 9417  H HD2  . PHE A 1 36  ? -6.988  -6.422  -5.055  1.00 0.00 ? 59  PHE A HD2  7  
ATOM 9418  H HE1  . PHE A 1 36  ? -3.541  -2.884  -5.537  1.00 0.00 ? 59  PHE A HE1  7  
ATOM 9419  H HE2  . PHE A 1 36  ? -7.498  -4.351  -6.305  1.00 0.00 ? 59  PHE A HE2  7  
ATOM 9420  H HZ   . PHE A 1 36  ? -5.792  -2.528  -6.479  1.00 0.00 ? 59  PHE A HZ   7  
ATOM 9421  N N    . ILE A 1 37  ? -3.832  -7.607  -0.445  1.00 0.00 ? 60  ILE A N    7  
ATOM 9422  C CA   . ILE A 1 37  ? -4.203  -8.426  0.725   1.00 0.00 ? 60  ILE A CA   7  
ATOM 9423  C C    . ILE A 1 37  ? -5.679  -8.879  0.682   1.00 0.00 ? 60  ILE A C    7  
ATOM 9424  O O    . ILE A 1 37  ? -5.994  -9.920  1.243   1.00 0.00 ? 60  ILE A O    7  
ATOM 9425  C CB   . ILE A 1 37  ? -3.854  -7.678  2.045   1.00 0.00 ? 60  ILE A CB   7  
ATOM 9426  C CG1  . ILE A 1 37  ? -2.327  -7.551  2.227   1.00 0.00 ? 60  ILE A CG1  7  
ATOM 9427  C CG2  . ILE A 1 37  ? -4.458  -8.348  3.285   1.00 0.00 ? 60  ILE A CG2  7  
ATOM 9428  C CD1  . ILE A 1 37  ? -1.852  -6.778  3.461   1.00 0.00 ? 60  ILE A CD1  7  
ATOM 9429  H H    . ILE A 1 37  ? -3.492  -6.666  -0.271  1.00 0.00 ? 60  ILE A H    7  
ATOM 9430  H HA   . ILE A 1 37  ? -3.612  -9.339  0.692   1.00 0.00 ? 60  ILE A HA   7  
ATOM 9431  H HB   . ILE A 1 37  ? -4.286  -6.686  1.989   1.00 0.00 ? 60  ILE A HB   7  
ATOM 9432  H HG12 . ILE A 1 37  ? -1.914  -8.552  2.309   1.00 0.00 ? 60  ILE A HG12 7  
ATOM 9433  H HG13 . ILE A 1 37  ? -1.901  -7.064  1.350   1.00 0.00 ? 60  ILE A HG13 7  
ATOM 9434  H HG21 . ILE A 1 37  ? -4.209  -7.804  4.196   1.00 0.00 ? 60  ILE A HG21 7  
ATOM 9435  H HG22 . ILE A 1 37  ? -5.539  -8.340  3.197   1.00 0.00 ? 60  ILE A HG22 7  
ATOM 9436  H HG23 . ILE A 1 37  ? -4.111  -9.379  3.351   1.00 0.00 ? 60  ILE A HG23 7  
ATOM 9437  H HD11 . ILE A 1 37  ? -2.406  -5.851  3.565   1.00 0.00 ? 60  ILE A HD11 7  
ATOM 9438  H HD12 . ILE A 1 37  ? -1.990  -7.382  4.357   1.00 0.00 ? 60  ILE A HD12 7  
ATOM 9439  H HD13 . ILE A 1 37  ? -0.790  -6.556  3.358   1.00 0.00 ? 60  ILE A HD13 7  
ATOM 9440  N N    . LYS A 1 38  ? -6.561  -8.088  0.049   1.00 0.00 ? 61  LYS A N    7  
ATOM 9441  C CA   . LYS A 1 38  ? -7.993  -8.253  -0.184  1.00 0.00 ? 61  LYS A CA   7  
ATOM 9442  C C    . LYS A 1 38  ? -8.621  -9.299  0.753   1.00 0.00 ? 61  LYS A C    7  
ATOM 9443  O O    . LYS A 1 38  ? -8.776  -10.463 0.400   1.00 0.00 ? 61  LYS A O    7  
ATOM 9444  C CB   . LYS A 1 38  ? -8.131  -8.512  -1.699  1.00 0.00 ? 61  LYS A CB   7  
ATOM 9445  C CG   . LYS A 1 38  ? -9.539  -8.460  -2.308  1.00 0.00 ? 61  LYS A CG   7  
ATOM 9446  C CD   . LYS A 1 38  ? -10.375 -9.660  -1.872  1.00 0.00 ? 61  LYS A CD   7  
ATOM 9447  C CE   . LYS A 1 38  ? -11.425 -10.040 -2.925  1.00 0.00 ? 61  LYS A CE   7  
ATOM 9448  N NZ   . LYS A 1 38  ? -11.845 -11.454 -2.792  1.00 0.00 ? 61  LYS A NZ   7  
ATOM 9449  H H    . LYS A 1 38  ? -6.134  -7.471  -0.604  1.00 0.00 ? 61  LYS A H    7  
ATOM 9450  H HA   . LYS A 1 38  ? -8.491  -7.308  0.032   1.00 0.00 ? 61  LYS A HA   7  
ATOM 9451  H HB2  . LYS A 1 38  ? -7.553  -7.751  -2.223  1.00 0.00 ? 61  LYS A HB2  7  
ATOM 9452  H HB3  . LYS A 1 38  ? -7.661  -9.467  -1.941  1.00 0.00 ? 61  LYS A HB3  7  
ATOM 9453  H HG2  . LYS A 1 38  ? -10.039 -7.537  -2.053  1.00 0.00 ? 61  LYS A HG2  7  
ATOM 9454  H HG3  . LYS A 1 38  ? -9.416  -8.477  -3.391  1.00 0.00 ? 61  LYS A HG3  7  
ATOM 9455  H HD2  . LYS A 1 38  ? -9.642  -10.460 -1.808  1.00 0.00 ? 61  LYS A HD2  7  
ATOM 9456  H HD3  . LYS A 1 38  ? -10.830 -9.492  -0.879  1.00 0.00 ? 61  LYS A HD3  7  
ATOM 9457  H HE2  . LYS A 1 38  ? -12.287 -9.371  -2.852  1.00 0.00 ? 61  LYS A HE2  7  
ATOM 9458  H HE3  . LYS A 1 38  ? -10.975 -9.910  -3.913  1.00 0.00 ? 61  LYS A HE3  7  
ATOM 9459  H HZ1  . LYS A 1 38  ? -11.070 -12.027 -2.459  1.00 0.00 ? 61  LYS A HZ1  7  
ATOM 9460  H HZ2  . LYS A 1 38  ? -12.605 -11.573 -2.131  1.00 0.00 ? 61  LYS A HZ2  7  
ATOM 9461  H HZ3  . LYS A 1 38  ? -12.124 -11.830 -3.692  1.00 0.00 ? 61  LYS A HZ3  7  
ATOM 9462  N N    . GLN A 1 39  ? -9.000  -8.859  1.955   1.00 0.00 ? 62  GLN A N    7  
ATOM 9463  C CA   . GLN A 1 39  ? -9.688  -9.714  2.915   1.00 0.00 ? 62  GLN A CA   7  
ATOM 9464  C C    . GLN A 1 39  ? -11.206 -9.519  2.760   1.00 0.00 ? 62  GLN A C    7  
ATOM 9465  O O    . GLN A 1 39  ? -11.745 -9.672  1.661   1.00 0.00 ? 62  GLN A O    7  
ATOM 9466  C CB   . GLN A 1 39  ? -9.156  -9.472  4.336   1.00 0.00 ? 62  GLN A CB   7  
ATOM 9467  C CG   . GLN A 1 39  ? -7.643  -9.700  4.466   1.00 0.00 ? 62  GLN A CG   7  
ATOM 9468  C CD   . GLN A 1 39  ? -7.219  -10.502 5.701   1.00 0.00 ? 62  GLN A CD   7  
ATOM 9469  O OE1  . GLN A 1 39  ? -7.716  -10.311 6.815   1.00 0.00 ? 62  GLN A OE1  7  
ATOM 9470  N NE2  . GLN A 1 39  ? -6.275  -11.410 5.528   1.00 0.00 ? 62  GLN A NE2  7  
ATOM 9471  H H    . GLN A 1 39  ? -8.797  -7.911  2.217   1.00 0.00 ? 62  GLN A H    7  
ATOM 9472  H HA   . GLN A 1 39  ? -9.456  -10.753 2.683   1.00 0.00 ? 62  GLN A HA   7  
ATOM 9473  H HB2  . GLN A 1 39  ? -9.376  -8.447  4.626   1.00 0.00 ? 62  GLN A HB2  7  
ATOM 9474  H HB3  . GLN A 1 39  ? -9.678  -10.155 5.000   1.00 0.00 ? 62  GLN A HB3  7  
ATOM 9475  H HG2  . GLN A 1 39  ? -7.276  -10.214 3.577   1.00 0.00 ? 62  GLN A HG2  7  
ATOM 9476  H HG3  . GLN A 1 39  ? -7.177  -8.723  4.514   1.00 0.00 ? 62  GLN A HG3  7  
ATOM 9477  H HE21 . GLN A 1 39  ? -5.947  -11.611 4.580   1.00 0.00 ? 62  GLN A HE21 7  
ATOM 9478  H HE22 . GLN A 1 39  ? -6.040  -12.089 6.248   1.00 0.00 ? 62  GLN A HE22 7  
ATOM 9479  N N    . GLY A 1 40  ? -11.907 -9.137  3.829   1.00 0.00 ? 63  GLY A N    7  
ATOM 9480  C CA   . GLY A 1 40  ? -13.365 -9.095  3.972   1.00 0.00 ? 63  GLY A CA   7  
ATOM 9481  C C    . GLY A 1 40  ? -13.827 -7.888  4.797   1.00 0.00 ? 63  GLY A C    7  
ATOM 9482  O O    . GLY A 1 40  ? -14.634 -8.026  5.719   1.00 0.00 ? 63  GLY A O    7  
ATOM 9483  H H    . GLY A 1 40  ? -11.365 -9.026  4.667   1.00 0.00 ? 63  GLY A H    7  
ATOM 9484  H HA2  . GLY A 1 40  ? -13.840 -9.067  2.994   1.00 0.00 ? 63  GLY A HA2  7  
ATOM 9485  H HA3  . GLY A 1 40  ? -13.700 -10.006 4.472   1.00 0.00 ? 63  GLY A HA3  7  
ATOM 9486  N N    . ARG A 1 41  ? -13.356 -6.680  4.470   1.00 0.00 ? 64  ARG A N    7  
ATOM 9487  C CA   . ARG A 1 41  ? -13.519 -5.449  5.268   1.00 0.00 ? 64  ARG A CA   7  
ATOM 9488  C C    . ARG A 1 41  ? -14.094 -4.269  4.480   1.00 0.00 ? 64  ARG A C    7  
ATOM 9489  O O    . ARG A 1 41  ? -14.322 -4.431  3.283   1.00 0.00 ? 64  ARG A O    7  
ATOM 9490  C CB   . ARG A 1 41  ? -12.202 -5.128  5.989   1.00 0.00 ? 64  ARG A CB   7  
ATOM 9491  C CG   . ARG A 1 41  ? -10.941 -5.181  5.144   1.00 0.00 ? 64  ARG A CG   7  
ATOM 9492  C CD   . ARG A 1 41  ? -10.875 -4.125  4.061   1.00 0.00 ? 64  ARG A CD   7  
ATOM 9493  N NE   . ARG A 1 41  ? -11.342 -4.651  2.780   1.00 0.00 ? 64  ARG A NE   7  
ATOM 9494  C CZ   . ARG A 1 41  ? -11.700 -3.906  1.730   1.00 0.00 ? 64  ARG A CZ   7  
ATOM 9495  N NH1  . ARG A 1 41  ? -11.404 -2.618  1.721   1.00 0.00 ? 64  ARG A NH1  7  
ATOM 9496  N NH2  . ARG A 1 41  ? -12.373 -4.449  0.732   1.00 0.00 ? 64  ARG A NH2  7  
ATOM 9497  H H    . ARG A 1 41  ? -12.866 -6.625  3.589   1.00 0.00 ? 64  ARG A H    7  
ATOM 9498  H HA   . ARG A 1 41  ? -14.231 -5.668  6.042   1.00 0.00 ? 64  ARG A HA   7  
ATOM 9499  H HB2  . ARG A 1 41  ? -12.253 -4.166  6.501   1.00 0.00 ? 64  ARG A HB2  7  
ATOM 9500  H HB3  . ARG A 1 41  ? -12.053 -5.906  6.718   1.00 0.00 ? 64  ARG A HB3  7  
ATOM 9501  H HG2  . ARG A 1 41  ? -10.096 -5.069  5.814   1.00 0.00 ? 64  ARG A HG2  7  
ATOM 9502  H HG3  . ARG A 1 41  ? -10.882 -6.154  4.688   1.00 0.00 ? 64  ARG A HG3  7  
ATOM 9503  H HD2  . ARG A 1 41  ? -11.508 -3.295  4.355   1.00 0.00 ? 64  ARG A HD2  7  
ATOM 9504  H HD3  . ARG A 1 41  ? -9.853  -3.782  3.971   1.00 0.00 ? 64  ARG A HD3  7  
ATOM 9505  H HE   . ARG A 1 41  ? -11.580 -5.631  2.809   1.00 0.00 ? 64  ARG A HE   7  
ATOM 9506  H HH11 . ARG A 1 41  ? -10.696 -2.291  2.359   1.00 0.00 ? 64  ARG A HH11 7  
ATOM 9507  H HH12 . ARG A 1 41  ? -11.666 -1.984  0.975   1.00 0.00 ? 64  ARG A HH12 7  
ATOM 9508  H HH21 . ARG A 1 41  ? -12.498 -5.460  0.738   1.00 0.00 ? 64  ARG A HH21 7  
ATOM 9509  H HH22 . ARG A 1 41  ? -12.766 -3.928  -0.047  1.00 0.00 ? 64  ARG A HH22 7  
ATOM 9510  N N    . LYS A 1 42  ? -14.300 -3.097  5.105   1.00 0.00 ? 65  LYS A N    7  
ATOM 9511  C CA   . LYS A 1 42  ? -14.723 -1.832  4.469   1.00 0.00 ? 65  LYS A CA   7  
ATOM 9512  C C    . LYS A 1 42  ? -13.826 -0.636  4.846   1.00 0.00 ? 65  LYS A C    7  
ATOM 9513  O O    . LYS A 1 42  ? -14.136 0.496   4.513   1.00 0.00 ? 65  LYS A O    7  
ATOM 9514  C CB   . LYS A 1 42  ? -16.196 -1.526  4.807   1.00 0.00 ? 65  LYS A CB   7  
ATOM 9515  C CG   . LYS A 1 42  ? -16.842 -0.656  3.708   1.00 0.00 ? 65  LYS A CG   7  
ATOM 9516  C CD   . LYS A 1 42  ? -18.307 -0.222  3.904   1.00 0.00 ? 65  LYS A CD   7  
ATOM 9517  C CE   . LYS A 1 42  ? -19.170 -1.159  4.759   1.00 0.00 ? 65  LYS A CE   7  
ATOM 9518  N NZ   . LYS A 1 42  ? -19.001 -0.900  6.208   1.00 0.00 ? 65  LYS A NZ   7  
ATOM 9519  H H    . LYS A 1 42  ? -14.199 -3.055  6.117   1.00 0.00 ? 65  LYS A H    7  
ATOM 9520  H HA   . LYS A 1 42  ? -14.641 -1.961  3.390   1.00 0.00 ? 65  LYS A HA   7  
ATOM 9521  H HB2  . LYS A 1 42  ? -16.748 -2.465  4.871   1.00 0.00 ? 65  LYS A HB2  7  
ATOM 9522  H HB3  . LYS A 1 42  ? -16.244 -1.014  5.769   1.00 0.00 ? 65  LYS A HB3  7  
ATOM 9523  H HG2  . LYS A 1 42  ? -16.281 0.260   3.552   1.00 0.00 ? 65  LYS A HG2  7  
ATOM 9524  H HG3  . LYS A 1 42  ? -16.740 -1.218  2.793   1.00 0.00 ? 65  LYS A HG3  7  
ATOM 9525  H HD2  . LYS A 1 42  ? -18.318 0.772   4.347   1.00 0.00 ? 65  LYS A HD2  7  
ATOM 9526  H HD3  . LYS A 1 42  ? -18.785 -0.089  2.929   1.00 0.00 ? 65  LYS A HD3  7  
ATOM 9527  H HE2  . LYS A 1 42  ? -20.212 -0.979  4.494   1.00 0.00 ? 65  LYS A HE2  7  
ATOM 9528  H HE3  . LYS A 1 42  ? -18.941 -2.198  4.522   1.00 0.00 ? 65  LYS A HE3  7  
ATOM 9529  H HZ1  . LYS A 1 42  ? -19.731 -1.347  6.749   1.00 0.00 ? 65  LYS A HZ1  7  
ATOM 9530  H HZ2  . LYS A 1 42  ? -18.105 -1.214  6.545   1.00 0.00 ? 65  LYS A HZ2  7  
ATOM 9531  H HZ3  . LYS A 1 42  ? -19.034 0.104   6.400   1.00 0.00 ? 65  LYS A HZ3  7  
ATOM 9532  N N    . LEU A 1 43  ? -12.684 -0.886  5.471   1.00 0.00 ? 66  LEU A N    7  
ATOM 9533  C CA   . LEU A 1 43  ? -11.684 0.086   5.941   1.00 0.00 ? 66  LEU A CA   7  
ATOM 9534  C C    . LEU A 1 43  ? -12.333 1.315   6.594   1.00 0.00 ? 66  LEU A C    7  
ATOM 9535  O O    . LEU A 1 43  ? -13.415 1.223   7.172   1.00 0.00 ? 66  LEU A O    7  
ATOM 9536  C CB   . LEU A 1 43  ? -10.691 0.408   4.798   1.00 0.00 ? 66  LEU A CB   7  
ATOM 9537  C CG   . LEU A 1 43  ? -9.748  -0.764  4.528   1.00 0.00 ? 66  LEU A CG   7  
ATOM 9538  C CD1  . LEU A 1 43  ? -9.114  -0.727  3.141   1.00 0.00 ? 66  LEU A CD1  7  
ATOM 9539  C CD2  . LEU A 1 43  ? -8.656  -0.863  5.586   1.00 0.00 ? 66  LEU A CD2  7  
ATOM 9540  H H    . LEU A 1 43  ? -12.573 -1.848  5.689   1.00 0.00 ? 66  LEU A H    7  
ATOM 9541  H HA   . LEU A 1 43  ? -11.120 -0.387  6.741   1.00 0.00 ? 66  LEU A HA   7  
ATOM 9542  H HB2  . LEU A 1 43  ? -11.258 0.637   3.899   1.00 0.00 ? 66  LEU A HB2  7  
ATOM 9543  H HB3  . LEU A 1 43  ? -10.066 1.260   5.052   1.00 0.00 ? 66  LEU A HB3  7  
ATOM 9544  H HG   . LEU A 1 43  ? -10.349 -1.652  4.559   1.00 0.00 ? 66  LEU A HG   7  
ATOM 9545  H HD11 . LEU A 1 43  ? -8.327  0.022   3.117   1.00 0.00 ? 66  LEU A HD11 7  
ATOM 9546  H HD12 . LEU A 1 43  ? -8.670  -1.702  2.946   1.00 0.00 ? 66  LEU A HD12 7  
ATOM 9547  H HD13 . LEU A 1 43  ? -9.845  -0.502  2.373   1.00 0.00 ? 66  LEU A HD13 7  
ATOM 9548  H HD21 . LEU A 1 43  ? -9.097  -1.130  6.548   1.00 0.00 ? 66  LEU A HD21 7  
ATOM 9549  H HD22 . LEU A 1 43  ? -7.950  -1.647  5.309   1.00 0.00 ? 66  LEU A HD22 7  
ATOM 9550  H HD23 . LEU A 1 43  ? -8.125  0.092   5.642   1.00 0.00 ? 66  LEU A HD23 7  
ATOM 9551  N N    . ASP A 1 44  ? -11.638 2.450   6.572   1.00 0.00 ? 67  ASP A N    7  
ATOM 9552  C CA   . ASP A 1 44  ? -12.143 3.767   6.927   1.00 0.00 ? 67  ASP A CA   7  
ATOM 9553  C C    . ASP A 1 44  ? -11.389 4.751   6.031   1.00 0.00 ? 67  ASP A C    7  
ATOM 9554  O O    . ASP A 1 44  ? -10.461 5.436   6.465   1.00 0.00 ? 67  ASP A O    7  
ATOM 9555  C CB   . ASP A 1 44  ? -11.936 4.017   8.427   1.00 0.00 ? 67  ASP A CB   7  
ATOM 9556  C CG   . ASP A 1 44  ? -12.560 5.323   8.918   1.00 0.00 ? 67  ASP A CG   7  
ATOM 9557  O OD1  . ASP A 1 44  ? -12.249 6.421   8.405   1.00 0.00 ? 67  ASP A OD1  7  
ATOM 9558  O OD2  . ASP A 1 44  ? -13.301 5.275   9.929   1.00 0.00 ? 67  ASP A OD2  7  
ATOM 9559  H H    . ASP A 1 44  ? -10.714 2.443   6.170   1.00 0.00 ? 67  ASP A H    7  
ATOM 9560  H HA   . ASP A 1 44  ? -13.212 3.819   6.714   1.00 0.00 ? 67  ASP A HA   7  
ATOM 9561  H HB2  . ASP A 1 44  ? -12.384 3.189   8.977   1.00 0.00 ? 67  ASP A HB2  7  
ATOM 9562  H HB3  . ASP A 1 44  ? -10.873 4.021   8.661   1.00 0.00 ? 67  ASP A HB3  7  
ATOM 9563  N N    . ILE A 1 45  ? -11.689 4.743   4.731   1.00 0.00 ? 68  ILE A N    7  
ATOM 9564  C CA   . ILE A 1 45  ? -11.044 5.597   3.734   1.00 0.00 ? 68  ILE A CA   7  
ATOM 9565  C C    . ILE A 1 45  ? -12.162 6.469   3.181   1.00 0.00 ? 68  ILE A C    7  
ATOM 9566  O O    . ILE A 1 45  ? -13.078 5.955   2.537   1.00 0.00 ? 68  ILE A O    7  
ATOM 9567  C CB   . ILE A 1 45  ? -10.294 4.792   2.641   1.00 0.00 ? 68  ILE A CB   7  
ATOM 9568  C CG1  . ILE A 1 45  ? -9.407  3.679   3.257   1.00 0.00 ? 68  ILE A CG1  7  
ATOM 9569  C CG2  . ILE A 1 45  ? -9.481  5.764   1.761   1.00 0.00 ? 68  ILE A CG2  7  
ATOM 9570  C CD1  . ILE A 1 45  ? -8.404  3.024   2.306   1.00 0.00 ? 68  ILE A CD1  7  
ATOM 9571  H H    . ILE A 1 45  ? -12.499 4.222   4.426   1.00 0.00 ? 68  ILE A H    7  
ATOM 9572  H HA   . ILE A 1 45  ? -10.309 6.237   4.219   1.00 0.00 ? 68  ILE A HA   7  
ATOM 9573  H HB   . ILE A 1 45  ? -11.036 4.311   2.000   1.00 0.00 ? 68  ILE A HB   7  
ATOM 9574  H HG12 . ILE A 1 45  ? -8.859  4.030   4.132   1.00 0.00 ? 68  ILE A HG12 7  
ATOM 9575  H HG13 . ILE A 1 45  ? -10.073 2.896   3.599   1.00 0.00 ? 68  ILE A HG13 7  
ATOM 9576  H HG21 . ILE A 1 45  ? -9.063  5.245   0.899   1.00 0.00 ? 68  ILE A HG21 7  
ATOM 9577  H HG22 . ILE A 1 45  ? -10.128 6.553   1.372   1.00 0.00 ? 68  ILE A HG22 7  
ATOM 9578  H HG23 . ILE A 1 45  ? -8.665  6.211   2.334   1.00 0.00 ? 68  ILE A HG23 7  
ATOM 9579  H HD11 . ILE A 1 45  ? -7.660  3.747   1.967   1.00 0.00 ? 68  ILE A HD11 7  
ATOM 9580  H HD12 . ILE A 1 45  ? -7.884  2.228   2.836   1.00 0.00 ? 68  ILE A HD12 7  
ATOM 9581  H HD13 . ILE A 1 45  ? -8.940  2.604   1.459   1.00 0.00 ? 68  ILE A HD13 7  
ATOM 9582  N N    . ASP A 1 46  ? -12.149 7.761   3.503   1.00 0.00 ? 69  ASP A N    7  
ATOM 9583  C CA   . ASP A 1 46  ? -13.122 8.705   2.969   1.00 0.00 ? 69  ASP A CA   7  
ATOM 9584  C C    . ASP A 1 46  ? -12.698 9.091   1.557   1.00 0.00 ? 69  ASP A C    7  
ATOM 9585  O O    . ASP A 1 46  ? -11.619 9.647   1.366   1.00 0.00 ? 69  ASP A O    7  
ATOM 9586  C CB   . ASP A 1 46  ? -13.224 9.958   3.833   1.00 0.00 ? 69  ASP A CB   7  
ATOM 9587  C CG   . ASP A 1 46  ? -14.323 10.848  3.260   1.00 0.00 ? 69  ASP A CG   7  
ATOM 9588  O OD1  . ASP A 1 46  ? -15.502 10.620  3.624   1.00 0.00 ? 69  ASP A OD1  7  
ATOM 9589  O OD2  . ASP A 1 46  ? -14.005 11.735  2.434   1.00 0.00 ? 69  ASP A OD2  7  
ATOM 9590  H H    . ASP A 1 46  ? -11.393 8.123   4.074   1.00 0.00 ? 69  ASP A H    7  
ATOM 9591  H HA   . ASP A 1 46  ? -14.107 8.238   2.945   1.00 0.00 ? 69  ASP A HA   7  
ATOM 9592  H HB2  . ASP A 1 46  ? -13.469 9.681   4.859   1.00 0.00 ? 69  ASP A HB2  7  
ATOM 9593  H HB3  . ASP A 1 46  ? -12.274 10.491  3.837   1.00 0.00 ? 69  ASP A HB3  7  
ATOM 9594  N N    . PHE A 1 47  ? -13.523 8.764   0.567   1.00 0.00 ? 70  PHE A N    7  
ATOM 9595  C CA   . PHE A 1 47  ? -13.269 8.963   -0.853  1.00 0.00 ? 70  PHE A CA   7  
ATOM 9596  C C    . PHE A 1 47  ? -13.935 10.238  -1.392  1.00 0.00 ? 70  PHE A C    7  
ATOM 9597  O O    . PHE A 1 47  ? -14.172 10.339  -2.601  1.00 0.00 ? 70  PHE A O    7  
ATOM 9598  C CB   . PHE A 1 47  ? -13.761 7.724   -1.614  1.00 0.00 ? 70  PHE A CB   7  
ATOM 9599  C CG   . PHE A 1 47  ? -13.007 6.448   -1.319  1.00 0.00 ? 70  PHE A CG   7  
ATOM 9600  C CD1  . PHE A 1 47  ? -11.714 6.271   -1.841  1.00 0.00 ? 70  PHE A CD1  7  
ATOM 9601  C CD2  . PHE A 1 47  ? -13.590 5.432   -0.545  1.00 0.00 ? 70  PHE A CD2  7  
ATOM 9602  C CE1  . PHE A 1 47  ? -11.013 5.075   -1.621  1.00 0.00 ? 70  PHE A CE1  7  
ATOM 9603  C CE2  . PHE A 1 47  ? -12.887 4.240   -0.320  1.00 0.00 ? 70  PHE A CE2  7  
ATOM 9604  C CZ   . PHE A 1 47  ? -11.610 4.052   -0.867  1.00 0.00 ? 70  PHE A CZ   7  
ATOM 9605  H H    . PHE A 1 47  ? -14.386 8.303   0.829   1.00 0.00 ? 70  PHE A H    7  
ATOM 9606  H HA   . PHE A 1 47  ? -12.193 9.063   -1.006  1.00 0.00 ? 70  PHE A HA   7  
ATOM 9607  H HB2  . PHE A 1 47  ? -14.817 7.581   -1.395  1.00 0.00 ? 70  PHE A HB2  7  
ATOM 9608  H HB3  . PHE A 1 47  ? -13.663 7.903   -2.683  1.00 0.00 ? 70  PHE A HB3  7  
ATOM 9609  H HD1  . PHE A 1 47  ? -11.250 7.071   -2.388  1.00 0.00 ? 70  PHE A HD1  7  
ATOM 9610  H HD2  . PHE A 1 47  ? -14.562 5.561   -0.095  1.00 0.00 ? 70  PHE A HD2  7  
ATOM 9611  H HE1  . PHE A 1 47  ? -10.012 4.958   -2.007  1.00 0.00 ? 70  PHE A HE1  7  
ATOM 9612  H HE2  . PHE A 1 47  ? -13.324 3.477   0.299   1.00 0.00 ? 70  PHE A HE2  7  
ATOM 9613  H HZ   . PHE A 1 47  ? -11.093 3.126   -0.679  1.00 0.00 ? 70  PHE A HZ   7  
ATOM 9614  N N    . GLY A 1 48  ? -14.287 11.195  -0.533  1.00 0.00 ? 71  GLY A N    7  
ATOM 9615  C CA   . GLY A 1 48  ? -14.846 12.471  -0.934  1.00 0.00 ? 71  GLY A CA   7  
ATOM 9616  C C    . GLY A 1 48  ? -16.354 12.396  -0.842  1.00 0.00 ? 71  GLY A C    7  
ATOM 9617  O O    . GLY A 1 48  ? -16.895 12.473  0.262   1.00 0.00 ? 71  GLY A O    7  
ATOM 9618  H H    . GLY A 1 48  ? -14.067 11.102  0.453   1.00 0.00 ? 71  GLY A H    7  
ATOM 9619  H HA2  . GLY A 1 48  ? -14.483 13.251  -0.265  1.00 0.00 ? 71  GLY A HA2  7  
ATOM 9620  H HA3  . GLY A 1 48  ? -14.541 12.708  -1.950  1.00 0.00 ? 71  GLY A HA3  7  
ATOM 9621  N N    . ALA A 1 49  ? -17.037 12.250  -1.979  1.00 0.00 ? 72  ALA A N    7  
ATOM 9622  C CA   . ALA A 1 49  ? -18.456 11.921  -2.034  1.00 0.00 ? 72  ALA A CA   7  
ATOM 9623  C C    . ALA A 1 49  ? -18.669 10.625  -2.808  1.00 0.00 ? 72  ALA A C    7  
ATOM 9624  O O    . ALA A 1 49  ? -18.918 9.576   -2.214  1.00 0.00 ? 72  ALA A O    7  
ATOM 9625  C CB   . ALA A 1 49  ? -19.265 13.083  -2.618  1.00 0.00 ? 72  ALA A CB   7  
ATOM 9626  H H    . ALA A 1 49  ? -16.515 12.240  -2.847  1.00 0.00 ? 72  ALA A H    7  
ATOM 9627  H HA   . ALA A 1 49  ? -18.822 11.754  -1.019  1.00 0.00 ? 72  ALA A HA   7  
ATOM 9628  H HB1  . ALA A 1 49  ? -20.326 12.851  -2.537  1.00 0.00 ? 72  ALA A HB1  7  
ATOM 9629  H HB2  . ALA A 1 49  ? -19.047 13.993  -2.063  1.00 0.00 ? 72  ALA A HB2  7  
ATOM 9630  H HB3  . ALA A 1 49  ? -19.026 13.230  -3.670  1.00 0.00 ? 72  ALA A HB3  7  
ATOM 9631  N N    . GLU A 1 50  ? -18.588 10.709  -4.142  1.00 0.00 ? 73  GLU A N    7  
ATOM 9632  C CA   . GLU A 1 50  ? -19.093 9.673   -5.043  1.00 0.00 ? 73  GLU A CA   7  
ATOM 9633  C C    . GLU A 1 50  ? -18.418 8.325   -4.790  1.00 0.00 ? 73  GLU A C    7  
ATOM 9634  O O    . GLU A 1 50  ? -19.077 7.284   -4.776  1.00 0.00 ? 73  GLU A O    7  
ATOM 9635  C CB   . GLU A 1 50  ? -19.018 10.118  -6.518  1.00 0.00 ? 73  GLU A CB   7  
ATOM 9636  C CG   . GLU A 1 50  ? -17.684 10.706  -7.039  1.00 0.00 ? 73  GLU A CG   7  
ATOM 9637  C CD   . GLU A 1 50  ? -17.712 11.025  -8.549  1.00 0.00 ? 73  GLU A CD   7  
ATOM 9638  O OE1  . GLU A 1 50  ? -18.610 11.783  -8.990  1.00 0.00 ? 73  GLU A OE1  7  
ATOM 9639  O OE2  . GLU A 1 50  ? -16.830 10.579  -9.329  1.00 0.00 ? 73  GLU A OE2  7  
ATOM 9640  H H    . GLU A 1 50  ? -18.285 11.592  -4.534  1.00 0.00 ? 73  GLU A H    7  
ATOM 9641  H HA   . GLU A 1 50  ? -20.150 9.526   -4.811  1.00 0.00 ? 73  GLU A HA   7  
ATOM 9642  H HB2  . GLU A 1 50  ? -19.285 9.257   -7.121  1.00 0.00 ? 73  GLU A HB2  7  
ATOM 9643  H HB3  . GLU A 1 50  ? -19.794 10.866  -6.666  1.00 0.00 ? 73  GLU A HB3  7  
ATOM 9644  H HG2  . GLU A 1 50  ? -17.488 11.636  -6.505  1.00 0.00 ? 73  GLU A HG2  7  
ATOM 9645  H HG3  . GLU A 1 50  ? -16.866 10.020  -6.831  1.00 0.00 ? 73  GLU A HG3  7  
ATOM 9646  N N    . GLY A 1 51  ? -17.115 8.347   -4.514  1.00 0.00 ? 74  GLY A N    7  
ATOM 9647  C CA   . GLY A 1 51  ? -16.373 7.130   -4.259  1.00 0.00 ? 74  GLY A CA   7  
ATOM 9648  C C    . GLY A 1 51  ? -16.865 6.390   -3.021  1.00 0.00 ? 74  GLY A C    7  
ATOM 9649  O O    . GLY A 1 51  ? -16.807 5.168   -3.019  1.00 0.00 ? 74  GLY A O    7  
ATOM 9650  H H    . GLY A 1 51  ? -16.623 9.226   -4.580  1.00 0.00 ? 74  GLY A H    7  
ATOM 9651  H HA2  . GLY A 1 51  ? -16.508 6.473   -5.116  1.00 0.00 ? 74  GLY A HA2  7  
ATOM 9652  H HA3  . GLY A 1 51  ? -15.316 7.359   -4.156  1.00 0.00 ? 74  GLY A HA3  7  
ATOM 9653  N N    . ASN A 1 52  ? -17.374 7.073   -1.987  1.00 0.00 ? 75  ASN A N    7  
ATOM 9654  C CA   . ASN A 1 52  ? -17.842 6.396   -0.771  1.00 0.00 ? 75  ASN A CA   7  
ATOM 9655  C C    . ASN A 1 52  ? -19.102 5.615   -1.072  1.00 0.00 ? 75  ASN A C    7  
ATOM 9656  O O    . ASN A 1 52  ? -19.240 4.476   -0.642  1.00 0.00 ? 75  ASN A O    7  
ATOM 9657  C CB   . ASN A 1 52  ? -18.184 7.362   0.364   1.00 0.00 ? 75  ASN A CB   7  
ATOM 9658  C CG   . ASN A 1 52  ? -17.015 8.240   0.723   1.00 0.00 ? 75  ASN A CG   7  
ATOM 9659  O OD1  . ASN A 1 52  ? -16.054 7.787   1.332   1.00 0.00 ? 75  ASN A OD1  7  
ATOM 9660  N ND2  . ASN A 1 52  ? -17.064 9.475   0.278   1.00 0.00 ? 75  ASN A ND2  7  
ATOM 9661  H H    . ASN A 1 52  ? -17.506 8.075   -2.072  1.00 0.00 ? 75  ASN A H    7  
ATOM 9662  H HA   . ASN A 1 52  ? -17.068 5.711   -0.423  1.00 0.00 ? 75  ASN A HA   7  
ATOM 9663  H HB2  . ASN A 1 52  ? -19.046 7.973   0.092   1.00 0.00 ? 75  ASN A HB2  7  
ATOM 9664  H HB3  . ASN A 1 52  ? -18.463 6.783   1.246   1.00 0.00 ? 75  ASN A HB3  7  
ATOM 9665  H HD21 . ASN A 1 52  ? -17.972 9.741   -0.109  1.00 0.00 ? 75  ASN A HD21 7  
ATOM 9666  H HD22 . ASN A 1 52  ? -16.466 10.195  0.666   1.00 0.00 ? 75  ASN A HD22 7  
ATOM 9667  N N    . ARG A 1 53  ? -20.030 6.231   -1.804  1.00 0.00 ? 76  ARG A N    7  
ATOM 9668  C CA   . ARG A 1 53  ? -21.280 5.589   -2.195  1.00 0.00 ? 76  ARG A CA   7  
ATOM 9669  C C    . ARG A 1 53  ? -21.007 4.315   -3.005  1.00 0.00 ? 76  ARG A C    7  
ATOM 9670  O O    . ARG A 1 53  ? -21.577 3.258   -2.735  1.00 0.00 ? 76  ARG A O    7  
ATOM 9671  C CB   . ARG A 1 53  ? -22.129 6.597   -2.973  1.00 0.00 ? 76  ARG A CB   7  
ATOM 9672  C CG   . ARG A 1 53  ? -22.705 7.692   -2.065  1.00 0.00 ? 76  ARG A CG   7  
ATOM 9673  C CD   . ARG A 1 53  ? -24.134 7.420   -1.568  1.00 0.00 ? 76  ARG A CD   7  
ATOM 9674  N NE   . ARG A 1 53  ? -24.194 6.285   -0.636  1.00 0.00 ? 76  ARG A NE   7  
ATOM 9675  C CZ   . ARG A 1 53  ? -23.923 6.320   0.673   1.00 0.00 ? 76  ARG A CZ   7  
ATOM 9676  N NH1  . ARG A 1 53  ? -23.648 7.470   1.281   1.00 0.00 ? 76  ARG A NH1  7  
ATOM 9677  N NH2  . ARG A 1 53  ? -23.911 5.198   1.374   1.00 0.00 ? 76  ARG A NH2  7  
ATOM 9678  H H    . ARG A 1 53  ? -19.840 7.191   -2.080  1.00 0.00 ? 76  ARG A H    7  
ATOM 9679  H HA   . ARG A 1 53  ? -21.818 5.322   -1.290  1.00 0.00 ? 76  ARG A HA   7  
ATOM 9680  H HB2  . ARG A 1 53  ? -21.518 7.060   -3.749  1.00 0.00 ? 76  ARG A HB2  7  
ATOM 9681  H HB3  . ARG A 1 53  ? -22.944 6.083   -3.462  1.00 0.00 ? 76  ARG A HB3  7  
ATOM 9682  H HG2  . ARG A 1 53  ? -22.045 7.876   -1.220  1.00 0.00 ? 76  ARG A HG2  7  
ATOM 9683  H HG3  . ARG A 1 53  ? -22.722 8.595   -2.651  1.00 0.00 ? 76  ARG A HG3  7  
ATOM 9684  H HD2  . ARG A 1 53  ? -24.521 8.317   -1.083  1.00 0.00 ? 76  ARG A HD2  7  
ATOM 9685  H HD3  . ARG A 1 53  ? -24.772 7.204   -2.424  1.00 0.00 ? 76  ARG A HD3  7  
ATOM 9686  H HE   . ARG A 1 53  ? -24.382 5.388   -1.091  1.00 0.00 ? 76  ARG A HE   7  
ATOM 9687  H HH11 . ARG A 1 53  ? -23.702 8.355   0.799   1.00 0.00 ? 76  ARG A HH11 7  
ATOM 9688  H HH12 . ARG A 1 53  ? -23.376 7.506   2.265   1.00 0.00 ? 76  ARG A HH12 7  
ATOM 9689  H HH21 . ARG A 1 53  ? -24.246 4.316   0.986   1.00 0.00 ? 76  ARG A HH21 7  
ATOM 9690  H HH22 . ARG A 1 53  ? -23.684 5.188   2.368   1.00 0.00 ? 76  ARG A HH22 7  
ATOM 9691  N N    . TYR A 1 54  ? -20.134 4.407   -4.005  1.00 0.00 ? 77  TYR A N    7  
ATOM 9692  C CA   . TYR A 1 54  ? -19.690 3.273   -4.816  1.00 0.00 ? 77  TYR A CA   7  
ATOM 9693  C C    . TYR A 1 54  ? -18.887 2.262   -3.983  1.00 0.00 ? 77  TYR A C    7  
ATOM 9694  O O    . TYR A 1 54  ? -18.899 1.066   -4.285  1.00 0.00 ? 77  TYR A O    7  
ATOM 9695  C CB   . TYR A 1 54  ? -18.864 3.841   -5.965  1.00 0.00 ? 77  TYR A CB   7  
ATOM 9696  C CG   . TYR A 1 54  ? -19.049 3.040   -7.225  1.00 0.00 ? 77  TYR A CG   7  
ATOM 9697  C CD1  . TYR A 1 54  ? -18.340 1.845   -7.394  1.00 0.00 ? 77  TYR A CD1  7  
ATOM 9698  C CD2  . TYR A 1 54  ? -19.909 3.500   -8.238  1.00 0.00 ? 77  TYR A CD2  7  
ATOM 9699  C CE1  . TYR A 1 54  ? -18.477 1.107   -8.571  1.00 0.00 ? 77  TYR A CE1  7  
ATOM 9700  C CE2  . TYR A 1 54  ? -19.981 2.808   -9.456  1.00 0.00 ? 77  TYR A CE2  7  
ATOM 9701  C CZ   . TYR A 1 54  ? -19.266 1.604   -9.628  1.00 0.00 ? 77  TYR A CZ   7  
ATOM 9702  O OH   . TYR A 1 54  ? -19.304 0.931   -10.806 1.00 0.00 ? 77  TYR A OH   7  
ATOM 9703  H H    . TYR A 1 54  ? -19.734 5.318   -4.208  1.00 0.00 ? 77  TYR A H    7  
ATOM 9704  H HA   . TYR A 1 54  ? -20.531 2.729   -5.278  1.00 0.00 ? 77  TYR A HA   7  
ATOM 9705  H HB2  . TYR A 1 54  ? -19.174 4.865   -6.174  1.00 0.00 ? 77  TYR A HB2  7  
ATOM 9706  H HB3  . TYR A 1 54  ? -17.808 3.873   -5.692  1.00 0.00 ? 77  TYR A HB3  7  
ATOM 9707  H HD1  . TYR A 1 54  ? -17.699 1.488   -6.612  1.00 0.00 ? 77  TYR A HD1  7  
ATOM 9708  H HD2  . TYR A 1 54  ? -20.470 4.416   -8.113  1.00 0.00 ? 77  TYR A HD2  7  
ATOM 9709  H HE1  . TYR A 1 54  ? -17.984 0.161   -8.645  1.00 0.00 ? 77  TYR A HE1  7  
ATOM 9710  H HE2  . TYR A 1 54  ? -20.581 3.217   -10.250 1.00 0.00 ? 77  TYR A HE2  7  
ATOM 9711  H HH   . TYR A 1 54  ? -20.070 0.313   -10.783 1.00 0.00 ? 77  TYR A HH   7  
ATOM 9712  N N    . TYR A 1 55  ? -18.182 2.698   -2.933  1.00 0.00 ? 78  TYR A N    7  
ATOM 9713  C CA   . TYR A 1 55  ? -17.556 1.795   -1.977  1.00 0.00 ? 78  TYR A CA   7  
ATOM 9714  C C    . TYR A 1 55  ? -18.673 1.024   -1.294  1.00 0.00 ? 78  TYR A C    7  
ATOM 9715  O O    . TYR A 1 55  ? -18.763 -0.173  -1.512  1.00 0.00 ? 78  TYR A O    7  
ATOM 9716  C CB   . TYR A 1 55  ? -16.630 2.532   -0.991  1.00 0.00 ? 78  TYR A CB   7  
ATOM 9717  C CG   . TYR A 1 55  ? -15.498 1.707   -0.408  1.00 0.00 ? 78  TYR A CG   7  
ATOM 9718  C CD1  . TYR A 1 55  ? -14.661 0.962   -1.262  1.00 0.00 ? 78  TYR A CD1  7  
ATOM 9719  C CD2  . TYR A 1 55  ? -15.186 1.792   0.964   1.00 0.00 ? 78  TYR A CD2  7  
ATOM 9720  C CE1  . TYR A 1 55  ? -13.530 0.303   -0.764  1.00 0.00 ? 78  TYR A CE1  7  
ATOM 9721  C CE2  . TYR A 1 55  ? -14.017 1.188   1.456   1.00 0.00 ? 78  TYR A CE2  7  
ATOM 9722  C CZ   . TYR A 1 55  ? -13.180 0.467   0.589   1.00 0.00 ? 78  TYR A CZ   7  
ATOM 9723  O OH   . TYR A 1 55  ? -11.995 0.002   1.046   1.00 0.00 ? 78  TYR A OH   7  
ATOM 9724  H H    . TYR A 1 55  ? -18.079 3.694   -2.777  1.00 0.00 ? 78  TYR A H    7  
ATOM 9725  H HA   . TYR A 1 55  ? -16.957 1.072   -2.536  1.00 0.00 ? 78  TYR A HA   7  
ATOM 9726  H HB2  . TYR A 1 55  ? -16.149 3.358   -1.509  1.00 0.00 ? 78  TYR A HB2  7  
ATOM 9727  H HB3  . TYR A 1 55  ? -17.220 2.950   -0.177  1.00 0.00 ? 78  TYR A HB3  7  
ATOM 9728  H HD1  . TYR A 1 55  ? -14.835 0.941   -2.322  1.00 0.00 ? 78  TYR A HD1  7  
ATOM 9729  H HD2  . TYR A 1 55  ? -15.781 2.398   1.633   1.00 0.00 ? 78  TYR A HD2  7  
ATOM 9730  H HE1  . TYR A 1 55  ? -12.891 -0.249  -1.435  1.00 0.00 ? 78  TYR A HE1  7  
ATOM 9731  H HE2  . TYR A 1 55  ? -13.717 1.312   2.485   1.00 0.00 ? 78  TYR A HE2  7  
ATOM 9732  H HH   . TYR A 1 55  ? -11.690 0.543   1.783   1.00 0.00 ? 78  TYR A HH   7  
ATOM 9733  N N    . GLU A 1 56  ? -19.571 1.678   -0.557  1.00 0.00 ? 79  GLU A N    7  
ATOM 9734  C CA   . GLU A 1 56  ? -20.675 1.070   0.180   1.00 0.00 ? 79  GLU A CA   7  
ATOM 9735  C C    . GLU A 1 56  ? -21.420 0.003   -0.602  1.00 0.00 ? 79  GLU A C    7  
ATOM 9736  O O    . GLU A 1 56  ? -21.797 -1.023  -0.032  1.00 0.00 ? 79  GLU A O    7  
ATOM 9737  C CB   . GLU A 1 56  ? -21.659 2.170   0.580   1.00 0.00 ? 79  GLU A CB   7  
ATOM 9738  C CG   . GLU A 1 56  ? -21.402 2.561   2.020   1.00 0.00 ? 79  GLU A CG   7  
ATOM 9739  C CD   . GLU A 1 56  ? -22.038 1.545   2.974   1.00 0.00 ? 79  GLU A CD   7  
ATOM 9740  O OE1  . GLU A 1 56  ? -21.417 0.504   3.283   1.00 0.00 ? 79  GLU A OE1  7  
ATOM 9741  O OE2  . GLU A 1 56  ? -23.212 1.711   3.377   1.00 0.00 ? 79  GLU A OE2  7  
ATOM 9742  H H    . GLU A 1 56  ? -19.482 2.688   -0.473  1.00 0.00 ? 79  GLU A H    7  
ATOM 9743  H HA   . GLU A 1 56  ? -20.263 0.587   1.066   1.00 0.00 ? 79  GLU A HA   7  
ATOM 9744  H HB2  . GLU A 1 56  ? -21.543 3.044   -0.064  1.00 0.00 ? 79  GLU A HB2  7  
ATOM 9745  H HB3  . GLU A 1 56  ? -22.690 1.825   0.490   1.00 0.00 ? 79  GLU A HB3  7  
ATOM 9746  H HG2  . GLU A 1 56  ? -20.332 2.677   2.189   1.00 0.00 ? 79  GLU A HG2  7  
ATOM 9747  H HG3  . GLU A 1 56  ? -21.851 3.524   2.145   1.00 0.00 ? 79  GLU A HG3  7  
ATOM 9748  N N    . ALA A 1 57  ? -21.592 0.239   -1.898  1.00 0.00 ? 80  ALA A N    7  
ATOM 9749  C CA   . ALA A 1 57  ? -22.072 -0.774  -2.819  1.00 0.00 ? 80  ALA A CA   7  
ATOM 9750  C C    . ALA A 1 57  ? -21.256 -2.077  -2.747  1.00 0.00 ? 80  ALA A C    7  
ATOM 9751  O O    . ALA A 1 57  ? -21.728 -3.097  -2.237  1.00 0.00 ? 80  ALA A O    7  
ATOM 9752  C CB   . ALA A 1 57  ? -22.156 -0.207  -4.243  1.00 0.00 ? 80  ALA A CB   7  
ATOM 9753  H H    . ALA A 1 57  ? -21.369 1.186   -2.188  1.00 0.00 ? 80  ALA A H    7  
ATOM 9754  H HA   . ALA A 1 57  ? -23.068 -1.013  -2.486  1.00 0.00 ? 80  ALA A HA   7  
ATOM 9755  H HB1  . ALA A 1 57  ? -21.161 0.011   -4.632  1.00 0.00 ? 80  ALA A HB1  7  
ATOM 9756  H HB2  . ALA A 1 57  ? -22.616 -0.943  -4.901  1.00 0.00 ? 80  ALA A HB2  7  
ATOM 9757  H HB3  . ALA A 1 57  ? -22.765 0.698   -4.246  1.00 0.00 ? 80  ALA A HB3  7  
ATOM 9758  N N    . ASN A 1 58  ? -20.036 -2.057  -3.287  1.00 0.00 ? 81  ASN A N    7  
ATOM 9759  C CA   . ASN A 1 58  ? -19.270 -3.238  -3.701  1.00 0.00 ? 81  ASN A CA   7  
ATOM 9760  C C    . ASN A 1 58  ? -17.790 -3.129  -3.300  1.00 0.00 ? 81  ASN A C    7  
ATOM 9761  O O    . ASN A 1 58  ? -16.893 -3.629  -3.977  1.00 0.00 ? 81  ASN A O    7  
ATOM 9762  C CB   . ASN A 1 58  ? -19.490 -3.492  -5.203  1.00 0.00 ? 81  ASN A CB   7  
ATOM 9763  C CG   . ASN A 1 58  ? -19.343 -2.234  -6.045  1.00 0.00 ? 81  ASN A CG   7  
ATOM 9764  O OD1  . ASN A 1 58  ? -20.309 -1.760  -6.626  1.00 0.00 ? 81  ASN A OD1  7  
ATOM 9765  N ND2  . ASN A 1 58  ? -18.170 -1.635  -6.072  1.00 0.00 ? 81  ASN A ND2  7  
ATOM 9766  H H    . ASN A 1 58  ? -19.700 -1.147  -3.586  1.00 0.00 ? 81  ASN A H    7  
ATOM 9767  H HA   . ASN A 1 58  ? -19.673 -4.104  -3.178  1.00 0.00 ? 81  ASN A HA   7  
ATOM 9768  H HB2  . ASN A 1 58  ? -18.812 -4.268  -5.565  1.00 0.00 ? 81  ASN A HB2  7  
ATOM 9769  H HB3  . ASN A 1 58  ? -20.510 -3.859  -5.329  1.00 0.00 ? 81  ASN A HB3  7  
ATOM 9770  H HD21 . ASN A 1 58  ? -17.385 -2.145  -5.705  1.00 0.00 ? 81  ASN A HD21 7  
ATOM 9771  H HD22 . ASN A 1 58  ? -18.089 -0.804  -6.632  1.00 0.00 ? 81  ASN A HD22 7  
ATOM 9772  N N    . TYR A 1 59  ? -17.529 -2.491  -2.162  1.00 0.00 ? 82  TYR A N    7  
ATOM 9773  C CA   . TYR A 1 59  ? -16.254 -2.272  -1.473  1.00 0.00 ? 82  TYR A CA   7  
ATOM 9774  C C    . TYR A 1 59  ? -15.410 -3.533  -1.298  1.00 0.00 ? 82  TYR A C    7  
ATOM 9775  O O    . TYR A 1 59  ? -14.196 -3.456  -1.130  1.00 0.00 ? 82  TYR A O    7  
ATOM 9776  C CB   . TYR A 1 59  ? -16.553 -1.745  -0.059  1.00 0.00 ? 82  TYR A CB   7  
ATOM 9777  C CG   . TYR A 1 59  ? -17.492 -2.642  0.739   1.00 0.00 ? 82  TYR A CG   7  
ATOM 9778  C CD1  . TYR A 1 59  ? -18.895 -2.580  0.601   1.00 0.00 ? 82  TYR A CD1  7  
ATOM 9779  C CD2  . TYR A 1 59  ? -16.929 -3.578  1.622   1.00 0.00 ? 82  TYR A CD2  7  
ATOM 9780  C CE1  . TYR A 1 59  ? -19.703 -3.444  1.349   1.00 0.00 ? 82  TYR A CE1  7  
ATOM 9781  C CE2  . TYR A 1 59  ? -17.735 -4.432  2.392   1.00 0.00 ? 82  TYR A CE2  7  
ATOM 9782  C CZ   . TYR A 1 59  ? -19.138 -4.370  2.252   1.00 0.00 ? 82  TYR A CZ   7  
ATOM 9783  O OH   . TYR A 1 59  ? -19.940 -5.207  2.966   1.00 0.00 ? 82  TYR A OH   7  
ATOM 9784  H H    . TYR A 1 59  ? -18.308 -1.990  -1.743  1.00 0.00 ? 82  TYR A H    7  
ATOM 9785  H HA   . TYR A 1 59  ? -15.673 -1.531  -2.021  1.00 0.00 ? 82  TYR A HA   7  
ATOM 9786  H HB2  . TYR A 1 59  ? -15.608 -1.654  0.479   1.00 0.00 ? 82  TYR A HB2  7  
ATOM 9787  H HB3  . TYR A 1 59  ? -16.954 -0.739  -0.090  1.00 0.00 ? 82  TYR A HB3  7  
ATOM 9788  H HD1  . TYR A 1 59  ? -19.409 -1.895  -0.066  1.00 0.00 ? 82  TYR A HD1  7  
ATOM 9789  H HD2  . TYR A 1 59  ? -15.858 -3.619  1.715   1.00 0.00 ? 82  TYR A HD2  7  
ATOM 9790  H HE1  . TYR A 1 59  ? -20.767 -3.373  1.211   1.00 0.00 ? 82  TYR A HE1  7  
ATOM 9791  H HE2  . TYR A 1 59  ? -17.266 -5.114  3.090   1.00 0.00 ? 82  TYR A HE2  7  
ATOM 9792  H HH   . TYR A 1 59  ? -20.878 -4.951  2.877   1.00 0.00 ? 82  TYR A HH   7  
ATOM 9793  N N    . TRP A 1 60  ? -16.037 -4.703  -1.294  1.00 0.00 ? 83  TRP A N    7  
ATOM 9794  C CA   . TRP A 1 60  ? -15.383 -5.972  -1.039  1.00 0.00 ? 83  TRP A CA   7  
ATOM 9795  C C    . TRP A 1 60  ? -14.495 -6.419  -2.203  1.00 0.00 ? 83  TRP A C    7  
ATOM 9796  O O    . TRP A 1 60  ? -13.605 -7.244  -2.008  1.00 0.00 ? 83  TRP A O    7  
ATOM 9797  C CB   . TRP A 1 60  ? -16.463 -6.996  -0.706  1.00 0.00 ? 83  TRP A CB   7  
ATOM 9798  C CG   . TRP A 1 60  ? -17.508 -7.243  -1.748  1.00 0.00 ? 83  TRP A CG   7  
ATOM 9799  C CD1  . TRP A 1 60  ? -18.585 -6.469  -2.013  1.00 0.00 ? 83  TRP A CD1  7  
ATOM 9800  C CD2  . TRP A 1 60  ? -17.606 -8.387  -2.637  1.00 0.00 ? 83  TRP A CD2  7  
ATOM 9801  N NE1  . TRP A 1 60  ? -19.370 -7.085  -2.968  1.00 0.00 ? 83  TRP A NE1  7  
ATOM 9802  C CE2  . TRP A 1 60  ? -18.825 -8.286  -3.365  1.00 0.00 ? 83  TRP A CE2  7  
ATOM 9803  C CE3  . TRP A 1 60  ? -16.792 -9.509  -2.884  1.00 0.00 ? 83  TRP A CE3  7  
ATOM 9804  C CZ2  . TRP A 1 60  ? -19.240 -9.279  -4.257  1.00 0.00 ? 83  TRP A CZ2  7  
ATOM 9805  C CZ3  . TRP A 1 60  ? -17.174 -10.484 -3.820  1.00 0.00 ? 83  TRP A CZ3  7  
ATOM 9806  C CH2  . TRP A 1 60  ? -18.400 -10.377 -4.495  1.00 0.00 ? 83  TRP A CH2  7  
ATOM 9807  H H    . TRP A 1 60  ? -17.034 -4.716  -1.424  1.00 0.00 ? 83  TRP A H    7  
ATOM 9808  H HA   . TRP A 1 60  ? -14.743 -5.867  -0.165  1.00 0.00 ? 83  TRP A HA   7  
ATOM 9809  H HB2  . TRP A 1 60  ? -15.966 -7.941  -0.480  1.00 0.00 ? 83  TRP A HB2  7  
ATOM 9810  H HB3  . TRP A 1 60  ? -16.976 -6.678  0.202   1.00 0.00 ? 83  TRP A HB3  7  
ATOM 9811  H HD1  . TRP A 1 60  ? -18.833 -5.545  -1.508  1.00 0.00 ? 83  TRP A HD1  7  
ATOM 9812  H HE1  . TRP A 1 60  ? -20.262 -6.726  -3.325  1.00 0.00 ? 83  TRP A HE1  7  
ATOM 9813  H HE3  . TRP A 1 60  ? -15.858 -9.612  -2.347  1.00 0.00 ? 83  TRP A HE3  7  
ATOM 9814  H HZ2  . TRP A 1 60  ? -20.187 -9.188  -4.768  1.00 0.00 ? 83  TRP A HZ2  7  
ATOM 9815  H HZ3  . TRP A 1 60  ? -16.526 -11.327 -4.020  1.00 0.00 ? 83  TRP A HZ3  7  
ATOM 9816  H HH2  . TRP A 1 60  ? -18.675 -11.128 -5.220  1.00 0.00 ? 83  TRP A HH2  7  
ATOM 9817  N N    . GLN A 1 61  ? -14.679 -5.845  -3.396  1.00 0.00 ? 84  GLN A N    7  
ATOM 9818  C CA   . GLN A 1 61  ? -13.890 -6.158  -4.586  1.00 0.00 ? 84  GLN A CA   7  
ATOM 9819  C C    . GLN A 1 61  ? -12.632 -5.274  -4.648  1.00 0.00 ? 84  GLN A C    7  
ATOM 9820  O O    . GLN A 1 61  ? -12.212 -4.850  -5.723  1.00 0.00 ? 84  GLN A O    7  
ATOM 9821  C CB   . GLN A 1 61  ? -14.773 -6.072  -5.849  1.00 0.00 ? 84  GLN A CB   7  
ATOM 9822  C CG   . GLN A 1 61  ? -16.129 -6.787  -5.679  1.00 0.00 ? 84  GLN A CG   7  
ATOM 9823  C CD   . GLN A 1 61  ? -16.637 -7.473  -6.946  1.00 0.00 ? 84  GLN A CD   7  
ATOM 9824  O OE1  . GLN A 1 61  ? -16.471 -7.005  -8.073  1.00 0.00 ? 84  GLN A OE1  7  
ATOM 9825  N NE2  . GLN A 1 61  ? -17.325 -8.586  -6.778  1.00 0.00 ? 84  GLN A NE2  7  
ATOM 9826  H H    . GLN A 1 61  ? -15.397 -5.139  -3.495  1.00 0.00 ? 84  GLN A H    7  
ATOM 9827  H HA   . GLN A 1 61  ? -13.546 -7.188  -4.504  1.00 0.00 ? 84  GLN A HA   7  
ATOM 9828  H HB2  . GLN A 1 61  ? -14.954 -5.027  -6.109  1.00 0.00 ? 84  GLN A HB2  7  
ATOM 9829  H HB3  . GLN A 1 61  ? -14.225 -6.541  -6.667  1.00 0.00 ? 84  GLN A HB3  7  
ATOM 9830  H HG2  . GLN A 1 61  ? -16.037 -7.548  -4.903  1.00 0.00 ? 84  GLN A HG2  7  
ATOM 9831  H HG3  . GLN A 1 61  ? -16.876 -6.065  -5.346  1.00 0.00 ? 84  GLN A HG3  7  
ATOM 9832  H HE21 . GLN A 1 61  ? -17.437 -8.981  -5.852  1.00 0.00 ? 84  GLN A HE21 7  
ATOM 9833  H HE22 . GLN A 1 61  ? -17.583 -9.162  -7.575  1.00 0.00 ? 84  GLN A HE22 7  
ATOM 9834  N N    . PHE A 1 62  ? -12.063 -4.927  -3.492  1.00 0.00 ? 85  PHE A N    7  
ATOM 9835  C CA   . PHE A 1 62  ? -10.950 -3.995  -3.350  1.00 0.00 ? 85  PHE A CA   7  
ATOM 9836  C C    . PHE A 1 62  ? -10.000 -4.505  -2.259  1.00 0.00 ? 85  PHE A C    7  
ATOM 9837  O O    . PHE A 1 62  ? -10.438 -5.277  -1.404  1.00 0.00 ? 85  PHE A O    7  
ATOM 9838  C CB   . PHE A 1 62  ? -11.494 -2.611  -2.979  1.00 0.00 ? 85  PHE A CB   7  
ATOM 9839  C CG   . PHE A 1 62  ? -12.331 -1.928  -4.046  1.00 0.00 ? 85  PHE A CG   7  
ATOM 9840  C CD1  . PHE A 1 62  ? -13.694 -2.243  -4.201  1.00 0.00 ? 85  PHE A CD1  7  
ATOM 9841  C CD2  . PHE A 1 62  ? -11.748 -0.964  -4.889  1.00 0.00 ? 85  PHE A CD2  7  
ATOM 9842  C CE1  . PHE A 1 62  ? -14.468 -1.602  -5.178  1.00 0.00 ? 85  PHE A CE1  7  
ATOM 9843  C CE2  . PHE A 1 62  ? -12.525 -0.324  -5.870  1.00 0.00 ? 85  PHE A CE2  7  
ATOM 9844  C CZ   . PHE A 1 62  ? -13.882 -0.639  -6.013  1.00 0.00 ? 85  PHE A CZ   7  
ATOM 9845  H H    . PHE A 1 62  ? -12.391 -5.367  -2.642  1.00 0.00 ? 85  PHE A H    7  
ATOM 9846  H HA   . PHE A 1 62  ? -10.411 -3.927  -4.297  1.00 0.00 ? 85  PHE A HA   7  
ATOM 9847  H HB2  . PHE A 1 62  ? -12.065 -2.681  -2.057  1.00 0.00 ? 85  PHE A HB2  7  
ATOM 9848  H HB3  . PHE A 1 62  ? -10.649 -1.976  -2.748  1.00 0.00 ? 85  PHE A HB3  7  
ATOM 9849  H HD1  . PHE A 1 62  ? -14.156 -2.996  -3.587  1.00 0.00 ? 85  PHE A HD1  7  
ATOM 9850  H HD2  . PHE A 1 62  ? -10.703 -0.711  -4.782  1.00 0.00 ? 85  PHE A HD2  7  
ATOM 9851  H HE1  . PHE A 1 62  ? -15.512 -1.848  -5.277  1.00 0.00 ? 85  PHE A HE1  7  
ATOM 9852  H HE2  . PHE A 1 62  ? -12.094 0.427   -6.511  1.00 0.00 ? 85  PHE A HE2  7  
ATOM 9853  H HZ   . PHE A 1 62  ? -14.476 -0.115  -6.744  1.00 0.00 ? 85  PHE A HZ   7  
ATOM 9854  N N    . PRO A 1 63  ? -8.714  -4.107  -2.257  1.00 0.00 ? 86  PRO A N    7  
ATOM 9855  C CA   . PRO A 1 63  ? -7.740  -4.630  -1.312  1.00 0.00 ? 86  PRO A CA   7  
ATOM 9856  C C    . PRO A 1 63  ? -8.000  -4.114  0.104   1.00 0.00 ? 86  PRO A C    7  
ATOM 9857  O O    . PRO A 1 63  ? -8.819  -3.222  0.334   1.00 0.00 ? 86  PRO A O    7  
ATOM 9858  C CB   . PRO A 1 63  ? -6.364  -4.214  -1.830  1.00 0.00 ? 86  PRO A CB   7  
ATOM 9859  C CG   . PRO A 1 63  ? -6.665  -2.954  -2.625  1.00 0.00 ? 86  PRO A CG   7  
ATOM 9860  C CD   . PRO A 1 63  ? -8.081  -3.165  -3.163  1.00 0.00 ? 86  PRO A CD   7  
ATOM 9861  H HA   . PRO A 1 63  ? -7.788  -5.717  -1.318  1.00 0.00 ? 86  PRO A HA   7  
ATOM 9862  H HB2  . PRO A 1 63  ? -5.646  -4.020  -1.032  1.00 0.00 ? 86  PRO A HB2  7  
ATOM 9863  H HB3  . PRO A 1 63  ? -5.983  -4.990  -2.483  1.00 0.00 ? 86  PRO A HB3  7  
ATOM 9864  H HG2  . PRO A 1 63  ? -6.663  -2.121  -1.935  1.00 0.00 ? 86  PRO A HG2  7  
ATOM 9865  H HG3  . PRO A 1 63  ? -5.938  -2.777  -3.411  1.00 0.00 ? 86  PRO A HG3  7  
ATOM 9866  H HD2  . PRO A 1 63  ? -8.603  -2.212  -3.189  1.00 0.00 ? 86  PRO A HD2  7  
ATOM 9867  H HD3  . PRO A 1 63  ? -8.060  -3.595  -4.158  1.00 0.00 ? 86  PRO A HD3  7  
ATOM 9868  N N    . ASP A 1 64  ? -7.266  -4.694  1.049   1.00 0.00 ? 87  ASP A N    7  
ATOM 9869  C CA   . ASP A 1 64  ? -7.297  -4.339  2.459   1.00 0.00 ? 87  ASP A CA   7  
ATOM 9870  C C    . ASP A 1 64  ? -6.035  -3.551  2.805   1.00 0.00 ? 87  ASP A C    7  
ATOM 9871  O O    . ASP A 1 64  ? -6.091  -2.365  3.129   1.00 0.00 ? 87  ASP A O    7  
ATOM 9872  C CB   . ASP A 1 64  ? -7.443  -5.617  3.285   1.00 0.00 ? 87  ASP A CB   7  
ATOM 9873  C CG   . ASP A 1 64  ? -7.372  -5.328  4.780   1.00 0.00 ? 87  ASP A CG   7  
ATOM 9874  O OD1  . ASP A 1 64  ? -7.840  -4.252  5.206   1.00 0.00 ? 87  ASP A OD1  7  
ATOM 9875  O OD2  . ASP A 1 64  ? -6.938  -6.232  5.519   1.00 0.00 ? 87  ASP A OD2  7  
ATOM 9876  H H    . ASP A 1 64  ? -6.560  -5.354  0.768   1.00 0.00 ? 87  ASP A H    7  
ATOM 9877  H HA   . ASP A 1 64  ? -8.157  -3.712  2.665   1.00 0.00 ? 87  ASP A HA   7  
ATOM 9878  H HB2  . ASP A 1 64  ? -8.406  -6.078  3.061   1.00 0.00 ? 87  ASP A HB2  7  
ATOM 9879  H HB3  . ASP A 1 64  ? -6.656  -6.319  3.012   1.00 0.00 ? 87  ASP A HB3  7  
ATOM 9880  N N    . GLY A 1 65  ? -4.882  -4.187  2.619   1.00 0.00 ? 88  GLY A N    7  
ATOM 9881  C CA   . GLY A 1 65  ? -3.581  -3.550  2.575   1.00 0.00 ? 88  GLY A CA   7  
ATOM 9882  C C    . GLY A 1 65  ? -2.812  -4.011  1.347   1.00 0.00 ? 88  GLY A C    7  
ATOM 9883  O O    . GLY A 1 65  ? -3.296  -4.850  0.573   1.00 0.00 ? 88  GLY A O    7  
ATOM 9884  H H    . GLY A 1 65  ? -4.893  -5.154  2.349   1.00 0.00 ? 88  GLY A H    7  
ATOM 9885  H HA2  . GLY A 1 65  ? -3.699  -2.478  2.517   1.00 0.00 ? 88  GLY A HA2  7  
ATOM 9886  H HA3  . GLY A 1 65  ? -3.023  -3.781  3.482   1.00 0.00 ? 88  GLY A HA3  7  
ATOM 9887  N N    . ILE A 1 66  ? -1.612  -3.465  1.175   1.00 0.00 ? 89  ILE A N    7  
ATOM 9888  C CA   . ILE A 1 66  ? -0.652  -3.903  0.168   1.00 0.00 ? 89  ILE A CA   7  
ATOM 9889  C C    . ILE A 1 66  ? 0.584   -4.443  0.882   1.00 0.00 ? 89  ILE A C    7  
ATOM 9890  O O    . ILE A 1 66  ? 1.093   -3.830  1.818   1.00 0.00 ? 89  ILE A O    7  
ATOM 9891  C CB   . ILE A 1 66  ? -0.327  -2.751  -0.807  1.00 0.00 ? 89  ILE A CB   7  
ATOM 9892  C CG1  . ILE A 1 66  ? -1.581  -2.218  -1.525  1.00 0.00 ? 89  ILE A CG1  7  
ATOM 9893  C CG2  . ILE A 1 66  ? 0.707   -3.195  -1.852  1.00 0.00 ? 89  ILE A CG2  7  
ATOM 9894  C CD1  . ILE A 1 66  ? -2.271  -3.216  -2.461  1.00 0.00 ? 89  ILE A CD1  7  
ATOM 9895  H H    . ILE A 1 66  ? -1.336  -2.722  1.817   1.00 0.00 ? 89  ILE A H    7  
ATOM 9896  H HA   . ILE A 1 66  ? -1.079  -4.722  -0.409  1.00 0.00 ? 89  ILE A HA   7  
ATOM 9897  H HB   . ILE A 1 66  ? 0.102   -1.923  -0.238  1.00 0.00 ? 89  ILE A HB   7  
ATOM 9898  H HG12 . ILE A 1 66  ? -2.307  -1.904  -0.785  1.00 0.00 ? 89  ILE A HG12 7  
ATOM 9899  H HG13 . ILE A 1 66  ? -1.295  -1.333  -2.092  1.00 0.00 ? 89  ILE A HG13 7  
ATOM 9900  H HG21 . ILE A 1 66  ? 1.692   -3.178  -1.402  1.00 0.00 ? 89  ILE A HG21 7  
ATOM 9901  H HG22 . ILE A 1 66  ? 0.464   -4.203  -2.207  1.00 0.00 ? 89  ILE A HG22 7  
ATOM 9902  H HG23 . ILE A 1 66  ? 0.735   -2.493  -2.686  1.00 0.00 ? 89  ILE A HG23 7  
ATOM 9903  H HD11 . ILE A 1 66  ? -1.629  -3.433  -3.314  1.00 0.00 ? 89  ILE A HD11 7  
ATOM 9904  H HD12 . ILE A 1 66  ? -2.508  -4.136  -1.934  1.00 0.00 ? 89  ILE A HD12 7  
ATOM 9905  H HD13 . ILE A 1 66  ? -3.206  -2.787  -2.818  1.00 0.00 ? 89  ILE A HD13 7  
ATOM 9906  N N    . HIS A 1 67  ? 1.083   -5.586  0.408   1.00 0.00 ? 90  HIS A N    7  
ATOM 9907  C CA   . HIS A 1 67  ? 2.244   -6.268  0.978   1.00 0.00 ? 90  HIS A CA   7  
ATOM 9908  C C    . HIS A 1 67  ? 3.557   -5.530  0.703   1.00 0.00 ? 90  HIS A C    7  
ATOM 9909  O O    . HIS A 1 67  ? 4.582   -5.843  1.298   1.00 0.00 ? 90  HIS A O    7  
ATOM 9910  C CB   . HIS A 1 67  ? 2.352   -7.694  0.423   1.00 0.00 ? 90  HIS A CB   7  
ATOM 9911  C CG   . HIS A 1 67  ? 1.095   -8.515  0.531   1.00 0.00 ? 90  HIS A CG   7  
ATOM 9912  N ND1  . HIS A 1 67  ? -0.017  -8.383  -0.260  1.00 0.00 ? 90  HIS A ND1  7  
ATOM 9913  C CD2  . HIS A 1 67  ? 0.900   -9.610  1.326   1.00 0.00 ? 90  HIS A CD2  7  
ATOM 9914  C CE1  . HIS A 1 67  ? -0.849  -9.390  0.019   1.00 0.00 ? 90  HIS A CE1  7  
ATOM 9915  N NE2  . HIS A 1 67  ? -0.361  -10.143 1.021   1.00 0.00 ? 90  HIS A NE2  7  
ATOM 9916  H H    . HIS A 1 67  ? 0.588   -6.055  -0.335  1.00 0.00 ? 90  HIS A H    7  
ATOM 9917  H HA   . HIS A 1 67  ? 2.108   -6.330  2.052   1.00 0.00 ? 90  HIS A HA   7  
ATOM 9918  H HB2  . HIS A 1 67  ? 2.644   -7.651  -0.627  1.00 0.00 ? 90  HIS A HB2  7  
ATOM 9919  H HB3  . HIS A 1 67  ? 3.145   -8.207  0.970   1.00 0.00 ? 90  HIS A HB3  7  
ATOM 9920  H HD1  . HIS A 1 67  ? -0.177  -7.712  -1.002  1.00 0.00 ? 90  HIS A HD1  7  
ATOM 9921  H HD2  . HIS A 1 67  ? 1.624   -10.017 2.014   1.00 0.00 ? 90  HIS A HD2  7  
ATOM 9922  H HE1  . HIS A 1 67  ? -1.777  -9.529  -0.515  1.00 0.00 ? 90  HIS A HE1  7  
ATOM 9923  N N    . TYR A 1 68  ? 3.553   -4.583  -0.236  1.00 0.00 ? 91  TYR A N    7  
ATOM 9924  C CA   . TYR A 1 68  ? 4.700   -3.744  -0.546  1.00 0.00 ? 91  TYR A CA   7  
ATOM 9925  C C    . TYR A 1 68  ? 5.061   -2.931  0.697   1.00 0.00 ? 91  TYR A C    7  
ATOM 9926  O O    . TYR A 1 68  ? 4.163   -2.464  1.398   1.00 0.00 ? 91  TYR A O    7  
ATOM 9927  C CB   . TYR A 1 68  ? 4.334   -2.829  -1.720  1.00 0.00 ? 91  TYR A CB   7  
ATOM 9928  C CG   . TYR A 1 68  ? 5.489   -2.128  -2.392  1.00 0.00 ? 91  TYR A CG   7  
ATOM 9929  C CD1  . TYR A 1 68  ? 6.329   -2.842  -3.266  1.00 0.00 ? 91  TYR A CD1  7  
ATOM 9930  C CD2  . TYR A 1 68  ? 5.665   -0.745  -2.212  1.00 0.00 ? 91  TYR A CD2  7  
ATOM 9931  C CE1  . TYR A 1 68  ? 7.352   -2.175  -3.962  1.00 0.00 ? 91  TYR A CE1  7  
ATOM 9932  C CE2  . TYR A 1 68  ? 6.686   -0.070  -2.905  1.00 0.00 ? 91  TYR A CE2  7  
ATOM 9933  C CZ   . TYR A 1 68  ? 7.538   -0.785  -3.777  1.00 0.00 ? 91  TYR A CZ   7  
ATOM 9934  O OH   . TYR A 1 68  ? 8.521   -0.124  -4.445  1.00 0.00 ? 91  TYR A OH   7  
ATOM 9935  H H    . TYR A 1 68  ? 2.651   -4.290  -0.564  1.00 0.00 ? 91  TYR A H    7  
ATOM 9936  H HA   . TYR A 1 68  ? 5.540   -4.381  -0.825  1.00 0.00 ? 91  TYR A HA   7  
ATOM 9937  H HB2  . TYR A 1 68  ? 3.836   -3.420  -2.482  1.00 0.00 ? 91  TYR A HB2  7  
ATOM 9938  H HB3  . TYR A 1 68  ? 3.621   -2.079  -1.376  1.00 0.00 ? 91  TYR A HB3  7  
ATOM 9939  H HD1  . TYR A 1 68  ? 6.177   -3.901  -3.419  1.00 0.00 ? 91  TYR A HD1  7  
ATOM 9940  H HD2  . TYR A 1 68  ? 4.976   -0.201  -1.575  1.00 0.00 ? 91  TYR A HD2  7  
ATOM 9941  H HE1  . TYR A 1 68  ? 7.978   -2.726  -4.650  1.00 0.00 ? 91  TYR A HE1  7  
ATOM 9942  H HE2  . TYR A 1 68  ? 6.809   0.997   -2.787  1.00 0.00 ? 91  TYR A HE2  7  
ATOM 9943  H HH   . TYR A 1 68  ? 9.183   -0.729  -4.796  1.00 0.00 ? 91  TYR A HH   7  
ATOM 9944  N N    . ASN A 1 69  ? 6.356   -2.745  0.937   1.00 0.00 ? 92  ASN A N    7  
ATOM 9945  C CA   . ASN A 1 69  ? 6.924   -2.096  2.120   1.00 0.00 ? 92  ASN A CA   7  
ATOM 9946  C C    . ASN A 1 69  ? 8.099   -1.199  1.753   1.00 0.00 ? 92  ASN A C    7  
ATOM 9947  O O    . ASN A 1 69  ? 9.025   -1.016  2.546   1.00 0.00 ? 92  ASN A O    7  
ATOM 9948  C CB   . ASN A 1 69  ? 7.325   -3.116  3.196   1.00 0.00 ? 92  ASN A CB   7  
ATOM 9949  C CG   . ASN A 1 69  ? 8.272   -4.207  2.720   1.00 0.00 ? 92  ASN A CG   7  
ATOM 9950  O OD1  . ASN A 1 69  ? 8.636   -4.286  1.547   1.00 0.00 ? 92  ASN A OD1  7  
ATOM 9951  N ND2  . ASN A 1 69  ? 8.629   -5.122  3.595   1.00 0.00 ? 92  ASN A ND2  7  
ATOM 9952  H H    . ASN A 1 69  ? 7.037   -3.210  0.352   1.00 0.00 ? 92  ASN A H    7  
ATOM 9953  H HA   . ASN A 1 69  ? 6.160   -1.462  2.554   1.00 0.00 ? 92  ASN A HA   7  
ATOM 9954  H HB2  . ASN A 1 69  ? 7.773   -2.595  4.043   1.00 0.00 ? 92  ASN A HB2  7  
ATOM 9955  H HB3  . ASN A 1 69  ? 6.417   -3.570  3.557   1.00 0.00 ? 92  ASN A HB3  7  
ATOM 9956  H HD21 . ASN A 1 69  ? 8.382   -5.080  4.581   1.00 0.00 ? 92  ASN A HD21 7  
ATOM 9957  H HD22 . ASN A 1 69  ? 9.118   -5.939  3.244   1.00 0.00 ? 92  ASN A HD22 7  
ATOM 9958  N N    . GLY A 1 70  ? 8.077   -0.611  0.557   1.00 0.00 ? 93  GLY A N    7  
ATOM 9959  C CA   . GLY A 1 70  ? 9.103   0.320   0.105   1.00 0.00 ? 93  GLY A CA   7  
ATOM 9960  C C    . GLY A 1 70  ? 9.105   1.665   0.843   1.00 0.00 ? 93  GLY A C    7  
ATOM 9961  O O    . GLY A 1 70  ? 9.757   2.589   0.351   1.00 0.00 ? 93  GLY A O    7  
ATOM 9962  H H    . GLY A 1 70  ? 7.290   -0.786  -0.050  1.00 0.00 ? 93  GLY A H    7  
ATOM 9963  H HA2  . GLY A 1 70  ? 10.080  -0.142  0.250   1.00 0.00 ? 93  GLY A HA2  7  
ATOM 9964  H HA3  . GLY A 1 70  ? 8.975   0.503   -0.961  1.00 0.00 ? 93  GLY A HA3  7  
ATOM 9965  N N    . CYS A 1 71  ? 8.372   1.819   1.957   1.00 0.00 ? 94  CYS A N    7  
ATOM 9966  C CA   . CYS A 1 71  ? 8.511   3.004   2.807   1.00 0.00 ? 94  CYS A CA   7  
ATOM 9967  C C    . CYS A 1 71  ? 9.828   2.852   3.580   1.00 0.00 ? 94  CYS A C    7  
ATOM 9968  O O    . CYS A 1 71  ? 9.852   2.314   4.691   1.00 0.00 ? 94  CYS A O    7  
ATOM 9969  C CB   . CYS A 1 71  ? 7.289   3.203   3.721   1.00 0.00 ? 94  CYS A CB   7  
ATOM 9970  S SG   . CYS A 1 71  ? 6.372   4.742   3.426   1.00 0.00 ? 94  CYS A SG   7  
ATOM 9971  H H    . CYS A 1 71  ? 7.895   1.003   2.336   1.00 0.00 ? 94  CYS A H    7  
ATOM 9972  H HA   . CYS A 1 71  ? 8.586   3.882   2.166   1.00 0.00 ? 94  CYS A HA   7  
ATOM 9973  H HB2  . CYS A 1 71  ? 6.605   2.370   3.591   1.00 0.00 ? 94  CYS A HB2  7  
ATOM 9974  H HB3  . CYS A 1 71  ? 7.611   3.205   4.761   1.00 0.00 ? 94  CYS A HB3  7  
ATOM 9975  N N    . SER A 1 72  ? 10.927  3.220   2.931   1.00 0.00 ? 95  SER A N    7  
ATOM 9976  C CA   . SER A 1 72  ? 12.301  2.911   3.307   1.00 0.00 ? 95  SER A CA   7  
ATOM 9977  C C    . SER A 1 72  ? 13.265  4.018   2.852   1.00 0.00 ? 95  SER A C    7  
ATOM 9978  O O    . SER A 1 72  ? 14.430  3.767   2.527   1.00 0.00 ? 95  SER A O    7  
ATOM 9979  C CB   . SER A 1 72  ? 12.693  1.587   2.655   1.00 0.00 ? 95  SER A CB   7  
ATOM 9980  O OG   . SER A 1 72  ? 11.863  0.511   3.061   1.00 0.00 ? 95  SER A OG   7  
ATOM 9981  H H    . SER A 1 72  ? 10.772  3.656   2.032   1.00 0.00 ? 95  SER A H    7  
ATOM 9982  H HA   . SER A 1 72  ? 12.373  2.808   4.391   1.00 0.00 ? 95  SER A HA   7  
ATOM 9983  H HB2  . SER A 1 72  ? 12.656  1.686   1.570   1.00 0.00 ? 95  SER A HB2  7  
ATOM 9984  H HB3  . SER A 1 72  ? 13.717  1.406   2.953   1.00 0.00 ? 95  SER A HB3  7  
ATOM 9985  H HG   . SER A 1 72  ? 12.209  -0.306  2.666   1.00 0.00 ? 95  SER A HG   7  
ATOM 9986  N N    . GLU A 1 73  ? 12.763  5.236   2.712   1.00 0.00 ? 96  GLU A N    7  
ATOM 9987  C CA   . GLU A 1 73  ? 13.394  6.300   1.943   1.00 0.00 ? 96  GLU A CA   7  
ATOM 9988  C C    . GLU A 1 73  ? 13.767  7.540   2.758   1.00 0.00 ? 96  GLU A C    7  
ATOM 9989  O O    . GLU A 1 73  ? 13.495  7.655   3.955   1.00 0.00 ? 96  GLU A O    7  
ATOM 9990  C CB   . GLU A 1 73  ? 12.493  6.651   0.742   1.00 0.00 ? 96  GLU A CB   7  
ATOM 9991  C CG   . GLU A 1 73  ? 13.060  6.144   -0.585  1.00 0.00 ? 96  GLU A CG   7  
ATOM 9992  C CD   . GLU A 1 73  ? 14.467  6.679   -0.816  1.00 0.00 ? 96  GLU A CD   7  
ATOM 9993  O OE1  . GLU A 1 73  ? 14.705  7.901   -0.677  1.00 0.00 ? 96  GLU A OE1  7  
ATOM 9994  O OE2  . GLU A 1 73  ? 15.378  5.847   -1.020  1.00 0.00 ? 96  GLU A OE2  7  
ATOM 9995  H H    . GLU A 1 73  ? 11.784  5.325   2.965   1.00 0.00 ? 96  GLU A H    7  
ATOM 9996  H HA   . GLU A 1 73  ? 14.343  5.918   1.570   1.00 0.00 ? 96  GLU A HA   7  
ATOM 9997  H HB2  . GLU A 1 73  ? 11.508  6.223   0.881   1.00 0.00 ? 96  GLU A HB2  7  
ATOM 9998  H HB3  . GLU A 1 73  ? 12.365  7.730   0.674   1.00 0.00 ? 96  GLU A HB3  7  
ATOM 9999  H HG2  . GLU A 1 73  ? 13.080  5.053   -0.568  1.00 0.00 ? 96  GLU A HG2  7  
ATOM 10000 H HG3  . GLU A 1 73  ? 12.419  6.456   -1.407  1.00 0.00 ? 96  GLU A HG3  7  
ATOM 10001 N N    . ALA A 1 74  ? 14.429  8.472   2.069   1.00 0.00 ? 97  ALA A N    7  
ATOM 10002 C CA   . ALA A 1 74  ? 14.928  9.729   2.593   1.00 0.00 ? 97  ALA A CA   7  
ATOM 10003 C C    . ALA A 1 74  ? 14.835  10.882  1.596   1.00 0.00 ? 97  ALA A C    7  
ATOM 10004 O O    . ALA A 1 74  ? 15.096  12.019  1.982   1.00 0.00 ? 97  ALA A O    7  
ATOM 10005 C CB   . ALA A 1 74  ? 16.381  9.537   3.025   1.00 0.00 ? 97  ALA A CB   7  
ATOM 10006 H H    . ALA A 1 74  ? 14.584  8.288   1.082   1.00 0.00 ? 97  ALA A H    7  
ATOM 10007 H HA   . ALA A 1 74  ? 14.324  10.007  3.450   1.00 0.00 ? 97  ALA A HA   7  
ATOM 10008 H HB1  . ALA A 1 74  ? 16.985  9.276   2.156   1.00 0.00 ? 97  ALA A HB1  7  
ATOM 10009 H HB2  . ALA A 1 74  ? 16.752  10.466  3.461   1.00 0.00 ? 97  ALA A HB2  7  
ATOM 10010 H HB3  . ALA A 1 74  ? 16.434  8.735   3.762   1.00 0.00 ? 97  ALA A HB3  7  
ATOM 10011 N N    . ASN A 1 75  ? 14.475  10.631  0.336   1.00 0.00 ? 98  ASN A N    7  
ATOM 10012 C CA   . ASN A 1 75  ? 14.205  11.683  -0.643  1.00 0.00 ? 98  ASN A CA   7  
ATOM 10013 C C    . ASN A 1 75  ? 13.162  11.200  -1.647  1.00 0.00 ? 98  ASN A C    7  
ATOM 10014 O O    . ASN A 1 75  ? 13.472  10.857  -2.788  1.00 0.00 ? 98  ASN A O    7  
ATOM 10015 C CB   . ASN A 1 75  ? 15.499  12.216  -1.290  1.00 0.00 ? 98  ASN A CB   7  
ATOM 10016 C CG   . ASN A 1 75  ? 15.648  13.682  -0.934  1.00 0.00 ? 98  ASN A CG   7  
ATOM 10017 O OD1  . ASN A 1 75  ? 15.060  14.547  -1.578  1.00 0.00 ? 98  ASN A OD1  7  
ATOM 10018 N ND2  . ASN A 1 75  ? 16.392  13.987  0.114   1.00 0.00 ? 98  ASN A ND2  7  
ATOM 10019 H H    . ASN A 1 75  ? 14.336  9.665   0.057   1.00 0.00 ? 98  ASN A H    7  
ATOM 10020 H HA   . ASN A 1 75  ? 13.761  12.519  -0.109  1.00 0.00 ? 98  ASN A HA   7  
ATOM 10021 H HB2  . ASN A 1 75  ? 16.363  11.654  -0.942  1.00 0.00 ? 98  ASN A HB2  7  
ATOM 10022 H HB3  . ASN A 1 75  ? 15.473  12.132  -2.376  1.00 0.00 ? 98  ASN A HB3  7  
ATOM 10023 H HD21 . ASN A 1 75  ? 16.816  13.239  0.658   1.00 0.00 ? 98  ASN A HD21 7  
ATOM 10024 H HD22 . ASN A 1 75  ? 16.404  14.921  0.500   1.00 0.00 ? 98  ASN A HD22 7  
ATOM 10025 N N    . VAL A 1 76  ? 11.902  11.130  -1.214  1.00 0.00 ? 99  VAL A N    7  
ATOM 10026 C CA   . VAL A 1 76  ? 10.836  10.523  -1.995  1.00 0.00 ? 99  VAL A CA   7  
ATOM 10027 C C    . VAL A 1 76  ? 9.553   11.341  -1.836  1.00 0.00 ? 99  VAL A C    7  
ATOM 10028 O O    . VAL A 1 76  ? 9.505   12.305  -1.063  1.00 0.00 ? 99  VAL A O    7  
ATOM 10029 C CB   . VAL A 1 76  ? 10.754  9.029   -1.605  1.00 0.00 ? 99  VAL A CB   7  
ATOM 10030 C CG1  . VAL A 1 76  ? 9.953   8.773   -0.330  1.00 0.00 ? 99  VAL A CG1  7  
ATOM 10031 C CG2  . VAL A 1 76  ? 10.225  8.137   -2.725  1.00 0.00 ? 99  VAL A CG2  7  
ATOM 10032 H H    . VAL A 1 76  ? 11.629  11.460  -0.300  1.00 0.00 ? 99  VAL A H    7  
ATOM 10033 H HA   . VAL A 1 76  ? 11.107  10.572  -3.048  1.00 0.00 ? 99  VAL A HA   7  
ATOM 10034 H HB   . VAL A 1 76  ? 11.772  8.693   -1.427  1.00 0.00 ? 99  VAL A HB   7  
ATOM 10035 H HG11 . VAL A 1 76  ? 9.992   7.714   -0.082  1.00 0.00 ? 99  VAL A HG11 7  
ATOM 10036 H HG12 . VAL A 1 76  ? 10.369  9.341   0.499   1.00 0.00 ? 99  VAL A HG12 7  
ATOM 10037 H HG13 . VAL A 1 76  ? 8.905   9.033   -0.482  1.00 0.00 ? 99  VAL A HG13 7  
ATOM 10038 H HG21 . VAL A 1 76  ? 10.781  8.333   -3.641  1.00 0.00 ? 99  VAL A HG21 7  
ATOM 10039 H HG22 . VAL A 1 76  ? 10.376  7.092   -2.460  1.00 0.00 ? 99  VAL A HG22 7  
ATOM 10040 H HG23 . VAL A 1 76  ? 9.162   8.303   -2.871  1.00 0.00 ? 99  VAL A HG23 7  
ATOM 10041 N N    . THR A 1 77  ? 8.534   10.972  -2.601  1.00 0.00 ? 100 THR A N    7  
ATOM 10042 C CA   . THR A 1 77  ? 7.224   11.595  -2.683  1.00 0.00 ? 100 THR A CA   7  
ATOM 10043 C C    . THR A 1 77  ? 6.196   10.486  -2.913  1.00 0.00 ? 100 THR A C    7  
ATOM 10044 O O    . THR A 1 77  ? 6.565   9.333   -3.155  1.00 0.00 ? 100 THR A O    7  
ATOM 10045 C CB   . THR A 1 77  ? 7.199   12.595  -3.857  1.00 0.00 ? 100 THR A CB   7  
ATOM 10046 O OG1  . THR A 1 77  ? 7.423   11.924  -5.082  1.00 0.00 ? 100 THR A OG1  7  
ATOM 10047 C CG2  . THR A 1 77  ? 8.221   13.723  -3.746  1.00 0.00 ? 100 THR A CG2  7  
ATOM 10048 H H    . THR A 1 77  ? 8.629   10.143  -3.168  1.00 0.00 ? 100 THR A H    7  
ATOM 10049 H HA   . THR A 1 77  ? 6.990   12.105  -1.747  1.00 0.00 ? 100 THR A HA   7  
ATOM 10050 H HB   . THR A 1 77  ? 6.215   13.049  -3.885  1.00 0.00 ? 100 THR A HB   7  
ATOM 10051 H HG1  . THR A 1 77  ? 7.368   12.589  -5.798  1.00 0.00 ? 100 THR A HG1  7  
ATOM 10052 H HG21 . THR A 1 77  ? 8.055   14.281  -2.826  1.00 0.00 ? 100 THR A HG21 7  
ATOM 10053 H HG22 . THR A 1 77  ? 9.231   13.322  -3.763  1.00 0.00 ? 100 THR A HG22 7  
ATOM 10054 H HG23 . THR A 1 77  ? 8.101   14.395  -4.596  1.00 0.00 ? 100 THR A HG23 7  
ATOM 10055 N N    . LYS A 1 78  ? 4.905   10.825  -2.942  1.00 0.00 ? 101 LYS A N    7  
ATOM 10056 C CA   . LYS A 1 78  ? 3.868   9.912   -3.400  1.00 0.00 ? 101 LYS A CA   7  
ATOM 10057 C C    . LYS A 1 78  ? 4.159   9.438   -4.824  1.00 0.00 ? 101 LYS A C    7  
ATOM 10058 O O    . LYS A 1 78  ? 4.118   8.246   -5.108  1.00 0.00 ? 101 LYS A O    7  
ATOM 10059 C CB   . LYS A 1 78  ? 2.497   10.612  -3.289  1.00 0.00 ? 101 LYS A CB   7  
ATOM 10060 C CG   . LYS A 1 78  ? 1.708   10.012  -2.128  1.00 0.00 ? 101 LYS A CG   7  
ATOM 10061 C CD   . LYS A 1 78  ? 0.396   10.743  -1.830  1.00 0.00 ? 101 LYS A CD   7  
ATOM 10062 C CE   . LYS A 1 78  ? -0.436  9.878   -0.878  1.00 0.00 ? 101 LYS A CE   7  
ATOM 10063 N NZ   . LYS A 1 78  ? -1.837  10.315  -0.735  1.00 0.00 ? 101 LYS A NZ   7  
ATOM 10064 H H    . LYS A 1 78  ? 4.624   11.787  -2.813  1.00 0.00 ? 101 LYS A H    7  
ATOM 10065 H HA   . LYS A 1 78  ? 3.898   9.038   -2.754  1.00 0.00 ? 101 LYS A HA   7  
ATOM 10066 H HB2  . LYS A 1 78  ? 2.619   11.684  -3.126  1.00 0.00 ? 101 LYS A HB2  7  
ATOM 10067 H HB3  . LYS A 1 78  ? 1.929   10.472  -4.209  1.00 0.00 ? 101 LYS A HB3  7  
ATOM 10068 H HG2  . LYS A 1 78  ? 1.478   8.992   -2.407  1.00 0.00 ? 101 LYS A HG2  7  
ATOM 10069 H HG3  . LYS A 1 78  ? 2.331   9.995   -1.236  1.00 0.00 ? 101 LYS A HG3  7  
ATOM 10070 H HD2  . LYS A 1 78  ? 0.606   11.707  -1.367  1.00 0.00 ? 101 LYS A HD2  7  
ATOM 10071 H HD3  . LYS A 1 78  ? -0.144  10.894  -2.763  1.00 0.00 ? 101 LYS A HD3  7  
ATOM 10072 H HE2  . LYS A 1 78  ? -0.449  8.859   -1.263  1.00 0.00 ? 101 LYS A HE2  7  
ATOM 10073 H HE3  . LYS A 1 78  ? 0.035   9.861   0.108   1.00 0.00 ? 101 LYS A HE3  7  
ATOM 10074 H HZ1  . LYS A 1 78  ? -2.287  9.711   -0.048  1.00 0.00 ? 101 LYS A HZ1  7  
ATOM 10075 H HZ2  . LYS A 1 78  ? -1.906  11.261  -0.370  1.00 0.00 ? 101 LYS A HZ2  7  
ATOM 10076 H HZ3  . LYS A 1 78  ? -2.336  10.233  -1.616  1.00 0.00 ? 101 LYS A HZ3  7  
ATOM 10077 N N    . GLU A 1 79  ? 4.492   10.354  -5.721  1.00 0.00 ? 102 GLU A N    7  
ATOM 10078 C CA   . GLU A 1 79  ? 4.627   10.079  -7.144  1.00 0.00 ? 102 GLU A CA   7  
ATOM 10079 C C    . GLU A 1 79  ? 5.906   9.311   -7.472  1.00 0.00 ? 102 GLU A C    7  
ATOM 10080 O O    . GLU A 1 79  ? 6.060   8.768   -8.573  1.00 0.00 ? 102 GLU A O    7  
ATOM 10081 C CB   . GLU A 1 79  ? 4.638   11.409  -7.907  1.00 0.00 ? 102 GLU A CB   7  
ATOM 10082 C CG   . GLU A 1 79  ? 3.298   11.693  -8.587  1.00 0.00 ? 102 GLU A CG   7  
ATOM 10083 C CD   . GLU A 1 79  ? 2.231   12.198  -7.621  1.00 0.00 ? 102 GLU A CD   7  
ATOM 10084 O OE1  . GLU A 1 79  ? 2.397   13.308  -7.062  1.00 0.00 ? 102 GLU A OE1  7  
ATOM 10085 O OE2  . GLU A 1 79  ? 1.180   11.531  -7.482  1.00 0.00 ? 102 GLU A OE2  7  
ATOM 10086 H H    . GLU A 1 79  ? 4.641   11.298  -5.390  1.00 0.00 ? 102 GLU A H    7  
ATOM 10087 H HA   . GLU A 1 79  ? 3.778   9.454   -7.431  1.00 0.00 ? 102 GLU A HA   7  
ATOM 10088 H HB2  . GLU A 1 79  ? 4.917   12.226  -7.244  1.00 0.00 ? 102 GLU A HB2  7  
ATOM 10089 H HB3  . GLU A 1 79  ? 5.418   11.391  -8.662  1.00 0.00 ? 102 GLU A HB3  7  
ATOM 10090 H HG2  . GLU A 1 79  ? 3.458   12.461  -9.336  1.00 0.00 ? 102 GLU A HG2  7  
ATOM 10091 H HG3  . GLU A 1 79  ? 2.948   10.796  -9.102  1.00 0.00 ? 102 GLU A HG3  7  
ATOM 10092 N N    . ALA A 1 80  ? 6.835   9.283   -6.526  1.00 0.00 ? 103 ALA A N    7  
ATOM 10093 C CA   . ALA A 1 80  ? 7.997   8.440   -6.561  1.00 0.00 ? 103 ALA A CA   7  
ATOM 10094 C C    . ALA A 1 80  ? 7.603   7.079   -5.979  1.00 0.00 ? 103 ALA A C    7  
ATOM 10095 O O    . ALA A 1 80  ? 7.489   6.104   -6.727  1.00 0.00 ? 103 ALA A O    7  
ATOM 10096 C CB   . ALA A 1 80  ? 9.120   9.173   -5.832  1.00 0.00 ? 103 ALA A CB   7  
ATOM 10097 H H    . ALA A 1 80  ? 6.682   9.835   -5.691  1.00 0.00 ? 103 ALA A H    7  
ATOM 10098 H HA   . ALA A 1 80  ? 8.313   8.304   -7.591  1.00 0.00 ? 103 ALA A HA   7  
ATOM 10099 H HB1  . ALA A 1 80  ? 9.276   10.140  -6.308  1.00 0.00 ? 103 ALA A HB1  7  
ATOM 10100 H HB2  . ALA A 1 80  ? 8.836   9.354   -4.802  1.00 0.00 ? 103 ALA A HB2  7  
ATOM 10101 H HB3  . ALA A 1 80  ? 10.041  8.599   -5.884  1.00 0.00 ? 103 ALA A HB3  7  
ATOM 10102 N N    . PHE A 1 81  ? 7.317   7.026   -4.677  1.00 0.00 ? 104 PHE A N    7  
ATOM 10103 C CA   . PHE A 1 81  ? 7.196   5.771   -3.936  1.00 0.00 ? 104 PHE A CA   7  
ATOM 10104 C C    . PHE A 1 81  ? 5.920   5.009   -4.325  1.00 0.00 ? 104 PHE A C    7  
ATOM 10105 O O    . PHE A 1 81  ? 5.997   3.837   -4.705  1.00 0.00 ? 104 PHE A O    7  
ATOM 10106 C CB   . PHE A 1 81  ? 7.281   6.026   -2.416  1.00 0.00 ? 104 PHE A CB   7  
ATOM 10107 C CG   . PHE A 1 81  ? 6.547   4.999   -1.584  1.00 0.00 ? 104 PHE A CG   7  
ATOM 10108 C CD1  . PHE A 1 81  ? 7.050   3.696   -1.402  1.00 0.00 ? 104 PHE A CD1  7  
ATOM 10109 C CD2  . PHE A 1 81  ? 5.287   5.341   -1.074  1.00 0.00 ? 104 PHE A CD2  7  
ATOM 10110 C CE1  . PHE A 1 81  ? 6.280   2.744   -0.709  1.00 0.00 ? 104 PHE A CE1  7  
ATOM 10111 C CE2  . PHE A 1 81  ? 4.500   4.370   -0.450  1.00 0.00 ? 104 PHE A CE2  7  
ATOM 10112 C CZ   . PHE A 1 81  ? 5.002   3.078   -0.238  1.00 0.00 ? 104 PHE A CZ   7  
ATOM 10113 H H    . PHE A 1 81  ? 7.215   7.910   -4.181  1.00 0.00 ? 104 PHE A H    7  
ATOM 10114 H HA   . PHE A 1 81  ? 8.046   5.142   -4.207  1.00 0.00 ? 104 PHE A HA   7  
ATOM 10115 H HB2  . PHE A 1 81  ? 8.320   6.050   -2.094  1.00 0.00 ? 104 PHE A HB2  7  
ATOM 10116 H HB3  . PHE A 1 81  ? 6.861   7.005   -2.188  1.00 0.00 ? 104 PHE A HB3  7  
ATOM 10117 H HD1  . PHE A 1 81  ? 8.024   3.423   -1.782  1.00 0.00 ? 104 PHE A HD1  7  
ATOM 10118 H HD2  . PHE A 1 81  ? 4.922   6.351   -1.183  1.00 0.00 ? 104 PHE A HD2  7  
ATOM 10119 H HE1  . PHE A 1 81  ? 6.662   1.752   -0.535  1.00 0.00 ? 104 PHE A HE1  7  
ATOM 10120 H HE2  . PHE A 1 81  ? 3.511   4.635   -0.145  1.00 0.00 ? 104 PHE A HE2  7  
ATOM 10121 H HZ   . PHE A 1 81  ? 4.413   2.348   0.297   1.00 0.00 ? 104 PHE A HZ   7  
ATOM 10122 N N    . VAL A 1 82  ? 4.744   5.640   -4.215  1.00 0.00 ? 105 VAL A N    7  
ATOM 10123 C CA   . VAL A 1 82  ? 3.450   4.983   -4.413  1.00 0.00 ? 105 VAL A CA   7  
ATOM 10124 C C    . VAL A 1 82  ? 3.308   4.582   -5.871  1.00 0.00 ? 105 VAL A C    7  
ATOM 10125 O O    . VAL A 1 82  ? 2.862   3.476   -6.157  1.00 0.00 ? 105 VAL A O    7  
ATOM 10126 C CB   . VAL A 1 82  ? 2.276   5.888   -3.995  1.00 0.00 ? 105 VAL A CB   7  
ATOM 10127 C CG1  . VAL A 1 82  ? 0.908   5.238   -4.195  1.00 0.00 ? 105 VAL A CG1  7  
ATOM 10128 C CG2  . VAL A 1 82  ? 2.364   6.334   -2.546  1.00 0.00 ? 105 VAL A CG2  7  
ATOM 10129 H H    . VAL A 1 82  ? 4.747   6.633   -4.014  1.00 0.00 ? 105 VAL A H    7  
ATOM 10130 H HA   . VAL A 1 82  ? 3.432   4.078   -3.804  1.00 0.00 ? 105 VAL A HA   7  
ATOM 10131 H HB   . VAL A 1 82  ? 2.283   6.784   -4.592  1.00 0.00 ? 105 VAL A HB   7  
ATOM 10132 H HG11 . VAL A 1 82  ? 0.837   4.308   -3.632  1.00 0.00 ? 105 VAL A HG11 7  
ATOM 10133 H HG12 . VAL A 1 82  ? 0.133   5.931   -3.874  1.00 0.00 ? 105 VAL A HG12 7  
ATOM 10134 H HG13 . VAL A 1 82  ? 0.752   5.031   -5.249  1.00 0.00 ? 105 VAL A HG13 7  
ATOM 10135 H HG21 . VAL A 1 82  ? 2.466   5.468   -1.901  1.00 0.00 ? 105 VAL A HG21 7  
ATOM 10136 H HG22 . VAL A 1 82  ? 3.209   7.009   -2.438  1.00 0.00 ? 105 VAL A HG22 7  
ATOM 10137 H HG23 . VAL A 1 82  ? 1.454   6.870   -2.290  1.00 0.00 ? 105 VAL A HG23 7  
ATOM 10138 N N    . THR A 1 83  ? 3.702   5.438   -6.809  1.00 0.00 ? 106 THR A N    7  
ATOM 10139 C CA   . THR A 1 83  ? 3.742   5.062   -8.206  1.00 0.00 ? 106 THR A CA   7  
ATOM 10140 C C    . THR A 1 83  ? 4.591   3.798   -8.392  1.00 0.00 ? 106 THR A C    7  
ATOM 10141 O O    . THR A 1 83  ? 4.135   2.882   -9.069  1.00 0.00 ? 106 THR A O    7  
ATOM 10142 C CB   . THR A 1 83  ? 4.239   6.255   -9.011  1.00 0.00 ? 106 THR A CB   7  
ATOM 10143 O OG1  . THR A 1 83  ? 3.312   7.320   -8.875  1.00 0.00 ? 106 THR A OG1  7  
ATOM 10144 C CG2  . THR A 1 83  ? 4.452   5.883   -10.472 1.00 0.00 ? 106 THR A CG2  7  
ATOM 10145 H H    . THR A 1 83  ? 3.974   6.380   -6.568  1.00 0.00 ? 106 THR A H    7  
ATOM 10146 H HA   . THR A 1 83  ? 2.728   4.831   -8.530  1.00 0.00 ? 106 THR A HA   7  
ATOM 10147 H HB   . THR A 1 83  ? 5.191   6.560   -8.590  1.00 0.00 ? 106 THR A HB   7  
ATOM 10148 H HG1  . THR A 1 83  ? 3.079   7.629   -9.775  1.00 0.00 ? 106 THR A HG1  7  
ATOM 10149 H HG21 . THR A 1 83  ? 3.559   5.401   -10.871 1.00 0.00 ? 106 THR A HG21 7  
ATOM 10150 H HG22 . THR A 1 83  ? 4.702   6.769   -11.052 1.00 0.00 ? 106 THR A HG22 7  
ATOM 10151 H HG23 . THR A 1 83  ? 5.286   5.183   -10.527 1.00 0.00 ? 106 THR A HG23 7  
ATOM 10152 N N    . GLY A 1 84  ? 5.755   3.679   -7.743  1.00 0.00 ? 107 GLY A N    7  
ATOM 10153 C CA   . GLY A 1 84  ? 6.538   2.450   -7.791  1.00 0.00 ? 107 GLY A CA   7  
ATOM 10154 C C    . GLY A 1 84  ? 5.780   1.258   -7.205  1.00 0.00 ? 107 GLY A C    7  
ATOM 10155 O O    . GLY A 1 84  ? 5.875   0.155   -7.741  1.00 0.00 ? 107 GLY A O    7  
ATOM 10156 H H    . GLY A 1 84  ? 6.122   4.442   -7.186  1.00 0.00 ? 107 GLY A H    7  
ATOM 10157 H HA2  . GLY A 1 84  ? 6.784   2.226   -8.827  1.00 0.00 ? 107 GLY A HA2  7  
ATOM 10158 H HA3  . GLY A 1 84  ? 7.470   2.594   -7.249  1.00 0.00 ? 107 GLY A HA3  7  
ATOM 10159 N N    . CYS A 1 85  ? 4.973   1.473   -6.159  1.00 0.00 ? 108 CYS A N    7  
ATOM 10160 C CA   . CYS A 1 85  ? 4.138   0.407   -5.593  1.00 0.00 ? 108 CYS A CA   7  
ATOM 10161 C C    . CYS A 1 85  ? 3.052   0.004   -6.596  1.00 0.00 ? 108 CYS A C    7  
ATOM 10162 O O    . CYS A 1 85  ? 2.642   -1.156  -6.656  1.00 0.00 ? 108 CYS A O    7  
ATOM 10163 C CB   . CYS A 1 85  ? 3.525   0.768   -4.219  1.00 0.00 ? 108 CYS A CB   7  
ATOM 10164 S SG   . CYS A 1 85  ? 1.809   1.380   -4.174  1.00 0.00 ? 108 CYS A SG   7  
ATOM 10165 H H    . CYS A 1 85  ? 4.855   2.443   -5.881  1.00 0.00 ? 108 CYS A H    7  
ATOM 10166 H HA   . CYS A 1 85  ? 4.789   -0.455  -5.438  1.00 0.00 ? 108 CYS A HA   7  
ATOM 10167 H HB2  . CYS A 1 85  ? 3.517   -0.156  -3.644  1.00 0.00 ? 108 CYS A HB2  7  
ATOM 10168 H HB3  . CYS A 1 85  ? 4.176   1.469   -3.694  1.00 0.00 ? 108 CYS A HB3  7  
ATOM 10169 N N    . ILE A 1 86  ? 2.575   0.949   -7.403  1.00 0.00 ? 109 ILE A N    7  
ATOM 10170 C CA   . ILE A 1 86  ? 1.524   0.750   -8.385  1.00 0.00 ? 109 ILE A CA   7  
ATOM 10171 C C    . ILE A 1 86  ? 2.078   0.069   -9.625  1.00 0.00 ? 109 ILE A C    7  
ATOM 10172 O O    . ILE A 1 86  ? 1.439   -0.813  -10.187 1.00 0.00 ? 109 ILE A O    7  
ATOM 10173 C CB   . ILE A 1 86  ? 0.831   2.095   -8.645  1.00 0.00 ? 109 ILE A CB   7  
ATOM 10174 C CG1  . ILE A 1 86  ? -0.232  2.224   -7.542  1.00 0.00 ? 109 ILE A CG1  7  
ATOM 10175 C CG2  . ILE A 1 86  ? 0.212   2.279   -10.036 1.00 0.00 ? 109 ILE A CG2  7  
ATOM 10176 C CD1  . ILE A 1 86  ? -0.585  3.675   -7.296  1.00 0.00 ? 109 ILE A CD1  7  
ATOM 10177 H H    . ILE A 1 86  ? 2.901   1.899   -7.251  1.00 0.00 ? 109 ILE A H    7  
ATOM 10178 H HA   . ILE A 1 86  ? 0.801   0.091   -7.925  1.00 0.00 ? 109 ILE A HA   7  
ATOM 10179 H HB   . ILE A 1 86  ? 1.569   2.887   -8.530  1.00 0.00 ? 109 ILE A HB   7  
ATOM 10180 H HG12 . ILE A 1 86  ? -1.127  1.659   -7.797  1.00 0.00 ? 109 ILE A HG12 7  
ATOM 10181 H HG13 . ILE A 1 86  ? 0.157   1.825   -6.605  1.00 0.00 ? 109 ILE A HG13 7  
ATOM 10182 H HG21 . ILE A 1 86  ? -0.353  3.210   -10.063 1.00 0.00 ? 109 ILE A HG21 7  
ATOM 10183 H HG22 . ILE A 1 86  ? 1.008   2.361   -10.777 1.00 0.00 ? 109 ILE A HG22 7  
ATOM 10184 H HG23 . ILE A 1 86  ? -0.453  1.451   -10.282 1.00 0.00 ? 109 ILE A HG23 7  
ATOM 10185 H HD11 . ILE A 1 86  ? -1.250  4.037   -8.077  1.00 0.00 ? 109 ILE A HD11 7  
ATOM 10186 H HD12 . ILE A 1 86  ? -1.068  3.720   -6.323  1.00 0.00 ? 109 ILE A HD12 7  
ATOM 10187 H HD13 . ILE A 1 86  ? 0.335   4.261   -7.296  1.00 0.00 ? 109 ILE A HD13 7  
ATOM 10188 N N    . ASN A 1 87  ? 3.297   0.403   -10.022 1.00 0.00 ? 110 ASN A N    7  
ATOM 10189 C CA   . ASN A 1 87  ? 4.088   -0.313  -11.034 1.00 0.00 ? 110 ASN A CA   7  
ATOM 10190 C C    . ASN A 1 87  ? 4.492   -1.722  -10.607 1.00 0.00 ? 110 ASN A C    7  
ATOM 10191 O O    . ASN A 1 87  ? 5.194   -2.441  -11.321 1.00 0.00 ? 110 ASN A O    7  
ATOM 10192 C CB   . ASN A 1 87  ? 5.373   0.449   -11.323 1.00 0.00 ? 110 ASN A CB   7  
ATOM 10193 C CG   . ASN A 1 87  ? 5.151   1.819   -11.932 1.00 0.00 ? 110 ASN A CG   7  
ATOM 10194 O OD1  . ASN A 1 87  ? 4.260   2.031   -12.753 1.00 0.00 ? 110 ASN A OD1  7  
ATOM 10195 N ND2  . ASN A 1 87  ? 5.979   2.761   -11.537 1.00 0.00 ? 110 ASN A ND2  7  
ATOM 10196 H H    . ASN A 1 87  ? 3.668   1.233   -9.559  1.00 0.00 ? 110 ASN A H    7  
ATOM 10197 H HA   . ASN A 1 87  ? 3.495   -0.428  -11.942 1.00 0.00 ? 110 ASN A HA   7  
ATOM 10198 H HB2  . ASN A 1 87  ? 5.945   0.538   -10.399 1.00 0.00 ? 110 ASN A HB2  7  
ATOM 10199 H HB3  . ASN A 1 87  ? 5.957   -0.148  -12.012 1.00 0.00 ? 110 ASN A HB3  7  
ATOM 10200 H HD21 . ASN A 1 87  ? 6.680   2.540   -10.832 1.00 0.00 ? 110 ASN A HD21 7  
ATOM 10201 H HD22 . ASN A 1 87  ? 5.940   3.696   -11.920 1.00 0.00 ? 110 ASN A HD22 7  
ATOM 10202 N N    . ALA A 1 88  ? 4.093   -2.115  -9.415  1.00 0.00 ? 111 ALA A N    7  
ATOM 10203 C CA   . ALA A 1 88  ? 4.227   -3.446  -8.876  1.00 0.00 ? 111 ALA A CA   7  
ATOM 10204 C C    . ALA A 1 88  ? 2.824   -4.069  -8.815  1.00 0.00 ? 111 ALA A C    7  
ATOM 10205 O O    . ALA A 1 88  ? 2.553   -5.059  -9.493  1.00 0.00 ? 111 ALA A O    7  
ATOM 10206 C CB   . ALA A 1 88  ? 4.998   -3.303  -7.556  1.00 0.00 ? 111 ALA A CB   7  
ATOM 10207 H H    . ALA A 1 88  ? 3.679   -1.391  -8.856  1.00 0.00 ? 111 ALA A H    7  
ATOM 10208 H HA   . ALA A 1 88  ? 4.818   -4.060  -9.556  1.00 0.00 ? 111 ALA A HA   7  
ATOM 10209 H HB1  . ALA A 1 88  ? 5.789   -2.551  -7.688  1.00 0.00 ? 111 ALA A HB1  7  
ATOM 10210 H HB2  . ALA A 1 88  ? 4.346   -2.975  -6.752  1.00 0.00 ? 111 ALA A HB2  7  
ATOM 10211 H HB3  . ALA A 1 88  ? 5.456   -4.250  -7.286  1.00 0.00 ? 111 ALA A HB3  7  
ATOM 10212 N N    . THR A 1 89  ? 1.886   -3.437  -8.105  1.00 0.00 ? 112 THR A N    7  
ATOM 10213 C CA   . THR A 1 89  ? 0.527   -3.934  -7.930  1.00 0.00 ? 112 THR A CA   7  
ATOM 10214 C C    . THR A 1 89  ? -0.218  -4.109  -9.262  1.00 0.00 ? 112 THR A C    7  
ATOM 10215 O O    . THR A 1 89  ? -0.979  -5.064  -9.396  1.00 0.00 ? 112 THR A O    7  
ATOM 10216 C CB   . THR A 1 89  ? -0.231  -3.026  -6.944  1.00 0.00 ? 112 THR A CB   7  
ATOM 10217 O OG1  . THR A 1 89  ? -1.260  -3.722  -6.297  1.00 0.00 ? 112 THR A OG1  7  
ATOM 10218 C CG2  . THR A 1 89  ? -0.889  -1.813  -7.596  1.00 0.00 ? 112 THR A CG2  7  
ATOM 10219 H H    . THR A 1 89  ? 2.148   -2.610  -7.580  1.00 0.00 ? 112 THR A H    7  
ATOM 10220 H HA   . THR A 1 89  ? 0.627   -4.912  -7.463  1.00 0.00 ? 112 THR A HA   7  
ATOM 10221 H HB   . THR A 1 89  ? 0.467   -2.701  -6.177  1.00 0.00 ? 112 THR A HB   7  
ATOM 10222 H HG1  . THR A 1 89  ? -0.836  -4.396  -5.726  1.00 0.00 ? 112 THR A HG1  7  
ATOM 10223 H HG21 . THR A 1 89  ? -1.853  -2.098  -8.003  1.00 0.00 ? 112 THR A HG21 7  
ATOM 10224 H HG22 . THR A 1 89  ? -1.009  -1.016  -6.865  1.00 0.00 ? 112 THR A HG22 7  
ATOM 10225 H HG23 . THR A 1 89  ? -0.294  -1.467  -8.427  1.00 0.00 ? 112 THR A HG23 7  
ATOM 10226 N N    . GLN A 1 90  ? -0.011  -3.238  -10.264 1.00 0.00 ? 113 GLN A N    7  
ATOM 10227 C CA   . GLN A 1 90  ? -0.843  -3.248  -11.466 1.00 0.00 ? 113 GLN A CA   7  
ATOM 10228 C C    . GLN A 1 90  ? -0.719  -4.580  -12.204 1.00 0.00 ? 113 GLN A C    7  
ATOM 10229 O O    . GLN A 1 90  ? -1.701  -5.073  -12.756 1.00 0.00 ? 113 GLN A O    7  
ATOM 10230 C CB   . GLN A 1 90  ? -0.557  -2.029  -12.360 1.00 0.00 ? 113 GLN A CB   7  
ATOM 10231 C CG   . GLN A 1 90  ? 0.804   -2.007  -13.068 1.00 0.00 ? 113 GLN A CG   7  
ATOM 10232 C CD   . GLN A 1 90  ? 1.059   -0.650  -13.727 1.00 0.00 ? 113 GLN A CD   7  
ATOM 10233 O OE1  . GLN A 1 90  ? 0.982   -0.495  -14.938 1.00 0.00 ? 113 GLN A OE1  7  
ATOM 10234 N NE2  . GLN A 1 90  ? 1.332   0.384   -12.945 1.00 0.00 ? 113 GLN A NE2  7  
ATOM 10235 H H    . GLN A 1 90  ? 0.620   -2.449  -10.136 1.00 0.00 ? 113 GLN A H    7  
ATOM 10236 H HA   . GLN A 1 90  ? -1.879  -3.160  -11.142 1.00 0.00 ? 113 GLN A HA   7  
ATOM 10237 H HB2  . GLN A 1 90  ? -1.321  -1.988  -13.131 1.00 0.00 ? 113 GLN A HB2  7  
ATOM 10238 H HB3  . GLN A 1 90  ? -0.658  -1.129  -11.752 1.00 0.00 ? 113 GLN A HB3  7  
ATOM 10239 H HG2  . GLN A 1 90  ? 1.603   -2.217  -12.359 1.00 0.00 ? 113 GLN A HG2  7  
ATOM 10240 H HG3  . GLN A 1 90  ? 0.821   -2.781  -13.836 1.00 0.00 ? 113 GLN A HG3  7  
ATOM 10241 H HE21 . GLN A 1 90  ? 1.407   0.208   -11.950 1.00 0.00 ? 113 GLN A HE21 7  
ATOM 10242 H HE22 . GLN A 1 90  ? 1.794   1.184   -13.364 1.00 0.00 ? 113 GLN A HE22 7  
ATOM 10243 N N    . ALA A 1 91  ? 0.463   -5.200  -12.137 1.00 0.00 ? 114 ALA A N    7  
ATOM 10244 C CA   . ALA A 1 91  ? 0.724   -6.524  -12.678 1.00 0.00 ? 114 ALA A CA   7  
ATOM 10245 C C    . ALA A 1 91  ? 0.651   -7.619  -11.605 1.00 0.00 ? 114 ALA A C    7  
ATOM 10246 O O    . ALA A 1 91  ? 0.926   -8.773  -11.930 1.00 0.00 ? 114 ALA A O    7  
ATOM 10247 C CB   . ALA A 1 91  ? 2.098   -6.495  -13.345 1.00 0.00 ? 114 ALA A CB   7  
ATOM 10248 H H    . ALA A 1 91  ? 1.217   -4.750  -11.626 1.00 0.00 ? 114 ALA A H    7  
ATOM 10249 H HA   . ALA A 1 91  ? -0.024  -6.770  -13.439 1.00 0.00 ? 114 ALA A HA   7  
ATOM 10250 H HB1  . ALA A 1 91  ? 2.130   -5.710  -14.102 1.00 0.00 ? 114 ALA A HB1  7  
ATOM 10251 H HB2  . ALA A 1 91  ? 2.859   -6.303  -12.590 1.00 0.00 ? 114 ALA A HB2  7  
ATOM 10252 H HB3  . ALA A 1 91  ? 2.290   -7.452  -13.829 1.00 0.00 ? 114 ALA A HB3  7  
ATOM 10253 N N    . ALA A 1 92  ? 0.364   -7.299  -10.338 1.00 0.00 ? 115 ALA A N    7  
ATOM 10254 C CA   . ALA A 1 92  ? 0.111   -8.282  -9.284  1.00 0.00 ? 115 ALA A CA   7  
ATOM 10255 C C    . ALA A 1 92  ? -1.342  -8.770  -9.319  1.00 0.00 ? 115 ALA A C    7  
ATOM 10256 O O    . ALA A 1 92  ? -1.596  -9.941  -9.038  1.00 0.00 ? 115 ALA A O    7  
ATOM 10257 C CB   . ALA A 1 92  ? 0.422   -7.684  -7.900  1.00 0.00 ? 115 ALA A CB   7  
ATOM 10258 H H    . ALA A 1 92  ? 0.152   -6.332  -10.119 1.00 0.00 ? 115 ALA A H    7  
ATOM 10259 H HA   . ALA A 1 92  ? 0.764   -9.140  -9.444  1.00 0.00 ? 115 ALA A HA   7  
ATOM 10260 H HB1  . ALA A 1 92  ? -0.329  -6.945  -7.612  1.00 0.00 ? 115 ALA A HB1  7  
ATOM 10261 H HB2  . ALA A 1 92  ? 0.403   -8.483  -7.159  1.00 0.00 ? 115 ALA A HB2  7  
ATOM 10262 H HB3  . ALA A 1 92  ? 1.410   -7.223  -7.898  1.00 0.00 ? 115 ALA A HB3  7  
ATOM 10263 N N    . ASN A 1 93  ? -2.289  -7.878  -9.635  1.00 0.00 ? 116 ASN A N    7  
ATOM 10264 C CA   . ASN A 1 93  ? -3.730  -8.145  -9.614  1.00 0.00 ? 116 ASN A CA   7  
ATOM 10265 C C    . ASN A 1 93  ? -4.405  -7.514  -10.833 1.00 0.00 ? 116 ASN A C    7  
ATOM 10266 O O    . ASN A 1 93  ? -5.344  -6.725  -10.741 1.00 0.00 ? 116 ASN A O    7  
ATOM 10267 C CB   . ASN A 1 93  ? -4.368  -7.713  -8.284  1.00 0.00 ? 116 ASN A CB   7  
ATOM 10268 C CG   . ASN A 1 93  ? -4.341  -6.219  -8.054  1.00 0.00 ? 116 ASN A CG   7  
ATOM 10269 O OD1  . ASN A 1 93  ? -5.315  -5.522  -8.261  1.00 0.00 ? 116 ASN A OD1  7  
ATOM 10270 N ND2  . ASN A 1 93  ? -3.227  -5.677  -7.618  1.00 0.00 ? 116 ASN A ND2  7  
ATOM 10271 H H    . ASN A 1 93  ? -2.002  -6.925  -9.829  1.00 0.00 ? 116 ASN A H    7  
ATOM 10272 H HA   . ASN A 1 93  ? -3.880  -9.220  -9.692  1.00 0.00 ? 116 ASN A HA   7  
ATOM 10273 H HB2  . ASN A 1 93  ? -5.409  -8.027  -8.272  1.00 0.00 ? 116 ASN A HB2  7  
ATOM 10274 H HB3  . ASN A 1 93  ? -3.870  -8.211  -7.461  1.00 0.00 ? 116 ASN A HB3  7  
ATOM 10275 H HD21 . ASN A 1 93  ? -2.390  -6.187  -7.399  1.00 0.00 ? 116 ASN A HD21 7  
ATOM 10276 H HD22 . ASN A 1 93  ? -3.313  -4.690  -7.439  1.00 0.00 ? 116 ASN A HD22 7  
ATOM 10277 N N    . GLN A 1 94  ? -3.955  -7.909  -12.021 1.00 0.00 ? 117 GLN A N    7  
ATOM 10278 C CA   . GLN A 1 94  ? -4.557  -7.486  -13.282 1.00 0.00 ? 117 GLN A CA   7  
ATOM 10279 C C    . GLN A 1 94  ? -6.073  -7.712  -13.271 1.00 0.00 ? 117 GLN A C    7  
ATOM 10280 O O    . GLN A 1 94  ? -6.815  -6.860  -13.745 1.00 0.00 ? 117 GLN A O    7  
ATOM 10281 C CB   . GLN A 1 94  ? -3.891  -8.261  -14.423 1.00 0.00 ? 117 GLN A CB   7  
ATOM 10282 C CG   . GLN A 1 94  ? -2.522  -7.722  -14.814 1.00 0.00 ? 117 GLN A CG   7  
ATOM 10283 C CD   . GLN A 1 94  ? -2.609  -6.607  -15.843 1.00 0.00 ? 117 GLN A CD   7  
ATOM 10284 O OE1  . GLN A 1 94  ? -2.664  -6.877  -17.044 1.00 0.00 ? 117 GLN A OE1  7  
ATOM 10285 N NE2  . GLN A 1 94  ? -2.591  -5.361  -15.413 1.00 0.00 ? 117 GLN A NE2  7  
ATOM 10286 H H    . GLN A 1 94  ? -3.278  -8.665  -12.041 1.00 0.00 ? 117 GLN A H    7  
ATOM 10287 H HA   . GLN A 1 94  ? -4.393  -6.416  -13.413 1.00 0.00 ? 117 GLN A HA   7  
ATOM 10288 H HB2  . GLN A 1 94  ? -3.718  -9.279  -14.089 1.00 0.00 ? 117 GLN A HB2  7  
ATOM 10289 H HB3  . GLN A 1 94  ? -4.538  -8.282  -15.301 1.00 0.00 ? 117 GLN A HB3  7  
ATOM 10290 H HG2  . GLN A 1 94  ? -1.983  -7.400  -13.928 1.00 0.00 ? 117 GLN A HG2  7  
ATOM 10291 H HG3  . GLN A 1 94  ? -1.976  -8.550  -15.253 1.00 0.00 ? 117 GLN A HG3  7  
ATOM 10292 H HE21 . GLN A 1 94  ? -2.470  -5.161  -14.421 1.00 0.00 ? 117 GLN A HE21 7  
ATOM 10293 H HE22 . GLN A 1 94  ? -2.692  -4.587  -16.066 1.00 0.00 ? 117 GLN A HE22 7  
ATOM 10294 N N    . GLY A 1 95  ? -6.552  -8.802  -12.676 1.00 0.00 ? 118 GLY A N    7  
ATOM 10295 C CA   . GLY A 1 95  ? -7.976  -9.100  -12.591 1.00 0.00 ? 118 GLY A CA   7  
ATOM 10296 C C    . GLY A 1 95  ? -8.820  -8.105  -11.778 1.00 0.00 ? 118 GLY A C    7  
ATOM 10297 O O    . GLY A 1 95  ? -10.046 -8.242  -11.799 1.00 0.00 ? 118 GLY A O    7  
ATOM 10298 H H    . GLY A 1 95  ? -5.888  -9.468  -12.309 1.00 0.00 ? 118 GLY A H    7  
ATOM 10299 H HA2  . GLY A 1 95  ? -8.378  -9.139  -13.605 1.00 0.00 ? 118 GLY A HA2  7  
ATOM 10300 H HA3  . GLY A 1 95  ? -8.091  -10.085 -12.141 1.00 0.00 ? 118 GLY A HA3  7  
ATOM 10301 N N    . GLU A 1 96  ? -8.236  -7.144  -11.047 1.00 0.00 ? 119 GLU A N    7  
ATOM 10302 C CA   . GLU A 1 96  ? -9.006  -6.062  -10.418 1.00 0.00 ? 119 GLU A CA   7  
ATOM 10303 C C    . GLU A 1 96  ? -8.981  -4.828  -11.307 1.00 0.00 ? 119 GLU A C    7  
ATOM 10304 O O    . GLU A 1 96  ? -10.029 -4.238  -11.548 1.00 0.00 ? 119 GLU A O    7  
ATOM 10305 C CB   . GLU A 1 96  ? -8.522  -5.687  -9.025  1.00 0.00 ? 119 GLU A CB   7  
ATOM 10306 C CG   . GLU A 1 96  ? -8.542  -6.844  -8.028  1.00 0.00 ? 119 GLU A CG   7  
ATOM 10307 C CD   . GLU A 1 96  ? -9.911  -7.358  -7.561  1.00 0.00 ? 119 GLU A CD   7  
ATOM 10308 O OE1  . GLU A 1 96  ? -10.964 -7.050  -8.168  1.00 0.00 ? 119 GLU A OE1  7  
ATOM 10309 O OE2  . GLU A 1 96  ? -9.929  -8.156  -6.592  1.00 0.00 ? 119 GLU A OE2  7  
ATOM 10310 H H    . GLU A 1 96  ? -7.225  -7.027  -11.091 1.00 0.00 ? 119 GLU A H    7  
ATOM 10311 H HA   . GLU A 1 96  ? -10.030 -6.365  -10.270 1.00 0.00 ? 119 GLU A HA   7  
ATOM 10312 H HB2  . GLU A 1 96  ? -7.516  -5.298  -9.116  1.00 0.00 ? 119 GLU A HB2  7  
ATOM 10313 H HB3  . GLU A 1 96  ? -9.147  -4.887  -8.631  1.00 0.00 ? 119 GLU A HB3  7  
ATOM 10314 H HG2  . GLU A 1 96  ? -7.962  -7.666  -8.429  1.00 0.00 ? 119 GLU A HG2  7  
ATOM 10315 H HG3  . GLU A 1 96  ? -8.036  -6.479  -7.155  1.00 0.00 ? 119 GLU A HG3  7  
ATOM 10316 N N    . PHE A 1 97  ? -7.801  -4.421  -11.783 1.00 0.00 ? 120 PHE A N    7  
ATOM 10317 C CA   . PHE A 1 97  ? -7.695  -3.230  -12.623 1.00 0.00 ? 120 PHE A CA   7  
ATOM 10318 C C    . PHE A 1 97  ? -8.168  -3.424  -14.072 1.00 0.00 ? 120 PHE A C    7  
ATOM 10319 O O    . PHE A 1 97  ? -8.290  -2.429  -14.788 1.00 0.00 ? 120 PHE A O    7  
ATOM 10320 C CB   . PHE A 1 97  ? -6.253  -2.738  -12.620 1.00 0.00 ? 120 PHE A CB   7  
ATOM 10321 C CG   . PHE A 1 97  ? -5.673  -2.474  -11.249 1.00 0.00 ? 120 PHE A CG   7  
ATOM 10322 C CD1  . PHE A 1 97  ? -6.139  -1.394  -10.472 1.00 0.00 ? 120 PHE A CD1  7  
ATOM 10323 C CD2  . PHE A 1 97  ? -4.651  -3.303  -10.755 1.00 0.00 ? 120 PHE A CD2  7  
ATOM 10324 C CE1  . PHE A 1 97  ? -5.527  -1.097  -9.245  1.00 0.00 ? 120 PHE A CE1  7  
ATOM 10325 C CE2  . PHE A 1 97  ? -4.041  -3.001  -9.531  1.00 0.00 ? 120 PHE A CE2  7  
ATOM 10326 C CZ   . PHE A 1 97  ? -4.470  -1.895  -8.780  1.00 0.00 ? 120 PHE A CZ   7  
ATOM 10327 H H    . PHE A 1 97  ? -6.948  -4.843  -11.419 1.00 0.00 ? 120 PHE A H    7  
ATOM 10328 H HA   . PHE A 1 97  ? -8.318  -2.448  -12.186 1.00 0.00 ? 120 PHE A HA   7  
ATOM 10329 H HB2  . PHE A 1 97  ? -5.635  -3.474  -13.137 1.00 0.00 ? 120 PHE A HB2  7  
ATOM 10330 H HB3  . PHE A 1 97  ? -6.213  -1.807  -13.186 1.00 0.00 ? 120 PHE A HB3  7  
ATOM 10331 H HD1  . PHE A 1 97  ? -6.981  -0.790  -10.788 1.00 0.00 ? 120 PHE A HD1  7  
ATOM 10332 H HD2  . PHE A 1 97  ? -4.342  -4.195  -11.285 1.00 0.00 ? 120 PHE A HD2  7  
ATOM 10333 H HE1  . PHE A 1 97  ? -5.859  -0.245  -8.669  1.00 0.00 ? 120 PHE A HE1  7  
ATOM 10334 H HE2  . PHE A 1 97  ? -3.264  -3.654  -9.169  1.00 0.00 ? 120 PHE A HE2  7  
ATOM 10335 H HZ   . PHE A 1 97  ? -4.011  -1.674  -7.831  1.00 0.00 ? 120 PHE A HZ   7  
ATOM 10336 N N    . GLN A 1 98  ? -8.388  -4.658  -14.537 1.00 0.00 ? 121 GLN A N    7  
ATOM 10337 C CA   . GLN A 1 98  ? -9.030  -4.932  -15.818 1.00 0.00 ? 121 GLN A CA   7  
ATOM 10338 C C    . GLN A 1 98  ? -10.535 -4.698  -15.654 1.00 0.00 ? 121 GLN A C    7  
ATOM 10339 O O    . GLN A 1 98  ? -10.966 -3.549  -15.589 1.00 0.00 ? 121 GLN A O    7  
ATOM 10340 C CB   . GLN A 1 98  ? -8.690  -6.348  -16.316 1.00 0.00 ? 121 GLN A CB   7  
ATOM 10341 C CG   . GLN A 1 98  ? -7.258  -6.501  -16.850 1.00 0.00 ? 121 GLN A CG   7  
ATOM 10342 C CD   . GLN A 1 98  ? -6.959  -7.940  -17.277 1.00 0.00 ? 121 GLN A CD   7  
ATOM 10343 O OE1  . GLN A 1 98  ? -7.733  -8.870  -17.033 1.00 0.00 ? 121 GLN A OE1  7  
ATOM 10344 N NE2  . GLN A 1 98  ? -5.834  -8.168  -17.933 1.00 0.00 ? 121 GLN A NE2  7  
ATOM 10345 H H    . GLN A 1 98  ? -8.150  -5.440  -13.938 1.00 0.00 ? 121 GLN A H    7  
ATOM 10346 H HA   . GLN A 1 98  ? -8.676  -4.219  -16.560 1.00 0.00 ? 121 GLN A HA   7  
ATOM 10347 H HB2  . GLN A 1 98  ? -8.852  -7.059  -15.507 1.00 0.00 ? 121 GLN A HB2  7  
ATOM 10348 H HB3  . GLN A 1 98  ? -9.365  -6.598  -17.137 1.00 0.00 ? 121 GLN A HB3  7  
ATOM 10349 H HG2  . GLN A 1 98  ? -7.142  -5.845  -17.707 1.00 0.00 ? 121 GLN A HG2  7  
ATOM 10350 H HG3  . GLN A 1 98  ? -6.533  -6.192  -16.100 1.00 0.00 ? 121 GLN A HG3  7  
ATOM 10351 H HE21 . GLN A 1 98  ? -5.197  -7.421  -18.183 1.00 0.00 ? 121 GLN A HE21 7  
ATOM 10352 H HE22 . GLN A 1 98  ? -5.687  -9.100  -18.294 1.00 0.00 ? 121 GLN A HE22 7  
ATOM 10353 N N    . LYS A 1 99  ? -11.338 -5.772  -15.573 1.00 0.00 ? 122 LYS A N    7  
ATOM 10354 C CA   . LYS A 1 99  ? -12.793 -5.740  -15.586 1.00 0.00 ? 122 LYS A CA   7  
ATOM 10355 C C    . LYS A 1 99  ? -13.297 -4.985  -16.832 1.00 0.00 ? 122 LYS A C    7  
ATOM 10356 O O    . LYS A 1 99  ? -12.505 -4.621  -17.706 1.00 0.00 ? 122 LYS A O    7  
ATOM 10357 C CB   . LYS A 1 99  ? -13.283 -5.239  -14.217 1.00 0.00 ? 122 LYS A CB   7  
ATOM 10358 C CG   . LYS A 1 99  ? -12.551 -5.835  -13.014 1.00 0.00 ? 122 LYS A CG   7  
ATOM 10359 C CD   . LYS A 1 99  ? -13.254 -5.461  -11.710 1.00 0.00 ? 122 LYS A CD   7  
ATOM 10360 C CE   . LYS A 1 99  ? -14.233 -6.557  -11.270 1.00 0.00 ? 122 LYS A CE   7  
ATOM 10361 N NZ   . LYS A 1 99  ? -15.362 -6.027  -10.480 1.00 0.00 ? 122 LYS A NZ   7  
ATOM 10362 H H    . LYS A 1 99  ? -10.945 -6.688  -15.632 1.00 0.00 ? 122 LYS A H    7  
ATOM 10363 H HA   . LYS A 1 99  ? -13.178 -6.751  -15.705 1.00 0.00 ? 122 LYS A HA   7  
ATOM 10364 H HB2  . LYS A 1 99  ? -13.191 -4.160  -14.163 1.00 0.00 ? 122 LYS A HB2  7  
ATOM 10365 H HB3  . LYS A 1 99  ? -14.313 -5.525  -14.103 1.00 0.00 ? 122 LYS A HB3  7  
ATOM 10366 H HG2  . LYS A 1 99  ? -12.517 -6.909  -13.107 1.00 0.00 ? 122 LYS A HG2  7  
ATOM 10367 H HG3  . LYS A 1 99  ? -11.534 -5.458  -12.996 1.00 0.00 ? 122 LYS A HG3  7  
ATOM 10368 H HD2  . LYS A 1 99  ? -12.491 -5.348  -10.945 1.00 0.00 ? 122 LYS A HD2  7  
ATOM 10369 H HD3  . LYS A 1 99  ? -13.771 -4.513  -11.856 1.00 0.00 ? 122 LYS A HD3  7  
ATOM 10370 H HE2  . LYS A 1 99  ? -14.634 -7.053  -12.156 1.00 0.00 ? 122 LYS A HE2  7  
ATOM 10371 H HE3  . LYS A 1 99  ? -13.686 -7.298  -10.683 1.00 0.00 ? 122 LYS A HE3  7  
ATOM 10372 H HZ1  . LYS A 1 99  ? -15.834 -6.769  -9.970  1.00 0.00 ? 122 LYS A HZ1  7  
ATOM 10373 H HZ2  . LYS A 1 99  ? -15.039 -5.359  -9.789  1.00 0.00 ? 122 LYS A HZ2  7  
ATOM 10374 H HZ3  . LYS A 1 99  ? -16.026 -5.560  -11.090 1.00 0.00 ? 122 LYS A HZ3  7  
ATOM 10375 N N    . PRO A 1 100 ? -14.617 -4.835  -17.009 1.00 0.00 ? 123 PRO A N    7  
ATOM 10376 C CA   . PRO A 1 100 ? -15.165 -4.135  -18.160 1.00 0.00 ? 123 PRO A CA   7  
ATOM 10377 C C    . PRO A 1 100 ? -14.694 -2.685  -18.258 1.00 0.00 ? 123 PRO A C    7  
ATOM 10378 O O    . PRO A 1 100 ? -14.614 -2.169  -19.372 1.00 0.00 ? 123 PRO A O    7  
ATOM 10379 C CB   . PRO A 1 100 ? -16.686 -4.228  -18.016 1.00 0.00 ? 123 PRO A CB   7  
ATOM 10380 C CG   . PRO A 1 100 ? -16.848 -5.523  -17.226 1.00 0.00 ? 123 PRO A CG   7  
ATOM 10381 C CD   . PRO A 1 100 ? -15.672 -5.499  -16.274 1.00 0.00 ? 123 PRO A CD   7  
ATOM 10382 H HA   . PRO A 1 100 ? -14.845 -4.671  -19.051 1.00 0.00 ? 123 PRO A HA   7  
ATOM 10383 H HB2  . PRO A 1 100 ? -17.064 -3.392  -17.429 1.00 0.00 ? 123 PRO A HB2  7  
ATOM 10384 H HB3  . PRO A 1 100 ? -17.182 -4.275  -18.986 1.00 0.00 ? 123 PRO A HB3  7  
ATOM 10385 H HG2  . PRO A 1 100 ? -17.774 -5.574  -16.668 1.00 0.00 ? 123 PRO A HG2  7  
ATOM 10386 H HG3  . PRO A 1 100 ? -16.739 -6.367  -17.899 1.00 0.00 ? 123 PRO A HG3  7  
ATOM 10387 H HD2  . PRO A 1 100 ? -15.927 -4.911  -15.395 1.00 0.00 ? 123 PRO A HD2  7  
ATOM 10388 H HD3  . PRO A 1 100 ? -15.401 -6.518  -15.996 1.00 0.00 ? 123 PRO A HD3  7  
ATOM 10389 N N    . ASP A 1 101 ? -14.408 -2.066  -17.106 1.00 0.00 ? 124 ASP A N    7  
ATOM 10390 C CA   . ASP A 1 101 ? -14.021 -0.678  -16.833 1.00 0.00 ? 124 ASP A CA   7  
ATOM 10391 C C    . ASP A 1 101 ? -15.293 -0.001  -16.340 1.00 0.00 ? 124 ASP A C    7  
ATOM 10392 O O    . ASP A 1 101 ? -16.265 0.107   -17.095 1.00 0.00 ? 124 ASP A O    7  
ATOM 10393 C CB   . ASP A 1 101 ? -13.399 0.077   -18.020 1.00 0.00 ? 124 ASP A CB   7  
ATOM 10394 C CG   . ASP A 1 101 ? -12.901 1.464   -17.614 1.00 0.00 ? 124 ASP A CG   7  
ATOM 10395 O OD1  . ASP A 1 101 ? -13.732 2.392   -17.476 1.00 0.00 ? 124 ASP A OD1  7  
ATOM 10396 O OD2  . ASP A 1 101 ? -11.668 1.663   -17.538 1.00 0.00 ? 124 ASP A OD2  7  
ATOM 10397 H H    . ASP A 1 101 ? -14.578 -2.611  -16.275 1.00 0.00 ? 124 ASP A H    7  
ATOM 10398 H HA   . ASP A 1 101 ? -13.278 -0.685  -16.034 1.00 0.00 ? 124 ASP A HA   7  
ATOM 10399 H HB2  . ASP A 1 101 ? -12.566 -0.507  -18.416 1.00 0.00 ? 124 ASP A HB2  7  
ATOM 10400 H HB3  . ASP A 1 101 ? -14.131 0.210   -18.814 1.00 0.00 ? 124 ASP A HB3  7  
ATOM 10401 N N    . ASN A 1 102 ? -15.351 0.326   -15.047 1.00 0.00 ? 125 ASN A N    7  
ATOM 10402 C CA   . ASN A 1 102 ? -16.451 1.053   -14.426 1.00 0.00 ? 125 ASN A CA   7  
ATOM 10403 C C    . ASN A 1 102 ? -15.876 2.353   -13.874 1.00 0.00 ? 125 ASN A C    7  
ATOM 10404 O O    . ASN A 1 102 ? -14.922 2.342   -13.091 1.00 0.00 ? 125 ASN A O    7  
ATOM 10405 C CB   . ASN A 1 102 ? -17.210 0.350   -13.270 1.00 0.00 ? 125 ASN A CB   7  
ATOM 10406 C CG   . ASN A 1 102 ? -17.211 -1.166  -13.087 1.00 0.00 ? 125 ASN A CG   7  
ATOM 10407 O OD1  . ASN A 1 102 ? -16.786 -1.971  -13.919 1.00 0.00 ? 125 ASN A OD1  7  
ATOM 10408 N ND2  . ASN A 1 102 ? -17.698 -1.579  -11.932 1.00 0.00 ? 125 ASN A ND2  7  
ATOM 10409 H H    . ASN A 1 102 ? -14.509 0.248   -14.507 1.00 0.00 ? 125 ASN A H    7  
ATOM 10410 H HA   . ASN A 1 102 ? -17.184 1.285   -15.200 1.00 0.00 ? 125 ASN A HA   7  
ATOM 10411 H HB2  . ASN A 1 102 ? -16.854 0.772   -12.331 1.00 0.00 ? 125 ASN A HB2  7  
ATOM 10412 H HB3  . ASN A 1 102 ? -18.251 0.663   -13.339 1.00 0.00 ? 125 ASN A HB3  7  
ATOM 10413 H HD21 . ASN A 1 102 ? -18.202 -0.904  -11.367 1.00 0.00 ? 125 ASN A HD21 7  
ATOM 10414 H HD22 . ASN A 1 102 ? -17.831 -2.556  -11.721 1.00 0.00 ? 125 ASN A HD22 7  
ATOM 10415 N N    . LYS A 1 103 ? -16.548 3.442   -14.223 1.00 0.00 ? 126 LYS A N    7  
ATOM 10416 C CA   . LYS A 1 103 ? -16.299 4.840   -13.889 1.00 0.00 ? 126 LYS A CA   7  
ATOM 10417 C C    . LYS A 1 103 ? -15.761 5.005   -12.476 1.00 0.00 ? 126 LYS A C    7  
ATOM 10418 O O    . LYS A 1 103 ? -14.626 5.430   -12.272 1.00 0.00 ? 126 LYS A O    7  
ATOM 10419 C CB   . LYS A 1 103 ? -17.611 5.625   -14.113 1.00 0.00 ? 126 LYS A CB   7  
ATOM 10420 C CG   . LYS A 1 103 ? -17.416 7.147   -14.224 1.00 0.00 ? 126 LYS A CG   7  
ATOM 10421 C CD   . LYS A 1 103 ? -17.161 7.883   -12.908 1.00 0.00 ? 126 LYS A CD   7  
ATOM 10422 C CE   . LYS A 1 103 ? -17.272 9.390   -13.156 1.00 0.00 ? 126 LYS A CE   7  
ATOM 10423 N NZ   . LYS A 1 103 ? -16.560 10.219  -12.157 1.00 0.00 ? 126 LYS A NZ   7  
ATOM 10424 H H    . LYS A 1 103 ? -17.306 3.234   -14.856 1.00 0.00 ? 126 LYS A H    7  
ATOM 10425 H HA   . LYS A 1 103 ? -15.544 5.218   -14.582 1.00 0.00 ? 126 LYS A HA   7  
ATOM 10426 H HB2  . LYS A 1 103 ? -18.040 5.296   -15.061 1.00 0.00 ? 126 LYS A HB2  7  
ATOM 10427 H HB3  . LYS A 1 103 ? -18.346 5.381   -13.330 1.00 0.00 ? 126 LYS A HB3  7  
ATOM 10428 H HG2  . LYS A 1 103 ? -16.600 7.361   -14.916 1.00 0.00 ? 126 LYS A HG2  7  
ATOM 10429 H HG3  . LYS A 1 103 ? -18.327 7.558   -14.648 1.00 0.00 ? 126 LYS A HG3  7  
ATOM 10430 H HD2  . LYS A 1 103 ? -17.927 7.583   -12.199 1.00 0.00 ? 126 LYS A HD2  7  
ATOM 10431 H HD3  . LYS A 1 103 ? -16.168 7.639   -12.533 1.00 0.00 ? 126 LYS A HD3  7  
ATOM 10432 H HE2  . LYS A 1 103 ? -16.845 9.600   -14.139 1.00 0.00 ? 126 LYS A HE2  7  
ATOM 10433 H HE3  . LYS A 1 103 ? -18.327 9.669   -13.185 1.00 0.00 ? 126 LYS A HE3  7  
ATOM 10434 H HZ1  . LYS A 1 103 ? -16.714 11.192  -12.390 1.00 0.00 ? 126 LYS A HZ1  7  
ATOM 10435 H HZ2  . LYS A 1 103 ? -16.882 10.077  -11.201 1.00 0.00 ? 126 LYS A HZ2  7  
ATOM 10436 H HZ3  . LYS A 1 103 ? -15.561 10.032  -12.219 1.00 0.00 ? 126 LYS A HZ3  7  
ATOM 10437 N N    . LEU A 1 104 ? -16.595 4.739   -11.472 1.00 0.00 ? 127 LEU A N    7  
ATOM 10438 C CA   . LEU A 1 104 ? -16.238 5.095   -10.112 1.00 0.00 ? 127 LEU A CA   7  
ATOM 10439 C C    . LEU A 1 104 ? -15.300 4.055   -9.525  1.00 0.00 ? 127 LEU A C    7  
ATOM 10440 O O    . LEU A 1 104 ? -14.437 4.422   -8.737  1.00 0.00 ? 127 LEU A O    7  
ATOM 10441 C CB   . LEU A 1 104 ? -17.484 5.208   -9.237  1.00 0.00 ? 127 LEU A CB   7  
ATOM 10442 C CG   . LEU A 1 104 ? -17.722 6.550   -8.540  1.00 0.00 ? 127 LEU A CG   7  
ATOM 10443 C CD1  . LEU A 1 104 ? -16.514 7.067   -7.757  1.00 0.00 ? 127 LEU A CD1  7  
ATOM 10444 C CD2  . LEU A 1 104 ? -18.164 7.622   -9.524  1.00 0.00 ? 127 LEU A CD2  7  
ATOM 10445 H H    . LEU A 1 104 ? -17.502 4.337   -11.656 1.00 0.00 ? 127 LEU A H    7  
ATOM 10446 H HA   . LEU A 1 104 ? -15.721 6.054   -10.130 1.00 0.00 ? 127 LEU A HA   7  
ATOM 10447 H HB2  . LEU A 1 104 ? -18.370 4.964   -9.822  1.00 0.00 ? 127 LEU A HB2  7  
ATOM 10448 H HB3  . LEU A 1 104 ? -17.390 4.470   -8.448  1.00 0.00 ? 127 LEU A HB3  7  
ATOM 10449 H HG   . LEU A 1 104 ? -18.542 6.386   -7.849  1.00 0.00 ? 127 LEU A HG   7  
ATOM 10450 H HD11 . LEU A 1 104 ? -16.078 6.258   -7.178  1.00 0.00 ? 127 LEU A HD11 7  
ATOM 10451 H HD12 . LEU A 1 104 ? -15.757 7.480   -8.419  1.00 0.00 ? 127 LEU A HD12 7  
ATOM 10452 H HD13 . LEU A 1 104 ? -16.841 7.860   -7.089  1.00 0.00 ? 127 LEU A HD13 7  
ATOM 10453 H HD21 . LEU A 1 104 ? -18.538 8.471   -8.967  1.00 0.00 ? 127 LEU A HD21 7  
ATOM 10454 H HD22 . LEU A 1 104 ? -17.316 7.945   -10.120 1.00 0.00 ? 127 LEU A HD22 7  
ATOM 10455 H HD23 . LEU A 1 104 ? -18.972 7.245   -10.151 1.00 0.00 ? 127 LEU A HD23 7  
ATOM 10456 N N    . HIS A 1 105 ? -15.445 2.772   -9.880  1.00 0.00 ? 128 HIS A N    7  
ATOM 10457 C CA   . HIS A 1 105 ? -14.588 1.736   -9.316  1.00 0.00 ? 128 HIS A CA   7  
ATOM 10458 C C    . HIS A 1 105 ? -13.122 2.006   -9.665  1.00 0.00 ? 128 HIS A C    7  
ATOM 10459 O O    . HIS A 1 105 ? -12.275 1.725   -8.825  1.00 0.00 ? 128 HIS A O    7  
ATOM 10460 C CB   . HIS A 1 105 ? -15.063 0.320   -9.692  1.00 0.00 ? 128 HIS A CB   7  
ATOM 10461 C CG   . HIS A 1 105 ? -14.071 -0.523  -10.455 1.00 0.00 ? 128 HIS A CG   7  
ATOM 10462 N ND1  . HIS A 1 105 ? -13.032 -1.274  -9.940  1.00 0.00 ? 128 HIS A ND1  7  
ATOM 10463 C CD2  . HIS A 1 105 ? -14.042 -0.655  -11.812 1.00 0.00 ? 128 HIS A CD2  7  
ATOM 10464 C CE1  . HIS A 1 105 ? -12.422 -1.876  -10.981 1.00 0.00 ? 128 HIS A CE1  7  
ATOM 10465 N NE2  . HIS A 1 105 ? -13.021 -1.544  -12.132 1.00 0.00 ? 128 HIS A NE2  7  
ATOM 10466 H H    . HIS A 1 105 ? -16.140 2.528   -10.569 1.00 0.00 ? 128 HIS A H    7  
ATOM 10467 H HA   . HIS A 1 105 ? -14.670 1.818   -8.231  1.00 0.00 ? 128 HIS A HA   7  
ATOM 10468 H HB2  . HIS A 1 105 ? -15.324 -0.214  -8.780  1.00 0.00 ? 128 HIS A HB2  7  
ATOM 10469 H HB3  . HIS A 1 105 ? -15.980 0.384   -10.276 1.00 0.00 ? 128 HIS A HB3  7  
ATOM 10470 H HD1  . HIS A 1 105 ? -12.708 -1.299  -8.980  1.00 0.00 ? 128 HIS A HD1  7  
ATOM 10471 H HD2  . HIS A 1 105 ? -14.684 -0.139  -12.500 1.00 0.00 ? 128 HIS A HD2  7  
ATOM 10472 H HE1  . HIS A 1 105 ? -11.561 -2.528  -10.916 1.00 0.00 ? 128 HIS A HE1  7  
ATOM 10473 N N    . GLN A 1 106 ? -12.832 2.605   -10.826 1.00 0.00 ? 129 GLN A N    7  
ATOM 10474 C CA   . GLN A 1 106 ? -11.524 3.146   -11.175 1.00 0.00 ? 129 GLN A CA   7  
ATOM 10475 C C    . GLN A 1 106 ? -11.071 4.171   -10.133 1.00 0.00 ? 129 GLN A C    7  
ATOM 10476 O O    . GLN A 1 106 ? -10.023 3.988   -9.512  1.00 0.00 ? 129 GLN A O    7  
ATOM 10477 C CB   . GLN A 1 106 ? -11.624 3.741   -12.587 1.00 0.00 ? 129 GLN A CB   7  
ATOM 10478 C CG   . GLN A 1 106 ? -10.388 4.483   -13.063 1.00 0.00 ? 129 GLN A CG   7  
ATOM 10479 C CD   . GLN A 1 106 ? -10.558 4.899   -14.518 1.00 0.00 ? 129 GLN A CD   7  
ATOM 10480 O OE1  . GLN A 1 106 ? -11.309 5.819   -14.839 1.00 0.00 ? 129 GLN A OE1  7  
ATOM 10481 N NE2  . GLN A 1 106 ? -9.830  4.267   -15.420 1.00 0.00 ? 129 GLN A NE2  7  
ATOM 10482 H H    . GLN A 1 106 ? -13.582 2.760   -11.491 1.00 0.00 ? 129 GLN A H    7  
ATOM 10483 H HA   . GLN A 1 106 ? -10.790 2.341   -11.181 1.00 0.00 ? 129 GLN A HA   7  
ATOM 10484 H HB2  . GLN A 1 106 ? -11.824 2.943   -13.294 1.00 0.00 ? 129 GLN A HB2  7  
ATOM 10485 H HB3  . GLN A 1 106 ? -12.439 4.451   -12.626 1.00 0.00 ? 129 GLN A HB3  7  
ATOM 10486 H HG2  . GLN A 1 106 ? -10.256 5.372   -12.458 1.00 0.00 ? 129 GLN A HG2  7  
ATOM 10487 H HG3  . GLN A 1 106 ? -9.528  3.835   -12.940 1.00 0.00 ? 129 GLN A HG3  7  
ATOM 10488 H HE21 . GLN A 1 106 ? -9.257  3.472   -15.130 1.00 0.00 ? 129 GLN A HE21 7  
ATOM 10489 H HE22 . GLN A 1 106 ? -10.113 4.342   -16.400 1.00 0.00 ? 129 GLN A HE22 7  
ATOM 10490 N N    . GLN A 1 107 ? -11.852 5.240   -9.944  1.00 0.00 ? 130 GLN A N    7  
ATOM 10491 C CA   . GLN A 1 107 ? -11.558 6.291   -8.975  1.00 0.00 ? 130 GLN A CA   7  
ATOM 10492 C C    . GLN A 1 107 ? -11.337 5.725   -7.570  1.00 0.00 ? 130 GLN A C    7  
ATOM 10493 O O    . GLN A 1 107 ? -10.465 6.211   -6.848  1.00 0.00 ? 130 GLN A O    7  
ATOM 10494 C CB   . GLN A 1 107 ? -12.699 7.328   -8.916  1.00 0.00 ? 130 GLN A CB   7  
ATOM 10495 C CG   . GLN A 1 107 ? -12.459 8.609   -9.730  1.00 0.00 ? 130 GLN A CG   7  
ATOM 10496 C CD   . GLN A 1 107 ? -12.725 9.846   -8.872  1.00 0.00 ? 130 GLN A CD   7  
ATOM 10497 O OE1  . GLN A 1 107 ? -11.795 10.480  -8.377  1.00 0.00 ? 130 GLN A OE1  7  
ATOM 10498 N NE2  . GLN A 1 107 ? -13.975 10.193  -8.608  1.00 0.00 ? 130 GLN A NE2  7  
ATOM 10499 H H    . GLN A 1 107 ? -12.675 5.327   -10.524 1.00 0.00 ? 130 GLN A H    7  
ATOM 10500 H HA   . GLN A 1 107 ? -10.630 6.767   -9.290  1.00 0.00 ? 130 GLN A HA   7  
ATOM 10501 H HB2  . GLN A 1 107 ? -13.633 6.874   -9.242  1.00 0.00 ? 130 GLN A HB2  7  
ATOM 10502 H HB3  . GLN A 1 107 ? -12.843 7.617   -7.873  1.00 0.00 ? 130 GLN A HB3  7  
ATOM 10503 H HG2  . GLN A 1 107 ? -11.426 8.644   -10.079 1.00 0.00 ? 130 GLN A HG2  7  
ATOM 10504 H HG3  . GLN A 1 107 ? -13.111 8.611   -10.602 1.00 0.00 ? 130 GLN A HG3  7  
ATOM 10505 H HE21 . GLN A 1 107 ? -14.793 9.741   -8.994  1.00 0.00 ? 130 GLN A HE21 7  
ATOM 10506 H HE22 . GLN A 1 107 ? -14.113 10.938  -7.933  1.00 0.00 ? 130 GLN A HE22 7  
ATOM 10507 N N    . VAL A 1 108 ? -12.152 4.761   -7.140  1.00 0.00 ? 131 VAL A N    7  
ATOM 10508 C CA   . VAL A 1 108 ? -11.993 4.118   -5.847  1.00 0.00 ? 131 VAL A CA   7  
ATOM 10509 C C    . VAL A 1 108 ? -10.681 3.339   -5.856  1.00 0.00 ? 131 VAL A C    7  
ATOM 10510 O O    . VAL A 1 108 ? -9.875  3.566   -4.962  1.00 0.00 ? 131 VAL A O    7  
ATOM 10511 C CB   . VAL A 1 108 ? -13.211 3.240   -5.500  1.00 0.00 ? 131 VAL A CB   7  
ATOM 10512 C CG1  . VAL A 1 108 ? -13.016 2.509   -4.164  1.00 0.00 ? 131 VAL A CG1  7  
ATOM 10513 C CG2  . VAL A 1 108 ? -14.495 4.072   -5.368  1.00 0.00 ? 131 VAL A CG2  7  
ATOM 10514 H H    . VAL A 1 108 ? -12.897 4.445   -7.753  1.00 0.00 ? 131 VAL A H    7  
ATOM 10515 H HA   . VAL A 1 108 ? -11.909 4.890   -5.083  1.00 0.00 ? 131 VAL A HA   7  
ATOM 10516 H HB   . VAL A 1 108 ? -13.357 2.502   -6.288  1.00 0.00 ? 131 VAL A HB   7  
ATOM 10517 H HG11 . VAL A 1 108 ? -12.953 3.224   -3.343  1.00 0.00 ? 131 VAL A HG11 7  
ATOM 10518 H HG12 . VAL A 1 108 ? -13.864 1.851   -4.002  1.00 0.00 ? 131 VAL A HG12 7  
ATOM 10519 H HG13 . VAL A 1 108 ? -12.113 1.901   -4.174  1.00 0.00 ? 131 VAL A HG13 7  
ATOM 10520 H HG21 . VAL A 1 108 ? -14.400 4.778   -4.543  1.00 0.00 ? 131 VAL A HG21 7  
ATOM 10521 H HG22 . VAL A 1 108 ? -14.697 4.620   -6.282  1.00 0.00 ? 131 VAL A HG22 7  
ATOM 10522 H HG23 . VAL A 1 108 ? -15.337 3.407   -5.173  1.00 0.00 ? 131 VAL A HG23 7  
ATOM 10523 N N    . LEU A 1 109 ? -10.459 2.440   -6.829  1.00 0.00 ? 132 LEU A N    7  
ATOM 10524 C CA   . LEU A 1 109 ? -9.353  1.485   -6.799  1.00 0.00 ? 132 LEU A CA   7  
ATOM 10525 C C    . LEU A 1 109 ? -8.056  2.232   -6.621  1.00 0.00 ? 132 LEU A C    7  
ATOM 10526 O O    . LEU A 1 109 ? -7.303  1.904   -5.709  1.00 0.00 ? 132 LEU A O    7  
ATOM 10527 C CB   . LEU A 1 109 ? -9.244  0.585   -8.060  1.00 0.00 ? 132 LEU A CB   7  
ATOM 10528 C CG   . LEU A 1 109 ? -9.409  -0.911  -7.752  1.00 0.00 ? 132 LEU A CG   7  
ATOM 10529 C CD1  . LEU A 1 109 ? -9.421  -1.773  -9.017  1.00 0.00 ? 132 LEU A CD1  7  
ATOM 10530 C CD2  . LEU A 1 109 ? -8.343  -1.423  -6.775  1.00 0.00 ? 132 LEU A CD2  7  
ATOM 10531 H H    . LEU A 1 109 ? -11.112 2.380   -7.603  1.00 0.00 ? 132 LEU A H    7  
ATOM 10532 H HA   . LEU A 1 109 ? -9.499  0.875   -5.912  1.00 0.00 ? 132 LEU A HA   7  
ATOM 10533 H HB2  . LEU A 1 109 ? -9.973  0.891   -8.806  1.00 0.00 ? 132 LEU A HB2  7  
ATOM 10534 H HB3  . LEU A 1 109 ? -8.261  0.702   -8.519  1.00 0.00 ? 132 LEU A HB3  7  
ATOM 10535 H HG   . LEU A 1 109 ? -10.373 -1.050  -7.302  1.00 0.00 ? 132 LEU A HG   7  
ATOM 10536 H HD11 . LEU A 1 109 ? -8.407  -1.963  -9.354  1.00 0.00 ? 132 LEU A HD11 7  
ATOM 10537 H HD12 . LEU A 1 109 ? -9.881  -2.739  -8.802  1.00 0.00 ? 132 LEU A HD12 7  
ATOM 10538 H HD13 . LEU A 1 109 ? -9.982  -1.276  -9.811  1.00 0.00 ? 132 LEU A HD13 7  
ATOM 10539 H HD21 . LEU A 1 109 ? -8.483  -2.489  -6.628  1.00 0.00 ? 132 LEU A HD21 7  
ATOM 10540 H HD22 . LEU A 1 109 ? -7.350  -1.228  -7.175  1.00 0.00 ? 132 LEU A HD22 7  
ATOM 10541 H HD23 . LEU A 1 109 ? -8.411  -0.935  -5.804  1.00 0.00 ? 132 LEU A HD23 7  
ATOM 10542 N N    . TRP A 1 110 ? -7.815  3.215   -7.487  1.00 0.00 ? 133 TRP A N    7  
ATOM 10543 C CA   . TRP A 1 110 ? -6.564  3.933   -7.497  1.00 0.00 ? 133 TRP A CA   7  
ATOM 10544 C C    . TRP A 1 110 ? -6.379  4.740   -6.223  1.00 0.00 ? 133 TRP A C    7  
ATOM 10545 O O    . TRP A 1 110 ? -5.348  4.574   -5.579  1.00 0.00 ? 133 TRP A O    7  
ATOM 10546 C CB   . TRP A 1 110 ? -6.432  4.728   -8.790  1.00 0.00 ? 133 TRP A CB   7  
ATOM 10547 C CG   . TRP A 1 110 ? -6.294  3.829   -9.981  1.00 0.00 ? 133 TRP A CG   7  
ATOM 10548 C CD1  . TRP A 1 110 ? -7.109  3.815   -11.057 1.00 0.00 ? 133 TRP A CD1  7  
ATOM 10549 C CD2  . TRP A 1 110 ? -5.299  2.785   -10.221 1.00 0.00 ? 133 TRP A CD2  7  
ATOM 10550 N NE1  . TRP A 1 110 ? -6.672  2.870   -11.962 1.00 0.00 ? 133 TRP A NE1  7  
ATOM 10551 C CE2  . TRP A 1 110 ? -5.554  2.211   -11.501 1.00 0.00 ? 133 TRP A CE2  7  
ATOM 10552 C CE3  . TRP A 1 110 ? -4.201  2.263   -9.494  1.00 0.00 ? 133 TRP A CE3  7  
ATOM 10553 C CZ2  . TRP A 1 110 ? -4.723  1.228   -12.058 1.00 0.00 ? 133 TRP A CZ2  7  
ATOM 10554 C CZ3  . TRP A 1 110 ? -3.381  1.258   -10.035 1.00 0.00 ? 133 TRP A CZ3  7  
ATOM 10555 C CH2  . TRP A 1 110 ? -3.628  0.752   -11.320 1.00 0.00 ? 133 TRP A CH2  7  
ATOM 10556 H H    . TRP A 1 110 ? -8.496  3.413   -8.214  1.00 0.00 ? 133 TRP A H    7  
ATOM 10557 H HA   . TRP A 1 110 ? -5.775  3.189   -7.504  1.00 0.00 ? 133 TRP A HA   7  
ATOM 10558 H HB2  . TRP A 1 110 ? -7.294  5.386   -8.912  1.00 0.00 ? 133 TRP A HB2  7  
ATOM 10559 H HB3  . TRP A 1 110 ? -5.537  5.344   -8.731  1.00 0.00 ? 133 TRP A HB3  7  
ATOM 10560 H HD1  . TRP A 1 110 ? -7.960  4.467   -11.192 1.00 0.00 ? 133 TRP A HD1  7  
ATOM 10561 H HE1  . TRP A 1 110 ? -7.107  2.722   -12.874 1.00 0.00 ? 133 TRP A HE1  7  
ATOM 10562 H HE3  . TRP A 1 110 ? -3.983  2.623   -8.499  1.00 0.00 ? 133 TRP A HE3  7  
ATOM 10563 H HZ2  . TRP A 1 110 ? -4.919  0.839   -13.045 1.00 0.00 ? 133 TRP A HZ2  7  
ATOM 10564 H HZ3  . TRP A 1 110 ? -2.564  0.855   -9.455  1.00 0.00 ? 133 TRP A HZ3  7  
ATOM 10565 H HH2  . TRP A 1 110 ? -2.989  -0.018  -11.727 1.00 0.00 ? 133 TRP A HH2  7  
ATOM 10566 N N    . ARG A 1 111 ? -7.369  5.531   -5.792  1.00 0.00 ? 134 ARG A N    7  
ATOM 10567 C CA   . ARG A 1 111 ? -7.276  6.289   -4.539  1.00 0.00 ? 134 ARG A CA   7  
ATOM 10568 C C    . ARG A 1 111 ? -6.916  5.375   -3.372  1.00 0.00 ? 134 ARG A C    7  
ATOM 10569 O O    . ARG A 1 111 ? -6.030  5.691   -2.579  1.00 0.00 ? 134 ARG A O    7  
ATOM 10570 C CB   . ARG A 1 111 ? -8.611  7.008   -4.285  1.00 0.00 ? 134 ARG A CB   7  
ATOM 10571 C CG   . ARG A 1 111 ? -8.654  7.852   -3.002  1.00 0.00 ? 134 ARG A CG   7  
ATOM 10572 C CD   . ARG A 1 111 ? -7.554  8.907   -2.943  1.00 0.00 ? 134 ARG A CD   7  
ATOM 10573 N NE   . ARG A 1 111 ? -7.843  9.885   -1.893  1.00 0.00 ? 134 ARG A NE   7  
ATOM 10574 C CZ   . ARG A 1 111 ? -7.053  10.858  -1.441  1.00 0.00 ? 134 ARG A CZ   7  
ATOM 10575 N NH1  . ARG A 1 111 ? -5.811  10.997  -1.890  1.00 0.00 ? 134 ARG A NH1  7  
ATOM 10576 N NH2  . ARG A 1 111 ? -7.512  11.708  -0.533  1.00 0.00 ? 134 ARG A NH2  7  
ATOM 10577 H H    . ARG A 1 111 ? -8.216  5.616   -6.339  1.00 0.00 ? 134 ARG A H    7  
ATOM 10578 H HA   . ARG A 1 111 ? -6.482  7.030   -4.657  1.00 0.00 ? 134 ARG A HA   7  
ATOM 10579 H HB2  . ARG A 1 111 ? -8.831  7.661   -5.128  1.00 0.00 ? 134 ARG A HB2  7  
ATOM 10580 H HB3  . ARG A 1 111 ? -9.407  6.265   -4.227  1.00 0.00 ? 134 ARG A HB3  7  
ATOM 10581 H HG2  . ARG A 1 111 ? -9.611  8.370   -2.978  1.00 0.00 ? 134 ARG A HG2  7  
ATOM 10582 H HG3  . ARG A 1 111 ? -8.587  7.207   -2.124  1.00 0.00 ? 134 ARG A HG3  7  
ATOM 10583 H HD2  . ARG A 1 111 ? -6.600  8.420   -2.742  1.00 0.00 ? 134 ARG A HD2  7  
ATOM 10584 H HD3  . ARG A 1 111 ? -7.515  9.427   -3.897  1.00 0.00 ? 134 ARG A HD3  7  
ATOM 10585 H HE   . ARG A 1 111 ? -8.685  9.698   -1.344  1.00 0.00 ? 134 ARG A HE   7  
ATOM 10586 H HH11 . ARG A 1 111 ? -5.459  10.310  -2.560  1.00 0.00 ? 134 ARG A HH11 7  
ATOM 10587 H HH12 . ARG A 1 111 ? -5.158  11.297  -1.167  1.00 0.00 ? 134 ARG A HH12 7  
ATOM 10588 H HH21 . ARG A 1 111 ? -8.475  11.657  -0.205  1.00 0.00 ? 134 ARG A HH21 7  
ATOM 10589 H HH22 . ARG A 1 111 ? -6.919  12.428  -0.125  1.00 0.00 ? 134 ARG A HH22 7  
ATOM 10590 N N    . LEU A 1 112 ? -7.616  4.245   -3.292  1.00 0.00 ? 135 LEU A N    7  
ATOM 10591 C CA   . LEU A 1 112 ? -7.488  3.223   -2.272  1.00 0.00 ? 135 LEU A CA   7  
ATOM 10592 C C    . LEU A 1 112 ? -6.067  2.671   -2.290  1.00 0.00 ? 135 LEU A C    7  
ATOM 10593 O O    . LEU A 1 112 ? -5.349  2.879   -1.320  1.00 0.00 ? 135 LEU A O    7  
ATOM 10594 C CB   . LEU A 1 112 ? -8.590  2.185   -2.525  1.00 0.00 ? 135 LEU A CB   7  
ATOM 10595 C CG   . LEU A 1 112 ? -8.958  1.218   -1.406  1.00 0.00 ? 135 LEU A CG   7  
ATOM 10596 C CD1  . LEU A 1 112 ? -10.280 0.549   -1.757  1.00 0.00 ? 135 LEU A CD1  7  
ATOM 10597 C CD2  . LEU A 1 112 ? -7.912  0.143   -1.288  1.00 0.00 ? 135 LEU A CD2  7  
ATOM 10598 H H    . LEU A 1 112 ? -8.296  4.061   -4.024  1.00 0.00 ? 135 LEU A H    7  
ATOM 10599 H HA   . LEU A 1 112 ? -7.666  3.685   -1.300  1.00 0.00 ? 135 LEU A HA   7  
ATOM 10600 H HB2  . LEU A 1 112 ? -9.490  2.737   -2.696  1.00 0.00 ? 135 LEU A HB2  7  
ATOM 10601 H HB3  . LEU A 1 112 ? -8.392  1.631   -3.437  1.00 0.00 ? 135 LEU A HB3  7  
ATOM 10602 H HG   . LEU A 1 112 ? -9.062  1.748   -0.466  1.00 0.00 ? 135 LEU A HG   7  
ATOM 10603 H HD11 . LEU A 1 112 ? -11.088 1.275   -1.730  1.00 0.00 ? 135 LEU A HD11 7  
ATOM 10604 H HD12 . LEU A 1 112 ? -10.221 0.147   -2.763  1.00 0.00 ? 135 LEU A HD12 7  
ATOM 10605 H HD13 . LEU A 1 112 ? -10.488 -0.247  -1.044  1.00 0.00 ? 135 LEU A HD13 7  
ATOM 10606 H HD21 . LEU A 1 112 ? -7.016  0.616   -0.913  1.00 0.00 ? 135 LEU A HD21 7  
ATOM 10607 H HD22 . LEU A 1 112 ? -8.229  -0.629  -0.584  1.00 0.00 ? 135 LEU A HD22 7  
ATOM 10608 H HD23 . LEU A 1 112 ? -7.734  -0.287  -2.272  1.00 0.00 ? 135 LEU A HD23 7  
ATOM 10609 N N    . VAL A 1 113 ? -5.627  2.007   -3.365  1.00 0.00 ? 136 VAL A N    7  
ATOM 10610 C CA   . VAL A 1 113 ? -4.285  1.414   -3.409  1.00 0.00 ? 136 VAL A CA   7  
ATOM 10611 C C    . VAL A 1 113 ? -3.189  2.467   -3.200  1.00 0.00 ? 136 VAL A C    7  
ATOM 10612 O O    . VAL A 1 113 ? -2.198  2.193   -2.519  1.00 0.00 ? 136 VAL A O    7  
ATOM 10613 C CB   . VAL A 1 113 ? -4.096  0.511   -4.647  1.00 0.00 ? 136 VAL A CB   7  
ATOM 10614 C CG1  . VAL A 1 113 ? -4.147  1.163   -6.014  1.00 0.00 ? 136 VAL A CG1  7  
ATOM 10615 C CG2  . VAL A 1 113 ? -2.765  -0.237  -4.619  1.00 0.00 ? 136 VAL A CG2  7  
ATOM 10616 H H    . VAL A 1 113 ? -6.245  1.910   -4.167  1.00 0.00 ? 136 VAL A H    7  
ATOM 10617 H HA   . VAL A 1 113 ? -4.219  0.747   -2.557  1.00 0.00 ? 136 VAL A HA   7  
ATOM 10618 H HB   . VAL A 1 113 ? -4.905  -0.217  -4.645  1.00 0.00 ? 136 VAL A HB   7  
ATOM 10619 H HG11 . VAL A 1 113 ? -3.217  1.685   -6.225  1.00 0.00 ? 136 VAL A HG11 7  
ATOM 10620 H HG12 . VAL A 1 113 ? -4.317  0.358   -6.736  1.00 0.00 ? 136 VAL A HG12 7  
ATOM 10621 H HG13 . VAL A 1 113 ? -4.965  1.862   -6.038  1.00 0.00 ? 136 VAL A HG13 7  
ATOM 10622 H HG21 . VAL A 1 113 ? -2.686  -0.782  -3.689  1.00 0.00 ? 136 VAL A HG21 7  
ATOM 10623 H HG22 . VAL A 1 113 ? -2.735  -0.937  -5.449  1.00 0.00 ? 136 VAL A HG22 7  
ATOM 10624 H HG23 . VAL A 1 113 ? -1.923  0.456   -4.715  1.00 0.00 ? 136 VAL A HG23 7  
ATOM 10625 N N    . GLN A 1 114 ? -3.389  3.692   -3.692  1.00 0.00 ? 137 GLN A N    7  
ATOM 10626 C CA   . GLN A 1 114 ? -2.463  4.788   -3.457  1.00 0.00 ? 137 GLN A CA   7  
ATOM 10627 C C    . GLN A 1 114 ? -2.315  5.064   -1.957  1.00 0.00 ? 137 GLN A C    7  
ATOM 10628 O O    . GLN A 1 114 ? -1.182  5.150   -1.466  1.00 0.00 ? 137 GLN A O    7  
ATOM 10629 C CB   . GLN A 1 114 ? -2.891  6.047   -4.233  1.00 0.00 ? 137 GLN A CB   7  
ATOM 10630 C CG   . GLN A 1 114 ? -2.636  5.916   -5.747  1.00 0.00 ? 137 GLN A CG   7  
ATOM 10631 C CD   . GLN A 1 114 ? -3.391  6.938   -6.595  1.00 0.00 ? 137 GLN A CD   7  
ATOM 10632 O OE1  . GLN A 1 114 ? -3.942  7.917   -6.097  1.00 0.00 ? 137 GLN A OE1  7  
ATOM 10633 N NE2  . GLN A 1 114 ? -3.385  6.791   -7.910  1.00 0.00 ? 137 GLN A NE2  7  
ATOM 10634 H H    . GLN A 1 114 ? -4.235  3.877   -4.220  1.00 0.00 ? 137 GLN A H    7  
ATOM 10635 H HA   . GLN A 1 114 ? -1.496  4.458   -3.825  1.00 0.00 ? 137 GLN A HA   7  
ATOM 10636 H HB2  . GLN A 1 114 ? -3.947  6.240   -4.047  1.00 0.00 ? 137 GLN A HB2  7  
ATOM 10637 H HB3  . GLN A 1 114 ? -2.326  6.905   -3.867  1.00 0.00 ? 137 GLN A HB3  7  
ATOM 10638 H HG2  . GLN A 1 114 ? -1.568  6.036   -5.930  1.00 0.00 ? 137 GLN A HG2  7  
ATOM 10639 H HG3  . GLN A 1 114 ? -2.935  4.925   -6.082  1.00 0.00 ? 137 GLN A HG3  7  
ATOM 10640 H HE21 . GLN A 1 114 ? -2.887  6.043   -8.377  1.00 0.00 ? 137 GLN A HE21 7  
ATOM 10641 H HE22 . GLN A 1 114 ? -3.859  7.475   -8.478  1.00 0.00 ? 137 GLN A HE22 7  
ATOM 10642 N N    . GLU A 1 115 ? -3.427  5.204   -1.224  1.00 0.00 ? 138 GLU A N    7  
ATOM 10643 C CA   . GLU A 1 115 ? -3.374  5.465   0.212   1.00 0.00 ? 138 GLU A CA   7  
ATOM 10644 C C    . GLU A 1 115 ? -2.894  4.241   0.988   1.00 0.00 ? 138 GLU A C    7  
ATOM 10645 O O    . GLU A 1 115 ? -2.206  4.397   1.985   1.00 0.00 ? 138 GLU A O    7  
ATOM 10646 C CB   . GLU A 1 115 ? -4.719  5.965   0.768   1.00 0.00 ? 138 GLU A CB   7  
ATOM 10647 C CG   . GLU A 1 115 ? -4.532  6.745   2.086   1.00 0.00 ? 138 GLU A CG   7  
ATOM 10648 C CD   . GLU A 1 115 ? -3.643  7.994   1.966   1.00 0.00 ? 138 GLU A CD   7  
ATOM 10649 O OE1  . GLU A 1 115 ? -3.466  8.524   0.841   1.00 0.00 ? 138 GLU A OE1  7  
ATOM 10650 O OE2  . GLU A 1 115 ? -3.177  8.525   3.002   1.00 0.00 ? 138 GLU A OE2  7  
ATOM 10651 H H    . GLU A 1 115 ? -4.338  5.081   -1.658  1.00 0.00 ? 138 GLU A H    7  
ATOM 10652 H HA   . GLU A 1 115 ? -2.638  6.249   0.358   1.00 0.00 ? 138 GLU A HA   7  
ATOM 10653 H HB2  . GLU A 1 115 ? -5.207  6.614   0.039   1.00 0.00 ? 138 GLU A HB2  7  
ATOM 10654 H HB3  . GLU A 1 115 ? -5.375  5.113   0.957   1.00 0.00 ? 138 GLU A HB3  7  
ATOM 10655 H HG2  . GLU A 1 115 ? -5.514  7.065   2.437   1.00 0.00 ? 138 GLU A HG2  7  
ATOM 10656 H HG3  . GLU A 1 115 ? -4.113  6.073   2.835   1.00 0.00 ? 138 GLU A HG3  7  
ATOM 10657 N N    . LEU A 1 116 ? -3.192  3.026   0.530   1.00 0.00 ? 139 LEU A N    7  
ATOM 10658 C CA   . LEU A 1 116 ? -2.735  1.804   1.185   1.00 0.00 ? 139 LEU A CA   7  
ATOM 10659 C C    . LEU A 1 116 ? -1.217  1.756   1.247   1.00 0.00 ? 139 LEU A C    7  
ATOM 10660 O O    . LEU A 1 116 ? -0.685  1.361   2.283   1.00 0.00 ? 139 LEU A O    7  
ATOM 10661 C CB   . LEU A 1 116 ? -3.247  0.564   0.447   1.00 0.00 ? 139 LEU A CB   7  
ATOM 10662 C CG   . LEU A 1 116 ? -4.530  -0.066  1.009   1.00 0.00 ? 139 LEU A CG   7  
ATOM 10663 C CD1  . LEU A 1 116 ? -5.593  0.918   1.491   1.00 0.00 ? 139 LEU A CD1  7  
ATOM 10664 C CD2  . LEU A 1 116 ? -5.116  -1.003  -0.054  1.00 0.00 ? 139 LEU A CD2  7  
ATOM 10665 H H    . LEU A 1 116 ? -3.789  2.951   -0.287  1.00 0.00 ? 139 LEU A H    7  
ATOM 10666 H HA   . LEU A 1 116 ? -3.098  1.797   2.211   1.00 0.00 ? 139 LEU A HA   7  
ATOM 10667 H HB2  . LEU A 1 116 ? -3.369  0.811   -0.603  1.00 0.00 ? 139 LEU A HB2  7  
ATOM 10668 H HB3  . LEU A 1 116 ? -2.474  -0.200  0.514   1.00 0.00 ? 139 LEU A HB3  7  
ATOM 10669 H HG   . LEU A 1 116 ? -4.256  -0.650  1.877   1.00 0.00 ? 139 LEU A HG   7  
ATOM 10670 H HD11 . LEU A 1 116 ? -6.489  0.366   1.764   1.00 0.00 ? 139 LEU A HD11 7  
ATOM 10671 H HD12 . LEU A 1 116 ? -5.236  1.430   2.383   1.00 0.00 ? 139 LEU A HD12 7  
ATOM 10672 H HD13 . LEU A 1 116 ? -5.822  1.647   0.723   1.00 0.00 ? 139 LEU A HD13 7  
ATOM 10673 H HD21 . LEU A 1 116 ? -4.460  -1.856  -0.207  1.00 0.00 ? 139 LEU A HD21 7  
ATOM 10674 H HD22 . LEU A 1 116 ? -6.090  -1.368  0.274   1.00 0.00 ? 139 LEU A HD22 7  
ATOM 10675 H HD23 . LEU A 1 116 ? -5.238  -0.473  -1.003  1.00 0.00 ? 139 LEU A HD23 7  
ATOM 10676 N N    . CYS A 1 117 ? -0.538  2.120   0.155   1.00 0.00 ? 140 CYS A N    7  
ATOM 10677 C CA   . CYS A 1 117 ? 0.913   2.194   0.147   1.00 0.00 ? 140 CYS A CA   7  
ATOM 10678 C C    . CYS A 1 117 ? 1.378   3.386   0.986   1.00 0.00 ? 140 CYS A C    7  
ATOM 10679 O O    . CYS A 1 117 ? 2.192   3.217   1.887   1.00 0.00 ? 140 CYS A O    7  
ATOM 10680 C CB   . CYS A 1 117 ? 1.446   2.289   -1.289  1.00 0.00 ? 140 CYS A CB   7  
ATOM 10681 S SG   . CYS A 1 117 ? 1.067   0.866   -2.345  1.00 0.00 ? 140 CYS A SG   7  
ATOM 10682 H H    . CYS A 1 117 ? -1.052  2.359   -0.685  1.00 0.00 ? 140 CYS A H    7  
ATOM 10683 H HA   . CYS A 1 117 ? 1.308   1.285   0.602   1.00 0.00 ? 140 CYS A HA   7  
ATOM 10684 H HB2  . CYS A 1 117 ? 1.043   3.187   -1.753  1.00 0.00 ? 140 CYS A HB2  7  
ATOM 10685 H HB3  . CYS A 1 117 ? 2.530   2.384   -1.240  1.00 0.00 ? 140 CYS A HB3  7  
ATOM 10686 N N    . SER A 1 118 ? 0.914   4.604   0.676   1.00 0.00 ? 141 SER A N    7  
ATOM 10687 C CA   . SER A 1 118 ? 1.461   5.810   1.311   1.00 0.00 ? 141 SER A CA   7  
ATOM 10688 C C    . SER A 1 118 ? 1.167   5.889   2.800   1.00 0.00 ? 141 SER A C    7  
ATOM 10689 O O    . SER A 1 118 ? 2.013   6.370   3.538   1.00 0.00 ? 141 SER A O    7  
ATOM 10690 C CB   . SER A 1 118 ? 1.006   7.098   0.620   1.00 0.00 ? 141 SER A CB   7  
ATOM 10691 O OG   . SER A 1 118 ? -0.335  7.067   0.171   1.00 0.00 ? 141 SER A OG   7  
ATOM 10692 H H    . SER A 1 118 ? 0.191   4.679   -0.026  1.00 0.00 ? 141 SER A H    7  
ATOM 10693 H HA   . SER A 1 118 ? 2.548   5.781   1.243   1.00 0.00 ? 141 SER A HA   7  
ATOM 10694 H HB2  . SER A 1 118 ? 1.126   7.932   1.313   1.00 0.00 ? 141 SER A HB2  7  
ATOM 10695 H HB3  . SER A 1 118 ? 1.662   7.291   -0.223  1.00 0.00 ? 141 SER A HB3  7  
ATOM 10696 H HG   . SER A 1 118 ? -0.465  6.328   -0.453  1.00 0.00 ? 141 SER A HG   7  
ATOM 10697 N N    . LEU A 1 119 ? -0.019  5.464   3.224   1.00 0.00 ? 142 LEU A N    7  
ATOM 10698 C CA   . LEU A 1 119 ? -0.563  5.492   4.565   1.00 0.00 ? 142 LEU A CA   7  
ATOM 10699 C C    . LEU A 1 119 ? -0.117  6.727   5.355   1.00 0.00 ? 142 LEU A C    7  
ATOM 10700 O O    . LEU A 1 119 ? 0.648   6.636   6.313   1.00 0.00 ? 142 LEU A O    7  
ATOM 10701 C CB   . LEU A 1 119 ? -0.271  4.123   5.205   1.00 0.00 ? 142 LEU A CB   7  
ATOM 10702 C CG   . LEU A 1 119 ? -1.461  3.516   5.953   1.00 0.00 ? 142 LEU A CG   7  
ATOM 10703 C CD1  . LEU A 1 119 ? -1.848  4.346   7.181   1.00 0.00 ? 142 LEU A CD1  7  
ATOM 10704 C CD2  . LEU A 1 119 ? -2.678  3.233   5.060   1.00 0.00 ? 142 LEU A CD2  7  
ATOM 10705 H H    . LEU A 1 119 ? -0.627  4.959   2.592   1.00 0.00 ? 142 LEU A H    7  
ATOM 10706 H HA   . LEU A 1 119 ? -1.638  5.587   4.440   1.00 0.00 ? 142 LEU A HA   7  
ATOM 10707 H HB2  . LEU A 1 119 ? 0.006   3.404   4.430   1.00 0.00 ? 142 LEU A HB2  7  
ATOM 10708 H HB3  . LEU A 1 119 ? 0.588   4.191   5.874   1.00 0.00 ? 142 LEU A HB3  7  
ATOM 10709 H HG   . LEU A 1 119 ? -1.114  2.546   6.280   1.00 0.00 ? 142 LEU A HG   7  
ATOM 10710 H HD11 . LEU A 1 119 ? -0.954  4.583   7.757   1.00 0.00 ? 142 LEU A HD11 7  
ATOM 10711 H HD12 . LEU A 1 119 ? -2.332  5.274   6.881   1.00 0.00 ? 142 LEU A HD12 7  
ATOM 10712 H HD13 . LEU A 1 119 ? -2.517  3.766   7.815   1.00 0.00 ? 142 LEU A HD13 7  
ATOM 10713 H HD21 . LEU A 1 119 ? -3.161  4.152   4.731   1.00 0.00 ? 142 LEU A HD21 7  
ATOM 10714 H HD22 . LEU A 1 119 ? -2.356  2.675   4.183   1.00 0.00 ? 142 LEU A HD22 7  
ATOM 10715 H HD23 . LEU A 1 119 ? -3.398  2.630   5.611   1.00 0.00 ? 142 LEU A HD23 7  
ATOM 10716 N N    . LYS A 1 120 ? -0.604  7.908   4.939   1.00 0.00 ? 143 LYS A N    7  
ATOM 10717 C CA   . LYS A 1 120 ? -0.260  9.219   5.515   1.00 0.00 ? 143 LYS A CA   7  
ATOM 10718 C C    . LYS A 1 120 ? 1.210   9.635   5.366   1.00 0.00 ? 143 LYS A C    7  
ATOM 10719 O O    . LYS A 1 120 ? 1.582   10.699  5.869   1.00 0.00 ? 143 LYS A O    7  
ATOM 10720 C CB   . LYS A 1 120 ? -0.796  9.318   6.965   1.00 0.00 ? 143 LYS A CB   7  
ATOM 10721 C CG   . LYS A 1 120 ? -2.163  10.013  7.001   1.00 0.00 ? 143 LYS A CG   7  
ATOM 10722 C CD   . LYS A 1 120 ? -2.081  11.462  7.505   1.00 0.00 ? 143 LYS A CD   7  
ATOM 10723 C CE   . LYS A 1 120 ? -3.105  12.407  6.867   1.00 0.00 ? 143 LYS A CE   7  
ATOM 10724 N NZ   . LYS A 1 120 ? -4.452  11.845  6.638   1.00 0.00 ? 143 LYS A NZ   7  
ATOM 10725 H H    . LYS A 1 120 ? -1.265  7.901   4.169   1.00 0.00 ? 143 LYS A H    7  
ATOM 10726 H HA   . LYS A 1 120 ? -0.789  9.959   4.916   1.00 0.00 ? 143 LYS A HA   7  
ATOM 10727 H HB2  . LYS A 1 120 ? -0.916  8.323   7.391   1.00 0.00 ? 143 LYS A HB2  7  
ATOM 10728 H HB3  . LYS A 1 120 ? -0.089  9.843   7.608   1.00 0.00 ? 143 LYS A HB3  7  
ATOM 10729 H HG2  . LYS A 1 120 ? -2.589  9.996   6.002   1.00 0.00 ? 143 LYS A HG2  7  
ATOM 10730 H HG3  . LYS A 1 120 ? -2.832  9.455   7.654   1.00 0.00 ? 143 LYS A HG3  7  
ATOM 10731 H HD2  . LYS A 1 120 ? -2.197  11.472  8.587   1.00 0.00 ? 143 LYS A HD2  7  
ATOM 10732 H HD3  . LYS A 1 120 ? -1.095  11.870  7.281   1.00 0.00 ? 143 LYS A HD3  7  
ATOM 10733 H HE2  . LYS A 1 120 ? -3.196  13.298  7.486   1.00 0.00 ? 143 LYS A HE2  7  
ATOM 10734 H HE3  . LYS A 1 120 ? -2.715  12.719  5.900   1.00 0.00 ? 143 LYS A HE3  7  
ATOM 10735 H HZ1  . LYS A 1 120 ? -4.955  12.506  6.048   1.00 0.00 ? 143 LYS A HZ1  7  
ATOM 10736 H HZ2  . LYS A 1 120 ? -4.412  10.968  6.125   1.00 0.00 ? 143 LYS A HZ2  7  
ATOM 10737 H HZ3  . LYS A 1 120 ? -4.983  11.741  7.494   1.00 0.00 ? 143 LYS A HZ3  7  
ATOM 10738 N N    . HIS A 1 121 ? 1.994   8.917   4.566   1.00 0.00 ? 144 HIS A N    7  
ATOM 10739 C CA   . HIS A 1 121 ? 3.448   8.941   4.409   1.00 0.00 ? 144 HIS A CA   7  
ATOM 10740 C C    . HIS A 1 121 ? 4.081   8.192   5.590   1.00 0.00 ? 144 HIS A C    7  
ATOM 10741 O O    . HIS A 1 121 ? 3.454   8.104   6.652   1.00 0.00 ? 144 HIS A O    7  
ATOM 10742 C CB   . HIS A 1 121 ? 4.028   10.352  4.207   1.00 0.00 ? 144 HIS A CB   7  
ATOM 10743 C CG   . HIS A 1 121 ? 4.831   10.913  5.351   1.00 0.00 ? 144 HIS A CG   7  
ATOM 10744 N ND1  . HIS A 1 121 ? 4.504   10.934  6.689   1.00 0.00 ? 144 HIS A ND1  7  
ATOM 10745 C CD2  . HIS A 1 121 ? 6.124   11.327  5.239   1.00 0.00 ? 144 HIS A CD2  7  
ATOM 10746 C CE1  . HIS A 1 121 ? 5.589   11.343  7.363   1.00 0.00 ? 144 HIS A CE1  7  
ATOM 10747 N NE2  . HIS A 1 121 ? 6.590   11.632  6.516   1.00 0.00 ? 144 HIS A NE2  7  
ATOM 10748 H H    . HIS A 1 121 ? 1.622   8.018   4.287   1.00 0.00 ? 144 HIS A H    7  
ATOM 10749 H HA   . HIS A 1 121 ? 3.657   8.405   3.480   1.00 0.00 ? 144 HIS A HA   7  
ATOM 10750 H HB2  . HIS A 1 121 ? 4.723   10.267  3.382   1.00 0.00 ? 144 HIS A HB2  7  
ATOM 10751 H HB3  . HIS A 1 121 ? 3.264   11.057  3.892   1.00 0.00 ? 144 HIS A HB3  7  
ATOM 10752 H HD1  . HIS A 1 121 ? 3.650   10.578  7.124   1.00 0.00 ? 144 HIS A HD1  7  
ATOM 10753 H HD2  . HIS A 1 121 ? 6.684   11.347  4.318   1.00 0.00 ? 144 HIS A HD2  7  
ATOM 10754 H HE1  . HIS A 1 121 ? 5.647   11.422  8.440   1.00 0.00 ? 144 HIS A HE1  7  
ATOM 10755 N N    . CYS A 1 122 ? 5.339   7.746   5.460   1.00 0.00 ? 145 CYS A N    7  
ATOM 10756 C CA   . CYS A 1 122 ? 6.011   7.048   6.554   1.00 0.00 ? 145 CYS A CA   7  
ATOM 10757 C C    . CYS A 1 122 ? 7.410   7.569   6.899   1.00 0.00 ? 145 CYS A C    7  
ATOM 10758 O O    . CYS A 1 122 ? 7.954   7.119   7.912   1.00 0.00 ? 145 CYS A O    7  
ATOM 10759 C CB   . CYS A 1 122 ? 5.997   5.522   6.349   1.00 0.00 ? 145 CYS A CB   7  
ATOM 10760 S SG   . CYS A 1 122 ? 5.043   4.831   4.964   1.00 0.00 ? 145 CYS A SG   7  
ATOM 10761 H H    . CYS A 1 122 ? 5.819   7.788   4.571   1.00 0.00 ? 145 CYS A H    7  
ATOM 10762 H HA   . CYS A 1 122 ? 5.432   7.222   7.459   1.00 0.00 ? 145 CYS A HA   7  
ATOM 10763 H HB2  . CYS A 1 122 ? 7.022   5.158   6.278   1.00 0.00 ? 145 CYS A HB2  7  
ATOM 10764 H HB3  . CYS A 1 122 ? 5.575   5.100   7.259   1.00 0.00 ? 145 CYS A HB3  7  
ATOM 10765 N N    . GLU A 1 123 ? 7.995   8.512   6.145   1.00 0.00 ? 146 GLU A N    7  
ATOM 10766 C CA   . GLU A 1 123 ? 9.373   8.955   6.376   1.00 0.00 ? 146 GLU A CA   7  
ATOM 10767 C C    . GLU A 1 123 ? 9.471   10.432  6.771   1.00 0.00 ? 146 GLU A C    7  
ATOM 10768 O O    . GLU A 1 123 ? 9.499   10.725  7.969   1.00 0.00 ? 146 GLU A O    7  
ATOM 10769 C CB   . GLU A 1 123 ? 10.321  8.564   5.231   1.00 0.00 ? 146 GLU A CB   7  
ATOM 10770 C CG   . GLU A 1 123 ? 10.279  7.057   4.918   1.00 0.00 ? 146 GLU A CG   7  
ATOM 10771 C CD   . GLU A 1 123 ? 9.470   6.757   3.658   1.00 0.00 ? 146 GLU A CD   7  
ATOM 10772 O OE1  . GLU A 1 123 ? 8.401   7.381   3.447   1.00 0.00 ? 146 GLU A OE1  7  
ATOM 10773 O OE2  . GLU A 1 123 ? 9.934   5.931   2.847   1.00 0.00 ? 146 GLU A OE2  7  
ATOM 10774 H H    . GLU A 1 123 ? 7.550   8.777   5.280   1.00 0.00 ? 146 GLU A H    7  
ATOM 10775 H HA   . GLU A 1 123 ? 9.746   8.409   7.235   1.00 0.00 ? 146 GLU A HA   7  
ATOM 10776 H HB2  . GLU A 1 123 ? 10.094  9.145   4.335   1.00 0.00 ? 146 GLU A HB2  7  
ATOM 10777 H HB3  . GLU A 1 123 ? 11.335  8.823   5.541   1.00 0.00 ? 146 GLU A HB3  7  
ATOM 10778 H HG2  . GLU A 1 123 ? 11.296  6.699   4.775   1.00 0.00 ? 146 GLU A HG2  7  
ATOM 10779 H HG3  . GLU A 1 123 ? 9.868   6.498   5.759   1.00 0.00 ? 146 GLU A HG3  7  
ATOM 10780 N N    . PHE A 1 124 ? 9.556   11.360  5.812   1.00 0.00 ? 147 PHE A N    7  
ATOM 10781 C CA   . PHE A 1 124 ? 9.814   12.782  6.082   1.00 0.00 ? 147 PHE A CA   7  
ATOM 10782 C C    . PHE A 1 124 ? 8.972   13.734  5.212   1.00 0.00 ? 147 PHE A C    7  
ATOM 10783 O O    . PHE A 1 124 ? 8.823   14.913  5.534   1.00 0.00 ? 147 PHE A O    7  
ATOM 10784 C CB   . PHE A 1 124 ? 11.314  13.053  5.863   1.00 0.00 ? 147 PHE A CB   7  
ATOM 10785 C CG   . PHE A 1 124 ? 11.675  13.136  4.393   1.00 0.00 ? 147 PHE A CG   7  
ATOM 10786 C CD1  . PHE A 1 124 ? 11.792  11.964  3.622   1.00 0.00 ? 147 PHE A CD1  7  
ATOM 10787 C CD2  . PHE A 1 124 ? 11.737  14.396  3.770   1.00 0.00 ? 147 PHE A CD2  7  
ATOM 10788 C CE1  . PHE A 1 124 ? 11.881  12.054  2.223   1.00 0.00 ? 147 PHE A CE1  7  
ATOM 10789 C CE2  . PHE A 1 124 ? 11.858  14.482  2.376   1.00 0.00 ? 147 PHE A CE2  7  
ATOM 10790 C CZ   . PHE A 1 124 ? 11.892  13.315  1.600   1.00 0.00 ? 147 PHE A CZ   7  
ATOM 10791 H H    . PHE A 1 124 ? 9.524   11.047  4.856   1.00 0.00 ? 147 PHE A H    7  
ATOM 10792 H HA   . PHE A 1 124 ? 9.579   13.000  7.125   1.00 0.00 ? 147 PHE A HA   7  
ATOM 10793 H HB2  . PHE A 1 124 ? 11.567  13.999  6.337   1.00 0.00 ? 147 PHE A HB2  7  
ATOM 10794 H HB3  . PHE A 1 124 ? 11.908  12.276  6.347   1.00 0.00 ? 147 PHE A HB3  7  
ATOM 10795 H HD1  . PHE A 1 124 ? 11.774  10.992  4.093   1.00 0.00 ? 147 PHE A HD1  7  
ATOM 10796 H HD2  . PHE A 1 124 ? 11.649  15.303  4.354   1.00 0.00 ? 147 PHE A HD2  7  
ATOM 10797 H HE1  . PHE A 1 124 ? 11.932  11.147  1.638   1.00 0.00 ? 147 PHE A HE1  7  
ATOM 10798 H HE2  . PHE A 1 124 ? 11.903  15.448  1.898   1.00 0.00 ? 147 PHE A HE2  7  
ATOM 10799 H HZ   . PHE A 1 124 ? 11.935  13.410  0.526   1.00 0.00 ? 147 PHE A HZ   7  
ATOM 10800 N N    . TRP A 1 125 ? 8.426   13.257  4.089   1.00 0.00 ? 148 TRP A N    7  
ATOM 10801 C CA   . TRP A 1 125 ? 7.707   14.052  3.101   1.00 0.00 ? 148 TRP A CA   7  
ATOM 10802 C C    . TRP A 1 125 ? 6.229   14.291  3.472   1.00 0.00 ? 148 TRP A C    7  
ATOM 10803 O O    . TRP A 1 125 ? 5.373   14.332  2.591   1.00 0.00 ? 148 TRP A O    7  
ATOM 10804 C CB   . TRP A 1 125 ? 7.854   13.306  1.759   1.00 0.00 ? 148 TRP A CB   7  
ATOM 10805 C CG   . TRP A 1 125 ? 7.587   11.826  1.742   1.00 0.00 ? 148 TRP A CG   7  
ATOM 10806 C CD1  . TRP A 1 125 ? 8.484   10.865  2.059   1.00 0.00 ? 148 TRP A CD1  7  
ATOM 10807 C CD2  . TRP A 1 125 ? 6.367   11.109  1.374   1.00 0.00 ? 148 TRP A CD2  7  
ATOM 10808 N NE1  . TRP A 1 125 ? 7.894   9.626   1.948   1.00 0.00 ? 148 TRP A NE1  7  
ATOM 10809 C CE2  . TRP A 1 125 ? 6.617   9.709   1.456   1.00 0.00 ? 148 TRP A CE2  7  
ATOM 10810 C CE3  . TRP A 1 125 ? 5.060   11.493  1.020   1.00 0.00 ? 148 TRP A CE3  7  
ATOM 10811 C CZ2  . TRP A 1 125 ? 5.656   8.742   1.134   1.00 0.00 ? 148 TRP A CZ2  7  
ATOM 10812 C CZ3  . TRP A 1 125 ? 4.056   10.527  0.805   1.00 0.00 ? 148 TRP A CZ3  7  
ATOM 10813 C CH2  . TRP A 1 125 ? 4.357   9.156   0.815   1.00 0.00 ? 148 TRP A CH2  7  
ATOM 10814 H H    . TRP A 1 125 ? 8.579   12.298  3.829   1.00 0.00 ? 148 TRP A H    7  
ATOM 10815 H HA   . TRP A 1 125 ? 8.189   15.026  3.002   1.00 0.00 ? 148 TRP A HA   7  
ATOM 10816 H HB2  . TRP A 1 125 ? 7.216   13.779  1.025   1.00 0.00 ? 148 TRP A HB2  7  
ATOM 10817 H HB3  . TRP A 1 125 ? 8.866   13.449  1.405   1.00 0.00 ? 148 TRP A HB3  7  
ATOM 10818 H HD1  . TRP A 1 125 ? 9.506   11.027  2.355   1.00 0.00 ? 148 TRP A HD1  7  
ATOM 10819 H HE1  . TRP A 1 125 ? 8.317   8.735   2.231   1.00 0.00 ? 148 TRP A HE1  7  
ATOM 10820 H HE3  . TRP A 1 125 ? 4.829   12.545  0.990   1.00 0.00 ? 148 TRP A HE3  7  
ATOM 10821 H HZ2  . TRP A 1 125 ? 5.905   7.689   1.169   1.00 0.00 ? 148 TRP A HZ2  7  
ATOM 10822 H HZ3  . TRP A 1 125 ? 3.031   10.828  0.683   1.00 0.00 ? 148 TRP A HZ3  7  
ATOM 10823 H HH2  . TRP A 1 125 ? 3.591   8.419   0.632   1.00 0.00 ? 148 TRP A HH2  7  
ATOM 10824 N N    . LEU A 1 126 ? 5.915   14.517  4.751   1.00 0.00 ? 149 LEU A N    7  
ATOM 10825 C CA   . LEU A 1 126 ? 4.548   14.592  5.256   1.00 0.00 ? 149 LEU A CA   7  
ATOM 10826 C C    . LEU A 1 126 ? 3.762   15.748  4.637   1.00 0.00 ? 149 LEU A C    7  
ATOM 10827 O O    . LEU A 1 126 ? 4.281   16.861  4.460   1.00 0.00 ? 149 LEU A O    7  
ATOM 10828 C CB   . LEU A 1 126 ? 4.483   14.683  6.793   1.00 0.00 ? 149 LEU A CB   7  
ATOM 10829 C CG   . LEU A 1 126 ? 5.465   15.653  7.475   1.00 0.00 ? 149 LEU A CG   7  
ATOM 10830 C CD1  . LEU A 1 126 ? 4.826   16.332  8.687   1.00 0.00 ? 149 LEU A CD1  7  
ATOM 10831 C CD2  . LEU A 1 126 ? 6.709   14.904  7.962   1.00 0.00 ? 149 LEU A CD2  7  
ATOM 10832 H H    . LEU A 1 126 ? 6.655   14.488  5.429   1.00 0.00 ? 149 LEU A H    7  
ATOM 10833 H HA   . LEU A 1 126 ? 4.060   13.658  4.980   1.00 0.00 ? 149 LEU A HA   7  
ATOM 10834 H HB2  . LEU A 1 126 ? 3.471   14.982  7.036   1.00 0.00 ? 149 LEU A HB2  7  
ATOM 10835 H HB3  . LEU A 1 126 ? 4.602   13.693  7.221   1.00 0.00 ? 149 LEU A HB3  7  
ATOM 10836 H HG   . LEU A 1 126 ? 5.764   16.425  6.767   1.00 0.00 ? 149 LEU A HG   7  
ATOM 10837 H HD11 . LEU A 1 126 ? 4.603   15.584  9.448   1.00 0.00 ? 149 LEU A HD11 7  
ATOM 10838 H HD12 . LEU A 1 126 ? 5.511   17.071  9.102   1.00 0.00 ? 149 LEU A HD12 7  
ATOM 10839 H HD13 . LEU A 1 126 ? 3.891   16.807  8.400   1.00 0.00 ? 149 LEU A HD13 7  
ATOM 10840 H HD21 . LEU A 1 126 ? 7.067   14.234  7.188   1.00 0.00 ? 149 LEU A HD21 7  
ATOM 10841 H HD22 . LEU A 1 126 ? 7.496   15.610  8.229   1.00 0.00 ? 149 LEU A HD22 7  
ATOM 10842 H HD23 . LEU A 1 126 ? 6.465   14.287  8.827   1.00 0.00 ? 149 LEU A HD23 7  
ATOM 10843 N N    . GLU A 1 127 ? 2.481   15.489  4.376   1.00 0.00 ? 150 GLU A N    7  
ATOM 10844 C CA   . GLU A 1 127 ? 1.435   16.414  3.957   1.00 0.00 ? 150 GLU A CA   7  
ATOM 10845 C C    . GLU A 1 127 ? 1.087   17.321  5.143   1.00 0.00 ? 150 GLU A C    7  
ATOM 10846 O O    . GLU A 1 127 ? 0.041   17.190  5.783   1.00 0.00 ? 150 GLU A O    7  
ATOM 10847 C CB   . GLU A 1 127 ? 0.239   15.572  3.473   1.00 0.00 ? 150 GLU A CB   7  
ATOM 10848 C CG   . GLU A 1 127 ? -0.934  16.313  2.827   1.00 0.00 ? 150 GLU A CG   7  
ATOM 10849 C CD   . GLU A 1 127 ? -2.004  15.301  2.393   1.00 0.00 ? 150 GLU A CD   7  
ATOM 10850 O OE1  . GLU A 1 127 ? -2.742  14.745  3.246   1.00 0.00 ? 150 GLU A OE1  7  
ATOM 10851 O OE2  . GLU A 1 127 ? -2.122  15.003  1.183   1.00 0.00 ? 150 GLU A OE2  7  
ATOM 10852 H H    . GLU A 1 127 ? 2.159   14.532  4.509   1.00 0.00 ? 150 GLU A H    7  
ATOM 10853 H HA   . GLU A 1 127 ? 1.798   17.015  3.123   1.00 0.00 ? 150 GLU A HA   7  
ATOM 10854 H HB2  . GLU A 1 127 ? 0.609   14.873  2.727   1.00 0.00 ? 150 GLU A HB2  7  
ATOM 10855 H HB3  . GLU A 1 127 ? -0.146  15.000  4.317   1.00 0.00 ? 150 GLU A HB3  7  
ATOM 10856 H HG2  . GLU A 1 127 ? -1.367  17.022  3.530   1.00 0.00 ? 150 GLU A HG2  7  
ATOM 10857 H HG3  . GLU A 1 127 ? -0.574  16.867  1.961   1.00 0.00 ? 150 GLU A HG3  7  
ATOM 10858 N N    . ALA A 1 29  ? 2.391   -15.200 -4.593  1.00 0.00 ? 52  ALA A N    8  
ATOM 10859 C CA   . ALA A 1 29  ? 1.500   -14.138 -5.021  1.00 0.00 ? 52  ALA A CA   8  
ATOM 10860 C C    . ALA A 1 29  ? 1.243   -13.063 -3.965  1.00 0.00 ? 52  ALA A C    8  
ATOM 10861 O O    . ALA A 1 29  ? 1.278   -11.895 -4.313  1.00 0.00 ? 52  ALA A O    8  
ATOM 10862 C CB   . ALA A 1 29  ? 0.210   -14.725 -5.556  1.00 0.00 ? 52  ALA A CB   8  
ATOM 10863 H H    . ALA A 1 29  ? 3.280   -15.234 -5.072  1.00 0.00 ? 52  ALA A H    8  
ATOM 10864 H HA   . ALA A 1 29  ? 1.979   -13.655 -5.865  1.00 0.00 ? 52  ALA A HA   8  
ATOM 10865 H HB1  . ALA A 1 29  ? 0.435   -15.533 -6.251  1.00 0.00 ? 52  ALA A HB1  8  
ATOM 10866 H HB2  . ALA A 1 29  ? -0.358  -15.104 -4.714  1.00 0.00 ? 52  ALA A HB2  8  
ATOM 10867 H HB3  . ALA A 1 29  ? -0.357  -13.939 -6.053  1.00 0.00 ? 52  ALA A HB3  8  
ATOM 10868 N N    . GLU A 1 30  ? 1.042   -13.413 -2.696  1.00 0.00 ? 53  GLU A N    8  
ATOM 10869 C CA   . GLU A 1 30  ? 0.856   -12.465 -1.596  1.00 0.00 ? 53  GLU A CA   8  
ATOM 10870 C C    . GLU A 1 30  ? 2.154   -11.744 -1.226  1.00 0.00 ? 53  GLU A C    8  
ATOM 10871 O O    . GLU A 1 30  ? 2.141   -10.600 -0.788  1.00 0.00 ? 53  GLU A O    8  
ATOM 10872 C CB   . GLU A 1 30  ? 0.274   -13.187 -0.376  1.00 0.00 ? 53  GLU A CB   8  
ATOM 10873 C CG   . GLU A 1 30  ? 1.125   -14.374 0.097   1.00 0.00 ? 53  GLU A CG   8  
ATOM 10874 C CD   . GLU A 1 30  ? 0.379   -15.246 1.097   1.00 0.00 ? 53  GLU A CD   8  
ATOM 10875 O OE1  . GLU A 1 30  ? -0.681  -15.797 0.716   1.00 0.00 ? 53  GLU A OE1  8  
ATOM 10876 O OE2  . GLU A 1 30  ? 0.867   -15.376 2.245   1.00 0.00 ? 53  GLU A OE2  8  
ATOM 10877 H H    . GLU A 1 30  ? 0.942   -14.400 -2.491  1.00 0.00 ? 53  GLU A H    8  
ATOM 10878 H HA   . GLU A 1 30  ? 0.129   -11.718 -1.902  1.00 0.00 ? 53  GLU A HA   8  
ATOM 10879 H HB2  . GLU A 1 30  ? 0.168   -12.476 0.443   1.00 0.00 ? 53  GLU A HB2  8  
ATOM 10880 H HB3  . GLU A 1 30  ? -0.721  -13.535 -0.640  1.00 0.00 ? 53  GLU A HB3  8  
ATOM 10881 H HG2  . GLU A 1 30  ? 1.383   -15.004 -0.748  1.00 0.00 ? 53  GLU A HG2  8  
ATOM 10882 H HG3  . GLU A 1 30  ? 2.052   -14.002 0.532   1.00 0.00 ? 53  GLU A HG3  8  
ATOM 10883 N N    . ASN A 1 31  ? 3.305   -12.387 -1.402  1.00 0.00 ? 54  ASN A N    8  
ATOM 10884 C CA   . ASN A 1 31  ? 4.602   -11.815 -1.031  1.00 0.00 ? 54  ASN A CA   8  
ATOM 10885 C C    . ASN A 1 31  ? 5.211   -11.103 -2.237  1.00 0.00 ? 54  ASN A C    8  
ATOM 10886 O O    . ASN A 1 31  ? 6.371   -11.307 -2.601  1.00 0.00 ? 54  ASN A O    8  
ATOM 10887 C CB   . ASN A 1 31  ? 5.504   -12.914 -0.482  1.00 0.00 ? 54  ASN A CB   8  
ATOM 10888 C CG   . ASN A 1 31  ? 6.746   -12.406 0.248   1.00 0.00 ? 54  ASN A CG   8  
ATOM 10889 O OD1  . ASN A 1 31  ? 6.921   -11.208 0.484   1.00 0.00 ? 54  ASN A OD1  8  
ATOM 10890 N ND2  . ASN A 1 31  ? 7.622   -13.314 0.647   1.00 0.00 ? 54  ASN A ND2  8  
ATOM 10891 H H    . ASN A 1 31  ? 3.252   -13.313 -1.793  1.00 0.00 ? 54  ASN A H    8  
ATOM 10892 H HA   . ASN A 1 31  ? 4.462   -11.071 -0.247  1.00 0.00 ? 54  ASN A HA   8  
ATOM 10893 H HB2  . ASN A 1 31  ? 4.930   -13.541 0.197   1.00 0.00 ? 54  ASN A HB2  8  
ATOM 10894 H HB3  . ASN A 1 31  ? 5.797   -13.500 -1.336  1.00 0.00 ? 54  ASN A HB3  8  
ATOM 10895 H HD21 . ASN A 1 31  ? 7.421   -14.296 0.512   1.00 0.00 ? 54  ASN A HD21 8  
ATOM 10896 H HD22 . ASN A 1 31  ? 8.414   -13.062 1.225   1.00 0.00 ? 54  ASN A HD22 8  
ATOM 10897 N N    . ARG A 1 32  ? 4.385   -10.317 -2.921  1.00 0.00 ? 55  ARG A N    8  
ATOM 10898 C CA   . ARG A 1 32  ? 4.730   -9.581  -4.120  1.00 0.00 ? 55  ARG A CA   8  
ATOM 10899 C C    . ARG A 1 32  ? 4.669   -8.096  -3.827  1.00 0.00 ? 55  ARG A C    8  
ATOM 10900 O O    . ARG A 1 32  ? 3.863   -7.655  -3.000  1.00 0.00 ? 55  ARG A O    8  
ATOM 10901 C CB   . ARG A 1 32  ? 3.731   -9.979  -5.209  1.00 0.00 ? 55  ARG A CB   8  
ATOM 10902 C CG   . ARG A 1 32  ? 4.143   -11.261 -5.914  1.00 0.00 ? 55  ARG A CG   8  
ATOM 10903 C CD   . ARG A 1 32  ? 3.228   -11.584 -7.110  1.00 0.00 ? 55  ARG A CD   8  
ATOM 10904 N NE   . ARG A 1 32  ? 3.683   -11.003 -8.385  1.00 0.00 ? 55  ARG A NE   8  
ATOM 10905 C CZ   . ARG A 1 32  ? 4.863   -11.231 -8.980  1.00 0.00 ? 55  ARG A CZ   8  
ATOM 10906 N NH1  . ARG A 1 32  ? 5.733   -12.100 -8.482  1.00 0.00 ? 55  ARG A NH1  8  
ATOM 10907 N NH2  . ARG A 1 32  ? 5.174   -10.576 -10.088 1.00 0.00 ? 55  ARG A NH2  8  
ATOM 10908 H H    . ARG A 1 32  ? 3.427   -10.240 -2.603  1.00 0.00 ? 55  ARG A H    8  
ATOM 10909 H HA   . ARG A 1 32  ? 5.751   -9.817  -4.429  1.00 0.00 ? 55  ARG A HA   8  
ATOM 10910 H HB2  . ARG A 1 32  ? 2.796   -10.187 -4.762  1.00 0.00 ? 55  ARG A HB2  8  
ATOM 10911 H HB3  . ARG A 1 32  ? 3.500   -9.162  -5.877  1.00 0.00 ? 55  ARG A HB3  8  
ATOM 10912 H HG2  . ARG A 1 32  ? 5.182   -11.157 -6.198  1.00 0.00 ? 55  ARG A HG2  8  
ATOM 10913 H HG3  . ARG A 1 32  ? 4.073   -12.081 -5.197  1.00 0.00 ? 55  ARG A HG3  8  
ATOM 10914 H HD2  . ARG A 1 32  ? 3.186   -12.664 -7.242  1.00 0.00 ? 55  ARG A HD2  8  
ATOM 10915 H HD3  . ARG A 1 32  ? 2.220   -11.222 -6.882  1.00 0.00 ? 55  ARG A HD3  8  
ATOM 10916 H HE   . ARG A 1 32  ? 2.969   -10.514 -8.915  1.00 0.00 ? 55  ARG A HE   8  
ATOM 10917 H HH11 . ARG A 1 32  ? 5.495   -12.665 -7.667  1.00 0.00 ? 55  ARG A HH11 8  
ATOM 10918 H HH12 . ARG A 1 32  ? 6.687   -12.156 -8.828  1.00 0.00 ? 55  ARG A HH12 8  
ATOM 10919 H HH21 . ARG A 1 32  ? 4.482   -9.983  -10.544 1.00 0.00 ? 55  ARG A HH21 8  
ATOM 10920 H HH22 . ARG A 1 32  ? 6.100   -10.614 -10.508 1.00 0.00 ? 55  ARG A HH22 8  
ATOM 10921 N N    . PRO A 1 33  ? 5.397   -7.287  -4.607  1.00 0.00 ? 56  PRO A N    8  
ATOM 10922 C CA   . PRO A 1 33  ? 5.603   -5.875  -4.328  1.00 0.00 ? 56  PRO A CA   8  
ATOM 10923 C C    . PRO A 1 33  ? 4.346   -5.005  -4.519  1.00 0.00 ? 56  PRO A C    8  
ATOM 10924 O O    . PRO A 1 33  ? 4.409   -3.786  -4.425  1.00 0.00 ? 56  PRO A O    8  
ATOM 10925 C CB   . PRO A 1 33  ? 6.780   -5.463  -5.215  1.00 0.00 ? 56  PRO A CB   8  
ATOM 10926 C CG   . PRO A 1 33  ? 6.727   -6.437  -6.383  1.00 0.00 ? 56  PRO A CG   8  
ATOM 10927 C CD   . PRO A 1 33  ? 6.197   -7.710  -5.745  1.00 0.00 ? 56  PRO A CD   8  
ATOM 10928 H HA   . PRO A 1 33  ? 5.920   -5.789  -3.293  1.00 0.00 ? 56  PRO A HA   8  
ATOM 10929 H HB2  . PRO A 1 33  ? 6.702   -4.438  -5.554  1.00 0.00 ? 56  PRO A HB2  8  
ATOM 10930 H HB3  . PRO A 1 33  ? 7.711   -5.601  -4.667  1.00 0.00 ? 56  PRO A HB3  8  
ATOM 10931 H HG2  . PRO A 1 33  ? 6.016   -6.084  -7.128  1.00 0.00 ? 56  PRO A HG2  8  
ATOM 10932 H HG3  . PRO A 1 33  ? 7.707   -6.590  -6.827  1.00 0.00 ? 56  PRO A HG3  8  
ATOM 10933 H HD2  . PRO A 1 33  ? 5.600   -8.260  -6.471  1.00 0.00 ? 56  PRO A HD2  8  
ATOM 10934 H HD3  . PRO A 1 33  ? 7.017   -8.336  -5.394  1.00 0.00 ? 56  PRO A HD3  8  
ATOM 10935 N N    . GLY A 1 34  ? 3.180   -5.599  -4.757  1.00 0.00 ? 57  GLY A N    8  
ATOM 10936 C CA   . GLY A 1 34  ? 1.882   -4.943  -4.857  1.00 0.00 ? 57  GLY A CA   8  
ATOM 10937 C C    . GLY A 1 34  ? 0.717   -5.924  -4.837  1.00 0.00 ? 57  GLY A C    8  
ATOM 10938 O O    . GLY A 1 34  ? -0.357  -5.593  -5.328  1.00 0.00 ? 57  GLY A O    8  
ATOM 10939 H H    . GLY A 1 34  ? 3.199   -6.597  -4.669  1.00 0.00 ? 57  GLY A H    8  
ATOM 10940 H HA2  . GLY A 1 34  ? 1.740   -4.292  -3.993  1.00 0.00 ? 57  GLY A HA2  8  
ATOM 10941 H HA3  . GLY A 1 34  ? 1.851   -4.342  -5.761  1.00 0.00 ? 57  GLY A HA3  8  
ATOM 10942 N N    . ALA A 1 35  ? 0.925   -7.123  -4.292  1.00 0.00 ? 58  ALA A N    8  
ATOM 10943 C CA   . ALA A 1 35  ? -0.134  -8.043  -3.934  1.00 0.00 ? 58  ALA A CA   8  
ATOM 10944 C C    . ALA A 1 35  ? -1.235  -7.336  -3.133  1.00 0.00 ? 58  ALA A C    8  
ATOM 10945 O O    . ALA A 1 35  ? -0.934  -6.561  -2.219  1.00 0.00 ? 58  ALA A O    8  
ATOM 10946 C CB   . ALA A 1 35  ? 0.520   -9.142  -3.108  1.00 0.00 ? 58  ALA A CB   8  
ATOM 10947 H H    . ALA A 1 35  ? 1.812   -7.355  -3.878  1.00 0.00 ? 58  ALA A H    8  
ATOM 10948 H HA   . ALA A 1 35  ? -0.551  -8.478  -4.843  1.00 0.00 ? 58  ALA A HA   8  
ATOM 10949 H HB1  . ALA A 1 35  ? 0.856   -8.777  -2.141  1.00 0.00 ? 58  ALA A HB1  8  
ATOM 10950 H HB2  . ALA A 1 35  ? -0.195  -9.945  -2.963  1.00 0.00 ? 58  ALA A HB2  8  
ATOM 10951 H HB3  . ALA A 1 35  ? 1.402   -9.498  -3.627  1.00 0.00 ? 58  ALA A HB3  8  
ATOM 10952 N N    . PHE A 1 36  ? -2.496  -7.589  -3.474  1.00 0.00 ? 59  PHE A N    8  
ATOM 10953 C CA   . PHE A 1 36  ? -3.648  -7.039  -2.779  1.00 0.00 ? 59  PHE A CA   8  
ATOM 10954 C C    . PHE A 1 36  ? -3.960  -7.944  -1.576  1.00 0.00 ? 59  PHE A C    8  
ATOM 10955 O O    . PHE A 1 36  ? -4.176  -9.142  -1.766  1.00 0.00 ? 59  PHE A O    8  
ATOM 10956 C CB   . PHE A 1 36  ? -4.853  -6.946  -3.746  1.00 0.00 ? 59  PHE A CB   8  
ATOM 10957 C CG   . PHE A 1 36  ? -5.001  -5.667  -4.572  1.00 0.00 ? 59  PHE A CG   8  
ATOM 10958 C CD1  . PHE A 1 36  ? -3.996  -4.672  -4.598  1.00 0.00 ? 59  PHE A CD1  8  
ATOM 10959 C CD2  . PHE A 1 36  ? -6.209  -5.436  -5.272  1.00 0.00 ? 59  PHE A CD2  8  
ATOM 10960 C CE1  . PHE A 1 36  ? -4.230  -3.456  -5.261  1.00 0.00 ? 59  PHE A CE1  8  
ATOM 10961 C CE2  . PHE A 1 36  ? -6.417  -4.224  -5.968  1.00 0.00 ? 59  PHE A CE2  8  
ATOM 10962 C CZ   . PHE A 1 36  ? -5.429  -3.228  -5.942  1.00 0.00 ? 59  PHE A CZ   8  
ATOM 10963 H H    . PHE A 1 36  ? -2.664  -8.322  -4.158  1.00 0.00 ? 59  PHE A H    8  
ATOM 10964 H HA   . PHE A 1 36  ? -3.374  -6.044  -2.433  1.00 0.00 ? 59  PHE A HA   8  
ATOM 10965 H HB2  . PHE A 1 36  ? -4.842  -7.803  -4.422  1.00 0.00 ? 59  PHE A HB2  8  
ATOM 10966 H HB3  . PHE A 1 36  ? -5.762  -7.037  -3.149  1.00 0.00 ? 59  PHE A HB3  8  
ATOM 10967 H HD1  . PHE A 1 36  ? -3.031  -4.804  -4.123  1.00 0.00 ? 59  PHE A HD1  8  
ATOM 10968 H HD2  . PHE A 1 36  ? -6.991  -6.187  -5.260  1.00 0.00 ? 59  PHE A HD2  8  
ATOM 10969 H HE1  . PHE A 1 36  ? -3.487  -2.677  -5.246  1.00 0.00 ? 59  PHE A HE1  8  
ATOM 10970 H HE2  . PHE A 1 36  ? -7.342  -3.997  -6.492  1.00 0.00 ? 59  PHE A HE2  8  
ATOM 10971 H HZ   . PHE A 1 36  ? -5.595  -2.266  -6.407  1.00 0.00 ? 59  PHE A HZ   8  
ATOM 10972 N N    . ILE A 1 37  ? -3.982  -7.409  -0.346  1.00 0.00 ? 60  ILE A N    8  
ATOM 10973 C CA   . ILE A 1 37  ? -4.335  -8.193  0.852   1.00 0.00 ? 60  ILE A CA   8  
ATOM 10974 C C    . ILE A 1 37  ? -5.816  -8.614  0.822   1.00 0.00 ? 60  ILE A C    8  
ATOM 10975 O O    . ILE A 1 37  ? -6.146  -9.738  1.186   1.00 0.00 ? 60  ILE A O    8  
ATOM 10976 C CB   . ILE A 1 37  ? -3.989  -7.410  2.147   1.00 0.00 ? 60  ILE A CB   8  
ATOM 10977 C CG1  . ILE A 1 37  ? -2.464  -7.246  2.302   1.00 0.00 ? 60  ILE A CG1  8  
ATOM 10978 C CG2  . ILE A 1 37  ? -4.555  -8.102  3.394   1.00 0.00 ? 60  ILE A CG2  8  
ATOM 10979 C CD1  . ILE A 1 37  ? -2.008  -6.491  3.554   1.00 0.00 ? 60  ILE A CD1  8  
ATOM 10980 H H    . ILE A 1 37  ? -3.701  -6.443  -0.211  1.00 0.00 ? 60  ILE A H    8  
ATOM 10981 H HA   . ILE A 1 37  ? -3.744  -9.112  0.848   1.00 0.00 ? 60  ILE A HA   8  
ATOM 10982 H HB   . ILE A 1 37  ? -4.451  -6.428  2.085   1.00 0.00 ? 60  ILE A HB   8  
ATOM 10983 H HG12 . ILE A 1 37  ? -2.019  -8.236  2.344   1.00 0.00 ? 60  ILE A HG12 8  
ATOM 10984 H HG13 . ILE A 1 37  ? -2.069  -6.722  1.433   1.00 0.00 ? 60  ILE A HG13 8  
ATOM 10985 H HG21 . ILE A 1 37  ? -4.086  -9.078  3.530   1.00 0.00 ? 60  ILE A HG21 8  
ATOM 10986 H HG22 . ILE A 1 37  ? -4.399  -7.492  4.285   1.00 0.00 ? 60  ILE A HG22 8  
ATOM 10987 H HG23 . ILE A 1 37  ? -5.623  -8.245  3.272   1.00 0.00 ? 60  ILE A HG23 8  
ATOM 10988 H HD11 . ILE A 1 37  ? -0.982  -6.148  3.416   1.00 0.00 ? 60  ILE A HD11 8  
ATOM 10989 H HD12 . ILE A 1 37  ? -2.651  -5.636  3.735   1.00 0.00 ? 60  ILE A HD12 8  
ATOM 10990 H HD13 . ILE A 1 37  ? -2.045  -7.149  4.422   1.00 0.00 ? 60  ILE A HD13 8  
ATOM 10991 N N    . LYS A 1 38  ? -6.728  -7.720  0.420   1.00 0.00 ? 61  LYS A N    8  
ATOM 10992 C CA   . LYS A 1 38  ? -8.124  -8.048  0.147   1.00 0.00 ? 61  LYS A CA   8  
ATOM 10993 C C    . LYS A 1 38  ? -8.817  -8.823  1.279   1.00 0.00 ? 61  LYS A C    8  
ATOM 10994 O O    . LYS A 1 38  ? -9.602  -9.721  0.988   1.00 0.00 ? 61  LYS A O    8  
ATOM 10995 C CB   . LYS A 1 38  ? -8.148  -8.740  -1.247  1.00 0.00 ? 61  LYS A CB   8  
ATOM 10996 C CG   . LYS A 1 38  ? -9.153  -8.175  -2.257  1.00 0.00 ? 61  LYS A CG   8  
ATOM 10997 C CD   . LYS A 1 38  ? -10.630 -8.435  -1.932  1.00 0.00 ? 61  LYS A CD   8  
ATOM 10998 C CE   . LYS A 1 38  ? -11.237 -9.625  -2.694  1.00 0.00 ? 61  LYS A CE   8  
ATOM 10999 N NZ   . LYS A 1 38  ? -10.682 -10.945 -2.326  1.00 0.00 ? 61  LYS A NZ   8  
ATOM 11000 H H    . LYS A 1 38  ? -6.412  -6.836  0.075   1.00 0.00 ? 61  LYS A H    8  
ATOM 11001 H HA   . LYS A 1 38  ? -8.681  -7.116  0.103   1.00 0.00 ? 61  LYS A HA   8  
ATOM 11002 H HB2  . LYS A 1 38  ? -7.172  -8.605  -1.721  1.00 0.00 ? 61  LYS A HB2  8  
ATOM 11003 H HB3  . LYS A 1 38  ? -8.285  -9.815  -1.137  1.00 0.00 ? 61  LYS A HB3  8  
ATOM 11004 H HG2  . LYS A 1 38  ? -8.988  -7.105  -2.338  1.00 0.00 ? 61  LYS A HG2  8  
ATOM 11005 H HG3  . LYS A 1 38  ? -8.921  -8.590  -3.234  1.00 0.00 ? 61  LYS A HG3  8  
ATOM 11006 H HD2  . LYS A 1 38  ? -10.757 -8.521  -0.855  1.00 0.00 ? 61  LYS A HD2  8  
ATOM 11007 H HD3  . LYS A 1 38  ? -11.196 -7.563  -2.255  1.00 0.00 ? 61  LYS A HD3  8  
ATOM 11008 H HE2  . LYS A 1 38  ? -12.315 -9.636  -2.524  1.00 0.00 ? 61  LYS A HE2  8  
ATOM 11009 H HE3  . LYS A 1 38  ? -11.061 -9.458  -3.760  1.00 0.00 ? 61  LYS A HE3  8  
ATOM 11010 H HZ1  . LYS A 1 38  ? -11.099 -11.667 -2.909  1.00 0.00 ? 61  LYS A HZ1  8  
ATOM 11011 H HZ2  . LYS A 1 38  ? -9.685  -10.984 -2.511  1.00 0.00 ? 61  LYS A HZ2  8  
ATOM 11012 H HZ3  . LYS A 1 38  ? -10.861 -11.190 -1.356  1.00 0.00 ? 61  LYS A HZ3  8  
ATOM 11013 N N    . GLN A 1 39  ? -8.638  -8.419  2.549   1.00 0.00 ? 62  GLN A N    8  
ATOM 11014 C CA   . GLN A 1 39  ? -9.391  -9.013  3.665   1.00 0.00 ? 62  GLN A CA   8  
ATOM 11015 C C    . GLN A 1 39  ? -10.910 -8.867  3.504   1.00 0.00 ? 62  GLN A C    8  
ATOM 11016 O O    . GLN A 1 39  ? -11.656 -9.553  4.197   1.00 0.00 ? 62  GLN A O    8  
ATOM 11017 C CB   . GLN A 1 39  ? -8.988  -8.439  5.036   1.00 0.00 ? 62  GLN A CB   8  
ATOM 11018 C CG   . GLN A 1 39  ? -7.550  -8.782  5.442   1.00 0.00 ? 62  GLN A CG   8  
ATOM 11019 C CD   . GLN A 1 39  ? -7.239  -8.581  6.928   1.00 0.00 ? 62  GLN A CD   8  
ATOM 11020 O OE1  . GLN A 1 39  ? -8.081  -8.788  7.809   1.00 0.00 ? 62  GLN A OE1  8  
ATOM 11021 N NE2  . GLN A 1 39  ? -6.002  -8.241  7.249   1.00 0.00 ? 62  GLN A NE2  8  
ATOM 11022 H H    . GLN A 1 39  ? -7.979  -7.687  2.757   1.00 0.00 ? 62  GLN A H    8  
ATOM 11023 H HA   . GLN A 1 39  ? -9.179  -10.079 3.676   1.00 0.00 ? 62  GLN A HA   8  
ATOM 11024 H HB2  . GLN A 1 39  ? -9.125  -7.359  5.034   1.00 0.00 ? 62  GLN A HB2  8  
ATOM 11025 H HB3  . GLN A 1 39  ? -9.661  -8.858  5.783   1.00 0.00 ? 62  GLN A HB3  8  
ATOM 11026 H HG2  . GLN A 1 39  ? -7.332  -9.820  5.184   1.00 0.00 ? 62  GLN A HG2  8  
ATOM 11027 H HG3  . GLN A 1 39  ? -6.899  -8.130  4.879   1.00 0.00 ? 62  GLN A HG3  8  
ATOM 11028 H HE21 . GLN A 1 39  ? -5.369  -7.944  6.521   1.00 0.00 ? 62  GLN A HE21 8  
ATOM 11029 H HE22 . GLN A 1 39  ? -5.698  -8.122  8.209   1.00 0.00 ? 62  GLN A HE22 8  
ATOM 11030 N N    . GLY A 1 40  ? -11.397 -7.992  2.620   1.00 0.00 ? 63  GLY A N    8  
ATOM 11031 C CA   . GLY A 1 40  ? -12.816 -7.773  2.428   1.00 0.00 ? 63  GLY A CA   8  
ATOM 11032 C C    . GLY A 1 40  ? -13.304 -6.934  3.591   1.00 0.00 ? 63  GLY A C    8  
ATOM 11033 O O    . GLY A 1 40  ? -13.916 -7.444  4.531   1.00 0.00 ? 63  GLY A O    8  
ATOM 11034 H H    . GLY A 1 40  ? -10.771 -7.347  2.155   1.00 0.00 ? 63  GLY A H    8  
ATOM 11035 H HA2  . GLY A 1 40  ? -12.984 -7.255  1.483   1.00 0.00 ? 63  GLY A HA2  8  
ATOM 11036 H HA3  . GLY A 1 40  ? -13.344 -8.728  2.430   1.00 0.00 ? 63  GLY A HA3  8  
ATOM 11037 N N    . ARG A 1 41  ? -13.007 -5.637  3.575   1.00 0.00 ? 64  ARG A N    8  
ATOM 11038 C CA   . ARG A 1 41  ? -13.479 -4.715  4.599   1.00 0.00 ? 64  ARG A CA   8  
ATOM 11039 C C    . ARG A 1 41  ? -14.017 -3.458  3.928   1.00 0.00 ? 64  ARG A C    8  
ATOM 11040 O O    . ARG A 1 41  ? -13.900 -3.305  2.712   1.00 0.00 ? 64  ARG A O    8  
ATOM 11041 C CB   . ARG A 1 41  ? -12.403 -4.417  5.654   1.00 0.00 ? 64  ARG A CB   8  
ATOM 11042 C CG   . ARG A 1 41  ? -11.245 -5.422  5.752   1.00 0.00 ? 64  ARG A CG   8  
ATOM 11043 C CD   . ARG A 1 41  ? -10.332 -5.108  6.948   1.00 0.00 ? 64  ARG A CD   8  
ATOM 11044 N NE   . ARG A 1 41  ? -9.738  -3.769  6.922   1.00 0.00 ? 64  ARG A NE   8  
ATOM 11045 C CZ   . ARG A 1 41  ? -9.273  -3.117  7.990   1.00 0.00 ? 64  ARG A CZ   8  
ATOM 11046 N NH1  . ARG A 1 41  ? -9.050  -3.762  9.130   1.00 0.00 ? 64  ARG A NH1  8  
ATOM 11047 N NH2  . ARG A 1 41  ? -9.046  -1.814  7.918   1.00 0.00 ? 64  ARG A NH2  8  
ATOM 11048 H H    . ARG A 1 41  ? -12.506 -5.218  2.796   1.00 0.00 ? 64  ARG A H    8  
ATOM 11049 H HA   . ARG A 1 41  ? -14.305 -5.174  5.126   1.00 0.00 ? 64  ARG A HA   8  
ATOM 11050 H HB2  . ARG A 1 41  ? -11.990 -3.441  5.455   1.00 0.00 ? 64  ARG A HB2  8  
ATOM 11051 H HB3  . ARG A 1 41  ? -12.901 -4.359  6.619   1.00 0.00 ? 64  ARG A HB3  8  
ATOM 11052 H HG2  . ARG A 1 41  ? -11.656 -6.419  5.907   1.00 0.00 ? 64  ARG A HG2  8  
ATOM 11053 H HG3  . ARG A 1 41  ? -10.695 -5.433  4.804   1.00 0.00 ? 64  ARG A HG3  8  
ATOM 11054 H HD2  . ARG A 1 41  ? -10.938 -5.140  7.846   1.00 0.00 ? 64  ARG A HD2  8  
ATOM 11055 H HD3  . ARG A 1 41  ? -9.541  -5.858  7.008   1.00 0.00 ? 64  ARG A HD3  8  
ATOM 11056 H HE   . ARG A 1 41  ? -9.325  -3.473  6.037   1.00 0.00 ? 64  ARG A HE   8  
ATOM 11057 H HH11 . ARG A 1 41  ? -9.027  -4.767  9.122   1.00 0.00 ? 64  ARG A HH11 8  
ATOM 11058 H HH12 . ARG A 1 41  ? -8.533  -3.278  9.866   1.00 0.00 ? 64  ARG A HH12 8  
ATOM 11059 H HH21 . ARG A 1 41  ? -9.151  -1.299  7.059   1.00 0.00 ? 64  ARG A HH21 8  
ATOM 11060 H HH22 . ARG A 1 41  ? -8.951  -1.260  8.771   1.00 0.00 ? 64  ARG A HH22 8  
ATOM 11061 N N    . LYS A 1 42  ? -14.594 -2.563  4.726   1.00 0.00 ? 65  LYS A N    8  
ATOM 11062 C CA   . LYS A 1 42  ? -14.921 -1.211  4.318   1.00 0.00 ? 65  LYS A CA   8  
ATOM 11063 C C    . LYS A 1 42  ? -13.857 -0.355  5.001   1.00 0.00 ? 65  LYS A C    8  
ATOM 11064 O O    . LYS A 1 42  ? -13.850 -0.244  6.225   1.00 0.00 ? 65  LYS A O    8  
ATOM 11065 C CB   . LYS A 1 42  ? -16.369 -0.876  4.718   1.00 0.00 ? 65  LYS A CB   8  
ATOM 11066 C CG   . LYS A 1 42  ? -17.080 -0.020  3.659   1.00 0.00 ? 65  LYS A CG   8  
ATOM 11067 C CD   . LYS A 1 42  ? -18.406 0.541   4.149   1.00 0.00 ? 65  LYS A CD   8  
ATOM 11068 C CE   . LYS A 1 42  ? -19.471 -0.522  4.401   1.00 0.00 ? 65  LYS A CE   8  
ATOM 11069 N NZ   . LYS A 1 42  ? -20.350 -0.101  5.506   1.00 0.00 ? 65  LYS A NZ   8  
ATOM 11070 H H    . LYS A 1 42  ? -14.630 -2.727  5.722   1.00 0.00 ? 65  LYS A H    8  
ATOM 11071 H HA   . LYS A 1 42  ? -14.826 -1.116  3.231   1.00 0.00 ? 65  LYS A HA   8  
ATOM 11072 H HB2  . LYS A 1 42  ? -16.933 -1.802  4.821   1.00 0.00 ? 65  LYS A HB2  8  
ATOM 11073 H HB3  . LYS A 1 42  ? -16.377 -0.367  5.681   1.00 0.00 ? 65  LYS A HB3  8  
ATOM 11074 H HG2  . LYS A 1 42  ? -16.486 0.843   3.407   1.00 0.00 ? 65  LYS A HG2  8  
ATOM 11075 H HG3  . LYS A 1 42  ? -17.212 -0.585  2.741   1.00 0.00 ? 65  LYS A HG3  8  
ATOM 11076 H HD2  . LYS A 1 42  ? -18.212 1.111   5.061   1.00 0.00 ? 65  LYS A HD2  8  
ATOM 11077 H HD3  . LYS A 1 42  ? -18.778 1.210   3.379   1.00 0.00 ? 65  LYS A HD3  8  
ATOM 11078 H HE2  . LYS A 1 42  ? -20.058 -0.655  3.490   1.00 0.00 ? 65  LYS A HE2  8  
ATOM 11079 H HE3  . LYS A 1 42  ? -18.993 -1.468  4.649   1.00 0.00 ? 65  LYS A HE3  8  
ATOM 11080 H HZ1  . LYS A 1 42  ? -21.023 -0.826  5.718   1.00 0.00 ? 65  LYS A HZ1  8  
ATOM 11081 H HZ2  . LYS A 1 42  ? -19.793 0.091   6.337   1.00 0.00 ? 65  LYS A HZ2  8  
ATOM 11082 H HZ3  . LYS A 1 42  ? -20.843 0.745   5.241   1.00 0.00 ? 65  LYS A HZ3  8  
ATOM 11083 N N    . LEU A 1 43  ? -12.863 0.085   4.240   1.00 0.00 ? 66  LEU A N    8  
ATOM 11084 C CA   . LEU A 1 43  ? -11.747 0.926   4.653   1.00 0.00 ? 66  LEU A CA   8  
ATOM 11085 C C    . LEU A 1 43  ? -12.268 2.357   4.698   1.00 0.00 ? 66  LEU A C    8  
ATOM 11086 O O    . LEU A 1 43  ? -12.762 2.851   3.685   1.00 0.00 ? 66  LEU A O    8  
ATOM 11087 C CB   . LEU A 1 43  ? -10.615 0.828   3.609   1.00 0.00 ? 66  LEU A CB   8  
ATOM 11088 C CG   . LEU A 1 43  ? -9.773  -0.457  3.587   1.00 0.00 ? 66  LEU A CG   8  
ATOM 11089 C CD1  . LEU A 1 43  ? -8.817  -0.432  4.773   1.00 0.00 ? 66  LEU A CD1  8  
ATOM 11090 C CD2  . LEU A 1 43  ? -10.601 -1.735  3.685   1.00 0.00 ? 66  LEU A CD2  8  
ATOM 11091 H H    . LEU A 1 43  ? -13.059 0.039   3.249   1.00 0.00 ? 66  LEU A H    8  
ATOM 11092 H HA   . LEU A 1 43  ? -11.389 0.626   5.641   1.00 0.00 ? 66  LEU A HA   8  
ATOM 11093 H HB2  . LEU A 1 43  ? -11.030 0.996   2.615   1.00 0.00 ? 66  LEU A HB2  8  
ATOM 11094 H HB3  . LEU A 1 43  ? -9.921  1.640   3.810   1.00 0.00 ? 66  LEU A HB3  8  
ATOM 11095 H HG   . LEU A 1 43  ? -9.215  -0.476  2.652   1.00 0.00 ? 66  LEU A HG   8  
ATOM 11096 H HD11 . LEU A 1 43  ? -8.171  -1.306  4.742   1.00 0.00 ? 66  LEU A HD11 8  
ATOM 11097 H HD12 . LEU A 1 43  ? -8.204  0.472   4.717   1.00 0.00 ? 66  LEU A HD12 8  
ATOM 11098 H HD13 . LEU A 1 43  ? -9.394  -0.431  5.694   1.00 0.00 ? 66  LEU A HD13 8  
ATOM 11099 H HD21 . LEU A 1 43  ? -11.123 -1.723  4.636   1.00 0.00 ? 66  LEU A HD21 8  
ATOM 11100 H HD22 . LEU A 1 43  ? -11.317 -1.787  2.866   1.00 0.00 ? 66  LEU A HD22 8  
ATOM 11101 H HD23 . LEU A 1 43  ? -9.962  -2.609  3.649   1.00 0.00 ? 66  LEU A HD23 8  
ATOM 11102 N N    . ASP A 1 44  ? -12.187 3.029   5.839   1.00 0.00 ? 67  ASP A N    8  
ATOM 11103 C CA   . ASP A 1 44  ? -12.846 4.323   6.081   1.00 0.00 ? 67  ASP A CA   8  
ATOM 11104 C C    . ASP A 1 44  ? -12.143 5.516   5.398   1.00 0.00 ? 67  ASP A C    8  
ATOM 11105 O O    . ASP A 1 44  ? -11.983 6.595   5.976   1.00 0.00 ? 67  ASP A O    8  
ATOM 11106 C CB   . ASP A 1 44  ? -13.095 4.509   7.587   1.00 0.00 ? 67  ASP A CB   8  
ATOM 11107 C CG   . ASP A 1 44  ? -14.248 3.615   8.042   1.00 0.00 ? 67  ASP A CG   8  
ATOM 11108 O OD1  . ASP A 1 44  ? -15.419 3.930   7.720   1.00 0.00 ? 67  ASP A OD1  8  
ATOM 11109 O OD2  . ASP A 1 44  ? -14.000 2.562   8.675   1.00 0.00 ? 67  ASP A OD2  8  
ATOM 11110 H H    . ASP A 1 44  ? -11.765 2.542   6.616   1.00 0.00 ? 67  ASP A H    8  
ATOM 11111 H HA   . ASP A 1 44  ? -13.826 4.271   5.614   1.00 0.00 ? 67  ASP A HA   8  
ATOM 11112 H HB2  . ASP A 1 44  ? -12.182 4.292   8.149   1.00 0.00 ? 67  ASP A HB2  8  
ATOM 11113 H HB3  . ASP A 1 44  ? -13.401 5.533   7.788   1.00 0.00 ? 67  ASP A HB3  8  
ATOM 11114 N N    . ILE A 1 45  ? -11.734 5.332   4.145   1.00 0.00 ? 68  ILE A N    8  
ATOM 11115 C CA   . ILE A 1 45  ? -11.011 6.277   3.315   1.00 0.00 ? 68  ILE A CA   8  
ATOM 11116 C C    . ILE A 1 45  ? -12.004 7.297   2.741   1.00 0.00 ? 68  ILE A C    8  
ATOM 11117 O O    . ILE A 1 45  ? -13.138 6.960   2.386   1.00 0.00 ? 68  ILE A O    8  
ATOM 11118 C CB   . ILE A 1 45  ? -10.252 5.528   2.188   1.00 0.00 ? 68  ILE A CB   8  
ATOM 11119 C CG1  . ILE A 1 45  ? -9.511  4.278   2.719   1.00 0.00 ? 68  ILE A CG1  8  
ATOM 11120 C CG2  . ILE A 1 45  ? -9.315  6.469   1.399   1.00 0.00 ? 68  ILE A CG2  8  
ATOM 11121 C CD1  . ILE A 1 45  ? -8.661  3.553   1.676   1.00 0.00 ? 68  ILE A CD1  8  
ATOM 11122 H H    . ILE A 1 45  ? -11.972 4.448   3.718   1.00 0.00 ? 68  ILE A H    8  
ATOM 11123 H HA   . ILE A 1 45  ? -10.292 6.773   3.959   1.00 0.00 ? 68  ILE A HA   8  
ATOM 11124 H HB   . ILE A 1 45  ? -10.999 5.169   1.489   1.00 0.00 ? 68  ILE A HB   8  
ATOM 11125 H HG12 . ILE A 1 45  ? -8.896  4.532   3.578   1.00 0.00 ? 68  ILE A HG12 8  
ATOM 11126 H HG13 . ILE A 1 45  ? -10.252 3.563   3.058   1.00 0.00 ? 68  ILE A HG13 8  
ATOM 11127 H HG21 . ILE A 1 45  ? -8.850  5.942   0.567   1.00 0.00 ? 68  ILE A HG21 8  
ATOM 11128 H HG22 . ILE A 1 45  ? -9.875  7.300   0.974   1.00 0.00 ? 68  ILE A HG22 8  
ATOM 11129 H HG23 . ILE A 1 45  ? -8.537  6.862   2.049   1.00 0.00 ? 68  ILE A HG23 8  
ATOM 11130 H HD11 . ILE A 1 45  ? -8.422  2.542   2.010   1.00 0.00 ? 68  ILE A HD11 8  
ATOM 11131 H HD12 . ILE A 1 45  ? -9.225  3.495   0.750   1.00 0.00 ? 68  ILE A HD12 8  
ATOM 11132 H HD13 . ILE A 1 45  ? -7.733  4.092   1.500   1.00 0.00 ? 68  ILE A HD13 8  
ATOM 11133 N N    . ASP A 1 46  ? -11.547 8.541   2.624   1.00 0.00 ? 69  ASP A N    8  
ATOM 11134 C CA   . ASP A 1 46  ? -12.280 9.667   2.060   1.00 0.00 ? 69  ASP A CA   8  
ATOM 11135 C C    . ASP A 1 46  ? -12.148 9.686   0.527   1.00 0.00 ? 69  ASP A C    8  
ATOM 11136 O O    . ASP A 1 46  ? -11.048 9.954   0.016   1.00 0.00 ? 69  ASP A O    8  
ATOM 11137 C CB   . ASP A 1 46  ? -11.721 10.956  2.687   1.00 0.00 ? 69  ASP A CB   8  
ATOM 11138 C CG   . ASP A 1 46  ? -12.472 12.226  2.287   1.00 0.00 ? 69  ASP A CG   8  
ATOM 11139 O OD1  . ASP A 1 46  ? -13.075 12.283  1.190   1.00 0.00 ? 69  ASP A OD1  8  
ATOM 11140 O OD2  . ASP A 1 46  ? -12.461 13.196  3.080   1.00 0.00 ? 69  ASP A OD2  8  
ATOM 11141 H H    . ASP A 1 46  ? -10.613 8.719   2.968   1.00 0.00 ? 69  ASP A H    8  
ATOM 11142 H HA   . ASP A 1 46  ? -13.331 9.581   2.337   1.00 0.00 ? 69  ASP A HA   8  
ATOM 11143 H HB2  . ASP A 1 46  ? -11.764 10.863  3.773   1.00 0.00 ? 69  ASP A HB2  8  
ATOM 11144 H HB3  . ASP A 1 46  ? -10.673 11.070  2.413   1.00 0.00 ? 69  ASP A HB3  8  
ATOM 11145 N N    . PHE A 1 47  ? -13.249 9.428   -0.201  1.00 0.00 ? 70  PHE A N    8  
ATOM 11146 C CA   . PHE A 1 47  ? -13.306 9.463   -1.669  1.00 0.00 ? 70  PHE A CA   8  
ATOM 11147 C C    . PHE A 1 47  ? -14.087 10.651  -2.254  1.00 0.00 ? 70  PHE A C    8  
ATOM 11148 O O    . PHE A 1 47  ? -14.002 10.884  -3.464  1.00 0.00 ? 70  PHE A O    8  
ATOM 11149 C CB   . PHE A 1 47  ? -13.888 8.152   -2.227  1.00 0.00 ? 70  PHE A CB   8  
ATOM 11150 C CG   . PHE A 1 47  ? -13.046 6.925   -1.956  1.00 0.00 ? 70  PHE A CG   8  
ATOM 11151 C CD1  . PHE A 1 47  ? -11.916 6.667   -2.752  1.00 0.00 ? 70  PHE A CD1  8  
ATOM 11152 C CD2  . PHE A 1 47  ? -13.359 6.063   -0.890  1.00 0.00 ? 70  PHE A CD2  8  
ATOM 11153 C CE1  . PHE A 1 47  ? -11.056 5.606   -2.423  1.00 0.00 ? 70  PHE A CE1  8  
ATOM 11154 C CE2  . PHE A 1 47  ? -12.499 4.998   -0.579  1.00 0.00 ? 70  PHE A CE2  8  
ATOM 11155 C CZ   . PHE A 1 47  ? -11.333 4.794   -1.324  1.00 0.00 ? 70  PHE A CZ   8  
ATOM 11156 H H    . PHE A 1 47  ? -14.095 9.176   0.301   1.00 0.00 ? 70  PHE A H    8  
ATOM 11157 H HA   . PHE A 1 47  ? -12.287 9.547   -2.040  1.00 0.00 ? 70  PHE A HA   8  
ATOM 11158 H HB2  . PHE A 1 47  ? -14.886 8.008   -1.821  1.00 0.00 ? 70  PHE A HB2  8  
ATOM 11159 H HB3  . PHE A 1 47  ? -13.981 8.250   -3.309  1.00 0.00 ? 70  PHE A HB3  8  
ATOM 11160 H HD1  . PHE A 1 47  ? -11.695 7.302   -3.595  1.00 0.00 ? 70  PHE A HD1  8  
ATOM 11161 H HD2  . PHE A 1 47  ? -14.244 6.217   -0.292  1.00 0.00 ? 70  PHE A HD2  8  
ATOM 11162 H HE1  . PHE A 1 47  ? -10.164 5.386   -2.981  1.00 0.00 ? 70  PHE A HE1  8  
ATOM 11163 H HE2  . PHE A 1 47  ? -12.701 4.352   0.261   1.00 0.00 ? 70  PHE A HE2  8  
ATOM 11164 H HZ   . PHE A 1 47  ? -10.638 4.019   -1.060  1.00 0.00 ? 70  PHE A HZ   8  
ATOM 11165 N N    . GLY A 1 48  ? -14.846 11.416  -1.471  1.00 0.00 ? 71  GLY A N    8  
ATOM 11166 C CA   . GLY A 1 48  ? -15.632 12.563  -1.923  1.00 0.00 ? 71  GLY A CA   8  
ATOM 11167 C C    . GLY A 1 48  ? -17.135 12.287  -1.861  1.00 0.00 ? 71  GLY A C    8  
ATOM 11168 O O    . GLY A 1 48  ? -17.720 12.352  -0.779  1.00 0.00 ? 71  GLY A O    8  
ATOM 11169 H H    . GLY A 1 48  ? -14.904 11.191  -0.484  1.00 0.00 ? 71  GLY A H    8  
ATOM 11170 H HA2  . GLY A 1 48  ? -15.415 13.402  -1.265  1.00 0.00 ? 71  GLY A HA2  8  
ATOM 11171 H HA3  . GLY A 1 48  ? -15.351 12.854  -2.935  1.00 0.00 ? 71  GLY A HA3  8  
ATOM 11172 N N    . ALA A 1 49  ? -17.784 12.034  -3.004  1.00 0.00 ? 72  ALA A N    8  
ATOM 11173 C CA   . ALA A 1 49  ? -19.179 11.610  -3.088  1.00 0.00 ? 72  ALA A CA   8  
ATOM 11174 C C    . ALA A 1 49  ? -19.300 10.272  -3.812  1.00 0.00 ? 72  ALA A C    8  
ATOM 11175 O O    . ALA A 1 49  ? -19.417 9.220   -3.181  1.00 0.00 ? 72  ALA A O    8  
ATOM 11176 C CB   . ALA A 1 49  ? -20.039 12.702  -3.730  1.00 0.00 ? 72  ALA A CB   8  
ATOM 11177 H H    . ALA A 1 49  ? -17.238 11.930  -3.856  1.00 0.00 ? 72  ALA A H    8  
ATOM 11178 H HA   . ALA A 1 49  ? -19.573 11.452  -2.084  1.00 0.00 ? 72  ALA A HA   8  
ATOM 11179 H HB1  . ALA A 1 49  ? -19.955 13.625  -3.160  1.00 0.00 ? 72  ALA A HB1  8  
ATOM 11180 H HB2  . ALA A 1 49  ? -19.726 12.886  -4.755  1.00 0.00 ? 72  ALA A HB2  8  
ATOM 11181 H HB3  . ALA A 1 49  ? -21.081 12.385  -3.736  1.00 0.00 ? 72  ALA A HB3  8  
ATOM 11182 N N    . GLU A 1 50  ? -19.285 10.335  -5.148  1.00 0.00 ? 73  GLU A N    8  
ATOM 11183 C CA   . GLU A 1 50  ? -19.561 9.246   -6.077  1.00 0.00 ? 73  GLU A CA   8  
ATOM 11184 C C    . GLU A 1 50  ? -18.721 8.010   -5.782  1.00 0.00 ? 73  GLU A C    8  
ATOM 11185 O O    . GLU A 1 50  ? -19.240 6.896   -5.826  1.00 0.00 ? 73  GLU A O    8  
ATOM 11186 C CB   . GLU A 1 50  ? -19.408 9.726   -7.534  1.00 0.00 ? 73  GLU A CB   8  
ATOM 11187 C CG   . GLU A 1 50  ? -18.105 10.489  -7.848  1.00 0.00 ? 73  GLU A CG   8  
ATOM 11188 C CD   . GLU A 1 50  ? -17.896 10.807  -9.331  1.00 0.00 ? 73  GLU A CD   8  
ATOM 11189 O OE1  . GLU A 1 50  ? -18.881 11.054  -10.058 1.00 0.00 ? 73  GLU A OE1  8  
ATOM 11190 O OE2  . GLU A 1 50  ? -16.728 10.825  -9.792  1.00 0.00 ? 73  GLU A OE2  8  
ATOM 11191 H H    . GLU A 1 50  ? -19.116 11.241  -5.563  1.00 0.00 ? 73  GLU A H    8  
ATOM 11192 H HA   . GLU A 1 50  ? -20.595 8.944   -5.946  1.00 0.00 ? 73  GLU A HA   8  
ATOM 11193 H HB2  . GLU A 1 50  ? -19.491 8.865   -8.195  1.00 0.00 ? 73  GLU A HB2  8  
ATOM 11194 H HB3  . GLU A 1 50  ? -20.243 10.392  -7.744  1.00 0.00 ? 73  GLU A HB3  8  
ATOM 11195 H HG2  . GLU A 1 50  ? -18.111 11.425  -7.300  1.00 0.00 ? 73  GLU A HG2  8  
ATOM 11196 H HG3  . GLU A 1 50  ? -17.252 9.915   -7.507  1.00 0.00 ? 73  GLU A HG3  8  
ATOM 11197 N N    . GLY A 1 51  ? -17.452 8.209   -5.435  1.00 0.00 ? 74  GLY A N    8  
ATOM 11198 C CA   . GLY A 1 51  ? -16.543 7.153   -5.048  1.00 0.00 ? 74  GLY A CA   8  
ATOM 11199 C C    . GLY A 1 51  ? -17.088 6.388   -3.852  1.00 0.00 ? 74  GLY A C    8  
ATOM 11200 O O    . GLY A 1 51  ? -17.274 5.182   -3.952  1.00 0.00 ? 74  GLY A O    8  
ATOM 11201 H H    . GLY A 1 51  ? -17.107 9.161   -5.453  1.00 0.00 ? 74  GLY A H    8  
ATOM 11202 H HA2  . GLY A 1 51  ? -16.441 6.464   -5.881  1.00 0.00 ? 74  GLY A HA2  8  
ATOM 11203 H HA3  . GLY A 1 51  ? -15.565 7.569   -4.816  1.00 0.00 ? 74  GLY A HA3  8  
ATOM 11204 N N    . ASN A 1 52  ? -17.388 7.067   -2.740  1.00 0.00 ? 75  ASN A N    8  
ATOM 11205 C CA   . ASN A 1 52  ? -17.898 6.415   -1.530  1.00 0.00 ? 75  ASN A CA   8  
ATOM 11206 C C    . ASN A 1 52  ? -19.183 5.669   -1.843  1.00 0.00 ? 75  ASN A C    8  
ATOM 11207 O O    . ASN A 1 52  ? -19.325 4.503   -1.481  1.00 0.00 ? 75  ASN A O    8  
ATOM 11208 C CB   . ASN A 1 52  ? -18.225 7.411   -0.413  1.00 0.00 ? 75  ASN A CB   8  
ATOM 11209 C CG   . ASN A 1 52  ? -17.058 8.284   -0.026  1.00 0.00 ? 75  ASN A CG   8  
ATOM 11210 O OD1  . ASN A 1 52  ? -16.062 7.825   0.517   1.00 0.00 ? 75  ASN A OD1  8  
ATOM 11211 N ND2  . ASN A 1 52  ? -17.182 9.558   -0.312  1.00 0.00 ? 75  ASN A ND2  8  
ATOM 11212 H H    . ASN A 1 52  ? -17.320 8.073   -2.767  1.00 0.00 ? 75  ASN A H    8  
ATOM 11213 H HA   . ASN A 1 52  ? -17.150 5.709   -1.168  1.00 0.00 ? 75  ASN A HA   8  
ATOM 11214 H HB2  . ASN A 1 52  ? -19.069 8.037   -0.707  1.00 0.00 ? 75  ASN A HB2  8  
ATOM 11215 H HB3  . ASN A 1 52  ? -18.541 6.856   0.470   1.00 0.00 ? 75  ASN A HB3  8  
ATOM 11216 H HD21 . ASN A 1 52  ? -18.058 9.873   -0.708  1.00 0.00 ? 75  ASN A HD21 8  
ATOM 11217 H HD22 . ASN A 1 52  ? -16.563 10.221  0.161   1.00 0.00 ? 75  ASN A HD22 8  
ATOM 11218 N N    . ARG A 1 53  ? -20.121 6.352   -2.509  1.00 0.00 ? 76  ARG A N    8  
ATOM 11219 C CA   . ARG A 1 53  ? -21.401 5.771   -2.915  1.00 0.00 ? 76  ARG A CA   8  
ATOM 11220 C C    . ARG A 1 53  ? -21.217 4.436   -3.614  1.00 0.00 ? 76  ARG A C    8  
ATOM 11221 O O    . ARG A 1 53  ? -21.961 3.489   -3.354  1.00 0.00 ? 76  ARG A O    8  
ATOM 11222 C CB   . ARG A 1 53  ? -22.143 6.715   -3.876  1.00 0.00 ? 76  ARG A CB   8  
ATOM 11223 C CG   . ARG A 1 53  ? -23.240 7.520   -3.174  1.00 0.00 ? 76  ARG A CG   8  
ATOM 11224 C CD   . ARG A 1 53  ? -24.452 6.635   -2.854  1.00 0.00 ? 76  ARG A CD   8  
ATOM 11225 N NE   . ARG A 1 53  ? -25.148 6.198   -4.075  1.00 0.00 ? 76  ARG A NE   8  
ATOM 11226 C CZ   . ARG A 1 53  ? -26.154 6.827   -4.693  1.00 0.00 ? 76  ARG A CZ   8  
ATOM 11227 N NH1  . ARG A 1 53  ? -26.683 7.944   -4.204  1.00 0.00 ? 76  ARG A NH1  8  
ATOM 11228 N NH2  . ARG A 1 53  ? -26.619 6.322   -5.823  1.00 0.00 ? 76  ARG A NH2  8  
ATOM 11229 H H    . ARG A 1 53  ? -19.909 7.333   -2.707  1.00 0.00 ? 76  ARG A H    8  
ATOM 11230 H HA   . ARG A 1 53  ? -21.991 5.587   -2.017  1.00 0.00 ? 76  ARG A HA   8  
ATOM 11231 H HB2  . ARG A 1 53  ? -21.439 7.404   -4.340  1.00 0.00 ? 76  ARG A HB2  8  
ATOM 11232 H HB3  . ARG A 1 53  ? -22.589 6.114   -4.676  1.00 0.00 ? 76  ARG A HB3  8  
ATOM 11233 H HG2  . ARG A 1 53  ? -22.837 7.946   -2.255  1.00 0.00 ? 76  ARG A HG2  8  
ATOM 11234 H HG3  . ARG A 1 53  ? -23.556 8.340   -3.820  1.00 0.00 ? 76  ARG A HG3  8  
ATOM 11235 H HD2  . ARG A 1 53  ? -24.128 5.753   -2.302  1.00 0.00 ? 76  ARG A HD2  8  
ATOM 11236 H HD3  . ARG A 1 53  ? -25.135 7.185   -2.213  1.00 0.00 ? 76  ARG A HD3  8  
ATOM 11237 H HE   . ARG A 1 53  ? -24.795 5.332   -4.481  1.00 0.00 ? 76  ARG A HE   8  
ATOM 11238 H HH11 . ARG A 1 53  ? -26.304 8.406   -3.381  1.00 0.00 ? 76  ARG A HH11 8  
ATOM 11239 H HH12 . ARG A 1 53  ? -27.452 8.416   -4.679  1.00 0.00 ? 76  ARG A HH12 8  
ATOM 11240 H HH21 . ARG A 1 53  ? -26.078 5.606   -6.299  1.00 0.00 ? 76  ARG A HH21 8  
ATOM 11241 H HH22 . ARG A 1 53  ? -27.415 6.699   -6.341  1.00 0.00 ? 76  ARG A HH22 8  
ATOM 11242 N N    . TYR A 1 54  ? -20.316 4.397   -4.587  1.00 0.00 ? 77  TYR A N    8  
ATOM 11243 C CA   . TYR A 1 54  ? -20.098 3.217   -5.390  1.00 0.00 ? 77  TYR A CA   8  
ATOM 11244 C C    . TYR A 1 54  ? -19.330 2.176   -4.586  1.00 0.00 ? 77  TYR A C    8  
ATOM 11245 O O    . TYR A 1 54  ? -19.674 1.001   -4.653  1.00 0.00 ? 77  TYR A O    8  
ATOM 11246 C CB   . TYR A 1 54  ? -19.372 3.647   -6.664  1.00 0.00 ? 77  TYR A CB   8  
ATOM 11247 C CG   . TYR A 1 54  ? -19.539 2.699   -7.826  1.00 0.00 ? 77  TYR A CG   8  
ATOM 11248 C CD1  . TYR A 1 54  ? -20.814 2.486   -8.382  1.00 0.00 ? 77  TYR A CD1  8  
ATOM 11249 C CD2  . TYR A 1 54  ? -18.418 2.060   -8.377  1.00 0.00 ? 77  TYR A CD2  8  
ATOM 11250 C CE1  . TYR A 1 54  ? -20.967 1.635   -9.489  1.00 0.00 ? 77  TYR A CE1  8  
ATOM 11251 C CE2  . TYR A 1 54  ? -18.561 1.238   -9.502  1.00 0.00 ? 77  TYR A CE2  8  
ATOM 11252 C CZ   . TYR A 1 54  ? -19.836 1.006   -10.053 1.00 0.00 ? 77  TYR A CZ   8  
ATOM 11253 O OH   . TYR A 1 54  ? -19.952 0.179   -11.124 1.00 0.00 ? 77  TYR A OH   8  
ATOM 11254 H H    . TYR A 1 54  ? -19.774 5.229   -4.802  1.00 0.00 ? 77  TYR A H    8  
ATOM 11255 H HA   . TYR A 1 54  ? -21.062 2.770   -5.647  1.00 0.00 ? 77  TYR A HA   8  
ATOM 11256 H HB2  . TYR A 1 54  ? -19.768 4.607   -6.997  1.00 0.00 ? 77  TYR A HB2  8  
ATOM 11257 H HB3  . TYR A 1 54  ? -18.315 3.793   -6.439  1.00 0.00 ? 77  TYR A HB3  8  
ATOM 11258 H HD1  . TYR A 1 54  ? -21.682 2.970   -7.960  1.00 0.00 ? 77  TYR A HD1  8  
ATOM 11259 H HD2  . TYR A 1 54  ? -17.444 2.197   -7.930  1.00 0.00 ? 77  TYR A HD2  8  
ATOM 11260 H HE1  . TYR A 1 54  ? -21.950 1.475   -9.899  1.00 0.00 ? 77  TYR A HE1  8  
ATOM 11261 H HE2  . TYR A 1 54  ? -17.702 0.762   -9.932  1.00 0.00 ? 77  TYR A HE2  8  
ATOM 11262 H HH   . TYR A 1 54  ? -20.886 -0.034  -11.300 1.00 0.00 ? 77  TYR A HH   8  
ATOM 11263 N N    . TYR A 1 55  ? -18.345 2.584   -3.786  1.00 0.00 ? 78  TYR A N    8  
ATOM 11264 C CA   . TYR A 1 55  ? -17.549 1.688   -2.963  1.00 0.00 ? 78  TYR A CA   8  
ATOM 11265 C C    . TYR A 1 55  ? -18.455 0.890   -2.022  1.00 0.00 ? 78  TYR A C    8  
ATOM 11266 O O    . TYR A 1 55  ? -18.408 -0.340  -2.036  1.00 0.00 ? 78  TYR A O    8  
ATOM 11267 C CB   . TYR A 1 55  ? -16.529 2.498   -2.155  1.00 0.00 ? 78  TYR A CB   8  
ATOM 11268 C CG   . TYR A 1 55  ? -15.390 1.731   -1.517  1.00 0.00 ? 78  TYR A CG   8  
ATOM 11269 C CD1  . TYR A 1 55  ? -15.161 0.357   -1.728  1.00 0.00 ? 78  TYR A CD1  8  
ATOM 11270 C CD2  . TYR A 1 55  ? -14.582 2.430   -0.612  1.00 0.00 ? 78  TYR A CD2  8  
ATOM 11271 C CE1  . TYR A 1 55  ? -14.184 -0.320  -0.973  1.00 0.00 ? 78  TYR A CE1  8  
ATOM 11272 C CE2  . TYR A 1 55  ? -13.590 1.760   0.116   1.00 0.00 ? 78  TYR A CE2  8  
ATOM 11273 C CZ   . TYR A 1 55  ? -13.414 0.374   -0.031  1.00 0.00 ? 78  TYR A CZ   8  
ATOM 11274 O OH   . TYR A 1 55  ? -12.587 -0.315  0.798   1.00 0.00 ? 78  TYR A OH   8  
ATOM 11275 H H    . TYR A 1 55  ? -18.105 3.570   -3.753  1.00 0.00 ? 78  TYR A H    8  
ATOM 11276 H HA   . TYR A 1 55  ? -17.021 1.007   -3.633  1.00 0.00 ? 78  TYR A HA   8  
ATOM 11277 H HB2  . TYR A 1 55  ? -16.082 3.276   -2.777  1.00 0.00 ? 78  TYR A HB2  8  
ATOM 11278 H HB3  . TYR A 1 55  ? -17.069 2.980   -1.336  1.00 0.00 ? 78  TYR A HB3  8  
ATOM 11279 H HD1  . TYR A 1 55  ? -15.783 -0.200  -2.405  1.00 0.00 ? 78  TYR A HD1  8  
ATOM 11280 H HD2  . TYR A 1 55  ? -14.801 3.464   -0.387  1.00 0.00 ? 78  TYR A HD2  8  
ATOM 11281 H HE1  . TYR A 1 55  ? -14.051 -1.384  -1.009  1.00 0.00 ? 78  TYR A HE1  8  
ATOM 11282 H HE2  . TYR A 1 55  ? -13.137 2.244   0.968   1.00 0.00 ? 78  TYR A HE2  8  
ATOM 11283 H HH   . TYR A 1 55  ? -12.236 0.287   1.455   1.00 0.00 ? 78  TYR A HH   8  
ATOM 11284 N N    . GLU A 1 56  ? -19.346 1.577   -1.292  1.00 0.00 ? 79  GLU A N    8  
ATOM 11285 C CA   . GLU A 1 56  ? -20.347 1.005   -0.386  1.00 0.00 ? 79  GLU A CA   8  
ATOM 11286 C C    . GLU A 1 56  ? -21.155 -0.103  -1.063  1.00 0.00 ? 79  GLU A C    8  
ATOM 11287 O O    . GLU A 1 56  ? -21.661 -1.019  -0.405  1.00 0.00 ? 79  GLU A O    8  
ATOM 11288 C CB   . GLU A 1 56  ? -21.344 2.095   0.030   1.00 0.00 ? 79  GLU A CB   8  
ATOM 11289 C CG   . GLU A 1 56  ? -20.753 3.098   1.018   1.00 0.00 ? 79  GLU A CG   8  
ATOM 11290 C CD   . GLU A 1 56  ? -20.772 2.675   2.495   1.00 0.00 ? 79  GLU A CD   8  
ATOM 11291 O OE1  . GLU A 1 56  ? -21.281 1.589   2.856   1.00 0.00 ? 79  GLU A OE1  8  
ATOM 11292 O OE2  . GLU A 1 56  ? -20.208 3.430   3.321   1.00 0.00 ? 79  GLU A OE2  8  
ATOM 11293 H H    . GLU A 1 56  ? -19.327 2.592   -1.370  1.00 0.00 ? 79  GLU A H    8  
ATOM 11294 H HA   . GLU A 1 56  ? -19.837 0.613   0.497   1.00 0.00 ? 79  GLU A HA   8  
ATOM 11295 H HB2  . GLU A 1 56  ? -21.656 2.636   -0.867  1.00 0.00 ? 79  GLU A HB2  8  
ATOM 11296 H HB3  . GLU A 1 56  ? -22.241 1.651   0.463   1.00 0.00 ? 79  GLU A HB3  8  
ATOM 11297 H HG2  . GLU A 1 56  ? -19.722 3.312   0.740   1.00 0.00 ? 79  GLU A HG2  8  
ATOM 11298 H HG3  . GLU A 1 56  ? -21.324 4.011   0.886   1.00 0.00 ? 79  GLU A HG3  8  
ATOM 11299 N N    . ALA A 1 57  ? -21.274 -0.029  -2.384  1.00 0.00 ? 80  ALA A N    8  
ATOM 11300 C CA   . ALA A 1 57  ? -22.045 -0.992  -3.128  1.00 0.00 ? 80  ALA A CA   8  
ATOM 11301 C C    . ALA A 1 57  ? -21.412 -2.388  -3.184  1.00 0.00 ? 80  ALA A C    8  
ATOM 11302 O O    . ALA A 1 57  ? -22.140 -3.380  -3.247  1.00 0.00 ? 80  ALA A O    8  
ATOM 11303 C CB   . ALA A 1 57  ? -22.371 -0.440  -4.524  1.00 0.00 ? 80  ALA A CB   8  
ATOM 11304 H H    . ALA A 1 57  ? -20.866 0.782   -2.832  1.00 0.00 ? 80  ALA A H    8  
ATOM 11305 H HA   . ALA A 1 57  ? -22.935 -1.095  -2.530  1.00 0.00 ? 80  ALA A HA   8  
ATOM 11306 H HB1  . ALA A 1 57  ? -22.559 0.640   -4.479  1.00 0.00 ? 80  ALA A HB1  8  
ATOM 11307 H HB2  . ALA A 1 57  ? -21.536 -0.642  -5.199  1.00 0.00 ? 80  ALA A HB2  8  
ATOM 11308 H HB3  . ALA A 1 57  ? -23.255 -0.942  -4.910  1.00 0.00 ? 80  ALA A HB3  8  
ATOM 11309 N N    . ASN A 1 58  ? -20.080 -2.497  -3.146  1.00 0.00 ? 81  ASN A N    8  
ATOM 11310 C CA   . ASN A 1 58  ? -19.345 -3.765  -3.270  1.00 0.00 ? 81  ASN A CA   8  
ATOM 11311 C C    . ASN A 1 58  ? -17.913 -3.597  -2.758  1.00 0.00 ? 81  ASN A C    8  
ATOM 11312 O O    . ASN A 1 58  ? -16.931 -3.852  -3.458  1.00 0.00 ? 81  ASN A O    8  
ATOM 11313 C CB   . ASN A 1 58  ? -19.396 -4.334  -4.703  1.00 0.00 ? 81  ASN A CB   8  
ATOM 11314 C CG   . ASN A 1 58  ? -19.232 -3.315  -5.805  1.00 0.00 ? 81  ASN A CG   8  
ATOM 11315 O OD1  . ASN A 1 58  ? -19.997 -3.297  -6.765  1.00 0.00 ? 81  ASN A OD1  8  
ATOM 11316 N ND2  . ASN A 1 58  ? -18.200 -2.503  -5.731  1.00 0.00 ? 81  ASN A ND2  8  
ATOM 11317 H H    . ASN A 1 58  ? -19.544 -1.638  -3.029  1.00 0.00 ? 81  ASN A H    8  
ATOM 11318 H HA   . ASN A 1 58  ? -19.821 -4.504  -2.632  1.00 0.00 ? 81  ASN A HA   8  
ATOM 11319 H HB2  . ASN A 1 58  ? -18.597 -5.052  -4.835  1.00 0.00 ? 81  ASN A HB2  8  
ATOM 11320 H HB3  . ASN A 1 58  ? -20.346 -4.853  -4.841  1.00 0.00 ? 81  ASN A HB3  8  
ATOM 11321 H HD21 . ASN A 1 58  ? -17.572 -2.554  -4.944  1.00 0.00 ? 81  ASN A HD21 8  
ATOM 11322 H HD22 . ASN A 1 58  ? -18.211 -1.688  -6.341  1.00 0.00 ? 81  ASN A HD22 8  
ATOM 11323 N N    . TYR A 1 59  ? -17.778 -3.139  -1.522  1.00 0.00 ? 82  TYR A N    8  
ATOM 11324 C CA   . TYR A 1 59  ? -16.498 -2.782  -0.917  1.00 0.00 ? 82  TYR A CA   8  
ATOM 11325 C C    . TYR A 1 59  ? -15.626 -3.997  -0.616  1.00 0.00 ? 82  TYR A C    8  
ATOM 11326 O O    . TYR A 1 59  ? -14.402 -3.926  -0.669  1.00 0.00 ? 82  TYR A O    8  
ATOM 11327 C CB   . TYR A 1 59  ? -16.750 -1.972  0.355   1.00 0.00 ? 82  TYR A CB   8  
ATOM 11328 C CG   . TYR A 1 59  ? -17.839 -2.564  1.219   1.00 0.00 ? 82  TYR A CG   8  
ATOM 11329 C CD1  . TYR A 1 59  ? -17.525 -3.561  2.156   1.00 0.00 ? 82  TYR A CD1  8  
ATOM 11330 C CD2  . TYR A 1 59  ? -19.172 -2.148  1.045   1.00 0.00 ? 82  TYR A CD2  8  
ATOM 11331 C CE1  . TYR A 1 59  ? -18.543 -4.134  2.929   1.00 0.00 ? 82  TYR A CE1  8  
ATOM 11332 C CE2  . TYR A 1 59  ? -20.178 -2.665  1.879   1.00 0.00 ? 82  TYR A CE2  8  
ATOM 11333 C CZ   . TYR A 1 59  ? -19.868 -3.661  2.830   1.00 0.00 ? 82  TYR A CZ   8  
ATOM 11334 O OH   . TYR A 1 59  ? -20.833 -4.148  3.656   1.00 0.00 ? 82  TYR A OH   8  
ATOM 11335 H H    . TYR A 1 59  ? -18.611 -2.913  -0.997  1.00 0.00 ? 82  TYR A H    8  
ATOM 11336 H HA   . TYR A 1 59  ? -15.962 -2.166  -1.627  1.00 0.00 ? 82  TYR A HA   8  
ATOM 11337 H HB2  . TYR A 1 59  ? -15.826 -1.900  0.930   1.00 0.00 ? 82  TYR A HB2  8  
ATOM 11338 H HB3  . TYR A 1 59  ? -17.032 -0.955  0.086   1.00 0.00 ? 82  TYR A HB3  8  
ATOM 11339 H HD1  . TYR A 1 59  ? -16.504 -3.897  2.278   1.00 0.00 ? 82  TYR A HD1  8  
ATOM 11340 H HD2  . TYR A 1 59  ? -19.434 -1.441  0.259   1.00 0.00 ? 82  TYR A HD2  8  
ATOM 11341 H HE1  . TYR A 1 59  ? -18.286 -4.934  3.602   1.00 0.00 ? 82  TYR A HE1  8  
ATOM 11342 H HE2  . TYR A 1 59  ? -21.193 -2.318  1.775   1.00 0.00 ? 82  TYR A HE2  8  
ATOM 11343 H HH   . TYR A 1 59  ? -20.449 -4.759  4.310   1.00 0.00 ? 82  TYR A HH   8  
ATOM 11344 N N    . TRP A 1 60  ? -16.247 -5.152  -0.404  1.00 0.00 ? 83  TRP A N    8  
ATOM 11345 C CA   . TRP A 1 60  ? -15.585 -6.433  -0.220  1.00 0.00 ? 83  TRP A CA   8  
ATOM 11346 C C    . TRP A 1 60  ? -14.736 -6.864  -1.423  1.00 0.00 ? 83  TRP A C    8  
ATOM 11347 O O    . TRP A 1 60  ? -14.028 -7.868  -1.330  1.00 0.00 ? 83  TRP A O    8  
ATOM 11348 C CB   . TRP A 1 60  ? -16.659 -7.461  0.119   1.00 0.00 ? 83  TRP A CB   8  
ATOM 11349 C CG   . TRP A 1 60  ? -17.757 -7.641  -0.885  1.00 0.00 ? 83  TRP A CG   8  
ATOM 11350 C CD1  . TRP A 1 60  ? -18.839 -6.846  -1.022  1.00 0.00 ? 83  TRP A CD1  8  
ATOM 11351 C CD2  . TRP A 1 60  ? -17.943 -8.719  -1.843  1.00 0.00 ? 83  TRP A CD2  8  
ATOM 11352 N NE1  . TRP A 1 60  ? -19.715 -7.393  -1.931  1.00 0.00 ? 83  TRP A NE1  8  
ATOM 11353 C CE2  . TRP A 1 60  ? -19.221 -8.568  -2.458  1.00 0.00 ? 83  TRP A CE2  8  
ATOM 11354 C CE3  . TRP A 1 60  ? -17.150 -9.810  -2.248  1.00 0.00 ? 83  TRP A CE3  8  
ATOM 11355 C CZ2  . TRP A 1 60  ? -19.721 -9.508  -3.373  1.00 0.00 ? 83  TRP A CZ2  8  
ATOM 11356 C CZ3  . TRP A 1 60  ? -17.635 -10.749 -3.179  1.00 0.00 ? 83  TRP A CZ3  8  
ATOM 11357 C CH2  . TRP A 1 60  ? -18.928 -10.617 -3.718  1.00 0.00 ? 83  TRP A CH2  8  
ATOM 11358 H H    . TRP A 1 60  ? -17.254 -5.140  -0.381  1.00 0.00 ? 83  TRP A H    8  
ATOM 11359 H HA   . TRP A 1 60  ? -14.917 -6.358  0.634   1.00 0.00 ? 83  TRP A HA   8  
ATOM 11360 H HB2  . TRP A 1 60  ? -16.183 -8.424  0.292   1.00 0.00 ? 83  TRP A HB2  8  
ATOM 11361 H HB3  . TRP A 1 60  ? -17.115 -7.168  1.063   1.00 0.00 ? 83  TRP A HB3  8  
ATOM 11362 H HD1  . TRP A 1 60  ? -19.029 -5.957  -0.449  1.00 0.00 ? 83  TRP A HD1  8  
ATOM 11363 H HE1  . TRP A 1 60  ? -20.651 -7.008  -2.080  1.00 0.00 ? 83  TRP A HE1  8  
ATOM 11364 H HE3  . TRP A 1 60  ? -16.160 -9.908  -1.821  1.00 0.00 ? 83  TRP A HE3  8  
ATOM 11365 H HZ2  . TRP A 1 60  ? -20.709 -9.389  -3.799  1.00 0.00 ? 83  TRP A HZ2  8  
ATOM 11366 H HZ3  . TRP A 1 60  ? -17.015 -11.585 -3.474  1.00 0.00 ? 83  TRP A HZ3  8  
ATOM 11367 H HH2  . TRP A 1 60  ? -19.308 -11.355 -4.414  1.00 0.00 ? 83  TRP A HH2  8  
ATOM 11368 N N    . GLN A 1 61  ? -14.777 -6.125  -2.534  1.00 0.00 ? 84  GLN A N    8  
ATOM 11369 C CA   . GLN A 1 61  ? -14.069 -6.413  -3.772  1.00 0.00 ? 84  GLN A CA   8  
ATOM 11370 C C    . GLN A 1 61  ? -12.889 -5.450  -3.973  1.00 0.00 ? 84  GLN A C    8  
ATOM 11371 O O    . GLN A 1 61  ? -12.531 -5.106  -5.105  1.00 0.00 ? 84  GLN A O    8  
ATOM 11372 C CB   . GLN A 1 61  ? -15.060 -6.399  -4.945  1.00 0.00 ? 84  GLN A CB   8  
ATOM 11373 C CG   . GLN A 1 61  ? -16.416 -7.060  -4.631  1.00 0.00 ? 84  GLN A CG   8  
ATOM 11374 C CD   . GLN A 1 61  ? -17.116 -7.534  -5.902  1.00 0.00 ? 84  GLN A CD   8  
ATOM 11375 O OE1  . GLN A 1 61  ? -17.042 -6.890  -6.952  1.00 0.00 ? 84  GLN A OE1  8  
ATOM 11376 N NE2  . GLN A 1 61  ? -17.775 -8.672  -5.844  1.00 0.00 ? 84  GLN A NE2  8  
ATOM 11377 H H    . GLN A 1 61  ? -15.368 -5.304  -2.542  1.00 0.00 ? 84  GLN A H    8  
ATOM 11378 H HA   . GLN A 1 61  ? -13.656 -7.418  -3.714  1.00 0.00 ? 84  GLN A HA   8  
ATOM 11379 H HB2  . GLN A 1 61  ? -15.245 -5.372  -5.263  1.00 0.00 ? 84  GLN A HB2  8  
ATOM 11380 H HB3  . GLN A 1 61  ? -14.586 -6.934  -5.767  1.00 0.00 ? 84  GLN A HB3  8  
ATOM 11381 H HG2  . GLN A 1 61  ? -16.278 -7.895  -3.947  1.00 0.00 ? 84  GLN A HG2  8  
ATOM 11382 H HG3  . GLN A 1 61  ? -17.053 -6.355  -4.108  1.00 0.00 ? 84  GLN A HG3  8  
ATOM 11383 H HE21 . GLN A 1 61  ? -17.869 -9.173  -4.966  1.00 0.00 ? 84  GLN A HE21 8  
ATOM 11384 H HE22 . GLN A 1 61  ? -18.137 -9.122  -6.680  1.00 0.00 ? 84  GLN A HE22 8  
ATOM 11385 N N    . PHE A 1 62  ? -12.310 -4.946  -2.881  1.00 0.00 ? 85  PHE A N    8  
ATOM 11386 C CA   . PHE A 1 62  ? -11.184 -4.020  -2.854  1.00 0.00 ? 85  PHE A CA   8  
ATOM 11387 C C    . PHE A 1 62  ? -10.120 -4.585  -1.913  1.00 0.00 ? 85  PHE A C    8  
ATOM 11388 O O    . PHE A 1 62  ? -10.452 -5.427  -1.069  1.00 0.00 ? 85  PHE A O    8  
ATOM 11389 C CB   . PHE A 1 62  ? -11.683 -2.646  -2.390  1.00 0.00 ? 85  PHE A CB   8  
ATOM 11390 C CG   . PHE A 1 62  ? -12.539 -1.942  -3.426  1.00 0.00 ? 85  PHE A CG   8  
ATOM 11391 C CD1  . PHE A 1 62  ? -13.862 -2.364  -3.678  1.00 0.00 ? 85  PHE A CD1  8  
ATOM 11392 C CD2  . PHE A 1 62  ? -11.995 -0.883  -4.172  1.00 0.00 ? 85  PHE A CD2  8  
ATOM 11393 C CE1  . PHE A 1 62  ? -14.643 -1.729  -4.656  1.00 0.00 ? 85  PHE A CE1  8  
ATOM 11394 C CE2  . PHE A 1 62  ? -12.768 -0.255  -5.157  1.00 0.00 ? 85  PHE A CE2  8  
ATOM 11395 C CZ   . PHE A 1 62  ? -14.091 -0.659  -5.382  1.00 0.00 ? 85  PHE A CZ   8  
ATOM 11396 H H    . PHE A 1 62  ? -12.665 -5.182  -1.963  1.00 0.00 ? 85  PHE A H    8  
ATOM 11397 H HA   . PHE A 1 62  ? -10.757 -3.918  -3.849  1.00 0.00 ? 85  PHE A HA   8  
ATOM 11398 H HB2  . PHE A 1 62  ? -12.241 -2.758  -1.462  1.00 0.00 ? 85  PHE A HB2  8  
ATOM 11399 H HB3  . PHE A 1 62  ? -10.829 -2.013  -2.152  1.00 0.00 ? 85  PHE A HB3  8  
ATOM 11400 H HD1  . PHE A 1 62  ? -14.289 -3.184  -3.123  1.00 0.00 ? 85  PHE A HD1  8  
ATOM 11401 H HD2  . PHE A 1 62  ? -10.992 -0.532  -3.983  1.00 0.00 ? 85  PHE A HD2  8  
ATOM 11402 H HE1  . PHE A 1 62  ? -15.657 -2.072  -4.840  1.00 0.00 ? 85  PHE A HE1  8  
ATOM 11403 H HE2  . PHE A 1 62  ? -12.355 0.564   -5.722  1.00 0.00 ? 85  PHE A HE2  8  
ATOM 11404 H HZ   . PHE A 1 62  ? -14.669 -0.130  -6.118  1.00 0.00 ? 85  PHE A HZ   8  
ATOM 11405 N N    . PRO A 1 63  ? -8.845  -4.169  -2.028  1.00 0.00 ? 86  PRO A N    8  
ATOM 11406 C CA   . PRO A 1 63  ? -7.809  -4.576  -1.096  1.00 0.00 ? 86  PRO A CA   8  
ATOM 11407 C C    . PRO A 1 63  ? -8.103  -4.038  0.304   1.00 0.00 ? 86  PRO A C    8  
ATOM 11408 O O    . PRO A 1 63  ? -9.098  -3.351  0.548   1.00 0.00 ? 86  PRO A O    8  
ATOM 11409 C CB   . PRO A 1 63  ? -6.481  -4.087  -1.673  1.00 0.00 ? 86  PRO A CB   8  
ATOM 11410 C CG   . PRO A 1 63  ? -6.892  -2.902  -2.534  1.00 0.00 ? 86  PRO A CG   8  
ATOM 11411 C CD   . PRO A 1 63  ? -8.289  -3.280  -3.028  1.00 0.00 ? 86  PRO A CD   8  
ATOM 11412 H HA   . PRO A 1 63  ? -7.773  -5.660  -1.060  1.00 0.00 ? 86  PRO A HA   8  
ATOM 11413 H HB2  . PRO A 1 63  ? -5.757  -3.795  -0.910  1.00 0.00 ? 86  PRO A HB2  8  
ATOM 11414 H HB3  . PRO A 1 63  ? -6.072  -4.878  -2.294  1.00 0.00 ? 86  PRO A HB3  8  
ATOM 11415 H HG2  . PRO A 1 63  ? -6.949  -2.023  -1.900  1.00 0.00 ? 86  PRO A HG2  8  
ATOM 11416 H HG3  . PRO A 1 63  ? -6.197  -2.729  -3.353  1.00 0.00 ? 86  PRO A HG3  8  
ATOM 11417 H HD2  . PRO A 1 63  ? -8.897  -2.388  -3.145  1.00 0.00 ? 86  PRO A HD2  8  
ATOM 11418 H HD3  . PRO A 1 63  ? -8.218  -3.814  -3.974  1.00 0.00 ? 86  PRO A HD3  8  
ATOM 11419 N N    . ASP A 1 64  ? -7.237  -4.409  1.235   1.00 0.00 ? 87  ASP A N    8  
ATOM 11420 C CA   . ASP A 1 64  ? -7.319  -3.976  2.617   1.00 0.00 ? 87  ASP A CA   8  
ATOM 11421 C C    . ASP A 1 64  ? -6.072  -3.163  2.882   1.00 0.00 ? 87  ASP A C    8  
ATOM 11422 O O    . ASP A 1 64  ? -6.138  -1.941  2.945   1.00 0.00 ? 87  ASP A O    8  
ATOM 11423 C CB   . ASP A 1 64  ? -7.468  -5.184  3.545   1.00 0.00 ? 87  ASP A CB   8  
ATOM 11424 C CG   . ASP A 1 64  ? -7.421  -4.783  5.016   1.00 0.00 ? 87  ASP A CG   8  
ATOM 11425 O OD1  . ASP A 1 64  ? -7.577  -3.579  5.318   1.00 0.00 ? 87  ASP A OD1  8  
ATOM 11426 O OD2  . ASP A 1 64  ? -7.331  -5.702  5.848   1.00 0.00 ? 87  ASP A OD2  8  
ATOM 11427 H H    . ASP A 1 64  ? -6.351  -4.800  0.956   1.00 0.00 ? 87  ASP A H    8  
ATOM 11428 H HA   . ASP A 1 64  ? -8.171  -3.318  2.765   1.00 0.00 ? 87  ASP A HA   8  
ATOM 11429 H HB2  . ASP A 1 64  ? -8.429  -5.658  3.343   1.00 0.00 ? 87  ASP A HB2  8  
ATOM 11430 H HB3  . ASP A 1 64  ? -6.678  -5.908  3.344   1.00 0.00 ? 87  ASP A HB3  8  
ATOM 11431 N N    . GLY A 1 65  ? -4.931  -3.844  2.877   1.00 0.00 ? 88  GLY A N    8  
ATOM 11432 C CA   . GLY A 1 65  ? -3.627  -3.233  2.795   1.00 0.00 ? 88  GLY A CA   8  
ATOM 11433 C C    . GLY A 1 65  ? -2.874  -3.673  1.546   1.00 0.00 ? 88  GLY A C    8  
ATOM 11434 O O    . GLY A 1 65  ? -3.358  -4.489  0.747   1.00 0.00 ? 88  GLY A O    8  
ATOM 11435 H H    . GLY A 1 65  ? -4.945  -4.849  2.850   1.00 0.00 ? 88  GLY A H    8  
ATOM 11436 H HA2  . GLY A 1 65  ? -3.716  -2.155  2.806   1.00 0.00 ? 88  GLY A HA2  8  
ATOM 11437 H HA3  . GLY A 1 65  ? -3.057  -3.526  3.671   1.00 0.00 ? 88  GLY A HA3  8  
ATOM 11438 N N    . ILE A 1 66  ? -1.659  -3.146  1.430   1.00 0.00 ? 89  ILE A N    8  
ATOM 11439 C CA   . ILE A 1 66  ? -0.598  -3.571  0.521   1.00 0.00 ? 89  ILE A CA   8  
ATOM 11440 C C    . ILE A 1 66  ? 0.565   -4.088  1.378   1.00 0.00 ? 89  ILE A C    8  
ATOM 11441 O O    . ILE A 1 66  ? 0.741   -3.679  2.533   1.00 0.00 ? 89  ILE A O    8  
ATOM 11442 C CB   . ILE A 1 66  ? -0.210  -2.371  -0.377  1.00 0.00 ? 89  ILE A CB   8  
ATOM 11443 C CG1  . ILE A 1 66  ? -1.367  -1.948  -1.307  1.00 0.00 ? 89  ILE A CG1  8  
ATOM 11444 C CG2  . ILE A 1 66  ? 1.047   -2.604  -1.225  1.00 0.00 ? 89  ILE A CG2  8  
ATOM 11445 C CD1  . ILE A 1 66  ? -1.852  -3.007  -2.309  1.00 0.00 ? 89  ILE A CD1  8  
ATOM 11446 H H    . ILE A 1 66  ? -1.424  -2.435  2.118   1.00 0.00 ? 89  ILE A H    8  
ATOM 11447 H HA   . ILE A 1 66  ? -0.946  -4.393  -0.109  1.00 0.00 ? 89  ILE A HA   8  
ATOM 11448 H HB   . ILE A 1 66  ? 0.008   -1.520  0.273   1.00 0.00 ? 89  ILE A HB   8  
ATOM 11449 H HG12 . ILE A 1 66  ? -2.218  -1.650  -0.701  1.00 0.00 ? 89  ILE A HG12 8  
ATOM 11450 H HG13 . ILE A 1 66  ? -1.043  -1.069  -1.863  1.00 0.00 ? 89  ILE A HG13 8  
ATOM 11451 H HG21 . ILE A 1 66  ? 1.194   -1.753  -1.891  1.00 0.00 ? 89  ILE A HG21 8  
ATOM 11452 H HG22 . ILE A 1 66  ? 1.925   -2.675  -0.584  1.00 0.00 ? 89  ILE A HG22 8  
ATOM 11453 H HG23 . ILE A 1 66  ? 0.942   -3.507  -1.822  1.00 0.00 ? 89  ILE A HG23 8  
ATOM 11454 H HD11 . ILE A 1 66  ? -2.212  -3.894  -1.790  1.00 0.00 ? 89  ILE A HD11 8  
ATOM 11455 H HD12 . ILE A 1 66  ? -2.678  -2.596  -2.885  1.00 0.00 ? 89  ILE A HD12 8  
ATOM 11456 H HD13 . ILE A 1 66  ? -1.052  -3.283  -2.995  1.00 0.00 ? 89  ILE A HD13 8  
ATOM 11457 N N    . HIS A 1 67  ? 1.373   -4.983  0.814   1.00 0.00 ? 90  HIS A N    8  
ATOM 11458 C CA   . HIS A 1 67  ? 2.549   -5.556  1.449   1.00 0.00 ? 90  HIS A CA   8  
ATOM 11459 C C    . HIS A 1 67  ? 3.735   -4.662  1.074   1.00 0.00 ? 90  HIS A C    8  
ATOM 11460 O O    . HIS A 1 67  ? 4.172   -3.840  1.877   1.00 0.00 ? 90  HIS A O    8  
ATOM 11461 C CB   . HIS A 1 67  ? 2.721   -7.039  1.056   1.00 0.00 ? 90  HIS A CB   8  
ATOM 11462 C CG   . HIS A 1 67  ? 1.437   -7.840  0.977   1.00 0.00 ? 90  HIS A CG   8  
ATOM 11463 N ND1  . HIS A 1 67  ? 0.419   -7.710  0.053   1.00 0.00 ? 90  HIS A ND1  8  
ATOM 11464 C CD2  . HIS A 1 67  ? 1.149   -8.940  1.729   1.00 0.00 ? 90  HIS A CD2  8  
ATOM 11465 C CE1  . HIS A 1 67  ? -0.430  -8.734  0.233   1.00 0.00 ? 90  HIS A CE1  8  
ATOM 11466 N NE2  . HIS A 1 67  ? -0.031  -9.509  1.251   1.00 0.00 ? 90  HIS A NE2  8  
ATOM 11467 H H    . HIS A 1 67  ? 1.223   -5.244  -0.152  1.00 0.00 ? 90  HIS A H    8  
ATOM 11468 H HA   . HIS A 1 67  ? 2.422   -5.531  2.527   1.00 0.00 ? 90  HIS A HA   8  
ATOM 11469 H HB2  . HIS A 1 67  ? 3.230   -7.137  0.100   1.00 0.00 ? 90  HIS A HB2  8  
ATOM 11470 H HB3  . HIS A 1 67  ? 3.376   -7.499  1.797   1.00 0.00 ? 90  HIS A HB3  8  
ATOM 11471 H HD1  . HIS A 1 67  ? 0.335   -7.031  -0.702  1.00 0.00 ? 90  HIS A HD1  8  
ATOM 11472 H HD2  . HIS A 1 67  ? 1.783   -9.336  2.497   1.00 0.00 ? 90  HIS A HD2  8  
ATOM 11473 H HE1  . HIS A 1 67  ? -1.310  -8.913  -0.367  1.00 0.00 ? 90  HIS A HE1  8  
ATOM 11474 N N    . TYR A 1 68  ? 4.150   -4.741  -0.196  1.00 0.00 ? 91  TYR A N    8  
ATOM 11475 C CA   . TYR A 1 68  ? 5.291   -4.063  -0.808  1.00 0.00 ? 91  TYR A CA   8  
ATOM 11476 C C    . TYR A 1 68  ? 6.528   -4.195  0.101   1.00 0.00 ? 91  TYR A C    8  
ATOM 11477 O O    . TYR A 1 68  ? 6.658   -5.187  0.822   1.00 0.00 ? 91  TYR A O    8  
ATOM 11478 C CB   . TYR A 1 68  ? 4.890   -2.628  -1.228  1.00 0.00 ? 91  TYR A CB   8  
ATOM 11479 C CG   . TYR A 1 68  ? 5.877   -1.803  -2.053  1.00 0.00 ? 91  TYR A CG   8  
ATOM 11480 C CD1  . TYR A 1 68  ? 6.681   -2.391  -3.050  1.00 0.00 ? 91  TYR A CD1  8  
ATOM 11481 C CD2  . TYR A 1 68  ? 5.931   -0.408  -1.866  1.00 0.00 ? 91  TYR A CD2  8  
ATOM 11482 C CE1  . TYR A 1 68  ? 7.489   -1.601  -3.887  1.00 0.00 ? 91  TYR A CE1  8  
ATOM 11483 C CE2  . TYR A 1 68  ? 6.759   0.391   -2.677  1.00 0.00 ? 91  TYR A CE2  8  
ATOM 11484 C CZ   . TYR A 1 68  ? 7.537   -0.201  -3.697  1.00 0.00 ? 91  TYR A CZ   8  
ATOM 11485 O OH   . TYR A 1 68  ? 8.323   0.579   -4.492  1.00 0.00 ? 91  TYR A OH   8  
ATOM 11486 H H    . TYR A 1 68  ? 3.687   -5.449  -0.742  1.00 0.00 ? 91  TYR A H    8  
ATOM 11487 H HA   . TYR A 1 68  ? 5.499   -4.619  -1.719  1.00 0.00 ? 91  TYR A HA   8  
ATOM 11488 H HB2  . TYR A 1 68  ? 3.996   -2.708  -1.849  1.00 0.00 ? 91  TYR A HB2  8  
ATOM 11489 H HB3  . TYR A 1 68  ? 4.627   -2.066  -0.329  1.00 0.00 ? 91  TYR A HB3  8  
ATOM 11490 H HD1  . TYR A 1 68  ? 6.669   -3.455  -3.211  1.00 0.00 ? 91  TYR A HD1  8  
ATOM 11491 H HD2  . TYR A 1 68  ? 5.317   0.054   -1.101  1.00 0.00 ? 91  TYR A HD2  8  
ATOM 11492 H HE1  . TYR A 1 68  ? 8.049   -2.081  -4.680  1.00 0.00 ? 91  TYR A HE1  8  
ATOM 11493 H HE2  . TYR A 1 68  ? 6.779   1.462   -2.527  1.00 0.00 ? 91  TYR A HE2  8  
ATOM 11494 H HH   . TYR A 1 68  ? 8.811   0.068   -5.148  1.00 0.00 ? 91  TYR A HH   8  
ATOM 11495 N N    . ASN A 1 69  ? 7.473   -3.260  0.018   1.00 0.00 ? 92  ASN A N    8  
ATOM 11496 C CA   . ASN A 1 69  ? 8.553   -3.108  0.986   1.00 0.00 ? 92  ASN A CA   8  
ATOM 11497 C C    . ASN A 1 69  ? 8.252   -1.843  1.769   1.00 0.00 ? 92  ASN A C    8  
ATOM 11498 O O    . ASN A 1 69  ? 7.664   -0.910  1.213   1.00 0.00 ? 92  ASN A O    8  
ATOM 11499 C CB   . ASN A 1 69  ? 9.913   -2.911  0.292   1.00 0.00 ? 92  ASN A CB   8  
ATOM 11500 C CG   . ASN A 1 69  ? 10.331  -4.092  -0.561  1.00 0.00 ? 92  ASN A CG   8  
ATOM 11501 O OD1  . ASN A 1 69  ? 10.097  -5.242  -0.200  1.00 0.00 ? 92  ASN A OD1  8  
ATOM 11502 N ND2  . ASN A 1 69  ? 10.940  -3.841  -1.707  1.00 0.00 ? 92  ASN A ND2  8  
ATOM 11503 H H    . ASN A 1 69  ? 7.265   -2.427  -0.516  1.00 0.00 ? 92  ASN A H    8  
ATOM 11504 H HA   . ASN A 1 69  ? 8.608   -3.967  1.657   1.00 0.00 ? 92  ASN A HA   8  
ATOM 11505 H HB2  . ASN A 1 69  ? 9.864   -2.013  -0.323  1.00 0.00 ? 92  ASN A HB2  8  
ATOM 11506 H HB3  . ASN A 1 69  ? 10.679  -2.757  1.052   1.00 0.00 ? 92  ASN A HB3  8  
ATOM 11507 H HD21 . ASN A 1 69  ? 11.087  -2.874  -1.994  1.00 0.00 ? 92  ASN A HD21 8  
ATOM 11508 H HD22 . ASN A 1 69  ? 11.073  -4.601  -2.362  1.00 0.00 ? 92  ASN A HD22 8  
ATOM 11509 N N    . GLY A 1 70  ? 8.814   -1.723  2.968   1.00 0.00 ? 93  GLY A N    8  
ATOM 11510 C CA   . GLY A 1 70  ? 8.865   -0.486  3.729   1.00 0.00 ? 93  GLY A CA   8  
ATOM 11511 C C    . GLY A 1 70  ? 9.889   0.494   3.157   1.00 0.00 ? 93  GLY A C    8  
ATOM 11512 O O    . GLY A 1 70  ? 10.634  1.092   3.929   1.00 0.00 ? 93  GLY A O    8  
ATOM 11513 H H    . GLY A 1 70  ? 9.273   -2.521  3.385   1.00 0.00 ? 93  GLY A H    8  
ATOM 11514 H HA2  . GLY A 1 70  ? 7.881   -0.016  3.715   1.00 0.00 ? 93  GLY A HA2  8  
ATOM 11515 H HA3  . GLY A 1 70  ? 9.122   -0.712  4.764   1.00 0.00 ? 93  GLY A HA3  8  
ATOM 11516 N N    . CYS A 1 71  ? 9.906   0.686   1.833   1.00 0.00 ? 94  CYS A N    8  
ATOM 11517 C CA   . CYS A 1 71  ? 10.564  1.756   1.098   1.00 0.00 ? 94  CYS A CA   8  
ATOM 11518 C C    . CYS A 1 71  ? 12.086  1.590   1.028   1.00 0.00 ? 94  CYS A C    8  
ATOM 11519 O O    . CYS A 1 71  ? 12.819  2.161   1.833   1.00 0.00 ? 94  CYS A O    8  
ATOM 11520 C CB   . CYS A 1 71  ? 10.146  3.121   1.663   1.00 0.00 ? 94  CYS A CB   8  
ATOM 11521 S SG   . CYS A 1 71  ? 8.386   3.230   2.112   1.00 0.00 ? 94  CYS A SG   8  
ATOM 11522 H H    . CYS A 1 71  ? 9.189   0.191   1.322   1.00 0.00 ? 94  CYS A H    8  
ATOM 11523 H HA   . CYS A 1 71  ? 10.182  1.714   0.077   1.00 0.00 ? 94  CYS A HA   8  
ATOM 11524 H HB2  . CYS A 1 71  ? 10.743  3.326   2.554   1.00 0.00 ? 94  CYS A HB2  8  
ATOM 11525 H HB3  . CYS A 1 71  ? 10.390  3.872   0.918   1.00 0.00 ? 94  CYS A HB3  8  
ATOM 11526 N N    . SER A 1 72  ? 12.584  0.882   0.008   1.00 0.00 ? 95  SER A N    8  
ATOM 11527 C CA   . SER A 1 72  ? 14.010  0.853   -0.324  1.00 0.00 ? 95  SER A CA   8  
ATOM 11528 C C    . SER A 1 72  ? 14.429  2.133   -1.088  1.00 0.00 ? 95  SER A C    8  
ATOM 11529 O O    . SER A 1 72  ? 15.241  2.096   -2.016  1.00 0.00 ? 95  SER A O    8  
ATOM 11530 C CB   . SER A 1 72  ? 14.314  -0.445  -1.085  1.00 0.00 ? 95  SER A CB   8  
ATOM 11531 O OG   . SER A 1 72  ? 15.647  -0.855  -0.860  1.00 0.00 ? 95  SER A OG   8  
ATOM 11532 H H    . SER A 1 72  ? 11.954  0.424   -0.639  1.00 0.00 ? 95  SER A H    8  
ATOM 11533 H HA   . SER A 1 72  ? 14.565  0.832   0.616   1.00 0.00 ? 95  SER A HA   8  
ATOM 11534 H HB2  . SER A 1 72  ? 13.651  -1.238  -0.731  1.00 0.00 ? 95  SER A HB2  8  
ATOM 11535 H HB3  . SER A 1 72  ? 14.146  -0.289  -2.149  1.00 0.00 ? 95  SER A HB3  8  
ATOM 11536 H HG   . SER A 1 72  ? 15.726  -1.093  0.076   1.00 0.00 ? 95  SER A HG   8  
ATOM 11537 N N    . GLU A 1 73  ? 13.872  3.283   -0.714  1.00 0.00 ? 96  GLU A N    8  
ATOM 11538 C CA   . GLU A 1 73  ? 14.235  4.616   -1.175  1.00 0.00 ? 96  GLU A CA   8  
ATOM 11539 C C    . GLU A 1 73  ? 14.130  5.521   0.044   1.00 0.00 ? 96  GLU A C    8  
ATOM 11540 O O    . GLU A 1 73  ? 13.283  5.286   0.909   1.00 0.00 ? 96  GLU A O    8  
ATOM 11541 C CB   . GLU A 1 73  ? 13.263  5.108   -2.257  1.00 0.00 ? 96  GLU A CB   8  
ATOM 11542 C CG   . GLU A 1 73  ? 13.648  4.709   -3.690  1.00 0.00 ? 96  GLU A CG   8  
ATOM 11543 C CD   . GLU A 1 73  ? 14.956  5.354   -4.166  1.00 0.00 ? 96  GLU A CD   8  
ATOM 11544 O OE1  . GLU A 1 73  ? 15.245  6.512   -3.781  1.00 0.00 ? 96  GLU A OE1  8  
ATOM 11545 O OE2  . GLU A 1 73  ? 15.685  4.708   -4.952  1.00 0.00 ? 96  GLU A OE2  8  
ATOM 11546 H H    . GLU A 1 73  ? 13.326  3.294   0.144   1.00 0.00 ? 96  GLU A H    8  
ATOM 11547 H HA   . GLU A 1 73  ? 15.260  4.630   -1.549  1.00 0.00 ? 96  GLU A HA   8  
ATOM 11548 H HB2  . GLU A 1 73  ? 12.265  4.739   -2.027  1.00 0.00 ? 96  GLU A HB2  8  
ATOM 11549 H HB3  . GLU A 1 73  ? 13.209  6.195   -2.212  1.00 0.00 ? 96  GLU A HB3  8  
ATOM 11550 H HG2  . GLU A 1 73  ? 13.720  3.623   -3.757  1.00 0.00 ? 96  GLU A HG2  8  
ATOM 11551 H HG3  . GLU A 1 73  ? 12.850  5.033   -4.358  1.00 0.00 ? 96  GLU A HG3  8  
ATOM 11552 N N    . ALA A 1 74  ? 14.945  6.572   0.096   1.00 0.00 ? 97  ALA A N    8  
ATOM 11553 C CA   . ALA A 1 74  ? 15.149  7.394   1.282   1.00 0.00 ? 97  ALA A CA   8  
ATOM 11554 C C    . ALA A 1 74  ? 14.856  8.870   1.007   1.00 0.00 ? 97  ALA A C    8  
ATOM 11555 O O    . ALA A 1 74  ? 15.266  9.725   1.792   1.00 0.00 ? 97  ALA A O    8  
ATOM 11556 C CB   . ALA A 1 74  ? 16.602  7.203   1.723   1.00 0.00 ? 97  ALA A CB   8  
ATOM 11557 H H    . ALA A 1 74  ? 15.590  6.739   -0.672  1.00 0.00 ? 97  ALA A H    8  
ATOM 11558 H HA   . ALA A 1 74  ? 14.495  7.057   2.088   1.00 0.00 ? 97  ALA A HA   8  
ATOM 11559 H HB1  . ALA A 1 74  ? 17.266  7.620   0.960   1.00 0.00 ? 97  ALA A HB1  8  
ATOM 11560 H HB2  . ALA A 1 74  ? 16.773  7.726