data_1LIK
# 
_entry.id   1LIK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LIK         
RCSB  RCSB015970   
WWPDB D_1000015970 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1LIK 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1DH0 
_pdbx_database_PDB_obs_spr.date             2002-05-15 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LII 'STRUCTURE OF T. GONDII ADENOSINE KINASE BOUND TO ADENOSINE 2 AND AMP-PCP'                unspecified 
PDB 1LIJ 'STRUCTURE OF T. GONDII ADENOSINE KINASE BOUND TO PRODRUG 2 7-IODOTUBERCIDIN AND AMP-PCP' unspecified 
PDB 1LIO 'STRUCTURE OF APO T. GONDII ADENOSINE KINASE'                                             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LIK 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schumacher, M.A.' 1 
'Scott, D.M.'      2 
'Mathews, I.I.'    3 
'Ealick, S.E.'     4 
'Roos, D.S.'       5 
'Ullman, B.'       6 
'Brennan, R.G.'    7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of Toxoplasma gondii adenosine kinase reveal a novel catalytic mechanism and prodrug binding.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            298 
_citation.page_first                875 
_citation.page_last                 893 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10801355 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2000.3753 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schumacher, M.A.' 1 
primary 'Scott, D.M.'      2 
primary 'Mathews, I.I.'    3 
primary 'Ealick, S.E.'     4 
primary 'Roos, D.S.'       5 
primary 'Ullman, B.'       6 
primary 'Brennan, R.G.'    7 
# 
_cell.entry_id           1LIK 
_cell.length_a           168.200 
_cell.length_b           47.010 
_cell.length_c           44.430 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LIK 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'adenosine kinase' 38373.824 1   2.7.1.20 ? ? ? 
2 non-polymer syn 'SULFATE ION'      96.063    1   ?        ? ? ? 
3 non-polymer syn 'CHLORIDE ION'     35.453    1   ?        ? ? ? 
4 non-polymer syn ADENOSINE          267.241   2   ?        ? ? ? 
5 water       nat water              18.015    154 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQK
LLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASG
ALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KVALSVANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAF
VGGFLYGLSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQK
LLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASG
ALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KVALSVANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAF
VGGFLYGLSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   VAL n 
1 4   ASP n 
1 5   SER n 
1 6   SER n 
1 7   ASN n 
1 8   SER n 
1 9   ALA n 
1 10  THR n 
1 11  GLY n 
1 12  PRO n 
1 13  MET n 
1 14  ARG n 
1 15  VAL n 
1 16  PHE n 
1 17  ALA n 
1 18  ILE n 
1 19  GLY n 
1 20  ASN n 
1 21  PRO n 
1 22  ILE n 
1 23  LEU n 
1 24  ASP n 
1 25  LEU n 
1 26  VAL n 
1 27  ALA n 
1 28  GLU n 
1 29  VAL n 
1 30  PRO n 
1 31  SER n 
1 32  SER n 
1 33  PHE n 
1 34  LEU n 
1 35  ASP n 
1 36  GLU n 
1 37  PHE n 
1 38  PHE n 
1 39  LEU n 
1 40  LYS n 
1 41  ARG n 
1 42  GLY n 
1 43  ASP n 
1 44  ALA n 
1 45  THR n 
1 46  LEU n 
1 47  ALA n 
1 48  THR n 
1 49  PRO n 
1 50  GLU n 
1 51  GLN n 
1 52  MET n 
1 53  ARG n 
1 54  ILE n 
1 55  TYR n 
1 56  SER n 
1 57  THR n 
1 58  LEU n 
1 59  ASP n 
1 60  GLN n 
1 61  PHE n 
1 62  ASN n 
1 63  PRO n 
1 64  THR n 
1 65  SER n 
1 66  LEU n 
1 67  PRO n 
1 68  GLY n 
1 69  GLY n 
1 70  SER n 
1 71  ALA n 
1 72  LEU n 
1 73  ASN n 
1 74  SER n 
1 75  VAL n 
1 76  ARG n 
1 77  VAL n 
1 78  VAL n 
1 79  GLN n 
1 80  LYS n 
1 81  LEU n 
1 82  LEU n 
1 83  ARG n 
1 84  LYS n 
1 85  PRO n 
1 86  GLY n 
1 87  SER n 
1 88  ALA n 
1 89  GLY n 
1 90  TYR n 
1 91  MET n 
1 92  GLY n 
1 93  ALA n 
1 94  ILE n 
1 95  GLY n 
1 96  ASP n 
1 97  ASP n 
1 98  PRO n 
1 99  ARG n 
1 100 GLY n 
1 101 GLN n 
1 102 VAL n 
1 103 LEU n 
1 104 LYS n 
1 105 GLU n 
1 106 LEU n 
1 107 CYS n 
1 108 ASP n 
1 109 LYS n 
1 110 GLU n 
1 111 GLY n 
1 112 LEU n 
1 113 ALA n 
1 114 THR n 
1 115 ARG n 
1 116 PHE n 
1 117 MET n 
1 118 VAL n 
1 119 ALA n 
1 120 PRO n 
1 121 GLY n 
1 122 GLN n 
1 123 SER n 
1 124 THR n 
1 125 GLY n 
1 126 THR n 
1 127 CYS n 
1 128 ALA n 
1 129 VAL n 
1 130 LEU n 
1 131 ILE n 
1 132 ASN n 
1 133 GLU n 
1 134 LYS n 
1 135 GLU n 
1 136 ARG n 
1 137 THR n 
1 138 LEU n 
1 139 CYS n 
1 140 THR n 
1 141 HIS n 
1 142 LEU n 
1 143 GLY n 
1 144 ALA n 
1 145 CYS n 
1 146 GLY n 
1 147 SER n 
1 148 PHE n 
1 149 ARG n 
1 150 ILE n 
1 151 PRO n 
1 152 GLU n 
1 153 ASN n 
1 154 TRP n 
1 155 THR n 
1 156 THR n 
1 157 PHE n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 ALA n 
1 162 LEU n 
1 163 ILE n 
1 164 PHE n 
1 165 TYR n 
1 166 ALA n 
1 167 THR n 
1 168 ALA n 
1 169 TYR n 
1 170 THR n 
1 171 LEU n 
1 172 THR n 
1 173 ALA n 
1 174 THR n 
1 175 PRO n 
1 176 LYS n 
1 177 ASN n 
1 178 ALA n 
1 179 LEU n 
1 180 GLU n 
1 181 VAL n 
1 182 ALA n 
1 183 GLY n 
1 184 TYR n 
1 185 ALA n 
1 186 HIS n 
1 187 GLY n 
1 188 ILE n 
1 189 PRO n 
1 190 ASN n 
1 191 ALA n 
1 192 ILE n 
1 193 PHE n 
1 194 THR n 
1 195 LEU n 
1 196 ASN n 
1 197 LEU n 
1 198 SER n 
1 199 ALA n 
1 200 PRO n 
1 201 PHE n 
1 202 CYS n 
1 203 VAL n 
1 204 GLU n 
1 205 LEU n 
1 206 TYR n 
1 207 LYS n 
1 208 ASP n 
1 209 ALA n 
1 210 MET n 
1 211 GLN n 
1 212 SER n 
1 213 LEU n 
1 214 LEU n 
1 215 LEU n 
1 216 HIS n 
1 217 THR n 
1 218 ASN n 
1 219 ILE n 
1 220 LEU n 
1 221 PHE n 
1 222 GLY n 
1 223 ASN n 
1 224 GLU n 
1 225 GLU n 
1 226 GLU n 
1 227 PHE n 
1 228 ALA n 
1 229 HIS n 
1 230 LEU n 
1 231 ALA n 
1 232 LYS n 
1 233 VAL n 
1 234 HIS n 
1 235 ASN n 
1 236 LEU n 
1 237 VAL n 
1 238 ALA n 
1 239 ALA n 
1 240 GLU n 
1 241 LYS n 
1 242 VAL n 
1 243 ALA n 
1 244 LEU n 
1 245 SER n 
1 246 VAL n 
1 247 ALA n 
1 248 ASN n 
1 249 LYS n 
1 250 GLU n 
1 251 HIS n 
1 252 ALA n 
1 253 VAL n 
1 254 GLU n 
1 255 VAL n 
1 256 CYS n 
1 257 THR n 
1 258 GLY n 
1 259 ALA n 
1 260 LEU n 
1 261 ARG n 
1 262 LEU n 
1 263 LEU n 
1 264 THR n 
1 265 ALA n 
1 266 GLY n 
1 267 GLN n 
1 268 ASN n 
1 269 THR n 
1 270 GLY n 
1 271 ALA n 
1 272 THR n 
1 273 LYS n 
1 274 LEU n 
1 275 VAL n 
1 276 VAL n 
1 277 MET n 
1 278 THR n 
1 279 ARG n 
1 280 GLY n 
1 281 HIS n 
1 282 ASN n 
1 283 PRO n 
1 284 VAL n 
1 285 ILE n 
1 286 ALA n 
1 287 ALA n 
1 288 GLU n 
1 289 GLN n 
1 290 THR n 
1 291 ALA n 
1 292 ASP n 
1 293 GLY n 
1 294 THR n 
1 295 VAL n 
1 296 VAL n 
1 297 VAL n 
1 298 HIS n 
1 299 GLU n 
1 300 VAL n 
1 301 GLY n 
1 302 VAL n 
1 303 PRO n 
1 304 VAL n 
1 305 VAL n 
1 306 ALA n 
1 307 ALA n 
1 308 GLU n 
1 309 LYS n 
1 310 ILE n 
1 311 VAL n 
1 312 ASP n 
1 313 THR n 
1 314 ASN n 
1 315 GLY n 
1 316 ALA n 
1 317 GLY n 
1 318 ASP n 
1 319 ALA n 
1 320 PHE n 
1 321 VAL n 
1 322 GLY n 
1 323 GLY n 
1 324 PHE n 
1 325 LEU n 
1 326 TYR n 
1 327 GLY n 
1 328 LEU n 
1 329 SER n 
1 330 GLN n 
1 331 GLY n 
1 332 LYS n 
1 333 THR n 
1 334 VAL n 
1 335 LYS n 
1 336 GLN n 
1 337 CYS n 
1 338 ILE n 
1 339 MET n 
1 340 CYS n 
1 341 GLY n 
1 342 ASN n 
1 343 ALA n 
1 344 CYS n 
1 345 ALA n 
1 346 GLN n 
1 347 ASP n 
1 348 VAL n 
1 349 ILE n 
1 350 GLN n 
1 351 HIS n 
1 352 VAL n 
1 353 GLY n 
1 354 PHE n 
1 355 SER n 
1 356 LEU n 
1 357 SER n 
1 358 PHE n 
1 359 THR n 
1 360 SER n 
1 361 LEU n 
1 362 PRO n 
1 363 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Toxoplasma 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Toxoplasma gondii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5811 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PBACE 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADK_TOXGO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQK
LLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASG
ALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KTALSTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAF
VGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9TVW2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LIK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 363 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9TVW2 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  363 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       363 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LIK THR A 126 ? UNP Q9TVW2 VAL 126 CONFLICT 126 1 
1 1LIK ILE A 150 ? UNP Q9TVW2 LEU 150 CONFLICT 150 2 
1 1LIK ASN A 153 ? UNP Q9TVW2 ASP 153 CONFLICT 153 3 
1 1LIK VAL A 242 ? UNP Q9TVW2 THR 242 CONFLICT 242 4 
1 1LIK VAL A 246 ? UNP Q9TVW2 THR 246 CONFLICT 246 5 
1 1LIK GLY A 327 ? UNP Q9TVW2 ALA 327 CONFLICT 327 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADN non-polymer         . ADENOSINE       ? 'C10 H13 N5 O4'  267.241 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LIK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.29 
_exptl_crystal.density_percent_sol   46.24 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    'pH 6.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'XUONG-HAMLIN MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   1998-01-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1LIK 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10.000 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   30369 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.0370000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.0000 
_reflns.B_iso_Wilson_estimate        26.300 
_reflns.pdbx_redundancy              2.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.68 
_reflns_shell.percent_possible_all   75.0 
_reflns_shell.Rmerge_I_obs           0.1090000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LIK 
_refine.ls_number_reflns_obs                     17172 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.1500000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1500000 
_refine.ls_R_factor_R_free                       0.2000000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  1031 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2433 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               2631 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d    0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg 2.181 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LIK 
_struct.title                     'STRUCTURE OF T. GONDII ADENOSINE KINASE BOUND TO ADENOSINE' 
_struct.pdbx_descriptor           'adenosine kinase (E.C.2.7.1.20)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LIK 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'ALPHA-BETA STRUCTURE, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 30  ? PHE A 37  ? PRO A 30  PHE A 37  1 ? 8  
HELX_P HELX_P2  2  THR A 48  ? MET A 52  ? THR A 48  MET A 52  5 ? 5  
HELX_P HELX_P3  3  ARG A 53  ? LEU A 58  ? ARG A 53  LEU A 58  1 ? 6  
HELX_P HELX_P4  4  ASP A 59  ? ASN A 62  ? ASP A 59  ASN A 62  5 ? 4  
HELX_P HELX_P5  5  GLY A 69  ? ARG A 83  ? GLY A 69  ARG A 83  1 ? 15 
HELX_P HELX_P6  6  ASP A 97  ? GLU A 110 ? ASP A 97  GLU A 110 1 ? 14 
HELX_P HELX_P7  7  LEU A 142 ? PHE A 148 ? LEU A 142 PHE A 148 5 ? 7  
HELX_P HELX_P8  8  ASN A 153 ? ALA A 158 ? ASN A 153 ALA A 158 1 ? 6  
HELX_P HELX_P9  9  TYR A 169 ? ALA A 173 ? TYR A 169 ALA A 173 5 ? 5  
HELX_P HELX_P10 10 PRO A 175 ? HIS A 186 ? PRO A 175 HIS A 186 1 ? 12 
HELX_P HELX_P11 11 ALA A 199 ? TYR A 206 ? ALA A 199 TYR A 206 1 ? 8  
HELX_P HELX_P12 12 TYR A 206 ? LEU A 215 ? TYR A 206 LEU A 215 1 ? 10 
HELX_P HELX_P13 13 GLU A 224 ? HIS A 234 ? GLU A 224 HIS A 234 1 ? 11 
HELX_P HELX_P14 14 LYS A 241 ? VAL A 253 ? LYS A 241 VAL A 253 1 ? 13 
HELX_P HELX_P15 15 ALA A 306 ? ILE A 310 ? ALA A 306 ILE A 310 5 ? 5  
HELX_P HELX_P16 16 GLY A 315 ? GLN A 330 ? GLY A 315 GLN A 330 1 ? 16 
HELX_P HELX_P17 17 THR A 333 ? GLN A 350 ? THR A 333 GLN A 350 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 113 ? ALA A 119 ? ALA A 113 ALA A 119 
A 2 ALA A 88  ? GLY A 95  ? ALA A 88  GLY A 95  
A 3 VAL A 15  ? ILE A 18  ? VAL A 15  ILE A 18  
A 4 ILE A 163 ? THR A 167 ? ILE A 163 THR A 167 
A 5 ILE A 192 ? ASN A 196 ? ILE A 192 ASN A 196 
A 6 ILE A 219 ? ASN A 223 ? ILE A 219 ASN A 223 
A 7 LEU A 274 ? ARG A 279 ? LEU A 274 ARG A 279 
A 8 ASN A 282 ? GLN A 289 ? ASN A 282 GLN A 289 
A 9 VAL A 295 ? VAL A 300 ? VAL A 295 VAL A 300 
B 1 ALA A 44  ? LEU A 46  ? ALA A 44  LEU A 46  
B 2 GLU A 135 ? HIS A 141 ? GLU A 135 HIS A 141 
B 3 GLY A 125 ? ASN A 132 ? GLY A 125 ASN A 132 
B 4 ILE A 22  ? GLU A 28  ? ILE A 22  GLU A 28  
B 5 THR A 64  ? PRO A 67  ? THR A 64  PRO A 67  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 117 ? O MET A 117 N GLY A 92  ? N GLY A 92  
A 2 3 O GLY A 89  ? O GLY A 89  N VAL A 15  ? N VAL A 15  
A 3 4 N PHE A 16  ? N PHE A 16  O TYR A 165 ? O TYR A 165 
A 4 5 N PHE A 164 ? N PHE A 164 O THR A 194 ? O THR A 194 
A 5 6 N LEU A 195 ? N LEU A 195 O PHE A 221 ? O PHE A 221 
A 6 7 N GLY A 222 ? N GLY A 222 O THR A 278 ? O THR A 278 
A 7 8 N MET A 277 ? N MET A 277 O ILE A 285 ? O ILE A 285 
A 8 9 N ALA A 286 ? N ALA A 286 O HIS A 298 ? O HIS A 298 
B 1 2 N THR A 45  ? N THR A 45  O THR A 140 ? O THR A 140 
B 2 3 O THR A 137 ? O THR A 137 N LEU A 130 ? N LEU A 130 
B 3 4 O CYS A 127 ? O CYS A 127 N LEU A 23  ? N LEU A 23  
B 4 5 N ASP A 24  ? N ASP A 24  O LEU A 66  ? O LEU A 66  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 999' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 899'  
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADN A 699' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ADN A 799' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ARG A 136 ? ARG A 136  . ? 1_555 ? 
2  AC1 6  ASN A 223 ? ASN A 223  . ? 1_555 ? 
3  AC1 6  GLY A 317 ? GLY A 317  . ? 1_555 ? 
4  AC1 6  HOH F .   ? HOH A 1034 . ? 1_555 ? 
5  AC1 6  HOH F .   ? HOH A 1056 . ? 1_555 ? 
6  AC1 6  HOH F .   ? HOH A 1098 . ? 1_555 ? 
7  AC2 2  ASP A 35  ? ASP A 35   . ? 1_556 ? 
8  AC2 2  LYS A 80  ? LYS A 80   . ? 1_555 ? 
9  AC3 14 ASN A 20  ? ASN A 20   . ? 1_555 ? 
10 AC3 14 ILE A 22  ? ILE A 22   . ? 1_555 ? 
11 AC3 14 ASP A 24  ? ASP A 24   . ? 1_555 ? 
12 AC3 14 GLY A 68  ? GLY A 68   . ? 1_555 ? 
13 AC3 14 GLY A 69  ? GLY A 69   . ? 1_555 ? 
14 AC3 14 SER A 70  ? SER A 70   . ? 1_555 ? 
15 AC3 14 ASN A 73  ? ASN A 73   . ? 1_555 ? 
16 AC3 14 THR A 140 ? THR A 140  . ? 1_555 ? 
17 AC3 14 TYR A 169 ? TYR A 169  . ? 1_555 ? 
18 AC3 14 ASP A 318 ? ASP A 318  . ? 1_555 ? 
19 AC3 14 HOH F .   ? HOH A 1038 . ? 1_555 ? 
20 AC3 14 HOH F .   ? HOH A 1040 . ? 1_555 ? 
21 AC3 14 HOH F .   ? HOH A 1041 . ? 1_555 ? 
22 AC3 14 HOH F .   ? HOH A 1056 . ? 1_555 ? 
23 AC4 8  GLY A 280 ? GLY A 280  . ? 1_555 ? 
24 AC4 8  HIS A 281 ? HIS A 281  . ? 1_555 ? 
25 AC4 8  VAL A 302 ? VAL A 302  . ? 1_555 ? 
26 AC4 8  ASN A 342 ? ASN A 342  . ? 1_555 ? 
27 AC4 8  ALA A 345 ? ALA A 345  . ? 1_555 ? 
28 AC4 8  GLN A 346 ? GLN A 346  . ? 1_555 ? 
29 AC4 8  HOH F .   ? HOH A 1032 . ? 1_555 ? 
30 AC4 8  HOH F .   ? HOH A 1076 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LIK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LIK 
_atom_sites.fract_transf_matrix[1][1]   0.005945 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022507 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 11  ? 146.133 32.487 18.859  1.00 97.59  ? 11   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 11  ? 144.844 33.154 19.003  1.00 97.90  ? 11   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 11  ? 143.799 32.357 18.232  1.00 98.29  ? 11   GLY A C     1 
ATOM   4    O  O     . GLY A 1 11  ? 144.179 31.676 17.276  1.00 98.67  ? 11   GLY A O     1 
ATOM   5    N  N     . PRO A 1 12  ? 142.526 32.442 18.672  1.00 88.72  ? 12   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 12  ? 141.376 31.747 18.069  1.00 83.92  ? 12   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 12  ? 141.515 31.672 16.556  1.00 63.06  ? 12   PRO A C     1 
ATOM   8    O  O     . PRO A 1 12  ? 141.752 30.591 16.001  1.00 63.72  ? 12   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 12  ? 140.206 32.640 18.466  1.00 89.05  ? 12   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 12  ? 140.799 34.020 18.517  1.00 97.01  ? 12   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 12  ? 142.288 33.894 18.771  1.00 91.81  ? 12   PRO A CD    1 
ATOM   12   N  N     . MET A 1 13  ? 141.467 32.824 15.898  1.00 39.24  ? 13   MET A N     1 
ATOM   13   C  CA    . MET A 1 13  ? 141.630 32.853 14.453  1.00 30.51  ? 13   MET A CA    1 
ATOM   14   C  C     . MET A 1 13  ? 143.114 32.720 14.095  1.00 30.89  ? 13   MET A C     1 
ATOM   15   O  O     . MET A 1 13  ? 143.935 33.573 14.437  1.00 31.13  ? 13   MET A O     1 
ATOM   16   C  CB    . MET A 1 13  ? 140.923 33.992 13.671  1.00 25.31  ? 13   MET A CB    1 
ATOM   17   C  CG    . MET A 1 13  ? 140.829 33.688 12.171  1.00 22.87  ? 13   MET A CG    1 
ATOM   18   S  SD    . MET A 1 13  ? 139.820 34.781 11.169  1.00 25.11  ? 13   MET A SD    1 
ATOM   19   C  CE    . MET A 1 13  ? 138.260 34.633 11.986  1.00 21.35  ? 13   MET A CE    1 
ATOM   20   N  N     . ARG A 1 14  ? 143.445 31.631 13.417  1.00 19.91  ? 14   ARG A N     1 
ATOM   21   C  CA    . ARG A 1 14  ? 144.810 31.365 12.998  1.00 18.38  ? 14   ARG A CA    1 
ATOM   22   C  C     . ARG A 1 14  ? 144.987 31.654 11.505  1.00 26.45  ? 14   ARG A C     1 
ATOM   23   O  O     . ARG A 1 14  ? 146.022 32.149 11.053  1.00 29.49  ? 14   ARG A O     1 
ATOM   24   C  CB    . ARG A 1 14  ? 145.098 29.892 13.253  1.00 12.33  ? 14   ARG A CB    1 
ATOM   25   C  CG    . ARG A 1 14  ? 145.519 29.554 14.632  1.00 20.32  ? 14   ARG A CG    1 
ATOM   26   C  CD    . ARG A 1 14  ? 144.366 29.386 15.573  1.00 49.02  ? 14   ARG A CD    1 
ATOM   27   N  NE    . ARG A 1 14  ? 144.674 28.411 16.623  1.00 85.17  ? 14   ARG A NE    1 
ATOM   28   C  CZ    . ARG A 1 14  ? 143.758 27.693 17.271  1.00 93.86  ? 14   ARG A CZ    1 
ATOM   29   N  NH1   . ARG A 1 14  ? 142.470 27.848 16.967  1.00 20.10  ? 14   ARG A NH1   1 
ATOM   30   N  NH2   . ARG A 1 14  ? 144.123 26.824 18.214  1.00 93.82  ? 14   ARG A NH2   1 
ATOM   31   N  N     . VAL A 1 15  ? 143.981 31.340 10.728  1.00 13.51  ? 15   VAL A N     1 
ATOM   32   C  CA    . VAL A 1 15  ? 144.104 31.581 9.319   1.00 10.50  ? 15   VAL A CA    1 
ATOM   33   C  C     . VAL A 1 15  ? 142.907 32.349 8.832   1.00 14.75  ? 15   VAL A C     1 
ATOM   34   O  O     . VAL A 1 15  ? 141.786 32.112 9.273   1.00 18.35  ? 15   VAL A O     1 
ATOM   35   C  CB    . VAL A 1 15  ? 144.150 30.215 8.667   1.00 18.99  ? 15   VAL A CB    1 
ATOM   36   C  CG1   . VAL A 1 15  ? 144.612 30.269 7.198   1.00 19.65  ? 15   VAL A CG1   1 
ATOM   37   C  CG2   . VAL A 1 15  ? 144.988 29.290 9.547   1.00 17.00  ? 15   VAL A CG2   1 
ATOM   38   N  N     . PHE A 1 16  ? 143.149 33.268 7.927   1.00 13.00  ? 16   PHE A N     1 
ATOM   39   C  CA    . PHE A 1 16  ? 142.074 34.058 7.384   1.00 15.85  ? 16   PHE A CA    1 
ATOM   40   C  C     . PHE A 1 16  ? 142.165 34.044 5.878   1.00 16.08  ? 16   PHE A C     1 
ATOM   41   O  O     . PHE A 1 16  ? 143.204 34.347 5.308   1.00 18.06  ? 16   PHE A O     1 
ATOM   42   C  CB    . PHE A 1 16  ? 142.091 35.472 7.863   1.00 20.35  ? 16   PHE A CB    1 
ATOM   43   C  CG    . PHE A 1 16  ? 141.130 36.297 7.118   1.00 22.22  ? 16   PHE A CG    1 
ATOM   44   C  CD1   . PHE A 1 16  ? 139.811 36.317 7.483   1.00 26.66  ? 16   PHE A CD1   1 
ATOM   45   C  CD2   . PHE A 1 16  ? 141.531 37.001 6.013   1.00 24.84  ? 16   PHE A CD2   1 
ATOM   46   C  CE1   . PHE A 1 16  ? 138.906 37.068 6.769   1.00 29.57  ? 16   PHE A CE1   1 
ATOM   47   C  CE2   . PHE A 1 16  ? 140.643 37.772 5.291   1.00 26.61  ? 16   PHE A CE2   1 
ATOM   48   C  CZ    . PHE A 1 16  ? 139.327 37.802 5.671   1.00 27.05  ? 16   PHE A CZ    1 
ATOM   49   N  N     . ALA A 1 17  ? 141.086 33.693 5.223   1.00 16.71  ? 17   ALA A N     1 
ATOM   50   C  CA    . ALA A 1 17  ? 141.139 33.658 3.782   1.00 19.12  ? 17   ALA A CA    1 
ATOM   51   C  C     . ALA A 1 17  ? 139.887 34.194 3.122   1.00 21.01  ? 17   ALA A C     1 
ATOM   52   O  O     . ALA A 1 17  ? 138.806 34.191 3.701   1.00 20.71  ? 17   ALA A O     1 
ATOM   53   C  CB    . ALA A 1 17  ? 141.335 32.202 3.331   1.00 20.36  ? 17   ALA A CB    1 
ATOM   54   N  N     . ILE A 1 18  ? 140.074 34.642 1.894   1.00 16.69  ? 18   ILE A N     1 
ATOM   55   C  CA    . ILE A 1 18  ? 139.019 35.162 1.059   1.00 16.77  ? 18   ILE A CA    1 
ATOM   56   C  C     . ILE A 1 18  ? 138.987 34.237 -0.149  1.00 23.68  ? 18   ILE A C     1 
ATOM   57   O  O     . ILE A 1 18  ? 140.006 33.652 -0.505  1.00 24.77  ? 18   ILE A O     1 
ATOM   58   C  CB    . ILE A 1 18  ? 139.217 36.598 0.648   1.00 19.98  ? 18   ILE A CB    1 
ATOM   59   C  CG1   . ILE A 1 18  ? 140.505 36.752 -0.152  1.00 23.96  ? 18   ILE A CG1   1 
ATOM   60   C  CG2   . ILE A 1 18  ? 139.196 37.475 1.867   1.00 16.36  ? 18   ILE A CG2   1 
ATOM   61   C  CD1   . ILE A 1 18  ? 140.448 37.898 -1.154  1.00 17.11  ? 18   ILE A CD1   1 
ATOM   62   N  N     . GLY A 1 19  ? 137.848 34.069 -0.778  1.00 15.99  ? 19   GLY A N     1 
ATOM   63   C  CA    . GLY A 1 19  ? 137.810 33.184 -1.925  1.00 11.42  ? 19   GLY A CA    1 
ATOM   64   C  C     . GLY A 1 19  ? 136.443 33.233 -2.563  1.00 16.37  ? 19   GLY A C     1 
ATOM   65   O  O     . GLY A 1 19  ? 135.628 34.079 -2.206  1.00 19.52  ? 19   GLY A O     1 
ATOM   66   N  N     . ASN A 1 20  ? 136.200 32.325 -3.496  1.00 11.39  ? 20   ASN A N     1 
ATOM   67   C  CA    . ASN A 1 20  ? 134.924 32.256 -4.187  1.00 8.99   ? 20   ASN A CA    1 
ATOM   68   C  C     . ASN A 1 20  ? 134.095 31.069 -3.700  1.00 16.84  ? 20   ASN A C     1 
ATOM   69   O  O     . ASN A 1 20  ? 134.333 29.950 -4.138  1.00 17.27  ? 20   ASN A O     1 
ATOM   70   C  CB    . ASN A 1 20  ? 135.247 31.959 -5.669  1.00 10.50  ? 20   ASN A CB    1 
ATOM   71   C  CG    . ASN A 1 20  ? 135.954 33.142 -6.381  1.00 29.52  ? 20   ASN A CG    1 
ATOM   72   O  OD1   . ASN A 1 20  ? 135.843 34.269 -5.911  1.00 13.99  ? 20   ASN A OD1   1 
ATOM   73   N  ND2   . ASN A 1 20  ? 136.666 32.884 -7.510  1.00 12.60  ? 20   ASN A ND2   1 
ATOM   74   N  N     . PRO A 1 21  ? 133.123 31.289 -2.808  1.00 15.90  ? 21   PRO A N     1 
ATOM   75   C  CA    . PRO A 1 21  ? 132.307 30.170 -2.332  1.00 11.41  ? 21   PRO A CA    1 
ATOM   76   C  C     . PRO A 1 21  ? 131.442 29.673 -3.487  1.00 16.86  ? 21   PRO A C     1 
ATOM   77   O  O     . PRO A 1 21  ? 130.552 30.382 -3.943  1.00 19.15  ? 21   PRO A O     1 
ATOM   78   C  CB    . PRO A 1 21  ? 131.427 30.805 -1.262  1.00 12.13  ? 21   PRO A CB    1 
ATOM   79   C  CG    . PRO A 1 21  ? 131.290 32.244 -1.649  1.00 13.69  ? 21   PRO A CG    1 
ATOM   80   C  CD    . PRO A 1 21  ? 132.510 32.596 -2.474  1.00 14.03  ? 21   PRO A CD    1 
ATOM   81   N  N     . ILE A 1 22  ? 131.707 28.463 -3.966  1.00 10.71  ? 22   ILE A N     1 
ATOM   82   C  CA    . ILE A 1 22  ? 130.956 27.895 -5.080  1.00 9.28   ? 22   ILE A CA    1 
ATOM   83   C  C     . ILE A 1 22  ? 130.415 26.501 -4.756  1.00 16.98  ? 22   ILE A C     1 
ATOM   84   O  O     . ILE A 1 22  ? 130.923 25.815 -3.874  1.00 18.47  ? 22   ILE A O     1 
ATOM   85   C  CB    . ILE A 1 22  ? 132.013 27.822 -6.242  1.00 12.03  ? 22   ILE A CB    1 
ATOM   86   C  CG1   . ILE A 1 22  ? 132.102 29.138 -7.003  1.00 10.70  ? 22   ILE A CG1   1 
ATOM   87   C  CG2   . ILE A 1 22  ? 132.037 26.486 -6.999  1.00 2.14   ? 22   ILE A CG2   1 
ATOM   88   C  CD1   . ILE A 1 22  ? 133.483 29.371 -7.555  1.00 25.63  ? 22   ILE A CD1   1 
ATOM   89   N  N     . LEU A 1 23  ? 129.383 26.083 -5.472  1.00 14.38  ? 23   LEU A N     1 
ATOM   90   C  CA    . LEU A 1 23  ? 128.794 24.767 -5.247  1.00 18.69  ? 23   LEU A CA    1 
ATOM   91   C  C     . LEU A 1 23  ? 129.286 23.762 -6.279  1.00 21.33  ? 23   LEU A C     1 
ATOM   92   O  O     . LEU A 1 23  ? 129.196 24.002 -7.484  1.00 19.42  ? 23   LEU A O     1 
ATOM   93   C  CB    . LEU A 1 23  ? 127.295 24.803 -5.279  1.00 18.18  ? 23   LEU A CB    1 
ATOM   94   C  CG    . LEU A 1 23  ? 126.794 23.407 -5.078  1.00 22.88  ? 23   LEU A CG    1 
ATOM   95   C  CD1   . LEU A 1 23  ? 126.024 23.398 -3.801  1.00 20.38  ? 23   LEU A CD1   1 
ATOM   96   C  CD2   . LEU A 1 23  ? 125.990 22.919 -6.282  1.00 29.26  ? 23   LEU A CD2   1 
ATOM   97   N  N     . ASP A 1 24  ? 129.805 22.637 -5.799  1.00 10.37  ? 24   ASP A N     1 
ATOM   98   C  CA    . ASP A 1 24  ? 130.324 21.611 -6.686  1.00 13.03  ? 24   ASP A CA    1 
ATOM   99   C  C     . ASP A 1 24  ? 129.336 20.530 -7.083  1.00 22.40  ? 24   ASP A C     1 
ATOM   100  O  O     . ASP A 1 24  ? 128.601 19.973 -6.262  1.00 16.66  ? 24   ASP A O     1 
ATOM   101  C  CB    . ASP A 1 24  ? 131.525 20.923 -6.109  1.00 15.15  ? 24   ASP A CB    1 
ATOM   102  C  CG    . ASP A 1 24  ? 132.779 21.728 -6.314  1.00 18.10  ? 24   ASP A CG    1 
ATOM   103  O  OD1   . ASP A 1 24  ? 132.689 22.819 -6.911  1.00 18.04  ? 24   ASP A OD1   1 
ATOM   104  O  OD2   . ASP A 1 24  ? 133.846 21.278 -5.889  1.00 6.73   ? 24   ASP A OD2   1 
ATOM   105  N  N     . LEU A 1 25  ? 129.362 20.258 -8.378  1.00 18.90  ? 25   LEU A N     1 
ATOM   106  C  CA    . LEU A 1 25  ? 128.537 19.252 -9.019  1.00 18.75  ? 25   LEU A CA    1 
ATOM   107  C  C     . LEU A 1 25  ? 129.506 18.283 -9.637  1.00 18.11  ? 25   LEU A C     1 
ATOM   108  O  O     . LEU A 1 25  ? 130.075 18.562 -10.694 1.00 11.23  ? 25   LEU A O     1 
ATOM   109  C  CB    . LEU A 1 25  ? 127.720 19.790 -10.185 1.00 18.55  ? 25   LEU A CB    1 
ATOM   110  C  CG    . LEU A 1 25  ? 126.240 19.927 -9.905  1.00 27.91  ? 25   LEU A CG    1 
ATOM   111  C  CD1   . LEU A 1 25  ? 125.927 19.629 -8.436  1.00 28.65  ? 25   LEU A CD1   1 
ATOM   112  C  CD2   . LEU A 1 25  ? 125.811 21.332 -10.267 1.00 39.64  ? 25   LEU A CD2   1 
ATOM   113  N  N     . VAL A 1 26  ? 129.697 17.165 -8.955  1.00 13.99  ? 26   VAL A N     1 
ATOM   114  C  CA    . VAL A 1 26  ? 130.615 16.135 -9.390  1.00 14.54  ? 26   VAL A CA    1 
ATOM   115  C  C     . VAL A 1 26  ? 129.943 15.048 -10.215 1.00 24.06  ? 26   VAL A C     1 
ATOM   116  O  O     . VAL A 1 26  ? 128.761 14.757 -10.036 1.00 23.82  ? 26   VAL A O     1 
ATOM   117  C  CB    . VAL A 1 26  ? 131.297 15.615 -8.134  1.00 11.62  ? 26   VAL A CB    1 
ATOM   118  C  CG1   . VAL A 1 26  ? 132.408 14.689 -8.517  1.00 11.55  ? 26   VAL A CG1   1 
ATOM   119  C  CG2   . VAL A 1 26  ? 131.911 16.798 -7.433  1.00 8.48   ? 26   VAL A CG2   1 
ATOM   120  N  N     . ALA A 1 27  ? 130.713 14.444 -11.115 1.00 16.34  ? 27   ALA A N     1 
ATOM   121  C  CA    . ALA A 1 27  ? 130.172 13.389 -11.951 1.00 15.84  ? 27   ALA A CA    1 
ATOM   122  C  C     . ALA A 1 27  ? 131.207 12.780 -12.868 1.00 21.30  ? 27   ALA A C     1 
ATOM   123  O  O     . ALA A 1 27  ? 132.069 13.468 -13.417 1.00 19.78  ? 27   ALA A O     1 
ATOM   124  C  CB    . ALA A 1 27  ? 129.072 13.926 -12.852 1.00 14.78  ? 27   ALA A CB    1 
ATOM   125  N  N     . GLU A 1 28  ? 131.098 11.474 -13.023 1.00 13.26  ? 28   GLU A N     1 
ATOM   126  C  CA    . GLU A 1 28  ? 131.984 10.738 -13.886 1.00 12.79  ? 28   GLU A CA    1 
ATOM   127  C  C     . GLU A 1 28  ? 131.322 10.744 -15.270 1.00 20.51  ? 28   GLU A C     1 
ATOM   128  O  O     . GLU A 1 28  ? 130.227 10.202 -15.449 1.00 28.49  ? 28   GLU A O     1 
ATOM   129  C  CB    . GLU A 1 28  ? 132.159 9.358  -13.297 1.00 14.60  ? 28   GLU A CB    1 
ATOM   130  C  CG    . GLU A 1 28  ? 133.322 8.592  -13.903 1.00 43.35  ? 28   GLU A CG    1 
ATOM   131  C  CD    . GLU A 1 28  ? 134.256 8.024  -12.857 1.00 94.29  ? 28   GLU A CD    1 
ATOM   132  O  OE1   . GLU A 1 28  ? 133.934 8.117  -11.646 1.00 95.66  ? 28   GLU A OE1   1 
ATOM   133  O  OE2   . GLU A 1 28  ? 135.312 7.484  -13.259 1.00 95.72  ? 28   GLU A OE2   1 
ATOM   134  N  N     . VAL A 1 29  ? 131.958 11.367 -16.252 1.00 15.57  ? 29   VAL A N     1 
ATOM   135  C  CA    . VAL A 1 29  ? 131.366 11.427 -17.584 1.00 17.53  ? 29   VAL A CA    1 
ATOM   136  C  C     . VAL A 1 29  ? 132.284 10.876 -18.657 1.00 14.96  ? 29   VAL A C     1 
ATOM   137  O  O     . VAL A 1 29  ? 133.498 10.832 -18.496 1.00 12.00  ? 29   VAL A O     1 
ATOM   138  C  CB    . VAL A 1 29  ? 131.068 12.909 -17.936 1.00 24.85  ? 29   VAL A CB    1 
ATOM   139  C  CG1   . VAL A 1 29  ? 130.509 13.630 -16.701 1.00 24.20  ? 29   VAL A CG1   1 
ATOM   140  C  CG2   . VAL A 1 29  ? 132.353 13.619 -18.374 1.00 25.24  ? 29   VAL A CG2   1 
ATOM   141  N  N     . PRO A 1 30  ? 131.684 10.460 -19.757 1.00 18.25  ? 30   PRO A N     1 
ATOM   142  C  CA    . PRO A 1 30  ? 132.424 9.914  -20.883 1.00 13.91  ? 30   PRO A CA    1 
ATOM   143  C  C     . PRO A 1 30  ? 133.114 11.035 -21.641 1.00 15.97  ? 30   PRO A C     1 
ATOM   144  O  O     . PRO A 1 30  ? 132.685 12.186 -21.578 1.00 19.50  ? 30   PRO A O     1 
ATOM   145  C  CB    . PRO A 1 30  ? 131.322 9.364  -21.776 1.00 13.61  ? 30   PRO A CB    1 
ATOM   146  C  CG    . PRO A 1 30  ? 130.089 10.125 -21.420 1.00 17.19  ? 30   PRO A CG    1 
ATOM   147  C  CD    . PRO A 1 30  ? 130.221 10.428 -19.958 1.00 18.42  ? 30   PRO A CD    1 
ATOM   148  N  N     . SER A 1 31  ? 134.175 10.696 -22.359 1.00 11.99  ? 31   SER A N     1 
ATOM   149  C  CA    . SER A 1 31  ? 134.931 11.679 -23.131 1.00 15.53  ? 31   SER A CA    1 
ATOM   150  C  C     . SER A 1 31  ? 134.048 12.371 -24.152 1.00 19.83  ? 31   SER A C     1 
ATOM   151  O  O     . SER A 1 31  ? 134.266 13.520 -24.510 1.00 31.90  ? 31   SER A O     1 
ATOM   152  C  CB    . SER A 1 31  ? 136.057 10.984 -23.904 1.00 24.28  ? 31   SER A CB    1 
ATOM   153  O  OG    . SER A 1 31  ? 136.873 10.228 -23.023 1.00 59.59  ? 31   SER A OG    1 
ATOM   154  N  N     . SER A 1 32  ? 133.057 11.656 -24.623 1.00 10.19  ? 32   SER A N     1 
ATOM   155  C  CA    . SER A 1 32  ? 132.147 12.195 -25.601 1.00 13.69  ? 32   SER A CA    1 
ATOM   156  C  C     . SER A 1 32  ? 131.507 13.449 -25.044 1.00 26.84  ? 32   SER A C     1 
ATOM   157  O  O     . SER A 1 32  ? 131.131 14.362 -25.787 1.00 32.70  ? 32   SER A O     1 
ATOM   158  C  CB    . SER A 1 32  ? 131.024 11.161 -25.737 1.00 32.46  ? 32   SER A CB    1 
ATOM   159  O  OG    . SER A 1 32  ? 130.793 10.479 -24.502 1.00 55.40  ? 32   SER A OG    1 
ATOM   160  N  N     . PHE A 1 33  ? 131.376 13.475 -23.723 1.00 16.24  ? 33   PHE A N     1 
ATOM   161  C  CA    . PHE A 1 33  ? 130.779 14.612 -23.049 1.00 16.48  ? 33   PHE A CA    1 
ATOM   162  C  C     . PHE A 1 33  ? 131.737 15.791 -23.121 1.00 27.21  ? 33   PHE A C     1 
ATOM   163  O  O     . PHE A 1 33  ? 131.350 16.914 -23.474 1.00 25.10  ? 33   PHE A O     1 
ATOM   164  C  CB    . PHE A 1 33  ? 130.501 14.234 -21.611 1.00 18.75  ? 33   PHE A CB    1 
ATOM   165  C  CG    . PHE A 1 33  ? 129.611 15.200 -20.913 1.00 24.86  ? 33   PHE A CG    1 
ATOM   166  C  CD1   . PHE A 1 33  ? 128.309 15.384 -21.337 1.00 28.51  ? 33   PHE A CD1   1 
ATOM   167  C  CD2   . PHE A 1 33  ? 130.073 15.940 -19.838 1.00 28.68  ? 33   PHE A CD2   1 
ATOM   168  C  CE1   . PHE A 1 33  ? 127.483 16.278 -20.696 1.00 27.50  ? 33   PHE A CE1   1 
ATOM   169  C  CE2   . PHE A 1 33  ? 129.247 16.841 -19.187 1.00 31.76  ? 33   PHE A CE2   1 
ATOM   170  C  CZ    . PHE A 1 33  ? 127.950 17.010 -19.616 1.00 29.04  ? 33   PHE A CZ    1 
ATOM   171  N  N     . LEU A 1 34  ? 132.997 15.517 -22.817 1.00 24.30  ? 34   LEU A N     1 
ATOM   172  C  CA    . LEU A 1 34  ? 134.033 16.540 -22.852 1.00 26.70  ? 34   LEU A CA    1 
ATOM   173  C  C     . LEU A 1 34  ? 134.070 17.245 -24.197 1.00 26.79  ? 34   LEU A C     1 
ATOM   174  O  O     . LEU A 1 34  ? 134.159 18.471 -24.268 1.00 28.11  ? 34   LEU A O     1 
ATOM   175  C  CB    . LEU A 1 34  ? 135.407 15.917 -22.673 1.00 27.48  ? 34   LEU A CB    1 
ATOM   176  C  CG    . LEU A 1 34  ? 136.074 16.086 -21.309 1.00 29.97  ? 34   LEU A CG    1 
ATOM   177  C  CD1   . LEU A 1 34  ? 135.057 16.383 -20.206 1.00 28.81  ? 34   LEU A CD1   1 
ATOM   178  C  CD2   . LEU A 1 34  ? 136.898 14.865 -20.980 1.00 30.71  ? 34   LEU A CD2   1 
ATOM   179  N  N     . ASP A 1 35  ? 134.021 16.475 -25.265 1.00 12.75  ? 35   ASP A N     1 
ATOM   180  C  CA    . ASP A 1 35  ? 134.068 17.075 -26.581 1.00 15.34  ? 35   ASP A CA    1 
ATOM   181  C  C     . ASP A 1 35  ? 132.824 17.854 -26.927 1.00 24.38  ? 35   ASP A C     1 
ATOM   182  O  O     . ASP A 1 35  ? 132.916 18.893 -27.574 1.00 34.98  ? 35   ASP A O     1 
ATOM   183  C  CB    . ASP A 1 35  ? 134.377 16.107 -27.664 1.00 20.51  ? 35   ASP A CB    1 
ATOM   184  C  CG    . ASP A 1 35  ? 135.203 15.001 -27.182 1.00 50.25  ? 35   ASP A CG    1 
ATOM   185  O  OD1   . ASP A 1 35  ? 135.700 15.111 -26.042 1.00 57.54  ? 35   ASP A OD1   1 
ATOM   186  O  OD2   . ASP A 1 35  ? 135.335 14.034 -27.953 1.00 74.54  ? 35   ASP A OD2   1 
ATOM   187  N  N     . GLU A 1 36  ? 131.663 17.363 -26.521 1.00 21.13  ? 36   GLU A N     1 
ATOM   188  C  CA    . GLU A 1 36  ? 130.430 18.073 -26.837 1.00 20.81  ? 36   GLU A CA    1 
ATOM   189  C  C     . GLU A 1 36  ? 130.379 19.444 -26.178 1.00 24.64  ? 36   GLU A C     1 
ATOM   190  O  O     . GLU A 1 36  ? 129.838 20.391 -26.742 1.00 24.70  ? 36   GLU A O     1 
ATOM   191  C  CB    . GLU A 1 36  ? 129.163 17.256 -26.663 1.00 22.38  ? 36   GLU A CB    1 
ATOM   192  C  CG    . GLU A 1 36  ? 128.706 16.970 -25.249 1.00 52.19  ? 36   GLU A CG    1 
ATOM   193  C  CD    . GLU A 1 36  ? 127.435 16.105 -25.272 1.00 95.42  ? 36   GLU A CD    1 
ATOM   194  O  OE1   . GLU A 1 36  ? 127.537 14.858 -25.112 1.00 100.00 ? 36   GLU A OE1   1 
ATOM   195  O  OE2   . GLU A 1 36  ? 126.337 16.674 -25.510 1.00 31.35  ? 36   GLU A OE2   1 
ATOM   196  N  N     . PHE A 1 37  ? 130.952 19.537 -24.980 1.00 19.44  ? 37   PHE A N     1 
ATOM   197  C  CA    . PHE A 1 37  ? 130.979 20.789 -24.240 1.00 20.24  ? 37   PHE A CA    1 
ATOM   198  C  C     . PHE A 1 37  ? 132.319 21.506 -24.408 1.00 25.43  ? 37   PHE A C     1 
ATOM   199  O  O     . PHE A 1 37  ? 132.711 22.330 -23.569 1.00 20.57  ? 37   PHE A O     1 
ATOM   200  C  CB    . PHE A 1 37  ? 130.423 20.594 -22.833 1.00 22.17  ? 37   PHE A CB    1 
ATOM   201  C  CG    . PHE A 1 37  ? 128.920 20.444 -22.837 1.00 24.66  ? 37   PHE A CG    1 
ATOM   202  C  CD1   . PHE A 1 37  ? 128.306 19.242 -22.553 1.00 25.42  ? 37   PHE A CD1   1 
ATOM   203  C  CD2   . PHE A 1 37  ? 128.110 21.532 -23.128 1.00 30.70  ? 37   PHE A CD2   1 
ATOM   204  C  CE1   . PHE A 1 37  ? 126.920 19.108 -22.558 1.00 24.79  ? 37   PHE A CE1   1 
ATOM   205  C  CE2   . PHE A 1 37  ? 126.723 21.403 -23.145 1.00 32.74  ? 37   PHE A CE2   1 
ATOM   206  C  CZ    . PHE A 1 37  ? 126.121 20.192 -22.869 1.00 27.09  ? 37   PHE A CZ    1 
ATOM   207  N  N     . PHE A 1 38  ? 133.003 21.168 -25.521 1.00 17.13  ? 38   PHE A N     1 
ATOM   208  C  CA    . PHE A 1 38  ? 134.312 21.725 -25.911 1.00 13.82  ? 38   PHE A CA    1 
ATOM   209  C  C     . PHE A 1 38  ? 135.295 21.843 -24.742 1.00 8.93   ? 38   PHE A C     1 
ATOM   210  O  O     . PHE A 1 38  ? 135.950 22.874 -24.578 1.00 3.96   ? 38   PHE A O     1 
ATOM   211  C  CB    . PHE A 1 38  ? 134.154 23.123 -26.574 1.00 13.48  ? 38   PHE A CB    1 
ATOM   212  C  CG    . PHE A 1 38  ? 132.953 23.233 -27.455 1.00 9.85   ? 38   PHE A CG    1 
ATOM   213  C  CD1   . PHE A 1 38  ? 132.966 22.665 -28.693 1.00 8.24   ? 38   PHE A CD1   1 
ATOM   214  C  CD2   . PHE A 1 38  ? 131.806 23.887 -27.026 1.00 14.94  ? 38   PHE A CD2   1 
ATOM   215  C  CE1   . PHE A 1 38  ? 131.872 22.751 -29.530 1.00 11.21  ? 38   PHE A CE1   1 
ATOM   216  C  CE2   . PHE A 1 38  ? 130.696 23.969 -27.845 1.00 18.02  ? 38   PHE A CE2   1 
ATOM   217  C  CZ    . PHE A 1 38  ? 130.731 23.404 -29.106 1.00 17.09  ? 38   PHE A CZ    1 
ATOM   218  N  N     . LEU A 1 39  ? 135.407 20.795 -23.938 1.00 8.14   ? 39   LEU A N     1 
ATOM   219  C  CA    . LEU A 1 39  ? 136.312 20.830 -22.791 1.00 12.41  ? 39   LEU A CA    1 
ATOM   220  C  C     . LEU A 1 39  ? 137.546 19.959 -22.953 1.00 15.74  ? 39   LEU A C     1 
ATOM   221  O  O     . LEU A 1 39  ? 137.496 18.894 -23.564 1.00 22.00  ? 39   LEU A O     1 
ATOM   222  C  CB    . LEU A 1 39  ? 135.601 20.192 -21.597 1.00 13.40  ? 39   LEU A CB    1 
ATOM   223  C  CG    . LEU A 1 39  ? 134.335 20.836 -21.096 1.00 14.40  ? 39   LEU A CG    1 
ATOM   224  C  CD1   . LEU A 1 39  ? 133.600 19.905 -20.114 1.00 14.83  ? 39   LEU A CD1   1 
ATOM   225  C  CD2   . LEU A 1 39  ? 134.735 22.126 -20.479 1.00 1.00   ? 39   LEU A CD2   1 
ATOM   226  N  N     . LYS A 1 40  ? 138.646 20.428 -22.375 1.00 11.68  ? 40   LYS A N     1 
ATOM   227  C  CA    . LYS A 1 40  ? 139.910 19.710 -22.421 1.00 9.77   ? 40   LYS A CA    1 
ATOM   228  C  C     . LYS A 1 40  ? 140.120 18.987 -21.099 1.00 16.22  ? 40   LYS A C     1 
ATOM   229  O  O     . LYS A 1 40  ? 140.060 19.605 -20.038 1.00 10.60  ? 40   LYS A O     1 
ATOM   230  C  CB    . LYS A 1 40  ? 141.050 20.681 -22.593 1.00 11.91  ? 40   LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 40  ? 142.286 19.932 -22.999 1.00 69.07  ? 40   LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 40  ? 141.827 18.600 -23.585 1.00 94.97  ? 40   LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 40  ? 142.493 17.395 -22.930 1.00 99.46  ? 40   LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 40  ? 141.700 16.146 -23.117 1.00 90.51  ? 40   LYS A NZ    1 
ATOM   235  N  N     . ARG A 1 41  ? 140.348 17.681 -21.163 1.00 19.98  ? 41   ARG A N     1 
ATOM   236  C  CA    . ARG A 1 41  ? 140.550 16.902 -19.954 1.00 16.00  ? 41   ARG A CA    1 
ATOM   237  C  C     . ARG A 1 41  ? 141.682 17.514 -19.153 1.00 16.18  ? 41   ARG A C     1 
ATOM   238  O  O     . ARG A 1 41  ? 142.696 17.886 -19.731 1.00 20.73  ? 41   ARG A O     1 
ATOM   239  C  CB    . ARG A 1 41  ? 140.896 15.411 -20.280 1.00 1.88   ? 41   ARG A CB    1 
ATOM   240  C  CG    . ARG A 1 41  ? 140.889 14.373 -19.053 1.00 14.96  ? 41   ARG A CG    1 
ATOM   241  C  CD    . ARG A 1 41  ? 140.951 12.898 -19.581 1.00 2.92   ? 41   ARG A CD    1 
ATOM   242  N  NE    . ARG A 1 41  ? 140.871 13.049 -21.038 1.00 43.89  ? 41   ARG A NE    1 
ATOM   243  C  CZ    . ARG A 1 41  ? 140.032 12.433 -21.881 1.00 79.31  ? 41   ARG A CZ    1 
ATOM   244  N  NH1   . ARG A 1 41  ? 139.150 11.539 -21.485 1.00 54.65  ? 41   ARG A NH1   1 
ATOM   245  N  NH2   . ARG A 1 41  ? 140.095 12.711 -23.177 1.00 76.88  ? 41   ARG A NH2   1 
ATOM   246  N  N     . GLY A 1 42  ? 141.482 17.618 -17.833 1.00 13.07  ? 42   GLY A N     1 
ATOM   247  C  CA    . GLY A 1 42  ? 142.457 18.164 -16.885 1.00 5.02   ? 42   GLY A CA    1 
ATOM   248  C  C     . GLY A 1 42  ? 142.353 19.666 -16.695 1.00 11.52  ? 42   GLY A C     1 
ATOM   249  O  O     . GLY A 1 42  ? 142.715 20.199 -15.648 1.00 13.28  ? 42   GLY A O     1 
ATOM   250  N  N     . ASP A 1 43  ? 141.864 20.340 -17.709 1.00 15.03  ? 43   ASP A N     1 
ATOM   251  C  CA    . ASP A 1 43  ? 141.716 21.789 -17.686 1.00 17.15  ? 43   ASP A CA    1 
ATOM   252  C  C     . ASP A 1 43  ? 140.754 22.354 -16.626 1.00 17.28  ? 43   ASP A C     1 
ATOM   253  O  O     . ASP A 1 43  ? 139.936 21.634 -16.041 1.00 10.83  ? 43   ASP A O     1 
ATOM   254  C  CB    . ASP A 1 43  ? 141.147 22.088 -19.069 1.00 22.12  ? 43   ASP A CB    1 
ATOM   255  C  CG    . ASP A 1 43  ? 141.823 23.257 -19.740 1.00 35.13  ? 43   ASP A CG    1 
ATOM   256  O  OD1   . ASP A 1 43  ? 143.024 23.467 -19.483 1.00 31.01  ? 43   ASP A OD1   1 
ATOM   257  O  OD2   . ASP A 1 43  ? 141.126 23.969 -20.502 1.00 40.05  ? 43   ASP A OD2   1 
ATOM   258  N  N     . ALA A 1 44  ? 140.888 23.680 -16.413 1.00 14.46  ? 44   ALA A N     1 
ATOM   259  C  CA    . ALA A 1 44  ? 140.091 24.501 -15.482 1.00 14.21  ? 44   ALA A CA    1 
ATOM   260  C  C     . ALA A 1 44  ? 139.753 25.840 -16.160 1.00 31.11  ? 44   ALA A C     1 
ATOM   261  O  O     . ALA A 1 44  ? 140.644 26.579 -16.586 1.00 34.46  ? 44   ALA A O     1 
ATOM   262  C  CB    . ALA A 1 44  ? 140.671 24.667 -14.077 1.00 12.79  ? 44   ALA A CB    1 
ATOM   263  N  N     . THR A 1 45  ? 138.466 26.156 -16.279 1.00 27.25  ? 45   THR A N     1 
ATOM   264  C  CA    . THR A 1 45  ? 138.099 27.403 -16.932 1.00 24.45  ? 45   THR A CA    1 
ATOM   265  C  C     . THR A 1 45  ? 136.716 27.910 -16.530 1.00 24.68  ? 45   THR A C     1 
ATOM   266  O  O     . THR A 1 45  ? 135.964 27.233 -15.823 1.00 19.77  ? 45   THR A O     1 
ATOM   267  C  CB    . THR A 1 45  ? 138.057 27.086 -18.459 1.00 8.35   ? 45   THR A CB    1 
ATOM   268  O  OG1   . THR A 1 45  ? 137.445 28.165 -19.170 1.00 58.72  ? 45   THR A OG1   1 
ATOM   269  C  CG2   . THR A 1 45  ? 137.176 25.897 -18.666 1.00 11.63  ? 45   THR A CG2   1 
ATOM   270  N  N     . LEU A 1 46  ? 136.408 29.119 -17.001 1.00 13.10  ? 46   LEU A N     1 
ATOM   271  C  CA    . LEU A 1 46  ? 135.136 29.752 -16.737 1.00 10.15  ? 46   LEU A CA    1 
ATOM   272  C  C     . LEU A 1 46  ? 134.185 29.389 -17.866 1.00 20.12  ? 46   LEU A C     1 
ATOM   273  O  O     . LEU A 1 46  ? 134.537 29.503 -19.036 1.00 28.87  ? 46   LEU A O     1 
ATOM   274  C  CB    . LEU A 1 46  ? 135.352 31.217 -16.515 1.00 11.68  ? 46   LEU A CB    1 
ATOM   275  C  CG    . LEU A 1 46  ? 136.152 31.465 -15.218 1.00 19.41  ? 46   LEU A CG    1 
ATOM   276  C  CD1   . LEU A 1 46  ? 136.768 32.855 -15.231 1.00 17.61  ? 46   LEU A CD1   1 
ATOM   277  C  CD2   . LEU A 1 46  ? 135.321 31.226 -13.947 1.00 20.41  ? 46   LEU A CD2   1 
ATOM   278  N  N     . ALA A 1 47  ? 132.990 28.938 -17.518 1.00 16.23  ? 47   ALA A N     1 
ATOM   279  C  CA    . ALA A 1 47  ? 131.990 28.531 -18.507 1.00 17.29  ? 47   ALA A CA    1 
ATOM   280  C  C     . ALA A 1 47  ? 131.617 29.592 -19.537 1.00 23.22  ? 47   ALA A C     1 
ATOM   281  O  O     . ALA A 1 47  ? 131.315 30.731 -19.185 1.00 27.88  ? 47   ALA A O     1 
ATOM   282  C  CB    . ALA A 1 47  ? 130.739 28.083 -17.814 1.00 18.90  ? 47   ALA A CB    1 
ATOM   283  N  N     . THR A 1 48  ? 131.613 29.201 -20.814 1.00 13.44  ? 48   THR A N     1 
ATOM   284  C  CA    . THR A 1 48  ? 131.245 30.118 -21.887 1.00 12.13  ? 48   THR A CA    1 
ATOM   285  C  C     . THR A 1 48  ? 129.743 30.033 -22.092 1.00 21.32  ? 48   THR A C     1 
ATOM   286  O  O     . THR A 1 48  ? 129.088 29.197 -21.479 1.00 31.39  ? 48   THR A O     1 
ATOM   287  C  CB    . THR A 1 48  ? 131.956 29.929 -23.262 1.00 23.41  ? 48   THR A CB    1 
ATOM   288  O  OG1   . THR A 1 48  ? 131.553 28.730 -23.946 1.00 24.74  ? 48   THR A OG1   1 
ATOM   289  C  CG2   . THR A 1 48  ? 133.436 29.970 -23.107 1.00 4.19   ? 48   THR A CG2   1 
ATOM   290  N  N     . PRO A 1 49  ? 129.185 30.881 -22.938 1.00 22.43  ? 49   PRO A N     1 
ATOM   291  C  CA    . PRO A 1 49  ? 127.750 30.829 -23.149 1.00 20.74  ? 49   PRO A CA    1 
ATOM   292  C  C     . PRO A 1 49  ? 127.331 29.488 -23.716 1.00 24.50  ? 49   PRO A C     1 
ATOM   293  O  O     . PRO A 1 49  ? 126.294 28.959 -23.334 1.00 26.55  ? 49   PRO A O     1 
ATOM   294  C  CB    . PRO A 1 49  ? 127.476 32.016 -24.062 1.00 24.59  ? 49   PRO A CB    1 
ATOM   295  C  CG    . PRO A 1 49  ? 128.594 32.965 -23.775 1.00 22.72  ? 49   PRO A CG    1 
ATOM   296  C  CD    . PRO A 1 49  ? 129.766 32.030 -23.655 1.00 18.49  ? 49   PRO A CD    1 
ATOM   297  N  N     . GLU A 1 50  ? 128.133 28.930 -24.620 1.00 22.32  ? 50   GLU A N     1 
ATOM   298  C  CA    . GLU A 1 50  ? 127.781 27.636 -25.196 1.00 23.87  ? 50   GLU A CA    1 
ATOM   299  C  C     . GLU A 1 50  ? 128.031 26.498 -24.210 1.00 32.41  ? 50   GLU A C     1 
ATOM   300  O  O     . GLU A 1 50  ? 127.636 25.359 -24.465 1.00 35.79  ? 50   GLU A O     1 
ATOM   301  C  CB    . GLU A 1 50  ? 128.282 27.314 -26.630 1.00 26.22  ? 50   GLU A CB    1 
ATOM   302  C  CG    . GLU A 1 50  ? 127.740 28.170 -27.820 1.00 65.19  ? 50   GLU A CG    1 
ATOM   303  C  CD    . GLU A 1 50  ? 126.293 27.838 -28.386 1.00 100.00 ? 50   GLU A CD    1 
ATOM   304  O  OE1   . GLU A 1 50  ? 126.119 27.876 -29.639 1.00 100.00 ? 50   GLU A OE1   1 
ATOM   305  O  OE2   . GLU A 1 50  ? 125.343 27.600 -27.593 1.00 100.00 ? 50   GLU A OE2   1 
ATOM   306  N  N     . GLN A 1 51  ? 128.675 26.801 -23.085 1.00 22.22  ? 51   GLN A N     1 
ATOM   307  C  CA    . GLN A 1 51  ? 128.949 25.770 -22.089 1.00 15.17  ? 51   GLN A CA    1 
ATOM   308  C  C     . GLN A 1 51  ? 127.995 25.848 -20.916 1.00 19.11  ? 51   GLN A C     1 
ATOM   309  O  O     . GLN A 1 51  ? 128.072 25.038 -20.008 1.00 22.13  ? 51   GLN A O     1 
ATOM   310  C  CB    . GLN A 1 51  ? 130.345 25.809 -21.522 1.00 10.87  ? 51   GLN A CB    1 
ATOM   311  C  CG    . GLN A 1 51  ? 131.364 25.663 -22.536 1.00 12.11  ? 51   GLN A CG    1 
ATOM   312  C  CD    . GLN A 1 51  ? 132.718 25.894 -21.978 1.00 23.45  ? 51   GLN A CD    1 
ATOM   313  O  OE1   . GLN A 1 51  ? 133.022 26.951 -21.361 1.00 13.94  ? 51   GLN A OE1   1 
ATOM   314  N  NE2   . GLN A 1 51  ? 133.577 24.898 -22.184 1.00 7.44   ? 51   GLN A NE2   1 
ATOM   315  N  N     . MET A 1 52  ? 127.100 26.812 -20.921 1.00 17.63  ? 52   MET A N     1 
ATOM   316  C  CA    . MET A 1 52  ? 126.161 26.924 -19.814 1.00 19.55  ? 52   MET A CA    1 
ATOM   317  C  C     . MET A 1 52  ? 125.190 25.744 -19.782 1.00 28.20  ? 52   MET A C     1 
ATOM   318  O  O     . MET A 1 52  ? 124.528 25.502 -18.776 1.00 28.31  ? 52   MET A O     1 
ATOM   319  C  CB    . MET A 1 52  ? 125.369 28.239 -19.879 1.00 20.51  ? 52   MET A CB    1 
ATOM   320  C  CG    . MET A 1 52  ? 126.104 29.508 -19.420 1.00 23.09  ? 52   MET A CG    1 
ATOM   321  S  SD    . MET A 1 52  ? 126.857 29.527 -17.759 1.00 26.55  ? 52   MET A SD    1 
ATOM   322  C  CE    . MET A 1 52  ? 125.490 29.921 -16.677 1.00 22.82  ? 52   MET A CE    1 
ATOM   323  N  N     . ARG A 1 53  ? 125.104 25.007 -20.877 1.00 23.47  ? 53   ARG A N     1 
ATOM   324  C  CA    . ARG A 1 53  ? 124.197 23.870 -20.939 1.00 23.14  ? 53   ARG A CA    1 
ATOM   325  C  C     . ARG A 1 53  ? 124.570 22.718 -20.001 1.00 28.02  ? 53   ARG A C     1 
ATOM   326  O  O     . ARG A 1 53  ? 123.684 22.022 -19.504 1.00 29.63  ? 53   ARG A O     1 
ATOM   327  C  CB    . ARG A 1 53  ? 124.154 23.374 -22.359 1.00 28.87  ? 53   ARG A CB    1 
ATOM   328  C  CG    . ARG A 1 53  ? 122.867 22.767 -22.774 1.00 54.81  ? 53   ARG A CG    1 
ATOM   329  C  CD    . ARG A 1 53  ? 123.151 21.810 -23.898 1.00 83.63  ? 53   ARG A CD    1 
ATOM   330  N  NE    . ARG A 1 53  ? 122.028 21.673 -24.813 1.00 97.73  ? 53   ARG A NE    1 
ATOM   331  C  CZ    . ARG A 1 53  ? 121.509 20.504 -25.178 1.00 100.00 ? 53   ARG A CZ    1 
ATOM   332  N  NH1   . ARG A 1 53  ? 122.009 19.364 -24.704 1.00 100.00 ? 53   ARG A NH1   1 
ATOM   333  N  NH2   . ARG A 1 53  ? 120.485 20.478 -26.022 1.00 100.00 ? 53   ARG A NH2   1 
ATOM   334  N  N     . ILE A 1 54  ? 125.872 22.520 -19.768 1.00 19.16  ? 54   ILE A N     1 
ATOM   335  C  CA    . ILE A 1 54  ? 126.373 21.448 -18.906 1.00 18.46  ? 54   ILE A CA    1 
ATOM   336  C  C     . ILE A 1 54  ? 125.661 21.325 -17.560 1.00 27.35  ? 54   ILE A C     1 
ATOM   337  O  O     . ILE A 1 54  ? 125.359 20.215 -17.110 1.00 26.32  ? 54   ILE A O     1 
ATOM   338  C  CB    . ILE A 1 54  ? 127.977 21.338 -18.686 1.00 24.24  ? 54   ILE A CB    1 
ATOM   339  C  CG1   . ILE A 1 54  ? 128.669 22.618 -18.320 1.00 24.17  ? 54   ILE A CG1   1 
ATOM   340  C  CG2   . ILE A 1 54  ? 128.739 21.123 -19.939 1.00 22.58  ? 54   ILE A CG2   1 
ATOM   341  C  CD1   . ILE A 1 54  ? 127.830 23.614 -17.620 1.00 56.20  ? 54   ILE A CD1   1 
ATOM   342  N  N     . TYR A 1 55  ? 125.400 22.452 -16.913 1.00 22.07  ? 55   TYR A N     1 
ATOM   343  C  CA    . TYR A 1 55  ? 124.747 22.443 -15.615 1.00 24.07  ? 55   TYR A CA    1 
ATOM   344  C  C     . TYR A 1 55  ? 123.482 21.607 -15.561 1.00 28.85  ? 55   TYR A C     1 
ATOM   345  O  O     . TYR A 1 55  ? 123.184 20.998 -14.532 1.00 30.23  ? 55   TYR A O     1 
ATOM   346  C  CB    . TYR A 1 55  ? 124.822 23.734 -14.822 1.00 26.20  ? 55   TYR A CB    1 
ATOM   347  C  CG    . TYR A 1 55  ? 126.210 24.384 -14.843 1.00 27.80  ? 55   TYR A CG    1 
ATOM   348  C  CD1   . TYR A 1 55  ? 126.451 25.477 -15.658 1.00 23.72  ? 55   TYR A CD1   1 
ATOM   349  C  CD2   . TYR A 1 55  ? 127.269 23.905 -14.049 1.00 29.46  ? 55   TYR A CD2   1 
ATOM   350  C  CE1   . TYR A 1 55  ? 127.690 26.084 -15.689 1.00 21.61  ? 55   TYR A CE1   1 
ATOM   351  C  CE2   . TYR A 1 55  ? 128.523 24.508 -14.082 1.00 29.82  ? 55   TYR A CE2   1 
ATOM   352  C  CZ    . TYR A 1 55  ? 128.728 25.611 -14.907 1.00 31.62  ? 55   TYR A CZ    1 
ATOM   353  O  OH    . TYR A 1 55  ? 129.954 26.254 -14.995 1.00 28.36  ? 55   TYR A OH    1 
ATOM   354  N  N     . SER A 1 56  ? 122.749 21.569 -16.661 1.00 28.23  ? 56   SER A N     1 
ATOM   355  C  CA    . SER A 1 56  ? 121.516 20.794 -16.710 1.00 31.43  ? 56   SER A CA    1 
ATOM   356  C  C     . SER A 1 56  ? 121.775 19.365 -17.180 1.00 42.62  ? 56   SER A C     1 
ATOM   357  O  O     . SER A 1 56  ? 121.523 18.390 -16.464 1.00 49.42  ? 56   SER A O     1 
ATOM   358  C  CB    . SER A 1 56  ? 120.533 21.525 -17.614 1.00 35.78  ? 56   SER A CB    1 
ATOM   359  O  OG    . SER A 1 56  ? 120.933 22.891 -17.705 1.00 59.92  ? 56   SER A OG    1 
ATOM   360  N  N     . THR A 1 57  ? 122.290 19.255 -18.384 1.00 27.56  ? 57   THR A N     1 
ATOM   361  C  CA    . THR A 1 57  ? 122.598 17.973 -18.985 1.00 25.36  ? 57   THR A CA    1 
ATOM   362  C  C     . THR A 1 57  ? 123.379 17.034 -18.059 1.00 23.26  ? 57   THR A C     1 
ATOM   363  O  O     . THR A 1 57  ? 123.533 15.860 -18.372 1.00 25.99  ? 57   THR A O     1 
ATOM   364  C  CB    . THR A 1 57  ? 123.577 18.424 -20.014 1.00 31.56  ? 57   THR A CB    1 
ATOM   365  O  OG1   . THR A 1 57  ? 123.908 19.745 -19.632 1.00 27.66  ? 57   THR A OG1   1 
ATOM   366  C  CG2   . THR A 1 57  ? 122.928 18.559 -21.374 1.00 26.05  ? 57   THR A CG2   1 
ATOM   367  N  N     . LEU A 1 58  ? 123.874 17.537 -16.930 1.00 16.86  ? 58   LEU A N     1 
ATOM   368  C  CA    . LEU A 1 58  ? 124.652 16.713 -15.992 1.00 18.13  ? 58   LEU A CA    1 
ATOM   369  C  C     . LEU A 1 58  ? 123.833 15.671 -15.218 1.00 22.53  ? 58   LEU A C     1 
ATOM   370  O  O     . LEU A 1 58  ? 124.352 14.598 -14.873 1.00 14.86  ? 58   LEU A O     1 
ATOM   371  C  CB    . LEU A 1 58  ? 125.350 17.618 -14.992 1.00 18.43  ? 58   LEU A CB    1 
ATOM   372  C  CG    . LEU A 1 58  ? 126.811 18.007 -15.160 1.00 28.41  ? 58   LEU A CG    1 
ATOM   373  C  CD1   . LEU A 1 58  ? 127.553 17.780 -13.854 1.00 28.80  ? 58   LEU A CD1   1 
ATOM   374  C  CD2   . LEU A 1 58  ? 127.454 17.264 -16.317 1.00 39.74  ? 58   LEU A CD2   1 
ATOM   375  N  N     . ASP A 1 59  ? 122.562 16.012 -14.952 1.00 25.03  ? 59   ASP A N     1 
ATOM   376  C  CA    . ASP A 1 59  ? 121.601 15.172 -14.215 1.00 26.01  ? 59   ASP A CA    1 
ATOM   377  C  C     . ASP A 1 59  ? 121.514 13.764 -14.784 1.00 25.34  ? 59   ASP A C     1 
ATOM   378  O  O     . ASP A 1 59  ? 121.306 12.798 -14.048 1.00 19.38  ? 59   ASP A O     1 
ATOM   379  C  CB    . ASP A 1 59  ? 120.164 15.783 -14.184 1.00 27.55  ? 59   ASP A CB    1 
ATOM   380  C  CG    . ASP A 1 59  ? 119.873 16.681 -12.950 1.00 31.54  ? 59   ASP A CG    1 
ATOM   381  O  OD1   . ASP A 1 59  ? 120.723 16.883 -12.056 1.00 33.57  ? 59   ASP A OD1   1 
ATOM   382  O  OD2   . ASP A 1 59  ? 118.743 17.190 -12.855 1.00 30.80  ? 59   ASP A OD2   1 
ATOM   383  N  N     . GLN A 1 60  ? 121.672 13.644 -16.093 1.00 18.11  ? 60   GLN A N     1 
ATOM   384  C  CA    . GLN A 1 60  ? 121.619 12.330 -16.703 1.00 15.08  ? 60   GLN A CA    1 
ATOM   385  C  C     . GLN A 1 60  ? 122.842 11.523 -16.332 1.00 22.56  ? 60   GLN A C     1 
ATOM   386  O  O     . GLN A 1 60  ? 123.114 10.501 -16.948 1.00 33.51  ? 60   GLN A O     1 
ATOM   387  C  CB    . GLN A 1 60  ? 121.734 12.406 -18.192 1.00 14.27  ? 60   GLN A CB    1 
ATOM   388  C  CG    . GLN A 1 60  ? 123.028 12.894 -18.667 1.00 54.97  ? 60   GLN A CG    1 
ATOM   389  C  CD    . GLN A 1 60  ? 122.908 13.130 -20.138 1.00 95.58  ? 60   GLN A CD    1 
ATOM   390  O  OE1   . GLN A 1 60  ? 121.809 13.012 -20.688 1.00 84.92  ? 60   GLN A OE1   1 
ATOM   391  N  NE2   . GLN A 1 60  ? 124.012 13.433 -20.802 1.00 89.62  ? 60   GLN A NE2   1 
ATOM   392  N  N     . PHE A 1 61  ? 123.586 11.981 -15.336 1.00 18.17  ? 61   PHE A N     1 
ATOM   393  C  CA    . PHE A 1 61  ? 124.785 11.278 -14.913 1.00 15.24  ? 61   PHE A CA    1 
ATOM   394  C  C     . PHE A 1 61  ? 124.852 11.089 -13.402 1.00 27.07  ? 61   PHE A C     1 
ATOM   395  O  O     . PHE A 1 61  ? 125.939 10.845 -12.874 1.00 26.29  ? 61   PHE A O     1 
ATOM   396  C  CB    . PHE A 1 61  ? 126.004 12.101 -15.303 1.00 13.42  ? 61   PHE A CB    1 
ATOM   397  C  CG    . PHE A 1 61  ? 126.223 12.201 -16.762 1.00 14.63  ? 61   PHE A CG    1 
ATOM   398  C  CD1   . PHE A 1 61  ? 125.770 13.285 -17.463 1.00 20.49  ? 61   PHE A CD1   1 
ATOM   399  C  CD2   . PHE A 1 61  ? 126.877 11.191 -17.450 1.00 16.59  ? 61   PHE A CD2   1 
ATOM   400  C  CE1   . PHE A 1 61  ? 125.993 13.349 -18.830 1.00 23.49  ? 61   PHE A CE1   1 
ATOM   401  C  CE2   . PHE A 1 61  ? 127.085 11.243 -18.815 1.00 16.30  ? 61   PHE A CE2   1 
ATOM   402  C  CZ    . PHE A 1 61  ? 126.649 12.328 -19.508 1.00 17.56  ? 61   PHE A CZ    1 
ATOM   403  N  N     . ASN A 1 62  ? 123.705 11.210 -12.719 1.00 26.20  ? 62   ASN A N     1 
ATOM   404  C  CA    . ASN A 1 62  ? 123.624 11.050 -11.260 1.00 25.48  ? 62   ASN A CA    1 
ATOM   405  C  C     . ASN A 1 62  ? 124.762 11.767 -10.521 1.00 25.24  ? 62   ASN A C     1 
ATOM   406  O  O     . ASN A 1 62  ? 125.524 11.178 -9.753  1.00 19.37  ? 62   ASN A O     1 
ATOM   407  C  CB    . ASN A 1 62  ? 123.443 9.585  -10.892 1.00 19.36  ? 62   ASN A CB    1 
ATOM   408  C  CG    . ASN A 1 62  ? 122.204 9.021  -11.521 1.00 31.23  ? 62   ASN A CG    1 
ATOM   409  O  OD1   . ASN A 1 62  ? 122.170 7.893  -11.988 1.00 23.19  ? 62   ASN A OD1   1 
ATOM   410  N  ND2   . ASN A 1 62  ? 121.179 9.848  -11.589 1.00 13.87  ? 62   ASN A ND2   1 
ATOM   411  N  N     . PRO A 1 63  ? 124.872 13.048 -10.767 1.00 13.29  ? 63   PRO A N     1 
ATOM   412  C  CA    . PRO A 1 63  ? 125.904 13.836 -10.146 1.00 9.34   ? 63   PRO A CA    1 
ATOM   413  C  C     . PRO A 1 63  ? 125.733 13.908 -8.643  1.00 12.25  ? 63   PRO A C     1 
ATOM   414  O  O     . PRO A 1 63  ? 124.666 13.654 -8.095  1.00 4.56   ? 63   PRO A O     1 
ATOM   415  C  CB    . PRO A 1 63  ? 125.574 15.217 -10.650 1.00 12.99  ? 63   PRO A CB    1 
ATOM   416  C  CG    . PRO A 1 63  ? 124.135 15.148 -11.066 1.00 19.19  ? 63   PRO A CG    1 
ATOM   417  C  CD    . PRO A 1 63  ? 124.040 13.827 -11.683 1.00 14.39  ? 63   PRO A CD    1 
ATOM   418  N  N     . THR A 1 64  ? 126.811 14.259 -7.985  1.00 18.63  ? 64   THR A N     1 
ATOM   419  C  CA    . THR A 1 64  ? 126.800 14.390 -6.551  1.00 20.02  ? 64   THR A CA    1 
ATOM   420  C  C     . THR A 1 64  ? 126.900 15.876 -6.235  1.00 24.03  ? 64   THR A C     1 
ATOM   421  O  O     . THR A 1 64  ? 127.302 16.660 -7.092  1.00 26.43  ? 64   THR A O     1 
ATOM   422  C  CB    . THR A 1 64  ? 127.778 13.443 -5.986  1.00 22.79  ? 64   THR A CB    1 
ATOM   423  O  OG1   . THR A 1 64  ? 127.094 12.530 -5.120  1.00 35.58  ? 64   THR A OG1   1 
ATOM   424  C  CG2   . THR A 1 64  ? 128.786 14.222 -5.302  1.00 1.00   ? 64   THR A CG2   1 
ATOM   425  N  N     . SER A 1 65  ? 126.532 16.305 -5.047  1.00 17.01  ? 65   SER A N     1 
ATOM   426  C  CA    . SER A 1 65  ? 126.642 17.735 -4.820  1.00 10.91  ? 65   SER A CA    1 
ATOM   427  C  C     . SER A 1 65  ? 127.230 18.078 -3.467  1.00 18.42  ? 65   SER A C     1 
ATOM   428  O  O     . SER A 1 65  ? 126.965 17.392 -2.478  1.00 17.98  ? 65   SER A O     1 
ATOM   429  C  CB    . SER A 1 65  ? 125.379 18.461 -5.218  1.00 10.66  ? 65   SER A CB    1 
ATOM   430  O  OG    . SER A 1 65  ? 124.759 18.964 -4.060  1.00 57.43  ? 65   SER A OG    1 
ATOM   431  N  N     . LEU A 1 66  ? 128.044 19.141 -3.430  1.00 20.20  ? 66   LEU A N     1 
ATOM   432  C  CA    . LEU A 1 66  ? 128.679 19.570 -2.175  1.00 16.42  ? 66   LEU A CA    1 
ATOM   433  C  C     . LEU A 1 66  ? 129.426 20.905 -2.279  1.00 17.07  ? 66   LEU A C     1 
ATOM   434  O  O     . LEU A 1 66  ? 129.711 21.414 -3.364  1.00 12.98  ? 66   LEU A O     1 
ATOM   435  C  CB    . LEU A 1 66  ? 129.678 18.500 -1.660  1.00 11.05  ? 66   LEU A CB    1 
ATOM   436  C  CG    . LEU A 1 66  ? 130.930 18.287 -2.559  1.00 13.56  ? 66   LEU A CG    1 
ATOM   437  C  CD1   . LEU A 1 66  ? 132.018 17.395 -1.954  1.00 2.46   ? 66   LEU A CD1   1 
ATOM   438  C  CD2   . LEU A 1 66  ? 130.546 17.748 -3.931  1.00 28.99  ? 66   LEU A CD2   1 
ATOM   439  N  N     . PRO A 1 67  ? 129.748 21.463 -1.121  1.00 18.16  ? 67   PRO A N     1 
ATOM   440  C  CA    . PRO A 1 67  ? 130.471 22.719 -1.065  1.00 18.33  ? 67   PRO A CA    1 
ATOM   441  C  C     . PRO A 1 67  ? 131.761 22.617 -1.877  1.00 18.18  ? 67   PRO A C     1 
ATOM   442  O  O     . PRO A 1 67  ? 132.477 21.610 -1.812  1.00 13.58  ? 67   PRO A O     1 
ATOM   443  C  CB    . PRO A 1 67  ? 130.937 22.790 0.408   1.00 20.71  ? 67   PRO A CB    1 
ATOM   444  C  CG    . PRO A 1 67  ? 130.005 21.914 1.152   1.00 25.33  ? 67   PRO A CG    1 
ATOM   445  C  CD    . PRO A 1 67  ? 129.573 20.848 0.203   1.00 19.97  ? 67   PRO A CD    1 
ATOM   446  N  N     . GLY A 1 68  ? 132.045 23.668 -2.634  1.00 9.38   ? 68   GLY A N     1 
ATOM   447  C  CA    . GLY A 1 68  ? 133.232 23.742 -3.461  1.00 10.73  ? 68   GLY A CA    1 
ATOM   448  C  C     . GLY A 1 68  ? 134.004 25.019 -3.132  1.00 16.53  ? 68   GLY A C     1 
ATOM   449  O  O     . GLY A 1 68  ? 133.859 25.575 -2.039  1.00 10.42  ? 68   GLY A O     1 
ATOM   450  N  N     . GLY A 1 69  ? 134.822 25.483 -4.080  1.00 7.87   ? 69   GLY A N     1 
ATOM   451  C  CA    . GLY A 1 69  ? 135.611 26.690 -3.874  1.00 2.59   ? 69   GLY A CA    1 
ATOM   452  C  C     . GLY A 1 69  ? 136.962 26.291 -3.303  1.00 15.71  ? 69   GLY A C     1 
ATOM   453  O  O     . GLY A 1 69  ? 137.052 25.762 -2.185  1.00 15.69  ? 69   GLY A O     1 
ATOM   454  N  N     . SER A 1 70  ? 138.002 26.544 -4.087  1.00 10.71  ? 70   SER A N     1 
ATOM   455  C  CA    . SER A 1 70  ? 139.385 26.223 -3.732  1.00 12.24  ? 70   SER A CA    1 
ATOM   456  C  C     . SER A 1 70  ? 139.795 26.604 -2.295  1.00 10.25  ? 70   SER A C     1 
ATOM   457  O  O     . SER A 1 70  ? 140.096 25.734 -1.471  1.00 18.79  ? 70   SER A O     1 
ATOM   458  C  CB    . SER A 1 70  ? 140.260 26.789 -4.830  1.00 13.25  ? 70   SER A CB    1 
ATOM   459  O  OG    . SER A 1 70  ? 141.565 26.437 -4.591  1.00 8.84   ? 70   SER A OG    1 
ATOM   460  N  N     . ALA A 1 71  ? 139.824 27.899 -1.997  1.00 3.07   ? 71   ALA A N     1 
ATOM   461  C  CA    . ALA A 1 71  ? 140.203 28.390 -0.673  1.00 5.65   ? 71   ALA A CA    1 
ATOM   462  C  C     . ALA A 1 71  ? 139.285 27.869 0.427   1.00 11.31  ? 71   ALA A C     1 
ATOM   463  O  O     . ALA A 1 71  ? 139.736 27.581 1.539   1.00 10.16  ? 71   ALA A O     1 
ATOM   464  C  CB    . ALA A 1 71  ? 140.176 29.895 -0.662  1.00 5.89   ? 71   ALA A CB    1 
ATOM   465  N  N     . LEU A 1 72  ? 137.996 27.764 0.105   1.00 11.33  ? 72   LEU A N     1 
ATOM   466  C  CA    . LEU A 1 72  ? 137.009 27.268 1.064   1.00 12.39  ? 72   LEU A CA    1 
ATOM   467  C  C     . LEU A 1 72  ? 137.414 25.887 1.523   1.00 13.31  ? 72   LEU A C     1 
ATOM   468  O  O     . LEU A 1 72  ? 137.390 25.554 2.710   1.00 12.65  ? 72   LEU A O     1 
ATOM   469  C  CB    . LEU A 1 72  ? 135.578 27.233 0.491   1.00 10.17  ? 72   LEU A CB    1 
ATOM   470  C  CG    . LEU A 1 72  ? 134.393 27.179 1.485   1.00 10.00  ? 72   LEU A CG    1 
ATOM   471  C  CD1   . LEU A 1 72  ? 134.678 27.924 2.785   1.00 17.64  ? 72   LEU A CD1   1 
ATOM   472  C  CD2   . LEU A 1 72  ? 133.182 27.767 0.819   1.00 7.66   ? 72   LEU A CD2   1 
ATOM   473  N  N     . ASN A 1 73  ? 137.807 25.078 0.572   1.00 3.89   ? 73   ASN A N     1 
ATOM   474  C  CA    . ASN A 1 73  ? 138.225 23.741 0.923   1.00 6.80   ? 73   ASN A CA    1 
ATOM   475  C  C     . ASN A 1 73  ? 139.455 23.808 1.836   1.00 18.93  ? 73   ASN A C     1 
ATOM   476  O  O     . ASN A 1 73  ? 139.527 23.112 2.844   1.00 23.95  ? 73   ASN A O     1 
ATOM   477  C  CB    . ASN A 1 73  ? 138.604 23.134 -0.399  1.00 11.55  ? 73   ASN A CB    1 
ATOM   478  C  CG    . ASN A 1 73  ? 137.432 22.784 -1.185  1.00 22.98  ? 73   ASN A CG    1 
ATOM   479  O  OD1   . ASN A 1 73  ? 136.407 22.447 -0.595  1.00 27.98  ? 73   ASN A OD1   1 
ATOM   480  N  ND2   . ASN A 1 73  ? 137.563 22.755 -2.531  1.00 5.72   ? 73   ASN A ND2   1 
ATOM   481  N  N     . SER A 1 74  ? 140.420 24.655 1.470   1.00 16.38  ? 74   SER A N     1 
ATOM   482  C  CA    . SER A 1 74  ? 141.659 24.824 2.236   1.00 17.26  ? 74   SER A CA    1 
ATOM   483  C  C     . SER A 1 74  ? 141.416 25.253 3.681   1.00 13.39  ? 74   SER A C     1 
ATOM   484  O  O     . SER A 1 74  ? 141.892 24.603 4.613   1.00 6.70   ? 74   SER A O     1 
ATOM   485  C  CB    . SER A 1 74  ? 142.718 25.641 1.473   1.00 15.49  ? 74   SER A CB    1 
ATOM   486  O  OG    . SER A 1 74  ? 143.035 24.960 0.253   1.00 11.33  ? 74   SER A OG    1 
ATOM   487  N  N     . VAL A 1 75  ? 140.680 26.342 3.874   1.00 8.51   ? 75   VAL A N     1 
ATOM   488  C  CA    . VAL A 1 75  ? 140.405 26.795 5.228   1.00 6.81   ? 75   VAL A CA    1 
ATOM   489  C  C     . VAL A 1 75  ? 139.620 25.718 5.968   1.00 7.76   ? 75   VAL A C     1 
ATOM   490  O  O     . VAL A 1 75  ? 139.724 25.569 7.188   1.00 7.03   ? 75   VAL A O     1 
ATOM   491  C  CB    . VAL A 1 75  ? 139.688 28.118 5.214   1.00 10.96  ? 75   VAL A CB    1 
ATOM   492  C  CG1   . VAL A 1 75  ? 140.573 29.111 4.534   1.00 12.51  ? 75   VAL A CG1   1 
ATOM   493  C  CG2   . VAL A 1 75  ? 138.341 28.114 4.578   1.00 11.99  ? 75   VAL A CG2   1 
ATOM   494  N  N     . ARG A 1 76  ? 138.842 24.957 5.203   1.00 5.08   ? 76   ARG A N     1 
ATOM   495  C  CA    . ARG A 1 76  ? 138.043 23.882 5.773   1.00 8.38   ? 76   ARG A CA    1 
ATOM   496  C  C     . ARG A 1 76  ? 138.958 22.843 6.387   1.00 20.24  ? 76   ARG A C     1 
ATOM   497  O  O     . ARG A 1 76  ? 138.736 22.384 7.515   1.00 25.70  ? 76   ARG A O     1 
ATOM   498  C  CB    . ARG A 1 76  ? 136.894 23.357 4.872   1.00 1.00   ? 76   ARG A CB    1 
ATOM   499  C  CG    . ARG A 1 76  ? 135.704 24.348 4.888   1.00 22.85  ? 76   ARG A CG    1 
ATOM   500  C  CD    . ARG A 1 76  ? 134.339 23.754 4.606   1.00 16.55  ? 76   ARG A CD    1 
ATOM   501  N  NE    . ARG A 1 76  ? 134.337 23.320 3.245   1.00 1.31   ? 76   ARG A NE    1 
ATOM   502  C  CZ    . ARG A 1 76  ? 134.042 22.096 2.856   1.00 10.88  ? 76   ARG A CZ    1 
ATOM   503  N  NH1   . ARG A 1 76  ? 133.682 21.197 3.742   1.00 20.67  ? 76   ARG A NH1   1 
ATOM   504  N  NH2   . ARG A 1 76  ? 134.093 21.785 1.577   1.00 35.39  ? 76   ARG A NH2   1 
ATOM   505  N  N     . VAL A 1 77  ? 139.997 22.480 5.641   1.00 11.04  ? 77   VAL A N     1 
ATOM   506  C  CA    . VAL A 1 77  ? 140.939 21.502 6.153   1.00 11.12  ? 77   VAL A CA    1 
ATOM   507  C  C     . VAL A 1 77  ? 141.562 22.089 7.411   1.00 24.24  ? 77   VAL A C     1 
ATOM   508  O  O     . VAL A 1 77  ? 141.788 21.407 8.406   1.00 30.34  ? 77   VAL A O     1 
ATOM   509  C  CB    . VAL A 1 77  ? 142.100 21.270 5.171   1.00 17.04  ? 77   VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 77  ? 143.211 20.496 5.855   1.00 20.16  ? 77   VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 77  ? 141.643 20.545 3.917   1.00 14.77  ? 77   VAL A CG2   1 
ATOM   512  N  N     . VAL A 1 78  ? 141.831 23.375 7.368   1.00 19.42  ? 78   VAL A N     1 
ATOM   513  C  CA    . VAL A 1 78  ? 142.424 24.019 8.517   1.00 18.91  ? 78   VAL A CA    1 
ATOM   514  C  C     . VAL A 1 78  ? 141.551 23.861 9.758   1.00 20.44  ? 78   VAL A C     1 
ATOM   515  O  O     . VAL A 1 78  ? 141.988 23.286 10.752  1.00 15.39  ? 78   VAL A O     1 
ATOM   516  C  CB    . VAL A 1 78  ? 142.833 25.442 8.172   1.00 16.18  ? 78   VAL A CB    1 
ATOM   517  C  CG1   . VAL A 1 78  ? 143.672 25.961 9.290   1.00 16.56  ? 78   VAL A CG1   1 
ATOM   518  C  CG2   . VAL A 1 78  ? 143.674 25.437 6.918   1.00 10.99  ? 78   VAL A CG2   1 
ATOM   519  N  N     . GLN A 1 79  ? 140.328 24.388 9.683   1.00 16.48  ? 79   GLN A N     1 
ATOM   520  C  CA    . GLN A 1 79  ? 139.374 24.319 10.779  1.00 17.41  ? 79   GLN A CA    1 
ATOM   521  C  C     . GLN A 1 79  ? 139.303 22.904 11.376  1.00 23.81  ? 79   GLN A C     1 
ATOM   522  O  O     . GLN A 1 79  ? 139.474 22.737 12.583  1.00 30.55  ? 79   GLN A O     1 
ATOM   523  C  CB    . GLN A 1 79  ? 138.036 24.834 10.239  1.00 17.65  ? 79   GLN A CB    1 
ATOM   524  C  CG    . GLN A 1 79  ? 136.861 25.402 11.163  1.00 11.19  ? 79   GLN A CG    1 
ATOM   525  C  CD    . GLN A 1 79  ? 137.252 25.879 12.549  1.00 20.73  ? 79   GLN A CD    1 
ATOM   526  O  OE1   . GLN A 1 79  ? 137.073 25.153 13.509  1.00 31.64  ? 79   GLN A OE1   1 
ATOM   527  N  NE2   . GLN A 1 79  ? 137.750 27.097 12.658  1.00 10.31  ? 79   GLN A NE2   1 
ATOM   528  N  N     . LYS A 1 80  ? 139.073 21.891 10.533  1.00 10.31  ? 80   LYS A N     1 
ATOM   529  C  CA    . LYS A 1 80  ? 138.988 20.511 11.005  1.00 9.65   ? 80   LYS A CA    1 
ATOM   530  C  C     . LYS A 1 80  ? 140.186 20.127 11.859  1.00 21.36  ? 80   LYS A C     1 
ATOM   531  O  O     . LYS A 1 80  ? 140.037 19.518 12.917  1.00 26.89  ? 80   LYS A O     1 
ATOM   532  C  CB    . LYS A 1 80  ? 138.816 19.510 9.873   1.00 21.33  ? 80   LYS A CB    1 
ATOM   533  C  CG    . LYS A 1 80  ? 138.549 18.079 10.338  1.00 51.76  ? 80   LYS A CG    1 
ATOM   534  C  CD    . LYS A 1 80  ? 137.192 17.565 9.867   1.00 76.09  ? 80   LYS A CD    1 
ATOM   535  C  CE    . LYS A 1 80  ? 136.247 17.203 11.013  1.00 100.00 ? 80   LYS A CE    1 
ATOM   536  N  NZ    . LYS A 1 80  ? 135.447 15.972 10.727  1.00 100.00 ? 80   LYS A NZ    1 
ATOM   537  N  N     . LEU A 1 81  ? 141.377 20.482 11.408  1.00 16.27  ? 81   LEU A N     1 
ATOM   538  C  CA    . LEU A 1 81  ? 142.576 20.148 12.165  1.00 18.03  ? 81   LEU A CA    1 
ATOM   539  C  C     . LEU A 1 81  ? 142.753 21.012 13.413  1.00 19.67  ? 81   LEU A C     1 
ATOM   540  O  O     . LEU A 1 81  ? 143.261 20.541 14.433  1.00 17.86  ? 81   LEU A O     1 
ATOM   541  C  CB    . LEU A 1 81  ? 143.857 20.103 11.309  1.00 19.00  ? 81   LEU A CB    1 
ATOM   542  C  CG    . LEU A 1 81  ? 143.878 19.256 10.024  1.00 20.41  ? 81   LEU A CG    1 
ATOM   543  C  CD1   . LEU A 1 81  ? 145.246 19.326 9.347   1.00 20.11  ? 81   LEU A CD1   1 
ATOM   544  C  CD2   . LEU A 1 81  ? 143.421 17.834 10.299  1.00 15.62  ? 81   LEU A CD2   1 
ATOM   545  N  N     . LEU A 1 82  ? 142.339 22.274 13.337  1.00 14.87  ? 82   LEU A N     1 
ATOM   546  C  CA    . LEU A 1 82  ? 142.475 23.172 14.477  1.00 9.28   ? 82   LEU A CA    1 
ATOM   547  C  C     . LEU A 1 82  ? 141.432 22.918 15.555  1.00 18.14  ? 82   LEU A C     1 
ATOM   548  O  O     . LEU A 1 82  ? 141.669 23.228 16.722  1.00 16.25  ? 82   LEU A O     1 
ATOM   549  C  CB    . LEU A 1 82  ? 142.572 24.616 14.094  1.00 7.39   ? 82   LEU A CB    1 
ATOM   550  C  CG    . LEU A 1 82  ? 143.984 25.169 13.898  1.00 11.70  ? 82   LEU A CG    1 
ATOM   551  C  CD1   . LEU A 1 82  ? 145.063 24.084 14.016  1.00 12.92  ? 82   LEU A CD1   1 
ATOM   552  C  CD2   . LEU A 1 82  ? 144.077 25.783 12.510  1.00 25.41  ? 82   LEU A CD2   1 
ATOM   553  N  N     . ARG A 1 83  ? 140.286 22.358 15.147  1.00 17.19  ? 83   ARG A N     1 
ATOM   554  C  CA    . ARG A 1 83  ? 139.173 22.027 16.045  1.00 18.73  ? 83   ARG A CA    1 
ATOM   555  C  C     . ARG A 1 83  ? 138.356 23.211 16.591  1.00 23.57  ? 83   ARG A C     1 
ATOM   556  O  O     . ARG A 1 83  ? 137.155 23.309 16.341  1.00 23.65  ? 83   ARG A O     1 
ATOM   557  C  CB    . ARG A 1 83  ? 139.624 21.093 17.172  1.00 26.24  ? 83   ARG A CB    1 
ATOM   558  C  CG    . ARG A 1 83  ? 140.267 19.791 16.715  1.00 48.59  ? 83   ARG A CG    1 
ATOM   559  C  CD    . ARG A 1 83  ? 140.141 18.712 17.800  1.00 61.37  ? 83   ARG A CD    1 
ATOM   560  N  NE    . ARG A 1 83  ? 139.475 17.493 17.331  1.00 41.14  ? 83   ARG A NE    1 
ATOM   561  C  CZ    . ARG A 1 83  ? 138.351 16.994 17.841  1.00 60.78  ? 83   ARG A CZ    1 
ATOM   562  N  NH1   . ARG A 1 83  ? 137.720 17.591 18.849  1.00 45.67  ? 83   ARG A NH1   1 
ATOM   563  N  NH2   . ARG A 1 83  ? 137.858 15.883 17.325  1.00 100.00 ? 83   ARG A NH2   1 
ATOM   564  N  N     . LYS A 1 84  ? 138.981 24.103 17.347  1.00 20.49  ? 84   LYS A N     1 
ATOM   565  C  CA    . LYS A 1 84  ? 138.259 25.244 17.914  1.00 20.79  ? 84   LYS A CA    1 
ATOM   566  C  C     . LYS A 1 84  ? 137.463 26.048 16.888  1.00 24.38  ? 84   LYS A C     1 
ATOM   567  O  O     . LYS A 1 84  ? 137.878 26.215 15.745  1.00 29.08  ? 84   LYS A O     1 
ATOM   568  C  CB    . LYS A 1 84  ? 139.151 26.087 18.790  1.00 24.03  ? 84   LYS A CB    1 
ATOM   569  C  CG    . LYS A 1 84  ? 139.376 25.446 20.135  1.00 32.52  ? 84   LYS A CG    1 
ATOM   570  C  CD    . LYS A 1 84  ? 140.526 24.473 20.062  1.00 30.15  ? 84   LYS A CD    1 
ATOM   571  C  CE    . LYS A 1 84  ? 141.475 24.751 21.202  1.00 34.45  ? 84   LYS A CE    1 
ATOM   572  N  NZ    . LYS A 1 84  ? 141.119 26.126 21.608  1.00 6.82   ? 84   LYS A NZ    1 
ATOM   573  N  N     . PRO A 1 85  ? 136.313 26.553 17.307  1.00 18.98  ? 85   PRO A N     1 
ATOM   574  C  CA    . PRO A 1 85  ? 135.455 27.333 16.420  1.00 15.91  ? 85   PRO A CA    1 
ATOM   575  C  C     . PRO A 1 85  ? 136.129 28.622 15.995  1.00 17.73  ? 85   PRO A C     1 
ATOM   576  O  O     . PRO A 1 85  ? 136.818 29.265 16.789  1.00 15.01  ? 85   PRO A O     1 
ATOM   577  C  CB    . PRO A 1 85  ? 134.245 27.637 17.274  1.00 11.25  ? 85   PRO A CB    1 
ATOM   578  C  CG    . PRO A 1 85  ? 134.668 27.311 18.670  1.00 16.27  ? 85   PRO A CG    1 
ATOM   579  C  CD    . PRO A 1 85  ? 135.639 26.198 18.557  1.00 13.47  ? 85   PRO A CD    1 
ATOM   580  N  N     . GLY A 1 86  ? 135.932 29.000 14.747  1.00 13.41  ? 86   GLY A N     1 
ATOM   581  C  CA    . GLY A 1 86  ? 136.546 30.226 14.282  1.00 13.42  ? 86   GLY A CA    1 
ATOM   582  C  C     . GLY A 1 86  ? 138.071 30.145 14.299  1.00 17.42  ? 86   GLY A C     1 
ATOM   583  O  O     . GLY A 1 86  ? 138.750 31.174 14.282  1.00 17.66  ? 86   GLY A O     1 
ATOM   584  N  N     . SER A 1 87  ? 138.613 28.934 14.251  1.00 11.44  ? 87   SER A N     1 
ATOM   585  C  CA    . SER A 1 87  ? 140.062 28.772 14.209  1.00 16.61  ? 87   SER A CA    1 
ATOM   586  C  C     . SER A 1 87  ? 140.524 29.260 12.838  1.00 25.66  ? 87   SER A C     1 
ATOM   587  O  O     . SER A 1 87  ? 141.671 29.640 12.646  1.00 28.34  ? 87   SER A O     1 
ATOM   588  C  CB    . SER A 1 87  ? 140.477 27.313 14.298  1.00 23.01  ? 87   SER A CB    1 
ATOM   589  O  OG    . SER A 1 87  ? 140.344 26.909 15.628  1.00 16.04  ? 87   SER A OG    1 
ATOM   590  N  N     . ALA A 1 88  ? 139.592 29.240 11.891  1.00 24.34  ? 88   ALA A N     1 
ATOM   591  C  CA    . ALA A 1 88  ? 139.820 29.687 10.520  1.00 21.12  ? 88   ALA A CA    1 
ATOM   592  C  C     . ALA A 1 88  ? 138.639 30.559 10.084  1.00 25.91  ? 88   ALA A C     1 
ATOM   593  O  O     . ALA A 1 88  ? 137.494 30.108 10.130  1.00 33.31  ? 88   ALA A O     1 
ATOM   594  C  CB    . ALA A 1 88  ? 139.873 28.465 9.622   1.00 20.10  ? 88   ALA A CB    1 
ATOM   595  N  N     . GLY A 1 89  ? 138.907 31.797 9.677   1.00 12.29  ? 89   GLY A N     1 
ATOM   596  C  CA    . GLY A 1 89  ? 137.852 32.722 9.242   1.00 12.76  ? 89   GLY A CA    1 
ATOM   597  C  C     . GLY A 1 89  ? 137.822 32.807 7.722   1.00 15.61  ? 89   GLY A C     1 
ATOM   598  O  O     . GLY A 1 89  ? 138.861 32.641 7.092   1.00 15.25  ? 89   GLY A O     1 
ATOM   599  N  N     . TYR A 1 90  ? 136.643 33.061 7.123   1.00 13.07  ? 90   TYR A N     1 
ATOM   600  C  CA    . TYR A 1 90  ? 136.539 33.140 5.655   1.00 10.60  ? 90   TYR A CA    1 
ATOM   601  C  C     . TYR A 1 90  ? 135.505 34.141 5.151   1.00 14.39  ? 90   TYR A C     1 
ATOM   602  O  O     . TYR A 1 90  ? 134.413 34.269 5.703   1.00 18.66  ? 90   TYR A O     1 
ATOM   603  C  CB    . TYR A 1 90  ? 136.203 31.781 5.029   1.00 8.69   ? 90   TYR A CB    1 
ATOM   604  C  CG    . TYR A 1 90  ? 135.919 31.713 3.516   1.00 14.15  ? 90   TYR A CG    1 
ATOM   605  C  CD1   . TYR A 1 90  ? 136.887 31.228 2.644   1.00 15.68  ? 90   TYR A CD1   1 
ATOM   606  C  CD2   . TYR A 1 90  ? 134.669 32.063 2.968   1.00 16.31  ? 90   TYR A CD2   1 
ATOM   607  C  CE1   . TYR A 1 90  ? 136.659 31.123 1.280   1.00 7.39   ? 90   TYR A CE1   1 
ATOM   608  C  CE2   . TYR A 1 90  ? 134.434 31.955 1.604   1.00 19.46  ? 90   TYR A CE2   1 
ATOM   609  C  CZ    . TYR A 1 90  ? 135.438 31.482 0.760   1.00 26.48  ? 90   TYR A CZ    1 
ATOM   610  O  OH    . TYR A 1 90  ? 135.228 31.361 -0.602  1.00 22.75  ? 90   TYR A OH    1 
ATOM   611  N  N     . MET A 1 91  ? 135.865 34.842 4.083   1.00 4.95   ? 91   MET A N     1 
ATOM   612  C  CA    . MET A 1 91  ? 134.983 35.824 3.486   1.00 5.05   ? 91   MET A CA    1 
ATOM   613  C  C     . MET A 1 91  ? 134.844 35.555 2.005   1.00 9.59   ? 91   MET A C     1 
ATOM   614  O  O     . MET A 1 91  ? 135.751 35.024 1.370   1.00 7.12   ? 91   MET A O     1 
ATOM   615  C  CB    . MET A 1 91  ? 135.379 37.264 3.775   1.00 9.08   ? 91   MET A CB    1 
ATOM   616  C  CG    . MET A 1 91  ? 135.298 37.623 5.247   1.00 15.04  ? 91   MET A CG    1 
ATOM   617  S  SD    . MET A 1 91  ? 135.448 39.424 5.466   1.00 23.09  ? 91   MET A SD    1 
ATOM   618  C  CE    . MET A 1 91  ? 135.313 39.612 7.254   1.00 19.98  ? 91   MET A CE    1 
ATOM   619  N  N     . GLY A 1 92  ? 133.699 35.917 1.473   1.00 11.39  ? 92   GLY A N     1 
ATOM   620  C  CA    . GLY A 1 92  ? 133.399 35.725 0.070   1.00 13.15  ? 92   GLY A CA    1 
ATOM   621  C  C     . GLY A 1 92  ? 131.955 36.112 -0.148  1.00 14.27  ? 92   GLY A C     1 
ATOM   622  O  O     . GLY A 1 92  ? 131.282 36.503 0.805   1.00 16.04  ? 92   GLY A O     1 
ATOM   623  N  N     . ALA A 1 93  ? 131.476 36.003 -1.383  1.00 14.65  ? 93   ALA A N     1 
ATOM   624  C  CA    . ALA A 1 93  ? 130.095 36.374 -1.695  1.00 14.83  ? 93   ALA A CA    1 
ATOM   625  C  C     . ALA A 1 93  ? 129.230 35.266 -2.278  1.00 16.40  ? 93   ALA A C     1 
ATOM   626  O  O     . ALA A 1 93  ? 129.543 34.717 -3.332  1.00 13.52  ? 93   ALA A O     1 
ATOM   627  C  CB    . ALA A 1 93  ? 130.156 37.452 -2.777  1.00 14.61  ? 93   ALA A CB    1 
ATOM   628  N  N     . ILE A 1 94  ? 128.128 34.964 -1.595  1.00 19.76  ? 94   ILE A N     1 
ATOM   629  C  CA    . ILE A 1 94  ? 127.181 33.937 -2.055  1.00 19.61  ? 94   ILE A CA    1 
ATOM   630  C  C     . ILE A 1 94  ? 125.949 34.649 -2.614  1.00 22.27  ? 94   ILE A C     1 
ATOM   631  O  O     . ILE A 1 94  ? 125.791 35.857 -2.423  1.00 22.01  ? 94   ILE A O     1 
ATOM   632  C  CB    . ILE A 1 94  ? 126.602 33.060 -0.946  1.00 16.88  ? 94   ILE A CB    1 
ATOM   633  C  CG1   . ILE A 1 94  ? 125.936 33.931 0.118   1.00 18.19  ? 94   ILE A CG1   1 
ATOM   634  C  CG2   . ILE A 1 94  ? 127.664 32.170 -0.365  1.00 18.91  ? 94   ILE A CG2   1 
ATOM   635  C  CD1   . ILE A 1 94  ? 125.403 33.175 1.317   1.00 31.92  ? 94   ILE A CD1   1 
ATOM   636  N  N     . GLY A 1 95  ? 125.073 33.938 -3.299  1.00 14.75  ? 95   GLY A N     1 
ATOM   637  C  CA    . GLY A 1 95  ? 123.889 34.608 -3.834  1.00 15.33  ? 95   GLY A CA    1 
ATOM   638  C  C     . GLY A 1 95  ? 122.785 34.664 -2.773  1.00 16.01  ? 95   GLY A C     1 
ATOM   639  O  O     . GLY A 1 95  ? 122.964 34.180 -1.655  1.00 11.44  ? 95   GLY A O     1 
ATOM   640  N  N     . ASP A 1 96  ? 121.647 35.259 -3.118  1.00 18.68  ? 96   ASP A N     1 
ATOM   641  C  CA    . ASP A 1 96  ? 120.519 35.353 -2.186  1.00 19.98  ? 96   ASP A CA    1 
ATOM   642  C  C     . ASP A 1 96  ? 119.512 34.287 -2.576  1.00 25.81  ? 96   ASP A C     1 
ATOM   643  O  O     . ASP A 1 96  ? 118.312 34.533 -2.649  1.00 34.99  ? 96   ASP A O     1 
ATOM   644  C  CB    . ASP A 1 96  ? 119.807 36.733 -2.109  1.00 18.26  ? 96   ASP A CB    1 
ATOM   645  C  CG    . ASP A 1 96  ? 119.216 37.211 -3.453  1.00 12.10  ? 96   ASP A CG    1 
ATOM   646  O  OD1   . ASP A 1 96  ? 118.585 38.298 -3.486  1.00 14.33  ? 96   ASP A OD1   1 
ATOM   647  O  OD2   . ASP A 1 96  ? 119.424 36.553 -4.489  1.00 15.43  ? 96   ASP A OD2   1 
ATOM   648  N  N     . ASP A 1 97  ? 120.035 33.099 -2.844  1.00 15.82  ? 97   ASP A N     1 
ATOM   649  C  CA    . ASP A 1 97  ? 119.229 31.961 -3.249  1.00 14.84  ? 97   ASP A CA    1 
ATOM   650  C  C     . ASP A 1 97  ? 119.421 30.828 -2.274  1.00 23.39  ? 97   ASP A C     1 
ATOM   651  O  O     . ASP A 1 97  ? 120.322 30.879 -1.434  1.00 18.82  ? 97   ASP A O     1 
ATOM   652  C  CB    . ASP A 1 97  ? 119.767 31.409 -4.549  1.00 13.09  ? 97   ASP A CB    1 
ATOM   653  C  CG    . ASP A 1 97  ? 121.259 31.296 -4.533  1.00 10.15  ? 97   ASP A CG    1 
ATOM   654  O  OD1   . ASP A 1 97  ? 121.775 31.112 -5.631  1.00 24.14  ? 97   ASP A OD1   1 
ATOM   655  O  OD2   . ASP A 1 97  ? 121.913 31.406 -3.454  1.00 3.12   ? 97   ASP A OD2   1 
ATOM   656  N  N     . PRO A 1 98  ? 118.577 29.813 -2.399  1.00 22.14  ? 98   PRO A N     1 
ATOM   657  C  CA    . PRO A 1 98  ? 118.655 28.661 -1.518  1.00 16.49  ? 98   PRO A CA    1 
ATOM   658  C  C     . PRO A 1 98  ? 120.076 28.092 -1.487  1.00 18.75  ? 98   PRO A C     1 
ATOM   659  O  O     . PRO A 1 98  ? 120.598 27.780 -0.416  1.00 18.42  ? 98   PRO A O     1 
ATOM   660  C  CB    . PRO A 1 98  ? 117.600 27.737 -2.094  1.00 14.84  ? 98   PRO A CB    1 
ATOM   661  C  CG    . PRO A 1 98  ? 116.639 28.692 -2.724  1.00 12.05  ? 98   PRO A CG    1 
ATOM   662  C  CD    . PRO A 1 98  ? 117.413 29.771 -3.312  1.00 15.08  ? 98   PRO A CD    1 
ATOM   663  N  N     . ARG A 1 99  ? 120.703 27.970 -2.657  1.00 11.88  ? 99   ARG A N     1 
ATOM   664  C  CA    . ARG A 1 99  ? 122.070 27.434 -2.767  1.00 9.79   ? 99   ARG A CA    1 
ATOM   665  C  C     . ARG A 1 99  ? 123.028 28.071 -1.774  1.00 17.52  ? 99   ARG A C     1 
ATOM   666  O  O     . ARG A 1 99  ? 123.741 27.382 -1.045  1.00 28.45  ? 99   ARG A O     1 
ATOM   667  C  CB    . ARG A 1 99  ? 122.625 27.743 -4.109  1.00 9.56   ? 99   ARG A CB    1 
ATOM   668  C  CG    . ARG A 1 99  ? 123.586 26.764 -4.633  1.00 20.21  ? 99   ARG A CG    1 
ATOM   669  C  CD    . ARG A 1 99  ? 123.937 27.154 -6.059  1.00 10.55  ? 99   ARG A CD    1 
ATOM   670  N  NE    . ARG A 1 99  ? 123.169 26.399 -7.028  1.00 17.21  ? 99   ARG A NE    1 
ATOM   671  C  CZ    . ARG A 1 99  ? 122.921 26.816 -8.258  1.00 42.25  ? 99   ARG A CZ    1 
ATOM   672  N  NH1   . ARG A 1 99  ? 123.373 27.995 -8.650  1.00 32.64  ? 99   ARG A NH1   1 
ATOM   673  N  NH2   . ARG A 1 99  ? 122.215 26.061 -9.090  1.00 42.83  ? 99   ARG A NH2   1 
ATOM   674  N  N     . GLY A 1 100 ? 123.045 29.387 -1.759  1.00 7.48   ? 100  GLY A N     1 
ATOM   675  C  CA    . GLY A 1 100 ? 123.914 30.099 -0.854  1.00 3.18   ? 100  GLY A CA    1 
ATOM   676  C  C     . GLY A 1 100 ? 123.519 29.798 0.582   1.00 14.63  ? 100  GLY A C     1 
ATOM   677  O  O     . GLY A 1 100 ? 124.344 29.840 1.489   1.00 22.62  ? 100  GLY A O     1 
ATOM   678  N  N     . GLN A 1 101 ? 122.264 29.493 0.820   1.00 11.62  ? 101  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 101 ? 121.914 29.217 2.198   1.00 14.73  ? 101  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 101 ? 122.510 27.908 2.649   1.00 26.90  ? 101  GLN A C     1 
ATOM   681  O  O     . GLN A 1 101 ? 123.007 27.781 3.776   1.00 26.02  ? 101  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 101 ? 120.481 29.416 2.536   1.00 16.63  ? 101  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 101 ? 120.302 30.779 3.229   1.00 69.70  ? 101  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 101 ? 121.312 31.034 4.377   1.00 74.87  ? 101  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 101 ? 121.563 30.130 5.215   1.00 48.19  ? 101  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 101 ? 121.884 32.279 4.427   1.00 23.71  ? 101  GLN A NE2   1 
ATOM   687  N  N     . VAL A 1 102 ? 122.458 26.946 1.745   1.00 18.58  ? 102  VAL A N     1 
ATOM   688  C  CA    . VAL A 1 102 ? 122.993 25.651 2.046   1.00 13.63  ? 102  VAL A CA    1 
ATOM   689  C  C     . VAL A 1 102 ? 124.475 25.749 2.282   1.00 17.75  ? 102  VAL A C     1 
ATOM   690  O  O     . VAL A 1 102 ? 124.968 25.271 3.299   1.00 20.27  ? 102  VAL A O     1 
ATOM   691  C  CB    . VAL A 1 102 ? 122.594 24.629 1.029   1.00 14.76  ? 102  VAL A CB    1 
ATOM   692  C  CG1   . VAL A 1 102 ? 123.730 23.599 0.829   1.00 16.11  ? 102  VAL A CG1   1 
ATOM   693  C  CG2   . VAL A 1 102 ? 121.311 24.000 1.553   1.00 7.33   ? 102  VAL A CG2   1 
ATOM   694  N  N     . LEU A 1 103 ? 125.172 26.381 1.347   1.00 14.73  ? 103  LEU A N     1 
ATOM   695  C  CA    . LEU A 1 103 ? 126.614 26.545 1.476   1.00 17.82  ? 103  LEU A CA    1 
ATOM   696  C  C     . LEU A 1 103 ? 126.977 27.147 2.844   1.00 21.05  ? 103  LEU A C     1 
ATOM   697  O  O     . LEU A 1 103 ? 127.864 26.634 3.534   1.00 17.13  ? 103  LEU A O     1 
ATOM   698  C  CB    . LEU A 1 103 ? 127.163 27.262 0.259   1.00 17.97  ? 103  LEU A CB    1 
ATOM   699  C  CG    . LEU A 1 103 ? 128.651 27.108 0.066   1.00 26.89  ? 103  LEU A CG    1 
ATOM   700  C  CD1   . LEU A 1 103 ? 128.990 27.404 -1.382  1.00 27.74  ? 103  LEU A CD1   1 
ATOM   701  C  CD2   . LEU A 1 103 ? 129.333 28.133 0.959   1.00 37.80  ? 103  LEU A CD2   1 
ATOM   702  N  N     . LYS A 1 104 ? 126.261 28.226 3.228   1.00 11.90  ? 104  LYS A N     1 
ATOM   703  C  CA    . LYS A 1 104 ? 126.454 28.933 4.507   1.00 13.35  ? 104  LYS A CA    1 
ATOM   704  C  C     . LYS A 1 104 ? 126.169 28.031 5.708   1.00 17.37  ? 104  LYS A C     1 
ATOM   705  O  O     . LYS A 1 104 ? 126.915 28.034 6.684   1.00 24.15  ? 104  LYS A O     1 
ATOM   706  C  CB    . LYS A 1 104 ? 125.572 30.213 4.615   1.00 20.07  ? 104  LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 104 ? 125.196 30.710 6.030   1.00 9.43   ? 104  LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 104 ? 125.974 31.938 6.495   1.00 17.77  ? 104  LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 104 ? 125.457 32.454 7.823   1.00 21.35  ? 104  LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 104 ? 126.167 31.879 9.002   1.00 28.75  ? 104  LYS A NZ    1 
ATOM   711  N  N     . GLU A 1 105 ? 125.092 27.263 5.642   1.00 14.78  ? 105  GLU A N     1 
ATOM   712  C  CA    . GLU A 1 105 ? 124.744 26.360 6.739   1.00 21.78  ? 105  GLU A CA    1 
ATOM   713  C  C     . GLU A 1 105 ? 125.880 25.368 6.969   1.00 18.74  ? 105  GLU A C     1 
ATOM   714  O  O     . GLU A 1 105 ? 126.269 25.085 8.105   1.00 15.94  ? 105  GLU A O     1 
ATOM   715  C  CB    . GLU A 1 105 ? 123.577 25.427 6.285   1.00 27.00  ? 105  GLU A CB    1 
ATOM   716  C  CG    . GLU A 1 105 ? 122.143 25.695 6.772   1.00 54.87  ? 105  GLU A CG    1 
ATOM   717  C  CD    . GLU A 1 105 ? 121.542 24.545 7.590   1.00 53.38  ? 105  GLU A CD    1 
ATOM   718  O  OE1   . GLU A 1 105 ? 121.717 23.362 7.224   1.00 76.53  ? 105  GLU A OE1   1 
ATOM   719  O  OE2   . GLU A 1 105 ? 120.900 24.826 8.620   1.00 61.78  ? 105  GLU A OE2   1 
ATOM   720  N  N     . LEU A 1 106 ? 126.405 24.840 5.868   1.00 15.24  ? 106  LEU A N     1 
ATOM   721  C  CA    . LEU A 1 106 ? 127.488 23.869 5.914   1.00 14.43  ? 106  LEU A CA    1 
ATOM   722  C  C     . LEU A 1 106 ? 128.683 24.384 6.698   1.00 19.85  ? 106  LEU A C     1 
ATOM   723  O  O     . LEU A 1 106 ? 129.159 23.726 7.623   1.00 24.41  ? 106  LEU A O     1 
ATOM   724  C  CB    . LEU A 1 106 ? 127.809 23.408 4.502   1.00 15.76  ? 106  LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 106 ? 126.901 22.203 4.101   1.00 20.69  ? 106  LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 106 ? 126.842 21.244 5.248   1.00 18.19  ? 106  LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 106 ? 125.443 22.568 3.808   1.00 31.77  ? 106  LEU A CD2   1 
ATOM   728  N  N     . CYS A 1 107 ? 129.161 25.566 6.327   1.00 20.40  ? 107  CYS A N     1 
ATOM   729  C  CA    . CYS A 1 107 ? 130.304 26.181 6.997   1.00 19.03  ? 107  CYS A CA    1 
ATOM   730  C  C     . CYS A 1 107 ? 130.076 26.287 8.496   1.00 16.14  ? 107  CYS A C     1 
ATOM   731  O  O     . CYS A 1 107 ? 130.890 25.810 9.288   1.00 19.22  ? 107  CYS A O     1 
ATOM   732  C  CB    . CYS A 1 107 ? 130.645 27.550 6.420   1.00 19.01  ? 107  CYS A CB    1 
ATOM   733  S  SG    . CYS A 1 107 ? 131.096 27.436 4.666   1.00 22.14  ? 107  CYS A SG    1 
ATOM   734  N  N     . ASP A 1 108 ? 128.967 26.907 8.877   1.00 4.94   ? 108  ASP A N     1 
ATOM   735  C  CA    . ASP A 1 108 ? 128.641 27.068 10.286  1.00 5.70   ? 108  ASP A CA    1 
ATOM   736  C  C     . ASP A 1 108 ? 128.713 25.733 11.039  1.00 21.38  ? 108  ASP A C     1 
ATOM   737  O  O     . ASP A 1 108 ? 129.308 25.656 12.113  1.00 28.19  ? 108  ASP A O     1 
ATOM   738  C  CB    . ASP A 1 108 ? 127.309 27.763 10.475  1.00 4.40   ? 108  ASP A CB    1 
ATOM   739  C  CG    . ASP A 1 108 ? 127.187 29.088 9.743   1.00 17.75  ? 108  ASP A CG    1 
ATOM   740  O  OD1   . ASP A 1 108 ? 128.167 29.737 9.267   1.00 35.91  ? 108  ASP A OD1   1 
ATOM   741  O  OD2   . ASP A 1 108 ? 126.020 29.478 9.688   1.00 16.44  ? 108  ASP A OD2   1 
ATOM   742  N  N     . LYS A 1 109 ? 128.113 24.682 10.473  1.00 19.55  ? 109  LYS A N     1 
ATOM   743  C  CA    . LYS A 1 109 ? 128.120 23.352 11.094  1.00 22.98  ? 109  LYS A CA    1 
ATOM   744  C  C     . LYS A 1 109 ? 129.557 22.902 11.386  1.00 28.53  ? 109  LYS A C     1 
ATOM   745  O  O     . LYS A 1 109 ? 129.812 22.138 12.322  1.00 24.56  ? 109  LYS A O     1 
ATOM   746  C  CB    . LYS A 1 109 ? 127.433 22.320 10.152  1.00 26.35  ? 109  LYS A CB    1 
ATOM   747  C  CG    . LYS A 1 109 ? 126.076 21.788 10.591  1.00 64.23  ? 109  LYS A CG    1 
ATOM   748  C  CD    . LYS A 1 109 ? 125.798 20.422 9.962   1.00 92.42  ? 109  LYS A CD    1 
ATOM   749  C  CE    . LYS A 1 109 ? 125.284 19.400 10.975  1.00 100.00 ? 109  LYS A CE    1 
ATOM   750  N  NZ    . LYS A 1 109 ? 124.074 18.682 10.466  1.00 82.90  ? 109  LYS A NZ    1 
ATOM   751  N  N     . GLU A 1 110 ? 130.488 23.393 10.572  1.00 21.87  ? 110  GLU A N     1 
ATOM   752  C  CA    . GLU A 1 110 ? 131.892 23.060 10.726  1.00 20.26  ? 110  GLU A CA    1 
ATOM   753  C  C     . GLU A 1 110 ? 132.579 23.868 11.819  1.00 22.81  ? 110  GLU A C     1 
ATOM   754  O  O     . GLU A 1 110 ? 133.617 23.455 12.324  1.00 24.89  ? 110  GLU A O     1 
ATOM   755  C  CB    . GLU A 1 110 ? 132.636 23.179 9.436   1.00 22.18  ? 110  GLU A CB    1 
ATOM   756  C  CG    . GLU A 1 110 ? 132.536 21.875 8.681   1.00 21.91  ? 110  GLU A CG    1 
ATOM   757  C  CD    . GLU A 1 110 ? 133.070 21.976 7.299   1.00 48.08  ? 110  GLU A CD    1 
ATOM   758  O  OE1   . GLU A 1 110 ? 132.417 21.433 6.384   1.00 21.26  ? 110  GLU A OE1   1 
ATOM   759  O  OE2   . GLU A 1 110 ? 134.152 22.580 7.139   1.00 62.12  ? 110  GLU A OE2   1 
ATOM   760  N  N     . GLY A 1 111 ? 132.032 25.012 12.198  1.00 19.05  ? 111  GLY A N     1 
ATOM   761  C  CA    . GLY A 1 111 ? 132.678 25.796 13.251  1.00 18.42  ? 111  GLY A CA    1 
ATOM   762  C  C     . GLY A 1 111 ? 133.602 26.855 12.667  1.00 19.60  ? 111  GLY A C     1 
ATOM   763  O  O     . GLY A 1 111 ? 134.343 27.530 13.397  1.00 13.36  ? 111  GLY A O     1 
ATOM   764  N  N     . LEU A 1 112 ? 133.539 26.987 11.342  1.00 7.49   ? 112  LEU A N     1 
ATOM   765  C  CA    . LEU A 1 112 ? 134.342 27.951 10.605  1.00 5.65   ? 112  LEU A CA    1 
ATOM   766  C  C     . LEU A 1 112 ? 133.819 29.360 10.840  1.00 22.75  ? 112  LEU A C     1 
ATOM   767  O  O     . LEU A 1 112 ? 132.615 29.577 10.825  1.00 36.47  ? 112  LEU A O     1 
ATOM   768  C  CB    . LEU A 1 112 ? 133.971 27.814 9.137   1.00 1.00   ? 112  LEU A CB    1 
ATOM   769  C  CG    . LEU A 1 112 ? 135.013 27.511 8.106   1.00 5.21   ? 112  LEU A CG    1 
ATOM   770  C  CD1   . LEU A 1 112 ? 134.453 27.848 6.770   1.00 8.08   ? 112  LEU A CD1   1 
ATOM   771  C  CD2   . LEU A 1 112 ? 136.355 28.223 8.335   1.00 2.29   ? 112  LEU A CD2   1 
ATOM   772  N  N     . ALA A 1 113 ? 134.700 30.322 11.024  1.00 16.07  ? 113  ALA A N     1 
ATOM   773  C  CA    . ALA A 1 113 ? 134.220 31.670 11.217  1.00 10.21  ? 113  ALA A CA    1 
ATOM   774  C  C     . ALA A 1 113 ? 134.073 32.268 9.830   1.00 14.05  ? 113  ALA A C     1 
ATOM   775  O  O     . ALA A 1 113 ? 135.008 32.256 9.036   1.00 10.91  ? 113  ALA A O     1 
ATOM   776  C  CB    . ALA A 1 113 ? 135.093 32.500 12.109  1.00 9.08   ? 113  ALA A CB    1 
ATOM   777  N  N     . THR A 1 114 ? 132.900 32.765 9.526   1.00 16.05  ? 114  THR A N     1 
ATOM   778  C  CA    . THR A 1 114 ? 132.687 33.344 8.223   1.00 16.71  ? 114  THR A CA    1 
ATOM   779  C  C     . THR A 1 114 ? 131.763 34.526 8.314   1.00 22.34  ? 114  THR A C     1 
ATOM   780  O  O     . THR A 1 114 ? 130.945 34.654 9.229   1.00 19.20  ? 114  THR A O     1 
ATOM   781  C  CB    . THR A 1 114 ? 131.809 32.504 7.218   1.00 16.04  ? 114  THR A CB    1 
ATOM   782  O  OG1   . THR A 1 114 ? 130.501 32.298 7.751   1.00 13.71  ? 114  THR A OG1   1 
ATOM   783  C  CG2   . THR A 1 114 ? 132.431 31.223 6.691   1.00 12.36  ? 114  THR A CG2   1 
ATOM   784  N  N     . ARG A 1 115 ? 131.925 35.367 7.330   1.00 19.51  ? 115  ARG A N     1 
ATOM   785  C  CA    . ARG A 1 115 ? 131.156 36.567 7.164   1.00 19.20  ? 115  ARG A CA    1 
ATOM   786  C  C     . ARG A 1 115 ? 130.920 36.674 5.675   1.00 18.14  ? 115  ARG A C     1 
ATOM   787  O  O     . ARG A 1 115 ? 131.723 37.248 4.949   1.00 27.81  ? 115  ARG A O     1 
ATOM   788  C  CB    . ARG A 1 115 ? 131.922 37.733 7.710   1.00 31.09  ? 115  ARG A CB    1 
ATOM   789  C  CG    . ARG A 1 115 ? 131.036 38.596 8.524   1.00 55.11  ? 115  ARG A CG    1 
ATOM   790  C  CD    . ARG A 1 115 ? 131.228 39.980 8.095   1.00 54.95  ? 115  ARG A CD    1 
ATOM   791  N  NE    . ARG A 1 115 ? 132.135 40.604 9.022   1.00 46.19  ? 115  ARG A NE    1 
ATOM   792  C  CZ    . ARG A 1 115 ? 132.112 41.889 9.273   1.00 38.64  ? 115  ARG A CZ    1 
ATOM   793  N  NH1   . ARG A 1 115 ? 131.219 42.626 8.631   1.00 40.50  ? 115  ARG A NH1   1 
ATOM   794  N  NH2   . ARG A 1 115 ? 132.980 42.414 10.143  1.00 18.45  ? 115  ARG A NH2   1 
ATOM   795  N  N     . PHE A 1 116 ? 129.830 36.092 5.215   1.00 11.40  ? 116  PHE A N     1 
ATOM   796  C  CA    . PHE A 1 116 ? 129.516 36.117 3.799   1.00 12.67  ? 116  PHE A CA    1 
ATOM   797  C  C     . PHE A 1 116 ? 128.693 37.332 3.375   1.00 18.05  ? 116  PHE A C     1 
ATOM   798  O  O     . PHE A 1 116 ? 127.728 37.731 4.036   1.00 15.18  ? 116  PHE A O     1 
ATOM   799  C  CB    . PHE A 1 116 ? 128.644 34.930 3.437   1.00 15.06  ? 116  PHE A CB    1 
ATOM   800  C  CG    . PHE A 1 116 ? 129.354 33.625 3.233   1.00 15.99  ? 116  PHE A CG    1 
ATOM   801  C  CD1   . PHE A 1 116 ? 129.439 32.719 4.241   1.00 18.68  ? 116  PHE A CD1   1 
ATOM   802  C  CD2   . PHE A 1 116 ? 129.871 33.280 2.006   1.00 17.15  ? 116  PHE A CD2   1 
ATOM   803  C  CE1   . PHE A 1 116 ? 130.066 31.508 4.045   1.00 18.44  ? 116  PHE A CE1   1 
ATOM   804  C  CE2   . PHE A 1 116 ? 130.488 32.074 1.803   1.00 10.58  ? 116  PHE A CE2   1 
ATOM   805  C  CZ    . PHE A 1 116 ? 130.589 31.190 2.826   1.00 10.36  ? 116  PHE A CZ    1 
ATOM   806  N  N     . MET A 1 117 ? 129.098 37.897 2.247   1.00 14.94  ? 117  MET A N     1 
ATOM   807  C  CA    . MET A 1 117 ? 128.440 39.043 1.662   1.00 14.63  ? 117  MET A CA    1 
ATOM   808  C  C     . MET A 1 117 ? 127.456 38.491 0.661   1.00 12.52  ? 117  MET A C     1 
ATOM   809  O  O     . MET A 1 117 ? 127.792 37.563 -0.084  1.00 8.04   ? 117  MET A O     1 
ATOM   810  C  CB    . MET A 1 117 ? 129.429 39.945 0.873   1.00 18.09  ? 117  MET A CB    1 
ATOM   811  C  CG    . MET A 1 117 ? 128.894 40.463 -0.459  1.00 20.67  ? 117  MET A CG    1 
ATOM   812  S  SD    . MET A 1 117 ? 129.768 41.866 -1.246  1.00 25.12  ? 117  MET A SD    1 
ATOM   813  C  CE    . MET A 1 117 ? 128.750 42.026 -2.700  1.00 19.37  ? 117  MET A CE    1 
ATOM   814  N  N     . VAL A 1 118 ? 126.251 39.043 0.653   1.00 5.02   ? 118  VAL A N     1 
ATOM   815  C  CA    . VAL A 1 118 ? 125.238 38.575 -0.269  1.00 3.09   ? 118  VAL A CA    1 
ATOM   816  C  C     . VAL A 1 118 ? 125.006 39.547 -1.412  1.00 8.32   ? 118  VAL A C     1 
ATOM   817  O  O     . VAL A 1 118 ? 124.820 40.747 -1.198  1.00 9.80   ? 118  VAL A O     1 
ATOM   818  C  CB    . VAL A 1 118 ? 123.846 38.380 0.390   1.00 11.86  ? 118  VAL A CB    1 
ATOM   819  C  CG1   . VAL A 1 118 ? 122.777 38.021 -0.665  1.00 7.18   ? 118  VAL A CG1   1 
ATOM   820  C  CG2   . VAL A 1 118 ? 123.894 37.391 1.559   1.00 10.25  ? 118  VAL A CG2   1 
ATOM   821  N  N     . ALA A 1 119 ? 125.014 38.987 -2.622  1.00 13.19  ? 119  ALA A N     1 
ATOM   822  C  CA    . ALA A 1 119 ? 124.781 39.709 -3.876  1.00 13.62  ? 119  ALA A CA    1 
ATOM   823  C  C     . ALA A 1 119 ? 123.320 39.485 -4.282  1.00 26.52  ? 119  ALA A C     1 
ATOM   824  O  O     . ALA A 1 119 ? 122.995 38.506 -4.959  1.00 33.07  ? 119  ALA A O     1 
ATOM   825  C  CB    . ALA A 1 119 ? 125.731 39.136 -4.987  1.00 10.13  ? 119  ALA A CB    1 
ATOM   826  N  N     . PRO A 1 120 ? 122.435 40.380 -3.854  1.00 20.51  ? 120  PRO A N     1 
ATOM   827  C  CA    . PRO A 1 120 ? 121.012 40.253 -4.168  1.00 19.97  ? 120  PRO A CA    1 
ATOM   828  C  C     . PRO A 1 120 ? 120.755 40.030 -5.656  1.00 10.98  ? 120  PRO A C     1 
ATOM   829  O  O     . PRO A 1 120 ? 121.437 40.590 -6.507  1.00 15.29  ? 120  PRO A O     1 
ATOM   830  C  CB    . PRO A 1 120 ? 120.411 41.566 -3.646  1.00 22.71  ? 120  PRO A CB    1 
ATOM   831  C  CG    . PRO A 1 120 ? 121.556 42.345 -3.056  1.00 21.06  ? 120  PRO A CG    1 
ATOM   832  C  CD    . PRO A 1 120 ? 122.801 41.788 -3.644  1.00 14.69  ? 120  PRO A CD    1 
ATOM   833  N  N     . GLY A 1 121 ? 119.770 39.200 -5.966  1.00 6.44   ? 121  GLY A N     1 
ATOM   834  C  CA    . GLY A 1 121 ? 119.421 38.905 -7.351  1.00 10.14  ? 121  GLY A CA    1 
ATOM   835  C  C     . GLY A 1 121 ? 120.487 38.079 -8.067  1.00 27.23  ? 121  GLY A C     1 
ATOM   836  O  O     . GLY A 1 121 ? 120.458 37.923 -9.290  1.00 26.71  ? 121  GLY A O     1 
ATOM   837  N  N     . GLN A 1 122 ? 121.437 37.542 -7.328  1.00 25.02  ? 122  GLN A N     1 
ATOM   838  C  CA    . GLN A 1 122 ? 122.453 36.751 -7.986  1.00 21.89  ? 122  GLN A CA    1 
ATOM   839  C  C     . GLN A 1 122 ? 122.463 35.336 -7.469  1.00 25.27  ? 122  GLN A C     1 
ATOM   840  O  O     . GLN A 1 122 ? 122.186 35.087 -6.300  1.00 32.11  ? 122  GLN A O     1 
ATOM   841  C  CB    . GLN A 1 122 ? 123.815 37.374 -7.909  1.00 20.99  ? 122  GLN A CB    1 
ATOM   842  C  CG    . GLN A 1 122 ? 123.848 38.624 -8.697  1.00 25.74  ? 122  GLN A CG    1 
ATOM   843  C  CD    . GLN A 1 122 ? 125.231 39.224 -8.717  1.00 58.73  ? 122  GLN A CD    1 
ATOM   844  O  OE1   . GLN A 1 122 ? 125.598 40.096 -7.861  1.00 18.79  ? 122  GLN A OE1   1 
ATOM   845  N  NE2   . GLN A 1 122 ? 126.041 38.748 -9.681  1.00 27.67  ? 122  GLN A NE2   1 
ATOM   846  N  N     . SER A 1 123 ? 122.781 34.412 -8.345  1.00 21.95  ? 123  SER A N     1 
ATOM   847  C  CA    . SER A 1 123 ? 122.833 33.013 -7.966  1.00 22.82  ? 123  SER A CA    1 
ATOM   848  C  C     . SER A 1 123 ? 124.228 32.635 -7.478  1.00 23.76  ? 123  SER A C     1 
ATOM   849  O  O     . SER A 1 123 ? 125.250 33.085 -8.030  1.00 12.09  ? 123  SER A O     1 
ATOM   850  C  CB    . SER A 1 123 ? 122.582 32.150 -9.186  1.00 24.08  ? 123  SER A CB    1 
ATOM   851  O  OG    . SER A 1 123 ? 123.434 32.589 -10.231 1.00 31.17  ? 123  SER A OG    1 
ATOM   852  N  N     . THR A 1 124 ? 124.262 31.806 -6.442  1.00 15.92  ? 124  THR A N     1 
ATOM   853  C  CA    . THR A 1 124 ? 125.526 31.360 -5.899  1.00 17.09  ? 124  THR A CA    1 
ATOM   854  C  C     . THR A 1 124 ? 126.277 30.678 -7.037  1.00 22.37  ? 124  THR A C     1 
ATOM   855  O  O     . THR A 1 124 ? 125.634 30.123 -7.933  1.00 25.16  ? 124  THR A O     1 
ATOM   856  C  CB    . THR A 1 124 ? 125.236 30.448 -4.678  1.00 14.35  ? 124  THR A CB    1 
ATOM   857  O  OG1   . THR A 1 124 ? 124.661 31.272 -3.655  1.00 15.40  ? 124  THR A OG1   1 
ATOM   858  C  CG2   . THR A 1 124 ? 126.502 29.768 -4.143  1.00 1.00   ? 124  THR A CG2   1 
ATOM   859  N  N     . GLY A 1 125 ? 127.616 30.737 -7.006  1.00 9.94   ? 125  GLY A N     1 
ATOM   860  C  CA    . GLY A 1 125 ? 128.473 30.136 -8.036  1.00 8.16   ? 125  GLY A CA    1 
ATOM   861  C  C     . GLY A 1 125 ? 128.374 28.604 -8.074  1.00 16.00  ? 125  GLY A C     1 
ATOM   862  O  O     . GLY A 1 125 ? 128.116 27.945 -7.061  1.00 8.92   ? 125  GLY A O     1 
ATOM   863  N  N     . THR A 1 126 ? 128.596 28.039 -9.255  1.00 11.08  ? 126  THR A N     1 
ATOM   864  C  CA    . THR A 1 126 ? 128.520 26.599 -9.417  1.00 14.30  ? 126  THR A CA    1 
ATOM   865  C  C     . THR A 1 126 ? 129.645 26.075 -10.291 1.00 24.66  ? 126  THR A C     1 
ATOM   866  O  O     . THR A 1 126 ? 130.020 26.701 -11.286 1.00 26.99  ? 126  THR A O     1 
ATOM   867  C  CB    . THR A 1 126 ? 127.102 26.226 -10.088 1.00 27.06  ? 126  THR A CB    1 
ATOM   868  O  OG1   . THR A 1 126 ? 126.862 24.809 -10.076 1.00 30.80  ? 126  THR A OG1   1 
ATOM   869  C  CG2   . THR A 1 126 ? 127.034 26.698 -11.543 1.00 23.26  ? 126  THR A CG2   1 
ATOM   870  N  N     . CYS A 1 127 ? 130.164 24.916 -9.907  1.00 18.67  ? 127  CYS A N     1 
ATOM   871  C  CA    . CYS A 1 127 ? 131.242 24.287 -10.640 1.00 13.72  ? 127  CYS A CA    1 
ATOM   872  C  C     . CYS A 1 127 ? 130.896 22.878 -11.070 1.00 16.88  ? 127  CYS A C     1 
ATOM   873  O  O     . CYS A 1 127 ? 130.425 22.045 -10.285 1.00 13.89  ? 127  CYS A O     1 
ATOM   874  C  CB    . CYS A 1 127 ? 132.539 24.151 -9.840  1.00 14.20  ? 127  CYS A CB    1 
ATOM   875  S  SG    . CYS A 1 127 ? 133.933 23.462 -10.820 1.00 18.23  ? 127  CYS A SG    1 
ATOM   876  N  N     . ALA A 1 128 ? 131.157 22.637 -12.336 1.00 12.02  ? 128  ALA A N     1 
ATOM   877  C  CA    . ALA A 1 128 ? 130.925 21.355 -12.915 1.00 11.28  ? 128  ALA A CA    1 
ATOM   878  C  C     . ALA A 1 128 ? 132.265 20.657 -12.843 1.00 18.76  ? 128  ALA A C     1 
ATOM   879  O  O     . ALA A 1 128 ? 133.201 21.016 -13.552 1.00 10.95  ? 128  ALA A O     1 
ATOM   880  C  CB    . ALA A 1 128 ? 130.476 21.492 -14.353 1.00 11.67  ? 128  ALA A CB    1 
ATOM   881  N  N     . VAL A 1 129 ? 132.353 19.686 -11.957 1.00 20.49  ? 129  VAL A N     1 
ATOM   882  C  CA    . VAL A 1 129 ? 133.565 18.926 -11.788 1.00 13.89  ? 129  VAL A CA    1 
ATOM   883  C  C     . VAL A 1 129 ? 133.379 17.697 -12.643 1.00 17.06  ? 129  VAL A C     1 
ATOM   884  O  O     . VAL A 1 129 ? 132.591 16.810 -12.313 1.00 12.06  ? 129  VAL A O     1 
ATOM   885  C  CB    . VAL A 1 129 ? 133.749 18.441 -10.345 1.00 13.05  ? 129  VAL A CB    1 
ATOM   886  C  CG1   . VAL A 1 129 ? 135.115 17.778 -10.192 1.00 5.98   ? 129  VAL A CG1   1 
ATOM   887  C  CG2   . VAL A 1 129 ? 133.576 19.584 -9.356  1.00 12.51  ? 129  VAL A CG2   1 
ATOM   888  N  N     . LEU A 1 130 ? 134.078 17.653 -13.751 1.00 18.35  ? 130  LEU A N     1 
ATOM   889  C  CA    . LEU A 1 130 ? 133.948 16.513 -14.631 1.00 20.83  ? 130  LEU A CA    1 
ATOM   890  C  C     . LEU A 1 130 ? 135.031 15.488 -14.367 1.00 26.94  ? 130  LEU A C     1 
ATOM   891  O  O     . LEU A 1 130 ? 136.221 15.798 -14.353 1.00 32.38  ? 130  LEU A O     1 
ATOM   892  C  CB    . LEU A 1 130 ? 133.791 16.999 -16.040 1.00 18.70  ? 130  LEU A CB    1 
ATOM   893  C  CG    . LEU A 1 130 ? 132.685 18.023 -15.980 1.00 21.71  ? 130  LEU A CG    1 
ATOM   894  C  CD1   . LEU A 1 130 ? 132.928 19.185 -16.925 1.00 22.08  ? 130  LEU A CD1   1 
ATOM   895  C  CD2   . LEU A 1 130 ? 131.375 17.317 -16.236 1.00 30.37  ? 130  LEU A CD2   1 
ATOM   896  N  N     . ILE A 1 131 ? 134.614 14.268 -14.099 1.00 20.41  ? 131  ILE A N     1 
ATOM   897  C  CA    . ILE A 1 131 ? 135.569 13.222 -13.815 1.00 19.88  ? 131  ILE A CA    1 
ATOM   898  C  C     . ILE A 1 131 ? 135.563 12.223 -14.927 1.00 17.58  ? 131  ILE A C     1 
ATOM   899  O  O     . ILE A 1 131 ? 134.552 11.577 -15.198 1.00 18.02  ? 131  ILE A O     1 
ATOM   900  C  CB    . ILE A 1 131 ? 135.506 12.620 -12.460 1.00 26.08  ? 131  ILE A CB    1 
ATOM   901  C  CG1   . ILE A 1 131 ? 135.857 13.728 -11.451 1.00 27.80  ? 131  ILE A CG1   1 
ATOM   902  C  CG2   . ILE A 1 131 ? 136.532 11.488 -12.381 1.00 19.43  ? 131  ILE A CG2   1 
ATOM   903  C  CD1   . ILE A 1 131 ? 135.626 13.352 -10.007 1.00 37.17  ? 131  ILE A CD1   1 
ATOM   904  N  N     . ASN A 1 132 ? 136.712 12.130 -15.567 1.00 10.60  ? 132  ASN A N     1 
ATOM   905  C  CA    . ASN A 1 132 ? 136.935 11.240 -16.676 1.00 11.78  ? 132  ASN A CA    1 
ATOM   906  C  C     . ASN A 1 132 ? 138.340 10.697 -16.577 1.00 22.77  ? 132  ASN A C     1 
ATOM   907  O  O     . ASN A 1 132 ? 139.311 11.459 -16.517 1.00 18.27  ? 132  ASN A O     1 
ATOM   908  C  CB    . ASN A 1 132 ? 136.631 11.932 -17.959 1.00 17.60  ? 132  ASN A CB    1 
ATOM   909  C  CG    . ASN A 1 132 ? 136.691 11.016 -19.075 1.00 22.80  ? 132  ASN A CG    1 
ATOM   910  O  OD1   . ASN A 1 132 ? 135.760 10.264 -19.345 1.00 23.20  ? 132  ASN A OD1   1 
ATOM   911  N  ND2   . ASN A 1 132 ? 137.826 10.990 -19.699 1.00 1.00   ? 132  ASN A ND2   1 
ATOM   912  N  N     . GLU A 1 133 ? 138.411 9.373  -16.462 1.00 26.05  ? 133  GLU A N     1 
ATOM   913  C  CA    . GLU A 1 133 ? 139.654 8.657  -16.289 1.00 33.36  ? 133  GLU A CA    1 
ATOM   914  C  C     . GLU A 1 133 ? 139.890 8.799  -14.803 1.00 46.02  ? 133  GLU A C     1 
ATOM   915  O  O     . GLU A 1 133 ? 139.174 8.207  -13.991 1.00 52.89  ? 133  GLU A O     1 
ATOM   916  C  CB    . GLU A 1 133 ? 140.808 9.172  -17.130 1.00 34.92  ? 133  GLU A CB    1 
ATOM   917  C  CG    . GLU A 1 133 ? 141.055 8.206  -18.287 1.00 61.54  ? 133  GLU A CG    1 
ATOM   918  C  CD    . GLU A 1 133 ? 139.790 7.889  -19.164 1.00 100.00 ? 133  GLU A CD    1 
ATOM   919  O  OE1   . GLU A 1 133 ? 138.682 7.526  -18.655 1.00 100.00 ? 133  GLU A OE1   1 
ATOM   920  O  OE2   . GLU A 1 133 ? 139.934 7.977  -20.407 1.00 100.00 ? 133  GLU A OE2   1 
ATOM   921  N  N     . LYS A 1 134 ? 140.855 9.601  -14.441 1.00 33.86  ? 134  LYS A N     1 
ATOM   922  C  CA    . LYS A 1 134 ? 141.126 9.832  -13.040 1.00 34.37  ? 134  LYS A CA    1 
ATOM   923  C  C     . LYS A 1 134 ? 141.310 11.312 -12.935 1.00 36.51  ? 134  LYS A C     1 
ATOM   924  O  O     . LYS A 1 134 ? 141.457 11.873 -11.858 1.00 42.73  ? 134  LYS A O     1 
ATOM   925  C  CB    . LYS A 1 134 ? 142.462 9.268  -12.618 1.00 35.96  ? 134  LYS A CB    1 
ATOM   926  C  CG    . LYS A 1 134 ? 142.647 7.875  -13.108 1.00 51.38  ? 134  LYS A CG    1 
ATOM   927  C  CD    . LYS A 1 134 ? 141.709 6.957  -12.354 1.00 33.40  ? 134  LYS A CD    1 
ATOM   928  C  CE    . LYS A 1 134 ? 142.455 6.329  -11.193 1.00 43.43  ? 134  LYS A CE    1 
ATOM   929  N  NZ    . LYS A 1 134 ? 142.510 4.838  -11.171 1.00 19.18  ? 134  LYS A NZ    1 
ATOM   930  N  N     . GLU A 1 135 ? 141.304 11.917 -14.111 1.00 31.95  ? 135  GLU A N     1 
ATOM   931  C  CA    . GLU A 1 135 ? 141.483 13.344 -14.259 1.00 34.87  ? 135  GLU A CA    1 
ATOM   932  C  C     . GLU A 1 135 ? 140.229 14.100 -13.930 1.00 32.93  ? 135  GLU A C     1 
ATOM   933  O  O     . GLU A 1 135 ? 139.119 13.592 -14.078 1.00 35.42  ? 135  GLU A O     1 
ATOM   934  C  CB    . GLU A 1 135 ? 141.630 13.719 -15.747 1.00 38.66  ? 135  GLU A CB    1 
ATOM   935  C  CG    . GLU A 1 135 ? 142.784 13.150 -16.530 1.00 53.49  ? 135  GLU A CG    1 
ATOM   936  C  CD    . GLU A 1 135 ? 144.057 13.758 -16.086 1.00 75.64  ? 135  GLU A CD    1 
ATOM   937  O  OE1   . GLU A 1 135 ? 145.087 13.059 -16.076 1.00 92.87  ? 135  GLU A OE1   1 
ATOM   938  O  OE2   . GLU A 1 135 ? 144.010 14.941 -15.713 1.00 63.28  ? 135  GLU A OE2   1 
ATOM   939  N  N     . ARG A 1 136 ? 140.432 15.329 -13.500 1.00 27.32  ? 136  ARG A N     1 
ATOM   940  C  CA    . ARG A 1 136 ? 139.339 16.207 -13.165 1.00 27.35  ? 136  ARG A CA    1 
ATOM   941  C  C     . ARG A 1 136 ? 139.303 17.393 -14.121 1.00 30.19  ? 136  ARG A C     1 
ATOM   942  O  O     . ARG A 1 136 ? 140.341 17.971 -14.447 1.00 32.76  ? 136  ARG A O     1 
ATOM   943  C  CB    . ARG A 1 136 ? 139.577 16.770 -11.753 1.00 30.37  ? 136  ARG A CB    1 
ATOM   944  C  CG    . ARG A 1 136 ? 140.764 17.778 -11.692 1.00 28.65  ? 136  ARG A CG    1 
ATOM   945  C  CD    . ARG A 1 136 ? 140.684 18.625 -10.492 1.00 20.95  ? 136  ARG A CD    1 
ATOM   946  N  NE    . ARG A 1 136 ? 141.351 19.939 -10.503 1.00 61.47  ? 136  ARG A NE    1 
ATOM   947  C  CZ    . ARG A 1 136 ? 141.961 20.558 -11.521 1.00 60.80  ? 136  ARG A CZ    1 
ATOM   948  N  NH1   . ARG A 1 136 ? 142.056 20.030 -12.731 1.00 7.58   ? 136  ARG A NH1   1 
ATOM   949  N  NH2   . ARG A 1 136 ? 142.492 21.757 -11.309 1.00 54.81  ? 136  ARG A NH2   1 
ATOM   950  N  N     . THR A 1 137 ? 138.104 17.747 -14.567 1.00 24.15  ? 137  THR A N     1 
ATOM   951  C  CA    . THR A 1 137 ? 137.901 18.876 -15.472 1.00 23.21  ? 137  THR A CA    1 
ATOM   952  C  C     . THR A 1 137 ? 136.939 19.855 -14.795 1.00 19.15  ? 137  THR A C     1 
ATOM   953  O  O     . THR A 1 137 ? 135.793 19.502 -14.502 1.00 12.22  ? 137  THR A O     1 
ATOM   954  C  CB    . THR A 1 137 ? 137.550 18.461 -16.888 1.00 22.77  ? 137  THR A CB    1 
ATOM   955  O  OG1   . THR A 1 137 ? 138.600 17.612 -17.341 1.00 32.30  ? 137  THR A OG1   1 
ATOM   956  C  CG2   . THR A 1 137 ? 137.403 19.664 -17.838 1.00 5.96   ? 137  THR A CG2   1 
ATOM   957  N  N     . LEU A 1 138 ? 137.415 21.074 -14.536 1.00 13.33  ? 138  LEU A N     1 
ATOM   958  C  CA    . LEU A 1 138 ? 136.617 22.107 -13.873 1.00 14.12  ? 138  LEU A CA    1 
ATOM   959  C  C     . LEU A 1 138 ? 136.001 23.134 -14.817 1.00 17.07  ? 138  LEU A C     1 
ATOM   960  O  O     . LEU A 1 138 ? 136.703 23.788 -15.586 1.00 22.06  ? 138  LEU A O     1 
ATOM   961  C  CB    . LEU A 1 138 ? 137.548 22.869 -12.899 1.00 15.37  ? 138  LEU A CB    1 
ATOM   962  C  CG    . LEU A 1 138 ? 138.174 21.985 -11.787 1.00 17.51  ? 138  LEU A CG    1 
ATOM   963  C  CD1   . LEU A 1 138 ? 139.070 22.778 -10.868 1.00 9.31   ? 138  LEU A CD1   1 
ATOM   964  C  CD2   . LEU A 1 138 ? 137.048 21.382 -10.970 1.00 20.78  ? 138  LEU A CD2   1 
ATOM   965  N  N     . CYS A 1 139 ? 134.682 23.273 -14.747 1.00 15.60  ? 139  CYS A N     1 
ATOM   966  C  CA    . CYS A 1 139 ? 133.940 24.237 -15.572 1.00 18.16  ? 139  CYS A CA    1 
ATOM   967  C  C     . CYS A 1 139 ? 133.121 25.095 -14.609 1.00 14.40  ? 139  CYS A C     1 
ATOM   968  O  O     . CYS A 1 139 ? 132.192 24.595 -13.965 1.00 11.96  ? 139  CYS A O     1 
ATOM   969  C  CB    . CYS A 1 139 ? 133.191 23.634 -16.748 1.00 18.64  ? 139  CYS A CB    1 
ATOM   970  S  SG    . CYS A 1 139 ? 132.686 24.987 -17.842 1.00 24.06  ? 139  CYS A SG    1 
ATOM   971  N  N     . THR A 1 140 ? 133.479 26.371 -14.489 1.00 3.36   ? 140  THR A N     1 
ATOM   972  C  CA    . THR A 1 140 ? 132.791 27.247 -13.545 1.00 6.71   ? 140  THR A CA    1 
ATOM   973  C  C     . THR A 1 140 ? 132.025 28.454 -14.068 1.00 8.47   ? 140  THR A C     1 
ATOM   974  O  O     . THR A 1 140 ? 132.320 29.032 -15.109 1.00 11.66  ? 140  THR A O     1 
ATOM   975  C  CB    . THR A 1 140 ? 133.973 27.816 -12.579 1.00 6.69   ? 140  THR A CB    1 
ATOM   976  O  OG1   . THR A 1 140 ? 134.605 26.706 -11.969 1.00 7.54   ? 140  THR A OG1   1 
ATOM   977  C  CG2   . THR A 1 140 ? 133.539 28.732 -11.445 1.00 1.00   ? 140  THR A CG2   1 
ATOM   978  N  N     . HIS A 1 141 ? 131.035 28.797 -13.255 1.00 7.78   ? 141  HIS A N     1 
ATOM   979  C  CA    . HIS A 1 141 ? 130.122 29.909 -13.428 1.00 9.57   ? 141  HIS A CA    1 
ATOM   980  C  C     . HIS A 1 141 ? 130.038 30.593 -12.069 1.00 12.55  ? 141  HIS A C     1 
ATOM   981  O  O     . HIS A 1 141 ? 129.206 30.271 -11.218 1.00 15.99  ? 141  HIS A O     1 
ATOM   982  C  CB    . HIS A 1 141 ? 128.769 29.457 -13.929 1.00 8.78   ? 141  HIS A CB    1 
ATOM   983  C  CG    . HIS A 1 141 ? 127.892 30.601 -14.204 1.00 10.59  ? 141  HIS A CG    1 
ATOM   984  N  ND1   . HIS A 1 141 ? 126.904 30.988 -13.342 1.00 13.86  ? 141  HIS A ND1   1 
ATOM   985  C  CD2   . HIS A 1 141 ? 127.878 31.478 -15.228 1.00 17.58  ? 141  HIS A CD2   1 
ATOM   986  C  CE1   . HIS A 1 141 ? 126.302 32.054 -13.832 1.00 17.73  ? 141  HIS A CE1   1 
ATOM   987  N  NE2   . HIS A 1 141 ? 126.869 32.365 -14.983 1.00 18.28  ? 141  HIS A NE2   1 
ATOM   988  N  N     . LEU A 1 142 ? 130.947 31.526 -11.889 1.00 9.59   ? 142  LEU A N     1 
ATOM   989  C  CA    . LEU A 1 142 ? 131.101 32.301 -10.673 1.00 11.35  ? 142  LEU A CA    1 
ATOM   990  C  C     . LEU A 1 142 ? 129.834 32.914 -10.107 1.00 17.80  ? 142  LEU A C     1 
ATOM   991  O  O     . LEU A 1 142 ? 129.630 32.875 -8.890  1.00 21.27  ? 142  LEU A O     1 
ATOM   992  C  CB    . LEU A 1 142 ? 132.170 33.363 -10.901 1.00 11.63  ? 142  LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 142 ? 133.584 32.861 -10.687 1.00 15.84  ? 142  LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 142 ? 134.565 33.868 -11.256 1.00 13.47  ? 142  LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 142 ? 133.795 32.512 -9.198  1.00 14.06  ? 142  LEU A CD2   1 
ATOM   996  N  N     . GLY A 1 143 ? 128.996 33.489 -10.956 1.00 11.43  ? 143  GLY A N     1 
ATOM   997  C  CA    . GLY A 1 143 ? 127.784 34.106 -10.437 1.00 14.31  ? 143  GLY A CA    1 
ATOM   998  C  C     . GLY A 1 143 ? 128.144 35.178 -9.395  1.00 16.54  ? 143  GLY A C     1 
ATOM   999  O  O     . GLY A 1 143 ? 129.062 35.970 -9.596  1.00 10.54  ? 143  GLY A O     1 
ATOM   1000 N  N     . ALA A 1 144 ? 127.419 35.180 -8.279  1.00 23.39  ? 144  ALA A N     1 
ATOM   1001 C  CA    . ALA A 1 144 ? 127.615 36.132 -7.175  1.00 17.84  ? 144  ALA A CA    1 
ATOM   1002 C  C     . ALA A 1 144 ? 129.074 36.411 -6.839  1.00 18.71  ? 144  ALA A C     1 
ATOM   1003 O  O     . ALA A 1 144 ? 129.420 37.558 -6.537  1.00 12.40  ? 144  ALA A O     1 
ATOM   1004 C  CB    . ALA A 1 144 ? 126.927 35.613 -5.910  1.00 17.05  ? 144  ALA A CB    1 
ATOM   1005 N  N     . CYS A 1 145 ? 129.903 35.362 -6.887  1.00 15.85  ? 145  CYS A N     1 
ATOM   1006 C  CA    . CYS A 1 145 ? 131.330 35.464 -6.578  1.00 17.90  ? 145  CYS A CA    1 
ATOM   1007 C  C     . CYS A 1 145 ? 132.004 36.715 -7.132  1.00 20.11  ? 145  CYS A C     1 
ATOM   1008 O  O     . CYS A 1 145 ? 132.865 37.291 -6.478  1.00 24.08  ? 145  CYS A O     1 
ATOM   1009 C  CB    . CYS A 1 145 ? 132.095 34.248 -7.049  1.00 21.08  ? 145  CYS A CB    1 
ATOM   1010 S  SG    . CYS A 1 145 ? 131.621 32.726 -6.172  1.00 26.78  ? 145  CYS A SG    1 
ATOM   1011 N  N     . GLY A 1 146 ? 131.611 37.135 -8.325  1.00 15.59  ? 146  GLY A N     1 
ATOM   1012 C  CA    . GLY A 1 146 ? 132.205 38.312 -8.948  1.00 13.92  ? 146  GLY A CA    1 
ATOM   1013 C  C     . GLY A 1 146 ? 131.810 39.613 -8.284  1.00 17.43  ? 146  GLY A C     1 
ATOM   1014 O  O     . GLY A 1 146 ? 132.287 40.679 -8.670  1.00 22.23  ? 146  GLY A O     1 
ATOM   1015 N  N     . SER A 1 147 ? 130.947 39.543 -7.296  1.00 12.18  ? 147  SER A N     1 
ATOM   1016 C  CA    . SER A 1 147 ? 130.542 40.773 -6.646  1.00 12.24  ? 147  SER A CA    1 
ATOM   1017 C  C     . SER A 1 147 ? 131.293 40.979 -5.363  1.00 13.18  ? 147  SER A C     1 
ATOM   1018 O  O     . SER A 1 147 ? 131.094 41.979 -4.677  1.00 19.91  ? 147  SER A O     1 
ATOM   1019 C  CB    . SER A 1 147 ? 129.041 40.880 -6.483  1.00 24.57  ? 147  SER A CB    1 
ATOM   1020 O  OG    . SER A 1 147 ? 128.493 41.162 -7.763  1.00 39.13  ? 147  SER A OG    1 
ATOM   1021 N  N     . PHE A 1 148 ? 132.161 40.037 -5.044  1.00 14.89  ? 148  PHE A N     1 
ATOM   1022 C  CA    . PHE A 1 148 ? 132.931 40.148 -3.819  1.00 14.50  ? 148  PHE A CA    1 
ATOM   1023 C  C     . PHE A 1 148 ? 133.655 41.476 -3.691  1.00 16.06  ? 148  PHE A C     1 
ATOM   1024 O  O     . PHE A 1 148 ? 134.346 41.921 -4.610  1.00 17.50  ? 148  PHE A O     1 
ATOM   1025 C  CB    . PHE A 1 148 ? 133.929 39.044 -3.495  1.00 13.63  ? 148  PHE A CB    1 
ATOM   1026 C  CG    . PHE A 1 148 ? 134.432 39.092 -2.029  1.00 13.66  ? 148  PHE A CG    1 
ATOM   1027 C  CD1   . PHE A 1 148 ? 133.541 39.296 -0.978  1.00 12.33  ? 148  PHE A CD1   1 
ATOM   1028 C  CD2   . PHE A 1 148 ? 135.773 38.942 -1.709  1.00 9.82   ? 148  PHE A CD2   1 
ATOM   1029 C  CE1   . PHE A 1 148 ? 133.967 39.343 0.335   1.00 12.15  ? 148  PHE A CE1   1 
ATOM   1030 C  CE2   . PHE A 1 148 ? 136.201 38.974 -0.390  1.00 13.35  ? 148  PHE A CE2   1 
ATOM   1031 C  CZ    . PHE A 1 148 ? 135.302 39.165 0.636   1.00 13.54  ? 148  PHE A CZ    1 
ATOM   1032 N  N     . ARG A 1 149 ? 133.465 42.078 -2.528  1.00 2.47   ? 149  ARG A N     1 
ATOM   1033 C  CA    . ARG A 1 149 ? 134.066 43.343 -2.136  1.00 3.51   ? 149  ARG A CA    1 
ATOM   1034 C  C     . ARG A 1 149 ? 134.415 43.153 -0.671  1.00 20.35  ? 149  ARG A C     1 
ATOM   1035 O  O     . ARG A 1 149 ? 133.563 42.726 0.119   1.00 13.59  ? 149  ARG A O     1 
ATOM   1036 C  CB    . ARG A 1 149 ? 133.159 44.568 -2.277  1.00 1.87   ? 149  ARG A CB    1 
ATOM   1037 C  CG    . ARG A 1 149 ? 133.011 45.284 -3.677  1.00 16.41  ? 149  ARG A CG    1 
ATOM   1038 C  CD    . ARG A 1 149 ? 133.854 44.735 -4.834  1.00 36.21  ? 149  ARG A CD    1 
ATOM   1039 N  NE    . ARG A 1 149 ? 133.255 44.985 -6.152  1.00 27.94  ? 149  ARG A NE    1 
ATOM   1040 C  CZ    . ARG A 1 149 ? 133.093 44.045 -7.079  1.00 48.24  ? 149  ARG A CZ    1 
ATOM   1041 N  NH1   . ARG A 1 149 ? 133.488 42.804 -6.824  1.00 31.09  ? 149  ARG A NH1   1 
ATOM   1042 N  NH2   . ARG A 1 149 ? 132.548 44.342 -8.253  1.00 60.97  ? 149  ARG A NH2   1 
ATOM   1043 N  N     . ILE A 1 150 ? 135.658 43.430 -0.307  1.00 22.77  ? 150  ILE A N     1 
ATOM   1044 C  CA    . ILE A 1 150 ? 136.076 43.260 1.072   1.00 20.86  ? 150  ILE A CA    1 
ATOM   1045 C  C     . ILE A 1 150 ? 135.541 44.395 1.952   1.00 28.12  ? 150  ILE A C     1 
ATOM   1046 O  O     . ILE A 1 150 ? 135.857 45.561 1.724   1.00 35.06  ? 150  ILE A O     1 
ATOM   1047 C  CB    . ILE A 1 150 ? 137.621 42.690 1.109   1.00 21.18  ? 150  ILE A CB    1 
ATOM   1048 C  CG1   . ILE A 1 150 ? 138.200 42.510 2.488   1.00 16.64  ? 150  ILE A CG1   1 
ATOM   1049 C  CG2   . ILE A 1 150 ? 138.591 43.547 0.362   1.00 25.20  ? 150  ILE A CG2   1 
ATOM   1050 C  CD1   . ILE A 1 150 ? 138.068 41.086 2.975   1.00 2.57   ? 150  ILE A CD1   1 
ATOM   1051 N  N     . PRO A 1 151 ? 134.717 44.049 2.950   1.00 22.49  ? 151  PRO A N     1 
ATOM   1052 C  CA    . PRO A 1 151 ? 134.109 45.012 3.874   1.00 16.53  ? 151  PRO A CA    1 
ATOM   1053 C  C     . PRO A 1 151 ? 135.071 45.764 4.739   1.00 29.63  ? 151  PRO A C     1 
ATOM   1054 O  O     . PRO A 1 151 ? 136.163 45.137 5.129   1.00 39.42  ? 151  PRO A O     1 
ATOM   1055 C  CB    . PRO A 1 151 ? 133.073 44.223 4.626   1.00 15.58  ? 151  PRO A CB    1 
ATOM   1056 C  CG    . PRO A 1 151 ? 133.736 42.915 4.781   1.00 28.15  ? 151  PRO A CG    1 
ATOM   1057 C  CD    . PRO A 1 151 ? 134.433 42.682 3.421   1.00 26.30  ? 151  PRO A CD    1 
ATOM   1058 N  N     . GLU A 1 152 ? 134.547 47.144 4.937   1.00 38.67  ? 152  GLU A N     1 
ATOM   1059 C  CA    . GLU A 1 152 ? 135.192 48.175 5.739   1.00 43.35  ? 152  GLU A CA    1 
ATOM   1060 C  C     . GLU A 1 152 ? 135.891 47.615 7.030   1.00 35.38  ? 152  GLU A C     1 
ATOM   1061 O  O     . GLU A 1 152 ? 136.949 48.163 7.323   1.00 36.72  ? 152  GLU A O     1 
ATOM   1062 C  CB    . GLU A 1 152 ? 134.727 49.593 5.971   1.00 52.43  ? 152  GLU A CB    1 
ATOM   1063 C  CG    . GLU A 1 152 ? 135.607 50.429 5.136   1.00 100.00 ? 152  GLU A CG    1 
ATOM   1064 C  CD    . GLU A 1 152 ? 136.113 51.271 5.549   1.00 100.00 ? 152  GLU A CD    1 
ATOM   1065 O  OE1   . GLU A 1 152 ? 137.589 51.035 5.787   1.00 96.44  ? 152  GLU A OE1   1 
ATOM   1066 O  OE2   . GLU A 1 152 ? 134.894 53.039 6.158   1.00 100.00 ? 152  GLU A OE2   1 
ATOM   1067 N  N     . ASN A 1 153 ? 135.331 46.554 7.843   1.00 20.14  ? 153  ASN A N     1 
ATOM   1068 C  CA    . ASN A 1 153 ? 135.786 45.882 9.160   1.00 23.08  ? 153  ASN A CA    1 
ATOM   1069 C  C     . ASN A 1 153 ? 136.403 44.473 9.103   1.00 29.92  ? 153  ASN A C     1 
ATOM   1070 O  O     . ASN A 1 153 ? 136.448 43.770 10.120  1.00 25.68  ? 153  ASN A O     1 
ATOM   1071 C  CB    . ASN A 1 153 ? 134.383 45.721 9.888   1.00 35.91  ? 153  ASN A CB    1 
ATOM   1072 C  CG    . ASN A 1 153 ? 133.243 45.270 8.910   1.00 72.89  ? 153  ASN A CG    1 
ATOM   1073 O  OD1   . ASN A 1 153 ? 133.396 44.256 8.207   1.00 38.14  ? 153  ASN A OD1   1 
ATOM   1074 N  ND2   . ASN A 1 153 ? 132.119 45.999 8.887   1.00 80.95  ? 153  ASN A ND2   1 
ATOM   1075 N  N     . TRP A 1 154 ? 136.858 44.085 7.913   1.00 20.60  ? 154  TRP A N     1 
ATOM   1076 C  CA    . TRP A 1 154 ? 137.473 42.775 7.714   1.00 19.12  ? 154  TRP A CA    1 
ATOM   1077 C  C     . TRP A 1 154 ? 138.636 42.538 8.683   1.00 22.31  ? 154  TRP A C     1 
ATOM   1078 O  O     . TRP A 1 154 ? 138.712 41.497 9.336   1.00 16.45  ? 154  TRP A O     1 
ATOM   1079 C  CB    . TRP A 1 154 ? 137.815 42.429 6.260   1.00 17.68  ? 154  TRP A CB    1 
ATOM   1080 C  CG    . TRP A 1 154 ? 139.123 42.992 5.813   1.00 21.63  ? 154  TRP A CG    1 
ATOM   1081 C  CD1   . TRP A 1 154 ? 139.283 44.177 5.205   1.00 26.65  ? 154  TRP A CD1   1 
ATOM   1082 C  CD2   . TRP A 1 154 ? 140.457 42.416 5.950   1.00 20.46  ? 154  TRP A CD2   1 
ATOM   1083 N  NE1   . TRP A 1 154 ? 140.619 44.397 4.936   1.00 29.26  ? 154  TRP A NE1   1 
ATOM   1084 C  CE2   . TRP A 1 154 ? 141.362 43.337 5.378   1.00 28.36  ? 154  TRP A CE2   1 
ATOM   1085 C  CE3   . TRP A 1 154 ? 140.958 41.223 6.485   1.00 21.55  ? 154  TRP A CE3   1 
ATOM   1086 C  CZ2   . TRP A 1 154 ? 142.753 43.113 5.330   1.00 28.37  ? 154  TRP A CZ2   1 
ATOM   1087 C  CZ3   . TRP A 1 154 ? 142.320 40.980 6.419   1.00 25.38  ? 154  TRP A CZ3   1 
ATOM   1088 C  CH2   . TRP A 1 154 ? 143.215 41.933 5.850   1.00 27.76  ? 154  TRP A CH2   1 
ATOM   1089 N  N     . THR A 1 155 ? 139.538 43.496 8.779   1.00 23.39  ? 155  THR A N     1 
ATOM   1090 C  CA    . THR A 1 155 ? 140.666 43.343 9.686   1.00 27.63  ? 155  THR A CA    1 
ATOM   1091 C  C     . THR A 1 155 ? 140.178 43.137 11.123  1.00 18.31  ? 155  THR A C     1 
ATOM   1092 O  O     . THR A 1 155 ? 140.860 42.527 11.938  1.00 20.10  ? 155  THR A O     1 
ATOM   1093 C  CB    . THR A 1 155 ? 141.522 44.577 9.663   1.00 31.11  ? 155  THR A CB    1 
ATOM   1094 O  OG1   . THR A 1 155 ? 140.994 45.497 10.628  1.00 35.69  ? 155  THR A OG1   1 
ATOM   1095 C  CG2   . THR A 1 155 ? 141.405 45.221 8.292   1.00 20.08  ? 155  THR A CG2   1 
ATOM   1096 N  N     . THR A 1 156 ? 138.999 43.644 11.443  1.00 11.33  ? 156  THR A N     1 
ATOM   1097 C  CA    . THR A 1 156 ? 138.493 43.470 12.797  1.00 18.39  ? 156  THR A CA    1 
ATOM   1098 C  C     . THR A 1 156 ? 137.983 42.043 12.996  1.00 31.27  ? 156  THR A C     1 
ATOM   1099 O  O     . THR A 1 156 ? 138.119 41.464 14.082  1.00 34.46  ? 156  THR A O     1 
ATOM   1100 C  CB    . THR A 1 156 ? 137.459 44.557 13.198  1.00 44.09  ? 156  THR A CB    1 
ATOM   1101 O  OG1   . THR A 1 156 ? 137.950 45.851 12.804  1.00 59.72  ? 156  THR A OG1   1 
ATOM   1102 C  CG2   . THR A 1 156 ? 137.232 44.564 14.706  1.00 38.83  ? 156  THR A CG2   1 
ATOM   1103 N  N     . PHE A 1 157 ? 137.406 41.489 11.930  1.00 20.81  ? 157  PHE A N     1 
ATOM   1104 C  CA    . PHE A 1 157 ? 136.862 40.135 11.929  1.00 18.92  ? 157  PHE A CA    1 
ATOM   1105 C  C     . PHE A 1 157 ? 137.974 39.096 11.995  1.00 35.17  ? 157  PHE A C     1 
ATOM   1106 O  O     . PHE A 1 157 ? 137.885 38.112 12.730  1.00 43.01  ? 157  PHE A O     1 
ATOM   1107 C  CB    . PHE A 1 157 ? 136.166 39.951 10.589  1.00 20.31  ? 157  PHE A CB    1 
ATOM   1108 C  CG    . PHE A 1 157 ? 135.702 38.559 10.327  1.00 25.05  ? 157  PHE A CG    1 
ATOM   1109 C  CD1   . PHE A 1 157 ? 134.587 38.066 10.965  1.00 25.90  ? 157  PHE A CD1   1 
ATOM   1110 C  CD2   . PHE A 1 157 ? 136.374 37.736 9.423   1.00 25.68  ? 157  PHE A CD2   1 
ATOM   1111 C  CE1   . PHE A 1 157 ? 134.150 36.777 10.717  1.00 23.28  ? 157  PHE A CE1   1 
ATOM   1112 C  CE2   . PHE A 1 157 ? 135.937 36.449 9.171   1.00 21.28  ? 157  PHE A CE2   1 
ATOM   1113 C  CZ    . PHE A 1 157 ? 134.823 35.972 9.820   1.00 18.87  ? 157  PHE A CZ    1 
ATOM   1114 N  N     . ALA A 1 158 ? 139.020 39.340 11.217  1.00 27.14  ? 158  ALA A N     1 
ATOM   1115 C  CA    . ALA A 1 158 ? 140.175 38.469 11.142  1.00 20.60  ? 158  ALA A CA    1 
ATOM   1116 C  C     . ALA A 1 158 ? 141.270 38.936 12.098  1.00 37.35  ? 158  ALA A C     1 
ATOM   1117 O  O     . ALA A 1 158 ? 142.436 38.576 11.927  1.00 37.22  ? 158  ALA A O     1 
ATOM   1118 C  CB    . ALA A 1 158 ? 140.706 38.572 9.726   1.00 18.31  ? 158  ALA A CB    1 
ATOM   1119 N  N     . SER A 1 159 ? 140.883 39.737 13.099  1.00 40.32  ? 159  SER A N     1 
ATOM   1120 C  CA    . SER A 1 159 ? 141.806 40.282 14.097  1.00 46.96  ? 159  SER A CA    1 
ATOM   1121 C  C     . SER A 1 159 ? 142.556 39.201 14.848  1.00 49.76  ? 159  SER A C     1 
ATOM   1122 O  O     . SER A 1 159 ? 141.960 38.352 15.512  1.00 46.65  ? 159  SER A O     1 
ATOM   1123 C  CB    . SER A 1 159 ? 141.208 41.333 15.036  1.00 59.22  ? 159  SER A CB    1 
ATOM   1124 O  OG    . SER A 1 159 ? 142.090 42.445 15.081  1.00 86.61  ? 159  SER A OG    1 
ATOM   1125 N  N     . GLY A 1 160 ? 143.874 39.237 14.735  1.00 43.38  ? 160  GLY A N     1 
ATOM   1126 C  CA    . GLY A 1 160 ? 144.687 38.251 15.426  1.00 38.69  ? 160  GLY A CA    1 
ATOM   1127 C  C     . GLY A 1 160 ? 145.246 37.162 14.524  1.00 33.32  ? 160  GLY A C     1 
ATOM   1128 O  O     . GLY A 1 160 ? 146.110 36.395 14.943  1.00 36.62  ? 160  GLY A O     1 
ATOM   1129 N  N     . ALA A 1 161 ? 144.778 37.067 13.298  1.00 22.02  ? 161  ALA A N     1 
ATOM   1130 C  CA    . ALA A 1 161 ? 145.321 36.033 12.441  1.00 23.85  ? 161  ALA A CA    1 
ATOM   1131 C  C     . ALA A 1 161 ? 146.693 36.455 11.936  1.00 27.94  ? 161  ALA A C     1 
ATOM   1132 O  O     . ALA A 1 161 ? 146.903 37.620 11.609  1.00 31.71  ? 161  ALA A O     1 
ATOM   1133 C  CB    . ALA A 1 161 ? 144.403 35.777 11.258  1.00 24.52  ? 161  ALA A CB    1 
ATOM   1134 N  N     . LEU A 1 162 ? 147.620 35.508 11.878  1.00 20.37  ? 162  LEU A N     1 
ATOM   1135 C  CA    . LEU A 1 162 ? 148.963 35.795 11.398  1.00 17.32  ? 162  LEU A CA    1 
ATOM   1136 C  C     . LEU A 1 162 ? 149.169 35.205 10.015  1.00 14.31  ? 162  LEU A C     1 
ATOM   1137 O  O     . LEU A 1 162 ? 150.176 35.464 9.356   1.00 15.85  ? 162  LEU A O     1 
ATOM   1138 C  CB    . LEU A 1 162 ? 150.051 35.481 12.384  1.00 18.96  ? 162  LEU A CB    1 
ATOM   1139 C  CG    . LEU A 1 162 ? 149.978 36.588 13.425  1.00 25.18  ? 162  LEU A CG    1 
ATOM   1140 C  CD1   . LEU A 1 162 ? 150.133 36.003 14.803  1.00 25.01  ? 162  LEU A CD1   1 
ATOM   1141 C  CD2   . LEU A 1 162 ? 150.924 37.753 13.124  1.00 28.46  ? 162  LEU A CD2   1 
ATOM   1142 N  N     . ILE A 1 163 ? 148.203 34.414 9.572   1.00 9.18   ? 163  ILE A N     1 
ATOM   1143 C  CA    . ILE A 1 163 ? 148.296 33.807 8.256   1.00 9.31   ? 163  ILE A CA    1 
ATOM   1144 C  C     . ILE A 1 163 ? 147.126 34.233 7.387   1.00 12.94  ? 163  ILE A C     1 
ATOM   1145 O  O     . ILE A 1 163 ? 145.979 33.968 7.702   1.00 11.22  ? 163  ILE A O     1 
ATOM   1146 C  CB    . ILE A 1 163 ? 148.469 32.323 8.253   1.00 9.04   ? 163  ILE A CB    1 
ATOM   1147 C  CG1   . ILE A 1 163 ? 149.695 31.942 9.063   1.00 5.87   ? 163  ILE A CG1   1 
ATOM   1148 C  CG2   . ILE A 1 163 ? 148.678 31.793 6.829   1.00 5.44   ? 163  ILE A CG2   1 
ATOM   1149 C  CD1   . ILE A 1 163 ? 149.818 30.415 9.178   1.00 3.06   ? 163  ILE A CD1   1 
ATOM   1150 N  N     . PHE A 1 164 ? 147.421 34.901 6.295   1.00 16.21  ? 164  PHE A N     1 
ATOM   1151 C  CA    . PHE A 1 164 ? 146.381 35.346 5.399   1.00 10.94  ? 164  PHE A CA    1 
ATOM   1152 C  C     . PHE A 1 164 ? 146.543 34.623 4.085   1.00 18.49  ? 164  PHE A C     1 
ATOM   1153 O  O     . PHE A 1 164 ? 147.637 34.566 3.540   1.00 22.77  ? 164  PHE A O     1 
ATOM   1154 C  CB    . PHE A 1 164 ? 146.508 36.820 5.237   1.00 14.15  ? 164  PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1 164 ? 146.303 37.549 6.530   1.00 18.58  ? 164  PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1 164 ? 145.019 37.980 6.905   1.00 18.74  ? 164  PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1 164 ? 147.376 37.781 7.395   1.00 19.30  ? 164  PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1 164 ? 144.817 38.643 8.106   1.00 16.37  ? 164  PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1 164 ? 147.184 38.452 8.592   1.00 23.54  ? 164  PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1 164 ? 145.898 38.877 8.947   1.00 23.99  ? 164  PHE A CZ    1 
ATOM   1161 N  N     . TYR A 1 165 ? 145.465 34.059 3.580   1.00 18.65  ? 165  TYR A N     1 
ATOM   1162 C  CA    . TYR A 1 165 ? 145.545 33.336 2.319   1.00 16.37  ? 165  TYR A CA    1 
ATOM   1163 C  C     . TYR A 1 165 ? 144.530 33.819 1.294   1.00 26.97  ? 165  TYR A C     1 
ATOM   1164 O  O     . TYR A 1 165 ? 143.422 34.243 1.631   1.00 34.63  ? 165  TYR A O     1 
ATOM   1165 C  CB    . TYR A 1 165 ? 145.119 31.924 2.585   1.00 6.68   ? 165  TYR A CB    1 
ATOM   1166 C  CG    . TYR A 1 165 ? 145.153 30.974 1.409   1.00 5.84   ? 165  TYR A CG    1 
ATOM   1167 C  CD1   . TYR A 1 165 ? 146.348 30.775 0.679   1.00 8.28   ? 165  TYR A CD1   1 
ATOM   1168 C  CD2   . TYR A 1 165 ? 144.010 30.230 1.040   1.00 1.09   ? 165  TYR A CD2   1 
ATOM   1169 C  CE1   . TYR A 1 165 ? 146.413 29.867 -0.376  1.00 9.25   ? 165  TYR A CE1   1 
ATOM   1170 C  CE2   . TYR A 1 165 ? 144.051 29.302 -0.009  1.00 1.02   ? 165  TYR A CE2   1 
ATOM   1171 C  CZ    . TYR A 1 165 ? 145.257 29.118 -0.722  1.00 27.36  ? 165  TYR A CZ    1 
ATOM   1172 O  OH    . TYR A 1 165 ? 145.313 28.196 -1.768  1.00 20.06  ? 165  TYR A OH    1 
ATOM   1173 N  N     . ALA A 1 166 ? 144.924 33.730 0.035   1.00 13.29  ? 166  ALA A N     1 
ATOM   1174 C  CA    . ALA A 1 166 ? 144.081 34.130 -1.078  1.00 9.76   ? 166  ALA A CA    1 
ATOM   1175 C  C     . ALA A 1 166 ? 144.526 33.395 -2.325  1.00 17.37  ? 166  ALA A C     1 
ATOM   1176 O  O     . ALA A 1 166 ? 145.719 33.197 -2.541  1.00 27.02  ? 166  ALA A O     1 
ATOM   1177 C  CB    . ALA A 1 166 ? 144.183 35.629 -1.350  1.00 9.57   ? 166  ALA A CB    1 
ATOM   1178 N  N     . THR A 1 167 ? 143.572 32.995 -3.139  1.00 5.61   ? 167  THR A N     1 
ATOM   1179 C  CA    . THR A 1 167 ? 143.868 32.290 -4.370  1.00 1.00   ? 167  THR A CA    1 
ATOM   1180 C  C     . THR A 1 167 ? 143.829 33.286 -5.521  1.00 8.17   ? 167  THR A C     1 
ATOM   1181 O  O     . THR A 1 167 ? 143.200 34.339 -5.426  1.00 3.60   ? 167  THR A O     1 
ATOM   1182 C  CB    . THR A 1 167 ? 142.642 31.404 -4.722  1.00 11.84  ? 167  THR A CB    1 
ATOM   1183 O  OG1   . THR A 1 167 ? 141.454 32.229 -4.772  1.00 13.88  ? 167  THR A OG1   1 
ATOM   1184 C  CG2   . THR A 1 167 ? 142.440 30.327 -3.680  1.00 11.24  ? 167  THR A CG2   1 
ATOM   1185 N  N     . ALA A 1 168 ? 144.488 32.960 -6.612  1.00 15.08  ? 168  ALA A N     1 
ATOM   1186 C  CA    . ALA A 1 168 ? 144.485 33.850 -7.758  1.00 17.22  ? 168  ALA A CA    1 
ATOM   1187 C  C     . ALA A 1 168 ? 143.085 33.885 -8.362  1.00 15.82  ? 168  ALA A C     1 
ATOM   1188 O  O     . ALA A 1 168 ? 142.715 34.838 -9.046  1.00 13.44  ? 168  ALA A O     1 
ATOM   1189 C  CB    . ALA A 1 168 ? 145.499 33.365 -8.804  1.00 18.99  ? 168  ALA A CB    1 
ATOM   1190 N  N     . TYR A 1 169 ? 142.309 32.836 -8.110  1.00 14.27  ? 169  TYR A N     1 
ATOM   1191 C  CA    . TYR A 1 169 ? 140.946 32.761 -8.630  1.00 11.89  ? 169  TYR A CA    1 
ATOM   1192 C  C     . TYR A 1 169 ? 140.167 34.022 -8.236  1.00 19.04  ? 169  TYR A C     1 
ATOM   1193 O  O     . TYR A 1 169 ? 139.293 34.489 -8.966  1.00 13.63  ? 169  TYR A O     1 
ATOM   1194 C  CB    . TYR A 1 169 ? 140.244 31.579 -7.995  1.00 10.19  ? 169  TYR A CB    1 
ATOM   1195 C  CG    . TYR A 1 169 ? 140.453 30.261 -8.697  1.00 9.53   ? 169  TYR A CG    1 
ATOM   1196 C  CD1   . TYR A 1 169 ? 140.685 29.097 -7.966  1.00 2.99   ? 169  TYR A CD1   1 
ATOM   1197 C  CD2   . TYR A 1 169 ? 140.339 30.165 -10.083 1.00 12.91  ? 169  TYR A CD2   1 
ATOM   1198 C  CE1   . TYR A 1 169 ? 140.855 27.879 -8.589  1.00 1.00   ? 169  TYR A CE1   1 
ATOM   1199 C  CE2   . TYR A 1 169 ? 140.518 28.947 -10.724 1.00 14.57  ? 169  TYR A CE2   1 
ATOM   1200 C  CZ    . TYR A 1 169 ? 140.750 27.816 -9.967  1.00 17.20  ? 169  TYR A CZ    1 
ATOM   1201 O  OH    . TYR A 1 169 ? 140.965 26.614 -10.559 1.00 20.56  ? 169  TYR A OH    1 
ATOM   1202 N  N     . THR A 1 170 ? 140.504 34.582 -7.076  1.00 17.05  ? 170  THR A N     1 
ATOM   1203 C  CA    . THR A 1 170 ? 139.841 35.789 -6.590  1.00 17.10  ? 170  THR A CA    1 
ATOM   1204 C  C     . THR A 1 170 ? 140.108 37.013 -7.486  1.00 13.54  ? 170  THR A C     1 
ATOM   1205 O  O     . THR A 1 170 ? 139.395 38.003 -7.423  1.00 8.91   ? 170  THR A O     1 
ATOM   1206 C  CB    . THR A 1 170 ? 140.121 36.114 -4.995  1.00 22.33  ? 170  THR A CB    1 
ATOM   1207 O  OG1   . THR A 1 170 ? 141.513 36.366 -4.726  1.00 13.17  ? 170  THR A OG1   1 
ATOM   1208 C  CG2   . THR A 1 170 ? 139.613 35.029 -4.049  1.00 1.00   ? 170  THR A CG2   1 
ATOM   1209 N  N     . LEU A 1 171 ? 141.121 36.983 -8.325  1.00 10.59  ? 171  LEU A N     1 
ATOM   1210 C  CA    . LEU A 1 171 ? 141.359 38.155 -9.161  1.00 9.96   ? 171  LEU A CA    1 
ATOM   1211 C  C     . LEU A 1 171 ? 140.253 38.418 -10.172 1.00 14.23  ? 171  LEU A C     1 
ATOM   1212 O  O     . LEU A 1 171 ? 140.122 39.526 -10.676 1.00 14.66  ? 171  LEU A O     1 
ATOM   1213 C  CB    . LEU A 1 171 ? 142.673 38.109 -9.822  1.00 8.28   ? 171  LEU A CB    1 
ATOM   1214 C  CG    . LEU A 1 171 ? 143.791 37.729 -8.881  1.00 17.18  ? 171  LEU A CG    1 
ATOM   1215 C  CD1   . LEU A 1 171 ? 145.018 37.454 -9.722  1.00 25.30  ? 171  LEU A CD1   1 
ATOM   1216 C  CD2   . LEU A 1 171 ? 144.061 38.784 -7.820  1.00 9.43   ? 171  LEU A CD2   1 
ATOM   1217 N  N     . THR A 1 172 ? 139.460 37.413 -10.483 1.00 13.92  ? 172  THR A N     1 
ATOM   1218 C  CA    . THR A 1 172 ? 138.396 37.615 -11.452 1.00 12.29  ? 172  THR A CA    1 
ATOM   1219 C  C     . THR A 1 172 ? 137.395 38.681 -11.021 1.00 19.66  ? 172  THR A C     1 
ATOM   1220 O  O     . THR A 1 172 ? 136.866 39.398 -11.871 1.00 21.37  ? 172  THR A O     1 
ATOM   1221 C  CB    . THR A 1 172 ? 137.683 36.400 -11.903 1.00 29.88  ? 172  THR A CB    1 
ATOM   1222 O  OG1   . THR A 1 172 ? 138.627 35.384 -12.278 1.00 41.32  ? 172  THR A OG1   1 
ATOM   1223 C  CG2   . THR A 1 172 ? 136.826 36.788 -13.109 1.00 25.78  ? 172  THR A CG2   1 
ATOM   1224 N  N     . ALA A 1 173 ? 137.129 38.777 -9.712  1.00 9.47   ? 173  ALA A N     1 
ATOM   1225 C  CA    . ALA A 1 173 ? 136.184 39.766 -9.183  1.00 9.16   ? 173  ALA A CA    1 
ATOM   1226 C  C     . ALA A 1 173 ? 136.809 41.153 -9.169  1.00 23.63  ? 173  ALA A C     1 
ATOM   1227 O  O     . ALA A 1 173 ? 136.197 42.134 -9.592  1.00 27.45  ? 173  ALA A O     1 
ATOM   1228 C  CB    . ALA A 1 173 ? 135.571 39.396 -7.809  1.00 7.32   ? 173  ALA A CB    1 
ATOM   1229 N  N     . THR A 1 174 ? 138.037 41.210 -8.678  1.00 24.47  ? 174  THR A N     1 
ATOM   1230 C  CA    . THR A 1 174 ? 138.816 42.438 -8.592  1.00 24.21  ? 174  THR A CA    1 
ATOM   1231 C  C     . THR A 1 174 ? 140.132 42.139 -7.896  1.00 23.68  ? 174  THR A C     1 
ATOM   1232 O  O     . THR A 1 174 ? 140.165 41.409 -6.910  1.00 18.84  ? 174  THR A O     1 
ATOM   1233 C  CB    . THR A 1 174 ? 138.192 43.655 -7.951  1.00 10.70  ? 174  THR A CB    1 
ATOM   1234 O  OG1   . THR A 1 174 ? 139.234 44.636 -7.959  1.00 41.53  ? 174  THR A OG1   1 
ATOM   1235 C  CG2   . THR A 1 174 ? 137.840 43.365 -6.484  1.00 9.34   ? 174  THR A CG2   1 
ATOM   1236 N  N     . PRO A 1 175 ? 141.211 42.692 -8.403  1.00 18.16  ? 175  PRO A N     1 
ATOM   1237 C  CA    . PRO A 1 175 ? 142.500 42.441 -7.797  1.00 14.22  ? 175  PRO A CA    1 
ATOM   1238 C  C     . PRO A 1 175 ? 142.576 43.110 -6.449  1.00 16.15  ? 175  PRO A C     1 
ATOM   1239 O  O     . PRO A 1 175 ? 143.454 42.812 -5.635  1.00 22.26  ? 175  PRO A O     1 
ATOM   1240 C  CB    . PRO A 1 175 ? 143.449 43.144 -8.759  1.00 18.92  ? 175  PRO A CB    1 
ATOM   1241 C  CG    . PRO A 1 175 ? 142.700 43.246 -10.047 1.00 24.58  ? 175  PRO A CG    1 
ATOM   1242 C  CD    . PRO A 1 175 ? 141.326 43.567 -9.577  1.00 20.81  ? 175  PRO A CD    1 
ATOM   1243 N  N     . LYS A 1 176 ? 141.646 44.018 -6.229  1.00 9.54   ? 176  LYS A N     1 
ATOM   1244 C  CA    . LYS A 1 176 ? 141.589 44.774 -4.986  1.00 9.85   ? 176  LYS A CA    1 
ATOM   1245 C  C     . LYS A 1 176 ? 141.557 43.930 -3.725  1.00 15.93  ? 176  LYS A C     1 
ATOM   1246 O  O     . LYS A 1 176 ? 142.325 44.193 -2.798  1.00 24.96  ? 176  LYS A O     1 
ATOM   1247 C  CB    . LYS A 1 176 ? 140.489 45.830 -4.954  1.00 9.30   ? 176  LYS A CB    1 
ATOM   1248 C  CG    . LYS A 1 176 ? 140.955 47.203 -5.336  1.00 6.50   ? 176  LYS A CG    1 
ATOM   1249 C  CD    . LYS A 1 176 ? 140.013 47.809 -6.382  1.00 51.69  ? 176  LYS A CD    1 
ATOM   1250 C  CE    . LYS A 1 176 ? 140.138 49.333 -6.497  1.00 80.94  ? 176  LYS A CE    1 
ATOM   1251 N  NZ    . LYS A 1 176 ? 140.058 49.897 -7.883  1.00 93.60  ? 176  LYS A NZ    1 
ATOM   1252 N  N     . ASN A 1 177 ? 140.668 42.941 -3.683  1.00 13.74  ? 177  ASN A N     1 
ATOM   1253 C  CA    . ASN A 1 177 ? 140.537 42.076 -2.503  1.00 14.59  ? 177  ASN A CA    1 
ATOM   1254 C  C     . ASN A 1 177 ? 141.870 41.570 -1.948  1.00 13.38  ? 177  ASN A C     1 
ATOM   1255 O  O     . ASN A 1 177 ? 142.255 41.904 -0.825  1.00 12.28  ? 177  ASN A O     1 
ATOM   1256 C  CB    . ASN A 1 177 ? 139.299 41.133 -2.452  1.00 14.37  ? 177  ASN A CB    1 
ATOM   1257 C  CG    . ASN A 1 177 ? 137.971 41.848 -2.749  1.00 25.98  ? 177  ASN A CG    1 
ATOM   1258 O  OD1   . ASN A 1 177 ? 137.632 42.888 -2.178  1.00 13.17  ? 177  ASN A OD1   1 
ATOM   1259 N  ND2   . ASN A 1 177 ? 137.204 41.252 -3.637  1.00 23.39  ? 177  ASN A ND2   1 
ATOM   1260 N  N     . ALA A 1 178 ? 142.557 40.765 -2.745  1.00 9.13   ? 178  ALA A N     1 
ATOM   1261 C  CA    . ALA A 1 178 ? 143.841 40.205 -2.370  1.00 5.43   ? 178  ALA A CA    1 
ATOM   1262 C  C     . ALA A 1 178 ? 144.798 41.337 -2.034  1.00 15.31  ? 178  ALA A C     1 
ATOM   1263 O  O     . ALA A 1 178 ? 145.468 41.329 -0.999  1.00 16.83  ? 178  ALA A O     1 
ATOM   1264 C  CB    . ALA A 1 178 ? 144.379 39.486 -3.614  1.00 1.81   ? 178  ALA A CB    1 
ATOM   1265 N  N     . LEU A 1 179 ? 144.843 42.313 -2.934  1.00 3.67   ? 179  LEU A N     1 
ATOM   1266 C  CA    . LEU A 1 179 ? 145.707 43.478 -2.786  1.00 7.64   ? 179  LEU A CA    1 
ATOM   1267 C  C     . LEU A 1 179 ? 145.508 44.099 -1.418  1.00 18.41  ? 179  LEU A C     1 
ATOM   1268 O  O     . LEU A 1 179 ? 146.450 44.400 -0.680  1.00 10.03  ? 179  LEU A O     1 
ATOM   1269 C  CB    . LEU A 1 179 ? 145.392 44.451 -3.951  1.00 5.74   ? 179  LEU A CB    1 
ATOM   1270 C  CG    . LEU A 1 179 ? 146.248 43.954 -5.112  1.00 14.49  ? 179  LEU A CG    1 
ATOM   1271 C  CD1   . LEU A 1 179 ? 146.314 44.889 -6.313  1.00 18.24  ? 179  LEU A CD1   1 
ATOM   1272 C  CD2   . LEU A 1 179 ? 147.623 43.715 -4.538  1.00 14.84  ? 179  LEU A CD2   1 
ATOM   1273 N  N     . GLU A 1 180 ? 144.257 44.281 -1.087  1.00 19.60  ? 180  GLU A N     1 
ATOM   1274 C  CA    . GLU A 1 180 ? 143.942 44.852 0.182   1.00 18.53  ? 180  GLU A CA    1 
ATOM   1275 C  C     . GLU A 1 180 ? 144.434 43.927 1.289   1.00 18.07  ? 180  GLU A C     1 
ATOM   1276 O  O     . GLU A 1 180 ? 145.232 44.326 2.132   1.00 17.63  ? 180  GLU A O     1 
ATOM   1277 C  CB    . GLU A 1 180 ? 142.463 45.151 0.206   1.00 18.38  ? 180  GLU A CB    1 
ATOM   1278 C  CG    . GLU A 1 180 ? 142.113 46.560 0.623   1.00 25.58  ? 180  GLU A CG    1 
ATOM   1279 C  CD    . GLU A 1 180 ? 140.810 47.036 -0.025  1.00 93.37  ? 180  GLU A CD    1 
ATOM   1280 O  OE1   . GLU A 1 180 ? 139.712 46.584 0.397   1.00 79.60  ? 180  GLU A OE1   1 
ATOM   1281 O  OE2   . GLU A 1 180 ? 140.886 47.854 -0.972  1.00 100.00 ? 180  GLU A OE2   1 
ATOM   1282 N  N     . VAL A 1 181 ? 143.970 42.689 1.291   1.00 15.47  ? 181  VAL A N     1 
ATOM   1283 C  CA    . VAL A 1 181 ? 144.391 41.752 2.327   1.00 13.84  ? 181  VAL A CA    1 
ATOM   1284 C  C     . VAL A 1 181 ? 145.896 41.627 2.385   1.00 20.53  ? 181  VAL A C     1 
ATOM   1285 O  O     . VAL A 1 181 ? 146.492 41.612 3.461   1.00 22.87  ? 181  VAL A O     1 
ATOM   1286 C  CB    . VAL A 1 181 ? 143.900 40.367 2.047   1.00 14.65  ? 181  VAL A CB    1 
ATOM   1287 C  CG1   . VAL A 1 181 ? 144.406 39.405 3.122   1.00 8.18   ? 181  VAL A CG1   1 
ATOM   1288 C  CG2   . VAL A 1 181 ? 142.381 40.427 1.978   1.00 18.34  ? 181  VAL A CG2   1 
ATOM   1289 N  N     . ALA A 1 182 ? 146.500 41.527 1.216   1.00 14.51  ? 182  ALA A N     1 
ATOM   1290 C  CA    . ALA A 1 182 ? 147.939 41.393 1.137   1.00 15.58  ? 182  ALA A CA    1 
ATOM   1291 C  C     . ALA A 1 182 ? 148.631 42.568 1.794   1.00 29.66  ? 182  ALA A C     1 
ATOM   1292 O  O     . ALA A 1 182 ? 149.548 42.385 2.597   1.00 33.46  ? 182  ALA A O     1 
ATOM   1293 C  CB    . ALA A 1 182 ? 148.404 41.225 -0.296  1.00 17.93  ? 182  ALA A CB    1 
ATOM   1294 N  N     . GLY A 1 183 ? 148.187 43.777 1.455   1.00 22.23  ? 183  GLY A N     1 
ATOM   1295 C  CA    . GLY A 1 183 ? 148.783 44.982 2.020   1.00 21.39  ? 183  GLY A CA    1 
ATOM   1296 C  C     . GLY A 1 183 ? 148.574 45.120 3.529   1.00 18.58  ? 183  GLY A C     1 
ATOM   1297 O  O     . GLY A 1 183 ? 149.263 45.886 4.193   1.00 22.41  ? 183  GLY A O     1 
ATOM   1298 N  N     . TYR A 1 184 ? 147.630 44.400 4.092   1.00 14.35  ? 184  TYR A N     1 
ATOM   1299 C  CA    . TYR A 1 184 ? 147.422 44.538 5.527   1.00 18.09  ? 184  TYR A CA    1 
ATOM   1300 C  C     . TYR A 1 184 ? 148.430 43.711 6.325   1.00 32.39  ? 184  TYR A C     1 
ATOM   1301 O  O     . TYR A 1 184 ? 149.111 44.225 7.218   1.00 29.50  ? 184  TYR A O     1 
ATOM   1302 C  CB    . TYR A 1 184 ? 145.956 44.337 5.880   1.00 14.86  ? 184  TYR A CB    1 
ATOM   1303 C  CG    . TYR A 1 184 ? 145.732 44.121 7.318   1.00 15.11  ? 184  TYR A CG    1 
ATOM   1304 C  CD1   . TYR A 1 184 ? 145.695 45.189 8.191   1.00 17.69  ? 184  TYR A CD1   1 
ATOM   1305 C  CD2   . TYR A 1 184 ? 145.547 42.856 7.824   1.00 16.61  ? 184  TYR A CD2   1 
ATOM   1306 C  CE1   . TYR A 1 184 ? 145.482 45.015 9.546   1.00 19.61  ? 184  TYR A CE1   1 
ATOM   1307 C  CE2   . TYR A 1 184 ? 145.325 42.655 9.191   1.00 20.03  ? 184  TYR A CE2   1 
ATOM   1308 C  CZ    . TYR A 1 184 ? 145.314 43.763 10.069  1.00 32.71  ? 184  TYR A CZ    1 
ATOM   1309 O  OH    . TYR A 1 184 ? 145.100 43.713 11.457  1.00 24.57  ? 184  TYR A OH    1 
ATOM   1310 N  N     . ALA A 1 185 ? 148.521 42.430 5.983   1.00 31.20  ? 185  ALA A N     1 
ATOM   1311 C  CA    . ALA A 1 185 ? 149.435 41.508 6.644   1.00 29.69  ? 185  ALA A CA    1 
ATOM   1312 C  C     . ALA A 1 185 ? 150.870 42.024 6.617   1.00 23.92  ? 185  ALA A C     1 
ATOM   1313 O  O     . ALA A 1 185 ? 151.601 41.893 7.594   1.00 18.45  ? 185  ALA A O     1 
ATOM   1314 C  CB    . ALA A 1 185 ? 149.380 40.170 5.940   1.00 31.49  ? 185  ALA A CB    1 
ATOM   1315 N  N     . HIS A 1 186 ? 151.258 42.601 5.486   1.00 21.83  ? 186  HIS A N     1 
ATOM   1316 C  CA    . HIS A 1 186 ? 152.594 43.144 5.282   1.00 27.13  ? 186  HIS A CA    1 
ATOM   1317 C  C     . HIS A 1 186 ? 152.943 44.242 6.275   1.00 32.82  ? 186  HIS A C     1 
ATOM   1318 O  O     . HIS A 1 186 ? 154.119 44.509 6.539   1.00 38.42  ? 186  HIS A O     1 
ATOM   1319 C  CB    . HIS A 1 186 ? 152.619 43.810 3.922   1.00 34.34  ? 186  HIS A CB    1 
ATOM   1320 C  CG    . HIS A 1 186 ? 153.956 44.355 3.562   1.00 43.62  ? 186  HIS A CG    1 
ATOM   1321 N  ND1   . HIS A 1 186 ? 154.862 43.643 2.808   1.00 47.64  ? 186  HIS A ND1   1 
ATOM   1322 C  CD2   . HIS A 1 186 ? 154.541 45.543 3.844   1.00 48.85  ? 186  HIS A CD2   1 
ATOM   1323 C  CE1   . HIS A 1 186 ? 155.952 44.369 2.639   1.00 49.10  ? 186  HIS A CE1   1 
ATOM   1324 N  NE2   . HIS A 1 186 ? 155.783 45.524 3.260   1.00 49.52  ? 186  HIS A NE2   1 
ATOM   1325 N  N     . GLY A 1 187 ? 151.921 44.884 6.813   1.00 20.21  ? 187  GLY A N     1 
ATOM   1326 C  CA    . GLY A 1 187 ? 152.131 45.944 7.776   1.00 18.53  ? 187  GLY A CA    1 
ATOM   1327 C  C     . GLY A 1 187 ? 152.168 45.324 9.155   1.00 29.99  ? 187  GLY A C     1 
ATOM   1328 O  O     . GLY A 1 187 ? 152.593 45.933 10.135  1.00 27.73  ? 187  GLY A O     1 
ATOM   1329 N  N     . ILE A 1 188 ? 151.706 44.090 9.219   1.00 36.41  ? 188  ILE A N     1 
ATOM   1330 C  CA    . ILE A 1 188 ? 151.703 43.398 10.481  1.00 36.71  ? 188  ILE A CA    1 
ATOM   1331 C  C     . ILE A 1 188 ? 152.986 42.632 10.637  1.00 39.47  ? 188  ILE A C     1 
ATOM   1332 O  O     . ILE A 1 188 ? 153.322 41.761 9.837   1.00 37.75  ? 188  ILE A O     1 
ATOM   1333 C  CB    . ILE A 1 188 ? 150.634 42.310 10.636  1.00 41.50  ? 188  ILE A CB    1 
ATOM   1334 C  CG1   . ILE A 1 188 ? 149.312 42.943 11.004  1.00 40.87  ? 188  ILE A CG1   1 
ATOM   1335 C  CG2   . ILE A 1 188 ? 151.004 41.419 11.831  1.00 45.98  ? 188  ILE A CG2   1 
ATOM   1336 C  CD1   . ILE A 1 188 ? 148.862 43.964 9.993   1.00 70.60  ? 188  ILE A CD1   1 
ATOM   1337 N  N     . PRO A 1 189 ? 153.700 42.964 11.672  1.00 42.68  ? 189  PRO A N     1 
ATOM   1338 C  CA    . PRO A 1 189 ? 154.937 42.283 11.941  1.00 42.31  ? 189  PRO A CA    1 
ATOM   1339 C  C     . PRO A 1 189 ? 154.543 40.886 12.408  1.00 39.89  ? 189  PRO A C     1 
ATOM   1340 O  O     . PRO A 1 189 ? 153.700 40.765 13.302  1.00 29.38  ? 189  PRO A O     1 
ATOM   1341 C  CB    . PRO A 1 189 ? 155.472 43.095 13.104  1.00 44.67  ? 189  PRO A CB    1 
ATOM   1342 C  CG    . PRO A 1 189 ? 154.237 43.553 13.836  1.00 51.90  ? 189  PRO A CG    1 
ATOM   1343 C  CD    . PRO A 1 189 ? 153.084 43.538 12.874  1.00 45.95  ? 189  PRO A CD    1 
ATOM   1344 N  N     . ASN A 1 190 ? 155.140 39.856 11.792  1.00 39.06  ? 190  ASN A N     1 
ATOM   1345 C  CA    . ASN A 1 190 ? 154.874 38.447 12.111  1.00 41.26  ? 190  ASN A CA    1 
ATOM   1346 C  C     . ASN A 1 190 ? 153.749 37.871 11.249  1.00 42.03  ? 190  ASN A C     1 
ATOM   1347 O  O     . ASN A 1 190 ? 153.537 36.657 11.202  1.00 38.11  ? 190  ASN A O     1 
ATOM   1348 C  CB    . ASN A 1 190 ? 154.683 38.175 13.595  1.00 56.56  ? 190  ASN A CB    1 
ATOM   1349 C  CG    . ASN A 1 190 ? 155.633 38.958 14.430  1.00 100.00 ? 190  ASN A CG    1 
ATOM   1350 O  OD1   . ASN A 1 190 ? 155.285 40.021 14.963  1.00 100.00 ? 190  ASN A OD1   1 
ATOM   1351 N  ND2   . ASN A 1 190 ? 156.867 38.462 14.533  1.00 85.72  ? 190  ASN A ND2   1 
ATOM   1352 N  N     . ALA A 1 191 ? 153.035 38.755 10.565  1.00 31.55  ? 191  ALA A N     1 
ATOM   1353 C  CA    . ALA A 1 191 ? 151.943 38.355 9.698   1.00 29.00  ? 191  ALA A CA    1 
ATOM   1354 C  C     . ALA A 1 191 ? 152.499 37.953 8.338   1.00 36.91  ? 191  ALA A C     1 
ATOM   1355 O  O     . ALA A 1 191 ? 153.409 38.603 7.830   1.00 34.21  ? 191  ALA A O     1 
ATOM   1356 C  CB    . ALA A 1 191 ? 150.982 39.549 9.487   1.00 28.17  ? 191  ALA A CB    1 
ATOM   1357 N  N     . ILE A 1 192 ? 151.956 36.890 7.741   1.00 35.91  ? 192  ILE A N     1 
ATOM   1358 C  CA    . ILE A 1 192 ? 152.435 36.452 6.431   1.00 34.24  ? 192  ILE A CA    1 
ATOM   1359 C  C     . ILE A 1 192 ? 151.309 36.335 5.408   1.00 26.39  ? 192  ILE A C     1 
ATOM   1360 O  O     . ILE A 1 192 ? 150.180 35.963 5.731   1.00 24.08  ? 192  ILE A O     1 
ATOM   1361 C  CB    . ILE A 1 192 ? 153.325 35.196 6.458   1.00 41.70  ? 192  ILE A CB    1 
ATOM   1362 C  CG1   . ILE A 1 192 ? 153.072 34.284 5.252   1.00 43.68  ? 192  ILE A CG1   1 
ATOM   1363 C  CG2   . ILE A 1 192 ? 153.031 34.383 7.707   1.00 48.74  ? 192  ILE A CG2   1 
ATOM   1364 C  CD1   . ILE A 1 192 ? 153.173 32.808 5.611   1.00 56.66  ? 192  ILE A CD1   1 
ATOM   1365 N  N     . PHE A 1 193 ? 151.618 36.651 4.165   1.00 14.85  ? 193  PHE A N     1 
ATOM   1366 C  CA    . PHE A 1 193 ? 150.626 36.559 3.116   1.00 10.21  ? 193  PHE A CA    1 
ATOM   1367 C  C     . PHE A 1 193 ? 150.983 35.396 2.215   1.00 24.66  ? 193  PHE A C     1 
ATOM   1368 O  O     . PHE A 1 193 ? 152.142 35.223 1.826   1.00 24.35  ? 193  PHE A O     1 
ATOM   1369 C  CB    . PHE A 1 193 ? 150.333 37.845 2.335   1.00 9.81   ? 193  PHE A CB    1 
ATOM   1370 C  CG    . PHE A 1 193 ? 149.349 37.666 1.167   1.00 10.92  ? 193  PHE A CG    1 
ATOM   1371 C  CD1   . PHE A 1 193 ? 149.784 37.760 -0.153  1.00 14.03  ? 193  PHE A CD1   1 
ATOM   1372 C  CD2   . PHE A 1 193 ? 148.004 37.427 1.372   1.00 16.50  ? 193  PHE A CD2   1 
ATOM   1373 C  CE1   . PHE A 1 193 ? 148.911 37.619 -1.225  1.00 13.21  ? 193  PHE A CE1   1 
ATOM   1374 C  CE2   . PHE A 1 193 ? 147.127 37.278 0.298   1.00 18.36  ? 193  PHE A CE2   1 
ATOM   1375 C  CZ    . PHE A 1 193 ? 147.580 37.374 -0.998  1.00 15.27  ? 193  PHE A CZ    1 
ATOM   1376 N  N     . THR A 1 194 ? 149.977 34.599 1.898   1.00 24.86  ? 194  THR A N     1 
ATOM   1377 C  CA    . THR A 1 194 ? 150.148 33.435 1.049   1.00 18.52  ? 194  THR A CA    1 
ATOM   1378 C  C     . THR A 1 194 ? 149.152 33.454 -0.091  1.00 18.70  ? 194  THR A C     1 
ATOM   1379 O  O     . THR A 1 194 ? 147.989 33.850 0.060   1.00 19.84  ? 194  THR A O     1 
ATOM   1380 C  CB    . THR A 1 194 ? 150.008 32.173 1.850   1.00 14.02  ? 194  THR A CB    1 
ATOM   1381 O  OG1   . THR A 1 194 ? 148.645 32.031 2.218   1.00 21.57  ? 194  THR A OG1   1 
ATOM   1382 C  CG2   . THR A 1 194 ? 150.798 32.308 3.150   1.00 14.17  ? 194  THR A CG2   1 
ATOM   1383 N  N     . LEU A 1 195 ? 149.624 33.017 -1.234  1.00 11.74  ? 195  LEU A N     1 
ATOM   1384 C  CA    . LEU A 1 195 ? 148.785 33.002 -2.396  1.00 11.36  ? 195  LEU A CA    1 
ATOM   1385 C  C     . LEU A 1 195 ? 148.969 31.755 -3.242  1.00 16.81  ? 195  LEU A C     1 
ATOM   1386 O  O     . LEU A 1 195 ? 150.033 31.128 -3.261  1.00 18.25  ? 195  LEU A O     1 
ATOM   1387 C  CB    . LEU A 1 195 ? 149.301 34.193 -3.172  1.00 9.89   ? 195  LEU A CB    1 
ATOM   1388 C  CG    . LEU A 1 195 ? 148.891 34.136 -4.604  1.00 18.15  ? 195  LEU A CG    1 
ATOM   1389 C  CD1   . LEU A 1 195 ? 147.394 34.328 -4.660  1.00 27.26  ? 195  LEU A CD1   1 
ATOM   1390 C  CD2   . LEU A 1 195 ? 149.595 35.222 -5.351  1.00 5.35   ? 195  LEU A CD2   1 
ATOM   1391 N  N     . ASN A 1 196 ? 147.913 31.410 -3.952  1.00 6.20   ? 196  ASN A N     1 
ATOM   1392 C  CA    . ASN A 1 196 ? 147.930 30.252 -4.817  1.00 6.22   ? 196  ASN A CA    1 
ATOM   1393 C  C     . ASN A 1 196 ? 147.713 30.712 -6.250  1.00 19.38  ? 196  ASN A C     1 
ATOM   1394 O  O     . ASN A 1 196 ? 146.925 31.628 -6.475  1.00 21.30  ? 196  ASN A O     1 
ATOM   1395 C  CB    . ASN A 1 196 ? 146.758 29.431 -4.397  1.00 3.34   ? 196  ASN A CB    1 
ATOM   1396 C  CG    . ASN A 1 196 ? 146.747 28.075 -4.991  1.00 34.10  ? 196  ASN A CG    1 
ATOM   1397 O  OD1   . ASN A 1 196 ? 146.628 27.099 -4.228  1.00 21.96  ? 196  ASN A OD1   1 
ATOM   1398 N  ND2   . ASN A 1 196 ? 146.783 27.972 -6.350  1.00 6.73   ? 196  ASN A ND2   1 
ATOM   1399 N  N     . LEU A 1 197 ? 148.409 30.082 -7.209  1.00 15.18  ? 197  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 197 ? 148.289 30.427 -8.632  1.00 13.58  ? 197  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 197 ? 146.937 29.987 -9.235  1.00 19.88  ? 197  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 197 ? 146.580 30.379 -10.352 1.00 24.48  ? 197  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 197 ? 149.520 29.931 -9.459  1.00 14.92  ? 197  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 197 ? 150.925 30.504 -9.184  1.00 16.98  ? 197  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 197 ? 151.962 30.069 -10.239 1.00 22.43  ? 197  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 197 ? 150.857 32.020 -9.144  1.00 12.73  ? 197  LEU A CD2   1 
ATOM   1407 N  N     . SER A 1 198 ? 146.189 29.172 -8.491  1.00 10.13  ? 198  SER A N     1 
ATOM   1408 C  CA    . SER A 1 198 ? 144.878 28.681 -8.921  1.00 7.67   ? 198  SER A CA    1 
ATOM   1409 C  C     . SER A 1 198 ? 144.845 27.993 -10.283 1.00 15.94  ? 198  SER A C     1 
ATOM   1410 O  O     . SER A 1 198 ? 144.443 26.835 -10.378 1.00 18.86  ? 198  SER A O     1 
ATOM   1411 C  CB    . SER A 1 198 ? 143.821 29.775 -8.874  1.00 1.92   ? 198  SER A CB    1 
ATOM   1412 O  OG    . SER A 1 198 ? 143.850 30.394 -7.593  1.00 5.97   ? 198  SER A OG    1 
ATOM   1413 N  N     . ALA A 1 199 ? 145.232 28.686 -11.341 1.00 15.54  ? 199  ALA A N     1 
ATOM   1414 C  CA    . ALA A 1 199 ? 145.192 28.055 -12.659 1.00 15.22  ? 199  ALA A CA    1 
ATOM   1415 C  C     . ALA A 1 199 ? 145.998 28.831 -13.692 1.00 16.33  ? 199  ALA A C     1 
ATOM   1416 O  O     . ALA A 1 199 ? 146.272 30.014 -13.509 1.00 13.04  ? 199  ALA A O     1 
ATOM   1417 C  CB    . ALA A 1 199 ? 143.730 28.011 -13.128 1.00 17.13  ? 199  ALA A CB    1 
ATOM   1418 N  N     . PRO A 1 200 ? 146.356 28.160 -14.787 1.00 14.37  ? 200  PRO A N     1 
ATOM   1419 C  CA    . PRO A 1 200 ? 147.125 28.796 -15.851 1.00 10.39  ? 200  PRO A CA    1 
ATOM   1420 C  C     . PRO A 1 200 ? 146.493 30.104 -16.301 1.00 7.02   ? 200  PRO A C     1 
ATOM   1421 O  O     . PRO A 1 200 ? 147.184 31.110 -16.476 1.00 9.80   ? 200  PRO A O     1 
ATOM   1422 C  CB    . PRO A 1 200 ? 147.055 27.739 -16.968 1.00 10.27  ? 200  PRO A CB    1 
ATOM   1423 C  CG    . PRO A 1 200 ? 147.204 26.469 -16.201 1.00 11.80  ? 200  PRO A CG    1 
ATOM   1424 C  CD    . PRO A 1 200 ? 146.239 26.704 -15.051 1.00 12.01  ? 200  PRO A CD    1 
ATOM   1425 N  N     . PHE A 1 201 ? 145.177 30.078 -16.491 1.00 2.43   ? 201  PHE A N     1 
ATOM   1426 C  CA    . PHE A 1 201 ? 144.427 31.251 -16.933 1.00 6.98   ? 201  PHE A CA    1 
ATOM   1427 C  C     . PHE A 1 201 ? 144.561 32.441 -15.997 1.00 16.93  ? 201  PHE A C     1 
ATOM   1428 O  O     . PHE A 1 201 ? 144.560 33.589 -16.445 1.00 17.77  ? 201  PHE A O     1 
ATOM   1429 C  CB    . PHE A 1 201 ? 142.952 30.971 -17.329 1.00 7.05   ? 201  PHE A CB    1 
ATOM   1430 C  CG    . PHE A 1 201 ? 141.941 31.096 -16.191 1.00 10.82  ? 201  PHE A CG    1 
ATOM   1431 C  CD1   . PHE A 1 201 ? 141.555 32.326 -15.678 1.00 15.48  ? 201  PHE A CD1   1 
ATOM   1432 C  CD2   . PHE A 1 201 ? 141.357 29.958 -15.642 1.00 14.77  ? 201  PHE A CD2   1 
ATOM   1433 C  CE1   . PHE A 1 201 ? 140.604 32.407 -14.651 1.00 13.97  ? 201  PHE A CE1   1 
ATOM   1434 C  CE2   . PHE A 1 201 ? 140.422 30.040 -14.608 1.00 14.12  ? 201  PHE A CE2   1 
ATOM   1435 C  CZ    . PHE A 1 201 ? 140.050 31.260 -14.109 1.00 10.58  ? 201  PHE A CZ    1 
ATOM   1436 N  N     . CYS A 1 202 ? 144.663 32.183 -14.702 1.00 14.07  ? 202  CYS A N     1 
ATOM   1437 C  CA    . CYS A 1 202 ? 144.796 33.286 -13.764 1.00 16.73  ? 202  CYS A CA    1 
ATOM   1438 C  C     . CYS A 1 202 ? 146.117 33.963 -14.069 1.00 22.81  ? 202  CYS A C     1 
ATOM   1439 O  O     . CYS A 1 202 ? 146.190 35.158 -14.373 1.00 22.73  ? 202  CYS A O     1 
ATOM   1440 C  CB    . CYS A 1 202 ? 144.745 32.752 -12.340 1.00 21.34  ? 202  CYS A CB    1 
ATOM   1441 S  SG    . CYS A 1 202 ? 143.109 32.049 -11.865 1.00 25.60  ? 202  CYS A SG    1 
ATOM   1442 N  N     . VAL A 1 203 ? 147.157 33.149 -13.994 1.00 23.54  ? 203  VAL A N     1 
ATOM   1443 C  CA    . VAL A 1 203 ? 148.516 33.565 -14.265 1.00 19.27  ? 203  VAL A CA    1 
ATOM   1444 C  C     . VAL A 1 203 ? 148.563 34.307 -15.584 1.00 22.82  ? 203  VAL A C     1 
ATOM   1445 O  O     . VAL A 1 203 ? 149.230 35.329 -15.715 1.00 28.54  ? 203  VAL A O     1 
ATOM   1446 C  CB    . VAL A 1 203 ? 149.206 32.250 -14.622 1.00 23.41  ? 203  VAL A CB    1 
ATOM   1447 C  CG1   . VAL A 1 203 ? 150.574 32.479 -15.212 1.00 23.09  ? 203  VAL A CG1   1 
ATOM   1448 C  CG2   . VAL A 1 203 ? 149.274 31.386 -13.380 1.00 25.06  ? 203  VAL A CG2   1 
ATOM   1449 N  N     . GLU A 1 204 ? 147.836 33.780 -16.560 1.00 18.28  ? 204  GLU A N     1 
ATOM   1450 C  CA    . GLU A 1 204 ? 147.786 34.374 -17.891 1.00 18.34  ? 204  GLU A CA    1 
ATOM   1451 C  C     . GLU A 1 204 ? 147.011 35.694 -17.992 1.00 24.33  ? 204  GLU A C     1 
ATOM   1452 O  O     . GLU A 1 204 ? 147.476 36.612 -18.657 1.00 26.69  ? 204  GLU A O     1 
ATOM   1453 C  CB    . GLU A 1 204 ? 147.442 33.350 -18.977 1.00 18.47  ? 204  GLU A CB    1 
ATOM   1454 C  CG    . GLU A 1 204 ? 148.401 32.159 -18.993 1.00 34.83  ? 204  GLU A CG    1 
ATOM   1455 C  CD    . GLU A 1 204 ? 149.569 32.366 -19.956 1.00 68.82  ? 204  GLU A CD    1 
ATOM   1456 O  OE1   . GLU A 1 204 ? 150.745 32.046 -19.612 1.00 48.78  ? 204  GLU A OE1   1 
ATOM   1457 O  OE2   . GLU A 1 204 ? 149.297 32.883 -21.061 1.00 48.80  ? 204  GLU A OE2   1 
ATOM   1458 N  N     . LEU A 1 205 ? 145.847 35.804 -17.350 1.00 21.37  ? 205  LEU A N     1 
ATOM   1459 C  CA    . LEU A 1 205 ? 145.055 37.035 -17.424 1.00 22.23  ? 205  LEU A CA    1 
ATOM   1460 C  C     . LEU A 1 205 ? 145.360 38.109 -16.379 1.00 26.28  ? 205  LEU A C     1 
ATOM   1461 O  O     . LEU A 1 205 ? 145.219 39.289 -16.680 1.00 28.20  ? 205  LEU A O     1 
ATOM   1462 C  CB    . LEU A 1 205 ? 143.563 36.768 -17.207 1.00 27.35  ? 205  LEU A CB    1 
ATOM   1463 C  CG    . LEU A 1 205 ? 142.676 36.129 -18.276 1.00 36.07  ? 205  LEU A CG    1 
ATOM   1464 C  CD1   . LEU A 1 205 ? 143.474 35.657 -19.485 1.00 37.70  ? 205  LEU A CD1   1 
ATOM   1465 C  CD2   . LEU A 1 205 ? 141.925 34.975 -17.657 1.00 39.55  ? 205  LEU A CD2   1 
ATOM   1466 N  N     . TYR A 1 206 ? 145.745 37.748 -15.158 1.00 20.92  ? 206  TYR A N     1 
ATOM   1467 C  CA    . TYR A 1 206 ? 146.008 38.783 -14.155 1.00 16.02  ? 206  TYR A CA    1 
ATOM   1468 C  C     . TYR A 1 206 ? 147.475 39.132 -13.977 1.00 25.01  ? 206  TYR A C     1 
ATOM   1469 O  O     . TYR A 1 206 ? 147.960 39.316 -12.854 1.00 23.20  ? 206  TYR A O     1 
ATOM   1470 C  CB    . TYR A 1 206 ? 145.280 38.446 -12.899 1.00 22.27  ? 206  TYR A CB    1 
ATOM   1471 C  CG    . TYR A 1 206 ? 143.876 37.971 -13.250 1.00 38.04  ? 206  TYR A CG    1 
ATOM   1472 C  CD1   . TYR A 1 206 ? 143.238 36.968 -12.530 1.00 41.07  ? 206  TYR A CD1   1 
ATOM   1473 C  CD2   . TYR A 1 206 ? 143.188 38.528 -14.323 1.00 42.41  ? 206  TYR A CD2   1 
ATOM   1474 C  CE1   . TYR A 1 206 ? 141.956 36.559 -12.854 1.00 42.22  ? 206  TYR A CE1   1 
ATOM   1475 C  CE2   . TYR A 1 206 ? 141.912 38.118 -14.652 1.00 43.75  ? 206  TYR A CE2   1 
ATOM   1476 C  CZ    . TYR A 1 206 ? 141.308 37.141 -13.923 1.00 42.91  ? 206  TYR A CZ    1 
ATOM   1477 O  OH    . TYR A 1 206 ? 140.049 36.772 -14.289 1.00 22.10  ? 206  TYR A OH    1 
ATOM   1478 N  N     . LYS A 1 207 ? 148.170 39.286 -15.093 1.00 32.11  ? 207  LYS A N     1 
ATOM   1479 C  CA    . LYS A 1 207 ? 149.590 39.622 -15.094 1.00 38.07  ? 207  LYS A CA    1 
ATOM   1480 C  C     . LYS A 1 207 ? 149.918 40.805 -14.185 1.00 39.42  ? 207  LYS A C     1 
ATOM   1481 O  O     . LYS A 1 207 ? 150.407 40.632 -13.071 1.00 42.66  ? 207  LYS A O     1 
ATOM   1482 C  CB    . LYS A 1 207 ? 150.010 40.008 -16.517 1.00 46.15  ? 207  LYS A CB    1 
ATOM   1483 C  CG    . LYS A 1 207 ? 149.149 39.434 -17.653 1.00 87.37  ? 207  LYS A CG    1 
ATOM   1484 C  CD    . LYS A 1 207 ? 147.705 39.949 -17.767 1.00 81.29  ? 207  LYS A CD    1 
ATOM   1485 C  CE    . LYS A 1 207 ? 147.518 41.453 -17.920 1.00 56.52  ? 207  LYS A CE    1 
ATOM   1486 N  NZ    . LYS A 1 207 ? 146.306 41.923 -17.197 1.00 66.97  ? 207  LYS A NZ    1 
ATOM   1487 N  N     . ASP A 1 208 ? 149.646 42.004 -14.685 1.00 32.41  ? 208  ASP A N     1 
ATOM   1488 C  CA    . ASP A 1 208 ? 149.899 43.254 -13.969 1.00 28.42  ? 208  ASP A CA    1 
ATOM   1489 C  C     . ASP A 1 208 ? 149.477 43.230 -12.509 1.00 21.93  ? 208  ASP A C     1 
ATOM   1490 O  O     . ASP A 1 208 ? 150.230 43.668 -11.646 1.00 28.49  ? 208  ASP A O     1 
ATOM   1491 C  CB    . ASP A 1 208 ? 149.319 44.446 -14.701 1.00 33.57  ? 208  ASP A CB    1 
ATOM   1492 C  CG    . ASP A 1 208 ? 149.510 44.351 -16.216 1.00 68.93  ? 208  ASP A CG    1 
ATOM   1493 O  OD1   . ASP A 1 208 ? 150.017 43.312 -16.701 1.00 72.26  ? 208  ASP A OD1   1 
ATOM   1494 O  OD2   . ASP A 1 208 ? 149.167 45.320 -16.932 1.00 78.70  ? 208  ASP A OD2   1 
ATOM   1495 N  N     . ALA A 1 209 ? 148.291 42.733 -12.207 1.00 14.91  ? 209  ALA A N     1 
ATOM   1496 C  CA    . ALA A 1 209 ? 147.901 42.713 -10.810 1.00 21.04  ? 209  ALA A CA    1 
ATOM   1497 C  C     . ALA A 1 209 ? 148.731 41.687 -10.066 1.00 32.88  ? 209  ALA A C     1 
ATOM   1498 O  O     . ALA A 1 209 ? 149.197 41.951 -8.952  1.00 37.38  ? 209  ALA A O     1 
ATOM   1499 C  CB    . ALA A 1 209 ? 146.448 42.411 -10.621 1.00 23.83  ? 209  ALA A CB    1 
ATOM   1500 N  N     . MET A 1 210 ? 148.900 40.518 -10.690 1.00 27.34  ? 210  MET A N     1 
ATOM   1501 C  CA    . MET A 1 210 ? 149.676 39.453 -10.076 1.00 28.38  ? 210  MET A CA    1 
ATOM   1502 C  C     . MET A 1 210 ? 151.036 39.987 -9.677  1.00 28.36  ? 210  MET A C     1 
ATOM   1503 O  O     . MET A 1 210 ? 151.518 39.736 -8.575  1.00 26.81  ? 210  MET A O     1 
ATOM   1504 C  CB    . MET A 1 210 ? 149.716 38.163 -10.874 1.00 33.33  ? 210  MET A CB    1 
ATOM   1505 C  CG    . MET A 1 210 ? 149.454 36.964 -9.983  1.00 40.70  ? 210  MET A CG    1 
ATOM   1506 S  SD    . MET A 1 210 ? 149.169 35.487 -10.952 1.00 50.12  ? 210  MET A SD    1 
ATOM   1507 C  CE    . MET A 1 210 ? 150.360 35.753 -12.282 1.00 46.78  ? 210  MET A CE    1 
ATOM   1508 N  N     . GLN A 1 211 ? 151.642 40.754 -10.573 1.00 28.49  ? 211  GLN A N     1 
ATOM   1509 C  CA    . GLN A 1 211 ? 152.947 41.332 -10.291 1.00 26.73  ? 211  GLN A CA    1 
ATOM   1510 C  C     . GLN A 1 211 ? 152.960 42.104 -8.968  1.00 26.71  ? 211  GLN A C     1 
ATOM   1511 O  O     . GLN A 1 211 ? 153.799 41.837 -8.115  1.00 34.56  ? 211  GLN A O     1 
ATOM   1512 C  CB    . GLN A 1 211 ? 153.445 42.203 -11.438 1.00 29.82  ? 211  GLN A CB    1 
ATOM   1513 C  CG    . GLN A 1 211 ? 154.975 42.094 -11.743 1.00 83.68  ? 211  GLN A CG    1 
ATOM   1514 C  CD    . GLN A 1 211 ? 155.675 43.454 -12.024 1.00 100.00 ? 211  GLN A CD    1 
ATOM   1515 O  OE1   . GLN A 1 211 ? 156.217 44.088 -11.109 1.00 93.42  ? 211  GLN A OE1   1 
ATOM   1516 N  NE2   . GLN A 1 211 ? 155.676 43.880 -13.291 1.00 100.00 ? 211  GLN A NE2   1 
ATOM   1517 N  N     . SER A 1 212 ? 152.041 43.053 -8.788  1.00 16.03  ? 212  SER A N     1 
ATOM   1518 C  CA    . SER A 1 212 ? 151.991 43.848 -7.555  1.00 16.81  ? 212  SER A CA    1 
ATOM   1519 C  C     . SER A 1 212 ? 151.747 43.038 -6.285  1.00 29.95  ? 212  SER A C     1 
ATOM   1520 O  O     . SER A 1 212 ? 152.328 43.326 -5.234  1.00 32.38  ? 212  SER A O     1 
ATOM   1521 C  CB    . SER A 1 212 ? 151.065 45.066 -7.657  1.00 27.07  ? 212  SER A CB    1 
ATOM   1522 O  OG    . SER A 1 212 ? 150.927 45.509 -9.007  1.00 34.23  ? 212  SER A OG    1 
ATOM   1523 N  N     . LEU A 1 213 ? 150.884 42.039 -6.372  1.00 23.85  ? 213  LEU A N     1 
ATOM   1524 C  CA    . LEU A 1 213 ? 150.572 41.207 -5.220  1.00 20.99  ? 213  LEU A CA    1 
ATOM   1525 C  C     . LEU A 1 213 ? 151.762 40.345 -4.813  1.00 16.24  ? 213  LEU A C     1 
ATOM   1526 O  O     . LEU A 1 213 ? 152.061 40.182 -3.630  1.00 8.17   ? 213  LEU A O     1 
ATOM   1527 C  CB    . LEU A 1 213 ? 149.537 40.246 -5.719  1.00 22.38  ? 213  LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1 213 ? 148.559 39.687 -4.728  1.00 25.32  ? 213  LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1 213 ? 147.986 40.813 -3.874  1.00 21.95  ? 213  LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1 213 ? 147.487 38.993 -5.556  1.00 25.91  ? 213  LEU A CD2   1 
ATOM   1531 N  N     . LEU A 1 214 ? 152.425 39.786 -5.807  1.00 12.75  ? 214  LEU A N     1 
ATOM   1532 C  CA    . LEU A 1 214 ? 153.579 38.937 -5.570  1.00 17.38  ? 214  LEU A CA    1 
ATOM   1533 C  C     . LEU A 1 214 ? 154.599 39.618 -4.649  1.00 26.28  ? 214  LEU A C     1 
ATOM   1534 O  O     . LEU A 1 214 ? 155.113 38.999 -3.711  1.00 18.01  ? 214  LEU A O     1 
ATOM   1535 C  CB    . LEU A 1 214 ? 154.158 38.527 -6.941  1.00 16.39  ? 214  LEU A CB    1 
ATOM   1536 C  CG    . LEU A 1 214 ? 153.397 37.377 -7.650  1.00 19.61  ? 214  LEU A CG    1 
ATOM   1537 C  CD1   . LEU A 1 214 ? 153.835 37.191 -9.088  1.00 13.18  ? 214  LEU A CD1   1 
ATOM   1538 C  CD2   . LEU A 1 214 ? 153.539 36.074 -6.872  1.00 23.71  ? 214  LEU A CD2   1 
ATOM   1539 N  N     . LEU A 1 215 ? 154.881 40.896 -4.916  1.00 25.96  ? 215  LEU A N     1 
ATOM   1540 C  CA    . LEU A 1 215 ? 155.844 41.641 -4.107  1.00 24.79  ? 215  LEU A CA    1 
ATOM   1541 C  C     . LEU A 1 215 ? 155.452 41.620 -2.639  1.00 26.80  ? 215  LEU A C     1 
ATOM   1542 O  O     . LEU A 1 215 ? 156.288 41.843 -1.761  1.00 27.87  ? 215  LEU A O     1 
ATOM   1543 C  CB    . LEU A 1 215 ? 156.262 43.036 -4.654  1.00 23.86  ? 215  LEU A CB    1 
ATOM   1544 C  CG    . LEU A 1 215 ? 156.969 43.149 -6.050  1.00 30.81  ? 215  LEU A CG    1 
ATOM   1545 C  CD1   . LEU A 1 215 ? 157.031 44.578 -6.605  1.00 26.38  ? 215  LEU A CD1   1 
ATOM   1546 C  CD2   . LEU A 1 215 ? 158.278 42.345 -6.240  1.00 28.54  ? 215  LEU A CD2   1 
ATOM   1547 N  N     . HIS A 1 216 ? 154.184 41.343 -2.364  1.00 21.53  ? 216  HIS A N     1 
ATOM   1548 C  CA    . HIS A 1 216 ? 153.743 41.300 -0.978  1.00 21.93  ? 216  HIS A CA    1 
ATOM   1549 C  C     . HIS A 1 216 ? 153.526 39.888 -0.464  1.00 20.55  ? 216  HIS A C     1 
ATOM   1550 O  O     . HIS A 1 216 ? 153.133 39.684 0.687   1.00 26.33  ? 216  HIS A O     1 
ATOM   1551 C  CB    . HIS A 1 216 ? 152.602 42.270 -0.675  1.00 28.55  ? 216  HIS A CB    1 
ATOM   1552 C  CG    . HIS A 1 216 ? 153.063 43.700 -0.565  1.00 39.55  ? 216  HIS A CG    1 
ATOM   1553 N  ND1   . HIS A 1 216 ? 154.394 44.048 -0.394  1.00 43.83  ? 216  HIS A ND1   1 
ATOM   1554 C  CD2   . HIS A 1 216 ? 152.374 44.869 -0.653  1.00 40.99  ? 216  HIS A CD2   1 
ATOM   1555 C  CE1   . HIS A 1 216 ? 154.500 45.366 -0.364  1.00 42.92  ? 216  HIS A CE1   1 
ATOM   1556 N  NE2   . HIS A 1 216 ? 153.287 45.886 -0.535  1.00 42.74  ? 216  HIS A NE2   1 
ATOM   1557 N  N     . THR A 1 217 ? 153.775 38.907 -1.308  1.00 15.81  ? 217  THR A N     1 
ATOM   1558 C  CA    . THR A 1 217 ? 153.583 37.529 -0.891  1.00 12.32  ? 217  THR A CA    1 
ATOM   1559 C  C     . THR A 1 217 ? 154.810 36.970 -0.182  1.00 15.27  ? 217  THR A C     1 
ATOM   1560 O  O     . THR A 1 217 ? 155.938 37.157 -0.634  1.00 13.52  ? 217  THR A O     1 
ATOM   1561 C  CB    . THR A 1 217 ? 153.400 36.685 -2.110  1.00 17.70  ? 217  THR A CB    1 
ATOM   1562 O  OG1   . THR A 1 217 ? 152.443 37.307 -2.974  1.00 24.12  ? 217  THR A OG1   1 
ATOM   1563 C  CG2   . THR A 1 217 ? 152.970 35.268 -1.739  1.00 17.43  ? 217  THR A CG2   1 
ATOM   1564 N  N     . ASN A 1 218 ? 154.574 36.283 0.926   1.00 8.75   ? 218  ASN A N     1 
ATOM   1565 C  CA    . ASN A 1 218 ? 155.639 35.675 1.708   1.00 8.27   ? 218  ASN A CA    1 
ATOM   1566 C  C     . ASN A 1 218 ? 155.785 34.203 1.317   1.00 16.37  ? 218  ASN A C     1 
ATOM   1567 O  O     . ASN A 1 218 ? 156.856 33.622 1.451   1.00 17.26  ? 218  ASN A O     1 
ATOM   1568 C  CB    . ASN A 1 218 ? 155.217 35.653 3.155   1.00 9.08   ? 218  ASN A CB    1 
ATOM   1569 C  CG    . ASN A 1 218 ? 155.031 36.983 3.693   1.00 22.16  ? 218  ASN A CG    1 
ATOM   1570 O  OD1   . ASN A 1 218 ? 155.880 37.487 4.416   1.00 45.02  ? 218  ASN A OD1   1 
ATOM   1571 N  ND2   . ASN A 1 218 ? 153.918 37.600 3.348   1.00 35.21  ? 218  ASN A ND2   1 
ATOM   1572 N  N     . ILE A 1 219 ? 154.691 33.603 0.828   1.00 9.00   ? 219  ILE A N     1 
ATOM   1573 C  CA    . ILE A 1 219 ? 154.674 32.200 0.397   1.00 7.44   ? 219  ILE A CA    1 
ATOM   1574 C  C     . ILE A 1 219 ? 153.809 32.041 -0.856  1.00 21.90  ? 219  ILE A C     1 
ATOM   1575 O  O     . ILE A 1 219 ? 152.636 32.405 -0.855  1.00 20.16  ? 219  ILE A O     1 
ATOM   1576 C  CB    . ILE A 1 219 ? 154.096 31.174 1.411   1.00 9.09   ? 219  ILE A CB    1 
ATOM   1577 C  CG1   . ILE A 1 219 ? 154.704 31.278 2.841   1.00 10.21  ? 219  ILE A CG1   1 
ATOM   1578 C  CG2   . ILE A 1 219 ? 154.235 29.751 0.810   1.00 8.14   ? 219  ILE A CG2   1 
ATOM   1579 C  CD1   . ILE A 1 219 ? 154.430 30.057 3.733   1.00 1.00   ? 219  ILE A CD1   1 
ATOM   1580 N  N     . LEU A 1 220 ? 154.386 31.499 -1.923  1.00 17.79  ? 220  LEU A N     1 
ATOM   1581 C  CA    . LEU A 1 220 ? 153.651 31.317 -3.162  1.00 13.63  ? 220  LEU A CA    1 
ATOM   1582 C  C     . LEU A 1 220 ? 153.448 29.849 -3.484  1.00 25.78  ? 220  LEU A C     1 
ATOM   1583 O  O     . LEU A 1 220 ? 154.408 29.090 -3.553  1.00 30.51  ? 220  LEU A O     1 
ATOM   1584 C  CB    . LEU A 1 220 ? 154.527 31.851 -4.318  1.00 12.32  ? 220  LEU A CB    1 
ATOM   1585 C  CG    . LEU A 1 220 ? 153.957 31.731 -5.770  1.00 17.02  ? 220  LEU A CG    1 
ATOM   1586 C  CD1   . LEU A 1 220 ? 152.442 31.998 -5.792  1.00 12.84  ? 220  LEU A CD1   1 
ATOM   1587 C  CD2   . LEU A 1 220 ? 154.560 32.761 -6.672  1.00 12.29  ? 220  LEU A CD2   1 
ATOM   1588 N  N     . PHE A 1 221 ? 152.198 29.448 -3.683  1.00 18.19  ? 221  PHE A N     1 
ATOM   1589 C  CA    . PHE A 1 221 ? 151.919 28.061 -4.016  1.00 12.27  ? 221  PHE A CA    1 
ATOM   1590 C  C     . PHE A 1 221 ? 151.458 27.935 -5.457  1.00 14.53  ? 221  PHE A C     1 
ATOM   1591 O  O     . PHE A 1 221 ? 150.923 28.877 -6.042  1.00 20.47  ? 221  PHE A O     1 
ATOM   1592 C  CB    . PHE A 1 221 ? 150.784 27.444 -3.242  1.00 12.26  ? 221  PHE A CB    1 
ATOM   1593 C  CG    . PHE A 1 221 ? 150.963 27.420 -1.784  1.00 13.89  ? 221  PHE A CG    1 
ATOM   1594 C  CD1   . PHE A 1 221 ? 150.292 28.321 -1.013  1.00 16.74  ? 221  PHE A CD1   1 
ATOM   1595 C  CD2   . PHE A 1 221 ? 151.751 26.469 -1.173  1.00 17.48  ? 221  PHE A CD2   1 
ATOM   1596 C  CE1   . PHE A 1 221 ? 150.436 28.295 0.359   1.00 20.40  ? 221  PHE A CE1   1 
ATOM   1597 C  CE2   . PHE A 1 221 ? 151.891 26.434 0.202   1.00 18.01  ? 221  PHE A CE2   1 
ATOM   1598 C  CZ    . PHE A 1 221 ? 151.238 27.348 0.970   1.00 13.91  ? 221  PHE A CZ    1 
ATOM   1599 N  N     . GLY A 1 222 ? 151.672 26.752 -6.008  1.00 11.07  ? 222  GLY A N     1 
ATOM   1600 C  CA    . GLY A 1 222 ? 151.295 26.433 -7.372  1.00 10.94  ? 222  GLY A CA    1 
ATOM   1601 C  C     . GLY A 1 222 ? 151.791 25.038 -7.743  1.00 25.75  ? 222  GLY A C     1 
ATOM   1602 O  O     . GLY A 1 222 ? 152.433 24.348 -6.940  1.00 25.10  ? 222  GLY A O     1 
ATOM   1603 N  N     . ASN A 1 223 ? 151.487 24.637 -8.968  1.00 24.37  ? 223  ASN A N     1 
ATOM   1604 C  CA    . ASN A 1 223 ? 151.892 23.348 -9.498  1.00 23.18  ? 223  ASN A CA    1 
ATOM   1605 C  C     . ASN A 1 223 ? 152.742 23.590 -10.739 1.00 25.05  ? 223  ASN A C     1 
ATOM   1606 O  O     . ASN A 1 223 ? 152.784 24.730 -11.228 1.00 18.87  ? 223  ASN A O     1 
ATOM   1607 C  CB    . ASN A 1 223 ? 150.670 22.522 -9.879  1.00 34.96  ? 223  ASN A CB    1 
ATOM   1608 C  CG    . ASN A 1 223 ? 149.722 23.243 -10.839 1.00 28.51  ? 223  ASN A CG    1 
ATOM   1609 O  OD1   . ASN A 1 223 ? 148.538 23.066 -10.699 1.00 19.29  ? 223  ASN A OD1   1 
ATOM   1610 N  ND2   . ASN A 1 223 ? 150.227 24.054 -11.794 1.00 24.36  ? 223  ASN A ND2   1 
ATOM   1611 N  N     . GLU A 1 224 ? 153.392 22.544 -11.245 1.00 22.95  ? 224  GLU A N     1 
ATOM   1612 C  CA    . GLU A 1 224 ? 154.237 22.664 -12.439 1.00 27.15  ? 224  GLU A CA    1 
ATOM   1613 C  C     . GLU A 1 224 ? 153.565 23.458 -13.571 1.00 37.92  ? 224  GLU A C     1 
ATOM   1614 O  O     . GLU A 1 224 ? 154.121 24.444 -14.070 1.00 29.43  ? 224  GLU A O     1 
ATOM   1615 C  CB    . GLU A 1 224 ? 154.599 21.283 -12.990 1.00 27.59  ? 224  GLU A CB    1 
ATOM   1616 C  CG    . GLU A 1 224 ? 155.959 21.132 -13.626 1.00 34.61  ? 224  GLU A CG    1 
ATOM   1617 C  CD    . GLU A 1 224 ? 156.524 19.801 -13.280 1.00 71.83  ? 224  GLU A CD    1 
ATOM   1618 O  OE1   . GLU A 1 224 ? 155.871 18.741 -13.446 1.00 85.05  ? 224  GLU A OE1   1 
ATOM   1619 O  OE2   . GLU A 1 224 ? 157.622 19.856 -12.763 1.00 46.18  ? 224  GLU A OE2   1 
ATOM   1620 N  N     . GLU A 1 225 ? 152.366 23.029 -13.965 1.00 35.73  ? 225  GLU A N     1 
ATOM   1621 C  CA    . GLU A 1 225 ? 151.609 23.681 -15.037 1.00 30.57  ? 225  GLU A CA    1 
ATOM   1622 C  C     . GLU A 1 225 ? 151.494 25.200 -14.886 1.00 26.61  ? 225  GLU A C     1 
ATOM   1623 O  O     . GLU A 1 225 ? 151.812 25.942 -15.820 1.00 24.90  ? 225  GLU A O     1 
ATOM   1624 C  CB    . GLU A 1 225 ? 150.248 23.017 -15.219 1.00 31.93  ? 225  GLU A CB    1 
ATOM   1625 C  CG    . GLU A 1 225 ? 149.078 23.746 -14.551 1.00 79.37  ? 225  GLU A CG    1 
ATOM   1626 C  CD    . GLU A 1 225 ? 148.315 22.921 -13.478 1.00 100.00 ? 225  GLU A CD    1 
ATOM   1627 O  OE1   . GLU A 1 225 ? 147.312 23.436 -12.927 1.00 34.20  ? 225  GLU A OE1   1 
ATOM   1628 O  OE2   . GLU A 1 225 ? 148.787 21.824 -13.100 1.00 100.00 ? 225  GLU A OE2   1 
ATOM   1629 N  N     . GLU A 1 226 ? 151.036 25.657 -13.722 1.00 15.87  ? 226  GLU A N     1 
ATOM   1630 C  CA    . GLU A 1 226 ? 150.878 27.088 -13.479 1.00 17.20  ? 226  GLU A CA    1 
ATOM   1631 C  C     . GLU A 1 226 ? 152.223 27.811 -13.415 1.00 27.18  ? 226  GLU A C     1 
ATOM   1632 O  O     . GLU A 1 226 ? 152.394 28.879 -14.008 1.00 26.37  ? 226  GLU A O     1 
ATOM   1633 C  CB    . GLU A 1 226 ? 149.971 27.395 -12.273 1.00 20.58  ? 226  GLU A CB    1 
ATOM   1634 C  CG    . GLU A 1 226 ? 148.678 26.565 -12.112 1.00 15.28  ? 226  GLU A CG    1 
ATOM   1635 C  CD    . GLU A 1 226 ? 148.385 26.240 -10.636 1.00 4.99   ? 226  GLU A CD    1 
ATOM   1636 O  OE1   . GLU A 1 226 ? 149.295 26.444 -9.772  1.00 2.01   ? 226  GLU A OE1   1 
ATOM   1637 O  OE2   . GLU A 1 226 ? 147.269 25.764 -10.341 1.00 13.62  ? 226  GLU A OE2   1 
ATOM   1638 N  N     . PHE A 1 227 ? 153.180 27.226 -12.702 1.00 27.30  ? 227  PHE A N     1 
ATOM   1639 C  CA    . PHE A 1 227 ? 154.505 27.828 -12.585 1.00 24.56  ? 227  PHE A CA    1 
ATOM   1640 C  C     . PHE A 1 227 ? 155.132 27.993 -13.973 1.00 26.09  ? 227  PHE A C     1 
ATOM   1641 O  O     . PHE A 1 227 ? 155.881 28.932 -14.234 1.00 23.10  ? 227  PHE A O     1 
ATOM   1642 C  CB    . PHE A 1 227 ? 155.372 26.991 -11.662 1.00 22.20  ? 227  PHE A CB    1 
ATOM   1643 C  CG    . PHE A 1 227 ? 155.279 27.368 -10.179 1.00 18.78  ? 227  PHE A CG    1 
ATOM   1644 C  CD1   . PHE A 1 227 ? 155.950 28.480 -9.679  1.00 9.90   ? 227  PHE A CD1   1 
ATOM   1645 C  CD2   . PHE A 1 227 ? 154.537 26.579 -9.274  1.00 14.76  ? 227  PHE A CD2   1 
ATOM   1646 C  CE1   . PHE A 1 227 ? 155.880 28.789 -8.311  1.00 11.13  ? 227  PHE A CE1   1 
ATOM   1647 C  CE2   . PHE A 1 227 ? 154.466 26.883 -7.912  1.00 13.26  ? 227  PHE A CE2   1 
ATOM   1648 C  CZ    . PHE A 1 227 ? 155.145 27.995 -7.424  1.00 10.03  ? 227  PHE A CZ    1 
ATOM   1649 N  N     . ALA A 1 228 ? 154.807 27.071 -14.876 1.00 23.92  ? 228  ALA A N     1 
ATOM   1650 C  CA    . ALA A 1 228 ? 155.332 27.126 -16.234 1.00 17.74  ? 228  ALA A CA    1 
ATOM   1651 C  C     . ALA A 1 228 ? 154.766 28.347 -16.936 1.00 22.90  ? 228  ALA A C     1 
ATOM   1652 O  O     . ALA A 1 228 ? 155.510 29.133 -17.517 1.00 24.90  ? 228  ALA A O     1 
ATOM   1653 C  CB    . ALA A 1 228 ? 155.068 25.845 -17.005 1.00 16.35  ? 228  ALA A CB    1 
ATOM   1654 N  N     . HIS A 1 229 ? 153.451 28.513 -16.872 1.00 16.70  ? 229  HIS A N     1 
ATOM   1655 C  CA    . HIS A 1 229 ? 152.848 29.668 -17.504 1.00 20.84  ? 229  HIS A CA    1 
ATOM   1656 C  C     . HIS A 1 229 ? 153.416 30.936 -16.864 1.00 23.25  ? 229  HIS A C     1 
ATOM   1657 O  O     . HIS A 1 229 ? 153.751 31.894 -17.557 1.00 20.76  ? 229  HIS A O     1 
ATOM   1658 C  CB    . HIS A 1 229 ? 151.327 29.583 -17.417 1.00 24.92  ? 229  HIS A CB    1 
ATOM   1659 C  CG    . HIS A 1 229 ? 150.733 28.769 -18.523 1.00 31.49  ? 229  HIS A CG    1 
ATOM   1660 N  ND1   . HIS A 1 229 ? 150.786 27.391 -18.540 1.00 35.29  ? 229  HIS A ND1   1 
ATOM   1661 C  CD2   . HIS A 1 229 ? 150.104 29.135 -19.664 1.00 32.26  ? 229  HIS A CD2   1 
ATOM   1662 C  CE1   . HIS A 1 229 ? 150.204 26.948 -19.639 1.00 32.55  ? 229  HIS A CE1   1 
ATOM   1663 N  NE2   . HIS A 1 229 ? 149.785 27.984 -20.338 1.00 31.73  ? 229  HIS A NE2   1 
ATOM   1664 N  N     . LEU A 1 230 ? 153.535 30.918 -15.533 1.00 18.52  ? 230  LEU A N     1 
ATOM   1665 C  CA    . LEU A 1 230 ? 154.063 32.048 -14.768 1.00 18.37  ? 230  LEU A CA    1 
ATOM   1666 C  C     . LEU A 1 230 ? 155.413 32.507 -15.284 1.00 26.93  ? 230  LEU A C     1 
ATOM   1667 O  O     . LEU A 1 230 ? 155.620 33.693 -15.546 1.00 18.91  ? 230  LEU A O     1 
ATOM   1668 C  CB    . LEU A 1 230 ? 154.345 31.663 -13.340 1.00 15.03  ? 230  LEU A CB    1 
ATOM   1669 C  CG    . LEU A 1 230 ? 154.889 32.927 -12.673 1.00 17.33  ? 230  LEU A CG    1 
ATOM   1670 C  CD1   . LEU A 1 230 ? 153.844 34.006 -12.499 1.00 11.04  ? 230  LEU A CD1   1 
ATOM   1671 C  CD2   . LEU A 1 230 ? 155.208 32.518 -11.359 1.00 28.14  ? 230  LEU A CD2   1 
ATOM   1672 N  N     . ALA A 1 231 ? 156.316 31.537 -15.409 1.00 34.23  ? 231  ALA A N     1 
ATOM   1673 C  CA    . ALA A 1 231 ? 157.684 31.737 -15.878 1.00 38.36  ? 231  ALA A CA    1 
ATOM   1674 C  C     . ALA A 1 231 ? 157.735 32.400 -17.243 1.00 40.80  ? 231  ALA A C     1 
ATOM   1675 O  O     . ALA A 1 231 ? 158.425 33.399 -17.438 1.00 42.64  ? 231  ALA A O     1 
ATOM   1676 C  CB    . ALA A 1 231 ? 158.389 30.385 -15.963 1.00 41.39  ? 231  ALA A CB    1 
ATOM   1677 N  N     . LYS A 1 232 ? 157.005 31.836 -18.176 1.00 33.34  ? 232  LYS A N     1 
ATOM   1678 C  CA    . LYS A 1 232 ? 156.977 32.370 -19.514 1.00 31.06  ? 232  LYS A CA    1 
ATOM   1679 C  C     . LYS A 1 232 ? 156.488 33.821 -19.574 1.00 38.23  ? 232  LYS A C     1 
ATOM   1680 O  O     . LYS A 1 232 ? 157.116 34.675 -20.190 1.00 39.21  ? 232  LYS A O     1 
ATOM   1681 C  CB    . LYS A 1 232 ? 156.091 31.457 -20.367 1.00 30.52  ? 232  LYS A CB    1 
ATOM   1682 C  CG    . LYS A 1 232 ? 155.314 32.144 -21.487 1.00 45.90  ? 232  LYS A CG    1 
ATOM   1683 C  CD    . LYS A 1 232 ? 153.845 32.323 -21.118 1.00 55.64  ? 232  LYS A CD    1 
ATOM   1684 C  CE    . LYS A 1 232 ? 152.912 32.126 -22.310 1.00 83.18  ? 232  LYS A CE    1 
ATOM   1685 N  NZ    . LYS A 1 232 ? 152.049 33.318 -22.564 1.00 100.00 ? 232  LYS A NZ    1 
ATOM   1686 N  N     . VAL A 1 233 ? 155.355 34.100 -18.943 1.00 30.50  ? 233  VAL A N     1 
ATOM   1687 C  CA    . VAL A 1 233 ? 154.734 35.435 -18.939 1.00 26.54  ? 233  VAL A CA    1 
ATOM   1688 C  C     . VAL A 1 233 ? 155.652 36.475 -18.431 1.00 47.74  ? 233  VAL A C     1 
ATOM   1689 O  O     . VAL A 1 233 ? 155.902 37.518 -19.048 1.00 51.57  ? 233  VAL A O     1 
ATOM   1690 C  CB    . VAL A 1 233 ? 153.482 35.396 -18.077 1.00 23.03  ? 233  VAL A CB    1 
ATOM   1691 C  CG1   . VAL A 1 233 ? 153.010 36.781 -17.688 1.00 19.87  ? 233  VAL A CG1   1 
ATOM   1692 C  CG2   . VAL A 1 233 ? 152.404 34.569 -18.747 1.00 24.50  ? 233  VAL A CG2   1 
ATOM   1693 N  N     . HIS A 1 234 ? 156.167 36.162 -17.302 1.00 57.00  ? 234  HIS A N     1 
ATOM   1694 C  CA    . HIS A 1 234 ? 157.067 37.109 -16.842 1.00 59.36  ? 234  HIS A CA    1 
ATOM   1695 C  C     . HIS A 1 234 ? 158.330 36.830 -17.649 1.00 66.07  ? 234  HIS A C     1 
ATOM   1696 O  O     . HIS A 1 234 ? 158.365 36.536 -18.854 1.00 65.96  ? 234  HIS A O     1 
ATOM   1697 C  CB    . HIS A 1 234 ? 157.002 37.191 -15.332 1.00 59.69  ? 234  HIS A CB    1 
ATOM   1698 C  CG    . HIS A 1 234 ? 155.784 37.930 -14.892 1.00 67.56  ? 234  HIS A CG    1 
ATOM   1699 N  ND1   . HIS A 1 234 ? 155.830 39.090 -14.148 1.00 76.07  ? 234  HIS A ND1   1 
ATOM   1700 C  CD2   . HIS A 1 234 ? 154.475 37.693 -15.139 1.00 73.68  ? 234  HIS A CD2   1 
ATOM   1701 C  CE1   . HIS A 1 234 ? 154.597 39.526 -13.939 1.00 78.35  ? 234  HIS A CE1   1 
ATOM   1702 N  NE2   . HIS A 1 234 ? 153.756 38.692 -14.528 1.00 77.44  ? 234  HIS A NE2   1 
ATOM   1703 N  N     . ASN A 1 235 ? 159.421 36.898 -16.993 1.00 68.18  ? 235  ASN A N     1 
ATOM   1704 C  CA    . ASN A 1 235 ? 160.666 36.646 -17.683 1.00 74.83  ? 235  ASN A CA    1 
ATOM   1705 C  C     . ASN A 1 235 ? 161.057 35.190 -17.486 1.00 78.77  ? 235  ASN A C     1 
ATOM   1706 O  O     . ASN A 1 235 ? 160.502 34.323 -18.148 1.00 80.41  ? 235  ASN A O     1 
ATOM   1707 C  CB    . ASN A 1 235 ? 161.684 37.635 -17.080 1.00 99.77  ? 235  ASN A CB    1 
ATOM   1708 C  CG    . ASN A 1 235 ? 161.045 38.625 -15.984 1.00 100.00 ? 235  ASN A CG    1 
ATOM   1709 O  OD1   . ASN A 1 235 ? 159.806 38.854 -15.874 1.00 100.00 ? 235  ASN A OD1   1 
ATOM   1710 N  ND2   . ASN A 1 235 ? 161.942 39.218 -15.181 1.00 100.00 ? 235  ASN A ND2   1 
ATOM   1711 N  N     . LEU A 1 236 ? 162.007 34.973 -16.569 1.00 72.23  ? 236  LEU A N     1 
ATOM   1712 C  CA    . LEU A 1 236 ? 162.559 33.677 -16.152 1.00 74.17  ? 236  LEU A CA    1 
ATOM   1713 C  C     . LEU A 1 236 ? 162.368 32.499 -17.119 1.00 87.65  ? 236  LEU A C     1 
ATOM   1714 O  O     . LEU A 1 236 ? 163.340 31.836 -17.486 1.00 85.05  ? 236  LEU A O     1 
ATOM   1715 C  CB    . LEU A 1 236 ? 161.837 33.356 -14.846 1.00 74.72  ? 236  LEU A CB    1 
ATOM   1716 C  CG    . LEU A 1 236 ? 160.407 33.935 -14.748 1.00 80.71  ? 236  LEU A CG    1 
ATOM   1717 C  CD1   . LEU A 1 236 ? 159.533 33.061 -13.850 1.00 78.41  ? 236  LEU A CD1   1 
ATOM   1718 C  CD2   . LEU A 1 236 ? 160.422 35.386 -14.269 1.00 89.80  ? 236  LEU A CD2   1 
ATOM   1719 N  N     . VAL A 1 237 ? 161.125 32.229 -17.512 1.00 95.51  ? 237  VAL A N     1 
ATOM   1720 C  CA    . VAL A 1 237 ? 160.803 31.132 -18.427 1.00 97.32  ? 237  VAL A CA    1 
ATOM   1721 C  C     . VAL A 1 237 ? 161.365 29.816 -17.902 1.00 100.00 ? 237  VAL A C     1 
ATOM   1722 O  O     . VAL A 1 237 ? 161.060 29.419 -16.775 1.00 100.00 ? 237  VAL A O     1 
ATOM   1723 C  CB    . VAL A 1 237 ? 161.108 31.401 -19.945 1.00 99.08  ? 237  VAL A CB    1 
ATOM   1724 C  CG1   . VAL A 1 237 ? 160.037 32.293 -20.584 1.00 99.29  ? 237  VAL A CG1   1 
ATOM   1725 C  CG2   . VAL A 1 237 ? 162.520 31.961 -20.156 1.00 96.74  ? 237  VAL A CG2   1 
ATOM   1726 N  N     . LYS A 1 241 ? 160.627 22.874 -13.512 1.00 77.23  ? 241  LYS A N     1 
ATOM   1727 C  CA    . LYS A 1 241 ? 160.952 22.514 -12.121 1.00 67.74  ? 241  LYS A CA    1 
ATOM   1728 C  C     . LYS A 1 241 ? 161.716 23.507 -11.246 1.00 54.74  ? 241  LYS A C     1 
ATOM   1729 O  O     . LYS A 1 241 ? 161.252 24.615 -10.978 1.00 59.53  ? 241  LYS A O     1 
ATOM   1730 C  CB    . LYS A 1 241 ? 160.547 21.128 -11.609 1.00 71.08  ? 241  LYS A CB    1 
ATOM   1731 N  N     . VAL A 1 242 ? 162.894 23.085 -10.791 1.00 32.14  ? 242  VAL A N     1 
ATOM   1732 C  CA    . VAL A 1 242 ? 163.764 23.893 -9.919  1.00 31.42  ? 242  VAL A CA    1 
ATOM   1733 C  C     . VAL A 1 242 ? 164.064 25.307 -10.424 1.00 40.74  ? 242  VAL A C     1 
ATOM   1734 O  O     . VAL A 1 242 ? 164.121 26.252 -9.641  1.00 35.27  ? 242  VAL A O     1 
ATOM   1735 C  CB    . VAL A 1 242 ? 165.100 23.163 -9.424  1.00 31.60  ? 242  VAL A CB    1 
ATOM   1736 N  N     . ALA A 1 243 ? 164.371 25.462 -11.710 1.00 43.03  ? 243  ALA A N     1 
ATOM   1737 C  CA    . ALA A 1 243 ? 164.662 26.786 -12.233 1.00 32.98  ? 243  ALA A CA    1 
ATOM   1738 C  C     . ALA A 1 243 ? 163.414 27.666 -12.204 1.00 40.13  ? 243  ALA A C     1 
ATOM   1739 O  O     . ALA A 1 243 ? 163.484 28.808 -11.755 1.00 48.01  ? 243  ALA A O     1 
ATOM   1740 C  CB    . ALA A 1 243 ? 165.247 26.672 -13.628 1.00 33.39  ? 243  ALA A CB    1 
ATOM   1741 N  N     . LEU A 1 244 ? 162.301 27.127 -12.697 1.00 36.47  ? 244  LEU A N     1 
ATOM   1742 C  CA    . LEU A 1 244 ? 161.070 27.866 -12.712 1.00 37.54  ? 244  LEU A CA    1 
ATOM   1743 C  C     . LEU A 1 244 ? 160.788 28.345 -11.296 1.00 32.89  ? 244  LEU A C     1 
ATOM   1744 O  O     . LEU A 1 244 ? 160.427 29.500 -11.076 1.00 32.31  ? 244  LEU A O     1 
ATOM   1745 C  CB    . LEU A 1 244 ? 160.053 26.842 -13.172 1.00 41.12  ? 244  LEU A CB    1 
ATOM   1746 N  N     . SER A 1 245 ? 160.992 27.433 -10.353 1.00 26.96  ? 245  SER A N     1 
ATOM   1747 C  CA    . SER A 1 245 ? 160.745 27.688 -8.935  1.00 29.52  ? 245  SER A CA    1 
ATOM   1748 C  C     . SER A 1 245 ? 161.627 28.810 -8.422  1.00 27.45  ? 245  SER A C     1 
ATOM   1749 O  O     . SER A 1 245 ? 161.172 29.780 -7.816  1.00 33.88  ? 245  SER A O     1 
ATOM   1750 C  CB    . SER A 1 245 ? 160.911 26.338 -8.126  1.00 26.77  ? 245  SER A CB    1 
ATOM   1751 N  N     . VAL A 1 246 ? 162.909 28.679 -8.664  1.00 28.98  ? 246  VAL A N     1 
ATOM   1752 C  CA    . VAL A 1 246 ? 163.864 29.700 -8.226  1.00 31.67  ? 246  VAL A CA    1 
ATOM   1753 C  C     . VAL A 1 246 ? 163.605 30.995 -8.983  1.00 39.15  ? 246  VAL A C     1 
ATOM   1754 O  O     . VAL A 1 246 ? 163.849 32.092 -8.479  1.00 33.90  ? 246  VAL A O     1 
ATOM   1755 C  CB    . VAL A 1 246 ? 165.366 29.296 -8.333  1.00 33.61  ? 246  VAL A CB    1 
ATOM   1756 N  N     . ALA A 1 247 ? 163.102 30.846 -10.195 1.00 48.44  ? 247  ALA A N     1 
ATOM   1757 C  CA    . ALA A 1 247 ? 162.778 31.994 -11.017 1.00 48.65  ? 247  ALA A CA    1 
ATOM   1758 C  C     . ALA A 1 247 ? 161.709 32.823 -10.311 1.00 42.38  ? 247  ALA A C     1 
ATOM   1759 O  O     . ALA A 1 247 ? 161.932 33.990 -9.998  1.00 41.95  ? 247  ALA A O     1 
ATOM   1760 C  CB    . ALA A 1 247 ? 162.296 31.554 -12.386 1.00 51.76  ? 247  ALA A CB    1 
ATOM   1761 N  N     . ASN A 1 248 ? 160.561 32.208 -10.051 1.00 32.00  ? 248  ASN A N     1 
ATOM   1762 C  CA    . ASN A 1 248 ? 159.464 32.893 -9.393  1.00 35.04  ? 248  ASN A CA    1 
ATOM   1763 C  C     . ASN A 1 248 ? 159.835 33.646 -8.136  1.00 30.25  ? 248  ASN A C     1 
ATOM   1764 O  O     . ASN A 1 248 ? 159.227 34.672 -7.818  1.00 24.79  ? 248  ASN A O     1 
ATOM   1765 C  CB    . ASN A 1 248 ? 158.413 32.024 -8.969  1.00 40.04  ? 248  ASN A CB    1 
ATOM   1766 N  N     . LYS A 1 249 ? 160.816 33.149 -7.415  1.00 21.33  ? 249  LYS A N     1 
ATOM   1767 C  CA    . LYS A 1 249 ? 161.216 33.819 -6.192  1.00 23.46  ? 249  LYS A CA    1 
ATOM   1768 C  C     . LYS A 1 249 ? 161.718 35.249 -6.400  1.00 31.38  ? 249  LYS A C     1 
ATOM   1769 O  O     . LYS A 1 249 ? 161.782 36.027 -5.454  1.00 32.94  ? 249  LYS A O     1 
ATOM   1770 C  CB    . LYS A 1 249 ? 161.899 32.833 -5.268  1.00 27.47  ? 249  LYS A CB    1 
ATOM   1771 N  N     . GLU A 1 250 ? 162.086 35.605 -7.623  1.00 32.55  ? 250  GLU A N     1 
ATOM   1772 C  CA    . GLU A 1 250 ? 162.545 36.957 -7.874  1.00 38.00  ? 250  GLU A CA    1 
ATOM   1773 C  C     . GLU A 1 250 ? 161.338 37.886 -7.867  1.00 45.30  ? 250  GLU A C     1 
ATOM   1774 O  O     . GLU A 1 250 ? 161.384 38.964 -7.289  1.00 50.48  ? 250  GLU A O     1 
ATOM   1775 C  CB    . GLU A 1 250 ? 163.368 37.032 -9.153  1.00 43.34  ? 250  GLU A CB    1 
ATOM   1776 N  N     . HIS A 1 251 ? 160.260 37.445 -8.502  1.00 42.13  ? 251  HIS A N     1 
ATOM   1777 C  CA    . HIS A 1 251 ? 159.033 38.214 -8.570  1.00 41.07  ? 251  HIS A CA    1 
ATOM   1778 C  C     . HIS A 1 251 ? 158.576 38.655 -7.195  1.00 43.24  ? 251  HIS A C     1 
ATOM   1779 O  O     . HIS A 1 251 ? 157.988 39.724 -7.037  1.00 48.15  ? 251  HIS A O     1 
ATOM   1780 C  CB    . HIS A 1 251 ? 157.980 37.226 -8.901  1.00 44.77  ? 251  HIS A CB    1 
ATOM   1781 N  N     . ALA A 1 252 ? 158.830 37.827 -6.199  1.00 34.79  ? 252  ALA A N     1 
ATOM   1782 C  CA    . ALA A 1 252 ? 158.416 38.157 -4.845  1.00 38.38  ? 252  ALA A CA    1 
ATOM   1783 C  C     . ALA A 1 252 ? 159.464 38.984 -4.137  1.00 51.16  ? 252  ALA A C     1 
ATOM   1784 O  O     . ALA A 1 252 ? 159.174 39.768 -3.228  1.00 49.42  ? 252  ALA A O     1 
ATOM   1785 C  CB    . ALA A 1 252 ? 158.319 36.754 -4.075  1.00 36.07  ? 252  ALA A CB    1 
ATOM   1786 N  N     . VAL A 1 253 ? 160.676 38.780 -4.571  1.00 52.31  ? 253  VAL A N     1 
ATOM   1787 C  CA    . VAL A 1 253 ? 161.790 39.430 -3.956  1.00 53.39  ? 253  VAL A CA    1 
ATOM   1788 C  C     . VAL A 1 253 ? 162.036 40.864 -4.173  1.00 65.14  ? 253  VAL A C     1 
ATOM   1789 O  O     . VAL A 1 253 ? 161.793 41.772 -3.365  1.00 73.51  ? 253  VAL A O     1 
ATOM   1790 C  CB    . VAL A 1 253 ? 163.090 38.574 -4.262  1.00 57.89  ? 253  VAL A CB    1 
ATOM   1791 N  N     . THR A 1 269 ? 165.000 42.294 8.130   1.00 93.17  ? 269  THR A N     1 
ATOM   1792 C  CA    . THR A 1 269 ? 164.693 42.710 6.757   1.00 88.71  ? 269  THR A CA    1 
ATOM   1793 C  C     . THR A 1 269 ? 163.724 43.907 6.651   1.00 100.00 ? 269  THR A C     1 
ATOM   1794 O  O     . THR A 1 269 ? 164.040 41.599 4.708   1.00 73.20  ? 269  THR A O     1 
ATOM   1795 C  CB    . THR A 1 269 ? 164.323 41.500 5.905   1.00 76.65  ? 269  THR A CB    1 
ATOM   1796 O  OG1   . THR A 1 269 ? 164.429 45.033 6.095   1.00 100.00 ? 269  THR A OG1   1 
ATOM   1797 C  CG2   . THR A 1 269 ? 163.186 44.288 8.028   1.00 100.00 ? 269  THR A CG2   1 
ATOM   1798 N  N     . GLY A 1 270 ? 164.344 40.352 6.552   1.00 60.60  ? 270  GLY A N     1 
ATOM   1799 C  CA    . GLY A 1 270 ? 164.039 39.119 5.890   1.00 52.00  ? 270  GLY A CA    1 
ATOM   1800 C  C     . GLY A 1 270 ? 162.728 38.532 6.346   1.00 47.03  ? 270  GLY A C     1 
ATOM   1801 O  O     . GLY A 1 270 ? 162.662 37.795 7.332   1.00 38.88  ? 270  GLY A O     1 
ATOM   1802 N  N     . ALA A 1 271 ? 161.686 38.870 5.607   1.00 49.15  ? 271  ALA A N     1 
ATOM   1803 C  CA    . ALA A 1 271 ? 160.357 38.360 5.878   1.00 47.66  ? 271  ALA A CA    1 
ATOM   1804 C  C     . ALA A 1 271 ? 160.248 37.206 4.909   1.00 31.90  ? 271  ALA A C     1 
ATOM   1805 O  O     . ALA A 1 271 ? 160.611 37.400 3.748   1.00 37.02  ? 271  ALA A O     1 
ATOM   1806 C  CB    . ALA A 1 271 ? 159.273 39.374 5.549   1.00 49.39  ? 271  ALA A CB    1 
ATOM   1807 N  N     . THR A 1 272 ? 159.793 36.057 5.390   1.00 9.12   ? 272  THR A N     1 
ATOM   1808 C  CA    . THR A 1 272 ? 159.639 34.833 4.607   1.00 10.46  ? 272  THR A CA    1 
ATOM   1809 C  C     . THR A 1 272 ? 159.341 35.032 3.122   1.00 18.18  ? 272  THR A C     1 
ATOM   1810 O  O     . THR A 1 272 ? 158.432 35.773 2.732   1.00 16.29  ? 272  THR A O     1 
ATOM   1811 C  CB    . THR A 1 272 ? 158.505 33.969 5.146   1.00 18.77  ? 272  THR A CB    1 
ATOM   1812 O  OG1   . THR A 1 272 ? 158.602 33.911 6.573   1.00 26.90  ? 272  THR A OG1   1 
ATOM   1813 C  CG2   . THR A 1 272 ? 158.551 32.573 4.540   1.00 18.53  ? 272  THR A CG2   1 
ATOM   1814 N  N     . LYS A 1 273 ? 160.146 34.362 2.319   1.00 12.93  ? 273  LYS A N     1 
ATOM   1815 C  CA    . LYS A 1 273 ? 160.053 34.374 0.873   1.00 15.71  ? 273  LYS A CA    1 
ATOM   1816 C  C     . LYS A 1 273 ? 160.245 32.930 0.435   1.00 22.33  ? 273  LYS A C     1 
ATOM   1817 O  O     . LYS A 1 273 ? 161.359 32.464 0.207   1.00 28.07  ? 273  LYS A O     1 
ATOM   1818 C  CB    . LYS A 1 273 ? 160.896 35.471 0.214   1.00 20.00  ? 273  LYS A CB    1 
ATOM   1819 C  CG    . LYS A 1 273 ? 160.378 36.883 0.562   1.00 30.21  ? 273  LYS A CG    1 
ATOM   1820 C  CD    . LYS A 1 273 ? 159.133 37.369 -0.235  1.00 51.52  ? 273  LYS A CD    1 
ATOM   1821 C  CE    . LYS A 1 273 ? 158.602 38.765 0.190   1.00 31.21  ? 273  LYS A CE    1 
ATOM   1822 N  NZ    . LYS A 1 273 ? 157.570 39.435 -0.675  1.00 21.50  ? 273  LYS A NZ    1 
ATOM   1823 N  N     . LEU A 1 274 ? 159.131 32.225 0.360   1.00 11.81  ? 274  LEU A N     1 
ATOM   1824 C  CA    . LEU A 1 274 ? 159.135 30.837 -0.009  1.00 10.48  ? 274  LEU A CA    1 
ATOM   1825 C  C     . LEU A 1 274 ? 158.228 30.553 -1.180  1.00 11.26  ? 274  LEU A C     1 
ATOM   1826 O  O     . LEU A 1 274 ? 157.198 31.188 -1.375  1.00 12.04  ? 274  LEU A O     1 
ATOM   1827 C  CB    . LEU A 1 274 ? 158.485 30.180 1.171   1.00 13.73  ? 274  LEU A CB    1 
ATOM   1828 C  CG    . LEU A 1 274 ? 158.583 28.677 1.204   1.00 21.35  ? 274  LEU A CG    1 
ATOM   1829 C  CD1   . LEU A 1 274 ? 159.915 28.257 0.627   1.00 18.37  ? 274  LEU A CD1   1 
ATOM   1830 C  CD2   . LEU A 1 274 ? 158.408 28.194 2.647   1.00 26.92  ? 274  LEU A CD2   1 
ATOM   1831 N  N     . VAL A 1 275 ? 158.623 29.580 -1.957  1.00 10.81  ? 275  VAL A N     1 
ATOM   1832 C  CA    . VAL A 1 275 ? 157.842 29.192 -3.107  1.00 13.17  ? 275  VAL A CA    1 
ATOM   1833 C  C     . VAL A 1 275 ? 157.752 27.678 -3.158  1.00 21.81  ? 275  VAL A C     1 
ATOM   1834 O  O     . VAL A 1 275 ? 158.770 26.995 -3.305  1.00 20.03  ? 275  VAL A O     1 
ATOM   1835 C  CB    . VAL A 1 275 ? 158.263 29.820 -4.469  1.00 18.70  ? 275  VAL A CB    1 
ATOM   1836 C  CG1   . VAL A 1 275 ? 158.565 31.317 -4.444  1.00 13.06  ? 275  VAL A CG1   1 
ATOM   1837 C  CG2   . VAL A 1 275 ? 159.256 28.975 -5.220  1.00 21.31  ? 275  VAL A CG2   1 
ATOM   1838 N  N     . VAL A 1 276 ? 156.527 27.167 -3.014  1.00 19.00  ? 276  VAL A N     1 
ATOM   1839 C  CA    . VAL A 1 276 ? 156.271 25.735 -3.045  1.00 14.49  ? 276  VAL A CA    1 
ATOM   1840 C  C     . VAL A 1 276 ? 155.665 25.368 -4.389  1.00 21.92  ? 276  VAL A C     1 
ATOM   1841 O  O     . VAL A 1 276 ? 154.643 25.934 -4.788  1.00 18.62  ? 276  VAL A O     1 
ATOM   1842 C  CB    . VAL A 1 276 ? 155.275 25.217 -1.984  1.00 12.47  ? 276  VAL A CB    1 
ATOM   1843 C  CG1   . VAL A 1 276 ? 155.455 23.709 -1.806  1.00 6.77   ? 276  VAL A CG1   1 
ATOM   1844 C  CG2   . VAL A 1 276 ? 155.417 25.930 -0.669  1.00 10.90  ? 276  VAL A CG2   1 
ATOM   1845 N  N     . MET A 1 277 ? 156.302 24.427 -5.084  1.00 15.10  ? 277  MET A N     1 
ATOM   1846 C  CA    . MET A 1 277 ? 155.817 23.986 -6.388  1.00 15.15  ? 277  MET A CA    1 
ATOM   1847 C  C     . MET A 1 277 ? 155.491 22.514 -6.330  1.00 24.24  ? 277  MET A C     1 
ATOM   1848 O  O     . MET A 1 277 ? 156.375 21.688 -6.107  1.00 23.10  ? 277  MET A O     1 
ATOM   1849 C  CB    . MET A 1 277 ? 156.822 24.163 -7.539  1.00 16.21  ? 277  MET A CB    1 
ATOM   1850 C  CG    . MET A 1 277 ? 156.428 23.378 -8.796  1.00 19.01  ? 277  MET A CG    1 
ATOM   1851 S  SD    . MET A 1 277 ? 157.721 23.020 -10.034 1.00 23.53  ? 277  MET A SD    1 
ATOM   1852 C  CE    . MET A 1 277 ? 158.269 24.669 -10.470 1.00 21.43  ? 277  MET A CE    1 
ATOM   1853 N  N     . THR A 1 278 ? 154.229 22.172 -6.520  1.00 20.31  ? 278  THR A N     1 
ATOM   1854 C  CA    . THR A 1 278 ? 153.886 20.763 -6.464  1.00 19.63  ? 278  THR A CA    1 
ATOM   1855 C  C     . THR A 1 278 ? 153.977 20.118 -7.845  1.00 20.22  ? 278  THR A C     1 
ATOM   1856 O  O     . THR A 1 278 ? 153.682 20.745 -8.880  1.00 11.64  ? 278  THR A O     1 
ATOM   1857 C  CB    . THR A 1 278 ? 152.595 20.451 -5.728  1.00 17.94  ? 278  THR A CB    1 
ATOM   1858 O  OG1   . THR A 1 278 ? 151.501 20.829 -6.562  1.00 18.68  ? 278  THR A OG1   1 
ATOM   1859 C  CG2   . THR A 1 278 ? 152.503 21.195 -4.424  1.00 17.94  ? 278  THR A CG2   1 
ATOM   1860 N  N     . ARG A 1 279 ? 154.384 18.859 -7.865  1.00 15.41  ? 279  ARG A N     1 
ATOM   1861 C  CA    . ARG A 1 279 ? 154.496 18.179 -9.138  1.00 14.81  ? 279  ARG A CA    1 
ATOM   1862 C  C     . ARG A 1 279 ? 153.895 16.783 -9.145  1.00 27.65  ? 279  ARG A C     1 
ATOM   1863 O  O     . ARG A 1 279 ? 154.648 15.824 -9.315  1.00 31.84  ? 279  ARG A O     1 
ATOM   1864 C  CB    . ARG A 1 279 ? 155.923 18.090 -9.620  1.00 17.68  ? 279  ARG A CB    1 
ATOM   1865 C  CG    . ARG A 1 279 ? 156.940 18.672 -8.724  1.00 40.60  ? 279  ARG A CG    1 
ATOM   1866 C  CD    . ARG A 1 279 ? 157.801 19.552 -9.550  1.00 25.95  ? 279  ARG A CD    1 
ATOM   1867 N  NE    . ARG A 1 279 ? 158.675 18.779 -10.420 1.00 44.91  ? 279  ARG A NE    1 
ATOM   1868 C  CZ    . ARG A 1 279 ? 159.536 17.868 -9.980  1.00 40.68  ? 279  ARG A CZ    1 
ATOM   1869 N  NH1   . ARG A 1 279 ? 159.655 17.583 -8.693  1.00 12.52  ? 279  ARG A NH1   1 
ATOM   1870 N  NH2   . ARG A 1 279 ? 160.282 17.228 -10.851 1.00 19.49  ? 279  ARG A NH2   1 
ATOM   1871 N  N     . GLY A 1 280 ? 152.560 16.685 -9.007  1.00 25.26  ? 280  GLY A N     1 
ATOM   1872 C  CA    . GLY A 1 280 ? 151.852 15.402 -9.011  1.00 17.27  ? 280  GLY A CA    1 
ATOM   1873 C  C     . GLY A 1 280 ? 152.573 14.409 -8.134  1.00 16.17  ? 280  GLY A C     1 
ATOM   1874 O  O     . GLY A 1 280 ? 152.813 14.688 -6.961  1.00 17.72  ? 280  GLY A O     1 
ATOM   1875 N  N     . HIS A 1 281 ? 152.950 13.275 -8.708  1.00 20.22  ? 281  HIS A N     1 
ATOM   1876 C  CA    . HIS A 1 281 ? 153.659 12.248 -7.960  1.00 19.28  ? 281  HIS A CA    1 
ATOM   1877 C  C     . HIS A 1 281 ? 155.155 12.537 -7.740  1.00 20.61  ? 281  HIS A C     1 
ATOM   1878 O  O     . HIS A 1 281 ? 155.780 11.887 -6.905  1.00 19.67  ? 281  HIS A O     1 
ATOM   1879 C  CB    . HIS A 1 281 ? 153.411 10.935 -8.624  1.00 19.29  ? 281  HIS A CB    1 
ATOM   1880 C  CG    . HIS A 1 281 ? 154.294 10.697 -9.780  1.00 28.89  ? 281  HIS A CG    1 
ATOM   1881 N  ND1   . HIS A 1 281 ? 155.378 9.848  -9.715  1.00 35.74  ? 281  HIS A ND1   1 
ATOM   1882 C  CD2   . HIS A 1 281 ? 154.259 11.177 -11.042 1.00 34.82  ? 281  HIS A CD2   1 
ATOM   1883 C  CE1   . HIS A 1 281 ? 155.972 9.812  -10.894 1.00 35.71  ? 281  HIS A CE1   1 
ATOM   1884 N  NE2   . HIS A 1 281 ? 155.312 10.609 -11.718 1.00 35.72  ? 281  HIS A NE2   1 
ATOM   1885 N  N     . ASN A 1 282 ? 155.734 13.503 -8.470  1.00 19.44  ? 282  ASN A N     1 
ATOM   1886 C  CA    . ASN A 1 282 ? 157.157 13.856 -8.327  1.00 14.84  ? 282  ASN A CA    1 
ATOM   1887 C  C     . ASN A 1 282 ? 157.413 14.631 -7.038  1.00 19.03  ? 282  ASN A C     1 
ATOM   1888 O  O     . ASN A 1 282 ? 156.491 15.157 -6.430  1.00 17.42  ? 282  ASN A O     1 
ATOM   1889 C  CB    . ASN A 1 282 ? 157.570 14.804 -9.418  1.00 16.48  ? 282  ASN A CB    1 
ATOM   1890 C  CG    . ASN A 1 282 ? 157.727 14.136 -10.749 1.00 54.74  ? 282  ASN A CG    1 
ATOM   1891 O  OD1   . ASN A 1 282 ? 157.685 12.936 -10.838 1.00 21.65  ? 282  ASN A OD1   1 
ATOM   1892 N  ND2   . ASN A 1 282 ? 157.971 14.928 -11.799 1.00 85.93  ? 282  ASN A ND2   1 
ATOM   1893 N  N     . PRO A 1 283 ? 158.666 14.706 -6.615  1.00 22.74  ? 283  PRO A N     1 
ATOM   1894 C  CA    . PRO A 1 283 ? 158.995 15.421 -5.387  1.00 18.57  ? 283  PRO A CA    1 
ATOM   1895 C  C     . PRO A 1 283 ? 158.579 16.892 -5.413  1.00 20.64  ? 283  PRO A C     1 
ATOM   1896 O  O     . PRO A 1 283 ? 158.704 17.594 -6.420  1.00 19.00  ? 283  PRO A O     1 
ATOM   1897 C  CB    . PRO A 1 283 ? 160.516 15.276 -5.298  1.00 21.03  ? 283  PRO A CB    1 
ATOM   1898 C  CG    . PRO A 1 283 ? 160.762 13.922 -5.891  1.00 23.49  ? 283  PRO A CG    1 
ATOM   1899 C  CD    . PRO A 1 283 ? 159.789 13.846 -7.052  1.00 20.75  ? 283  PRO A CD    1 
ATOM   1900 N  N     . VAL A 1 284 ? 158.094 17.355 -4.283  1.00 13.84  ? 284  VAL A N     1 
ATOM   1901 C  CA    . VAL A 1 284 ? 157.683 18.730 -4.170  1.00 11.88  ? 284  VAL A CA    1 
ATOM   1902 C  C     . VAL A 1 284 ? 158.947 19.588 -4.085  1.00 20.63  ? 284  VAL A C     1 
ATOM   1903 O  O     . VAL A 1 284 ? 159.864 19.277 -3.324  1.00 21.70  ? 284  VAL A O     1 
ATOM   1904 C  CB    . VAL A 1 284 ? 156.805 18.912 -2.869  1.00 12.16  ? 284  VAL A CB    1 
ATOM   1905 C  CG1   . VAL A 1 284 ? 156.516 20.398 -2.579  1.00 4.50   ? 284  VAL A CG1   1 
ATOM   1906 C  CG2   . VAL A 1 284 ? 155.497 18.125 -2.974  1.00 13.40  ? 284  VAL A CG2   1 
ATOM   1907 N  N     . ILE A 1 285 ? 159.000 20.660 -4.864  1.00 16.11  ? 285  ILE A N     1 
ATOM   1908 C  CA    . ILE A 1 285 ? 160.158 21.539 -4.845  1.00 18.78  ? 285  ILE A CA    1 
ATOM   1909 C  C     . ILE A 1 285 ? 159.855 22.849 -4.130  1.00 21.33  ? 285  ILE A C     1 
ATOM   1910 O  O     . ILE A 1 285 ? 158.948 23.587 -4.510  1.00 24.53  ? 285  ILE A O     1 
ATOM   1911 C  CB    . ILE A 1 285 ? 160.771 21.778 -6.203  1.00 22.37  ? 285  ILE A CB    1 
ATOM   1912 C  CG1   . ILE A 1 285 ? 161.326 20.474 -6.737  1.00 23.50  ? 285  ILE A CG1   1 
ATOM   1913 C  CG2   . ILE A 1 285 ? 161.943 22.713 -6.053  1.00 24.99  ? 285  ILE A CG2   1 
ATOM   1914 C  CD1   . ILE A 1 285 ? 161.223 20.402 -8.233  1.00 41.90  ? 285  ILE A CD1   1 
ATOM   1915 N  N     . ALA A 1 286 ? 160.628 23.126 -3.088  1.00 14.28  ? 286  ALA A N     1 
ATOM   1916 C  CA    . ALA A 1 286 ? 160.461 24.336 -2.298  1.00 14.03  ? 286  ALA A CA    1 
ATOM   1917 C  C     . ALA A 1 286 ? 161.768 25.106 -2.238  1.00 14.85  ? 286  ALA A C     1 
ATOM   1918 O  O     . ALA A 1 286 ? 162.814 24.547 -1.917  1.00 14.19  ? 286  ALA A O     1 
ATOM   1919 C  CB    . ALA A 1 286 ? 160.013 23.984 -0.896  1.00 14.40  ? 286  ALA A CB    1 
ATOM   1920 N  N     . ALA A 1 287 ? 161.689 26.384 -2.554  1.00 13.56  ? 287  ALA A N     1 
ATOM   1921 C  CA    . ALA A 1 287 ? 162.848 27.258 -2.555  1.00 20.51  ? 287  ALA A CA    1 
ATOM   1922 C  C     . ALA A 1 287 ? 162.593 28.488 -1.712  1.00 19.55  ? 287  ALA A C     1 
ATOM   1923 O  O     . ALA A 1 287 ? 161.596 29.181 -1.880  1.00 14.53  ? 287  ALA A O     1 
ATOM   1924 C  CB    . ALA A 1 287 ? 163.147 27.713 -3.977  1.00 23.77  ? 287  ALA A CB    1 
ATOM   1925 N  N     . GLU A 1 288 ? 163.501 28.764 -0.807  1.00 21.97  ? 288  GLU A N     1 
ATOM   1926 C  CA    . GLU A 1 288 ? 163.320 29.922 0.030   1.00 22.68  ? 288  GLU A CA    1 
ATOM   1927 C  C     . GLU A 1 288 ? 164.574 30.776 0.119   1.00 25.78  ? 288  GLU A C     1 
ATOM   1928 O  O     . GLU A 1 288 ? 165.704 30.285 0.130   1.00 27.47  ? 288  GLU A O     1 
ATOM   1929 C  CB    . GLU A 1 288 ? 162.917 29.461 1.396   1.00 22.45  ? 288  GLU A CB    1 
ATOM   1930 C  CG    . GLU A 1 288 ? 163.717 30.184 2.429   1.00 12.84  ? 288  GLU A CG    1 
ATOM   1931 C  CD    . GLU A 1 288 ? 163.273 29.802 3.802   1.00 52.38  ? 288  GLU A CD    1 
ATOM   1932 O  OE1   . GLU A 1 288 ? 163.083 28.586 4.044   1.00 58.22  ? 288  GLU A OE1   1 
ATOM   1933 O  OE2   . GLU A 1 288 ? 163.107 30.722 4.642   1.00 35.30  ? 288  GLU A OE2   1 
ATOM   1934 N  N     . GLN A 1 289 ? 164.355 32.067 0.260   1.00 21.77  ? 289  GLN A N     1 
ATOM   1935 C  CA    . GLN A 1 289 ? 165.444 33.017 0.394   1.00 23.88  ? 289  GLN A CA    1 
ATOM   1936 C  C     . GLN A 1 289 ? 165.580 33.423 1.853   1.00 34.52  ? 289  GLN A C     1 
ATOM   1937 O  O     . GLN A 1 289 ? 164.634 33.893 2.482   1.00 39.25  ? 289  GLN A O     1 
ATOM   1938 C  CB    . GLN A 1 289 ? 165.265 34.244 -0.505  1.00 26.12  ? 289  GLN A CB    1 
ATOM   1939 C  CG    . GLN A 1 289 ? 166.562 34.945 -0.901  1.00 43.33  ? 289  GLN A CG    1 
ATOM   1940 C  CD    . GLN A 1 289 ? 166.301 36.298 -1.531  1.00 49.19  ? 289  GLN A CD    1 
ATOM   1941 O  OE1   . GLN A 1 289 ? 166.514 36.490 -2.735  1.00 38.47  ? 289  GLN A OE1   1 
ATOM   1942 N  NE2   . GLN A 1 289 ? 165.807 37.246 -0.724  1.00 7.34   ? 289  GLN A NE2   1 
ATOM   1943 N  N     . THR A 1 290 ? 166.757 33.239 2.390   1.00 35.70  ? 290  THR A N     1 
ATOM   1944 C  CA    . THR A 1 290 ? 166.978 33.592 3.770   1.00 36.52  ? 290  THR A CA    1 
ATOM   1945 C  C     . THR A 1 290 ? 167.363 35.051 3.902   1.00 39.57  ? 290  THR A C     1 
ATOM   1946 O  O     . THR A 1 290 ? 167.619 35.735 2.906   1.00 36.63  ? 290  THR A O     1 
ATOM   1947 C  CB    . THR A 1 290 ? 168.029 32.757 4.250   1.00 39.58  ? 290  THR A CB    1 
ATOM   1948 O  OG1   . THR A 1 290 ? 169.216 33.168 3.573   1.00 32.22  ? 290  THR A OG1   1 
ATOM   1949 C  CG2   . THR A 1 290 ? 167.679 31.351 3.847   1.00 37.06  ? 290  THR A CG2   1 
ATOM   1950 N  N     . ALA A 1 291 ? 167.408 35.505 5.147   1.00 35.97  ? 291  ALA A N     1 
ATOM   1951 C  CA    . ALA A 1 291 ? 167.745 36.880 5.479   1.00 38.06  ? 291  ALA A CA    1 
ATOM   1952 C  C     . ALA A 1 291 ? 169.006 37.378 4.787   1.00 44.37  ? 291  ALA A C     1 
ATOM   1953 O  O     . ALA A 1 291 ? 169.089 38.554 4.428   1.00 46.64  ? 291  ALA A O     1 
ATOM   1954 C  CB    . ALA A 1 291 ? 167.862 37.076 6.995   1.00 37.78  ? 291  ALA A CB    1 
ATOM   1955 N  N     . ASP A 1 292 ? 169.983 36.499 4.601   1.00 37.59  ? 292  ASP A N     1 
ATOM   1956 C  CA    . ASP A 1 292 ? 171.227 36.909 3.961   1.00 32.51  ? 292  ASP A CA    1 
ATOM   1957 C  C     . ASP A 1 292 ? 171.329 36.520 2.490   1.00 40.23  ? 292  ASP A C     1 
ATOM   1958 O  O     . ASP A 1 292 ? 172.411 36.178 2.014   1.00 36.98  ? 292  ASP A O     1 
ATOM   1959 C  CB    . ASP A 1 292 ? 172.339 36.298 4.717   1.00 27.88  ? 292  ASP A CB    1 
ATOM   1960 C  CG    . ASP A 1 292 ? 172.296 34.830 4.631   1.00 37.92  ? 292  ASP A CG    1 
ATOM   1961 O  OD1   . ASP A 1 292 ? 171.217 34.311 4.300   1.00 50.14  ? 292  ASP A OD1   1 
ATOM   1962 O  OD2   . ASP A 1 292 ? 173.328 34.200 4.871   1.00 55.03  ? 292  ASP A OD2   1 
ATOM   1963 N  N     . GLY A 1 293 ? 170.213 36.602 1.771   1.00 34.46  ? 293  GLY A N     1 
ATOM   1964 C  CA    . GLY A 1 293 ? 170.209 36.267 0.354   1.00 28.99  ? 293  GLY A CA    1 
ATOM   1965 C  C     . GLY A 1 293 ? 170.616 34.817 0.106   1.00 31.30  ? 293  GLY A C     1 
ATOM   1966 O  O     . GLY A 1 293 ? 170.887 34.418 -1.029  1.00 34.95  ? 293  GLY A O     1 
ATOM   1967 N  N     . THR A 1 294 ? 170.679 34.014 1.155   1.00 19.94  ? 294  THR A N     1 
ATOM   1968 C  CA    . THR A 1 294 ? 171.051 32.620 0.963   1.00 18.61  ? 294  THR A CA    1 
ATOM   1969 C  C     . THR A 1 294 ? 169.846 31.851 0.456   1.00 21.86  ? 294  THR A C     1 
ATOM   1970 O  O     . THR A 1 294 ? 168.751 31.967 1.014   1.00 22.54  ? 294  THR A O     1 
ATOM   1971 C  CB    . THR A 1 294 ? 171.537 31.945 2.204   1.00 27.06  ? 294  THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 294 ? 172.764 32.569 2.611   1.00 18.22  ? 294  THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 294 ? 171.709 30.448 1.947   1.00 14.63  ? 294  THR A CG2   1 
ATOM   1974 N  N     . VAL A 1 295 ? 170.048 31.078 -0.603  1.00 12.73  ? 295  VAL A N     1 
ATOM   1975 C  CA    . VAL A 1 295 ? 168.959 30.301 -1.178  1.00 18.84  ? 295  VAL A CA    1 
ATOM   1976 C  C     . VAL A 1 295 ? 169.031 28.846 -0.776  1.00 30.82  ? 295  VAL A C     1 
ATOM   1977 O  O     . VAL A 1 295 ? 170.037 28.173 -1.002  1.00 34.18  ? 295  VAL A O     1 
ATOM   1978 C  CB    . VAL A 1 295 ? 168.844 30.302 -2.719  1.00 22.24  ? 295  VAL A CB    1 
ATOM   1979 C  CG1   . VAL A 1 295 ? 167.928 29.174 -3.172  1.00 19.31  ? 295  VAL A CG1   1 
ATOM   1980 C  CG2   . VAL A 1 295 ? 168.261 31.605 -3.207  1.00 20.69  ? 295  VAL A CG2   1 
ATOM   1981 N  N     . VAL A 1 296 ? 167.950 28.379 -0.181  1.00 19.33  ? 296  VAL A N     1 
ATOM   1982 C  CA    . VAL A 1 296 ? 167.865 27.007 0.252   1.00 16.92  ? 296  VAL A CA    1 
ATOM   1983 C  C     . VAL A 1 296 ? 166.701 26.361 -0.438  1.00 20.91  ? 296  VAL A C     1 
ATOM   1984 O  O     . VAL A 1 296 ? 165.580 26.864 -0.401  1.00 28.61  ? 296  VAL A O     1 
ATOM   1985 C  CB    . VAL A 1 296 ? 167.533 26.951 1.703   1.00 19.84  ? 296  VAL A CB    1 
ATOM   1986 C  CG1   . VAL A 1 296 ? 167.524 25.487 2.149   1.00 15.77  ? 296  VAL A CG1   1 
ATOM   1987 C  CG2   . VAL A 1 296 ? 168.425 27.948 2.464   1.00 16.60  ? 296  VAL A CG2   1 
ATOM   1988 N  N     . VAL A 1 297 ? 166.960 25.254 -1.066  1.00 9.29   ? 297  VAL A N     1 
ATOM   1989 C  CA    . VAL A 1 297 ? 165.905 24.575 -1.763  1.00 11.09  ? 297  VAL A CA    1 
ATOM   1990 C  C     . VAL A 1 297 ? 165.718 23.178 -1.221  1.00 20.06  ? 297  VAL A C     1 
ATOM   1991 O  O     . VAL A 1 297 ? 166.660 22.556 -0.739  1.00 18.36  ? 297  VAL A O     1 
ATOM   1992 C  CB    . VAL A 1 297 ? 166.449 24.529 -3.162  1.00 19.34  ? 297  VAL A CB    1 
ATOM   1993 C  CG1   . VAL A 1 297 ? 165.616 23.694 -4.134  1.00 20.06  ? 297  VAL A CG1   1 
ATOM   1994 C  CG2   . VAL A 1 297 ? 166.742 25.973 -3.586  1.00 16.61  ? 297  VAL A CG2   1 
ATOM   1995 N  N     . HIS A 1 298 ? 164.498 22.690 -1.294  1.00 17.46  ? 298  HIS A N     1 
ATOM   1996 C  CA    . HIS A 1 298 ? 164.224 21.360 -0.810  1.00 13.72  ? 298  HIS A CA    1 
ATOM   1997 C  C     . HIS A 1 298 ? 163.382 20.600 -1.805  1.00 11.07  ? 298  HIS A C     1 
ATOM   1998 O  O     . HIS A 1 298 ? 162.403 21.121 -2.323  1.00 22.73  ? 298  HIS A O     1 
ATOM   1999 C  CB    . HIS A 1 298 ? 163.336 21.435 0.434   1.00 15.41  ? 298  HIS A CB    1 
ATOM   2000 C  CG    . HIS A 1 298 ? 164.054 21.811 1.681   1.00 23.14  ? 298  HIS A CG    1 
ATOM   2001 N  ND1   . HIS A 1 298 ? 164.477 20.883 2.609   1.00 26.67  ? 298  HIS A ND1   1 
ATOM   2002 C  CD2   . HIS A 1 298 ? 164.406 23.020 2.173   1.00 25.80  ? 298  HIS A CD2   1 
ATOM   2003 C  CE1   . HIS A 1 298 ? 165.071 21.507 3.614   1.00 25.97  ? 298  HIS A CE1   1 
ATOM   2004 N  NE2   . HIS A 1 298 ? 165.038 22.807 3.372   1.00 26.50  ? 298  HIS A NE2   1 
ATOM   2005 N  N     . GLU A 1 299 ? 163.764 19.374 -2.071  1.00 4.50   ? 299  GLU A N     1 
ATOM   2006 C  CA    . GLU A 1 299 ? 163.011 18.537 -2.985  1.00 10.78  ? 299  GLU A CA    1 
ATOM   2007 C  C     . GLU A 1 299 ? 162.415 17.486 -2.079  1.00 19.46  ? 299  GLU A C     1 
ATOM   2008 O  O     . GLU A 1 299 ? 163.138 16.593 -1.641  1.00 13.44  ? 299  GLU A O     1 
ATOM   2009 C  CB    . GLU A 1 299 ? 163.881 17.783 -3.955  1.00 13.75  ? 299  GLU A CB    1 
ATOM   2010 C  CG    . GLU A 1 299 ? 164.107 18.514 -5.231  1.00 19.12  ? 299  GLU A CG    1 
ATOM   2011 C  CD    . GLU A 1 299 ? 165.491 18.968 -5.286  1.00 45.05  ? 299  GLU A CD    1 
ATOM   2012 O  OE1   . GLU A 1 299 ? 166.144 18.737 -6.323  1.00 40.07  ? 299  GLU A OE1   1 
ATOM   2013 O  OE2   . GLU A 1 299 ? 165.930 19.542 -4.264  1.00 53.69  ? 299  GLU A OE2   1 
ATOM   2014 N  N     . VAL A 1 300 ? 161.125 17.593 -1.765  1.00 17.00  ? 300  VAL A N     1 
ATOM   2015 C  CA    . VAL A 1 300 ? 160.509 16.616 -0.874  1.00 12.02  ? 300  VAL A CA    1 
ATOM   2016 C  C     . VAL A 1 300 ? 159.872 15.466 -1.643  1.00 15.96  ? 300  VAL A C     1 
ATOM   2017 O  O     . VAL A 1 300 ? 159.129 15.671 -2.603  1.00 23.90  ? 300  VAL A O     1 
ATOM   2018 C  CB    . VAL A 1 300 ? 159.884 17.266 0.404   1.00 13.88  ? 300  VAL A CB    1 
ATOM   2019 C  CG1   . VAL A 1 300 ? 159.482 16.235 1.420   1.00 14.58  ? 300  VAL A CG1   1 
ATOM   2020 C  CG2   . VAL A 1 300 ? 160.888 18.203 1.099   1.00 9.94   ? 300  VAL A CG2   1 
ATOM   2021 N  N     . GLY A 1 301 ? 160.176 14.252 -1.230  1.00 11.99  ? 301  GLY A N     1 
ATOM   2022 C  CA    . GLY A 1 301 ? 159.629 13.079 -1.902  1.00 14.59  ? 301  GLY A CA    1 
ATOM   2023 C  C     . GLY A 1 301 ? 158.163 12.808 -1.547  1.00 28.26  ? 301  GLY A C     1 
ATOM   2024 O  O     . GLY A 1 301 ? 157.734 12.960 -0.396  1.00 25.90  ? 301  GLY A O     1 
ATOM   2025 N  N     . VAL A 1 302 ? 157.395 12.404 -2.553  1.00 20.95  ? 302  VAL A N     1 
ATOM   2026 C  CA    . VAL A 1 302 ? 155.995 12.100 -2.339  1.00 16.15  ? 302  VAL A CA    1 
ATOM   2027 C  C     . VAL A 1 302 ? 155.885 10.608 -2.170  1.00 19.51  ? 302  VAL A C     1 
ATOM   2028 O  O     . VAL A 1 302 ? 156.398 9.854  -2.990  1.00 24.02  ? 302  VAL A O     1 
ATOM   2029 C  CB    . VAL A 1 302 ? 155.010 12.683 -3.387  1.00 22.43  ? 302  VAL A CB    1 
ATOM   2030 C  CG1   . VAL A 1 302 ? 153.951 11.697 -3.852  1.00 18.90  ? 302  VAL A CG1   1 
ATOM   2031 C  CG2   . VAL A 1 302 ? 154.249 13.830 -2.761  1.00 29.35  ? 302  VAL A CG2   1 
ATOM   2032 N  N     . PRO A 1 303 ? 155.238 10.183 -1.105  1.00 13.54  ? 303  PRO A N     1 
ATOM   2033 C  CA    . PRO A 1 303 ? 155.084 8.756  -0.855  1.00 14.65  ? 303  PRO A CA    1 
ATOM   2034 C  C     . PRO A 1 303 ? 154.270 8.092  -1.962  1.00 30.79  ? 303  PRO A C     1 
ATOM   2035 O  O     . PRO A 1 303 ? 153.242 8.606  -2.406  1.00 30.53  ? 303  PRO A O     1 
ATOM   2036 C  CB    . PRO A 1 303 ? 154.488 8.666  0.556   1.00 14.33  ? 303  PRO A CB    1 
ATOM   2037 C  CG    . PRO A 1 303 ? 154.657 10.050 1.143   1.00 15.18  ? 303  PRO A CG    1 
ATOM   2038 C  CD    . PRO A 1 303 ? 154.807 11.041 0.016   1.00 9.74   ? 303  PRO A CD    1 
ATOM   2039 N  N     . VAL A 1 304 ? 154.745 6.946  -2.408  1.00 37.66  ? 304  VAL A N     1 
ATOM   2040 C  CA    . VAL A 1 304 ? 154.084 6.205  -3.464  1.00 36.18  ? 304  VAL A CA    1 
ATOM   2041 C  C     . VAL A 1 304 ? 152.655 5.790  -3.122  1.00 32.85  ? 304  VAL A C     1 
ATOM   2042 O  O     . VAL A 1 304 ? 152.369 5.301  -2.029  1.00 30.68  ? 304  VAL A O     1 
ATOM   2043 C  CB    . VAL A 1 304 ? 154.878 4.920  -3.718  1.00 40.69  ? 304  VAL A CB    1 
ATOM   2044 C  CG1   . VAL A 1 304 ? 154.335 4.172  -4.930  1.00 40.19  ? 304  VAL A CG1   1 
ATOM   2045 C  CG2   . VAL A 1 304 ? 156.355 5.254  -3.856  1.00 40.23  ? 304  VAL A CG2   1 
ATOM   2046 N  N     . VAL A 1 305 ? 151.772 5.996  -4.092  1.00 24.13  ? 305  VAL A N     1 
ATOM   2047 C  CA    . VAL A 1 305 ? 150.361 5.637  -3.984  1.00 21.05  ? 305  VAL A CA    1 
ATOM   2048 C  C     . VAL A 1 305 ? 150.013 4.903  -5.262  1.00 34.21  ? 305  VAL A C     1 
ATOM   2049 O  O     . VAL A 1 305 ? 150.013 5.503  -6.334  1.00 43.50  ? 305  VAL A O     1 
ATOM   2050 C  CB    . VAL A 1 305 ? 149.353 6.766  -3.803  1.00 21.90  ? 305  VAL A CB    1 
ATOM   2051 C  CG1   . VAL A 1 305 ? 147.941 6.194  -3.922  1.00 22.30  ? 305  VAL A CG1   1 
ATOM   2052 C  CG2   . VAL A 1 305 ? 149.538 7.413  -2.448  1.00 17.26  ? 305  VAL A CG2   1 
ATOM   2053 N  N     . ALA A 1 306 ? 149.775 3.608  -5.158  1.00 28.37  ? 306  ALA A N     1 
ATOM   2054 C  CA    . ALA A 1 306 ? 149.463 2.812  -6.334  1.00 29.24  ? 306  ALA A CA    1 
ATOM   2055 C  C     . ALA A 1 306 ? 148.350 3.419  -7.169  1.00 33.21  ? 306  ALA A C     1 
ATOM   2056 O  O     . ALA A 1 306 ? 147.351 3.911  -6.634  1.00 35.78  ? 306  ALA A O     1 
ATOM   2057 C  CB    . ALA A 1 306 ? 149.144 1.390  -5.965  1.00 31.83  ? 306  ALA A CB    1 
ATOM   2058 N  N     . ALA A 1 307 ? 148.544 3.382  -8.481  1.00 26.68  ? 307  ALA A N     1 
ATOM   2059 C  CA    . ALA A 1 307 ? 147.585 3.920  -9.439  1.00 24.68  ? 307  ALA A CA    1 
ATOM   2060 C  C     . ALA A 1 307 ? 146.151 3.498  -9.122  1.00 26.82  ? 307  ALA A C     1 
ATOM   2061 O  O     . ALA A 1 307 ? 145.261 4.341  -9.000  1.00 23.02  ? 307  ALA A O     1 
ATOM   2062 C  CB    . ALA A 1 307 ? 147.958 3.489  -10.859 1.00 24.01  ? 307  ALA A CB    1 
ATOM   2063 N  N     . GLU A 1 308 ? 145.937 2.195  -8.990  1.00 31.19  ? 308  GLU A N     1 
ATOM   2064 C  CA    . GLU A 1 308 ? 144.609 1.669  -8.697  1.00 35.12  ? 308  GLU A CA    1 
ATOM   2065 C  C     . GLU A 1 308 ? 143.967 2.277  -7.453  1.00 37.81  ? 308  GLU A C     1 
ATOM   2066 O  O     . GLU A 1 308 ? 142.768 2.507  -7.433  1.00 38.81  ? 308  GLU A O     1 
ATOM   2067 C  CB    . GLU A 1 308 ? 144.471 0.159  -8.889  1.00 39.74  ? 308  GLU A CB    1 
ATOM   2068 C  CG    . GLU A 1 308 ? 145.789 -0.605 -9.042  1.00 65.27  ? 308  GLU A CG    1 
ATOM   2069 C  CD    . GLU A 1 308 ? 146.473 -0.475 -10.419 1.00 88.45  ? 308  GLU A CD    1 
ATOM   2070 O  OE1   . GLU A 1 308 ? 145.834 -0.761 -11.464 1.00 90.11  ? 308  GLU A OE1   1 
ATOM   2071 O  OE2   . GLU A 1 308 ? 147.677 -0.121 -10.428 1.00 49.48  ? 308  GLU A OE2   1 
ATOM   2072 N  N     . LYS A 1 309 ? 144.749 2.547  -6.418  1.00 35.18  ? 309  LYS A N     1 
ATOM   2073 C  CA    . LYS A 1 309 ? 144.191 3.134  -5.203  1.00 31.33  ? 309  LYS A CA    1 
ATOM   2074 C  C     . LYS A 1 309 ? 143.748 4.573  -5.434  1.00 27.39  ? 309  LYS A C     1 
ATOM   2075 O  O     . LYS A 1 309 ? 142.915 5.093  -4.697  1.00 22.67  ? 309  LYS A O     1 
ATOM   2076 C  CB    . LYS A 1 309 ? 145.215 3.155  -4.093  1.00 31.38  ? 309  LYS A CB    1 
ATOM   2077 C  CG    . LYS A 1 309 ? 144.861 2.301  -2.898  1.00 36.96  ? 309  LYS A CG    1 
ATOM   2078 C  CD    . LYS A 1 309 ? 146.145 1.696  -2.376  1.00 51.45  ? 309  LYS A CD    1 
ATOM   2079 C  CE    . LYS A 1 309 ? 147.137 1.521  -3.520  1.00 67.07  ? 309  LYS A CE    1 
ATOM   2080 N  NZ    . LYS A 1 309 ? 147.964 2.728  -3.810  1.00 90.27  ? 309  LYS A NZ    1 
ATOM   2081 N  N     . ILE A 1 310 ? 144.321 5.215  -6.453  1.00 26.93  ? 310  ILE A N     1 
ATOM   2082 C  CA    . ILE A 1 310 ? 143.971 6.597  -6.770  1.00 26.97  ? 310  ILE A CA    1 
ATOM   2083 C  C     . ILE A 1 310 ? 142.588 6.647  -7.407  1.00 39.05  ? 310  ILE A C     1 
ATOM   2084 O  O     . ILE A 1 310 ? 142.310 5.936  -8.378  1.00 40.33  ? 310  ILE A O     1 
ATOM   2085 C  CB    . ILE A 1 310 ? 144.950 7.284  -7.734  1.00 26.16  ? 310  ILE A CB    1 
ATOM   2086 C  CG1   . ILE A 1 310 ? 146.147 7.727  -6.968  1.00 24.07  ? 310  ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A 1 310 ? 144.396 8.626  -8.189  1.00 31.22  ? 310  ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A 1 310 ? 147.339 7.915  -7.867  1.00 43.95  ? 310  ILE A CD1   1 
ATOM   2089 N  N     . VAL A 1 311 ? 141.720 7.475  -6.848  1.00 33.12  ? 311  VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 311 ? 140.367 7.609  -7.360  1.00 31.80  ? 311  VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 311 ? 140.310 8.769  -8.346  1.00 42.10  ? 311  VAL A C     1 
ATOM   2092 O  O     . VAL A 1 311 ? 140.065 8.582  -9.541  1.00 42.34  ? 311  VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 311 ? 139.377 7.757  -6.180  1.00 32.81  ? 311  VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 311 ? 137.959 7.932  -6.701  1.00 33.01  ? 311  VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 311 ? 139.451 6.532  -5.266  1.00 30.54  ? 311  VAL A CG2   1 
ATOM   2096 N  N     . ASP A 1 312 ? 140.543 9.965  -7.821  1.00 39.01  ? 312  ASP A N     1 
ATOM   2097 C  CA    . ASP A 1 312 ? 140.548 11.191 -8.603  1.00 39.85  ? 312  ASP A CA    1 
ATOM   2098 C  C     . ASP A 1 312 ? 141.540 12.167 -7.992  1.00 40.66  ? 312  ASP A C     1 
ATOM   2099 O  O     . ASP A 1 312 ? 142.020 11.956 -6.878  1.00 46.64  ? 312  ASP A O     1 
ATOM   2100 C  CB    . ASP A 1 312 ? 139.148 11.795 -8.892  1.00 41.28  ? 312  ASP A CB    1 
ATOM   2101 C  CG    . ASP A 1 312 ? 138.473 12.353 -7.660  1.00 30.51  ? 312  ASP A CG    1 
ATOM   2102 O  OD1   . ASP A 1 312 ? 137.704 11.593 -7.039  1.00 28.72  ? 312  ASP A OD1   1 
ATOM   2103 O  OD2   . ASP A 1 312 ? 138.710 13.537 -7.337  1.00 32.20  ? 312  ASP A OD2   1 
ATOM   2104 N  N     . THR A 1 313 ? 141.848 13.225 -8.720  1.00 25.10  ? 313  THR A N     1 
ATOM   2105 C  CA    . THR A 1 313 ? 142.792 14.222 -8.248  1.00 24.96  ? 313  THR A CA    1 
ATOM   2106 C  C     . THR A 1 313 ? 142.101 15.563 -8.010  1.00 33.56  ? 313  THR A C     1 
ATOM   2107 O  O     . THR A 1 313 ? 142.759 16.600 -7.940  1.00 36.97  ? 313  THR A O     1 
ATOM   2108 C  CB    . THR A 1 313 ? 143.820 14.436 -9.432  1.00 38.63  ? 313  THR A CB    1 
ATOM   2109 O  OG1   . THR A 1 313 ? 143.142 15.064 -10.529 1.00 45.65  ? 313  THR A OG1   1 
ATOM   2110 C  CG2   . THR A 1 313 ? 144.374 13.097 -9.979  1.00 27.99  ? 313  THR A CG2   1 
ATOM   2111 N  N     . ASN A 1 314 ? 140.778 15.550 -7.891  1.00 30.18  ? 314  ASN A N     1 
ATOM   2112 C  CA    . ASN A 1 314 ? 140.053 16.796 -7.668  1.00 27.38  ? 314  ASN A CA    1 
ATOM   2113 C  C     . ASN A 1 314 ? 140.238 17.273 -6.245  1.00 14.37  ? 314  ASN A C     1 
ATOM   2114 O  O     . ASN A 1 314 ? 140.023 16.516 -5.317  1.00 17.75  ? 314  ASN A O     1 
ATOM   2115 C  CB    . ASN A 1 314 ? 138.565 16.678 -7.877  1.00 22.83  ? 314  ASN A CB    1 
ATOM   2116 C  CG    . ASN A 1 314 ? 137.831 17.881 -7.316  1.00 29.87  ? 314  ASN A CG    1 
ATOM   2117 O  OD1   . ASN A 1 314 ? 137.186 17.815 -6.255  1.00 52.70  ? 314  ASN A OD1   1 
ATOM   2118 N  ND2   . ASN A 1 314 ? 137.933 19.008 -8.031  1.00 5.11   ? 314  ASN A ND2   1 
ATOM   2119 N  N     . GLY A 1 315 ? 140.642 18.517 -6.063  1.00 13.85  ? 315  GLY A N     1 
ATOM   2120 C  CA    . GLY A 1 315 ? 140.841 19.038 -4.711  1.00 15.39  ? 315  GLY A CA    1 
ATOM   2121 C  C     . GLY A 1 315 ? 142.202 18.643 -4.115  1.00 20.45  ? 315  GLY A C     1 
ATOM   2122 O  O     . GLY A 1 315 ? 142.436 18.848 -2.922  1.00 18.96  ? 315  GLY A O     1 
ATOM   2123 N  N     . ALA A 1 316 ? 143.106 18.089 -4.941  1.00 12.79  ? 316  ALA A N     1 
ATOM   2124 C  CA    . ALA A 1 316 ? 144.438 17.673 -4.474  1.00 10.03  ? 316  ALA A CA    1 
ATOM   2125 C  C     . ALA A 1 316 ? 145.236 18.824 -3.881  1.00 17.69  ? 316  ALA A C     1 
ATOM   2126 O  O     . ALA A 1 316 ? 145.697 18.747 -2.731  1.00 12.16  ? 316  ALA A O     1 
ATOM   2127 C  CB    . ALA A 1 316 ? 145.277 17.034 -5.556  1.00 7.16   ? 316  ALA A CB    1 
ATOM   2128 N  N     . GLY A 1 317 ? 145.400 19.882 -4.678  1.00 10.96  ? 317  GLY A N     1 
ATOM   2129 C  CA    . GLY A 1 317 ? 146.149 21.064 -4.258  1.00 8.32   ? 317  GLY A CA    1 
ATOM   2130 C  C     . GLY A 1 317 ? 145.582 21.662 -2.983  1.00 14.79  ? 317  GLY A C     1 
ATOM   2131 O  O     . GLY A 1 317 ? 146.321 21.905 -2.030  1.00 23.36  ? 317  GLY A O     1 
ATOM   2132 N  N     . ASP A 1 318 ? 144.270 21.904 -2.988  1.00 14.64  ? 318  ASP A N     1 
ATOM   2133 C  CA    . ASP A 1 318 ? 143.538 22.484 -1.865  1.00 11.10  ? 318  ASP A CA    1 
ATOM   2134 C  C     . ASP A 1 318 ? 143.812 21.690 -0.614  1.00 14.38  ? 318  ASP A C     1 
ATOM   2135 O  O     . ASP A 1 318 ? 143.956 22.262 0.462   1.00 21.04  ? 318  ASP A O     1 
ATOM   2136 C  CB    . ASP A 1 318 ? 142.040 22.608 -2.123  1.00 9.80   ? 318  ASP A CB    1 
ATOM   2137 C  CG    . ASP A 1 318 ? 141.716 23.137 -3.532  1.00 17.23  ? 318  ASP A CG    1 
ATOM   2138 O  OD1   . ASP A 1 318 ? 142.513 23.939 -4.095  1.00 17.82  ? 318  ASP A OD1   1 
ATOM   2139 O  OD2   . ASP A 1 318 ? 140.654 22.711 -4.077  1.00 15.83  ? 318  ASP A OD2   1 
ATOM   2140 N  N     . ALA A 1 319 ? 143.883 20.371 -0.762  1.00 3.77   ? 319  ALA A N     1 
ATOM   2141 C  CA    . ALA A 1 319 ? 144.170 19.497 0.377   1.00 7.51   ? 319  ALA A CA    1 
ATOM   2142 C  C     . ALA A 1 319 ? 145.623 19.706 0.788   1.00 12.03  ? 319  ALA A C     1 
ATOM   2143 O  O     . ALA A 1 319 ? 145.977 19.666 1.968   1.00 10.09  ? 319  ALA A O     1 
ATOM   2144 C  CB    . ALA A 1 319 ? 143.975 18.055 -0.011  1.00 11.97  ? 319  ALA A CB    1 
ATOM   2145 N  N     . PHE A 1 320 ? 146.459 19.936 -0.211  1.00 5.06   ? 320  PHE A N     1 
ATOM   2146 C  CA    . PHE A 1 320 ? 147.856 20.159 0.040   1.00 5.74   ? 320  PHE A CA    1 
ATOM   2147 C  C     . PHE A 1 320 ? 148.066 21.471 0.781   1.00 14.12  ? 320  PHE A C     1 
ATOM   2148 O  O     . PHE A 1 320 ? 148.711 21.500 1.825   1.00 18.39  ? 320  PHE A O     1 
ATOM   2149 C  CB    . PHE A 1 320 ? 148.630 20.194 -1.228  1.00 10.12  ? 320  PHE A CB    1 
ATOM   2150 C  CG    . PHE A 1 320 ? 150.083 20.482 -0.992  1.00 16.07  ? 320  PHE A CG    1 
ATOM   2151 C  CD1   . PHE A 1 320 ? 150.993 19.424 -0.865  1.00 17.56  ? 320  PHE A CD1   1 
ATOM   2152 C  CD2   . PHE A 1 320 ? 150.563 21.806 -0.840  1.00 16.42  ? 320  PHE A CD2   1 
ATOM   2153 C  CE1   . PHE A 1 320 ? 152.347 19.653 -0.636  1.00 13.14  ? 320  PHE A CE1   1 
ATOM   2154 C  CE2   . PHE A 1 320 ? 151.916 22.041 -0.591  1.00 19.42  ? 320  PHE A CE2   1 
ATOM   2155 C  CZ    . PHE A 1 320 ? 152.807 20.961 -0.518  1.00 16.56  ? 320  PHE A CZ    1 
ATOM   2156 N  N     . VAL A 1 321 ? 147.536 22.562 0.242   1.00 10.36  ? 321  VAL A N     1 
ATOM   2157 C  CA    . VAL A 1 321 ? 147.703 23.855 0.894   1.00 11.56  ? 321  VAL A CA    1 
ATOM   2158 C  C     . VAL A 1 321 ? 147.122 23.842 2.307   1.00 15.71  ? 321  VAL A C     1 
ATOM   2159 O  O     . VAL A 1 321 ? 147.647 24.481 3.220   1.00 17.70  ? 321  VAL A O     1 
ATOM   2160 C  CB    . VAL A 1 321 ? 147.160 25.027 0.023   1.00 12.76  ? 321  VAL A CB    1 
ATOM   2161 C  CG1   . VAL A 1 321 ? 147.029 26.318 0.824   1.00 6.13   ? 321  VAL A CG1   1 
ATOM   2162 C  CG2   . VAL A 1 321 ? 148.074 25.254 -1.171  1.00 14.03  ? 321  VAL A CG2   1 
ATOM   2163 N  N     . GLY A 1 322 ? 146.036 23.104 2.480   1.00 9.72   ? 322  GLY A N     1 
ATOM   2164 C  CA    . GLY A 1 322 ? 145.390 23.014 3.776   1.00 10.69  ? 322  GLY A CA    1 
ATOM   2165 C  C     . GLY A 1 322 ? 146.344 22.430 4.796   1.00 13.44  ? 322  GLY A C     1 
ATOM   2166 O  O     . GLY A 1 322 ? 146.571 23.018 5.852   1.00 13.39  ? 322  GLY A O     1 
ATOM   2167 N  N     . GLY A 1 323 ? 146.892 21.263 4.469   1.00 12.36  ? 323  GLY A N     1 
ATOM   2168 C  CA    . GLY A 1 323 ? 147.831 20.591 5.357   1.00 12.67  ? 323  GLY A CA    1 
ATOM   2169 C  C     . GLY A 1 323 ? 148.952 21.549 5.704   1.00 11.90  ? 323  GLY A C     1 
ATOM   2170 O  O     . GLY A 1 323 ? 149.290 21.740 6.880   1.00 6.73   ? 323  GLY A O     1 
ATOM   2171 N  N     . PHE A 1 324 ? 149.504 22.156 4.654   1.00 6.77   ? 324  PHE A N     1 
ATOM   2172 C  CA    . PHE A 1 324 ? 150.590 23.110 4.789   1.00 10.20  ? 324  PHE A CA    1 
ATOM   2173 C  C     . PHE A 1 324 ? 150.255 24.202 5.804   1.00 24.45  ? 324  PHE A C     1 
ATOM   2174 O  O     . PHE A 1 324 ? 150.899 24.306 6.848   1.00 25.59  ? 324  PHE A O     1 
ATOM   2175 C  CB    . PHE A 1 324 ? 150.941 23.675 3.447   1.00 12.26  ? 324  PHE A CB    1 
ATOM   2176 C  CG    . PHE A 1 324 ? 152.286 24.244 3.423   1.00 17.75  ? 324  PHE A CG    1 
ATOM   2177 C  CD1   . PHE A 1 324 ? 153.365 23.514 2.882   1.00 25.94  ? 324  PHE A CD1   1 
ATOM   2178 C  CD2   . PHE A 1 324 ? 152.522 25.491 3.978   1.00 18.13  ? 324  PHE A CD2   1 
ATOM   2179 C  CE1   . PHE A 1 324 ? 154.664 24.038 2.867   1.00 22.19  ? 324  PHE A CE1   1 
ATOM   2180 C  CE2   . PHE A 1 324 ? 153.824 26.015 3.975   1.00 20.59  ? 324  PHE A CE2   1 
ATOM   2181 C  CZ    . PHE A 1 324 ? 154.893 25.287 3.415   1.00 17.51  ? 324  PHE A CZ    1 
ATOM   2182 N  N     . LEU A 1 325 ? 149.241 25.010 5.500   1.00 15.54  ? 325  LEU A N     1 
ATOM   2183 C  CA    . LEU A 1 325 ? 148.844 26.086 6.398   1.00 7.36   ? 325  LEU A CA    1 
ATOM   2184 C  C     . LEU A 1 325 ? 148.620 25.594 7.830   1.00 9.89   ? 325  LEU A C     1 
ATOM   2185 O  O     . LEU A 1 325 ? 148.972 26.281 8.794   1.00 2.47   ? 325  LEU A O     1 
ATOM   2186 C  CB    . LEU A 1 325 ? 147.706 26.823 5.823   1.00 5.36   ? 325  LEU A CB    1 
ATOM   2187 C  CG    . LEU A 1 325 ? 147.919 27.444 4.462   1.00 5.51   ? 325  LEU A CG    1 
ATOM   2188 C  CD1   . LEU A 1 325 ? 146.540 27.983 3.946   1.00 2.67   ? 325  LEU A CD1   1 
ATOM   2189 C  CD2   . LEU A 1 325 ? 148.975 28.543 4.594   1.00 6.92   ? 325  LEU A CD2   1 
ATOM   2190 N  N     . TYR A 1 326 ? 148.042 24.404 7.972   1.00 6.48   ? 326  TYR A N     1 
ATOM   2191 C  CA    . TYR A 1 326 ? 147.798 23.844 9.296   1.00 9.82   ? 326  TYR A CA    1 
ATOM   2192 C  C     . TYR A 1 326 ? 149.123 23.752 10.045  1.00 19.56  ? 326  TYR A C     1 
ATOM   2193 O  O     . TYR A 1 326 ? 149.312 24.377 11.094  1.00 8.86   ? 326  TYR A O     1 
ATOM   2194 C  CB    . TYR A 1 326 ? 147.204 22.405 9.218   1.00 14.94  ? 326  TYR A CB    1 
ATOM   2195 C  CG    . TYR A 1 326 ? 147.305 21.597 10.543  1.00 16.17  ? 326  TYR A CG    1 
ATOM   2196 C  CD1   . TYR A 1 326 ? 146.724 22.068 11.723  1.00 17.39  ? 326  TYR A CD1   1 
ATOM   2197 C  CD2   . TYR A 1 326 ? 147.996 20.362 10.614  1.00 18.48  ? 326  TYR A CD2   1 
ATOM   2198 C  CE1   . TYR A 1 326 ? 146.825 21.332 12.925  1.00 28.64  ? 326  TYR A CE1   1 
ATOM   2199 C  CE2   . TYR A 1 326 ? 148.102 19.621 11.812  1.00 15.88  ? 326  TYR A CE2   1 
ATOM   2200 C  CZ    . TYR A 1 326 ? 147.520 20.110 12.963  1.00 32.34  ? 326  TYR A CZ    1 
ATOM   2201 O  OH    . TYR A 1 326 ? 147.619 19.397 14.142  1.00 55.87  ? 326  TYR A OH    1 
ATOM   2202 N  N     . GLY A 1 327 ? 150.036 22.960 9.479   1.00 22.81  ? 327  GLY A N     1 
ATOM   2203 C  CA    . GLY A 1 327 ? 151.361 22.761 10.052  1.00 23.25  ? 327  GLY A CA    1 
ATOM   2204 C  C     . GLY A 1 327 ? 152.051 24.105 10.267  1.00 25.14  ? 327  GLY A C     1 
ATOM   2205 O  O     . GLY A 1 327 ? 152.687 24.326 11.303  1.00 23.70  ? 327  GLY A O     1 
ATOM   2206 N  N     . LEU A 1 328 ? 151.917 24.994 9.286   1.00 12.96  ? 328  LEU A N     1 
ATOM   2207 C  CA    . LEU A 1 328 ? 152.521 26.310 9.373   1.00 9.54   ? 328  LEU A CA    1 
ATOM   2208 C  C     . LEU A 1 328 ? 152.128 26.981 10.683  1.00 17.06  ? 328  LEU A C     1 
ATOM   2209 O  O     . LEU A 1 328 ? 152.979 27.302 11.509  1.00 21.35  ? 328  LEU A O     1 
ATOM   2210 C  CB    . LEU A 1 328 ? 152.144 27.162 8.152   1.00 8.46   ? 328  LEU A CB    1 
ATOM   2211 C  CG    . LEU A 1 328 ? 153.028 28.410 7.964   1.00 16.22  ? 328  LEU A CG    1 
ATOM   2212 C  CD1   . LEU A 1 328 ? 154.515 28.089 8.017   1.00 12.68  ? 328  LEU A CD1   1 
ATOM   2213 C  CD2   . LEU A 1 328 ? 152.721 29.169 6.681   1.00 29.34  ? 328  LEU A CD2   1 
ATOM   2214 N  N     . SER A 1 329 ? 150.835 27.176 10.876  1.00 22.17  ? 329  SER A N     1 
ATOM   2215 C  CA    . SER A 1 329 ? 150.334 27.807 12.094  1.00 18.48  ? 329  SER A CA    1 
ATOM   2216 C  C     . SER A 1 329 ? 150.803 27.051 13.326  1.00 17.89  ? 329  SER A C     1 
ATOM   2217 O  O     . SER A 1 329 ? 150.712 27.553 14.449  1.00 20.01  ? 329  SER A O     1 
ATOM   2218 C  CB    . SER A 1 329 ? 148.810 27.803 12.104  1.00 13.31  ? 329  SER A CB    1 
ATOM   2219 O  OG    . SER A 1 329 ? 148.332 26.545 12.573  1.00 33.83  ? 329  SER A OG    1 
ATOM   2220 N  N     . GLN A 1 330 ? 151.288 25.839 13.104  1.00 9.95   ? 330  GLN A N     1 
ATOM   2221 C  CA    . GLN A 1 330 ? 151.767 24.995 14.185  1.00 16.89  ? 330  GLN A CA    1 
ATOM   2222 C  C     . GLN A 1 330 ? 153.265 25.195 14.439  1.00 32.16  ? 330  GLN A C     1 
ATOM   2223 O  O     . GLN A 1 330 ? 153.813 24.617 15.374  1.00 35.17  ? 330  GLN A O     1 
ATOM   2224 C  CB    . GLN A 1 330 ? 151.555 23.513 13.811  1.00 23.49  ? 330  GLN A CB    1 
ATOM   2225 C  CG    . GLN A 1 330 ? 150.113 22.990 13.815  1.00 35.28  ? 330  GLN A CG    1 
ATOM   2226 C  CD    . GLN A 1 330 ? 149.501 23.116 15.189  1.00 74.81  ? 330  GLN A CD    1 
ATOM   2227 O  OE1   . GLN A 1 330 ? 149.285 22.125 15.885  1.00 88.14  ? 330  GLN A OE1   1 
ATOM   2228 N  NE2   . GLN A 1 330 ? 149.241 24.354 15.601  1.00 43.27  ? 330  GLN A NE2   1 
ATOM   2229 N  N     . GLY A 1 331 ? 153.934 25.998 13.609  1.00 24.74  ? 331  GLY A N     1 
ATOM   2230 C  CA    . GLY A 1 331 ? 155.366 26.243 13.778  1.00 21.08  ? 331  GLY A CA    1 
ATOM   2231 C  C     . GLY A 1 331 ? 156.262 25.125 13.219  1.00 31.71  ? 331  GLY A C     1 
ATOM   2232 O  O     . GLY A 1 331 ? 157.474 25.155 13.404  1.00 36.41  ? 331  GLY A O     1 
ATOM   2233 N  N     . LYS A 1 332 ? 155.701 24.136 12.540  1.00 22.00  ? 332  LYS A N     1 
ATOM   2234 C  CA    . LYS A 1 332 ? 156.550 23.084 12.002  1.00 20.45  ? 332  LYS A CA    1 
ATOM   2235 C  C     . LYS A 1 332 ? 157.428 23.668 10.896  1.00 26.03  ? 332  LYS A C     1 
ATOM   2236 O  O     . LYS A 1 332 ? 157.175 24.782 10.441  1.00 17.75  ? 332  LYS A O     1 
ATOM   2237 C  CB    . LYS A 1 332 ? 155.694 21.929 11.476  1.00 14.44  ? 332  LYS A CB    1 
ATOM   2238 C  CG    . LYS A 1 332 ? 154.672 21.450 12.490  1.00 30.33  ? 332  LYS A CG    1 
ATOM   2239 C  CD    . LYS A 1 332 ? 155.254 21.421 13.898  1.00 59.96  ? 332  LYS A CD    1 
ATOM   2240 C  CE    . LYS A 1 332 ? 155.530 19.999 14.384  1.00 82.04  ? 332  LYS A CE    1 
ATOM   2241 N  NZ    . LYS A 1 332 ? 154.283 19.225 14.652  1.00 94.11  ? 332  LYS A NZ    1 
ATOM   2242 N  N     . THR A 1 333 ? 158.449 22.927 10.459  1.00 23.01  ? 333  THR A N     1 
ATOM   2243 C  CA    . THR A 1 333 ? 159.343 23.408 9.400   1.00 23.26  ? 333  THR A CA    1 
ATOM   2244 C  C     . THR A 1 333 ? 158.730 23.255 8.012   1.00 21.56  ? 333  THR A C     1 
ATOM   2245 O  O     . THR A 1 333 ? 157.734 22.546 7.844   1.00 23.30  ? 333  THR A O     1 
ATOM   2246 C  CB    . THR A 1 333 ? 160.564 22.498 9.305   1.00 32.13  ? 333  THR A CB    1 
ATOM   2247 O  OG1   . THR A 1 333 ? 160.289 21.424 8.374   1.00 15.81  ? 333  THR A OG1   1 
ATOM   2248 C  CG2   . THR A 1 333 ? 160.935 21.977 10.687  1.00 14.52  ? 333  THR A CG2   1 
ATOM   2249 N  N     . VAL A 1 334 ? 159.340 23.907 7.018   1.00 11.92  ? 334  VAL A N     1 
ATOM   2250 C  CA    . VAL A 1 334 ? 158.839 23.825 5.651   1.00 11.96  ? 334  VAL A CA    1 
ATOM   2251 C  C     . VAL A 1 334 ? 158.690 22.378 5.230   1.00 18.71  ? 334  VAL A C     1 
ATOM   2252 O  O     . VAL A 1 334 ? 157.602 21.949 4.831   1.00 11.33  ? 334  VAL A O     1 
ATOM   2253 C  CB    . VAL A 1 334 ? 159.597 24.677 4.645   1.00 15.62  ? 334  VAL A CB    1 
ATOM   2254 C  CG1   . VAL A 1 334 ? 160.558 25.596 5.330   1.00 16.24  ? 334  VAL A CG1   1 
ATOM   2255 C  CG2   . VAL A 1 334 ? 160.238 23.863 3.549   1.00 17.68  ? 334  VAL A CG2   1 
ATOM   2256 N  N     . LYS A 1 335 ? 159.799 21.652 5.334   1.00 20.62  ? 335  LYS A N     1 
ATOM   2257 C  CA    . LYS A 1 335 ? 159.833 20.244 4.988   1.00 19.38  ? 335  LYS A CA    1 
ATOM   2258 C  C     . LYS A 1 335 ? 158.704 19.556 5.734   1.00 21.42  ? 335  LYS A C     1 
ATOM   2259 O  O     . LYS A 1 335 ? 157.927 18.788 5.167   1.00 17.76  ? 335  LYS A O     1 
ATOM   2260 C  CB    . LYS A 1 335 ? 161.163 19.616 5.469   1.00 12.18  ? 335  LYS A CB    1 
ATOM   2261 C  CG    . LYS A 1 335 ? 161.348 18.206 4.934   1.00 19.90  ? 335  LYS A CG    1 
ATOM   2262 C  CD    . LYS A 1 335 ? 161.985 17.221 5.891   1.00 38.49  ? 335  LYS A CD    1 
ATOM   2263 C  CE    . LYS A 1 335 ? 161.783 15.813 5.363   1.00 37.40  ? 335  LYS A CE    1 
ATOM   2264 N  NZ    . LYS A 1 335 ? 163.108 15.226 5.034   1.00 63.17  ? 335  LYS A NZ    1 
ATOM   2265 N  N     . GLN A 1 336 ? 158.615 19.850 7.016   1.00 10.41  ? 336  GLN A N     1 
ATOM   2266 C  CA    . GLN A 1 336 ? 157.570 19.254 7.806   1.00 12.62  ? 336  GLN A CA    1 
ATOM   2267 C  C     . GLN A 1 336 ? 156.214 19.762 7.308   1.00 25.80  ? 336  GLN A C     1 
ATOM   2268 O  O     . GLN A 1 336 ? 155.237 19.015 7.326   1.00 24.61  ? 336  GLN A O     1 
ATOM   2269 C  CB    . GLN A 1 336 ? 157.815 19.594 9.236   1.00 17.00  ? 336  GLN A CB    1 
ATOM   2270 C  CG    . GLN A 1 336 ? 158.592 18.603 10.074  1.00 32.96  ? 336  GLN A CG    1 
ATOM   2271 C  CD    . GLN A 1 336 ? 158.703 19.133 11.519  1.00 45.99  ? 336  GLN A CD    1 
ATOM   2272 O  OE1   . GLN A 1 336 ? 158.637 18.367 12.483  1.00 35.13  ? 336  GLN A OE1   1 
ATOM   2273 N  NE2   . GLN A 1 336 ? 158.786 20.470 11.663  1.00 12.93  ? 336  GLN A NE2   1 
ATOM   2274 N  N     . CYS A 1 337 ? 156.148 21.026 6.863   1.00 18.15  ? 337  CYS A N     1 
ATOM   2275 C  CA    . CYS A 1 337 ? 154.880 21.550 6.355   1.00 15.29  ? 337  CYS A CA    1 
ATOM   2276 C  C     . CYS A 1 337 ? 154.536 20.810 5.072   1.00 12.95  ? 337  CYS A C     1 
ATOM   2277 O  O     . CYS A 1 337 ? 153.393 20.425 4.841   1.00 10.05  ? 337  CYS A O     1 
ATOM   2278 C  CB    . CYS A 1 337 ? 154.934 23.020 5.995   1.00 15.18  ? 337  CYS A CB    1 
ATOM   2279 S  SG    . CYS A 1 337 ? 154.920 24.039 7.480   1.00 21.83  ? 337  CYS A SG    1 
ATOM   2280 N  N     . ILE A 1 338 ? 155.544 20.602 4.230   1.00 11.39  ? 338  ILE A N     1 
ATOM   2281 C  CA    . ILE A 1 338 ? 155.332 19.896 2.972   1.00 11.92  ? 338  ILE A CA    1 
ATOM   2282 C  C     . ILE A 1 338 ? 154.839 18.464 3.216   1.00 29.12  ? 338  ILE A C     1 
ATOM   2283 O  O     . ILE A 1 338 ? 154.082 17.910 2.412   1.00 33.26  ? 338  ILE A O     1 
ATOM   2284 C  CB    . ILE A 1 338 ? 156.555 19.942 1.977   1.00 11.74  ? 338  ILE A CB    1 
ATOM   2285 C  CG1   . ILE A 1 338 ? 156.775 21.328 1.390   1.00 4.28   ? 338  ILE A CG1   1 
ATOM   2286 C  CG2   . ILE A 1 338 ? 156.403 18.975 0.793   1.00 12.74  ? 338  ILE A CG2   1 
ATOM   2287 C  CD1   . ILE A 1 338 ? 158.190 21.766 1.626   1.00 29.49  ? 338  ILE A CD1   1 
ATOM   2288 N  N     . MET A 1 339 ? 155.261 17.866 4.327   1.00 24.70  ? 339  MET A N     1 
ATOM   2289 C  CA    . MET A 1 339 ? 154.854 16.506 4.648   1.00 24.33  ? 339  MET A CA    1 
ATOM   2290 C  C     . MET A 1 339 ? 153.398 16.423 5.076   1.00 33.03  ? 339  MET A C     1 
ATOM   2291 O  O     . MET A 1 339 ? 152.672 15.500 4.689   1.00 34.57  ? 339  MET A O     1 
ATOM   2292 C  CB    . MET A 1 339 ? 155.789 15.829 5.561   1.00 25.39  ? 339  MET A CB    1 
ATOM   2293 C  CG    . MET A 1 339 ? 156.772 15.051 4.740   1.00 31.66  ? 339  MET A CG    1 
ATOM   2294 S  SD    . MET A 1 339 ? 158.109 15.007 5.882   1.00 40.87  ? 339  MET A SD    1 
ATOM   2295 C  CE    . MET A 1 339 ? 158.089 13.271 6.316   1.00 37.01  ? 339  MET A CE    1 
ATOM   2296 N  N     . CYS A 1 340 ? 152.958 17.381 5.871   1.00 25.23  ? 340  CYS A N     1 
ATOM   2297 C  CA    . CYS A 1 340 ? 151.571 17.338 6.287   1.00 27.90  ? 340  CYS A CA    1 
ATOM   2298 C  C     . CYS A 1 340 ? 150.672 17.467 5.069   1.00 19.12  ? 340  CYS A C     1 
ATOM   2299 O  O     . CYS A 1 340 ? 149.688 16.744 4.940   1.00 14.16  ? 340  CYS A O     1 
ATOM   2300 C  CB    . CYS A 1 340 ? 151.127 18.291 7.403   1.00 33.37  ? 340  CYS A CB    1 
ATOM   2301 S  SG    . CYS A 1 340 ? 149.503 17.793 8.190   1.00 37.61  ? 340  CYS A SG    1 
ATOM   2302 N  N     . GLY A 1 341 ? 151.010 18.388 4.173   1.00 11.51  ? 341  GLY A N     1 
ATOM   2303 C  CA    . GLY A 1 341 ? 150.208 18.575 2.971   1.00 10.57  ? 341  GLY A CA    1 
ATOM   2304 C  C     . GLY A 1 341 ? 150.110 17.277 2.173   1.00 22.91  ? 341  GLY A C     1 
ATOM   2305 O  O     . GLY A 1 341 ? 149.005 16.846 1.830   1.00 29.89  ? 341  GLY A O     1 
ATOM   2306 N  N     . ASN A 1 342 ? 151.273 16.676 1.876   1.00 16.73  ? 342  ASN A N     1 
ATOM   2307 C  CA    . ASN A 1 342 ? 151.349 15.426 1.128   1.00 10.28  ? 342  ASN A CA    1 
ATOM   2308 C  C     . ASN A 1 342 ? 150.378 14.435 1.712   1.00 10.03  ? 342  ASN A C     1 
ATOM   2309 O  O     . ASN A 1 342 ? 149.628 13.782 0.997   1.00 9.07   ? 342  ASN A O     1 
ATOM   2310 C  CB    . ASN A 1 342 ? 152.727 14.804 1.236   1.00 1.00   ? 342  ASN A CB    1 
ATOM   2311 C  CG    . ASN A 1 342 ? 153.674 15.439 0.271   1.00 36.05  ? 342  ASN A CG    1 
ATOM   2312 O  OD1   . ASN A 1 342 ? 154.869 15.556 0.509   1.00 34.40  ? 342  ASN A OD1   1 
ATOM   2313 N  ND2   . ASN A 1 342 ? 153.122 15.917 -0.826  1.00 26.67  ? 342  ASN A ND2   1 
ATOM   2314 N  N     . ALA A 1 343 ? 150.385 14.348 3.025   1.00 8.29   ? 343  ALA A N     1 
ATOM   2315 C  CA    . ALA A 1 343 ? 149.484 13.435 3.693   1.00 9.91   ? 343  ALA A CA    1 
ATOM   2316 C  C     . ALA A 1 343 ? 148.035 13.770 3.324   1.00 22.12  ? 343  ALA A C     1 
ATOM   2317 O  O     . ALA A 1 343 ? 147.307 12.920 2.811   1.00 24.63  ? 343  ALA A O     1 
ATOM   2318 C  CB    . ALA A 1 343 ? 149.772 13.399 5.172   1.00 7.77   ? 343  ALA A CB    1 
ATOM   2319 N  N     . CYS A 1 344 ? 147.623 15.009 3.568   1.00 18.87  ? 344  CYS A N     1 
ATOM   2320 C  CA    . CYS A 1 344 ? 146.260 15.447 3.249   1.00 18.52  ? 344  CYS A CA    1 
ATOM   2321 C  C     . CYS A 1 344 ? 145.889 15.154 1.808   1.00 19.36  ? 344  CYS A C     1 
ATOM   2322 O  O     . CYS A 1 344 ? 144.847 14.564 1.523   1.00 18.89  ? 344  CYS A O     1 
ATOM   2323 C  CB    . CYS A 1 344 ? 146.075 16.941 3.500   1.00 19.46  ? 344  CYS A CB    1 
ATOM   2324 S  SG    . CYS A 1 344 ? 146.126 17.199 5.318   1.00 24.80  ? 344  CYS A SG    1 
ATOM   2325 N  N     . ALA A 1 345 ? 146.740 15.571 0.895   1.00 13.16  ? 345  ALA A N     1 
ATOM   2326 C  CA    . ALA A 1 345 ? 146.457 15.330 -0.504  1.00 9.62   ? 345  ALA A CA    1 
ATOM   2327 C  C     . ALA A 1 345 ? 146.293 13.837 -0.754  1.00 17.97  ? 345  ALA A C     1 
ATOM   2328 O  O     . ALA A 1 345 ? 145.386 13.393 -1.465  1.00 19.37  ? 345  ALA A O     1 
ATOM   2329 C  CB    . ALA A 1 345 ? 147.573 15.901 -1.360  1.00 8.77   ? 345  ALA A CB    1 
ATOM   2330 N  N     . GLN A 1 346 ? 147.175 13.058 -0.161  1.00 15.99  ? 346  GLN A N     1 
ATOM   2331 C  CA    . GLN A 1 346 ? 147.107 11.627 -0.346  1.00 17.06  ? 346  GLN A CA    1 
ATOM   2332 C  C     . GLN A 1 346 ? 145.780 11.047 0.108   1.00 17.81  ? 346  GLN A C     1 
ATOM   2333 O  O     . GLN A 1 346 ? 145.178 10.235 -0.592  1.00 12.21  ? 346  GLN A O     1 
ATOM   2334 C  CB    . GLN A 1 346 ? 148.381 10.975 0.091   1.00 16.84  ? 346  GLN A CB    1 
ATOM   2335 C  CG    . GLN A 1 346 ? 149.506 11.621 -0.774  1.00 38.34  ? 346  GLN A CG    1 
ATOM   2336 C  CD    . GLN A 1 346 ? 150.617 10.668 -1.105  1.00 46.31  ? 346  GLN A CD    1 
ATOM   2337 O  OE1   . GLN A 1 346 ? 150.908 9.775  -0.313  1.00 31.56  ? 346  GLN A OE1   1 
ATOM   2338 N  NE2   . GLN A 1 346 ? 151.217 10.809 -2.297  1.00 31.29  ? 346  GLN A NE2   1 
ATOM   2339 N  N     . ASP A 1 347 ? 145.317 11.459 1.272   1.00 10.17  ? 347  ASP A N     1 
ATOM   2340 C  CA    . ASP A 1 347 ? 144.060 10.930 1.745   1.00 12.54  ? 347  ASP A CA    1 
ATOM   2341 C  C     . ASP A 1 347 ? 142.950 11.274 0.763   1.00 27.00  ? 347  ASP A C     1 
ATOM   2342 O  O     . ASP A 1 347 ? 142.149 10.428 0.373   1.00 29.99  ? 347  ASP A O     1 
ATOM   2343 C  CB    . ASP A 1 347 ? 143.848 11.148 3.277   1.00 17.42  ? 347  ASP A CB    1 
ATOM   2344 C  CG    . ASP A 1 347 ? 142.392 10.990 3.736   1.00 54.63  ? 347  ASP A CG    1 
ATOM   2345 O  OD1   . ASP A 1 347 ? 142.087 10.099 4.568   1.00 62.78  ? 347  ASP A OD1   1 
ATOM   2346 O  OD2   . ASP A 1 347 ? 141.543 11.803 3.311   1.00 68.02  ? 347  ASP A OD2   1 
ATOM   2347 N  N     . VAL A 1 348 ? 142.924 12.520 0.350   1.00 24.13  ? 348  VAL A N     1 
ATOM   2348 C  CA    . VAL A 1 348 ? 141.912 12.994 -0.579  1.00 22.28  ? 348  VAL A CA    1 
ATOM   2349 C  C     . VAL A 1 348 ? 141.882 12.313 -1.965  1.00 27.05  ? 348  VAL A C     1 
ATOM   2350 O  O     . VAL A 1 348 ? 140.797 11.980 -2.457  1.00 16.76  ? 348  VAL A O     1 
ATOM   2351 C  CB    . VAL A 1 348 ? 141.933 14.528 -0.668  1.00 14.33  ? 348  VAL A CB    1 
ATOM   2352 C  CG1   . VAL A 1 348 ? 141.358 14.967 -1.996  1.00 9.32   ? 348  VAL A CG1   1 
ATOM   2353 C  CG2   . VAL A 1 348 ? 141.186 15.113 0.508   1.00 12.65  ? 348  VAL A CG2   1 
ATOM   2354 N  N     . ILE A 1 349 ? 143.028 12.125 -2.612  1.00 26.07  ? 349  ILE A N     1 
ATOM   2355 C  CA    . ILE A 1 349 ? 142.992 11.501 -3.939  1.00 28.27  ? 349  ILE A CA    1 
ATOM   2356 C  C     . ILE A 1 349 ? 142.579 10.033 -3.894  1.00 23.00  ? 349  ILE A C     1 
ATOM   2357 O  O     . ILE A 1 349 ? 142.371 9.379  -4.922  1.00 15.90  ? 349  ILE A O     1 
ATOM   2358 C  CB    . ILE A 1 349 ? 144.262 11.665 -4.727  1.00 32.69  ? 349  ILE A CB    1 
ATOM   2359 C  CG1   . ILE A 1 349 ? 145.436 11.077 -3.949  1.00 31.72  ? 349  ILE A CG1   1 
ATOM   2360 C  CG2   . ILE A 1 349 ? 144.414 13.123 -5.126  1.00 34.93  ? 349  ILE A CG2   1 
ATOM   2361 C  CD1   . ILE A 1 349 ? 146.676 10.940 -4.795  1.00 38.83  ? 349  ILE A CD1   1 
ATOM   2362 N  N     . GLN A 1 350 ? 142.472 9.508  -2.690  1.00 17.89  ? 350  GLN A N     1 
ATOM   2363 C  CA    . GLN A 1 350 ? 142.089 8.117  -2.511  1.00 21.96  ? 350  GLN A CA    1 
ATOM   2364 C  C     . GLN A 1 350 ? 140.600 8.008  -2.254  1.00 29.73  ? 350  GLN A C     1 
ATOM   2365 O  O     . GLN A 1 350 ? 140.093 6.950  -1.886  1.00 27.08  ? 350  GLN A O     1 
ATOM   2366 C  CB    . GLN A 1 350 ? 142.969 7.509  -1.437  1.00 25.38  ? 350  GLN A CB    1 
ATOM   2367 C  CG    . GLN A 1 350 ? 144.269 6.922  -2.088  1.00 37.94  ? 350  GLN A CG    1 
ATOM   2368 C  CD    . GLN A 1 350 ? 145.376 6.574  -1.119  1.00 47.14  ? 350  GLN A CD    1 
ATOM   2369 O  OE1   . GLN A 1 350 ? 145.993 5.505  -1.235  1.00 47.56  ? 350  GLN A OE1   1 
ATOM   2370 N  NE2   . GLN A 1 350 ? 145.661 7.483  -0.175  1.00 36.41  ? 350  GLN A NE2   1 
ATOM   2371 N  N     . HIS A 1 351 ? 139.936 9.144  -2.470  1.00 30.75  ? 351  HIS A N     1 
ATOM   2372 C  CA    . HIS A 1 351 ? 138.504 9.329  -2.306  1.00 30.82  ? 351  HIS A CA    1 
ATOM   2373 C  C     . HIS A 1 351 ? 137.953 10.120 -3.496  1.00 32.00  ? 351  HIS A C     1 
ATOM   2374 O  O     . HIS A 1 351 ? 138.677 10.898 -4.130  1.00 25.88  ? 351  HIS A O     1 
ATOM   2375 C  CB    . HIS A 1 351 ? 138.234 10.132 -1.013  1.00 34.71  ? 351  HIS A CB    1 
ATOM   2376 C  CG    . HIS A 1 351 ? 138.667 9.446  0.247   1.00 43.70  ? 351  HIS A CG    1 
ATOM   2377 N  ND1   . HIS A 1 351 ? 137.841 9.298  1.343   1.00 49.77  ? 351  HIS A ND1   1 
ATOM   2378 C  CD2   . HIS A 1 351 ? 139.843 8.870  0.584   1.00 51.47  ? 351  HIS A CD2   1 
ATOM   2379 C  CE1   . HIS A 1 351 ? 138.495 8.662  2.300   1.00 53.25  ? 351  HIS A CE1   1 
ATOM   2380 N  NE2   . HIS A 1 351 ? 139.715 8.395  1.865   1.00 53.68  ? 351  HIS A NE2   1 
ATOM   2381 N  N     . VAL A 1 352 ? 136.669 9.905  -3.792  1.00 28.97  ? 352  VAL A N     1 
ATOM   2382 C  CA    . VAL A 1 352 ? 135.991 10.579 -4.897  1.00 28.93  ? 352  VAL A CA    1 
ATOM   2383 C  C     . VAL A 1 352 ? 135.912 12.074 -4.637  1.00 27.23  ? 352  VAL A C     1 
ATOM   2384 O  O     . VAL A 1 352 ? 135.105 12.541 -3.834  1.00 27.19  ? 352  VAL A O     1 
ATOM   2385 C  CB    . VAL A 1 352 ? 134.590 10.014 -5.106  1.00 29.37  ? 352  VAL A CB    1 
ATOM   2386 C  CG1   . VAL A 1 352 ? 133.994 10.611 -6.370  1.00 25.61  ? 352  VAL A CG1   1 
ATOM   2387 C  CG2   . VAL A 1 352 ? 134.674 8.492  -5.162  1.00 28.09  ? 352  VAL A CG2   1 
ATOM   2388 N  N     . GLY A 1 353 ? 136.770 12.807 -5.331  1.00 21.73  ? 353  GLY A N     1 
ATOM   2389 C  CA    . GLY A 1 353 ? 136.851 14.246 -5.210  1.00 24.69  ? 353  GLY A CA    1 
ATOM   2390 C  C     . GLY A 1 353 ? 137.314 14.605 -3.797  1.00 33.89  ? 353  GLY A C     1 
ATOM   2391 O  O     . GLY A 1 353 ? 137.840 13.781 -3.063  1.00 38.07  ? 353  GLY A O     1 
ATOM   2392 N  N     . PHE A 1 354 ? 137.024 15.857 -3.433  1.00 26.60  ? 354  PHE A N     1 
ATOM   2393 C  CA    . PHE A 1 354 ? 137.354 16.374 -2.114  1.00 24.85  ? 354  PHE A CA    1 
ATOM   2394 C  C     . PHE A 1 354 ? 136.519 15.677 -1.038  1.00 24.78  ? 354  PHE A C     1 
ATOM   2395 O  O     . PHE A 1 354 ? 135.311 15.517 -1.166  1.00 27.54  ? 354  PHE A O     1 
ATOM   2396 C  CB    . PHE A 1 354 ? 137.109 17.876 -2.056  1.00 22.11  ? 354  PHE A CB    1 
ATOM   2397 C  CG    . PHE A 1 354 ? 137.629 18.528 -0.829  1.00 15.36  ? 354  PHE A CG    1 
ATOM   2398 C  CD1   . PHE A 1 354 ? 136.747 18.997 0.145   1.00 19.13  ? 354  PHE A CD1   1 
ATOM   2399 C  CD2   . PHE A 1 354 ? 138.988 18.709 -0.658  1.00 13.53  ? 354  PHE A CD2   1 
ATOM   2400 C  CE1   . PHE A 1 354 ? 137.212 19.630 1.282   1.00 19.43  ? 354  PHE A CE1   1 
ATOM   2401 C  CE2   . PHE A 1 354 ? 139.475 19.342 0.470   1.00 19.74  ? 354  PHE A CE2   1 
ATOM   2402 C  CZ    . PHE A 1 354 ? 138.585 19.810 1.437   1.00 21.05  ? 354  PHE A CZ    1 
ATOM   2403 N  N     . SER A 1 355 ? 137.199 15.254 0.018   1.00 19.68  ? 355  SER A N     1 
ATOM   2404 C  CA    . SER A 1 355 ? 136.611 14.567 1.164   1.00 19.06  ? 355  SER A CA    1 
ATOM   2405 C  C     . SER A 1 355 ? 137.071 15.275 2.419   1.00 29.25  ? 355  SER A C     1 
ATOM   2406 O  O     . SER A 1 355 ? 138.134 15.897 2.420   1.00 24.31  ? 355  SER A O     1 
ATOM   2407 C  CB    . SER A 1 355 ? 136.920 13.090 1.225   1.00 29.92  ? 355  SER A CB    1 
ATOM   2408 O  OG    . SER A 1 355 ? 136.201 12.501 2.304   1.00 11.30  ? 355  SER A OG    1 
ATOM   2409 N  N     . LEU A 1 356 ? 136.292 15.200 3.488   1.00 35.47  ? 356  LEU A N     1 
ATOM   2410 C  CA    . LEU A 1 356 ? 136.693 15.914 4.688   1.00 35.30  ? 356  LEU A CA    1 
ATOM   2411 C  C     . LEU A 1 356 ? 137.126 15.154 5.914   1.00 54.38  ? 356  LEU A C     1 
ATOM   2412 O  O     . LEU A 1 356 ? 137.656 15.776 6.826   1.00 63.50  ? 356  LEU A O     1 
ATOM   2413 C  CB    . LEU A 1 356 ? 135.537 16.748 5.147   1.00 34.87  ? 356  LEU A CB    1 
ATOM   2414 C  CG    . LEU A 1 356 ? 135.707 18.214 4.890   1.00 35.76  ? 356  LEU A CG    1 
ATOM   2415 C  CD1   . LEU A 1 356 ? 134.768 18.990 5.788   1.00 36.80  ? 356  LEU A CD1   1 
ATOM   2416 C  CD2   . LEU A 1 356 ? 137.167 18.599 5.100   1.00 25.18  ? 356  LEU A CD2   1 
ATOM   2417 N  N     . SER A 1 357 ? 136.918 13.873 6.011   1.00 57.04  ? 357  SER A N     1 
ATOM   2418 C  CA    . SER A 1 357 ? 137.370 13.304 7.252   1.00 65.59  ? 357  SER A CA    1 
ATOM   2419 C  C     . SER A 1 357 ? 138.549 12.391 7.128   1.00 70.55  ? 357  SER A C     1 
ATOM   2420 O  O     . SER A 1 357 ? 138.509 11.344 6.473   1.00 65.16  ? 357  SER A O     1 
ATOM   2421 C  CB    . SER A 1 357 ? 136.270 12.743 8.127   1.00 83.27  ? 357  SER A CB    1 
ATOM   2422 O  OG    . SER A 1 357 ? 136.344 13.288 9.443   1.00 100.00 ? 357  SER A OG    1 
ATOM   2423 N  N     . PHE A 1 358 ? 139.583 12.845 7.797   1.00 64.39  ? 358  PHE A N     1 
ATOM   2424 C  CA    . PHE A 1 358 ? 140.850 12.191 7.901   1.00 59.53  ? 358  PHE A CA    1 
ATOM   2425 C  C     . PHE A 1 358 ? 140.885 11.806 9.345   1.00 84.16  ? 358  PHE A C     1 
ATOM   2426 O  O     . PHE A 1 358 ? 140.394 12.663 10.117  1.00 86.45  ? 358  PHE A O     1 
ATOM   2427 C  CB    . PHE A 1 358 ? 141.918 13.277 7.707   1.00 54.01  ? 358  PHE A CB    1 
ATOM   2428 C  CG    . PHE A 1 358 ? 141.623 14.320 6.620   1.00 45.97  ? 358  PHE A CG    1 
ATOM   2429 C  CD1   . PHE A 1 358 ? 141.457 13.974 5.307   1.00 46.29  ? 358  PHE A CD1   1 
ATOM   2430 C  CD2   . PHE A 1 358 ? 141.567 15.656 6.931   1.00 38.86  ? 358  PHE A CD2   1 
ATOM   2431 C  CE1   . PHE A 1 358 ? 141.250 14.929 4.342   1.00 47.71  ? 358  PHE A CE1   1 
ATOM   2432 C  CE2   . PHE A 1 358 ? 141.370 16.618 5.976   1.00 41.81  ? 358  PHE A CE2   1 
ATOM   2433 C  CZ    . PHE A 1 358 ? 141.231 16.255 4.672   1.00 44.26  ? 358  PHE A CZ    1 
HETATM 2434 S  S     . SO4 B 2 .   ? 145.375 21.427 -8.519  1.00 70.10  ? 999  SO4 A S     1 
HETATM 2435 O  O1    . SO4 B 2 .   ? 144.772 20.380 -9.259  1.00 71.51  ? 999  SO4 A O1    1 
HETATM 2436 O  O2    . SO4 B 2 .   ? 144.473 21.825 -7.520  1.00 71.58  ? 999  SO4 A O2    1 
HETATM 2437 O  O3    . SO4 B 2 .   ? 146.566 20.967 -7.915  1.00 71.46  ? 999  SO4 A O3    1 
HETATM 2438 O  O4    . SO4 B 2 .   ? 145.657 22.536 -9.351  1.00 71.51  ? 999  SO4 A O4    1 
HETATM 2439 CL CL    . CL  C 3 .   ? 136.117 17.907 14.279  1.00 84.23  ? 899  CL  A CL    1 
HETATM 2440 O  "O5'" . ADN D 4 .   ? 140.489 22.735 -6.431  1.00 15.39  ? 699  ADN A "O5'" 1 
HETATM 2441 C  "C5'" . ADN D 4 .   ? 139.206 22.282 -6.838  1.00 13.32  ? 699  ADN A "C5'" 1 
HETATM 2442 C  "C4'" . ADN D 4 .   ? 138.145 23.313 -6.500  1.00 11.27  ? 699  ADN A "C4'" 1 
HETATM 2443 O  "O4'" . ADN D 4 .   ? 138.286 24.476 -7.336  1.00 11.19  ? 699  ADN A "O4'" 1 
HETATM 2444 C  "C3'" . ADN D 4 .   ? 136.695 22.852 -6.646  1.00 10.53  ? 699  ADN A "C3'" 1 
HETATM 2445 O  "O3'" . ADN D 4 .   ? 136.165 22.583 -5.352  1.00 11.95  ? 699  ADN A "O3'" 1 
HETATM 2446 C  "C2'" . ADN D 4 .   ? 136.000 24.050 -7.316  1.00 10.96  ? 699  ADN A "C2'" 1 
HETATM 2447 O  "O2'" . ADN D 4 .   ? 134.851 24.444 -6.598  1.00 13.04  ? 699  ADN A "O2'" 1 
HETATM 2448 C  "C1'" . ADN D 4 .   ? 137.077 25.154 -7.243  1.00 11.20  ? 699  ADN A "C1'" 1 
HETATM 2449 N  N9    . ADN D 4 .   ? 137.039 26.115 -8.326  1.00 10.35  ? 699  ADN A N9    1 
HETATM 2450 C  C8    . ADN D 4 .   ? 137.001 25.890 -9.660  1.00 10.67  ? 699  ADN A C8    1 
HETATM 2451 N  N7    . ADN D 4 .   ? 136.836 26.986 -10.376 1.00 10.79  ? 699  ADN A N7    1 
HETATM 2452 C  C5    . ADN D 4 .   ? 137.186 27.996 -9.446  1.00 10.12  ? 699  ADN A C5    1 
HETATM 2453 C  C6    . ADN D 4 .   ? 137.113 29.390 -9.570  1.00 10.44  ? 699  ADN A C6    1 
HETATM 2454 N  N6    . ADN D 4 .   ? 136.983 30.030 -10.744 1.00 11.56  ? 699  ADN A N6    1 
HETATM 2455 N  N1    . ADN D 4 .   ? 137.331 30.101 -8.435  1.00 10.61  ? 699  ADN A N1    1 
HETATM 2456 C  C2    . ADN D 4 .   ? 137.389 29.460 -7.275  1.00 10.47  ? 699  ADN A C2    1 
HETATM 2457 N  N3    . ADN D 4 .   ? 137.335 28.152 -7.029  1.00 10.38  ? 699  ADN A N3    1 
HETATM 2458 C  C4    . ADN D 4 .   ? 137.234 27.477 -8.165  1.00 10.67  ? 699  ADN A C4    1 
HETATM 2459 O  "O5'" . ADN E 4 .   ? 149.204 17.481 -6.768  1.00 21.54  ? 799  ADN A "O5'" 1 
HETATM 2460 C  "C5'" . ADN E 4 .   ? 149.214 17.884 -5.404  1.00 19.31  ? 799  ADN A "C5'" 1 
HETATM 2461 C  "C4'" . ADN E 4 .   ? 149.655 16.733 -4.511  1.00 17.98  ? 799  ADN A "C4'" 1 
HETATM 2462 O  "O4'" . ADN E 4 .   ? 148.820 15.555 -4.712  1.00 18.52  ? 799  ADN A "O4'" 1 
HETATM 2463 C  "C3'" . ADN E 4 .   ? 151.079 16.258 -4.740  1.00 17.92  ? 799  ADN A "C3'" 1 
HETATM 2464 O  "O3'" . ADN E 4 .   ? 151.970 17.030 -3.931  1.00 19.50  ? 799  ADN A "O3'" 1 
HETATM 2465 C  "C2'" . ADN E 4 .   ? 151.002 14.818 -4.235  1.00 17.90  ? 799  ADN A "C2'" 1 
HETATM 2466 O  "O2'" . ADN E 4 .   ? 151.109 14.777 -2.824  1.00 19.18  ? 799  ADN A "O2'" 1 
HETATM 2467 C  "C1'" . ADN E 4 .   ? 149.595 14.376 -4.651  1.00 18.36  ? 799  ADN A "C1'" 1 
HETATM 2468 N  N9    . ADN E 4 .   ? 149.524 13.741 -5.952  1.00 18.05  ? 799  ADN A N9    1 
HETATM 2469 C  C8    . ADN E 4 .   ? 149.042 14.219 -7.144  1.00 18.62  ? 799  ADN A C8    1 
HETATM 2470 N  N7    . ADN E 4 .   ? 149.145 13.352 -8.128  1.00 19.23  ? 799  ADN A N7    1 
HETATM 2471 C  C5    . ADN E 4 .   ? 149.740 12.243 -7.528  1.00 19.06  ? 799  ADN A C5    1 
HETATM 2472 C  C6    . ADN E 4 .   ? 150.127 10.977 -8.016  1.00 20.20  ? 799  ADN A C6    1 
HETATM 2473 N  N6    . ADN E 4 .   ? 149.962 10.596 -9.289  1.00 22.22  ? 799  ADN A N6    1 
HETATM 2474 N  N1    . ADN E 4 .   ? 150.684 10.103 -7.137  1.00 20.23  ? 799  ADN A N1    1 
HETATM 2475 C  C2    . ADN E 4 .   ? 150.849 10.468 -5.860  1.00 19.64  ? 799  ADN A C2    1 
HETATM 2476 N  N3    . ADN E 4 .   ? 150.524 11.624 -5.287  1.00 19.35  ? 799  ADN A N3    1 
HETATM 2477 C  C4    . ADN E 4 .   ? 149.972 12.469 -6.184  1.00 19.19  ? 799  ADN A C4    1 
HETATM 2478 O  O     . HOH F 5 .   ? 155.792 47.166 8.737   1.00 72.38  ? 1000 HOH A O     1 
HETATM 2479 O  O     . HOH F 5 .   ? 128.430 10.807 -11.373 1.00 35.27  ? 1001 HOH A O     1 
HETATM 2480 O  O     . HOH F 5 .   ? 169.979 35.536 -3.120  1.00 15.54  ? 1002 HOH A O     1 
HETATM 2481 O  O     . HOH F 5 .   ? 120.549 28.713 -10.112 1.00 42.76  ? 1003 HOH A O     1 
HETATM 2482 O  O     . HOH F 5 .   ? 163.411 44.814 -1.809  1.00 89.38  ? 1004 HOH A O     1 
HETATM 2483 O  O     . HOH F 5 .   ? 135.567 22.007 13.911  1.00 43.78  ? 1005 HOH A O     1 
HETATM 2484 O  O     . HOH F 5 .   ? 122.358 13.421 -32.940 1.00 19.61  ? 1006 HOH A O     1 
HETATM 2485 O  O     . HOH F 5 .   ? 147.594 25.441 -7.727  1.00 35.52  ? 1007 HOH A O     1 
HETATM 2486 O  O     . HOH F 5 .   ? 133.375 33.709 -24.058 1.00 44.94  ? 1008 HOH A O     1 
HETATM 2487 O  O     . HOH F 5 .   ? 144.156 25.846 -8.089  1.00 26.14  ? 1009 HOH A O     1 
HETATM 2488 O  O     . HOH F 5 .   ? 130.354 11.943 -4.623  1.00 62.98  ? 1010 HOH A O     1 
HETATM 2489 O  O     . HOH F 5 .   ? 120.112 14.576 -18.883 1.00 100.00 ? 1011 HOH A O     1 
HETATM 2490 O  O     . HOH F 5 .   ? 138.033 38.884 -15.320 1.00 71.55  ? 1012 HOH A O     1 
HETATM 2491 O  O     . HOH F 5 .   ? 116.632 30.620 -22.695 1.00 32.51  ? 1013 HOH A O     1 
HETATM 2492 O  O     . HOH F 5 .   ? 130.170 10.198 -7.254  1.00 58.65  ? 1014 HOH A O     1 
HETATM 2493 O  O     . HOH F 5 .   ? 145.914 7.909  8.289   1.00 87.82  ? 1015 HOH A O     1 
HETATM 2494 O  O     . HOH F 5 .   ? 147.101 42.570 -15.141 1.00 51.76  ? 1016 HOH A O     1 
HETATM 2495 O  O     . HOH F 5 .   ? 129.447 12.025 -8.791  1.00 49.29  ? 1017 HOH A O     1 
HETATM 2496 O  O     . HOH F 5 .   ? 152.906 50.402 7.691   1.00 100.00 ? 1018 HOH A O     1 
HETATM 2497 O  O     . HOH F 5 .   ? 139.676 41.431 -13.107 1.00 35.73  ? 1019 HOH A O     1 
HETATM 2498 O  O     . HOH F 5 .   ? 165.537 44.189 -22.276 1.00 62.72  ? 1020 HOH A O     1 
HETATM 2499 O  O     . HOH F 5 .   ? 116.891 24.633 -17.103 1.00 75.32  ? 1021 HOH A O     1 
HETATM 2500 O  O     . HOH F 5 .   ? 147.366 43.634 -20.443 1.00 89.99  ? 1022 HOH A O     1 
HETATM 2501 O  O     . HOH F 5 .   ? 143.618 27.688 27.805  1.00 43.55  ? 1023 HOH A O     1 
HETATM 2502 O  O     . HOH F 5 .   ? 138.210 20.478 -30.506 1.00 99.81  ? 1024 HOH A O     1 
HETATM 2503 O  O     . HOH F 5 .   ? 138.385 53.483 4.775   1.00 58.45  ? 1025 HOH A O     1 
HETATM 2504 O  O     . HOH F 5 .   ? 127.359 34.797 -17.324 1.00 45.26  ? 1026 HOH A O     1 
HETATM 2505 O  O     . HOH F 5 .   ? 128.447 7.464  -18.324 1.00 63.55  ? 1027 HOH A O     1 
HETATM 2506 O  O     . HOH F 5 .   ? 152.723 14.839 15.323  1.00 70.65  ? 1028 HOH A O     1 
HETATM 2507 O  O     . HOH F 5 .   ? 121.364 21.111 -28.173 1.00 53.34  ? 1029 HOH A O     1 
HETATM 2508 O  O     . HOH F 5 .   ? 129.008 34.654 -13.364 1.00 47.57  ? 1030 HOH A O     1 
HETATM 2509 O  O     . HOH F 5 .   ? 137.613 7.997  -25.858 1.00 54.91  ? 1031 HOH A O     1 
HETATM 2510 O  O     . HOH F 5 .   ? 151.178 12.590 -11.115 1.00 34.50  ? 1032 HOH A O     1 
HETATM 2511 O  O     . HOH F 5 .   ? 136.102 4.465  -13.242 1.00 59.10  ? 1033 HOH A O     1 
HETATM 2512 O  O     . HOH F 5 .   ? 145.535 24.177 -11.248 1.00 63.94  ? 1034 HOH A O     1 
HETATM 2513 O  O     . HOH F 5 .   ? 137.871 13.762 -25.491 1.00 36.19  ? 1035 HOH A O     1 
HETATM 2514 O  O     . HOH F 5 .   ? 138.723 30.384 -4.359  1.00 1.00   ? 1036 HOH A O     1 
HETATM 2515 O  O     . HOH F 5 .   ? 119.149 28.181 -4.822  1.00 19.20  ? 1037 HOH A O     1 
HETATM 2516 O  O     . HOH F 5 .   ? 138.145 32.722 -10.661 1.00 32.22  ? 1038 HOH A O     1 
HETATM 2517 O  O     . HOH F 5 .   ? 126.167 19.655 -0.934  1.00 22.02  ? 1039 HOH A O     1 
HETATM 2518 O  O     . HOH F 5 .   ? 137.453 27.828 -13.060 1.00 34.08  ? 1040 HOH A O     1 
HETATM 2519 O  O     . HOH F 5 .   ? 141.108 24.388 -8.558  1.00 29.79  ? 1041 HOH A O     1 
HETATM 2520 O  O     . HOH F 5 .   ? 163.781 25.126 0.446   1.00 28.78  ? 1042 HOH A O     1 
HETATM 2521 O  O     . HOH F 5 .   ? 154.276 16.812 -6.014  1.00 12.55  ? 1043 HOH A O     1 
HETATM 2522 O  O     . HOH F 5 .   ? 123.875 11.039 -6.936  1.00 12.03  ? 1044 HOH A O     1 
HETATM 2523 O  O     . HOH F 5 .   ? 138.259 23.525 -21.002 1.00 62.02  ? 1045 HOH A O     1 
HETATM 2524 O  O     . HOH F 5 .   ? 113.071 15.661 -23.135 1.00 57.44  ? 1046 HOH A O     1 
HETATM 2525 O  O     . HOH F 5 .   ? 130.499 43.607 6.636   1.00 22.79  ? 1047 HOH A O     1 
HETATM 2526 O  O     . HOH F 5 .   ? 132.788 10.148 -10.094 1.00 43.66  ? 1048 HOH A O     1 
HETATM 2527 O  O     . HOH F 5 .   ? 172.131 32.936 -3.545  1.00 26.46  ? 1049 HOH A O     1 
HETATM 2528 O  O     . HOH F 5 .   ? 168.607 24.600 9.039   1.00 65.52  ? 1050 HOH A O     1 
HETATM 2529 O  O     . HOH F 5 .   ? 123.906 35.437 -11.603 1.00 30.39  ? 1051 HOH A O     1 
HETATM 2530 O  O     . HOH F 5 .   ? 121.531 32.931 0.391   1.00 36.42  ? 1052 HOH A O     1 
HETATM 2531 O  O     . HOH F 5 .   ? 138.616 31.260 -18.522 1.00 38.04  ? 1053 HOH A O     1 
HETATM 2532 O  O     . HOH F 5 .   ? 141.448 39.573 -4.408  1.00 42.77  ? 1054 HOH A O     1 
HETATM 2533 O  O     . HOH F 5 .   ? 130.510 29.069 -27.042 1.00 15.20  ? 1055 HOH A O     1 
HETATM 2534 O  O     . HOH F 5 .   ? 142.265 20.845 -6.894  1.00 34.21  ? 1056 HOH A O     1 
HETATM 2535 O  O     . HOH F 5 .   ? 146.297 16.666 13.488  1.00 54.34  ? 1057 HOH A O     1 
HETATM 2536 O  O     . HOH F 5 .   ? 150.339 -0.287 -11.647 1.00 49.95  ? 1058 HOH A O     1 
HETATM 2537 O  O     . HOH F 5 .   ? 134.639 15.310 -3.442  1.00 60.98  ? 1059 HOH A O     1 
HETATM 2538 O  O     . HOH F 5 .   ? 143.474 41.825 11.418  1.00 45.49  ? 1060 HOH A O     1 
HETATM 2539 O  O     . HOH F 5 .   ? 167.374 41.870 13.798  1.00 49.03  ? 1061 HOH A O     1 
HETATM 2540 O  O     . HOH F 5 .   ? 131.868 32.537 -13.905 1.00 19.82  ? 1062 HOH A O     1 
HETATM 2541 O  O     . HOH F 5 .   ? 151.195 21.212 -13.182 1.00 39.21  ? 1063 HOH A O     1 
HETATM 2542 O  O     . HOH F 5 .   ? 157.885 47.661 0.423   1.00 58.18  ? 1064 HOH A O     1 
HETATM 2543 O  O     . HOH F 5 .   ? 145.383 41.505 -14.048 1.00 72.66  ? 1065 HOH A O     1 
HETATM 2544 O  O     . HOH F 5 .   ? 164.274 25.152 5.616   1.00 14.26  ? 1066 HOH A O     1 
HETATM 2545 O  O     . HOH F 5 .   ? 133.647 8.953  -25.599 1.00 39.90  ? 1067 HOH A O     1 
HETATM 2546 O  O     . HOH F 5 .   ? 151.140 19.102 -16.009 1.00 38.68  ? 1068 HOH A O     1 
HETATM 2547 O  O     . HOH F 5 .   ? 155.941 14.936 -19.377 1.00 43.43  ? 1069 HOH A O     1 
HETATM 2548 O  O     . HOH F 5 .   ? 138.379 49.866 1.058   1.00 30.00  ? 1070 HOH A O     1 
HETATM 2549 O  O     . HOH F 5 .   ? 146.920 13.622 -13.629 1.00 75.56  ? 1071 HOH A O     1 
HETATM 2550 O  O     . HOH F 5 .   ? 166.876 32.801 -18.419 1.00 47.13  ? 1072 HOH A O     1 
HETATM 2551 O  O     . HOH F 5 .   ? 154.857 13.505 2.691   1.00 50.19  ? 1073 HOH A O     1 
HETATM 2552 O  O     . HOH F 5 .   ? 134.814 19.685 -3.402  1.00 24.33  ? 1074 HOH A O     1 
HETATM 2553 O  O     . HOH F 5 .   ? 162.538 22.432 5.989   1.00 21.78  ? 1075 HOH A O     1 
HETATM 2554 O  O     . HOH F 5 .   ? 150.917 18.962 -8.803  1.00 19.00  ? 1076 HOH A O     1 
HETATM 2555 O  O     . HOH F 5 .   ? 115.119 13.204 -23.256 1.00 50.11  ? 1077 HOH A O     1 
HETATM 2556 O  O     . HOH F 5 .   ? 128.484 32.295 -4.644  1.00 12.95  ? 1078 HOH A O     1 
HETATM 2557 O  O     . HOH F 5 .   ? 158.273 11.797 -5.202  1.00 21.86  ? 1079 HOH A O     1 
HETATM 2558 O  O     . HOH F 5 .   ? 130.837 7.286  -11.057 1.00 36.33  ? 1080 HOH A O     1 
HETATM 2559 O  O     . HOH F 5 .   ? 132.474 30.087 14.380  1.00 48.32  ? 1081 HOH A O     1 
HETATM 2560 O  O     . HOH F 5 .   ? 140.825 0.458  -18.335 1.00 68.93  ? 1082 HOH A O     1 
HETATM 2561 O  O     . HOH F 5 .   ? 158.473 3.665  -9.992  1.00 78.02  ? 1083 HOH A O     1 
HETATM 2562 O  O     . HOH F 5 .   ? 132.945 16.285 -30.668 1.00 82.98  ? 1084 HOH A O     1 
HETATM 2563 O  O     . HOH F 5 .   ? 154.567 6.888  -12.575 1.00 60.43  ? 1085 HOH A O     1 
HETATM 2564 O  O     . HOH F 5 .   ? 166.083 16.023 4.821   1.00 37.47  ? 1086 HOH A O     1 
HETATM 2565 O  O     . HOH F 5 .   ? 162.311 32.671 3.588   1.00 24.29  ? 1087 HOH A O     1 
HETATM 2566 O  O     . HOH F 5 .   ? 144.191 20.161 -19.606 1.00 58.28  ? 1088 HOH A O     1 
HETATM 2567 O  O     . HOH F 5 .   ? 162.765 22.670 15.076  1.00 58.90  ? 1089 HOH A O     1 
HETATM 2568 O  O     . HOH F 5 .   ? 135.528 53.159 -2.701  1.00 63.81  ? 1090 HOH A O     1 
HETATM 2569 O  O     . HOH F 5 .   ? 153.833 40.905 3.687   1.00 36.74  ? 1091 HOH A O     1 
HETATM 2570 O  O     . HOH F 5 .   ? 155.640 35.621 12.988  1.00 45.99  ? 1092 HOH A O     1 
HETATM 2571 O  O     . HOH F 5 .   ? 149.408 12.209 17.021  1.00 93.67  ? 1093 HOH A O     1 
HETATM 2572 O  O     . HOH F 5 .   ? 147.360 33.999 17.374  1.00 78.91  ? 1094 HOH A O     1 
HETATM 2573 O  O     . HOH F 5 .   ? 123.222 20.490 -2.150  1.00 43.13  ? 1095 HOH A O     1 
HETATM 2574 O  O     . HOH F 5 .   ? 157.246 49.828 18.485  1.00 69.53  ? 1096 HOH A O     1 
HETATM 2575 O  O     . HOH F 5 .   ? 152.112 17.940 22.712  1.00 100.00 ? 1097 HOH A O     1 
HETATM 2576 O  O     . HOH F 5 .   ? 143.420 21.022 -4.918  1.00 44.19  ? 1098 HOH A O     1 
HETATM 2577 O  O     . HOH F 5 .   ? 138.150 29.557 19.333  1.00 56.32  ? 1099 HOH A O     1 
HETATM 2578 O  O     . HOH F 5 .   ? 163.524 47.573 8.192   1.00 85.82  ? 1100 HOH A O     1 
HETATM 2579 O  O     . HOH F 5 .   ? 169.622 33.458 7.547   1.00 65.72  ? 1101 HOH A O     1 
HETATM 2580 O  O     . HOH F 5 .   ? 143.239 16.043 -12.971 1.00 36.50  ? 1102 HOH A O     1 
HETATM 2581 O  O     . HOH F 5 .   ? 150.918 48.344 9.205   1.00 76.07  ? 1103 HOH A O     1 
HETATM 2582 O  O     . HOH F 5 .   ? 138.175 15.059 -16.471 1.00 36.78  ? 1104 HOH A O     1 
HETATM 2583 O  O     . HOH F 5 .   ? 171.605 33.090 10.615  1.00 59.91  ? 1105 HOH A O     1 
HETATM 2584 O  O     . HOH F 5 .   ? 143.952 28.216 -6.249  1.00 32.87  ? 1106 HOH A O     1 
HETATM 2585 O  O     . HOH F 5 .   ? 156.907 40.435 9.818   1.00 36.58  ? 1107 HOH A O     1 
HETATM 2586 O  O     . HOH F 5 .   ? 137.118 46.530 18.471  1.00 60.50  ? 1108 HOH A O     1 
HETATM 2587 O  O     . HOH F 5 .   ? 122.263 23.338 -11.914 1.00 68.69  ? 1109 HOH A O     1 
HETATM 2588 O  O     . HOH F 5 .   ? 143.853 23.312 -13.634 1.00 50.93  ? 1110 HOH A O     1 
HETATM 2589 O  O     . HOH F 5 .   ? 138.077 45.768 -2.174  1.00 32.87  ? 1111 HOH A O     1 
HETATM 2590 O  O     . HOH F 5 .   ? 150.761 1.687  -2.396  1.00 44.76  ? 1112 HOH A O     1 
HETATM 2591 O  O     . HOH F 5 .   ? 155.945 12.729 -14.721 1.00 32.86  ? 1113 HOH A O     1 
HETATM 2592 O  O     . HOH F 5 .   ? 133.271 35.948 -3.706  1.00 32.98  ? 1114 HOH A O     1 
HETATM 2593 O  O     . HOH F 5 .   ? 174.347 33.715 1.334   1.00 41.30  ? 1115 HOH A O     1 
HETATM 2594 O  O     . HOH F 5 .   ? 147.682 12.460 25.428  1.00 60.38  ? 1116 HOH A O     1 
HETATM 2595 O  O     . HOH F 5 .   ? 164.132 30.386 -15.512 1.00 34.51  ? 1117 HOH A O     1 
HETATM 2596 O  O     . HOH F 5 .   ? 167.622 19.126 -8.068  1.00 84.29  ? 1118 HOH A O     1 
HETATM 2597 O  O     . HOH F 5 .   ? 136.779 52.651 7.628   1.00 55.85  ? 1119 HOH A O     1 
HETATM 2598 O  O     . HOH F 5 .   ? 141.035 29.460 7.259   1.00 37.98  ? 1120 HOH A O     1 
HETATM 2599 O  O     . HOH F 5 .   ? 151.743 1.651  -10.108 1.00 70.78  ? 1121 HOH A O     1 
HETATM 2600 O  O     . HOH F 5 .   ? 130.783 47.293 6.239   1.00 30.64  ? 1122 HOH A O     1 
HETATM 2601 O  O     . HOH F 5 .   ? 139.412 13.565 2.401   1.00 26.94  ? 1123 HOH A O     1 
HETATM 2602 O  O     . HOH F 5 .   ? 157.380 29.911 7.089   1.00 43.68  ? 1124 HOH A O     1 
HETATM 2603 O  O     . HOH F 5 .   ? 153.249 46.707 -14.206 1.00 68.61  ? 1125 HOH A O     1 
HETATM 2604 O  O     . HOH F 5 .   ? 122.727 15.817 -34.020 1.00 36.20  ? 1126 HOH A O     1 
HETATM 2605 O  O     . HOH F 5 .   ? 138.872 46.549 9.092   1.00 43.66  ? 1127 HOH A O     1 
HETATM 2606 O  O     . HOH F 5 .   ? 134.514 47.883 -7.479  1.00 54.03  ? 1128 HOH A O     1 
HETATM 2607 O  O     . HOH F 5 .   ? 145.551 16.988 -19.163 1.00 91.41  ? 1129 HOH A O     1 
HETATM 2608 O  O     . HOH F 5 .   ? 156.401 40.929 2.567   1.00 35.73  ? 1130 HOH A O     1 
HETATM 2609 O  O     . HOH F 5 .   ? 149.437 51.017 -17.971 1.00 59.44  ? 1131 HOH A O     1 
HETATM 2610 O  O     . HOH F 5 .   ? 141.307 39.430 -6.689  1.00 85.89  ? 1132 HOH A O     1 
HETATM 2611 O  O     . HOH F 5 .   ? 129.717 21.340 6.692   1.00 36.25  ? 1133 HOH A O     1 
HETATM 2612 O  O     . HOH F 5 .   ? 114.989 27.135 -18.680 1.00 48.74  ? 1134 HOH A O     1 
HETATM 2613 O  O     . HOH F 5 .   ? 142.444 3.346  -1.622  1.00 70.55  ? 1135 HOH A O     1 
HETATM 2614 O  O     . HOH F 5 .   ? 139.486 16.684 20.631  1.00 40.21  ? 1136 HOH A O     1 
HETATM 2615 O  O     . HOH F 5 .   ? 133.641 19.645 0.310   1.00 35.49  ? 1137 HOH A O     1 
HETATM 2616 O  O     . HOH F 5 .   ? 148.844 20.217 -23.511 1.00 88.74  ? 1138 HOH A O     1 
HETATM 2617 O  O     . HOH F 5 .   ? 170.781 39.447 7.786   1.00 42.04  ? 1139 HOH A O     1 
HETATM 2618 O  O     . HOH F 5 .   ? 144.694 9.421  -14.549 1.00 58.80  ? 1140 HOH A O     1 
HETATM 2619 O  O     . HOH F 5 .   ? 148.226 24.984 23.216  1.00 32.04  ? 1141 HOH A O     1 
HETATM 2620 O  O     . HOH F 5 .   ? 166.168 33.809 7.204   1.00 46.13  ? 1142 HOH A O     1 
HETATM 2621 O  O     . HOH F 5 .   ? 158.429 26.626 7.525   1.00 47.07  ? 1143 HOH A O     1 
HETATM 2622 O  O     . HOH F 5 .   ? 143.147 26.563 -2.056  1.00 40.54  ? 1144 HOH A O     1 
HETATM 2623 O  O     . HOH F 5 .   ? 156.821 42.098 6.572   1.00 49.62  ? 1145 HOH A O     1 
HETATM 2624 O  O     . HOH F 5 .   ? 156.462 5.931  -0.106  1.00 61.39  ? 1146 HOH A O     1 
HETATM 2625 O  O     . HOH F 5 .   ? 164.686 39.913 -23.079 1.00 42.49  ? 1147 HOH A O     1 
HETATM 2626 O  O     . HOH F 5 .   ? 134.652 24.538 0.528   1.00 33.01  ? 1148 HOH A O     1 
HETATM 2627 O  O     . HOH F 5 .   ? 160.614 10.291 -7.580  1.00 61.84  ? 1149 HOH A O     1 
HETATM 2628 O  O     . HOH F 5 .   ? 120.222 10.411 -13.978 1.00 95.22  ? 1150 HOH A O     1 
HETATM 2629 O  O     . HOH F 5 .   ? 145.376 24.029 -5.380  1.00 27.53  ? 1151 HOH A O     1 
HETATM 2630 O  O     . HOH F 5 .   ? 155.829 9.866  -5.447  1.00 61.31  ? 1152 HOH A O     1 
HETATM 2631 O  O     . HOH F 5 .   ? 153.386 0.965  -8.032  1.00 69.83  ? 1153 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   ?   ?   ?   A . n 
A 1 4   ASP 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   ASN 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 CYS 139 139 139 CYS CYS A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 CYS 145 145 145 CYS CYS A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TRP 154 154 154 TRP TRP A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 HIS 186 186 186 HIS HIS A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 CYS 202 202 202 CYS CYS A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 TYR 206 206 206 TYR TYR A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 MET 210 210 210 MET MET A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 PHE 221 221 221 PHE PHE A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 ALA 238 238 ?   ?   ?   A . n 
A 1 239 ALA 239 239 ?   ?   ?   A . n 
A 1 240 GLU 240 240 ?   ?   ?   A . n 
A 1 241 LYS 241 241 241 LYS ALA A . n 
A 1 242 VAL 242 242 242 VAL ALA A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 LEU 244 244 244 LEU ALA A . n 
A 1 245 SER 245 245 245 SER ALA A . n 
A 1 246 VAL 246 246 246 VAL ALA A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 ASN 248 248 248 ASN ALA A . n 
A 1 249 LYS 249 249 249 LYS ALA A . n 
A 1 250 GLU 250 250 250 GLU ALA A . n 
A 1 251 HIS 251 251 251 HIS ALA A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 VAL 253 253 253 VAL ALA A . n 
A 1 254 GLU 254 254 ?   ?   ?   A . n 
A 1 255 VAL 255 255 ?   ?   ?   A . n 
A 1 256 CYS 256 256 ?   ?   ?   A . n 
A 1 257 THR 257 257 ?   ?   ?   A . n 
A 1 258 GLY 258 258 ?   ?   ?   A . n 
A 1 259 ALA 259 259 ?   ?   ?   A . n 
A 1 260 LEU 260 260 ?   ?   ?   A . n 
A 1 261 ARG 261 261 ?   ?   ?   A . n 
A 1 262 LEU 262 262 ?   ?   ?   A . n 
A 1 263 LEU 263 263 ?   ?   ?   A . n 
A 1 264 THR 264 264 ?   ?   ?   A . n 
A 1 265 ALA 265 265 ?   ?   ?   A . n 
A 1 266 GLY 266 266 ?   ?   ?   A . n 
A 1 267 GLN 267 267 ?   ?   ?   A . n 
A 1 268 ASN 268 268 ?   ?   ?   A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 ASN 282 282 282 ASN ASN A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ALA 306 306 306 ALA ALA A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 ILE 310 310 310 ILE ILE A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 ASP 318 318 318 ASP ASP A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 PHE 320 320 320 PHE PHE A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 GLY 331 331 331 GLY GLY A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 THR 333 333 333 THR THR A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 CYS 337 337 337 CYS CYS A . n 
A 1 338 ILE 338 338 338 ILE ILE A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 CYS 340 340 340 CYS CYS A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 CYS 344 344 344 CYS CYS A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 ILE 349 349 349 ILE ILE A . n 
A 1 350 GLN 350 350 350 GLN GLN A . n 
A 1 351 HIS 351 351 351 HIS HIS A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 PHE 358 358 358 PHE PHE A . n 
A 1 359 THR 359 359 ?   ?   ?   A . n 
A 1 360 SER 360 360 ?   ?   ?   A . n 
A 1 361 LEU 361 361 ?   ?   ?   A . n 
A 1 362 PRO 362 362 ?   ?   ?   A . n 
A 1 363 CYS 363 363 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   999  999 SO4 SO4 A . 
C 3 CL  1   899  899 CL  CL  A . 
D 4 ADN 1   699  699 ADN ADN A . 
E 4 ADN 1   799  799 ADN ADN A . 
F 5 HOH 1   1000 100 HOH HOH A . 
F 5 HOH 2   1001 101 HOH HOH A . 
F 5 HOH 3   1002 102 HOH HOH A . 
F 5 HOH 4   1003 103 HOH HOH A . 
F 5 HOH 5   1004 104 HOH HOH A . 
F 5 HOH 6   1005 105 HOH HOH A . 
F 5 HOH 7   1006 106 HOH HOH A . 
F 5 HOH 8   1007 107 HOH HOH A . 
F 5 HOH 9   1008 108 HOH HOH A . 
F 5 HOH 10  1009 109 HOH HOH A . 
F 5 HOH 11  1010 110 HOH HOH A . 
F 5 HOH 12  1011 111 HOH HOH A . 
F 5 HOH 13  1012 112 HOH HOH A . 
F 5 HOH 14  1013 113 HOH HOH A . 
F 5 HOH 15  1014 114 HOH HOH A . 
F 5 HOH 16  1015 115 HOH HOH A . 
F 5 HOH 17  1016 116 HOH HOH A . 
F 5 HOH 18  1017 117 HOH HOH A . 
F 5 HOH 19  1018 118 HOH HOH A . 
F 5 HOH 20  1019 119 HOH HOH A . 
F 5 HOH 21  1020 120 HOH HOH A . 
F 5 HOH 22  1021 121 HOH HOH A . 
F 5 HOH 23  1022 122 HOH HOH A . 
F 5 HOH 24  1023 123 HOH HOH A . 
F 5 HOH 25  1024 124 HOH HOH A . 
F 5 HOH 26  1025 125 HOH HOH A . 
F 5 HOH 27  1026 126 HOH HOH A . 
F 5 HOH 28  1027 127 HOH HOH A . 
F 5 HOH 29  1028 128 HOH HOH A . 
F 5 HOH 30  1029 129 HOH HOH A . 
F 5 HOH 31  1030 130 HOH HOH A . 
F 5 HOH 32  1031 131 HOH HOH A . 
F 5 HOH 33  1032 132 HOH HOH A . 
F 5 HOH 34  1033 133 HOH HOH A . 
F 5 HOH 35  1034 134 HOH HOH A . 
F 5 HOH 36  1035 135 HOH HOH A . 
F 5 HOH 37  1036 136 HOH HOH A . 
F 5 HOH 38  1037 137 HOH HOH A . 
F 5 HOH 39  1038 138 HOH HOH A . 
F 5 HOH 40  1039 139 HOH HOH A . 
F 5 HOH 41  1040 140 HOH HOH A . 
F 5 HOH 42  1041 141 HOH HOH A . 
F 5 HOH 43  1042 142 HOH HOH A . 
F 5 HOH 44  1043 143 HOH HOH A . 
F 5 HOH 45  1044 144 HOH HOH A . 
F 5 HOH 46  1045 145 HOH HOH A . 
F 5 HOH 47  1046 146 HOH HOH A . 
F 5 HOH 48  1047 147 HOH HOH A . 
F 5 HOH 49  1048 148 HOH HOH A . 
F 5 HOH 50  1049 149 HOH HOH A . 
F 5 HOH 51  1050 150 HOH HOH A . 
F 5 HOH 52  1051 151 HOH HOH A . 
F 5 HOH 53  1052 152 HOH HOH A . 
F 5 HOH 54  1053 153 HOH HOH A . 
F 5 HOH 55  1054 154 HOH HOH A . 
F 5 HOH 56  1055 155 HOH HOH A . 
F 5 HOH 57  1056 156 HOH HOH A . 
F 5 HOH 58  1057 157 HOH HOH A . 
F 5 HOH 59  1058 158 HOH HOH A . 
F 5 HOH 60  1059 159 HOH HOH A . 
F 5 HOH 61  1060 160 HOH HOH A . 
F 5 HOH 62  1061 161 HOH HOH A . 
F 5 HOH 63  1062 162 HOH HOH A . 
F 5 HOH 64  1063 163 HOH HOH A . 
F 5 HOH 65  1064 164 HOH HOH A . 
F 5 HOH 66  1065 165 HOH HOH A . 
F 5 HOH 67  1066 166 HOH HOH A . 
F 5 HOH 68  1067 167 HOH HOH A . 
F 5 HOH 69  1068 168 HOH HOH A . 
F 5 HOH 70  1069 169 HOH HOH A . 
F 5 HOH 71  1070 170 HOH HOH A . 
F 5 HOH 72  1071 171 HOH HOH A . 
F 5 HOH 73  1072 172 HOH HOH A . 
F 5 HOH 74  1073 173 HOH HOH A . 
F 5 HOH 75  1074 200 HOH HOH A . 
F 5 HOH 76  1075 201 HOH HOH A . 
F 5 HOH 77  1076 202 HOH HOH A . 
F 5 HOH 78  1077 203 HOH HOH A . 
F 5 HOH 79  1078 204 HOH HOH A . 
F 5 HOH 80  1079 205 HOH HOH A . 
F 5 HOH 81  1080 206 HOH HOH A . 
F 5 HOH 82  1081 207 HOH HOH A . 
F 5 HOH 83  1082 208 HOH HOH A . 
F 5 HOH 84  1083 209 HOH HOH A . 
F 5 HOH 85  1084 210 HOH HOH A . 
F 5 HOH 86  1085 211 HOH HOH A . 
F 5 HOH 87  1086 212 HOH HOH A . 
F 5 HOH 88  1087 213 HOH HOH A . 
F 5 HOH 89  1088 214 HOH HOH A . 
F 5 HOH 90  1089 215 HOH HOH A . 
F 5 HOH 91  1090 216 HOH HOH A . 
F 5 HOH 92  1091 217 HOH HOH A . 
F 5 HOH 93  1092 218 HOH HOH A . 
F 5 HOH 94  1093 219 HOH HOH A . 
F 5 HOH 95  1094 220 HOH HOH A . 
F 5 HOH 96  1095 221 HOH HOH A . 
F 5 HOH 97  1096 222 HOH HOH A . 
F 5 HOH 98  1097 223 HOH HOH A . 
F 5 HOH 99  1098 224 HOH HOH A . 
F 5 HOH 100 1099 225 HOH HOH A . 
F 5 HOH 101 1100 226 HOH HOH A . 
F 5 HOH 102 1101 227 HOH HOH A . 
F 5 HOH 103 1102 228 HOH HOH A . 
F 5 HOH 104 1103 229 HOH HOH A . 
F 5 HOH 105 1104 230 HOH HOH A . 
F 5 HOH 106 1105 231 HOH HOH A . 
F 5 HOH 107 1106 232 HOH HOH A . 
F 5 HOH 108 1107 233 HOH HOH A . 
F 5 HOH 109 1108 234 HOH HOH A . 
F 5 HOH 110 1109 235 HOH HOH A . 
F 5 HOH 111 1110 236 HOH HOH A . 
F 5 HOH 112 1111 237 HOH HOH A . 
F 5 HOH 113 1112 238 HOH HOH A . 
F 5 HOH 114 1113 239 HOH HOH A . 
F 5 HOH 115 1114 240 HOH HOH A . 
F 5 HOH 116 1115 241 HOH HOH A . 
F 5 HOH 117 1116 242 HOH HOH A . 
F 5 HOH 118 1117 243 HOH HOH A . 
F 5 HOH 119 1118 244 HOH HOH A . 
F 5 HOH 120 1119 245 HOH HOH A . 
F 5 HOH 121 1120 246 HOH HOH A . 
F 5 HOH 122 1121 247 HOH HOH A . 
F 5 HOH 123 1122 248 HOH HOH A . 
F 5 HOH 124 1123 249 HOH HOH A . 
F 5 HOH 125 1124 250 HOH HOH A . 
F 5 HOH 126 1125 251 HOH HOH A . 
F 5 HOH 127 1126 252 HOH HOH A . 
F 5 HOH 128 1127 253 HOH HOH A . 
F 5 HOH 129 1128 254 HOH HOH A . 
F 5 HOH 130 1129 255 HOH HOH A . 
F 5 HOH 131 1130 256 HOH HOH A . 
F 5 HOH 132 1131 257 HOH HOH A . 
F 5 HOH 133 1132 258 HOH HOH A . 
F 5 HOH 134 1133 259 HOH HOH A . 
F 5 HOH 135 1134 260 HOH HOH A . 
F 5 HOH 136 1135 261 HOH HOH A . 
F 5 HOH 137 1136 300 HOH HOH A . 
F 5 HOH 138 1137 301 HOH HOH A . 
F 5 HOH 139 1138 302 HOH HOH A . 
F 5 HOH 140 1139 303 HOH HOH A . 
F 5 HOH 141 1140 304 HOH HOH A . 
F 5 HOH 142 1141 305 HOH HOH A . 
F 5 HOH 143 1142 306 HOH HOH A . 
F 5 HOH 144 1143 307 HOH HOH A . 
F 5 HOH 145 1144 308 HOH HOH A . 
F 5 HOH 146 1145 309 HOH HOH A . 
F 5 HOH 147 1146 310 HOH HOH A . 
F 5 HOH 148 1147 311 HOH HOH A . 
F 5 HOH 149 1148 312 HOH HOH A . 
F 5 HOH 150 1149 313 HOH HOH A . 
F 5 HOH 151 1150 314 HOH HOH A . 
F 5 HOH 152 1151 315 HOH HOH A . 
F 5 HOH 153 1152 316 HOH HOH A . 
F 5 HOH 154 1153 317 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-05-15 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
EPMR phasing           . ? 1 
TNT  refinement        . ? 2 
ADSC 'data collection' . ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CB 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    269 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLY 
_pdbx_validate_close_contact.auth_seq_id_2    270 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.32 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A PRO 151 ? ? N   A GLU 152 ? ? 1.489 1.336 0.153  0.023 Y 
2 1 CG A GLU 152 ? ? CD  A GLU 152 ? ? 1.066 1.515 -0.449 0.015 N 
3 1 CD A GLU 152 ? ? OE1 A GLU 152 ? ? 1.514 1.252 0.262  0.011 N 
4 1 CD A GLU 152 ? ? OE2 A GLU 152 ? ? 2.232 1.252 0.980  0.011 N 
5 1 CB A THR 269 ? ? OG1 A THR 269 ? ? 3.540 1.428 2.112  0.020 N 
6 1 CB A THR 269 ? ? CG2 A THR 269 ? ? 3.684 1.519 2.165  0.033 N 
7 1 C  A THR 269 ? ? O   A THR 269 ? ? 3.033 1.229 1.804  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C   A GLY 11  ? ? N  A PRO 12  ? ? CD  A PRO 12  ? ? 103.66 128.40 -24.74 2.10 Y 
2  1 CG1 A ILE 54  ? ? CB A ILE 54  ? ? CG2 A ILE 54  ? ? 95.33  111.40 -16.07 2.20 N 
3  1 CB  A ASP 108 ? ? CG A ASP 108 ? ? OD1 A ASP 108 ? ? 124.43 118.30 6.13   0.90 N 
4  1 CB  A ASP 108 ? ? CG A ASP 108 ? ? OD2 A ASP 108 ? ? 111.96 118.30 -6.34  0.90 N 
5  1 CB  A LEU 112 ? ? CA A LEU 112 ? ? C   A LEU 112 ? ? 98.55  110.20 -11.65 1.90 N 
6  1 CB  A ILE 150 ? ? CA A ILE 150 ? ? C   A ILE 150 ? ? 124.81 111.60 13.21  2.00 N 
7  1 O   A PRO 151 ? ? C  A PRO 151 ? ? N   A GLU 152 ? ? 133.86 122.70 11.16  1.60 Y 
8  1 N   A GLU 152 ? ? CA A GLU 152 ? ? CB  A GLU 152 ? ? 127.79 110.60 17.19  1.80 N 
9  1 CB  A HIS 234 ? ? CA A HIS 234 ? ? C   A HIS 234 ? ? 125.00 110.40 14.60  2.00 N 
10 1 CB  A LYS 249 ? ? CA A LYS 249 ? ? C   A LYS 249 ? ? 122.94 110.40 12.54  2.00 N 
11 1 OG1 A THR 269 ? ? CB A THR 269 ? ? CG2 A THR 269 ? ? 39.01  110.00 -70.99 2.30 N 
12 1 CA  A THR 269 ? ? CB A THR 269 ? ? OG1 A THR 269 ? ? 34.01  109.00 -74.99 2.10 N 
13 1 CA  A THR 269 ? ? CB A THR 269 ? ? CG2 A THR 269 ? ? 32.08  112.40 -80.32 1.40 N 
14 1 CA  A THR 269 ? ? C  A THR 269 ? ? O   A THR 269 ? ? 52.31  120.10 -67.79 2.10 N 
15 1 CB  A VAL 300 ? ? CA A VAL 300 ? ? C   A VAL 300 ? ? 124.00 111.40 12.60  1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 27  ? ? -177.43 141.62  
2  1 SER A 56  ? ? -90.15  -60.71  
3  1 THR A 57  ? ? -47.99  -10.66  
4  1 ARG A 83  ? ? 72.47   -62.08  
5  1 ASP A 96  ? ? -101.53 44.57   
6  1 GLU A 133 ? ? 82.05   -108.15 
7  1 GLU A 152 ? ? -36.43  -38.64  
8  1 THR A 174 ? ? 176.30  137.72  
9  1 ASN A 190 ? ? 91.02   -12.50  
10 1 SER A 198 ? ? 53.96   -59.25  
11 1 TYR A 206 ? ? -98.81  44.71   
12 1 LYS A 207 ? ? -49.27  -79.05  
13 1 HIS A 234 ? ? -78.36  -138.91 
14 1 ASN A 235 ? ? -95.42  -101.70 
15 1 LEU A 236 ? ? 20.03   -54.39  
16 1 THR A 272 ? ? -29.84  128.36  
17 1 VAL A 311 ? ? -93.87  -64.99  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    LYS 
_pdbx_validate_chiral.auth_seq_id     241 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   THR 
_pdbx_validate_polymer_linkage.auth_seq_id_1    269 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_2    270 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             3.61 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 241 ? CG  ? A LYS 241 CG  
2  1 Y 1 A LYS 241 ? CD  ? A LYS 241 CD  
3  1 Y 1 A LYS 241 ? CE  ? A LYS 241 CE  
4  1 Y 1 A LYS 241 ? NZ  ? A LYS 241 NZ  
5  1 Y 1 A VAL 242 ? CG1 ? A VAL 242 CG1 
6  1 Y 1 A VAL 242 ? CG2 ? A VAL 242 CG2 
7  1 Y 1 A LEU 244 ? CG  ? A LEU 244 CG  
8  1 Y 1 A LEU 244 ? CD1 ? A LEU 244 CD1 
9  1 Y 1 A LEU 244 ? CD2 ? A LEU 244 CD2 
10 1 Y 1 A SER 245 ? OG  ? A SER 245 OG  
11 1 Y 1 A VAL 246 ? CG1 ? A VAL 246 CG1 
12 1 Y 1 A VAL 246 ? CG2 ? A VAL 246 CG2 
13 1 Y 1 A ASN 248 ? CG  ? A ASN 248 CG  
14 1 Y 1 A ASN 248 ? OD1 ? A ASN 248 OD1 
15 1 Y 1 A ASN 248 ? ND2 ? A ASN 248 ND2 
16 1 Y 1 A LYS 249 ? CG  ? A LYS 249 CG  
17 1 Y 1 A LYS 249 ? CD  ? A LYS 249 CD  
18 1 Y 1 A LYS 249 ? CE  ? A LYS 249 CE  
19 1 Y 1 A LYS 249 ? NZ  ? A LYS 249 NZ  
20 1 Y 1 A GLU 250 ? CG  ? A GLU 250 CG  
21 1 Y 1 A GLU 250 ? CD  ? A GLU 250 CD  
22 1 Y 1 A GLU 250 ? OE1 ? A GLU 250 OE1 
23 1 Y 1 A GLU 250 ? OE2 ? A GLU 250 OE2 
24 1 Y 1 A HIS 251 ? CG  ? A HIS 251 CG  
25 1 Y 1 A HIS 251 ? ND1 ? A HIS 251 ND1 
26 1 Y 1 A HIS 251 ? CD2 ? A HIS 251 CD2 
27 1 Y 1 A HIS 251 ? CE1 ? A HIS 251 CE1 
28 1 Y 1 A HIS 251 ? NE2 ? A HIS 251 NE2 
29 1 Y 1 A VAL 253 ? CG1 ? A VAL 253 CG1 
30 1 Y 1 A VAL 253 ? CG2 ? A VAL 253 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A VAL 3   ? A VAL 3   
4  1 Y 1 A ASP 4   ? A ASP 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A ASN 7   ? A ASN 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A ALA 9   ? A ALA 9   
10 1 Y 1 A THR 10  ? A THR 10  
11 1 Y 1 A ALA 238 ? A ALA 238 
12 1 Y 1 A ALA 239 ? A ALA 239 
13 1 Y 1 A GLU 240 ? A GLU 240 
14 1 Y 1 A GLU 254 ? A GLU 254 
15 1 Y 1 A VAL 255 ? A VAL 255 
16 1 Y 1 A CYS 256 ? A CYS 256 
17 1 Y 1 A THR 257 ? A THR 257 
18 1 Y 1 A GLY 258 ? A GLY 258 
19 1 Y 1 A ALA 259 ? A ALA 259 
20 1 Y 1 A LEU 260 ? A LEU 260 
21 1 Y 1 A ARG 261 ? A ARG 261 
22 1 Y 1 A LEU 262 ? A LEU 262 
23 1 Y 1 A LEU 263 ? A LEU 263 
24 1 Y 1 A THR 264 ? A THR 264 
25 1 Y 1 A ALA 265 ? A ALA 265 
26 1 Y 1 A GLY 266 ? A GLY 266 
27 1 Y 1 A GLN 267 ? A GLN 267 
28 1 Y 1 A ASN 268 ? A ASN 268 
29 1 Y 1 A THR 359 ? A THR 359 
30 1 Y 1 A SER 360 ? A SER 360 
31 1 Y 1 A LEU 361 ? A LEU 361 
32 1 Y 1 A PRO 362 ? A PRO 362 
33 1 Y 1 A CYS 363 ? A CYS 363 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'  SO4 
3 'CHLORIDE ION' CL  
4 ADENOSINE      ADN 
5 water          HOH 
#