data_1LL8
# 
_entry.id   1LL8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LL8         
RCSB  RCSB016049   
WWPDB D_1000016049 
BMRB  5354         
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          5354 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LL8 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Amezcua, C.A.' 1 
'Harper, S.M.'  2 
'Rutter, J.'    3 
'Gardner, K.H.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structure and interactions of PAS kinase N-terminal PAS domain: model for intramolecular kinase regulation.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            10 
_citation.page_first                1349 
_citation.page_last                 1361 
_citation.year                      2002 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12377121 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(02)00857-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Amezcua, C.A.' 1 ? 
primary 'Harper, S.M.'  2 ? 
primary 'Rutter, J.'    3 ? 
primary 'Gardner, K.H.' 4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PAS Kinase' 
_entity.formula_weight             12659.517 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.1.37 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PAS-A domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMDPEFNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDI
ISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDPEFNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDI
ISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVER
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   PRO n 
1 6   GLU n 
1 7   PHE n 
1 8   ASN n 
1 9   LYS n 
1 10  ALA n 
1 11  ILE n 
1 12  PHE n 
1 13  THR n 
1 14  VAL n 
1 15  ASP n 
1 16  ALA n 
1 17  LYS n 
1 18  THR n 
1 19  THR n 
1 20  GLU n 
1 21  ILE n 
1 22  LEU n 
1 23  VAL n 
1 24  ALA n 
1 25  ASN n 
1 26  ASP n 
1 27  LYS n 
1 28  ALA n 
1 29  CYS n 
1 30  GLY n 
1 31  LEU n 
1 32  LEU n 
1 33  GLY n 
1 34  TYR n 
1 35  SER n 
1 36  SER n 
1 37  GLN n 
1 38  ASP n 
1 39  LEU n 
1 40  ILE n 
1 41  GLY n 
1 42  GLN n 
1 43  LYS n 
1 44  LEU n 
1 45  THR n 
1 46  GLN n 
1 47  PHE n 
1 48  PHE n 
1 49  LEU n 
1 50  ARG n 
1 51  SER n 
1 52  ASP n 
1 53  SER n 
1 54  ASP n 
1 55  VAL n 
1 56  VAL n 
1 57  GLU n 
1 58  ALA n 
1 59  LEU n 
1 60  SER n 
1 61  GLU n 
1 62  GLU n 
1 63  HIS n 
1 64  MET n 
1 65  GLU n 
1 66  ALA n 
1 67  ASP n 
1 68  GLY n 
1 69  HIS n 
1 70  ALA n 
1 71  ALA n 
1 72  VAL n 
1 73  VAL n 
1 74  PHE n 
1 75  GLY n 
1 76  THR n 
1 77  VAL n 
1 78  VAL n 
1 79  ASP n 
1 80  ILE n 
1 81  ILE n 
1 82  SER n 
1 83  ARG n 
1 84  SER n 
1 85  GLY n 
1 86  GLU n 
1 87  LYS n 
1 88  ILE n 
1 89  PRO n 
1 90  VAL n 
1 91  SER n 
1 92  VAL n 
1 93  TRP n 
1 94  MET n 
1 95  LYS n 
1 96  ARG n 
1 97  MET n 
1 98  ARG n 
1 99  GLN n 
1 100 GLU n 
1 101 ARG n 
1 102 ARG n 
1 103 LEU n 
1 104 CYS n 
1 105 CYS n 
1 106 VAL n 
1 107 VAL n 
1 108 VAL n 
1 109 LEU n 
1 110 GLU n 
1 111 PRO n 
1 112 VAL n 
1 113 GLU n 
1 114 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PASK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEK
IPVSVWMKRMRQERRLCCVVVLEPVER
;
_struct_ref.pdbx_align_begin           131 
_struct_ref.pdbx_db_accession          Q96RG2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LL8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 114 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96RG2 
_struct_ref_seq.db_align_beg                  131 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  237 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       114 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LL8 GLY A 1 ? UNP Q96RG2 ? ? 'cloning artifact' 1 1 
1 1LL8 ALA A 2 ? UNP Q96RG2 ? ? 'cloning artifact' 2 2 
1 1LL8 MET A 3 ? UNP Q96RG2 ? ? 'cloning artifact' 3 3 
1 1LL8 ASP A 4 ? UNP Q96RG2 ? ? 'cloning artifact' 4 4 
1 1LL8 PRO A 5 ? UNP Q96RG2 ? ? 'cloning artifact' 5 5 
1 1LL8 GLU A 6 ? UNP Q96RG2 ? ? 'cloning artifact' 6 6 
1 1LL8 PHE A 7 ? UNP Q96RG2 ? ? 'cloning artifact' 7 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY'                
2 1 1 '3D_13C,15N-edited NOESY' 
3 1 1 3D_15N-separated_NOESY    
4 1 1 1H-15N-IPAP               
5 1 1 ?                         
6 1 1 ?                         
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM sodium chloride' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1mM PAS Kinase PAS-A domain U-15N,13C;  
20mM sodium phosphate buffer;  
50mM sodium chloride; 5mM DTT
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 500 
2 ? Varian INOVA 600 
# 
_pdbx_nmr_refine.entry_id           1LL8 
_pdbx_nmr_refine.method             'molecular dynamics/simulated annealing' 
_pdbx_nmr_refine.details            
;2520 NOE-derived distance constraints, 48 Hydrogen bonds, 
116 Dihedral angle restraints, 61 dipolar couplings
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1LL8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1LL8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.2  collection           'VARIAN INC.'   1 
NMRPipe NA   processing           'Delaglio, F.'  2 
NMRView 5.04 'data analysis'      'Johnson, B.'   3 
CNS     1.0  'structure solution' 'Brunger, A.T.' 4 
ARIA    1.1  refinement           'Nilges, M.'    5 
# 
_exptl.entry_id          1LL8 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1LL8 
_struct.title                     
'Structure and interactions of PAS kinase N-terminal PAS domain: Model for intramolecular kinase regulation' 
_struct.pdbx_descriptor           'PAS Kinase (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LL8 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'PAS Domain, Ligand binding, Ligand screening, kinase regulation, Transferase' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 27 ? GLY A 33 ? LYS A 27 GLY A 33 1 ? 7 
HELX_P HELX_P2 2 LYS A 43 ? PHE A 48 ? LYS A 43 PHE A 48 5 ? 6 
HELX_P HELX_P3 3 SER A 53 ? LEU A 59 ? SER A 53 LEU A 59 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 21  ? ALA A 24  ? ILE A 21  ALA A 24  
A 2 ALA A 10  ? ASP A 15  ? ALA A 10  ASP A 15  
A 3 CYS A 104 ? PRO A 111 ? CYS A 104 PRO A 111 
A 4 ILE A 88  ? SER A 91  ? ILE A 88  SER A 91  
A 5 VAL A 78  ? ILE A 80  ? VAL A 78  ILE A 80  
B 1 ILE A 21  ? ALA A 24  ? ILE A 21  ALA A 24  
B 2 ALA A 10  ? ASP A 15  ? ALA A 10  ASP A 15  
B 3 CYS A 104 ? PRO A 111 ? CYS A 104 PRO A 111 
B 4 MET A 94  ? LYS A 95  ? MET A 94  LYS A 95  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 23  ? O VAL A 23  N THR A 13  ? N THR A 13  
A 2 3 N PHE A 12  ? N PHE A 12  O VAL A 107 ? O VAL A 107 
A 3 4 O GLU A 110 ? O GLU A 110 N SER A 91  ? N SER A 91  
A 4 5 O VAL A 90  ? O VAL A 90  N VAL A 78  ? N VAL A 78  
B 1 2 O VAL A 23  ? O VAL A 23  N THR A 13  ? N THR A 13  
B 2 3 N PHE A 12  ? N PHE A 12  O VAL A 107 ? O VAL A 107 
B 3 4 O VAL A 106 ? O VAL A 106 N LYS A 95  ? N LYS A 95  
# 
_database_PDB_matrix.entry_id          1LL8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LL8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -5.716  15.097  -15.738 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -6.899  14.507  -15.051 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -7.731  13.642  -15.975 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -8.960  13.687  -15.936 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -6.005  15.536  -16.636 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? -5.011  14.359  -15.936 1.00 0.00 ? 1   GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? -5.280  15.824  -15.136 1.00 0.00 ? 1   GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? -6.554  13.902  -14.224 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? -7.515  15.306  -14.669 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 10    N N    . ALA A 1 2   ? -7.059  12.851  -16.809 1.00 0.00 ? 2   ALA A N    1  
ATOM 11    C CA   . ALA A 1 2   ? -7.744  11.972  -17.748 1.00 0.00 ? 2   ALA A CA   1  
ATOM 12    C C    . ALA A 1 2   ? -7.007  10.644  -17.896 1.00 0.00 ? 2   ALA A C    1  
ATOM 13    O O    . ALA A 1 2   ? -7.116  9.975   -18.925 1.00 0.00 ? 2   ALA A O    1  
ATOM 14    C CB   . ALA A 1 2   ? -7.882  12.653  -19.102 1.00 0.00 ? 2   ALA A CB   1  
ATOM 15    H H    . ALA A 1 2   ? -6.079  12.861  -16.791 1.00 0.00 ? 2   ALA A H    1  
ATOM 16    H HA   . ALA A 1 2   ? -8.736  11.780  -17.365 1.00 0.00 ? 2   ALA A HA   1  
ATOM 17    H HB1  . ALA A 1 2   ? -7.981  13.719  -18.960 1.00 0.00 ? 2   ALA A HB1  1  
ATOM 18    H HB2  . ALA A 1 2   ? -8.757  12.273  -19.607 1.00 0.00 ? 2   ALA A HB2  1  
ATOM 19    H HB3  . ALA A 1 2   ? -7.004  12.450  -19.698 1.00 0.00 ? 2   ALA A HB3  1  
ATOM 20    N N    . MET A 1 3   ? -6.258  10.266  -16.864 1.00 0.00 ? 3   MET A N    1  
ATOM 21    C CA   . MET A 1 3   ? -5.506  9.018   -16.886 1.00 0.00 ? 3   MET A CA   1  
ATOM 22    C C    . MET A 1 3   ? -5.552  8.325   -15.522 1.00 0.00 ? 3   MET A C    1  
ATOM 23    O O    . MET A 1 3   ? -6.570  7.740   -15.152 1.00 0.00 ? 3   MET A O    1  
ATOM 24    C CB   . MET A 1 3   ? -4.056  9.276   -17.308 1.00 0.00 ? 3   MET A CB   1  
ATOM 25    C CG   . MET A 1 3   ? -3.625  8.480   -18.527 1.00 0.00 ? 3   MET A CG   1  
ATOM 26    S SD   . MET A 1 3   ? -1.878  8.041   -18.486 1.00 0.00 ? 3   MET A SD   1  
ATOM 27    C CE   . MET A 1 3   ? -1.118  9.644   -18.734 1.00 0.00 ? 3   MET A CE   1  
ATOM 28    H H    . MET A 1 3   ? -6.211  10.841  -16.072 1.00 0.00 ? 3   MET A H    1  
ATOM 29    H HA   . MET A 1 3   ? -5.969  8.369   -17.614 1.00 0.00 ? 3   MET A HA   1  
ATOM 30    H HB2  . MET A 1 3   ? -3.944  10.326  -17.533 1.00 0.00 ? 3   MET A HB2  1  
ATOM 31    H HB3  . MET A 1 3   ? -3.403  9.021   -16.488 1.00 0.00 ? 3   MET A HB3  1  
ATOM 32    H HG2  . MET A 1 3   ? -4.208  7.572   -18.573 1.00 0.00 ? 3   MET A HG2  1  
ATOM 33    H HG3  . MET A 1 3   ? -3.812  9.071   -19.412 1.00 0.00 ? 3   MET A HG3  1  
ATOM 34    H HE1  . MET A 1 3   ? -1.403  10.031  -19.700 1.00 0.00 ? 3   MET A HE1  1  
ATOM 35    H HE2  . MET A 1 3   ? -0.044  9.543   -18.689 1.00 0.00 ? 3   MET A HE2  1  
ATOM 36    H HE3  . MET A 1 3   ? -1.450  10.321  -17.961 1.00 0.00 ? 3   MET A HE3  1  
ATOM 37    N N    . ASP A 1 4   ? -4.449  8.393   -14.777 1.00 0.00 ? 4   ASP A N    1  
ATOM 38    C CA   . ASP A 1 4   ? -4.375  7.769   -13.457 1.00 0.00 ? 4   ASP A CA   1  
ATOM 39    C C    . ASP A 1 4   ? -3.391  8.505   -12.537 1.00 0.00 ? 4   ASP A C    1  
ATOM 40    O O    . ASP A 1 4   ? -3.744  8.853   -11.410 1.00 0.00 ? 4   ASP A O    1  
ATOM 41    C CB   . ASP A 1 4   ? -3.977  6.290   -13.570 1.00 0.00 ? 4   ASP A CB   1  
ATOM 42    C CG   . ASP A 1 4   ? -4.084  5.758   -14.986 1.00 0.00 ? 4   ASP A CG   1  
ATOM 43    O OD1  . ASP A 1 4   ? -3.222  6.108   -15.819 1.00 0.00 ? 4   ASP A OD1  1  
ATOM 44    O OD2  . ASP A 1 4   ? -5.030  4.989   -15.260 1.00 0.00 ? 4   ASP A OD2  1  
ATOM 45    H H    . ASP A 1 4   ? -3.668  8.874   -15.121 1.00 0.00 ? 4   ASP A H    1  
ATOM 46    H HA   . ASP A 1 4   ? -5.359  7.827   -13.016 1.00 0.00 ? 4   ASP A HA   1  
ATOM 47    H HB2  . ASP A 1 4   ? -2.957  6.174   -13.240 1.00 0.00 ? 4   ASP A HB2  1  
ATOM 48    H HB3  . ASP A 1 4   ? -4.624  5.703   -12.934 1.00 0.00 ? 4   ASP A HB3  1  
ATOM 49    N N    . PRO A 1 5   ? -2.139  8.749   -12.992 1.00 0.00 ? 5   PRO A N    1  
ATOM 50    C CA   . PRO A 1 5   ? -1.125  9.439   -12.181 1.00 0.00 ? 5   PRO A CA   1  
ATOM 51    C C    . PRO A 1 5   ? -1.654  10.716  -11.531 1.00 0.00 ? 5   PRO A C    1  
ATOM 52    O O    . PRO A 1 5   ? -1.133  11.164  -10.510 1.00 0.00 ? 5   PRO A O    1  
ATOM 53    C CB   . PRO A 1 5   ? -0.033  9.774   -13.195 1.00 0.00 ? 5   PRO A CB   1  
ATOM 54    C CG   . PRO A 1 5   ? -0.140  8.702   -14.221 1.00 0.00 ? 5   PRO A CG   1  
ATOM 55    C CD   . PRO A 1 5   ? -1.602  8.367   -14.319 1.00 0.00 ? 5   PRO A CD   1  
ATOM 56    H HA   . PRO A 1 5   ? -0.723  8.791   -11.417 1.00 0.00 ? 5   PRO A HA   1  
ATOM 57    H HB2  . PRO A 1 5   ? -0.216  10.751  -13.619 1.00 0.00 ? 5   PRO A HB2  1  
ATOM 58    H HB3  . PRO A 1 5   ? 0.932   9.759   -12.709 1.00 0.00 ? 5   PRO A HB3  1  
ATOM 59    H HG2  . PRO A 1 5   ? 0.225   9.065   -15.172 1.00 0.00 ? 5   PRO A HG2  1  
ATOM 60    H HG3  . PRO A 1 5   ? 0.424   7.835   -13.910 1.00 0.00 ? 5   PRO A HG3  1  
ATOM 61    H HD2  . PRO A 1 5   ? -2.071  8.945   -15.102 1.00 0.00 ? 5   PRO A HD2  1  
ATOM 62    H HD3  . PRO A 1 5   ? -1.737  7.310   -14.497 1.00 0.00 ? 5   PRO A HD3  1  
ATOM 63    N N    . GLU A 1 6   ? -2.690  11.296  -12.130 1.00 0.00 ? 6   GLU A N    1  
ATOM 64    C CA   . GLU A 1 6   ? -3.285  12.520  -11.607 1.00 0.00 ? 6   GLU A CA   1  
ATOM 65    C C    . GLU A 1 6   ? -4.779  12.336  -11.363 1.00 0.00 ? 6   GLU A C    1  
ATOM 66    O O    . GLU A 1 6   ? -5.419  13.165  -10.716 1.00 0.00 ? 6   GLU A O    1  
ATOM 67    C CB   . GLU A 1 6   ? -3.056  13.677  -12.579 1.00 0.00 ? 6   GLU A CB   1  
ATOM 68    C CG   . GLU A 1 6   ? -3.436  13.347  -14.011 1.00 0.00 ? 6   GLU A CG   1  
ATOM 69    C CD   . GLU A 1 6   ? -2.380  13.778  -15.011 1.00 0.00 ? 6   GLU A CD   1  
ATOM 70    O OE1  . GLU A 1 6   ? -1.633  14.734  -14.711 1.00 0.00 ? 6   GLU A OE1  1  
ATOM 71    O OE2  . GLU A 1 6   ? -2.301  13.162  -16.094 1.00 0.00 ? 6   GLU A OE2  1  
ATOM 72    H H    . GLU A 1 6   ? -3.061  10.891  -12.940 1.00 0.00 ? 6   GLU A H    1  
ATOM 73    H HA   . GLU A 1 6   ? -2.804  12.748  -10.669 1.00 0.00 ? 6   GLU A HA   1  
ATOM 74    H HB2  . GLU A 1 6   ? -3.646  14.525  -12.258 1.00 0.00 ? 6   GLU A HB2  1  
ATOM 75    H HB3  . GLU A 1 6   ? -2.011  13.949  -12.560 1.00 0.00 ? 6   GLU A HB3  1  
ATOM 76    H HG2  . GLU A 1 6   ? -3.570  12.277  -14.095 1.00 0.00 ? 6   GLU A HG2  1  
ATOM 77    H HG3  . GLU A 1 6   ? -4.364  13.846  -14.250 1.00 0.00 ? 6   GLU A HG3  1  
ATOM 78    N N    . PHE A 1 7   ? -5.328  11.247  -11.888 1.00 0.00 ? 7   PHE A N    1  
ATOM 79    C CA   . PHE A 1 7   ? -6.747  10.955  -11.726 1.00 0.00 ? 7   PHE A CA   1  
ATOM 80    C C    . PHE A 1 7   ? -7.033  10.408  -10.332 1.00 0.00 ? 7   PHE A C    1  
ATOM 81    O O    . PHE A 1 7   ? -7.910  10.906  -9.627  1.00 0.00 ? 7   PHE A O    1  
ATOM 82    C CB   . PHE A 1 7   ? -7.210  9.955   -12.789 1.00 0.00 ? 7   PHE A CB   1  
ATOM 83    C CG   . PHE A 1 7   ? -8.559  10.273  -13.374 1.00 0.00 ? 7   PHE A CG   1  
ATOM 84    C CD1  . PHE A 1 7   ? -9.662  10.446  -12.551 1.00 0.00 ? 7   PHE A CD1  1  
ATOM 85    C CD2  . PHE A 1 7   ? -8.723  10.397  -14.743 1.00 0.00 ? 7   PHE A CD2  1  
ATOM 86    C CE1  . PHE A 1 7   ? -10.903 10.738  -13.087 1.00 0.00 ? 7   PHE A CE1  1  
ATOM 87    C CE2  . PHE A 1 7   ? -9.962  10.689  -15.283 1.00 0.00 ? 7   PHE A CE2  1  
ATOM 88    C CZ   . PHE A 1 7   ? -11.054 10.858  -14.454 1.00 0.00 ? 7   PHE A CZ   1  
ATOM 89    H H    . PHE A 1 7   ? -4.767  10.624  -12.394 1.00 0.00 ? 7   PHE A H    1  
ATOM 90    H HA   . PHE A 1 7   ? -7.290  11.878  -11.854 1.00 0.00 ? 7   PHE A HA   1  
ATOM 91    H HB2  . PHE A 1 7   ? -6.495  9.945   -13.599 1.00 0.00 ? 7   PHE A HB2  1  
ATOM 92    H HB3  . PHE A 1 7   ? -7.262  8.971   -12.348 1.00 0.00 ? 7   PHE A HB3  1  
ATOM 93    H HD1  . PHE A 1 7   ? -9.546  10.353  -11.482 1.00 0.00 ? 7   PHE A HD1  1  
ATOM 94    H HD2  . PHE A 1 7   ? -7.871  10.264  -15.393 1.00 0.00 ? 7   PHE A HD2  1  
ATOM 95    H HE1  . PHE A 1 7   ? -11.755 10.869  -12.435 1.00 0.00 ? 7   PHE A HE1  1  
ATOM 96    H HE2  . PHE A 1 7   ? -10.076 10.782  -16.353 1.00 0.00 ? 7   PHE A HE2  1  
ATOM 97    H HZ   . PHE A 1 7   ? -12.021 11.086  -14.875 1.00 0.00 ? 7   PHE A HZ   1  
ATOM 98    N N    . ASN A 1 8   ? -6.283  9.380   -9.942  1.00 0.00 ? 8   ASN A N    1  
ATOM 99    C CA   . ASN A 1 8   ? -6.448  8.762   -8.629  1.00 0.00 ? 8   ASN A CA   1  
ATOM 100   C C    . ASN A 1 8   ? -5.337  7.750   -8.365  1.00 0.00 ? 8   ASN A C    1  
ATOM 101   O O    . ASN A 1 8   ? -5.597  6.633   -7.914  1.00 0.00 ? 8   ASN A O    1  
ATOM 102   C CB   . ASN A 1 8   ? -7.814  8.077   -8.531  1.00 0.00 ? 8   ASN A CB   1  
ATOM 103   C CG   . ASN A 1 8   ? -8.177  7.322   -9.797  1.00 0.00 ? 8   ASN A CG   1  
ATOM 104   O OD1  . ASN A 1 8   ? -7.304  6.844   -10.521 1.00 0.00 ? 8   ASN A OD1  1  
ATOM 105   N ND2  . ASN A 1 8   ? -9.472  7.212   -10.069 1.00 0.00 ? 8   ASN A ND2  1  
ATOM 106   H H    . ASN A 1 8   ? -5.599  9.031   -10.549 1.00 0.00 ? 8   ASN A H    1  
ATOM 107   H HA   . ASN A 1 8   ? -6.393  9.542   -7.885  1.00 0.00 ? 8   ASN A HA   1  
ATOM 108   H HB2  . ASN A 1 8   ? -7.800  7.376   -7.711  1.00 0.00 ? 8   ASN A HB2  1  
ATOM 109   H HB3  . ASN A 1 8   ? -8.571  8.823   -8.349  1.00 0.00 ? 8   ASN A HB3  1  
ATOM 110   H HD21 . ASN A 1 8   ? -10.112 7.619   -9.448  1.00 0.00 ? 8   ASN A HD21 1  
ATOM 111   H HD22 . ASN A 1 8   ? -9.736  6.728   -10.880 1.00 0.00 ? 8   ASN A HD22 1  
ATOM 112   N N    . LYS A 1 9   ? -4.100  8.141   -8.660  1.00 0.00 ? 9   LYS A N    1  
ATOM 113   C CA   . LYS A 1 9   ? -2.955  7.257   -8.461  1.00 0.00 ? 9   LYS A CA   1  
ATOM 114   C C    . LYS A 1 9   ? -2.696  6.992   -6.979  1.00 0.00 ? 9   LYS A C    1  
ATOM 115   O O    . LYS A 1 9   ? -2.251  7.875   -6.239  1.00 0.00 ? 9   LYS A O    1  
ATOM 116   C CB   . LYS A 1 9   ? -1.704  7.845   -9.114  1.00 0.00 ? 9   LYS A CB   1  
ATOM 117   C CG   . LYS A 1 9   ? -0.934  6.838   -9.955  1.00 0.00 ? 9   LYS A CG   1  
ATOM 118   C CD   . LYS A 1 9   ? 0.554   7.144   -9.973  1.00 0.00 ? 9   LYS A CD   1  
ATOM 119   C CE   . LYS A 1 9   ? 1.375   5.927   -9.579  1.00 0.00 ? 9   LYS A CE   1  
ATOM 120   N NZ   . LYS A 1 9   ? 2.775   6.292   -9.229  1.00 0.00 ? 9   LYS A NZ   1  
ATOM 121   H H    . LYS A 1 9   ? -3.955  9.040   -9.026  1.00 0.00 ? 9   LYS A H    1  
ATOM 122   H HA   . LYS A 1 9   ? -3.184  6.317   -8.941  1.00 0.00 ? 9   LYS A HA   1  
ATOM 123   H HB2  . LYS A 1 9   ? -1.994  8.669   -9.748  1.00 0.00 ? 9   LYS A HB2  1  
ATOM 124   H HB3  . LYS A 1 9   ? -1.046  8.211   -8.339  1.00 0.00 ? 9   LYS A HB3  1  
ATOM 125   H HG2  . LYS A 1 9   ? -1.083  5.852   -9.544  1.00 0.00 ? 9   LYS A HG2  1  
ATOM 126   H HG3  . LYS A 1 9   ? -1.312  6.870   -10.967 1.00 0.00 ? 9   LYS A HG3  1  
ATOM 127   H HD2  . LYS A 1 9   ? 0.836   7.450   -10.969 1.00 0.00 ? 9   LYS A HD2  1  
ATOM 128   H HD3  . LYS A 1 9   ? 0.755   7.946   -9.277  1.00 0.00 ? 9   LYS A HD3  1  
ATOM 129   H HE2  . LYS A 1 9   ? 0.912   5.457   -8.725  1.00 0.00 ? 9   LYS A HE2  1  
ATOM 130   H HE3  . LYS A 1 9   ? 1.388   5.235   -10.409 1.00 0.00 ? 9   LYS A HE3  1  
ATOM 131   H HZ1  . LYS A 1 9   ? 3.387   6.208   -10.067 1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 132   H HZ2  . LYS A 1 9   ? 3.135   5.659   -8.486  1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 133   H HZ3  . LYS A 1 9   ? 2.815   7.272   -8.884  1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 134   N N    . ALA A 1 10  ? -2.981  5.770   -6.549  1.00 0.00 ? 10  ALA A N    1  
ATOM 135   C CA   . ALA A 1 10  ? -2.780  5.388   -5.162  1.00 0.00 ? 10  ALA A CA   1  
ATOM 136   C C    . ALA A 1 10  ? -1.300  5.169   -4.865  1.00 0.00 ? 10  ALA A C    1  
ATOM 137   O O    . ALA A 1 10  ? -0.798  4.056   -4.971  1.00 0.00 ? 10  ALA A O    1  
ATOM 138   C CB   . ALA A 1 10  ? -3.580  4.138   -4.834  1.00 0.00 ? 10  ALA A CB   1  
ATOM 139   H H    . ALA A 1 10  ? -3.342  5.111   -7.180  1.00 0.00 ? 10  ALA A H    1  
ATOM 140   H HA   . ALA A 1 10  ? -3.144  6.192   -4.543  1.00 0.00 ? 10  ALA A HA   1  
ATOM 141   H HB1  . ALA A 1 10  ? -3.031  3.264   -5.153  1.00 0.00 ? 10  ALA A HB1  1  
ATOM 142   H HB2  . ALA A 1 10  ? -4.530  4.172   -5.349  1.00 0.00 ? 10  ALA A HB2  1  
ATOM 143   H HB3  . ALA A 1 10  ? -3.750  4.088   -3.769  1.00 0.00 ? 10  ALA A HB3  1  
ATOM 144   N N    . ILE A 1 11  ? -0.605  6.242   -4.493  1.00 0.00 ? 11  ILE A N    1  
ATOM 145   C CA   . ILE A 1 11  ? 0.818   6.162   -4.188  1.00 0.00 ? 11  ILE A CA   1  
ATOM 146   C C    . ILE A 1 11  ? 1.081   6.203   -2.686  1.00 0.00 ? 11  ILE A C    1  
ATOM 147   O O    . ILE A 1 11  ? 0.837   7.216   -2.030  1.00 0.00 ? 11  ILE A O    1  
ATOM 148   C CB   . ILE A 1 11  ? 1.601   7.311   -4.855  1.00 0.00 ? 11  ILE A CB   1  
ATOM 149   C CG1  . ILE A 1 11  ? 1.355   7.320   -6.364  1.00 0.00 ? 11  ILE A CG1  1  
ATOM 150   C CG2  . ILE A 1 11  ? 3.089   7.185   -4.556  1.00 0.00 ? 11  ILE A CG2  1  
ATOM 151   C CD1  . ILE A 1 11  ? 1.295   8.711   -6.956  1.00 0.00 ? 11  ILE A CD1  1  
ATOM 152   H H    . ILE A 1 11  ? -1.058  7.109   -4.428  1.00 0.00 ? 11  ILE A H    1  
ATOM 153   H HA   . ILE A 1 11  ? 1.191   5.227   -4.582  1.00 0.00 ? 11  ILE A HA   1  
ATOM 154   H HB   . ILE A 1 11  ? 1.254   8.243   -4.435  1.00 0.00 ? 11  ILE A HB   1  
ATOM 155   H HG12 . ILE A 1 11  ? 2.153   6.784   -6.855  1.00 0.00 ? 11  ILE A HG12 1  
ATOM 156   H HG13 . ILE A 1 11  ? 0.416   6.828   -6.574  1.00 0.00 ? 11  ILE A HG13 1  
ATOM 157   H HG21 . ILE A 1 11  ? 3.271   7.426   -3.521  1.00 0.00 ? 11  ILE A HG21 1  
ATOM 158   H HG22 . ILE A 1 11  ? 3.641   7.865   -5.187  1.00 0.00 ? 11  ILE A HG22 1  
ATOM 159   H HG23 . ILE A 1 11  ? 3.410   6.172   -4.753  1.00 0.00 ? 11  ILE A HG23 1  
ATOM 160   H HD11 . ILE A 1 11  ? 2.145   8.863   -7.605  1.00 0.00 ? 11  ILE A HD11 1  
ATOM 161   H HD12 . ILE A 1 11  ? 1.314   9.443   -6.162  1.00 0.00 ? 11  ILE A HD12 1  
ATOM 162   H HD13 . ILE A 1 11  ? 0.384   8.822   -7.526  1.00 0.00 ? 11  ILE A HD13 1  
ATOM 163   N N    . PHE A 1 12  ? 1.603   5.101   -2.152  1.00 0.00 ? 12  PHE A N    1  
ATOM 164   C CA   . PHE A 1 12  ? 1.930   5.011   -0.734  1.00 0.00 ? 12  PHE A CA   1  
ATOM 165   C C    . PHE A 1 12  ? 3.425   4.772   -0.562  1.00 0.00 ? 12  PHE A C    1  
ATOM 166   O O    . PHE A 1 12  ? 3.927   3.691   -0.876  1.00 0.00 ? 12  PHE A O    1  
ATOM 167   C CB   . PHE A 1 12  ? 1.154   3.870   -0.071  1.00 0.00 ? 12  PHE A CB   1  
ATOM 168   C CG   . PHE A 1 12  ? -0.209  4.259   0.433   1.00 0.00 ? 12  PHE A CG   1  
ATOM 169   C CD1  . PHE A 1 12  ? -1.310  4.218   -0.404  1.00 0.00 ? 12  PHE A CD1  1  
ATOM 170   C CD2  . PHE A 1 12  ? -0.388  4.656   1.751   1.00 0.00 ? 12  PHE A CD2  1  
ATOM 171   C CE1  . PHE A 1 12  ? -2.566  4.565   0.060   1.00 0.00 ? 12  PHE A CE1  1  
ATOM 172   C CE2  . PHE A 1 12  ? -1.640  5.006   2.222   1.00 0.00 ? 12  PHE A CE2  1  
ATOM 173   C CZ   . PHE A 1 12  ? -2.731  4.960   1.373   1.00 0.00 ? 12  PHE A CZ   1  
ATOM 174   H H    . PHE A 1 12  ? 1.789   4.332   -2.731  1.00 0.00 ? 12  PHE A H    1  
ATOM 175   H HA   . PHE A 1 12  ? 1.662   5.947   -0.263  1.00 0.00 ? 12  PHE A HA   1  
ATOM 176   H HB2  . PHE A 1 12  ? 1.025   3.072   -0.785  1.00 0.00 ? 12  PHE A HB2  1  
ATOM 177   H HB3  . PHE A 1 12  ? 1.726   3.505   0.769   1.00 0.00 ? 12  PHE A HB3  1  
ATOM 178   H HD1  . PHE A 1 12  ? -1.183  3.908   -1.431  1.00 0.00 ? 12  PHE A HD1  1  
ATOM 179   H HD2  . PHE A 1 12  ? 0.463   4.691   2.413   1.00 0.00 ? 12  PHE A HD2  1  
ATOM 180   H HE1  . PHE A 1 12  ? -3.417  4.530   -0.605  1.00 0.00 ? 12  PHE A HE1  1  
ATOM 181   H HE2  . PHE A 1 12  ? -1.765  5.315   3.254   1.00 0.00 ? 12  PHE A HE2  1  
ATOM 182   H HZ   . PHE A 1 12  ? -3.712  5.231   1.737   1.00 0.00 ? 12  PHE A HZ   1  
ATOM 183   N N    . THR A 1 13  ? 4.138   5.781   -0.073  1.00 0.00 ? 13  THR A N    1  
ATOM 184   C CA   . THR A 1 13  ? 5.579   5.663   0.125   1.00 0.00 ? 13  THR A CA   1  
ATOM 185   C C    . THR A 1 13  ? 5.912   5.247   1.551   1.00 0.00 ? 13  THR A C    1  
ATOM 186   O O    . THR A 1 13  ? 5.527   5.916   2.508   1.00 0.00 ? 13  THR A O    1  
ATOM 187   C CB   . THR A 1 13  ? 6.306   6.981   -0.196  1.00 0.00 ? 13  THR A CB   1  
ATOM 188   O OG1  . THR A 1 13  ? 5.678   7.632   -1.306  1.00 0.00 ? 13  THR A OG1  1  
ATOM 189   C CG2  . THR A 1 13  ? 7.767   6.718   -0.516  1.00 0.00 ? 13  THR A CG2  1  
ATOM 190   H H    . THR A 1 13  ? 3.686   6.620   0.157   1.00 0.00 ? 13  THR A H    1  
ATOM 191   H HA   . THR A 1 13  ? 5.943   4.904   -0.549  1.00 0.00 ? 13  THR A HA   1  
ATOM 192   H HB   . THR A 1 13  ? 6.252   7.626   0.670   1.00 0.00 ? 13  THR A HB   1  
ATOM 193   H HG1  . THR A 1 13  ? 6.349   7.930   -1.925  1.00 0.00 ? 13  THR A HG1  1  
ATOM 194   H HG21 . THR A 1 13  ? 8.289   7.657   -0.621  1.00 0.00 ? 13  THR A HG21 1  
ATOM 195   H HG22 . THR A 1 13  ? 7.839   6.160   -1.439  1.00 0.00 ? 13  THR A HG22 1  
ATOM 196   H HG23 . THR A 1 13  ? 8.215   6.146   0.284   1.00 0.00 ? 13  THR A HG23 1  
ATOM 197   N N    . VAL A 1 14  ? 6.622   4.129   1.681   1.00 0.00 ? 14  VAL A N    1  
ATOM 198   C CA   . VAL A 1 14  ? 7.007   3.606   2.990   1.00 0.00 ? 14  VAL A CA   1  
ATOM 199   C C    . VAL A 1 14  ? 8.432   3.058   2.967   1.00 0.00 ? 14  VAL A C    1  
ATOM 200   O O    . VAL A 1 14  ? 9.067   3.001   1.916   1.00 0.00 ? 14  VAL A O    1  
ATOM 201   C CB   . VAL A 1 14  ? 6.048   2.483   3.454   1.00 0.00 ? 14  VAL A CB   1  
ATOM 202   C CG1  . VAL A 1 14  ? 4.634   2.746   2.967   1.00 0.00 ? 14  VAL A CG1  1  
ATOM 203   C CG2  . VAL A 1 14  ? 6.525   1.120   2.969   1.00 0.00 ? 14  VAL A CG2  1  
ATOM 204   H H    . VAL A 1 14  ? 6.890   3.639   0.876   1.00 0.00 ? 14  VAL A H    1  
ATOM 205   H HA   . VAL A 1 14  ? 6.953   4.417   3.702   1.00 0.00 ? 14  VAL A HA   1  
ATOM 206   H HB   . VAL A 1 14  ? 6.037   2.473   4.534   1.00 0.00 ? 14  VAL A HB   1  
ATOM 207   H HG11 . VAL A 1 14  ? 4.513   3.800   2.765   1.00 0.00 ? 14  VAL A HG11 1  
ATOM 208   H HG12 . VAL A 1 14  ? 3.930   2.441   3.729   1.00 0.00 ? 14  VAL A HG12 1  
ATOM 209   H HG13 . VAL A 1 14  ? 4.456   2.181   2.064   1.00 0.00 ? 14  VAL A HG13 1  
ATOM 210   H HG21 . VAL A 1 14  ? 6.912   1.208   1.963   1.00 0.00 ? 14  VAL A HG21 1  
ATOM 211   H HG22 . VAL A 1 14  ? 5.697   0.426   2.976   1.00 0.00 ? 14  VAL A HG22 1  
ATOM 212   H HG23 . VAL A 1 14  ? 7.303   0.757   3.623   1.00 0.00 ? 14  VAL A HG23 1  
ATOM 213   N N    . ASP A 1 15  ? 8.915   2.639   4.131   1.00 0.00 ? 15  ASP A N    1  
ATOM 214   C CA   . ASP A 1 15  ? 10.251  2.066   4.252   1.00 0.00 ? 15  ASP A CA   1  
ATOM 215   C C    . ASP A 1 15  ? 10.176  0.556   4.027   1.00 0.00 ? 15  ASP A C    1  
ATOM 216   O O    . ASP A 1 15  ? 9.131   -0.050  4.246   1.00 0.00 ? 15  ASP A O    1  
ATOM 217   C CB   . ASP A 1 15  ? 10.834  2.371   5.635   1.00 0.00 ? 15  ASP A CB   1  
ATOM 218   C CG   . ASP A 1 15  ? 12.049  1.523   5.961   1.00 0.00 ? 15  ASP A CG   1  
ATOM 219   O OD1  . ASP A 1 15  ? 12.912  1.350   5.074   1.00 0.00 ? 15  ASP A OD1  1  
ATOM 220   O OD2  . ASP A 1 15  ? 12.139  1.035   7.105   1.00 0.00 ? 15  ASP A OD2  1  
ATOM 221   H H    . ASP A 1 15  ? 8.352   2.701   4.929   1.00 0.00 ? 15  ASP A H    1  
ATOM 222   H HA   . ASP A 1 15  ? 10.878  2.507   3.492   1.00 0.00 ? 15  ASP A HA   1  
ATOM 223   H HB2  . ASP A 1 15  ? 11.125  3.410   5.673   1.00 0.00 ? 15  ASP A HB2  1  
ATOM 224   H HB3  . ASP A 1 15  ? 10.079  2.185   6.383   1.00 0.00 ? 15  ASP A HB3  1  
ATOM 225   N N    . ALA A 1 16  ? 11.265  -0.050  3.572   1.00 0.00 ? 16  ALA A N    1  
ATOM 226   C CA   . ALA A 1 16  ? 11.268  -1.485  3.313   1.00 0.00 ? 16  ALA A CA   1  
ATOM 227   C C    . ALA A 1 16  ? 11.654  -2.285  4.548   1.00 0.00 ? 16  ALA A C    1  
ATOM 228   O O    . ALA A 1 16  ? 11.298  -3.457  4.666   1.00 0.00 ? 16  ALA A O    1  
ATOM 229   C CB   . ALA A 1 16  ? 12.197  -1.810  2.154   1.00 0.00 ? 16  ALA A CB   1  
ATOM 230   H H    . ALA A 1 16  ? 12.077  0.467   3.393   1.00 0.00 ? 16  ALA A H    1  
ATOM 231   H HA   . ALA A 1 16  ? 10.266  -1.770  3.034   1.00 0.00 ? 16  ALA A HA   1  
ATOM 232   H HB1  . ALA A 1 16  ? 11.831  -2.683  1.634   1.00 0.00 ? 16  ALA A HB1  1  
ATOM 233   H HB2  . ALA A 1 16  ? 13.191  -2.007  2.531   1.00 0.00 ? 16  ALA A HB2  1  
ATOM 234   H HB3  . ALA A 1 16  ? 12.229  -0.972  1.473   1.00 0.00 ? 16  ALA A HB3  1  
ATOM 235   N N    . LYS A 1 17  ? 12.371  -1.658  5.466   1.00 0.00 ? 17  LYS A N    1  
ATOM 236   C CA   . LYS A 1 17  ? 12.778  -2.344  6.682   1.00 0.00 ? 17  LYS A CA   1  
ATOM 237   C C    . LYS A 1 17  ? 11.558  -2.650  7.546   1.00 0.00 ? 17  LYS A C    1  
ATOM 238   O O    . LYS A 1 17  ? 11.204  -3.810  7.755   1.00 0.00 ? 17  LYS A O    1  
ATOM 239   C CB   . LYS A 1 17  ? 13.778  -1.492  7.464   1.00 0.00 ? 17  LYS A CB   1  
ATOM 240   C CG   . LYS A 1 17  ? 14.696  -2.302  8.366   1.00 0.00 ? 17  LYS A CG   1  
ATOM 241   C CD   . LYS A 1 17  ? 14.552  -1.888  9.822   1.00 0.00 ? 17  LYS A CD   1  
ATOM 242   C CE   . LYS A 1 17  ? 13.344  -2.543  10.471  1.00 0.00 ? 17  LYS A CE   1  
ATOM 243   N NZ   . LYS A 1 17  ? 13.486  -4.025  10.538  1.00 0.00 ? 17  LYS A NZ   1  
ATOM 244   H H    . LYS A 1 17  ? 12.627  -0.720  5.327   1.00 0.00 ? 17  LYS A H    1  
ATOM 245   H HA   . LYS A 1 17  ? 13.248  -3.273  6.400   1.00 0.00 ? 17  LYS A HA   1  
ATOM 246   H HB2  . LYS A 1 17  ? 14.390  -0.942  6.765   1.00 0.00 ? 17  LYS A HB2  1  
ATOM 247   H HB3  . LYS A 1 17  ? 13.233  -0.791  8.079   1.00 0.00 ? 17  LYS A HB3  1  
ATOM 248   H HG2  . LYS A 1 17  ? 14.444  -3.347  8.273   1.00 0.00 ? 17  LYS A HG2  1  
ATOM 249   H HG3  . LYS A 1 17  ? 15.719  -2.144  8.056   1.00 0.00 ? 17  LYS A HG3  1  
ATOM 250   H HD2  . LYS A 1 17  ? 15.442  -2.184  10.359  1.00 0.00 ? 17  LYS A HD2  1  
ATOM 251   H HD3  . LYS A 1 17  ? 14.439  -0.815  9.873   1.00 0.00 ? 17  LYS A HD3  1  
ATOM 252   H HE2  . LYS A 1 17  ? 13.235  -2.158  11.473  1.00 0.00 ? 17  LYS A HE2  1  
ATOM 253   H HE3  . LYS A 1 17  ? 12.464  -2.301  9.894   1.00 0.00 ? 17  LYS A HE3  1  
ATOM 254   H HZ1  . LYS A 1 17  ? 14.485  -4.295  10.432  1.00 0.00 ? 17  LYS A HZ1  1  
ATOM 255   H HZ2  . LYS A 1 17  ? 12.936  -4.472  9.776   1.00 0.00 ? 17  LYS A HZ2  1  
ATOM 256   H HZ3  . LYS A 1 17  ? 13.137  -4.378  11.452  1.00 0.00 ? 17  LYS A HZ3  1  
ATOM 257   N N    . THR A 1 18  ? 10.943  -1.595  8.071   1.00 0.00 ? 18  THR A N    1  
ATOM 258   C CA   . THR A 1 18  ? 9.786   -1.765  8.944   1.00 0.00 ? 18  THR A CA   1  
ATOM 259   C C    . THR A 1 18  ? 8.482   -1.253  8.346   1.00 0.00 ? 18  THR A C    1  
ATOM 260   O O    . THR A 1 18  ? 7.438   -1.332  8.995   1.00 0.00 ? 18  THR A O    1  
ATOM 261   C CB   . THR A 1 18  ? 10.010  -1.109  10.319  1.00 0.00 ? 18  THR A CB   1  
ATOM 262   O OG1  . THR A 1 18  ? 8.917   -1.418  11.192  1.00 0.00 ? 18  THR A OG1  1  
ATOM 263   C CG2  . THR A 1 18  ? 10.150  0.400   10.187  1.00 0.00 ? 18  THR A CG2  1  
ATOM 264   H H    . THR A 1 18  ? 11.322  -0.712  7.887   1.00 0.00 ? 18  THR A H    1  
ATOM 265   H HA   . THR A 1 18  ? 9.677   -2.820  9.093   1.00 0.00 ? 18  THR A HA   1  
ATOM 266   H HB   . THR A 1 18  ? 10.922  -1.504  10.745  1.00 0.00 ? 18  THR A HB   1  
ATOM 267   H HG1  . THR A 1 18  ? 8.907   -0.796  11.924  1.00 0.00 ? 18  THR A HG1  1  
ATOM 268   H HG21 . THR A 1 18  ? 9.317   0.790   9.621   1.00 0.00 ? 18  THR A HG21 1  
ATOM 269   H HG22 . THR A 1 18  ? 11.073  0.633   9.676   1.00 0.00 ? 18  THR A HG22 1  
ATOM 270   H HG23 . THR A 1 18  ? 10.158  0.848   11.169  1.00 0.00 ? 18  THR A HG23 1  
ATOM 271   N N    . THR A 1 19  ? 8.546   -0.713  7.136   1.00 0.00 ? 19  THR A N    1  
ATOM 272   C CA   . THR A 1 19  ? 7.363   -0.168  6.466   1.00 0.00 ? 19  THR A CA   1  
ATOM 273   C C    . THR A 1 19  ? 7.077   1.247   6.962   1.00 0.00 ? 19  THR A C    1  
ATOM 274   O O    . THR A 1 19  ? 7.835   2.168   6.664   1.00 0.00 ? 19  THR A O    1  
ATOM 275   C CB   . THR A 1 19  ? 6.113   -1.060  6.655   1.00 0.00 ? 19  THR A CB   1  
ATOM 276   O OG1  . THR A 1 19  ? 6.494   -2.441  6.700   1.00 0.00 ? 19  THR A OG1  1  
ATOM 277   C CG2  . THR A 1 19  ? 5.113   -0.848  5.529   1.00 0.00 ? 19  THR A CG2  1  
ATOM 278   H H    . THR A 1 19  ? 9.415   -0.645  6.693   1.00 0.00 ? 19  THR A H    1  
ATOM 279   H HA   . THR A 1 19  ? 7.582   -0.120  5.409   1.00 0.00 ? 19  THR A HA   1  
ATOM 280   H HB   . THR A 1 19  ? 5.639   -0.797  7.589   1.00 0.00 ? 19  THR A HB   1  
ATOM 281   H HG1  . THR A 1 19  ? 6.162   -2.839  7.504   1.00 0.00 ? 19  THR A HG1  1  
ATOM 282   H HG21 . THR A 1 19  ? 4.625   0.107   5.655   1.00 0.00 ? 19  THR A HG21 1  
ATOM 283   H HG22 . THR A 1 19  ? 4.372   -1.636  5.551   1.00 0.00 ? 19  THR A HG22 1  
ATOM 284   H HG23 . THR A 1 19  ? 5.628   -0.866  4.581   1.00 0.00 ? 19  THR A HG23 1  
ATOM 285   N N    . GLU A 1 20  ? 5.996   1.424   7.723   1.00 0.00 ? 20  GLU A N    1  
ATOM 286   C CA   . GLU A 1 20  ? 5.641   2.743   8.244   1.00 0.00 ? 20  GLU A CA   1  
ATOM 287   C C    . GLU A 1 20  ? 5.533   3.751   7.104   1.00 0.00 ? 20  GLU A C    1  
ATOM 288   O O    . GLU A 1 20  ? 6.535   4.313   6.660   1.00 0.00 ? 20  GLU A O    1  
ATOM 289   C CB   . GLU A 1 20  ? 6.681   3.212   9.265   1.00 0.00 ? 20  GLU A CB   1  
ATOM 290   C CG   . GLU A 1 20  ? 6.104   4.094   10.361  1.00 0.00 ? 20  GLU A CG   1  
ATOM 291   C CD   . GLU A 1 20  ? 6.526   5.544   10.221  1.00 0.00 ? 20  GLU A CD   1  
ATOM 292   O OE1  . GLU A 1 20  ? 6.293   6.129   9.144   1.00 0.00 ? 20  GLU A OE1  1  
ATOM 293   O OE2  . GLU A 1 20  ? 7.090   6.093   11.192  1.00 0.00 ? 20  GLU A OE2  1  
ATOM 294   H H    . GLU A 1 20  ? 5.425   0.657   7.938   1.00 0.00 ? 20  GLU A H    1  
ATOM 295   H HA   . GLU A 1 20  ? 4.680   2.662   8.730   1.00 0.00 ? 20  GLU A HA   1  
ATOM 296   H HB2  . GLU A 1 20  ? 7.129   2.346   9.729   1.00 0.00 ? 20  GLU A HB2  1  
ATOM 297   H HB3  . GLU A 1 20  ? 7.447   3.771   8.748   1.00 0.00 ? 20  GLU A HB3  1  
ATOM 298   H HG2  . GLU A 1 20  ? 5.026   4.044   10.315  1.00 0.00 ? 20  GLU A HG2  1  
ATOM 299   H HG3  . GLU A 1 20  ? 6.441   3.725   11.317  1.00 0.00 ? 20  GLU A HG3  1  
ATOM 300   N N    . ILE A 1 21  ? 4.314   3.960   6.621   1.00 0.00 ? 21  ILE A N    1  
ATOM 301   C CA   . ILE A 1 21  ? 4.077   4.878   5.511   1.00 0.00 ? 21  ILE A CA   1  
ATOM 302   C C    . ILE A 1 21  ? 4.634   6.268   5.786   1.00 0.00 ? 21  ILE A C    1  
ATOM 303   O O    . ILE A 1 21  ? 4.121   6.998   6.636   1.00 0.00 ? 21  ILE A O    1  
ATOM 304   C CB   . ILE A 1 21  ? 2.580   5.020   5.181   1.00 0.00 ? 21  ILE A CB   1  
ATOM 305   C CG1  . ILE A 1 21  ? 1.811   3.752   5.558   1.00 0.00 ? 21  ILE A CG1  1  
ATOM 306   C CG2  . ILE A 1 21  ? 2.401   5.329   3.704   1.00 0.00 ? 21  ILE A CG2  1  
ATOM 307   C CD1  . ILE A 1 21  ? 0.536   4.029   6.324   1.00 0.00 ? 21  ILE A CD1  1  
ATOM 308   H H    . ILE A 1 21  ? 3.560   3.469   7.005   1.00 0.00 ? 21  ILE A H    1  
ATOM 309   H HA   . ILE A 1 21  ? 4.573   4.476   4.641   1.00 0.00 ? 21  ILE A HA   1  
ATOM 310   H HB   . ILE A 1 21  ? 2.186   5.854   5.749   1.00 0.00 ? 21  ILE A HB   1  
ATOM 311   H HG12 . ILE A 1 21  ? 1.548   3.218   4.658   1.00 0.00 ? 21  ILE A HG12 1  
ATOM 312   H HG13 . ILE A 1 21  ? 2.439   3.127   6.174   1.00 0.00 ? 21  ILE A HG13 1  
ATOM 313   H HG21 . ILE A 1 21  ? 3.151   4.801   3.133   1.00 0.00 ? 21  ILE A HG21 1  
ATOM 314   H HG22 . ILE A 1 21  ? 2.507   6.392   3.543   1.00 0.00 ? 21  ILE A HG22 1  
ATOM 315   H HG23 . ILE A 1 21  ? 1.419   5.014   3.387   1.00 0.00 ? 21  ILE A HG23 1  
ATOM 316   H HD11 . ILE A 1 21  ? -0.170  4.530   5.676   1.00 0.00 ? 21  ILE A HD11 1  
ATOM 317   H HD12 . ILE A 1 21  ? 0.755   4.659   7.172   1.00 0.00 ? 21  ILE A HD12 1  
ATOM 318   H HD13 . ILE A 1 21  ? 0.111   3.097   6.666   1.00 0.00 ? 21  ILE A HD13 1  
ATOM 319   N N    . LEU A 1 22  ? 5.668   6.636   5.039   1.00 0.00 ? 22  LEU A N    1  
ATOM 320   C CA   . LEU A 1 22  ? 6.276   7.949   5.177   1.00 0.00 ? 22  LEU A CA   1  
ATOM 321   C C    . LEU A 1 22  ? 5.231   9.022   4.888   1.00 0.00 ? 22  LEU A C    1  
ATOM 322   O O    . LEU A 1 22  ? 4.868   9.799   5.769   1.00 0.00 ? 22  LEU A O    1  
ATOM 323   C CB   . LEU A 1 22  ? 7.473   8.100   4.231   1.00 0.00 ? 22  LEU A CB   1  
ATOM 324   C CG   . LEU A 1 22  ? 8.269   6.818   3.969   1.00 0.00 ? 22  LEU A CG   1  
ATOM 325   C CD1  . LEU A 1 22  ? 9.353   7.067   2.934   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 326   C CD2  . LEU A 1 22  ? 8.876   6.291   5.261   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 327   H H    . LEU A 1 22  ? 6.016   6.011   4.369   1.00 0.00 ? 22  LEU A H    1  
ATOM 328   H HA   . LEU A 1 22  ? 6.612   8.054   6.199   1.00 0.00 ? 22  LEU A HA   1  
ATOM 329   H HB2  . LEU A 1 22  ? 7.112   8.471   3.283   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 330   H HB3  . LEU A 1 22  ? 8.148   8.831   4.652   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 331   H HG   . LEU A 1 22  ? 7.603   6.062   3.578   1.00 0.00 ? 22  LEU A HG   1  
ATOM 332   H HD11 . LEU A 1 22  ? 9.984   6.194   2.854   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 333   H HD12 . LEU A 1 22  ? 9.950   7.917   3.234   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 334   H HD13 . LEU A 1 22  ? 8.898   7.272   1.975   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 335   H HD21 . LEU A 1 22  ? 9.151   5.254   5.133   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 336   H HD22 . LEU A 1 22  ? 8.154   6.377   6.060   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 337   H HD23 . LEU A 1 22  ? 9.754   6.869   5.507   1.00 0.00 ? 22  LEU A HD23 1  
ATOM 338   N N    . VAL A 1 23  ? 4.740   9.051   3.647   1.00 0.00 ? 23  VAL A N    1  
ATOM 339   C CA   . VAL A 1 23  ? 3.724   10.011  3.242   1.00 0.00 ? 23  VAL A CA   1  
ATOM 340   C C    . VAL A 1 23  ? 2.857   9.442   2.121   1.00 0.00 ? 23  VAL A C    1  
ATOM 341   O O    . VAL A 1 23  ? 3.217   8.452   1.484   1.00 0.00 ? 23  VAL A O    1  
ATOM 342   C CB   . VAL A 1 23  ? 4.340   11.341  2.754   1.00 0.00 ? 23  VAL A CB   1  
ATOM 343   C CG1  . VAL A 1 23  ? 5.523   11.759  3.615   1.00 0.00 ? 23  VAL A CG1  1  
ATOM 344   C CG2  . VAL A 1 23  ? 4.744   11.253  1.287   1.00 0.00 ? 23  VAL A CG2  1  
ATOM 345   H H    . VAL A 1 23  ? 5.059   8.404   2.992   1.00 0.00 ? 23  VAL A H    1  
ATOM 346   H HA   . VAL A 1 23  ? 3.101   10.219  4.101   1.00 0.00 ? 23  VAL A HA   1  
ATOM 347   H HB   . VAL A 1 23  ? 3.586   12.098  2.844   1.00 0.00 ? 23  VAL A HB   1  
ATOM 348   H HG11 . VAL A 1 23  ? 5.217   11.799  4.650   1.00 0.00 ? 23  VAL A HG11 1  
ATOM 349   H HG12 . VAL A 1 23  ? 5.868   12.733  3.303   1.00 0.00 ? 23  VAL A HG12 1  
ATOM 350   H HG13 . VAL A 1 23  ? 6.320   11.039  3.503   1.00 0.00 ? 23  VAL A HG13 1  
ATOM 351   H HG21 . VAL A 1 23  ? 5.457   12.034  1.063   1.00 0.00 ? 23  VAL A HG21 1  
ATOM 352   H HG22 . VAL A 1 23  ? 3.867   11.377  0.665   1.00 0.00 ? 23  VAL A HG22 1  
ATOM 353   H HG23 . VAL A 1 23  ? 5.191   10.289  1.094   1.00 0.00 ? 23  VAL A HG23 1  
ATOM 354   N N    . ALA A 1 24  ? 1.727   10.093  1.872   1.00 0.00 ? 24  ALA A N    1  
ATOM 355   C CA   . ALA A 1 24  ? 0.818   9.679   0.810   1.00 0.00 ? 24  ALA A CA   1  
ATOM 356   C C    . ALA A 1 24  ? 0.292   10.904  0.073   1.00 0.00 ? 24  ALA A C    1  
ATOM 357   O O    . ALA A 1 24  ? 0.188   11.986  0.651   1.00 0.00 ? 24  ALA A O    1  
ATOM 358   C CB   . ALA A 1 24  ? -0.331  8.852   1.361   1.00 0.00 ? 24  ALA A CB   1  
ATOM 359   H H    . ALA A 1 24  ? 1.508   10.886  2.402   1.00 0.00 ? 24  ALA A H    1  
ATOM 360   H HA   . ALA A 1 24  ? 1.376   9.065   0.116   1.00 0.00 ? 24  ALA A HA   1  
ATOM 361   H HB1  . ALA A 1 24  ? -0.064  7.805   1.337   1.00 0.00 ? 24  ALA A HB1  1  
ATOM 362   H HB2  . ALA A 1 24  ? -1.215  9.011   0.758   1.00 0.00 ? 24  ALA A HB2  1  
ATOM 363   H HB3  . ALA A 1 24  ? -0.534  9.147   2.380   1.00 0.00 ? 24  ALA A HB3  1  
ATOM 364   N N    . ASN A 1 25  ? -0.006  10.744  -1.207  1.00 0.00 ? 25  ASN A N    1  
ATOM 365   C CA   . ASN A 1 25  ? -0.480  11.859  -2.012  1.00 0.00 ? 25  ASN A CA   1  
ATOM 366   C C    . ASN A 1 25  ? -1.999  12.031  -1.947  1.00 0.00 ? 25  ASN A C    1  
ATOM 367   O O    . ASN A 1 25  ? -2.712  11.227  -1.347  1.00 0.00 ? 25  ASN A O    1  
ATOM 368   C CB   . ASN A 1 25  ? -0.035  11.695  -3.467  1.00 0.00 ? 25  ASN A CB   1  
ATOM 369   C CG   . ASN A 1 25  ? -0.525  10.399  -4.084  1.00 0.00 ? 25  ASN A CG   1  
ATOM 370   O OD1  . ASN A 1 25  ? -0.521  9.348   -3.442  1.00 0.00 ? 25  ASN A OD1  1  
ATOM 371   N ND2  . ASN A 1 25  ? -0.946  10.467  -5.340  1.00 0.00 ? 25  ASN A ND2  1  
ATOM 372   H H    . ASN A 1 25  ? 0.121   9.867   -1.625  1.00 0.00 ? 25  ASN A H    1  
ATOM 373   H HA   . ASN A 1 25  ? -0.024  12.753  -1.612  1.00 0.00 ? 25  ASN A HA   1  
ATOM 374   H HB2  . ASN A 1 25  ? -0.421  12.516  -4.050  1.00 0.00 ? 25  ASN A HB2  1  
ATOM 375   H HB3  . ASN A 1 25  ? 1.045   11.707  -3.507  1.00 0.00 ? 25  ASN A HB3  1  
ATOM 376   H HD21 . ASN A 1 25  ? -0.919  11.337  -5.791  1.00 0.00 ? 25  ASN A HD21 1  
ATOM 377   H HD22 . ASN A 1 25  ? -1.266  9.646   -5.767  1.00 0.00 ? 25  ASN A HD22 1  
ATOM 378   N N    . ASP A 1 26  ? -2.464  13.110  -2.572  1.00 0.00 ? 26  ASP A N    1  
ATOM 379   C CA   . ASP A 1 26  ? -3.884  13.456  -2.609  1.00 0.00 ? 26  ASP A CA   1  
ATOM 380   C C    . ASP A 1 26  ? -4.689  12.478  -3.456  1.00 0.00 ? 26  ASP A C    1  
ATOM 381   O O    . ASP A 1 26  ? -5.918  12.549  -3.490  1.00 0.00 ? 26  ASP A O    1  
ATOM 382   C CB   . ASP A 1 26  ? -4.070  14.879  -3.135  1.00 0.00 ? 26  ASP A CB   1  
ATOM 383   C CG   . ASP A 1 26  ? -3.470  15.920  -2.210  1.00 0.00 ? 26  ASP A CG   1  
ATOM 384   O OD1  . ASP A 1 26  ? -4.146  16.306  -1.232  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 385   O OD2  . ASP A 1 26  ? -2.324  16.348  -2.459  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 386   H H    . ASP A 1 26  ? -1.816  13.698  -3.012  1.00 0.00 ? 26  ASP A H    1  
ATOM 387   H HA   . ASP A 1 26  ? -4.259  13.407  -1.598  1.00 0.00 ? 26  ASP A HA   1  
ATOM 388   H HB2  . ASP A 1 26  ? -3.592  14.965  -4.100  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 389   H HB3  . ASP A 1 26  ? -5.125  15.083  -3.241  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 390   N N    . LYS A 1 27  ? -4.009  11.549  -4.113  1.00 0.00 ? 27  LYS A N    1  
ATOM 391   C CA   . LYS A 1 27  ? -4.691  10.549  -4.920  1.00 0.00 ? 27  LYS A CA   1  
ATOM 392   C C    . LYS A 1 27  ? -4.906  9.294   -4.084  1.00 0.00 ? 27  LYS A C    1  
ATOM 393   O O    . LYS A 1 27  ? -6.040  8.921   -3.788  1.00 0.00 ? 27  LYS A O    1  
ATOM 394   C CB   . LYS A 1 27  ? -3.888  10.233  -6.182  1.00 0.00 ? 27  LYS A CB   1  
ATOM 395   C CG   . LYS A 1 27  ? -3.493  11.468  -6.978  1.00 0.00 ? 27  LYS A CG   1  
ATOM 396   C CD   . LYS A 1 27  ? -4.511  11.783  -8.062  1.00 0.00 ? 27  LYS A CD   1  
ATOM 397   C CE   . LYS A 1 27  ? -5.696  12.559  -7.507  1.00 0.00 ? 27  LYS A CE   1  
ATOM 398   N NZ   . LYS A 1 27  ? -5.557  14.024  -7.739  1.00 0.00 ? 27  LYS A NZ   1  
ATOM 399   H H    . LYS A 1 27  ? -3.035  11.501  -4.023  1.00 0.00 ? 27  LYS A H    1  
ATOM 400   H HA   . LYS A 1 27  ? -5.653  10.951  -5.200  1.00 0.00 ? 27  LYS A HA   1  
ATOM 401   H HB2  . LYS A 1 27  ? -2.988  9.710   -5.902  1.00 0.00 ? 27  LYS A HB2  1  
ATOM 402   H HB3  . LYS A 1 27  ? -4.483  9.596   -6.822  1.00 0.00 ? 27  LYS A HB3  1  
ATOM 403   H HG2  . LYS A 1 27  ? -3.425  12.311  -6.306  1.00 0.00 ? 27  LYS A HG2  1  
ATOM 404   H HG3  . LYS A 1 27  ? -2.532  11.294  -7.439  1.00 0.00 ? 27  LYS A HG3  1  
ATOM 405   H HD2  . LYS A 1 27  ? -4.034  12.375  -8.829  1.00 0.00 ? 27  LYS A HD2  1  
ATOM 406   H HD3  . LYS A 1 27  ? -4.866  10.856  -8.488  1.00 0.00 ? 27  LYS A HD3  1  
ATOM 407   H HE2  . LYS A 1 27  ? -6.595  12.211  -7.990  1.00 0.00 ? 27  LYS A HE2  1  
ATOM 408   H HE3  . LYS A 1 27  ? -5.764  12.375  -6.445  1.00 0.00 ? 27  LYS A HE3  1  
ATOM 409   H HZ1  . LYS A 1 27  ? -4.785  14.208  -8.409  1.00 0.00 ? 27  LYS A HZ1  1  
ATOM 410   H HZ2  . LYS A 1 27  ? -5.348  14.510  -6.845  1.00 0.00 ? 27  LYS A HZ2  1  
ATOM 411   H HZ3  . LYS A 1 27  ? -6.443  14.408  -8.130  1.00 0.00 ? 27  LYS A HZ3  1  
ATOM 412   N N    . ALA A 1 28  ? -3.802  8.663   -3.683  1.00 0.00 ? 28  ALA A N    1  
ATOM 413   C CA   . ALA A 1 28  ? -3.859  7.467   -2.848  1.00 0.00 ? 28  ALA A CA   1  
ATOM 414   C C    . ALA A 1 28  ? -4.796  7.676   -1.667  1.00 0.00 ? 28  ALA A C    1  
ATOM 415   O O    . ALA A 1 28  ? -5.683  6.862   -1.407  1.00 0.00 ? 28  ALA A O    1  
ATOM 416   C CB   . ALA A 1 28  ? -2.470  7.112   -2.343  1.00 0.00 ? 28  ALA A CB   1  
ATOM 417   H H    . ALA A 1 28  ? -2.925  9.022   -3.944  1.00 0.00 ? 28  ALA A H    1  
ATOM 418   H HA   . ALA A 1 28  ? -4.222  6.647   -3.449  1.00 0.00 ? 28  ALA A HA   1  
ATOM 419   H HB1  . ALA A 1 28  ? -2.327  6.044   -2.401  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 420   H HB2  . ALA A 1 28  ? -2.370  7.435   -1.316  1.00 0.00 ? 28  ALA A HB2  1  
ATOM 421   H HB3  . ALA A 1 28  ? -1.729  7.610   -2.950  1.00 0.00 ? 28  ALA A HB3  1  
ATOM 422   N N    . CYS A 1 29  ? -4.591  8.780   -0.957  1.00 0.00 ? 29  CYS A N    1  
ATOM 423   C CA   . CYS A 1 29  ? -5.417  9.114   0.191   1.00 0.00 ? 29  CYS A CA   1  
ATOM 424   C C    . CYS A 1 29  ? -6.884  9.126   -0.207  1.00 0.00 ? 29  CYS A C    1  
ATOM 425   O O    . CYS A 1 29  ? -7.742  8.628   0.520   1.00 0.00 ? 29  CYS A O    1  
ATOM 426   C CB   . CYS A 1 29  ? -4.998  10.472  0.755   1.00 0.00 ? 29  CYS A CB   1  
ATOM 427   S SG   . CYS A 1 29  ? -6.104  11.838  0.322   1.00 0.00 ? 29  CYS A SG   1  
ATOM 428   H H    . CYS A 1 29  ? -3.870  9.387   -1.220  1.00 0.00 ? 29  CYS A H    1  
ATOM 429   H HA   . CYS A 1 29  ? -5.268  8.353   0.945   1.00 0.00 ? 29  CYS A HA   1  
ATOM 430   H HB2  . CYS A 1 29  ? -4.962  10.411  1.831   1.00 0.00 ? 29  CYS A HB2  1  
ATOM 431   H HB3  . CYS A 1 29  ? -4.016  10.716  0.381   1.00 0.00 ? 29  CYS A HB3  1  
ATOM 432   H HG   . CYS A 1 29  ? -6.948  12.014  1.327   1.00 0.00 ? 29  CYS A HG   1  
ATOM 433   N N    . GLY A 1 30  ? -7.160  9.684   -1.382  1.00 0.00 ? 30  GLY A N    1  
ATOM 434   C CA   . GLY A 1 30  ? -8.523  9.733   -1.875  1.00 0.00 ? 30  GLY A CA   1  
ATOM 435   C C    . GLY A 1 30  ? -9.106  8.342   -2.019  1.00 0.00 ? 30  GLY A C    1  
ATOM 436   O O    . GLY A 1 30  ? -10.282 8.116   -1.728  1.00 0.00 ? 30  GLY A O    1  
ATOM 437   H H    . GLY A 1 30  ? -6.425  10.054  -1.921  1.00 0.00 ? 30  GLY A H    1  
ATOM 438   H HA2  . GLY A 1 30  ? -9.128  10.299  -1.181  1.00 0.00 ? 30  GLY A HA2  1  
ATOM 439   H HA3  . GLY A 1 30  ? -8.534  10.221  -2.836  1.00 0.00 ? 30  GLY A HA3  1  
ATOM 440   N N    . LEU A 1 31  ? -8.267  7.409   -2.463  1.00 0.00 ? 31  LEU A N    1  
ATOM 441   C CA   . LEU A 1 31  ? -8.675  6.021   -2.646  1.00 0.00 ? 31  LEU A CA   1  
ATOM 442   C C    . LEU A 1 31  ? -9.356  5.498   -1.377  1.00 0.00 ? 31  LEU A C    1  
ATOM 443   O O    . LEU A 1 31  ? -10.500 5.048   -1.423  1.00 0.00 ? 31  LEU A O    1  
ATOM 444   C CB   . LEU A 1 31  ? -7.454  5.167   -3.029  1.00 0.00 ? 31  LEU A CB   1  
ATOM 445   C CG   . LEU A 1 31  ? -7.634  3.639   -3.021  1.00 0.00 ? 31  LEU A CG   1  
ATOM 446   C CD1  . LEU A 1 31  ? -7.245  3.078   -1.663  1.00 0.00 ? 31  LEU A CD1  1  
ATOM 447   C CD2  . LEU A 1 31  ? -9.058  3.237   -3.391  1.00 0.00 ? 31  LEU A CD2  1  
ATOM 448   H H    . LEU A 1 31  ? -7.345  7.670   -2.670  1.00 0.00 ? 31  LEU A H    1  
ATOM 449   H HA   . LEU A 1 31  ? -9.390  5.993   -3.455  1.00 0.00 ? 31  LEU A HA   1  
ATOM 450   H HB2  . LEU A 1 31  ? -7.146  5.456   -4.023  1.00 0.00 ? 31  LEU A HB2  1  
ATOM 451   H HB3  . LEU A 1 31  ? -6.654  5.409   -2.346  1.00 0.00 ? 31  LEU A HB3  1  
ATOM 452   H HG   . LEU A 1 31  ? -6.968  3.208   -3.755  1.00 0.00 ? 31  LEU A HG   1  
ATOM 453   H HD11 . LEU A 1 31  ? -7.499  3.792   -0.893  1.00 0.00 ? 31  LEU A HD11 1  
ATOM 454   H HD12 . LEU A 1 31  ? -6.179  2.896   -1.646  1.00 0.00 ? 31  LEU A HD12 1  
ATOM 455   H HD13 . LEU A 1 31  ? -7.773  2.153   -1.488  1.00 0.00 ? 31  LEU A HD13 1  
ATOM 456   H HD21 . LEU A 1 31  ? -9.632  3.074   -2.491  1.00 0.00 ? 31  LEU A HD21 1  
ATOM 457   H HD22 . LEU A 1 31  ? -9.033  2.328   -3.973  1.00 0.00 ? 31  LEU A HD22 1  
ATOM 458   H HD23 . LEU A 1 31  ? -9.516  4.024   -3.972  1.00 0.00 ? 31  LEU A HD23 1  
ATOM 459   N N    . LEU A 1 32  ? -8.661  5.580   -0.242  1.00 0.00 ? 32  LEU A N    1  
ATOM 460   C CA   . LEU A 1 32  ? -9.247  5.127   1.021   1.00 0.00 ? 32  LEU A CA   1  
ATOM 461   C C    . LEU A 1 32  ? -9.955  6.274   1.731   1.00 0.00 ? 32  LEU A C    1  
ATOM 462   O O    . LEU A 1 32  ? -11.185 6.327   1.772   1.00 0.00 ? 32  LEU A O    1  
ATOM 463   C CB   . LEU A 1 32  ? -8.212  4.508   1.967   1.00 0.00 ? 32  LEU A CB   1  
ATOM 464   C CG   . LEU A 1 32  ? -6.752  4.542   1.513   1.00 0.00 ? 32  LEU A CG   1  
ATOM 465   C CD1  . LEU A 1 32  ? -6.206  5.961   1.560   1.00 0.00 ? 32  LEU A CD1  1  
ATOM 466   C CD2  . LEU A 1 32  ? -5.928  3.622   2.400   1.00 0.00 ? 32  LEU A CD2  1  
ATOM 467   H H    . LEU A 1 32  ? -7.756  5.966   -0.265  1.00 0.00 ? 32  LEU A H    1  
ATOM 468   H HA   . LEU A 1 32  ? -9.984  4.375   0.778   1.00 0.00 ? 32  LEU A HA   1  
ATOM 469   H HB2  . LEU A 1 32  ? -8.277  5.021   2.913   1.00 0.00 ? 32  LEU A HB2  1  
ATOM 470   H HB3  . LEU A 1 32  ? -8.485  3.474   2.123   1.00 0.00 ? 32  LEU A HB3  1  
ATOM 471   H HG   . LEU A 1 32  ? -6.682  4.185   0.498   1.00 0.00 ? 32  LEU A HG   1  
ATOM 472   H HD11 . LEU A 1 32  ? -6.079  6.265   2.588   1.00 0.00 ? 32  LEU A HD11 1  
ATOM 473   H HD12 . LEU A 1 32  ? -6.899  6.630   1.069   1.00 0.00 ? 32  LEU A HD12 1  
ATOM 474   H HD13 . LEU A 1 32  ? -5.253  5.998   1.053   1.00 0.00 ? 32  LEU A HD13 1  
ATOM 475   H HD21 . LEU A 1 32  ? -5.574  2.784   1.821   1.00 0.00 ? 32  LEU A HD21 1  
ATOM 476   H HD22 . LEU A 1 32  ? -6.548  3.262   3.215   1.00 0.00 ? 32  LEU A HD22 1  
ATOM 477   H HD23 . LEU A 1 32  ? -5.087  4.167   2.802   1.00 0.00 ? 32  LEU A HD23 1  
ATOM 478   N N    . GLY A 1 33  ? -9.172  7.189   2.295   1.00 0.00 ? 33  GLY A N    1  
ATOM 479   C CA   . GLY A 1 33  ? -9.740  8.322   3.000   1.00 0.00 ? 33  GLY A CA   1  
ATOM 480   C C    . GLY A 1 33  ? -8.768  8.916   3.998   1.00 0.00 ? 33  GLY A C    1  
ATOM 481   O O    . GLY A 1 33  ? -9.173  9.541   4.979   1.00 0.00 ? 33  GLY A O    1  
ATOM 482   H H    . GLY A 1 33  ? -8.197  7.092   2.231   1.00 0.00 ? 33  GLY A H    1  
ATOM 483   H HA2  . GLY A 1 33  ? -10.013 9.082   2.283   1.00 0.00 ? 33  GLY A HA2  1  
ATOM 484   H HA3  . GLY A 1 33  ? -10.627 7.999   3.524   1.00 0.00 ? 33  GLY A HA3  1  
ATOM 485   N N    . TYR A 1 34  ? -7.481  8.713   3.744   1.00 0.00 ? 34  TYR A N    1  
ATOM 486   C CA   . TYR A 1 34  ? -6.432  9.222   4.617   1.00 0.00 ? 34  TYR A CA   1  
ATOM 487   C C    . TYR A 1 34  ? -5.703  10.389  3.954   1.00 0.00 ? 34  TYR A C    1  
ATOM 488   O O    . TYR A 1 34  ? -6.316  11.201  3.261   1.00 0.00 ? 34  TYR A O    1  
ATOM 489   C CB   . TYR A 1 34  ? -5.428  8.110   4.939   1.00 0.00 ? 34  TYR A CB   1  
ATOM 490   C CG   . TYR A 1 34  ? -5.991  6.968   5.753   1.00 0.00 ? 34  TYR A CG   1  
ATOM 491   C CD1  . TYR A 1 34  ? -6.983  6.143   5.238   1.00 0.00 ? 34  TYR A CD1  1  
ATOM 492   C CD2  . TYR A 1 34  ? -5.522  6.712   7.033   1.00 0.00 ? 34  TYR A CD2  1  
ATOM 493   C CE1  . TYR A 1 34  ? -7.492  5.098   5.980   1.00 0.00 ? 34  TYR A CE1  1  
ATOM 494   C CE2  . TYR A 1 34  ? -6.026  5.664   7.781   1.00 0.00 ? 34  TYR A CE2  1  
ATOM 495   C CZ   . TYR A 1 34  ? -7.011  4.862   7.250   1.00 0.00 ? 34  TYR A CZ   1  
ATOM 496   O OH   . TYR A 1 34  ? -7.517  3.817   7.991   1.00 0.00 ? 34  TYR A OH   1  
ATOM 497   H H    . TYR A 1 34  ? -7.229  8.204   2.945   1.00 0.00 ? 34  TYR A H    1  
ATOM 498   H HA   . TYR A 1 34  ? -6.891  9.565   5.532   1.00 0.00 ? 34  TYR A HA   1  
ATOM 499   H HB2  . TYR A 1 34  ? -5.057  7.697   4.014   1.00 0.00 ? 34  TYR A HB2  1  
ATOM 500   H HB3  . TYR A 1 34  ? -4.603  8.533   5.491   1.00 0.00 ? 34  TYR A HB3  1  
ATOM 501   H HD1  . TYR A 1 34  ? -7.359  6.330   4.243   1.00 0.00 ? 34  TYR A HD1  1  
ATOM 502   H HD2  . TYR A 1 34  ? -4.747  7.343   7.443   1.00 0.00 ? 34  TYR A HD2  1  
ATOM 503   H HE1  . TYR A 1 34  ? -8.265  4.467   5.563   1.00 0.00 ? 34  TYR A HE1  1  
ATOM 504   H HE2  . TYR A 1 34  ? -5.647  5.482   8.775   1.00 0.00 ? 34  TYR A HE2  1  
ATOM 505   H HH   . TYR A 1 34  ? -7.887  4.155   8.809   1.00 0.00 ? 34  TYR A HH   1  
ATOM 506   N N    . SER A 1 35  ? -4.386  10.443  4.165   1.00 0.00 ? 35  SER A N    1  
ATOM 507   C CA   . SER A 1 35  ? -3.526  11.476  3.591   1.00 0.00 ? 35  SER A CA   1  
ATOM 508   C C    . SER A 1 35  ? -2.142  11.396  4.215   1.00 0.00 ? 35  SER A C    1  
ATOM 509   O O    . SER A 1 35  ? -1.948  10.708  5.214   1.00 0.00 ? 35  SER A O    1  
ATOM 510   C CB   . SER A 1 35  ? -4.104  12.873  3.787   1.00 0.00 ? 35  SER A CB   1  
ATOM 511   O OG   . SER A 1 35  ? -4.298  13.165  5.159   1.00 0.00 ? 35  SER A OG   1  
ATOM 512   H H    . SER A 1 35  ? -3.972  9.753   4.721   1.00 0.00 ? 35  SER A H    1  
ATOM 513   H HA   . SER A 1 35  ? -3.442  11.282  2.534   1.00 0.00 ? 35  SER A HA   1  
ATOM 514   H HB2  . SER A 1 35  ? -3.423  13.600  3.367   1.00 0.00 ? 35  SER A HB2  1  
ATOM 515   H HB3  . SER A 1 35  ? -5.052  12.932  3.276   1.00 0.00 ? 35  SER A HB3  1  
ATOM 516   H HG   . SER A 1 35  ? -5.223  13.363  5.317   1.00 0.00 ? 35  SER A HG   1  
ATOM 517   N N    . SER A 1 36  ? -1.185  12.095  3.627   1.00 0.00 ? 36  SER A N    1  
ATOM 518   C CA   . SER A 1 36  ? 0.183   12.087  4.134   1.00 0.00 ? 36  SER A CA   1  
ATOM 519   C C    . SER A 1 36  ? 0.222   12.390  5.631   1.00 0.00 ? 36  SER A C    1  
ATOM 520   O O    . SER A 1 36  ? 1.089   11.893  6.347   1.00 0.00 ? 36  SER A O    1  
ATOM 521   C CB   . SER A 1 36  ? 1.036   13.107  3.377   1.00 0.00 ? 36  SER A CB   1  
ATOM 522   O OG   . SER A 1 36  ? 0.761   14.427  3.814   1.00 0.00 ? 36  SER A OG   1  
ATOM 523   H H    . SER A 1 36  ? -1.398  12.623  2.830   1.00 0.00 ? 36  SER A H    1  
ATOM 524   H HA   . SER A 1 36  ? 0.589   11.101  3.969   1.00 0.00 ? 36  SER A HA   1  
ATOM 525   H HB2  . SER A 1 36  ? 2.079   12.896  3.545   1.00 0.00 ? 36  SER A HB2  1  
ATOM 526   H HB3  . SER A 1 36  ? 0.820   13.040  2.321   1.00 0.00 ? 36  SER A HB3  1  
ATOM 527   H HG   . SER A 1 36  ? 1.432   14.702  4.443   1.00 0.00 ? 36  SER A HG   1  
ATOM 528   N N    . GLN A 1 37  ? -0.708  13.218  6.094   1.00 0.00 ? 37  GLN A N    1  
ATOM 529   C CA   . GLN A 1 37  ? -0.766  13.598  7.506   1.00 0.00 ? 37  GLN A CA   1  
ATOM 530   C C    . GLN A 1 37  ? -1.823  12.810  8.283   1.00 0.00 ? 37  GLN A C    1  
ATOM 531   O O    . GLN A 1 37  ? -1.975  13.004  9.491   1.00 0.00 ? 37  GLN A O    1  
ATOM 532   C CB   . GLN A 1 37  ? -1.044  15.096  7.633   1.00 0.00 ? 37  GLN A CB   1  
ATOM 533   C CG   . GLN A 1 37  ? -2.247  15.563  6.830   1.00 0.00 ? 37  GLN A CG   1  
ATOM 534   C CD   . GLN A 1 37  ? -3.205  16.407  7.649   1.00 0.00 ? 37  GLN A CD   1  
ATOM 535   O OE1  . GLN A 1 37  ? -4.418  16.199  7.615   1.00 0.00 ? 37  GLN A OE1  1  
ATOM 536   N NE2  . GLN A 1 37  ? -2.663  17.365  8.391   1.00 0.00 ? 37  GLN A NE2  1  
ATOM 537   H H    . GLN A 1 37  ? -1.367  13.592  5.472   1.00 0.00 ? 37  GLN A H    1  
ATOM 538   H HA   . GLN A 1 37  ? 0.202   13.391  7.938   1.00 0.00 ? 37  GLN A HA   1  
ATOM 539   H HB2  . GLN A 1 37  ? -1.220  15.331  8.673   1.00 0.00 ? 37  GLN A HB2  1  
ATOM 540   H HB3  . GLN A 1 37  ? -0.177  15.643  7.291   1.00 0.00 ? 37  GLN A HB3  1  
ATOM 541   H HG2  . GLN A 1 37  ? -1.902  16.150  5.992   1.00 0.00 ? 37  GLN A HG2  1  
ATOM 542   H HG3  . GLN A 1 37  ? -2.779  14.695  6.463   1.00 0.00 ? 37  GLN A HG3  1  
ATOM 543   H HE21 . GLN A 1 37  ? -1.689  17.472  8.370   1.00 0.00 ? 37  GLN A HE21 1  
ATOM 544   H HE22 . GLN A 1 37  ? -3.259  17.927  8.930   1.00 0.00 ? 37  GLN A HE22 1  
ATOM 545   N N    . ASP A 1 38  ? -2.570  11.947  7.600   1.00 0.00 ? 38  ASP A N    1  
ATOM 546   C CA   . ASP A 1 38  ? -3.623  11.173  8.260   1.00 0.00 ? 38  ASP A CA   1  
ATOM 547   C C    . ASP A 1 38  ? -3.317  9.676   8.300   1.00 0.00 ? 38  ASP A C    1  
ATOM 548   O O    . ASP A 1 38  ? -3.982  8.925   9.013   1.00 0.00 ? 38  ASP A O    1  
ATOM 549   C CB   . ASP A 1 38  ? -4.963  11.403  7.561   1.00 0.00 ? 38  ASP A CB   1  
ATOM 550   C CG   . ASP A 1 38  ? -5.517  12.792  7.811   1.00 0.00 ? 38  ASP A CG   1  
ATOM 551   O OD1  . ASP A 1 38  ? -5.010  13.481  8.721   1.00 0.00 ? 38  ASP A OD1  1  
ATOM 552   O OD2  . ASP A 1 38  ? -6.459  13.193  7.094   1.00 0.00 ? 38  ASP A OD2  1  
ATOM 553   H H    . ASP A 1 38  ? -2.423  11.840  6.637   1.00 0.00 ? 38  ASP A H    1  
ATOM 554   H HA   . ASP A 1 38  ? -3.700  11.533  9.275   1.00 0.00 ? 38  ASP A HA   1  
ATOM 555   H HB2  . ASP A 1 38  ? -4.835  11.273  6.498   1.00 0.00 ? 38  ASP A HB2  1  
ATOM 556   H HB3  . ASP A 1 38  ? -5.680  10.680  7.924   1.00 0.00 ? 38  ASP A HB3  1  
ATOM 557   N N    . LEU A 1 39  ? -2.324  9.242   7.536   1.00 0.00 ? 39  LEU A N    1  
ATOM 558   C CA   . LEU A 1 39  ? -1.963  7.827   7.498   1.00 0.00 ? 39  LEU A CA   1  
ATOM 559   C C    . LEU A 1 39  ? -0.497  7.625   7.868   1.00 0.00 ? 39  LEU A C    1  
ATOM 560   O O    . LEU A 1 39  ? -0.023  6.495   7.977   1.00 0.00 ? 39  LEU A O    1  
ATOM 561   C CB   . LEU A 1 39  ? -2.248  7.246   6.111   1.00 0.00 ? 39  LEU A CB   1  
ATOM 562   C CG   . LEU A 1 39  ? -1.469  7.888   4.964   1.00 0.00 ? 39  LEU A CG   1  
ATOM 563   C CD1  . LEU A 1 39  ? -0.227  7.076   4.642   1.00 0.00 ? 39  LEU A CD1  1  
ATOM 564   C CD2  . LEU A 1 39  ? -2.353  8.028   3.738   1.00 0.00 ? 39  LEU A CD2  1  
ATOM 565   H H    . LEU A 1 39  ? -1.827  9.879   6.981   1.00 0.00 ? 39  LEU A H    1  
ATOM 566   H HA   . LEU A 1 39  ? -2.575  7.313   8.224   1.00 0.00 ? 39  LEU A HA   1  
ATOM 567   H HB2  . LEU A 1 39  ? -2.021  6.190   6.126   1.00 0.00 ? 39  LEU A HB2  1  
ATOM 568   H HB3  . LEU A 1 39  ? -3.301  7.365   5.906   1.00 0.00 ? 39  LEU A HB3  1  
ATOM 569   H HG   . LEU A 1 39  ? -1.151  8.875   5.265   1.00 0.00 ? 39  LEU A HG   1  
ATOM 570   H HD11 . LEU A 1 39  ? 0.525   7.253   5.395   1.00 0.00 ? 39  LEU A HD11 1  
ATOM 571   H HD12 . LEU A 1 39  ? 0.153   7.372   3.676   1.00 0.00 ? 39  LEU A HD12 1  
ATOM 572   H HD13 . LEU A 1 39  ? -0.480  6.026   4.623   1.00 0.00 ? 39  LEU A HD13 1  
ATOM 573   H HD21 . LEU A 1 39  ? -3.275  7.485   3.891   1.00 0.00 ? 39  LEU A HD21 1  
ATOM 574   H HD22 . LEU A 1 39  ? -1.839  7.628   2.876   1.00 0.00 ? 39  LEU A HD22 1  
ATOM 575   H HD23 . LEU A 1 39  ? -2.575  9.072   3.570   1.00 0.00 ? 39  LEU A HD23 1  
ATOM 576   N N    . ILE A 1 40  ? 0.214   8.730   8.068   1.00 0.00 ? 40  ILE A N    1  
ATOM 577   C CA   . ILE A 1 40  ? 1.623   8.680   8.431   1.00 0.00 ? 40  ILE A CA   1  
ATOM 578   C C    . ILE A 1 40  ? 1.812   8.084   9.823   1.00 0.00 ? 40  ILE A C    1  
ATOM 579   O O    . ILE A 1 40  ? 0.988   8.294   10.717  1.00 0.00 ? 40  ILE A O    1  
ATOM 580   C CB   . ILE A 1 40  ? 2.259   10.086  8.381   1.00 0.00 ? 40  ILE A CB   1  
ATOM 581   C CG1  . ILE A 1 40  ? 3.789   9.996   8.449   1.00 0.00 ? 40  ILE A CG1  1  
ATOM 582   C CG2  . ILE A 1 40  ? 1.704   10.971  9.490   1.00 0.00 ? 40  ILE A CG2  1  
ATOM 583   C CD1  . ILE A 1 40  ? 4.359   9.990   9.853   1.00 0.00 ? 40  ILE A CD1  1  
ATOM 584   H H    . ILE A 1 40  ? -0.223  9.601   7.971   1.00 0.00 ? 40  ILE A H    1  
ATOM 585   H HA   . ILE A 1 40  ? 2.131   8.051   7.709   1.00 0.00 ? 40  ILE A HA   1  
ATOM 586   H HB   . ILE A 1 40  ? 1.980   10.534  7.438   1.00 0.00 ? 40  ILE A HB   1  
ATOM 587   H HG12 . ILE A 1 40  ? 4.109   9.087   7.961   1.00 0.00 ? 40  ILE A HG12 1  
ATOM 588   H HG13 . ILE A 1 40  ? 4.212   10.841  7.924   1.00 0.00 ? 40  ILE A HG13 1  
ATOM 589   H HG21 . ILE A 1 40  ? 1.605   10.394  10.396  1.00 0.00 ? 40  ILE A HG21 1  
ATOM 590   H HG22 . ILE A 1 40  ? 0.734   11.351  9.198   1.00 0.00 ? 40  ILE A HG22 1  
ATOM 591   H HG23 . ILE A 1 40  ? 2.376   11.798  9.662   1.00 0.00 ? 40  ILE A HG23 1  
ATOM 592   H HD11 . ILE A 1 40  ? 4.028   10.873  10.377  1.00 0.00 ? 40  ILE A HD11 1  
ATOM 593   H HD12 . ILE A 1 40  ? 5.437   9.982   9.804   1.00 0.00 ? 40  ILE A HD12 1  
ATOM 594   H HD13 . ILE A 1 40  ? 4.015   9.111   10.377  1.00 0.00 ? 40  ILE A HD13 1  
ATOM 595   N N    . GLY A 1 41  ? 2.900   7.342   10.003  1.00 0.00 ? 41  GLY A N    1  
ATOM 596   C CA   . GLY A 1 41  ? 3.178   6.730   11.288  1.00 0.00 ? 41  GLY A CA   1  
ATOM 597   C C    . GLY A 1 41  ? 2.643   5.317   11.384  1.00 0.00 ? 41  GLY A C    1  
ATOM 598   O O    . GLY A 1 41  ? 3.128   4.515   12.183  1.00 0.00 ? 41  GLY A O    1  
ATOM 599   H H    . GLY A 1 41  ? 3.519   7.210   9.256   1.00 0.00 ? 41  GLY A H    1  
ATOM 600   H HA2  . GLY A 1 41  ? 4.247   6.711   11.442  1.00 0.00 ? 41  GLY A HA2  1  
ATOM 601   H HA3  . GLY A 1 41  ? 2.723   7.328   12.066  1.00 0.00 ? 41  GLY A HA3  1  
ATOM 602   N N    . GLN A 1 42  ? 1.641   5.008   10.565  1.00 0.00 ? 42  GLN A N    1  
ATOM 603   C CA   . GLN A 1 42  ? 1.043   3.679   10.558  1.00 0.00 ? 42  GLN A CA   1  
ATOM 604   C C    . GLN A 1 42  ? 1.532   2.872   9.361   1.00 0.00 ? 42  GLN A C    1  
ATOM 605   O O    . GLN A 1 42  ? 2.523   3.230   8.723   1.00 0.00 ? 42  GLN A O    1  
ATOM 606   C CB   . GLN A 1 42  ? -0.484  3.785   10.530  1.00 0.00 ? 42  GLN A CB   1  
ATOM 607   C CG   . GLN A 1 42  ? -1.038  4.852   11.461  1.00 0.00 ? 42  GLN A CG   1  
ATOM 608   C CD   . GLN A 1 42  ? -2.390  5.373   11.014  1.00 0.00 ? 42  GLN A CD   1  
ATOM 609   O OE1  . GLN A 1 42  ? -3.266  5.646   11.835  1.00 0.00 ? 42  GLN A OE1  1  
ATOM 610   N NE2  . GLN A 1 42  ? -2.569  5.515   9.705   1.00 0.00 ? 42  GLN A NE2  1  
ATOM 611   H H    . GLN A 1 42  ? 1.300   5.692   9.948   1.00 0.00 ? 42  GLN A H    1  
ATOM 612   H HA   . GLN A 1 42  ? 1.344   3.175   11.465  1.00 0.00 ? 42  GLN A HA   1  
ATOM 613   H HB2  . GLN A 1 42  ? -0.799  4.017   9.523   1.00 0.00 ? 42  GLN A HB2  1  
ATOM 614   H HB3  . GLN A 1 42  ? -0.904  2.833   10.818  1.00 0.00 ? 42  GLN A HB3  1  
ATOM 615   H HG2  . GLN A 1 42  ? -1.142  4.429   12.448  1.00 0.00 ? 42  GLN A HG2  1  
ATOM 616   H HG3  . GLN A 1 42  ? -0.343  5.678   11.494  1.00 0.00 ? 42  GLN A HG3  1  
ATOM 617   H HE21 . GLN A 1 42  ? -1.828  5.278   9.108   1.00 0.00 ? 42  GLN A HE21 1  
ATOM 618   H HE22 . GLN A 1 42  ? -3.434  5.849   9.389   1.00 0.00 ? 42  GLN A HE22 1  
ATOM 619   N N    . LYS A 1 43  ? 0.830   1.785   9.056   1.00 0.00 ? 43  LYS A N    1  
ATOM 620   C CA   . LYS A 1 43  ? 1.195   0.931   7.932   1.00 0.00 ? 43  LYS A CA   1  
ATOM 621   C C    . LYS A 1 43  ? 0.031   0.806   6.955   1.00 0.00 ? 43  LYS A C    1  
ATOM 622   O O    . LYS A 1 43  ? -1.095  0.522   7.355   1.00 0.00 ? 43  LYS A O    1  
ATOM 623   C CB   . LYS A 1 43  ? 1.610   -0.454  8.430   1.00 0.00 ? 43  LYS A CB   1  
ATOM 624   C CG   . LYS A 1 43  ? 2.841   -0.435  9.321   1.00 0.00 ? 43  LYS A CG   1  
ATOM 625   C CD   . LYS A 1 43  ? 2.467   -0.274  10.785  1.00 0.00 ? 43  LYS A CD   1  
ATOM 626   C CE   . LYS A 1 43  ? 2.320   -1.622  11.474  1.00 0.00 ? 43  LYS A CE   1  
ATOM 627   N NZ   . LYS A 1 43  ? 3.575   -2.420  11.405  1.00 0.00 ? 43  LYS A NZ   1  
ATOM 628   H H    . LYS A 1 43  ? 0.048   1.553   9.600   1.00 0.00 ? 43  LYS A H    1  
ATOM 629   H HA   . LYS A 1 43  ? 2.029   1.389   7.424   1.00 0.00 ? 43  LYS A HA   1  
ATOM 630   H HB2  . LYS A 1 43  ? 0.793   -0.884  8.988   1.00 0.00 ? 43  LYS A HB2  1  
ATOM 631   H HB3  . LYS A 1 43  ? 1.822   -1.082  7.575   1.00 0.00 ? 43  LYS A HB3  1  
ATOM 632   H HG2  . LYS A 1 43  ? 3.376   -1.362  9.197   1.00 0.00 ? 43  LYS A HG2  1  
ATOM 633   H HG3  . LYS A 1 43  ? 3.472   0.390   9.028   1.00 0.00 ? 43  LYS A HG3  1  
ATOM 634   H HD2  . LYS A 1 43  ? 3.239   0.291   11.284  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 635   H HD3  . LYS A 1 43  ? 1.528   0.258   10.851  1.00 0.00 ? 43  LYS A HD3  1  
ATOM 636   H HE2  . LYS A 1 43  ? 2.065   -1.457  12.510  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 637   H HE3  . LYS A 1 43  ? 1.525   -2.172  10.994  1.00 0.00 ? 43  LYS A HE3  1  
ATOM 638   H HZ1  . LYS A 1 43  ? 3.929   -2.444  10.427  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 639   H HZ2  . LYS A 1 43  ? 3.396   -3.396  11.721  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 640   H HZ3  . LYS A 1 43  ? 4.301   -1.999  12.017  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 641   N N    . LEU A 1 44  ? 0.307   1.053   5.675   1.00 0.00 ? 44  LEU A N    1  
ATOM 642   C CA   . LEU A 1 44  ? -0.721  0.993   4.640   1.00 0.00 ? 44  LEU A CA   1  
ATOM 643   C C    . LEU A 1 44  ? -1.570  -0.270  4.758   1.00 0.00 ? 44  LEU A C    1  
ATOM 644   O O    . LEU A 1 44  ? -2.792  -0.215  4.637   1.00 0.00 ? 44  LEU A O    1  
ATOM 645   C CB   . LEU A 1 44  ? -0.095  1.068   3.241   1.00 0.00 ? 44  LEU A CB   1  
ATOM 646   C CG   . LEU A 1 44  ? 1.390   0.697   3.146   1.00 0.00 ? 44  LEU A CG   1  
ATOM 647   C CD1  . LEU A 1 44  ? 1.586   -0.804  3.285   1.00 0.00 ? 44  LEU A CD1  1  
ATOM 648   C CD2  . LEU A 1 44  ? 1.969   1.182   1.829   1.00 0.00 ? 44  LEU A CD2  1  
ATOM 649   H H    . LEU A 1 44  ? 1.219   1.309   5.426   1.00 0.00 ? 44  LEU A H    1  
ATOM 650   H HA   . LEU A 1 44  ? -1.364  1.849   4.774   1.00 0.00 ? 44  LEU A HA   1  
ATOM 651   H HB2  . LEU A 1 44  ? -0.648  0.404   2.591   1.00 0.00 ? 44  LEU A HB2  1  
ATOM 652   H HB3  . LEU A 1 44  ? -0.213  2.076   2.874   1.00 0.00 ? 44  LEU A HB3  1  
ATOM 653   H HG   . LEU A 1 44  ? 1.928   1.181   3.948   1.00 0.00 ? 44  LEU A HG   1  
ATOM 654   H HD11 . LEU A 1 44  ? 0.760   -1.225  3.837   1.00 0.00 ? 44  LEU A HD11 1  
ATOM 655   H HD12 . LEU A 1 44  ? 2.509   -0.997  3.809   1.00 0.00 ? 44  LEU A HD12 1  
ATOM 656   H HD13 . LEU A 1 44  ? 1.630   -1.253  2.302   1.00 0.00 ? 44  LEU A HD13 1  
ATOM 657   H HD21 . LEU A 1 44  ? 2.011   2.260   1.829   1.00 0.00 ? 44  LEU A HD21 1  
ATOM 658   H HD22 . LEU A 1 44  ? 1.344   0.846   1.015   1.00 0.00 ? 44  LEU A HD22 1  
ATOM 659   H HD23 . LEU A 1 44  ? 2.966   0.782   1.705   1.00 0.00 ? 44  LEU A HD23 1  
ATOM 660   N N    . THR A 1 45  ? -0.913  -1.403  4.973   1.00 0.00 ? 45  THR A N    1  
ATOM 661   C CA   . THR A 1 45  ? -1.594  -2.691  5.085   1.00 0.00 ? 45  THR A CA   1  
ATOM 662   C C    . THR A 1 45  ? -2.688  -2.693  6.143   1.00 0.00 ? 45  THR A C    1  
ATOM 663   O O    . THR A 1 45  ? -3.598  -3.520  6.097   1.00 0.00 ? 45  THR A O    1  
ATOM 664   C CB   . THR A 1 45  ? -0.590  -3.802  5.394   1.00 0.00 ? 45  THR A CB   1  
ATOM 665   O OG1  . THR A 1 45  ? 0.053   -3.553  6.648   1.00 0.00 ? 45  THR A OG1  1  
ATOM 666   C CG2  . THR A 1 45  ? 0.443   -3.873  4.292   1.00 0.00 ? 45  THR A CG2  1  
ATOM 667   H H    . THR A 1 45  ? 0.063   -1.374  5.049   1.00 0.00 ? 45  THR A H    1  
ATOM 668   H HA   . THR A 1 45  ? -2.041  -2.909  4.128   1.00 0.00 ? 45  THR A HA   1  
ATOM 669   H HB   . THR A 1 45  ? -1.110  -4.743  5.437   1.00 0.00 ? 45  THR A HB   1  
ATOM 670   H HG1  . THR A 1 45  ? -0.161  -2.667  6.949   1.00 0.00 ? 45  THR A HG1  1  
ATOM 671   H HG21 . THR A 1 45  ? 1.367   -3.435  4.638   1.00 0.00 ? 45  THR A HG21 1  
ATOM 672   H HG22 . THR A 1 45  ? 0.083   -3.319  3.436   1.00 0.00 ? 45  THR A HG22 1  
ATOM 673   H HG23 . THR A 1 45  ? 0.608   -4.902  4.018   1.00 0.00 ? 45  THR A HG23 1  
ATOM 674   N N    . GLN A 1 46  ? -2.605  -1.765  7.083   1.00 0.00 ? 46  GLN A N    1  
ATOM 675   C CA   . GLN A 1 46  ? -3.609  -1.669  8.134   1.00 0.00 ? 46  GLN A CA   1  
ATOM 676   C C    . GLN A 1 46  ? -4.953  -1.331  7.511   1.00 0.00 ? 46  GLN A C    1  
ATOM 677   O O    . GLN A 1 46  ? -6.008  -1.625  8.070   1.00 0.00 ? 46  GLN A O    1  
ATOM 678   C CB   . GLN A 1 46  ? -3.216  -0.601  9.156   1.00 0.00 ? 46  GLN A CB   1  
ATOM 679   C CG   . GLN A 1 46  ? -3.523  -0.989  10.594  1.00 0.00 ? 46  GLN A CG   1  
ATOM 680   C CD   . GLN A 1 46  ? -2.386  -0.667  11.545  1.00 0.00 ? 46  GLN A CD   1  
ATOM 681   O OE1  . GLN A 1 46  ? -2.113  -1.417  12.483  1.00 0.00 ? 46  GLN A OE1  1  
ATOM 682   N NE2  . GLN A 1 46  ? -1.716  0.458   11.314  1.00 0.00 ? 46  GLN A NE2  1  
ATOM 683   H H    . GLN A 1 46  ? -1.868  -1.126  7.061   1.00 0.00 ? 46  GLN A H    1  
ATOM 684   H HA   . GLN A 1 46  ? -3.677  -2.632  8.626   1.00 0.00 ? 46  GLN A HA   1  
ATOM 685   H HB2  . GLN A 1 46  ? -2.155  -0.412  9.076   1.00 0.00 ? 46  GLN A HB2  1  
ATOM 686   H HB3  . GLN A 1 46  ? -3.751  0.311   8.932   1.00 0.00 ? 46  GLN A HB3  1  
ATOM 687   H HG2  . GLN A 1 46  ? -4.405  -0.457  10.917  1.00 0.00 ? 46  GLN A HG2  1  
ATOM 688   H HG3  . GLN A 1 46  ? -3.712  -2.052  10.632  1.00 0.00 ? 46  GLN A HG3  1  
ATOM 689   H HE21 . GLN A 1 46  ? -1.988  1.010   10.552  1.00 0.00 ? 46  GLN A HE21 1  
ATOM 690   H HE22 . GLN A 1 46  ? -0.979  0.689   11.915  1.00 0.00 ? 46  GLN A HE22 1  
ATOM 691   N N    . PHE A 1 47  ? -4.894  -0.693  6.348   1.00 0.00 ? 47  PHE A N    1  
ATOM 692   C CA   . PHE A 1 47  ? -6.096  -0.286  5.630   1.00 0.00 ? 47  PHE A CA   1  
ATOM 693   C C    . PHE A 1 47  ? -6.303  -1.131  4.374   1.00 0.00 ? 47  PHE A C    1  
ATOM 694   O O    . PHE A 1 47  ? -6.758  -0.629  3.348   1.00 0.00 ? 47  PHE A O    1  
ATOM 695   C CB   . PHE A 1 47  ? -6.010  1.199   5.254   1.00 0.00 ? 47  PHE A CB   1  
ATOM 696   C CG   . PHE A 1 47  ? -4.941  1.957   5.994   1.00 0.00 ? 47  PHE A CG   1  
ATOM 697   C CD1  . PHE A 1 47  ? -4.999  2.104   7.371   1.00 0.00 ? 47  PHE A CD1  1  
ATOM 698   C CD2  . PHE A 1 47  ? -3.878  2.523   5.310   1.00 0.00 ? 47  PHE A CD2  1  
ATOM 699   C CE1  . PHE A 1 47  ? -4.016  2.797   8.051   1.00 0.00 ? 47  PHE A CE1  1  
ATOM 700   C CE2  . PHE A 1 47  ? -2.892  3.219   5.985   1.00 0.00 ? 47  PHE A CE2  1  
ATOM 701   C CZ   . PHE A 1 47  ? -2.963  3.356   7.356   1.00 0.00 ? 47  PHE A CZ   1  
ATOM 702   H H    . PHE A 1 47  ? -4.014  -0.473  5.973   1.00 0.00 ? 47  PHE A H    1  
ATOM 703   H HA   . PHE A 1 47  ? -6.939  -0.431  6.289   1.00 0.00 ? 47  PHE A HA   1  
ATOM 704   H HB2  . PHE A 1 47  ? -5.799  1.282   4.198   1.00 0.00 ? 47  PHE A HB2  1  
ATOM 705   H HB3  . PHE A 1 47  ? -6.959  1.670   5.465   1.00 0.00 ? 47  PHE A HB3  1  
ATOM 706   H HD1  . PHE A 1 47  ? -5.824  1.667   7.916   1.00 0.00 ? 47  PHE A HD1  1  
ATOM 707   H HD2  . PHE A 1 47  ? -3.821  2.417   4.236   1.00 0.00 ? 47  PHE A HD2  1  
ATOM 708   H HE1  . PHE A 1 47  ? -4.072  2.903   9.124   1.00 0.00 ? 47  PHE A HE1  1  
ATOM 709   H HE2  . PHE A 1 47  ? -2.067  3.653   5.439   1.00 0.00 ? 47  PHE A HE2  1  
ATOM 710   H HZ   . PHE A 1 47  ? -2.193  3.900   7.885   1.00 0.00 ? 47  PHE A HZ   1  
ATOM 711   N N    . PHE A 1 48  ? -5.978  -2.420  4.474   1.00 0.00 ? 48  PHE A N    1  
ATOM 712   C CA   . PHE A 1 48  ? -6.137  -3.352  3.355   1.00 0.00 ? 48  PHE A CA   1  
ATOM 713   C C    . PHE A 1 48  ? -6.512  -4.735  3.875   1.00 0.00 ? 48  PHE A C    1  
ATOM 714   O O    . PHE A 1 48  ? -6.084  -5.121  4.962   1.00 0.00 ? 48  PHE A O    1  
ATOM 715   C CB   . PHE A 1 48  ? -4.852  -3.438  2.521   1.00 0.00 ? 48  PHE A CB   1  
ATOM 716   C CG   . PHE A 1 48  ? -4.441  -2.129  1.910   1.00 0.00 ? 48  PHE A CG   1  
ATOM 717   C CD1  . PHE A 1 48  ? -5.284  -1.455  1.044   1.00 0.00 ? 48  PHE A CD1  1  
ATOM 718   C CD2  . PHE A 1 48  ? -3.211  -1.571  2.205   1.00 0.00 ? 48  PHE A CD2  1  
ATOM 719   C CE1  . PHE A 1 48  ? -4.910  -0.248  0.486   1.00 0.00 ? 48  PHE A CE1  1  
ATOM 720   C CE2  . PHE A 1 48  ? -2.827  -0.365  1.649   1.00 0.00 ? 48  PHE A CE2  1  
ATOM 721   C CZ   . PHE A 1 48  ? -3.679  0.296   0.791   1.00 0.00 ? 48  PHE A CZ   1  
ATOM 722   H H    . PHE A 1 48  ? -5.631  -2.754  5.324   1.00 0.00 ? 48  PHE A H    1  
ATOM 723   H HA   . PHE A 1 48  ? -6.937  -2.987  2.728   1.00 0.00 ? 48  PHE A HA   1  
ATOM 724   H HB2  . PHE A 1 48  ? -4.044  -3.776  3.152   1.00 0.00 ? 48  PHE A HB2  1  
ATOM 725   H HB3  . PHE A 1 48  ? -4.998  -4.151  1.718   1.00 0.00 ? 48  PHE A HB3  1  
ATOM 726   H HD1  . PHE A 1 48  ? -6.247  -1.878  0.806   1.00 0.00 ? 48  PHE A HD1  1  
ATOM 727   H HD2  . PHE A 1 48  ? -2.542  -2.088  2.876   1.00 0.00 ? 48  PHE A HD2  1  
ATOM 728   H HE1  . PHE A 1 48  ? -5.577  0.267   -0.188  1.00 0.00 ? 48  PHE A HE1  1  
ATOM 729   H HE2  . PHE A 1 48  ? -1.865  0.058   1.889   1.00 0.00 ? 48  PHE A HE2  1  
ATOM 730   H HZ   . PHE A 1 48  ? -3.383  1.240   0.357   1.00 0.00 ? 48  PHE A HZ   1  
ATOM 731   N N    . LEU A 1 49  ? -7.311  -5.461  3.083   1.00 0.00 ? 49  LEU A N    1  
ATOM 732   C CA   . LEU A 1 49  ? -7.776  -6.816  3.423   1.00 0.00 ? 49  LEU A CA   1  
ATOM 733   C C    . LEU A 1 49  ? -7.541  -7.164  4.893   1.00 0.00 ? 49  LEU A C    1  
ATOM 734   O O    . LEU A 1 49  ? -6.463  -7.618  5.269   1.00 0.00 ? 49  LEU A O    1  
ATOM 735   C CB   . LEU A 1 49  ? -7.121  -7.882  2.522   1.00 0.00 ? 49  LEU A CB   1  
ATOM 736   C CG   . LEU A 1 49  ? -5.757  -7.536  1.898   1.00 0.00 ? 49  LEU A CG   1  
ATOM 737   C CD1  . LEU A 1 49  ? -5.894  -6.445  0.848   1.00 0.00 ? 49  LEU A CD1  1  
ATOM 738   C CD2  . LEU A 1 49  ? -4.747  -7.135  2.964   1.00 0.00 ? 49  LEU A CD2  1  
ATOM 739   H H    . LEU A 1 49  ? -7.602  -5.071  2.232   1.00 0.00 ? 49  LEU A H    1  
ATOM 740   H HA   . LEU A 1 49  ? -8.840  -6.835  3.245   1.00 0.00 ? 49  LEU A HA   1  
ATOM 741   H HB2  . LEU A 1 49  ? -6.996  -8.780  3.109   1.00 0.00 ? 49  LEU A HB2  1  
ATOM 742   H HB3  . LEU A 1 49  ? -7.808  -8.101  1.718   1.00 0.00 ? 49  LEU A HB3  1  
ATOM 743   H HG   . LEU A 1 49  ? -5.375  -8.416  1.400   1.00 0.00 ? 49  LEU A HG   1  
ATOM 744   H HD11 . LEU A 1 49  ? -5.739  -6.867  -0.134  1.00 0.00 ? 49  LEU A HD11 1  
ATOM 745   H HD12 . LEU A 1 49  ? -5.157  -5.675  1.029   1.00 0.00 ? 49  LEU A HD12 1  
ATOM 746   H HD13 . LEU A 1 49  ? -6.885  -6.015  0.901   1.00 0.00 ? 49  LEU A HD13 1  
ATOM 747   H HD21 . LEU A 1 49  ? -4.074  -6.392  2.561   1.00 0.00 ? 49  LEU A HD21 1  
ATOM 748   H HD22 . LEU A 1 49  ? -4.181  -8.004  3.270   1.00 0.00 ? 49  LEU A HD22 1  
ATOM 749   H HD23 . LEU A 1 49  ? -5.266  -6.725  3.816   1.00 0.00 ? 49  LEU A HD23 1  
ATOM 750   N N    . ARG A 1 50  ? -8.565  -6.945  5.718   1.00 0.00 ? 50  ARG A N    1  
ATOM 751   C CA   . ARG A 1 50  ? -8.487  -7.226  7.152   1.00 0.00 ? 50  ARG A CA   1  
ATOM 752   C C    . ARG A 1 50  ? -7.455  -6.331  7.831   1.00 0.00 ? 50  ARG A C    1  
ATOM 753   O O    . ARG A 1 50  ? -6.255  -6.437  7.577   1.00 0.00 ? 50  ARG A O    1  
ATOM 754   C CB   . ARG A 1 50  ? -8.153  -8.699  7.404   1.00 0.00 ? 50  ARG A CB   1  
ATOM 755   C CG   . ARG A 1 50  ? -8.559  -9.180  8.786   1.00 0.00 ? 50  ARG A CG   1  
ATOM 756   C CD   . ARG A 1 50  ? -8.227  -10.650 8.988   1.00 0.00 ? 50  ARG A CD   1  
ATOM 757   N NE   . ARG A 1 50  ? -9.406  -11.429 9.360   1.00 0.00 ? 50  ARG A NE   1  
ATOM 758   C CZ   . ARG A 1 50  ? -10.335 -11.821 8.493   1.00 0.00 ? 50  ARG A CZ   1  
ATOM 759   N NH1  . ARG A 1 50  ? -10.219 -11.510 7.207   1.00 0.00 ? 50  ARG A NH1  1  
ATOM 760   N NH2  . ARG A 1 50  ? -11.378 -12.524 8.908   1.00 0.00 ? 50  ARG A NH2  1  
ATOM 761   H H    . ARG A 1 50  ? -9.398  -6.580  5.352   1.00 0.00 ? 50  ARG A H    1  
ATOM 762   H HA   . ARG A 1 50  ? -9.457  -7.014  7.576   1.00 0.00 ? 50  ARG A HA   1  
ATOM 763   H HB2  . ARG A 1 50  ? -8.665  -9.304  6.669   1.00 0.00 ? 50  ARG A HB2  1  
ATOM 764   H HB3  . ARG A 1 50  ? -7.089  -8.840  7.294   1.00 0.00 ? 50  ARG A HB3  1  
ATOM 765   H HG2  . ARG A 1 50  ? -8.032  -8.599  9.528   1.00 0.00 ? 50  ARG A HG2  1  
ATOM 766   H HG3  . ARG A 1 50  ? -9.623  -9.040  8.908   1.00 0.00 ? 50  ARG A HG3  1  
ATOM 767   H HD2  . ARG A 1 50  ? -7.824  -11.044 8.069   1.00 0.00 ? 50  ARG A HD2  1  
ATOM 768   H HD3  . ARG A 1 50  ? -7.490  -10.734 9.772   1.00 0.00 ? 50  ARG A HD3  1  
ATOM 769   H HE   . ARG A 1 50  ? -9.511  -11.670 10.305  1.00 0.00 ? 50  ARG A HE   1  
ATOM 770   H HH11 . ARG A 1 50  ? -9.434  -10.980 6.889   1.00 0.00 ? 50  ARG A HH11 1  
ATOM 771   H HH12 . ARG A 1 50  ? -10.918 -11.808 6.557   1.00 0.00 ? 50  ARG A HH12 1  
ATOM 772   H HH21 . ARG A 1 50  ? -11.470 -12.760 9.875   1.00 0.00 ? 50  ARG A HH21 1  
ATOM 773   H HH22 . ARG A 1 50  ? -12.076 -12.818 8.254   1.00 0.00 ? 50  ARG A HH22 1  
ATOM 774   N N    . SER A 1 51  ? -7.939  -5.440  8.687   1.00 0.00 ? 51  SER A N    1  
ATOM 775   C CA   . SER A 1 51  ? -7.078  -4.506  9.404   1.00 0.00 ? 51  SER A CA   1  
ATOM 776   C C    . SER A 1 51  ? -6.570  -5.087  10.720  1.00 0.00 ? 51  SER A C    1  
ATOM 777   O O    . SER A 1 51  ? -5.803  -4.438  11.432  1.00 0.00 ? 51  SER A O    1  
ATOM 778   C CB   . SER A 1 51  ? -7.839  -3.208  9.678   1.00 0.00 ? 51  SER A CB   1  
ATOM 779   O OG   . SER A 1 51  ? -9.155  -3.473  10.131  1.00 0.00 ? 51  SER A OG   1  
ATOM 780   H H    . SER A 1 51  ? -8.907  -5.405  8.837   1.00 0.00 ? 51  SER A H    1  
ATOM 781   H HA   . SER A 1 51  ? -6.232  -4.286  8.771   1.00 0.00 ? 51  SER A HA   1  
ATOM 782   H HB2  . SER A 1 51  ? -7.318  -2.641  10.437  1.00 0.00 ? 51  SER A HB2  1  
ATOM 783   H HB3  . SER A 1 51  ? -7.893  -2.625  8.770   1.00 0.00 ? 51  SER A HB3  1  
ATOM 784   H HG   . SER A 1 51  ? -9.245  -3.183  11.041  1.00 0.00 ? 51  SER A HG   1  
ATOM 785   N N    . ASP A 1 52  ? -7.021  -6.291  11.066  1.00 0.00 ? 52  ASP A N    1  
ATOM 786   C CA   . ASP A 1 52  ? -6.616  -6.909  12.326  1.00 0.00 ? 52  ASP A CA   1  
ATOM 787   C C    . ASP A 1 52  ? -5.353  -7.762  12.198  1.00 0.00 ? 52  ASP A C    1  
ATOM 788   O O    . ASP A 1 52  ? -4.293  -7.388  12.700  1.00 0.00 ? 52  ASP A O    1  
ATOM 789   C CB   . ASP A 1 52  ? -7.760  -7.767  12.872  1.00 0.00 ? 52  ASP A CB   1  
ATOM 790   C CG   . ASP A 1 52  ? -8.462  -7.119  14.050  1.00 0.00 ? 52  ASP A CG   1  
ATOM 791   O OD1  . ASP A 1 52  ? -7.975  -6.075  14.533  1.00 0.00 ? 52  ASP A OD1  1  
ATOM 792   O OD2  . ASP A 1 52  ? -9.500  -7.658  14.492  1.00 0.00 ? 52  ASP A OD2  1  
ATOM 793   H H    . ASP A 1 52  ? -7.650  -6.759  10.478  1.00 0.00 ? 52  ASP A H    1  
ATOM 794   H HA   . ASP A 1 52  ? -6.422  -6.115  13.029  1.00 0.00 ? 52  ASP A HA   1  
ATOM 795   H HB2  . ASP A 1 52  ? -8.488  -7.926  12.089  1.00 0.00 ? 52  ASP A HB2  1  
ATOM 796   H HB3  . ASP A 1 52  ? -7.365  -8.721  13.190  1.00 0.00 ? 52  ASP A HB3  1  
ATOM 797   N N    . SER A 1 53  ? -5.474  -8.922  11.557  1.00 0.00 ? 53  SER A N    1  
ATOM 798   C CA   . SER A 1 53  ? -4.338  -9.832  11.410  1.00 0.00 ? 53  SER A CA   1  
ATOM 799   C C    . SER A 1 53  ? -3.583  -9.640  10.096  1.00 0.00 ? 53  SER A C    1  
ATOM 800   O O    . SER A 1 53  ? -2.393  -9.334  10.097  1.00 0.00 ? 53  SER A O    1  
ATOM 801   C CB   . SER A 1 53  ? -4.810  -11.282 11.526  1.00 0.00 ? 53  SER A CB   1  
ATOM 802   O OG   . SER A 1 53  ? -5.768  -11.590 10.529  1.00 0.00 ? 53  SER A OG   1  
ATOM 803   H H    . SER A 1 53  ? -6.346  -9.183  11.198  1.00 0.00 ? 53  SER A H    1  
ATOM 804   H HA   . SER A 1 53  ? -3.658  -9.632  12.223  1.00 0.00 ? 53  SER A HA   1  
ATOM 805   H HB2  . SER A 1 53  ? -3.963  -11.942 11.411  1.00 0.00 ? 53  SER A HB2  1  
ATOM 806   H HB3  . SER A 1 53  ? -5.254  -11.434 12.498  1.00 0.00 ? 53  SER A HB3  1  
ATOM 807   H HG   . SER A 1 53  ? -5.569  -12.448 10.150  1.00 0.00 ? 53  SER A HG   1  
ATOM 808   N N    . ASP A 1 54  ? -4.279  -9.866  8.985   1.00 0.00 ? 54  ASP A N    1  
ATOM 809   C CA   . ASP A 1 54  ? -3.694  -9.767  7.645   1.00 0.00 ? 54  ASP A CA   1  
ATOM 810   C C    . ASP A 1 54  ? -2.648  -8.655  7.518   1.00 0.00 ? 54  ASP A C    1  
ATOM 811   O O    . ASP A 1 54  ? -1.630  -8.834  6.851   1.00 0.00 ? 54  ASP A O    1  
ATOM 812   C CB   . ASP A 1 54  ? -4.795  -9.559  6.608   1.00 0.00 ? 54  ASP A CB   1  
ATOM 813   C CG   . ASP A 1 54  ? -5.644  -10.801 6.405   1.00 0.00 ? 54  ASP A CG   1  
ATOM 814   O OD1  . ASP A 1 54  ? -5.450  -11.784 7.151   1.00 0.00 ? 54  ASP A OD1  1  
ATOM 815   O OD2  . ASP A 1 54  ? -6.504  -10.790 5.498   1.00 0.00 ? 54  ASP A OD2  1  
ATOM 816   H H    . ASP A 1 54  ? -5.217  -10.137 9.067   1.00 0.00 ? 54  ASP A H    1  
ATOM 817   H HA   . ASP A 1 54  ? -3.209  -10.710 7.438   1.00 0.00 ? 54  ASP A HA   1  
ATOM 818   H HB2  . ASP A 1 54  ? -5.439  -8.756  6.931   1.00 0.00 ? 54  ASP A HB2  1  
ATOM 819   H HB3  . ASP A 1 54  ? -4.344  -9.297  5.663   1.00 0.00 ? 54  ASP A HB3  1  
ATOM 820   N N    . VAL A 1 55  ? -2.902  -7.511  8.140   1.00 0.00 ? 55  VAL A N    1  
ATOM 821   C CA   . VAL A 1 55  ? -1.968  -6.387  8.064   1.00 0.00 ? 55  VAL A CA   1  
ATOM 822   C C    . VAL A 1 55  ? -0.603  -6.740  8.661   1.00 0.00 ? 55  VAL A C    1  
ATOM 823   O O    . VAL A 1 55  ? 0.435   -6.420  8.083   1.00 0.00 ? 55  VAL A O    1  
ATOM 824   C CB   . VAL A 1 55  ? -2.529  -5.129  8.768   1.00 0.00 ? 55  VAL A CB   1  
ATOM 825   C CG1  . VAL A 1 55  ? -3.363  -5.507  9.981   1.00 0.00 ? 55  VAL A CG1  1  
ATOM 826   C CG2  . VAL A 1 55  ? -1.409  -4.179  9.166   1.00 0.00 ? 55  VAL A CG2  1  
ATOM 827   H H    . VAL A 1 55  ? -3.732  -7.413  8.651   1.00 0.00 ? 55  VAL A H    1  
ATOM 828   H HA   . VAL A 1 55  ? -1.831  -6.149  7.019   1.00 0.00 ? 55  VAL A HA   1  
ATOM 829   H HB   . VAL A 1 55  ? -3.173  -4.614  8.070   1.00 0.00 ? 55  VAL A HB   1  
ATOM 830   H HG11 . VAL A 1 55  ? -3.975  -4.665  10.269  1.00 0.00 ? 55  VAL A HG11 1  
ATOM 831   H HG12 . VAL A 1 55  ? -2.709  -5.774  10.798  1.00 0.00 ? 55  VAL A HG12 1  
ATOM 832   H HG13 . VAL A 1 55  ? -3.996  -6.347  9.736   1.00 0.00 ? 55  VAL A HG13 1  
ATOM 833   H HG21 . VAL A 1 55  ? -1.196  -4.295  10.218  1.00 0.00 ? 55  VAL A HG21 1  
ATOM 834   H HG22 . VAL A 1 55  ? -1.713  -3.161  8.972   1.00 0.00 ? 55  VAL A HG22 1  
ATOM 835   H HG23 . VAL A 1 55  ? -0.524  -4.406  8.591   1.00 0.00 ? 55  VAL A HG23 1  
ATOM 836   N N    . VAL A 1 56  ? -0.614  -7.379  9.825   1.00 0.00 ? 56  VAL A N    1  
ATOM 837   C CA   . VAL A 1 56  ? 0.625   -7.751  10.507  1.00 0.00 ? 56  VAL A CA   1  
ATOM 838   C C    . VAL A 1 56  ? 1.330   -8.935  9.843   1.00 0.00 ? 56  VAL A C    1  
ATOM 839   O O    . VAL A 1 56  ? 2.514   -9.167  10.082  1.00 0.00 ? 56  VAL A O    1  
ATOM 840   C CB   . VAL A 1 56  ? 0.364   -8.092  11.987  1.00 0.00 ? 56  VAL A CB   1  
ATOM 841   C CG1  . VAL A 1 56  ? 1.664   -8.081  12.777  1.00 0.00 ? 56  VAL A CG1  1  
ATOM 842   C CG2  . VAL A 1 56  ? -0.640  -7.122  12.591  1.00 0.00 ? 56  VAL A CG2  1  
ATOM 843   H H    . VAL A 1 56  ? -1.472  -7.594  10.246  1.00 0.00 ? 56  VAL A H    1  
ATOM 844   H HA   . VAL A 1 56  ? 1.285   -6.895  10.476  1.00 0.00 ? 56  VAL A HA   1  
ATOM 845   H HB   . VAL A 1 56  ? -0.053  -9.087  12.039  1.00 0.00 ? 56  VAL A HB   1  
ATOM 846   H HG11 . VAL A 1 56  ? 2.490   -8.298  12.116  1.00 0.00 ? 56  VAL A HG11 1  
ATOM 847   H HG12 . VAL A 1 56  ? 1.621   -8.831  13.553  1.00 0.00 ? 56  VAL A HG12 1  
ATOM 848   H HG13 . VAL A 1 56  ? 1.806   -7.108  13.223  1.00 0.00 ? 56  VAL A HG13 1  
ATOM 849   H HG21 . VAL A 1 56  ? -0.167  -6.560  13.383  1.00 0.00 ? 56  VAL A HG21 1  
ATOM 850   H HG22 . VAL A 1 56  ? -1.477  -7.674  12.993  1.00 0.00 ? 56  VAL A HG22 1  
ATOM 851   H HG23 . VAL A 1 56  ? -0.991  -6.443  11.827  1.00 0.00 ? 56  VAL A HG23 1  
ATOM 852   N N    . GLU A 1 57  ? 0.607   -9.690  9.019   1.00 0.00 ? 57  GLU A N    1  
ATOM 853   C CA   . GLU A 1 57  ? 1.194   -10.851 8.347   1.00 0.00 ? 57  GLU A CA   1  
ATOM 854   C C    . GLU A 1 57  ? 1.817   -10.468 7.009   1.00 0.00 ? 57  GLU A C    1  
ATOM 855   O O    . GLU A 1 57  ? 2.962   -10.813 6.726   1.00 0.00 ? 57  GLU A O    1  
ATOM 856   C CB   . GLU A 1 57  ? 0.144   -11.942 8.130   1.00 0.00 ? 57  GLU A CB   1  
ATOM 857   C CG   . GLU A 1 57  ? -1.115  -11.759 8.960   1.00 0.00 ? 57  GLU A CG   1  
ATOM 858   C CD   . GLU A 1 57  ? -1.252  -12.804 10.050  1.00 0.00 ? 57  GLU A CD   1  
ATOM 859   O OE1  . GLU A 1 57  ? -0.267  -13.031 10.783  1.00 0.00 ? 57  GLU A OE1  1  
ATOM 860   O OE2  . GLU A 1 57  ? -2.344  -13.398 10.170  1.00 0.00 ? 57  GLU A OE2  1  
ATOM 861   H H    . GLU A 1 57  ? -0.335  -9.469  8.864   1.00 0.00 ? 57  GLU A H    1  
ATOM 862   H HA   . GLU A 1 57  ? 1.970   -11.240 8.989   1.00 0.00 ? 57  GLU A HA   1  
ATOM 863   H HB2  . GLU A 1 57  ? -0.139  -11.951 7.087   1.00 0.00 ? 57  GLU A HB2  1  
ATOM 864   H HB3  . GLU A 1 57  ? 0.578   -12.897 8.382   1.00 0.00 ? 57  GLU A HB3  1  
ATOM 865   H HG2  . GLU A 1 57  ? -1.087  -10.782 9.419   1.00 0.00 ? 57  GLU A HG2  1  
ATOM 866   H HG3  . GLU A 1 57  ? -1.973  -11.825 8.308   1.00 0.00 ? 57  GLU A HG3  1  
ATOM 867   N N    . ALA A 1 58  ? 1.050   -9.768  6.186   1.00 0.00 ? 58  ALA A N    1  
ATOM 868   C CA   . ALA A 1 58  ? 1.517   -9.348  4.869   1.00 0.00 ? 58  ALA A CA   1  
ATOM 869   C C    . ALA A 1 58  ? 2.755   -8.456  4.964   1.00 0.00 ? 58  ALA A C    1  
ATOM 870   O O    . ALA A 1 58  ? 3.529   -8.353  4.012   1.00 0.00 ? 58  ALA A O    1  
ATOM 871   C CB   . ALA A 1 58  ? 0.401   -8.633  4.123   1.00 0.00 ? 58  ALA A CB   1  
ATOM 872   H H    . ALA A 1 58  ? 0.140   -9.534  6.467   1.00 0.00 ? 58  ALA A H    1  
ATOM 873   H HA   . ALA A 1 58  ? 1.774   -10.238 4.311   1.00 0.00 ? 58  ALA A HA   1  
ATOM 874   H HB1  . ALA A 1 58  ? 0.778   -8.260  3.181   1.00 0.00 ? 58  ALA A HB1  1  
ATOM 875   H HB2  . ALA A 1 58  ? 0.041   -7.806  4.718   1.00 0.00 ? 58  ALA A HB2  1  
ATOM 876   H HB3  . ALA A 1 58  ? -0.410  -9.324  3.939   1.00 0.00 ? 58  ALA A HB3  1  
ATOM 877   N N    . LEU A 1 59  ? 2.934   -7.812  6.113   1.00 0.00 ? 59  LEU A N    1  
ATOM 878   C CA   . LEU A 1 59  ? 4.077   -6.926  6.327   1.00 0.00 ? 59  LEU A CA   1  
ATOM 879   C C    . LEU A 1 59  ? 5.345   -7.713  6.651   1.00 0.00 ? 59  LEU A C    1  
ATOM 880   O O    . LEU A 1 59  ? 6.420   -7.131  6.812   1.00 0.00 ? 59  LEU A O    1  
ATOM 881   C CB   . LEU A 1 59  ? 3.780   -5.936  7.456   1.00 0.00 ? 59  LEU A CB   1  
ATOM 882   C CG   . LEU A 1 59  ? 2.852   -4.776  7.081   1.00 0.00 ? 59  LEU A CG   1  
ATOM 883   C CD1  . LEU A 1 59  ? 2.682   -3.829  8.258   1.00 0.00 ? 59  LEU A CD1  1  
ATOM 884   C CD2  . LEU A 1 59  ? 3.386   -4.028  5.868   1.00 0.00 ? 59  LEU A CD2  1  
ATOM 885   H H    . LEU A 1 59  ? 2.283   -7.930  6.834   1.00 0.00 ? 59  LEU A H    1  
ATOM 886   H HA   . LEU A 1 59  ? 4.238   -6.373  5.414   1.00 0.00 ? 59  LEU A HA   1  
ATOM 887   H HB2  . LEU A 1 59  ? 3.330   -6.479  8.273   1.00 0.00 ? 59  LEU A HB2  1  
ATOM 888   H HB3  . LEU A 1 59  ? 4.715   -5.519  7.797   1.00 0.00 ? 59  LEU A HB3  1  
ATOM 889   H HG   . LEU A 1 59  ? 1.879   -5.172  6.830   1.00 0.00 ? 59  LEU A HG   1  
ATOM 890   H HD11 . LEU A 1 59  ? 1.976   -3.055  7.999   1.00 0.00 ? 59  LEU A HD11 1  
ATOM 891   H HD12 . LEU A 1 59  ? 3.633   -3.382  8.501   1.00 0.00 ? 59  LEU A HD12 1  
ATOM 892   H HD13 . LEU A 1 59  ? 2.314   -4.379  9.113   1.00 0.00 ? 59  LEU A HD13 1  
ATOM 893   H HD21 . LEU A 1 59  ? 3.566   -2.997  6.132   1.00 0.00 ? 59  LEU A HD21 1  
ATOM 894   H HD22 . LEU A 1 59  ? 2.657   -4.072  5.069   1.00 0.00 ? 59  LEU A HD22 1  
ATOM 895   H HD23 . LEU A 1 59  ? 4.308   -4.484  5.539   1.00 0.00 ? 59  LEU A HD23 1  
ATOM 896   N N    . SER A 1 60  ? 5.222   -9.033  6.744   1.00 0.00 ? 60  SER A N    1  
ATOM 897   C CA   . SER A 1 60  ? 6.366   -9.889  7.046   1.00 0.00 ? 60  SER A CA   1  
ATOM 898   C C    . SER A 1 60  ? 7.042   -10.366 5.758   1.00 0.00 ? 60  SER A C    1  
ATOM 899   O O    . SER A 1 60  ? 7.281   -9.570  4.849   1.00 0.00 ? 60  SER A O    1  
ATOM 900   C CB   . SER A 1 60  ? 5.925   -11.081 7.902   1.00 0.00 ? 60  SER A CB   1  
ATOM 901   O OG   . SER A 1 60  ? 5.199   -12.024 7.136   1.00 0.00 ? 60  SER A OG   1  
ATOM 902   H H    . SER A 1 60  ? 4.343   -9.443  6.599   1.00 0.00 ? 60  SER A H    1  
ATOM 903   H HA   . SER A 1 60  ? 7.075   -9.298  7.609   1.00 0.00 ? 60  SER A HA   1  
ATOM 904   H HB2  . SER A 1 60  ? 6.798   -11.567 8.312   1.00 0.00 ? 60  SER A HB2  1  
ATOM 905   H HB3  . SER A 1 60  ? 5.299   -10.728 8.708   1.00 0.00 ? 60  SER A HB3  1  
ATOM 906   H HG   . SER A 1 60  ? 5.150   -11.727 6.224   1.00 0.00 ? 60  SER A HG   1  
ATOM 907   N N    . GLU A 1 61  ? 7.363   -11.662 5.692   1.00 0.00 ? 61  GLU A N    1  
ATOM 908   C CA   . GLU A 1 61  ? 8.023   -12.244 4.521   1.00 0.00 ? 61  GLU A CA   1  
ATOM 909   C C    . GLU A 1 61  ? 7.356   -11.814 3.214   1.00 0.00 ? 61  GLU A C    1  
ATOM 910   O O    . GLU A 1 61  ? 7.947   -11.950 2.143   1.00 0.00 ? 61  GLU A O    1  
ATOM 911   C CB   . GLU A 1 61  ? 8.025   -13.770 4.624   1.00 0.00 ? 61  GLU A CB   1  
ATOM 912   C CG   . GLU A 1 61  ? 9.418   -14.380 4.602   1.00 0.00 ? 61  GLU A CG   1  
ATOM 913   C CD   . GLU A 1 61  ? 10.210  -14.067 5.856   1.00 0.00 ? 61  GLU A CD   1  
ATOM 914   O OE1  . GLU A 1 61  ? 10.018  -14.767 6.872   1.00 0.00 ? 61  GLU A OE1  1  
ATOM 915   O OE2  . GLU A 1 61  ? 11.027  -13.120 5.822   1.00 0.00 ? 61  GLU A OE2  1  
ATOM 916   H H    . GLU A 1 61  ? 7.168   -12.241 6.456   1.00 0.00 ? 61  GLU A H    1  
ATOM 917   H HA   . GLU A 1 61  ? 9.045   -11.897 4.516   1.00 0.00 ? 61  GLU A HA   1  
ATOM 918   H HB2  . GLU A 1 61  ? 7.545   -14.060 5.546   1.00 0.00 ? 61  GLU A HB2  1  
ATOM 919   H HB3  . GLU A 1 61  ? 7.466   -14.176 3.794   1.00 0.00 ? 61  GLU A HB3  1  
ATOM 920   H HG2  . GLU A 1 61  ? 9.327   -15.452 4.511   1.00 0.00 ? 61  GLU A HG2  1  
ATOM 921   H HG3  . GLU A 1 61  ? 9.953   -13.992 3.748   1.00 0.00 ? 61  GLU A HG3  1  
ATOM 922   N N    . GLU A 1 62  ? 6.131   -11.295 3.313   1.00 0.00 ? 62  GLU A N    1  
ATOM 923   C CA   . GLU A 1 62  ? 5.378   -10.833 2.144   1.00 0.00 ? 62  GLU A CA   1  
ATOM 924   C C    . GLU A 1 62  ? 4.795   -11.998 1.356   1.00 0.00 ? 62  GLU A C    1  
ATOM 925   O O    . GLU A 1 62  ? 4.633   -13.099 1.881   1.00 0.00 ? 62  GLU A O    1  
ATOM 926   C CB   . GLU A 1 62  ? 6.258   -9.964  1.239   1.00 0.00 ? 62  GLU A CB   1  
ATOM 927   C CG   . GLU A 1 62  ? 5.580   -8.684  0.779   1.00 0.00 ? 62  GLU A CG   1  
ATOM 928   C CD   . GLU A 1 62  ? 6.496   -7.478  0.855   1.00 0.00 ? 62  GLU A CD   1  
ATOM 929   O OE1  . GLU A 1 62  ? 7.260   -7.252  -0.107  1.00 0.00 ? 62  GLU A OE1  1  
ATOM 930   O OE2  . GLU A 1 62  ? 6.452   -6.761  1.877   1.00 0.00 ? 62  GLU A OE2  1  
ATOM 931   H H    . GLU A 1 62  ? 5.722   -11.213 4.199   1.00 0.00 ? 62  GLU A H    1  
ATOM 932   H HA   . GLU A 1 62  ? 4.559   -10.231 2.502   1.00 0.00 ? 62  GLU A HA   1  
ATOM 933   H HB2  . GLU A 1 62  ? 7.155   -9.698  1.775   1.00 0.00 ? 62  GLU A HB2  1  
ATOM 934   H HB3  . GLU A 1 62  ? 6.530   -10.536 0.363   1.00 0.00 ? 62  GLU A HB3  1  
ATOM 935   H HG2  . GLU A 1 62  ? 5.258   -8.808  -0.243  1.00 0.00 ? 62  GLU A HG2  1  
ATOM 936   H HG3  . GLU A 1 62  ? 4.719   -8.501  1.406   1.00 0.00 ? 62  GLU A HG3  1  
ATOM 937   N N    . HIS A 1 63  ? 4.475   -11.725 0.093   1.00 0.00 ? 63  HIS A N    1  
ATOM 938   C CA   . HIS A 1 63  ? 3.891   -12.715 -0.813  1.00 0.00 ? 63  HIS A CA   1  
ATOM 939   C C    . HIS A 1 63  ? 2.838   -13.573 -0.109  1.00 0.00 ? 63  HIS A C    1  
ATOM 940   O O    . HIS A 1 63  ? 2.193   -13.122 0.840   1.00 0.00 ? 63  HIS A O    1  
ATOM 941   C CB   . HIS A 1 63  ? 4.976   -13.597 -1.455  1.00 0.00 ? 63  HIS A CB   1  
ATOM 942   C CG   . HIS A 1 63  ? 5.892   -14.275 -0.482  1.00 0.00 ? 63  HIS A CG   1  
ATOM 943   N ND1  . HIS A 1 63  ? 7.098   -13.738 -0.086  1.00 0.00 ? 63  HIS A ND1  1  
ATOM 944   C CD2  . HIS A 1 63  ? 5.781   -15.461 0.160   1.00 0.00 ? 63  HIS A CD2  1  
ATOM 945   C CE1  . HIS A 1 63  ? 7.691   -14.566 0.757   1.00 0.00 ? 63  HIS A CE1  1  
ATOM 946   N NE2  . HIS A 1 63  ? 6.913   -15.618 0.922   1.00 0.00 ? 63  HIS A NE2  1  
ATOM 947   H H    . HIS A 1 63  ? 4.634   -10.819 -0.240  1.00 0.00 ? 63  HIS A H    1  
ATOM 948   H HA   . HIS A 1 63  ? 3.394   -12.165 -1.600  1.00 0.00 ? 63  HIS A HA   1  
ATOM 949   H HB2  . HIS A 1 63  ? 4.497   -14.365 -2.042  1.00 0.00 ? 63  HIS A HB2  1  
ATOM 950   H HB3  . HIS A 1 63  ? 5.580   -12.983 -2.107  1.00 0.00 ? 63  HIS A HB3  1  
ATOM 951   H HD1  . HIS A 1 63  ? 7.467   -12.877 -0.376  1.00 0.00 ? 63  HIS A HD1  1  
ATOM 952   H HD2  . HIS A 1 63  ? 4.953   -16.152 0.092   1.00 0.00 ? 63  HIS A HD2  1  
ATOM 953   H HE1  . HIS A 1 63  ? 8.649   -14.407 1.231   1.00 0.00 ? 63  HIS A HE1  1  
ATOM 954   H HE2  . HIS A 1 63  ? 7.080   -16.352 1.549   1.00 0.00 ? 63  HIS A HE2  1  
ATOM 955   N N    . MET A 1 64  ? 2.654   -14.799 -0.585  1.00 0.00 ? 64  MET A N    1  
ATOM 956   C CA   . MET A 1 64  ? 1.665   -15.710 -0.011  1.00 0.00 ? 64  MET A CA   1  
ATOM 957   C C    . MET A 1 64  ? 2.003   -16.074 1.430   1.00 0.00 ? 64  MET A C    1  
ATOM 958   O O    . MET A 1 64  ? 1.181   -16.670 2.128   1.00 0.00 ? 64  MET A O    1  
ATOM 959   C CB   . MET A 1 64  ? 1.562   -16.984 -0.856  1.00 0.00 ? 64  MET A CB   1  
ATOM 960   C CG   . MET A 1 64  ? 1.848   -16.764 -2.333  1.00 0.00 ? 64  MET A CG   1  
ATOM 961   S SD   . MET A 1 64  ? 0.457   -16.022 -3.207  1.00 0.00 ? 64  MET A SD   1  
ATOM 962   C CE   . MET A 1 64  ? 0.630   -16.782 -4.820  1.00 0.00 ? 64  MET A CE   1  
ATOM 963   H H    . MET A 1 64  ? 3.189   -15.098 -1.351  1.00 0.00 ? 64  MET A H    1  
ATOM 964   H HA   . MET A 1 64  ? 0.711   -15.209 -0.023  1.00 0.00 ? 64  MET A HA   1  
ATOM 965   H HB2  . MET A 1 64  ? 2.269   -17.709 -0.479  1.00 0.00 ? 64  MET A HB2  1  
ATOM 966   H HB3  . MET A 1 64  ? 0.564   -17.384 -0.760  1.00 0.00 ? 64  MET A HB3  1  
ATOM 967   H HG2  . MET A 1 64  ? 2.703   -16.110 -2.428  1.00 0.00 ? 64  MET A HG2  1  
ATOM 968   H HG3  . MET A 1 64  ? 2.074   -17.718 -2.787  1.00 0.00 ? 64  MET A HG3  1  
ATOM 969   H HE1  . MET A 1 64  ? 0.546   -17.853 -4.724  1.00 0.00 ? 64  MET A HE1  1  
ATOM 970   H HE2  . MET A 1 64  ? 1.596   -16.530 -5.234  1.00 0.00 ? 64  MET A HE2  1  
ATOM 971   H HE3  . MET A 1 64  ? -0.147  -16.416 -5.475  1.00 0.00 ? 64  MET A HE3  1  
ATOM 972   N N    . GLU A 1 65  ? 3.212   -15.714 1.862   1.00 0.00 ? 65  GLU A N    1  
ATOM 973   C CA   . GLU A 1 65  ? 3.682   -15.999 3.219   1.00 0.00 ? 65  GLU A CA   1  
ATOM 974   C C    . GLU A 1 65  ? 4.029   -17.475 3.387   1.00 0.00 ? 65  GLU A C    1  
ATOM 975   O O    . GLU A 1 65  ? 5.043   -17.820 3.995   1.00 0.00 ? 65  GLU A O    1  
ATOM 976   C CB   . GLU A 1 65  ? 2.637   -15.588 4.261   1.00 0.00 ? 65  GLU A CB   1  
ATOM 977   C CG   . GLU A 1 65  ? 2.825   -14.174 4.778   1.00 0.00 ? 65  GLU A CG   1  
ATOM 978   C CD   . GLU A 1 65  ? 3.340   -14.140 6.203   1.00 0.00 ? 65  GLU A CD   1  
ATOM 979   O OE1  . GLU A 1 65  ? 4.465   -14.630 6.439   1.00 0.00 ? 65  GLU A OE1  1  
ATOM 980   O OE2  . GLU A 1 65  ? 2.620   -13.625 7.084   1.00 0.00 ? 65  GLU A OE2  1  
ATOM 981   H H    . GLU A 1 65  ? 3.810   -15.243 1.247   1.00 0.00 ? 65  GLU A H    1  
ATOM 982   H HA   . GLU A 1 65  ? 4.578   -15.418 3.382   1.00 0.00 ? 65  GLU A HA   1  
ATOM 983   H HB2  . GLU A 1 65  ? 1.655   -15.660 3.818   1.00 0.00 ? 65  GLU A HB2  1  
ATOM 984   H HB3  . GLU A 1 65  ? 2.697   -16.266 5.100   1.00 0.00 ? 65  GLU A HB3  1  
ATOM 985   H HG2  . GLU A 1 65  ? 3.534   -13.666 4.142   1.00 0.00 ? 65  GLU A HG2  1  
ATOM 986   H HG3  . GLU A 1 65  ? 1.875   -13.662 4.740   1.00 0.00 ? 65  GLU A HG3  1  
ATOM 987   N N    . ALA A 1 66  ? 3.181   -18.342 2.845   1.00 0.00 ? 66  ALA A N    1  
ATOM 988   C CA   . ALA A 1 66  ? 3.395   -19.782 2.935   1.00 0.00 ? 66  ALA A CA   1  
ATOM 989   C C    . ALA A 1 66  ? 3.748   -20.373 1.574   1.00 0.00 ? 66  ALA A C    1  
ATOM 990   O O    . ALA A 1 66  ? 3.837   -21.592 1.423   1.00 0.00 ? 66  ALA A O    1  
ATOM 991   C CB   . ALA A 1 66  ? 2.158   -20.461 3.502   1.00 0.00 ? 66  ALA A CB   1  
ATOM 992   H H    . ALA A 1 66  ? 2.392   -18.003 2.375   1.00 0.00 ? 66  ALA A H    1  
ATOM 993   H HA   . ALA A 1 66  ? 4.217   -19.954 3.615   1.00 0.00 ? 66  ALA A HA   1  
ATOM 994   H HB1  . ALA A 1 66  ? 2.367   -20.808 4.504   1.00 0.00 ? 66  ALA A HB1  1  
ATOM 995   H HB2  . ALA A 1 66  ? 1.893   -21.303 2.878   1.00 0.00 ? 66  ALA A HB2  1  
ATOM 996   H HB3  . ALA A 1 66  ? 1.339   -19.759 3.527   1.00 0.00 ? 66  ALA A HB3  1  
ATOM 997   N N    . ASP A 1 67  ? 3.945   -19.501 0.587   1.00 0.00 ? 67  ASP A N    1  
ATOM 998   C CA   . ASP A 1 67  ? 4.288   -19.929 -0.767  1.00 0.00 ? 67  ASP A CA   1  
ATOM 999   C C    . ASP A 1 67  ? 3.201   -20.825 -1.351  1.00 0.00 ? 67  ASP A C    1  
ATOM 1000  O O    . ASP A 1 67  ? 3.153   -22.024 -1.074  1.00 0.00 ? 67  ASP A O    1  
ATOM 1001  C CB   . ASP A 1 67  ? 5.631   -20.664 -0.769  1.00 0.00 ? 67  ASP A CB   1  
ATOM 1002  C CG   . ASP A 1 67  ? 6.369   -20.511 -2.085  1.00 0.00 ? 67  ASP A CG   1  
ATOM 1003  O OD1  . ASP A 1 67  ? 5.727   -20.656 -3.148  1.00 0.00 ? 67  ASP A OD1  1  
ATOM 1004  O OD2  . ASP A 1 67  ? 7.590   -20.250 -2.053  1.00 0.00 ? 67  ASP A OD2  1  
ATOM 1005  H H    . ASP A 1 67  ? 3.856   -18.543 0.775   1.00 0.00 ? 67  ASP A H    1  
ATOM 1006  H HA   . ASP A 1 67  ? 4.373   -19.044 -1.380  1.00 0.00 ? 67  ASP A HA   1  
ATOM 1007  H HB2  . ASP A 1 67  ? 6.253   -20.266 0.018   1.00 0.00 ? 67  ASP A HB2  1  
ATOM 1008  H HB3  . ASP A 1 67  ? 5.459   -21.715 -0.592  1.00 0.00 ? 67  ASP A HB3  1  
ATOM 1009  N N    . GLY A 1 68  ? 2.331   -20.234 -2.165  1.00 0.00 ? 68  GLY A N    1  
ATOM 1010  C CA   . GLY A 1 68  ? 1.254   -20.992 -2.778  1.00 0.00 ? 68  GLY A CA   1  
ATOM 1011  C C    . GLY A 1 68  ? -0.021  -20.951 -1.957  1.00 0.00 ? 68  GLY A C    1  
ATOM 1012  O O    . GLY A 1 68  ? -0.803  -21.901 -1.968  1.00 0.00 ? 68  GLY A O    1  
ATOM 1013  H H    . GLY A 1 68  ? 2.420   -19.275 -2.350  1.00 0.00 ? 68  GLY A H    1  
ATOM 1014  H HA2  . GLY A 1 68  ? 1.053   -20.583 -3.757  1.00 0.00 ? 68  GLY A HA2  1  
ATOM 1015  H HA3  . GLY A 1 68  ? 1.567   -22.019 -2.885  1.00 0.00 ? 68  GLY A HA3  1  
ATOM 1016  N N    . HIS A 1 69  ? -0.225  -19.849 -1.245  1.00 0.00 ? 69  HIS A N    1  
ATOM 1017  C CA   . HIS A 1 69  ? -1.411  -19.683 -0.412  1.00 0.00 ? 69  HIS A CA   1  
ATOM 1018  C C    . HIS A 1 69  ? -2.142  -18.390 -0.757  1.00 0.00 ? 69  HIS A C    1  
ATOM 1019  O O    . HIS A 1 69  ? -1.649  -17.577 -1.539  1.00 0.00 ? 69  HIS A O    1  
ATOM 1020  C CB   . HIS A 1 69  ? -1.024  -19.684 1.068   1.00 0.00 ? 69  HIS A CB   1  
ATOM 1021  C CG   . HIS A 1 69  ? -1.265  -20.994 1.751   1.00 0.00 ? 69  HIS A CG   1  
ATOM 1022  N ND1  . HIS A 1 69  ? -2.401  -21.260 2.488   1.00 0.00 ? 69  HIS A ND1  1  
ATOM 1023  C CD2  . HIS A 1 69  ? -0.512  -22.119 1.805   1.00 0.00 ? 69  HIS A CD2  1  
ATOM 1024  C CE1  . HIS A 1 69  ? -2.335  -22.491 2.965   1.00 0.00 ? 69  HIS A CE1  1  
ATOM 1025  N NE2  . HIS A 1 69  ? -1.200  -23.032 2.565   1.00 0.00 ? 69  HIS A NE2  1  
ATOM 1026  H H    . HIS A 1 69  ? 0.438   -19.129 -1.278  1.00 0.00 ? 69  HIS A H    1  
ATOM 1027  H HA   . HIS A 1 69  ? -2.069  -20.517 -0.603  1.00 0.00 ? 69  HIS A HA   1  
ATOM 1028  H HB2  . HIS A 1 69  ? 0.028   -19.451 1.158   1.00 0.00 ? 69  HIS A HB2  1  
ATOM 1029  H HB3  . HIS A 1 69  ? -1.599  -18.928 1.583   1.00 0.00 ? 69  HIS A HB3  1  
ATOM 1030  H HD1  . HIS A 1 69  ? -3.145  -20.641 2.637   1.00 0.00 ? 69  HIS A HD1  1  
ATOM 1031  H HD2  . HIS A 1 69  ? 0.451   -22.268 1.337   1.00 0.00 ? 69  HIS A HD2  1  
ATOM 1032  H HE1  . HIS A 1 69  ? -3.083  -22.973 3.577   1.00 0.00 ? 69  HIS A HE1  1  
ATOM 1033  H HE2  . HIS A 1 69  ? -0.883  -23.928 2.806   1.00 0.00 ? 69  HIS A HE2  1  
ATOM 1034  N N    . ALA A 1 70  ? -3.320  -18.208 -0.170  1.00 0.00 ? 70  ALA A N    1  
ATOM 1035  C CA   . ALA A 1 70  ? -4.120  -17.014 -0.413  1.00 0.00 ? 70  ALA A CA   1  
ATOM 1036  C C    . ALA A 1 70  ? -4.595  -16.400 0.900   1.00 0.00 ? 70  ALA A C    1  
ATOM 1037  O O    . ALA A 1 70  ? -5.569  -15.648 0.929   1.00 0.00 ? 70  ALA A O    1  
ATOM 1038  C CB   . ALA A 1 70  ? -5.306  -17.348 -1.305  1.00 0.00 ? 70  ALA A CB   1  
ATOM 1039  H H    . ALA A 1 70  ? -3.659  -18.893 0.442   1.00 0.00 ? 70  ALA A H    1  
ATOM 1040  H HA   . ALA A 1 70  ? -3.499  -16.297 -0.932  1.00 0.00 ? 70  ALA A HA   1  
ATOM 1041  H HB1  . ALA A 1 70  ? -6.181  -17.511 -0.695  1.00 0.00 ? 70  ALA A HB1  1  
ATOM 1042  H HB2  . ALA A 1 70  ? -5.090  -18.245 -1.870  1.00 0.00 ? 70  ALA A HB2  1  
ATOM 1043  H HB3  . ALA A 1 70  ? -5.487  -16.529 -1.985  1.00 0.00 ? 70  ALA A HB3  1  
ATOM 1044  N N    . ALA A 1 71  ? -3.900  -16.730 1.985   1.00 0.00 ? 71  ALA A N    1  
ATOM 1045  C CA   . ALA A 1 71  ? -4.248  -16.216 3.303   1.00 0.00 ? 71  ALA A CA   1  
ATOM 1046  C C    . ALA A 1 71  ? -3.878  -14.743 3.438   1.00 0.00 ? 71  ALA A C    1  
ATOM 1047  O O    . ALA A 1 71  ? -4.749  -13.890 3.623   1.00 0.00 ? 71  ALA A O    1  
ATOM 1048  C CB   . ALA A 1 71  ? -3.559  -17.035 4.385   1.00 0.00 ? 71  ALA A CB   1  
ATOM 1049  H H    . ALA A 1 71  ? -3.136  -17.336 1.894   1.00 0.00 ? 71  ALA A H    1  
ATOM 1050  H HA   . ALA A 1 71  ? -5.314  -16.323 3.430   1.00 0.00 ? 71  ALA A HA   1  
ATOM 1051  H HB1  . ALA A 1 71  ? -4.239  -17.187 5.210   1.00 0.00 ? 71  ALA A HB1  1  
ATOM 1052  H HB2  . ALA A 1 71  ? -2.683  -16.509 4.732   1.00 0.00 ? 71  ALA A HB2  1  
ATOM 1053  H HB3  . ALA A 1 71  ? -3.265  -17.993 3.980   1.00 0.00 ? 71  ALA A HB3  1  
ATOM 1054  N N    . VAL A 1 72  ? -2.584  -14.450 3.349   1.00 0.00 ? 72  VAL A N    1  
ATOM 1055  C CA   . VAL A 1 72  ? -2.105  -13.078 3.465   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1056  C C    . VAL A 1 72  ? -1.146  -12.726 2.338   1.00 0.00 ? 72  VAL A C    1  
ATOM 1057  O O    . VAL A 1 72  ? -0.015  -13.211 2.290   1.00 0.00 ? 72  VAL A O    1  
ATOM 1058  C CB   . VAL A 1 72  ? -1.413  -12.831 4.814   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1059  C CG1  . VAL A 1 72  ? -2.425  -12.345 5.833   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1060  C CG2  . VAL A 1 72  ? -0.713  -14.092 5.297   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1061  H H    . VAL A 1 72  ? -1.939  -15.173 3.203   1.00 0.00 ? 72  VAL A H    1  
ATOM 1062  H HA   . VAL A 1 72  ? -2.962  -12.422 3.404   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1063  H HB   . VAL A 1 72  ? -0.669  -12.058 4.683   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1064  H HG11 . VAL A 1 72  ? -1.983  -11.570 6.441   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1065  H HG12 . VAL A 1 72  ? -2.728  -13.169 6.461   1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1066  H HG13 . VAL A 1 72  ? -3.287  -11.950 5.315   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1067  H HG21 . VAL A 1 72  ? 0.110   -14.321 4.639   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1068  H HG22 . VAL A 1 72  ? -1.413  -14.914 5.297   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1069  H HG23 . VAL A 1 72  ? -0.342  -13.936 6.300   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1070  N N    . VAL A 1 73  ? -1.613  -11.874 1.437   1.00 0.00 ? 73  VAL A N    1  
ATOM 1071  C CA   . VAL A 1 73  ? -0.812  -11.436 0.301   1.00 0.00 ? 73  VAL A CA   1  
ATOM 1072  C C    . VAL A 1 73  ? -1.000  -9.943  0.042   1.00 0.00 ? 73  VAL A C    1  
ATOM 1073  O O    . VAL A 1 73  ? -2.117  -9.429  0.110   1.00 0.00 ? 73  VAL A O    1  
ATOM 1074  C CB   . VAL A 1 73  ? -1.173  -12.224 -0.975  1.00 0.00 ? 73  VAL A CB   1  
ATOM 1075  C CG1  . VAL A 1 73  ? -2.661  -12.109 -1.275  1.00 0.00 ? 73  VAL A CG1  1  
ATOM 1076  C CG2  . VAL A 1 73  ? -0.346  -11.745 -2.158  1.00 0.00 ? 73  VAL A CG2  1  
ATOM 1077  H H    . VAL A 1 73  ? -2.523  -11.527 1.544   1.00 0.00 ? 73  VAL A H    1  
ATOM 1078  H HA   . VAL A 1 73  ? 0.226   -11.624 0.532   1.00 0.00 ? 73  VAL A HA   1  
ATOM 1079  H HB   . VAL A 1 73  ? -0.947  -13.266 -0.805  1.00 0.00 ? 73  VAL A HB   1  
ATOM 1080  H HG11 . VAL A 1 73  ? -3.143  -11.557 -0.481  1.00 0.00 ? 73  VAL A HG11 1  
ATOM 1081  H HG12 . VAL A 1 73  ? -3.093  -13.096 -1.343  1.00 0.00 ? 73  VAL A HG12 1  
ATOM 1082  H HG13 . VAL A 1 73  ? -2.801  -11.588 -2.210  1.00 0.00 ? 73  VAL A HG13 1  
ATOM 1083  H HG21 . VAL A 1 73  ? 0.050   -10.762 -1.946  1.00 0.00 ? 73  VAL A HG21 1  
ATOM 1084  H HG22 . VAL A 1 73  ? -0.967  -11.700 -3.040  1.00 0.00 ? 73  VAL A HG22 1  
ATOM 1085  H HG23 . VAL A 1 73  ? 0.470   -12.432 -2.328  1.00 0.00 ? 73  VAL A HG23 1  
ATOM 1086  N N    . PHE A 1 74  ? 0.098   -9.252  -0.255  1.00 0.00 ? 74  PHE A N    1  
ATOM 1087  C CA   . PHE A 1 74  ? 0.044   -7.819  -0.524  1.00 0.00 ? 74  PHE A CA   1  
ATOM 1088  C C    . PHE A 1 74  ? 1.074   -7.422  -1.581  1.00 0.00 ? 74  PHE A C    1  
ATOM 1089  O O    . PHE A 1 74  ? 2.079   -6.777  -1.283  1.00 0.00 ? 74  PHE A O    1  
ATOM 1090  C CB   . PHE A 1 74  ? 0.264   -7.026  0.763   1.00 0.00 ? 74  PHE A CB   1  
ATOM 1091  C CG   . PHE A 1 74  ? -0.106  -5.576  0.641   1.00 0.00 ? 74  PHE A CG   1  
ATOM 1092  C CD1  . PHE A 1 74  ? -1.413  -5.192  0.355   1.00 0.00 ? 74  PHE A CD1  1  
ATOM 1093  C CD2  . PHE A 1 74  ? 0.855   -4.592  0.810   1.00 0.00 ? 74  PHE A CD2  1  
ATOM 1094  C CE1  . PHE A 1 74  ? -1.743  -3.857  0.242   1.00 0.00 ? 74  PHE A CE1  1  
ATOM 1095  C CE2  . PHE A 1 74  ? 0.526   -3.257  0.700   1.00 0.00 ? 74  PHE A CE2  1  
ATOM 1096  C CZ   . PHE A 1 74  ? -0.774  -2.889  0.415   1.00 0.00 ? 74  PHE A CZ   1  
ATOM 1097  H H    . PHE A 1 74  ? 0.960   -9.716  -0.295  1.00 0.00 ? 74  PHE A H    1  
ATOM 1098  H HA   . PHE A 1 74  ? -0.942  -7.596  -0.907  1.00 0.00 ? 74  PHE A HA   1  
ATOM 1099  H HB2  . PHE A 1 74  ? -0.335  -7.455  1.552   1.00 0.00 ? 74  PHE A HB2  1  
ATOM 1100  H HB3  . PHE A 1 74  ? 1.308   -7.082  1.038   1.00 0.00 ? 74  PHE A HB3  1  
ATOM 1101  H HD1  . PHE A 1 74  ? -2.179  -5.948  0.222   1.00 0.00 ? 74  PHE A HD1  1  
ATOM 1102  H HD2  . PHE A 1 74  ? 1.873   -4.876  1.030   1.00 0.00 ? 74  PHE A HD2  1  
ATOM 1103  H HE1  . PHE A 1 74  ? -2.761  -3.570  0.020   1.00 0.00 ? 74  PHE A HE1  1  
ATOM 1104  H HE2  . PHE A 1 74  ? 1.284   -2.501  0.837   1.00 0.00 ? 74  PHE A HE2  1  
ATOM 1105  H HZ   . PHE A 1 74  ? -1.032  -1.843  0.326   1.00 0.00 ? 74  PHE A HZ   1  
ATOM 1106  N N    . GLY A 1 75  ? 0.800   -7.820  -2.815  1.00 0.00 ? 75  GLY A N    1  
ATOM 1107  C CA   . GLY A 1 75  ? 1.675   -7.519  -3.934  1.00 0.00 ? 75  GLY A CA   1  
ATOM 1108  C C    . GLY A 1 75  ? 1.046   -7.974  -5.232  1.00 0.00 ? 75  GLY A C    1  
ATOM 1109  O O    . GLY A 1 75  ? 1.715   -8.145  -6.250  1.00 0.00 ? 75  GLY A O    1  
ATOM 1110  H H    . GLY A 1 75  ? -0.024  -8.329  -2.975  1.00 0.00 ? 75  GLY A H    1  
ATOM 1111  H HA2  . GLY A 1 75  ? 1.852   -6.450  -3.974  1.00 0.00 ? 75  GLY A HA2  1  
ATOM 1112  H HA3  . GLY A 1 75  ? 2.615   -8.033  -3.799  1.00 0.00 ? 75  GLY A HA3  1  
ATOM 1113  N N    . THR A 1 76  ? -0.266  -8.171  -5.164  1.00 0.00 ? 76  THR A N    1  
ATOM 1114  C CA   . THR A 1 76  ? -1.067  -8.613  -6.297  1.00 0.00 ? 76  THR A CA   1  
ATOM 1115  C C    . THR A 1 76  ? -2.470  -8.021  -6.199  1.00 0.00 ? 76  THR A C    1  
ATOM 1116  O O    . THR A 1 76  ? -2.842  -7.477  -5.160  1.00 0.00 ? 76  THR A O    1  
ATOM 1117  C CB   . THR A 1 76  ? -1.169  -10.149 -6.356  1.00 0.00 ? 76  THR A CB   1  
ATOM 1118  O OG1  . THR A 1 76  ? 0.062   -10.740 -5.927  1.00 0.00 ? 76  THR A OG1  1  
ATOM 1119  C CG2  . THR A 1 76  ? -1.496  -10.618 -7.766  1.00 0.00 ? 76  THR A CG2  1  
ATOM 1120  H H    . THR A 1 76  ? -0.714  -8.006  -4.309  1.00 0.00 ? 76  THR A H    1  
ATOM 1121  H HA   . THR A 1 76  ? -0.597  -8.262  -7.204  1.00 0.00 ? 76  THR A HA   1  
ATOM 1122  H HB   . THR A 1 76  ? -1.961  -10.467 -5.694  1.00 0.00 ? 76  THR A HB   1  
ATOM 1123  H HG1  . THR A 1 76  ? -0.041  -11.693 -5.873  1.00 0.00 ? 76  THR A HG1  1  
ATOM 1124  H HG21 . THR A 1 76  ? -0.818  -10.154 -8.466  1.00 0.00 ? 76  THR A HG21 1  
ATOM 1125  H HG22 . THR A 1 76  ? -2.511  -10.341 -8.011  1.00 0.00 ? 76  THR A HG22 1  
ATOM 1126  H HG23 . THR A 1 76  ? -1.393  -11.691 -7.822  1.00 0.00 ? 76  THR A HG23 1  
ATOM 1127  N N    . VAL A 1 77  ? -3.247  -8.125  -7.270  1.00 0.00 ? 77  VAL A N    1  
ATOM 1128  C CA   . VAL A 1 77  ? -4.606  -7.596  -7.255  1.00 0.00 ? 77  VAL A CA   1  
ATOM 1129  C C    . VAL A 1 77  ? -5.424  -8.336  -6.201  1.00 0.00 ? 77  VAL A C    1  
ATOM 1130  O O    . VAL A 1 77  ? -5.857  -9.469  -6.417  1.00 0.00 ? 77  VAL A O    1  
ATOM 1131  C CB   . VAL A 1 77  ? -5.286  -7.743  -8.630  1.00 0.00 ? 77  VAL A CB   1  
ATOM 1132  C CG1  . VAL A 1 77  ? -6.587  -6.955  -8.679  1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1133  C CG2  . VAL A 1 77  ? -4.346  -7.301  -9.742  1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1134  H H    . VAL A 1 77  ? -2.908  -8.568  -8.076  1.00 0.00 ? 77  VAL A H    1  
ATOM 1135  H HA   . VAL A 1 77  ? -4.560  -6.547  -7.000  1.00 0.00 ? 77  VAL A HA   1  
ATOM 1136  H HB   . VAL A 1 77  ? -5.519  -8.788  -8.784  1.00 0.00 ? 77  VAL A HB   1  
ATOM 1137  H HG11 . VAL A 1 77  ? -6.368  -5.897  -8.660  1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1138  H HG12 . VAL A 1 77  ? -7.194  -7.213  -7.823  1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1139  H HG13 . VAL A 1 77  ? -7.120  -7.196  -9.586  1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1140  H HG21 . VAL A 1 77  ? -3.865  -8.165  -10.175 1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1141  H HG22 . VAL A 1 77  ? -3.597  -6.637  -9.336  1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1142  H HG23 . VAL A 1 77  ? -4.909  -6.783  -10.504 1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1143  N N    . VAL A 1 78  ? -5.604  -7.693  -5.049  1.00 0.00 ? 78  VAL A N    1  
ATOM 1144  C CA   . VAL A 1 78  ? -6.340  -8.287  -3.937  1.00 0.00 ? 78  VAL A CA   1  
ATOM 1145  C C    . VAL A 1 78  ? -7.538  -7.438  -3.531  1.00 0.00 ? 78  VAL A C    1  
ATOM 1146  O O    . VAL A 1 78  ? -7.701  -6.311  -3.994  1.00 0.00 ? 78  VAL A O    1  
ATOM 1147  C CB   . VAL A 1 78  ? -5.431  -8.442  -2.702  1.00 0.00 ? 78  VAL A CB   1  
ATOM 1148  C CG1  . VAL A 1 78  ? -4.448  -9.581  -2.890  1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1149  C CG2  . VAL A 1 78  ? -4.699  -7.139  -2.415  1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1150  H H    . VAL A 1 78  ? -5.222  -6.798  -4.937  1.00 0.00 ? 78  VAL A H    1  
ATOM 1151  H HA   . VAL A 1 78  ? -6.678  -9.266  -4.237  1.00 0.00 ? 78  VAL A HA   1  
ATOM 1152  H HB   . VAL A 1 78  ? -6.052  -8.671  -1.847  1.00 0.00 ? 78  VAL A HB   1  
ATOM 1153  H HG11 . VAL A 1 78  ? -3.632  -9.468  -2.190  1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1154  H HG12 . VAL A 1 78  ? -4.063  -9.562  -3.898  1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1155  H HG13 . VAL A 1 78  ? -4.947  -10.521 -2.712  1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1156  H HG21 . VAL A 1 78  ? -4.424  -6.667  -3.347  1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1157  H HG22 . VAL A 1 78  ? -3.806  -7.346  -1.841  1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1158  H HG23 . VAL A 1 78  ? -5.344  -6.480  -1.854  1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1159  N N    . ASP A 1 79  ? -8.353  -7.984  -2.635  1.00 0.00 ? 79  ASP A N    1  
ATOM 1160  C CA   . ASP A 1 79  ? -9.520  -7.276  -2.127  1.00 0.00 ? 79  ASP A CA   1  
ATOM 1161  C C    . ASP A 1 79  ? -9.127  -6.480  -0.890  1.00 0.00 ? 79  ASP A C    1  
ATOM 1162  O O    . ASP A 1 79  ? -8.829  -7.054  0.158   1.00 0.00 ? 79  ASP A O    1  
ATOM 1163  C CB   . ASP A 1 79  ? -10.640 -8.261  -1.786  1.00 0.00 ? 79  ASP A CB   1  
ATOM 1164  C CG   . ASP A 1 79  ? -11.513 -8.581  -2.984  1.00 0.00 ? 79  ASP A CG   1  
ATOM 1165  O OD1  . ASP A 1 79  ? -10.968 -8.704  -4.101  1.00 0.00 ? 79  ASP A OD1  1  
ATOM 1166  O OD2  . ASP A 1 79  ? -12.743 -8.710  -2.805  1.00 0.00 ? 79  ASP A OD2  1  
ATOM 1167  H H    . ASP A 1 79  ? -8.149  -8.878  -2.289  1.00 0.00 ? 79  ASP A H    1  
ATOM 1168  H HA   . ASP A 1 79  ? -9.861  -6.594  -2.893  1.00 0.00 ? 79  ASP A HA   1  
ATOM 1169  H HB2  . ASP A 1 79  ? -10.204 -9.182  -1.428  1.00 0.00 ? 79  ASP A HB2  1  
ATOM 1170  H HB3  . ASP A 1 79  ? -11.262 -7.836  -1.013  1.00 0.00 ? 79  ASP A HB3  1  
ATOM 1171  N N    . ILE A 1 80  ? -9.108  -5.159  -1.020  1.00 0.00 ? 80  ILE A N    1  
ATOM 1172  C CA   . ILE A 1 80  ? -8.724  -4.292  0.083   1.00 0.00 ? 80  ILE A CA   1  
ATOM 1173  C C    . ILE A 1 80  ? -9.939  -3.681  0.775   1.00 0.00 ? 80  ILE A C    1  
ATOM 1174  O O    . ILE A 1 80  ? -11.061 -3.755  0.274   1.00 0.00 ? 80  ILE A O    1  
ATOM 1175  C CB   . ILE A 1 80  ? -7.803  -3.155  -0.400  1.00 0.00 ? 80  ILE A CB   1  
ATOM 1176  C CG1  . ILE A 1 80  ? -8.600  -2.112  -1.189  1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1177  C CG2  . ILE A 1 80  ? -6.671  -3.718  -1.249  1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1178  C CD1  . ILE A 1 80  ? -7.913  -0.768  -1.280  1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1179  H H    . ILE A 1 80  ? -9.346  -4.760  -1.881  1.00 0.00 ? 80  ILE A H    1  
ATOM 1180  H HA   . ILE A 1 80  ? -8.173  -4.888  0.799   1.00 0.00 ? 80  ILE A HA   1  
ATOM 1181  H HB   . ILE A 1 80  ? -7.367  -2.685  0.468   1.00 0.00 ? 80  ILE A HB   1  
ATOM 1182  H HG12 . ILE A 1 80  ? -8.759  -2.473  -2.194  1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1183  H HG13 . ILE A 1 80  ? -9.557  -1.964  -0.707  1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1184  H HG21 . ILE A 1 80  ? -6.985  -4.650  -1.695  1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1185  H HG22 . ILE A 1 80  ? -5.806  -3.890  -0.626  1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1186  H HG23 . ILE A 1 80  ? -6.420  -3.012  -2.027  1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1187  H HD11 . ILE A 1 80  ? -8.585  -0.047  -1.722  1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1188  H HD12 . ILE A 1 80  ? -7.028  -0.857  -1.891  1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1189  H HD13 . ILE A 1 80  ? -7.634  -0.437  -0.289  1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1190  N N    . ILE A 1 81  ? -9.695  -3.063  1.926   1.00 0.00 ? 81  ILE A N    1  
ATOM 1191  C CA   . ILE A 1 81  ? -10.749 -2.419  2.701   1.00 0.00 ? 81  ILE A CA   1  
ATOM 1192  C C    . ILE A 1 81  ? -10.266 -1.069  3.218   1.00 0.00 ? 81  ILE A C    1  
ATOM 1193  O O    . ILE A 1 81  ? -9.177  -0.969  3.778   1.00 0.00 ? 81  ILE A O    1  
ATOM 1194  C CB   . ILE A 1 81  ? -11.191 -3.290  3.891   1.00 0.00 ? 81  ILE A CB   1  
ATOM 1195  C CG1  . ILE A 1 81  ? -9.995  -4.056  4.458   1.00 0.00 ? 81  ILE A CG1  1  
ATOM 1196  C CG2  . ILE A 1 81  ? -12.290 -4.251  3.464   1.00 0.00 ? 81  ILE A CG2  1  
ATOM 1197  C CD1  . ILE A 1 81  ? -9.708  -3.738  5.910   1.00 0.00 ? 81  ILE A CD1  1  
ATOM 1198  H H    . ILE A 1 81  ? -8.775  -3.035  2.264   1.00 0.00 ? 81  ILE A H    1  
ATOM 1199  H HA   . ILE A 1 81  ? -11.598 -2.265  2.052   1.00 0.00 ? 81  ILE A HA   1  
ATOM 1200  H HB   . ILE A 1 81  ? -11.590 -2.641  4.656   1.00 0.00 ? 81  ILE A HB   1  
ATOM 1201  H HG12 . ILE A 1 81  ? -10.183 -5.114  4.382   1.00 0.00 ? 81  ILE A HG12 1  
ATOM 1202  H HG13 . ILE A 1 81  ? -9.114  -3.809  3.884   1.00 0.00 ? 81  ILE A HG13 1  
ATOM 1203  H HG21 . ILE A 1 81  ? -12.400 -4.221  2.390   1.00 0.00 ? 81  ILE A HG21 1  
ATOM 1204  H HG22 . ILE A 1 81  ? -13.220 -3.963  3.930   1.00 0.00 ? 81  ILE A HG22 1  
ATOM 1205  H HG23 . ILE A 1 81  ? -12.031 -5.254  3.772   1.00 0.00 ? 81  ILE A HG23 1  
ATOM 1206  H HD11 . ILE A 1 81  ? -8.668  -3.470  6.023   1.00 0.00 ? 81  ILE A HD11 1  
ATOM 1207  H HD12 . ILE A 1 81  ? -9.923  -4.605  6.519   1.00 0.00 ? 81  ILE A HD12 1  
ATOM 1208  H HD13 . ILE A 1 81  ? -10.328 -2.914  6.229   1.00 0.00 ? 81  ILE A HD13 1  
ATOM 1209  N N    . SER A 1 82  ? -11.075 -0.034  3.027   1.00 0.00 ? 82  SER A N    1  
ATOM 1210  C CA   . SER A 1 82  ? -10.707 1.305   3.474   1.00 0.00 ? 82  SER A CA   1  
ATOM 1211  C C    . SER A 1 82  ? -11.195 1.575   4.894   1.00 0.00 ? 82  SER A C    1  
ATOM 1212  O O    . SER A 1 82  ? -11.954 0.790   5.460   1.00 0.00 ? 82  SER A O    1  
ATOM 1213  C CB   . SER A 1 82  ? -11.270 2.354   2.513   1.00 0.00 ? 82  SER A CB   1  
ATOM 1214  O OG   . SER A 1 82  ? -12.359 3.049   3.094   1.00 0.00 ? 82  SER A OG   1  
ATOM 1215  H H    . SER A 1 82  ? -11.933 -0.172  2.577   1.00 0.00 ? 82  SER A H    1  
ATOM 1216  H HA   . SER A 1 82  ? -9.627  1.368   3.464   1.00 0.00 ? 82  SER A HA   1  
ATOM 1217  H HB2  . SER A 1 82  ? -10.495 3.067   2.268   1.00 0.00 ? 82  SER A HB2  1  
ATOM 1218  H HB3  . SER A 1 82  ? -11.610 1.867   1.611   1.00 0.00 ? 82  SER A HB3  1  
ATOM 1219  H HG   . SER A 1 82  ? -12.251 3.991   2.950   1.00 0.00 ? 82  SER A HG   1  
ATOM 1220  N N    . ARG A 1 83  ? -10.734 2.687   5.462   1.00 0.00 ? 83  ARG A N    1  
ATOM 1221  C CA   . ARG A 1 83  ? -11.101 3.074   6.826   1.00 0.00 ? 83  ARG A CA   1  
ATOM 1222  C C    . ARG A 1 83  ? -12.610 3.004   7.063   1.00 0.00 ? 83  ARG A C    1  
ATOM 1223  O O    . ARG A 1 83  ? -13.054 2.751   8.184   1.00 0.00 ? 83  ARG A O    1  
ATOM 1224  C CB   . ARG A 1 83  ? -10.605 4.491   7.126   1.00 0.00 ? 83  ARG A CB   1  
ATOM 1225  C CG   . ARG A 1 83  ? -11.366 5.578   6.382   1.00 0.00 ? 83  ARG A CG   1  
ATOM 1226  C CD   . ARG A 1 83  ? -10.490 6.790   6.112   1.00 0.00 ? 83  ARG A CD   1  
ATOM 1227  N NE   . ARG A 1 83  ? -10.921 7.963   6.868   1.00 0.00 ? 83  ARG A NE   1  
ATOM 1228  C CZ   . ARG A 1 83  ? -12.029 8.648   6.601   1.00 0.00 ? 83  ARG A CZ   1  
ATOM 1229  N NH1  . ARG A 1 83  ? -12.823 8.273   5.606   1.00 0.00 ? 83  ARG A NH1  1  
ATOM 1230  N NH2  . ARG A 1 83  ? -12.348 9.708   7.330   1.00 0.00 ? 83  ARG A NH2  1  
ATOM 1231  H H    . ARG A 1 83  ? -10.113 3.257   4.956   1.00 0.00 ? 83  ARG A H    1  
ATOM 1232  H HA   . ARG A 1 83  ? -10.615 2.388   7.504   1.00 0.00 ? 83  ARG A HA   1  
ATOM 1233  H HB2  . ARG A 1 83  ? -10.704 4.676   8.187   1.00 0.00 ? 83  ARG A HB2  1  
ATOM 1234  H HB3  . ARG A 1 83  ? -9.564  4.560   6.854   1.00 0.00 ? 83  ARG A HB3  1  
ATOM 1235  H HG2  . ARG A 1 83  ? -11.713 5.181   5.440   1.00 0.00 ? 83  ARG A HG2  1  
ATOM 1236  H HG3  . ARG A 1 83  ? -12.214 5.885   6.979   1.00 0.00 ? 83  ARG A HG3  1  
ATOM 1237  H HD2  . ARG A 1 83  ? -9.473  6.553   6.388   1.00 0.00 ? 83  ARG A HD2  1  
ATOM 1238  H HD3  . ARG A 1 83  ? -10.530 7.020   5.057   1.00 0.00 ? 83  ARG A HD3  1  
ATOM 1239  H HE   . ARG A 1 83  ? -10.356 8.257   7.614   1.00 0.00 ? 83  ARG A HE   1  
ATOM 1240  H HH11 . ARG A 1 83  ? -12.589 7.473   5.054   1.00 0.00 ? 83  ARG A HH11 1  
ATOM 1241  H HH12 . ARG A 1 83  ? -13.656 8.790   5.408   1.00 0.00 ? 83  ARG A HH12 1  
ATOM 1242  H HH21 . ARG A 1 83  ? -11.756 9.993   8.084   1.00 0.00 ? 83  ARG A HH21 1  
ATOM 1243  H HH22 . ARG A 1 83  ? -13.182 10.223  7.128   1.00 0.00 ? 83  ARG A HH22 1  
ATOM 1244  N N    . SER A 1 84  ? -13.396 3.236   6.016   1.00 0.00 ? 84  SER A N    1  
ATOM 1245  C CA   . SER A 1 84  ? -14.851 3.203   6.140   1.00 0.00 ? 84  SER A CA   1  
ATOM 1246  C C    . SER A 1 84  ? -15.399 1.828   5.781   1.00 0.00 ? 84  SER A C    1  
ATOM 1247  O O    . SER A 1 84  ? -16.529 1.486   6.134   1.00 0.00 ? 84  SER A O    1  
ATOM 1248  C CB   . SER A 1 84  ? -15.488 4.267   5.241   1.00 0.00 ? 84  SER A CB   1  
ATOM 1249  O OG   . SER A 1 84  ? -14.710 4.487   4.078   1.00 0.00 ? 84  SER A OG   1  
ATOM 1250  H H    . SER A 1 84  ? -12.994 3.436   5.143   1.00 0.00 ? 84  SER A H    1  
ATOM 1251  H HA   . SER A 1 84  ? -15.101 3.417   7.167   1.00 0.00 ? 84  SER A HA   1  
ATOM 1252  H HB2  . SER A 1 84  ? -16.473 3.941   4.943   1.00 0.00 ? 84  SER A HB2  1  
ATOM 1253  H HB3  . SER A 1 84  ? -15.566 5.195   5.787   1.00 0.00 ? 84  SER A HB3  1  
ATOM 1254  H HG   . SER A 1 84  ? -14.018 3.824   4.025   1.00 0.00 ? 84  SER A HG   1  
ATOM 1255  N N    . GLY A 1 85  ? -14.595 1.048   5.071   1.00 0.00 ? 85  GLY A N    1  
ATOM 1256  C CA   . GLY A 1 85  ? -15.018 -0.276  4.667   1.00 0.00 ? 85  GLY A CA   1  
ATOM 1257  C C    . GLY A 1 85  ? -15.717 -0.259  3.332   1.00 0.00 ? 85  GLY A C    1  
ATOM 1258  O O    . GLY A 1 85  ? -16.853 0.205   3.225   1.00 0.00 ? 85  GLY A O    1  
ATOM 1259  H H    . GLY A 1 85  ? -13.712 1.383   4.814   1.00 0.00 ? 85  GLY A H    1  
ATOM 1260  H HA2  . GLY A 1 85  ? -14.150 -0.918  4.601   1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1261  H HA3  . GLY A 1 85  ? -15.691 -0.672  5.403   1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1262  N N    . GLU A 1 86  ? -15.039 -0.753  2.312   1.00 0.00 ? 86  GLU A N    1  
ATOM 1263  C CA   . GLU A 1 86  ? -15.604 -0.780  0.977   1.00 0.00 ? 86  GLU A CA   1  
ATOM 1264  C C    . GLU A 1 86  ? -15.328 -2.113  0.292   1.00 0.00 ? 86  GLU A C    1  
ATOM 1265  O O    . GLU A 1 86  ? -15.925 -2.420  -0.739  1.00 0.00 ? 86  GLU A O    1  
ATOM 1266  C CB   . GLU A 1 86  ? -15.032 0.373   0.156   1.00 0.00 ? 86  GLU A CB   1  
ATOM 1267  C CG   . GLU A 1 86  ? -15.340 1.744   0.732   1.00 0.00 ? 86  GLU A CG   1  
ATOM 1268  C CD   . GLU A 1 86  ? -16.605 2.350   0.155   1.00 0.00 ? 86  GLU A CD   1  
ATOM 1269  O OE1  . GLU A 1 86  ? -16.702 2.446   -1.086  1.00 0.00 ? 86  GLU A OE1  1  
ATOM 1270  O OE2  . GLU A 1 86  ? -17.497 2.726   0.943   1.00 0.00 ? 86  GLU A OE2  1  
ATOM 1271  H H    . GLU A 1 86  ? -14.135 -1.101  2.460   1.00 0.00 ? 86  GLU A H    1  
ATOM 1272  H HA   . GLU A 1 86  ? -16.672 -0.648  1.069   1.00 0.00 ? 86  GLU A HA   1  
ATOM 1273  H HB2  . GLU A 1 86  ? -13.959 0.262   0.100   1.00 0.00 ? 86  GLU A HB2  1  
ATOM 1274  H HB3  . GLU A 1 86  ? -15.445 0.323   -0.833  1.00 0.00 ? 86  GLU A HB3  1  
ATOM 1275  H HG2  . GLU A 1 86  ? -15.460 1.654   1.801   1.00 0.00 ? 86  GLU A HG2  1  
ATOM 1276  H HG3  . GLU A 1 86  ? -14.512 2.404   0.519   1.00 0.00 ? 86  GLU A HG3  1  
ATOM 1277  N N    . LYS A 1 87  ? -14.425 -2.897  0.885   1.00 0.00 ? 87  LYS A N    1  
ATOM 1278  C CA   . LYS A 1 87  ? -14.052 -4.214  0.358   1.00 0.00 ? 87  LYS A CA   1  
ATOM 1279  C C    . LYS A 1 87  ? -14.111 -4.250  -1.166  1.00 0.00 ? 87  LYS A C    1  
ATOM 1280  O O    . LYS A 1 87  ? -14.786 -5.097  -1.754  1.00 0.00 ? 87  LYS A O    1  
ATOM 1281  C CB   . LYS A 1 87  ? -14.952 -5.305  0.946   1.00 0.00 ? 87  LYS A CB   1  
ATOM 1282  C CG   . LYS A 1 87  ? -16.437 -4.979  0.895   1.00 0.00 ? 87  LYS A CG   1  
ATOM 1283  C CD   . LYS A 1 87  ? -16.984 -4.657  2.276   1.00 0.00 ? 87  LYS A CD   1  
ATOM 1284  C CE   . LYS A 1 87  ? -17.032 -5.891  3.162   1.00 0.00 ? 87  LYS A CE   1  
ATOM 1285  N NZ   . LYS A 1 87  ? -18.220 -5.887  4.059   1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1286  H H    . LYS A 1 87  ? -13.998 -2.584  1.709   1.00 0.00 ? 87  LYS A H    1  
ATOM 1287  H HA   . LYS A 1 87  ? -13.034 -4.406  0.664   1.00 0.00 ? 87  LYS A HA   1  
ATOM 1288  H HB2  . LYS A 1 87  ? -14.789 -6.222  0.398   1.00 0.00 ? 87  LYS A HB2  1  
ATOM 1289  H HB3  . LYS A 1 87  ? -14.677 -5.462  1.979   1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1290  H HG2  . LYS A 1 87  ? -16.586 -4.127  0.252   1.00 0.00 ? 87  LYS A HG2  1  
ATOM 1291  H HG3  . LYS A 1 87  ? -16.969 -5.831  0.497   1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1292  H HD2  . LYS A 1 87  ? -16.348 -3.918  2.741   1.00 0.00 ? 87  LYS A HD2  1  
ATOM 1293  H HD3  . LYS A 1 87  ? -17.984 -4.258  2.173   1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1294  H HE2  . LYS A 1 87  ? -17.071 -6.767  2.533   1.00 0.00 ? 87  LYS A HE2  1  
ATOM 1295  H HE3  . LYS A 1 87  ? -16.135 -5.922  3.764   1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1296  H HZ1  . LYS A 1 87  ? -18.163 -6.679  4.730   1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1297  H HZ2  . LYS A 1 87  ? -19.092 -5.982  3.502   1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1298  H HZ3  . LYS A 1 87  ? -18.259 -4.995  4.596   1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1299  N N    . ILE A 1 88  ? -13.392 -3.331  -1.804  1.00 0.00 ? 88  ILE A N    1  
ATOM 1300  C CA   . ILE A 1 88  ? -13.358 -3.260  -3.256  1.00 0.00 ? 88  ILE A CA   1  
ATOM 1301  C C    . ILE A 1 88  ? -12.055 -3.852  -3.792  1.00 0.00 ? 88  ILE A C    1  
ATOM 1302  O O    . ILE A 1 88  ? -10.969 -3.511  -3.318  1.00 0.00 ? 88  ILE A O    1  
ATOM 1303  C CB   . ILE A 1 88  ? -13.507 -1.803  -3.741  1.00 0.00 ? 88  ILE A CB   1  
ATOM 1304  C CG1  . ILE A 1 88  ? -14.968 -1.359  -3.643  1.00 0.00 ? 88  ILE A CG1  1  
ATOM 1305  C CG2  . ILE A 1 88  ? -12.999 -1.655  -5.165  1.00 0.00 ? 88  ILE A CG2  1  
ATOM 1306  C CD1  . ILE A 1 88  ? -15.140 0.140   -3.528  1.00 0.00 ? 88  ILE A CD1  1  
ATOM 1307  H H    . ILE A 1 88  ? -12.869 -2.687  -1.285  1.00 0.00 ? 88  ILE A H    1  
ATOM 1308  H HA   . ILE A 1 88  ? -14.188 -3.834  -3.637  1.00 0.00 ? 88  ILE A HA   1  
ATOM 1309  H HB   . ILE A 1 88  ? -12.904 -1.171  -3.106  1.00 0.00 ? 88  ILE A HB   1  
ATOM 1310  H HG12 . ILE A 1 88  ? -15.497 -1.686  -4.524  1.00 0.00 ? 88  ILE A HG12 1  
ATOM 1311  H HG13 . ILE A 1 88  ? -15.415 -1.812  -2.771  1.00 0.00 ? 88  ILE A HG13 1  
ATOM 1312  H HG21 . ILE A 1 88  ? -13.131 -2.590  -5.690  1.00 0.00 ? 88  ILE A HG21 1  
ATOM 1313  H HG22 . ILE A 1 88  ? -11.952 -1.397  -5.147  1.00 0.00 ? 88  ILE A HG22 1  
ATOM 1314  H HG23 . ILE A 1 88  ? -13.556 -0.878  -5.668  1.00 0.00 ? 88  ILE A HG23 1  
ATOM 1315  H HD11 . ILE A 1 88  ? -15.477 0.537   -4.475  1.00 0.00 ? 88  ILE A HD11 1  
ATOM 1316  H HD12 . ILE A 1 88  ? -14.195 0.594   -3.263  1.00 0.00 ? 88  ILE A HD12 1  
ATOM 1317  H HD13 . ILE A 1 88  ? -15.870 0.361   -2.764  1.00 0.00 ? 88  ILE A HD13 1  
ATOM 1318  N N    . PRO A 1 89  ? -12.141 -4.750  -4.791  1.00 0.00 ? 89  PRO A N    1  
ATOM 1319  C CA   . PRO A 1 89  ? -10.963 -5.385  -5.385  1.00 0.00 ? 89  PRO A CA   1  
ATOM 1320  C C    . PRO A 1 89  ? -10.106 -4.392  -6.160  1.00 0.00 ? 89  PRO A C    1  
ATOM 1321  O O    . PRO A 1 89  ? -10.615 -3.627  -6.979  1.00 0.00 ? 89  PRO A O    1  
ATOM 1322  C CB   . PRO A 1 89  ? -11.541 -6.439  -6.334  1.00 0.00 ? 89  PRO A CB   1  
ATOM 1323  C CG   . PRO A 1 89  ? -12.991 -6.546  -5.989  1.00 0.00 ? 89  PRO A CG   1  
ATOM 1324  C CD   . PRO A 1 89  ? -13.384 -5.217  -5.416  1.00 0.00 ? 89  PRO A CD   1  
ATOM 1325  H HA   . PRO A 1 89  ? -10.355 -5.870  -4.640  1.00 0.00 ? 89  PRO A HA   1  
ATOM 1326  H HB2  . PRO A 1 89  ? -11.401 -6.112  -7.350  1.00 0.00 ? 89  PRO A HB2  1  
ATOM 1327  H HB3  . PRO A 1 89  ? -11.032 -7.377  -6.181  1.00 0.00 ? 89  PRO A HB3  1  
ATOM 1328  H HG2  . PRO A 1 89  ? -13.564 -6.754  -6.880  1.00 0.00 ? 89  PRO A HG2  1  
ATOM 1329  H HG3  . PRO A 1 89  ? -13.135 -7.327  -5.257  1.00 0.00 ? 89  PRO A HG3  1  
ATOM 1330  H HD2  . PRO A 1 89  ? -13.701 -4.544  -6.200  1.00 0.00 ? 89  PRO A HD2  1  
ATOM 1331  H HD3  . PRO A 1 89  ? -14.165 -5.339  -4.680  1.00 0.00 ? 89  PRO A HD3  1  
ATOM 1332  N N    . VAL A 1 90  ? -8.802  -4.412  -5.901  1.00 0.00 ? 90  VAL A N    1  
ATOM 1333  C CA   . VAL A 1 90  ? -7.871  -3.518  -6.578  1.00 0.00 ? 90  VAL A CA   1  
ATOM 1334  C C    . VAL A 1 90  ? -6.523  -4.197  -6.794  1.00 0.00 ? 90  VAL A C    1  
ATOM 1335  O O    . VAL A 1 90  ? -6.265  -5.273  -6.257  1.00 0.00 ? 90  VAL A O    1  
ATOM 1336  C CB   . VAL A 1 90  ? -7.651  -2.210  -5.788  1.00 0.00 ? 90  VAL A CB   1  
ATOM 1337  C CG1  . VAL A 1 90  ? -8.962  -1.463  -5.599  1.00 0.00 ? 90  VAL A CG1  1  
ATOM 1338  C CG2  . VAL A 1 90  ? -6.999  -2.496  -4.446  1.00 0.00 ? 90  VAL A CG2  1  
ATOM 1339  H H    . VAL A 1 90  ? -8.455  -5.050  -5.243  1.00 0.00 ? 90  VAL A H    1  
ATOM 1340  H HA   . VAL A 1 90  ? -8.291  -3.267  -7.540  1.00 0.00 ? 90  VAL A HA   1  
ATOM 1341  H HB   . VAL A 1 90  ? -6.985  -1.579  -6.358  1.00 0.00 ? 90  VAL A HB   1  
ATOM 1342  H HG11 . VAL A 1 90  ? -9.038  -0.676  -6.334  1.00 0.00 ? 90  VAL A HG11 1  
ATOM 1343  H HG12 . VAL A 1 90  ? -8.992  -1.034  -4.608  1.00 0.00 ? 90  VAL A HG12 1  
ATOM 1344  H HG13 . VAL A 1 90  ? -9.788  -2.149  -5.716  1.00 0.00 ? 90  VAL A HG13 1  
ATOM 1345  H HG21 . VAL A 1 90  ? -7.483  -1.912  -3.679  1.00 0.00 ? 90  VAL A HG21 1  
ATOM 1346  H HG22 . VAL A 1 90  ? -5.952  -2.235  -4.492  1.00 0.00 ? 90  VAL A HG22 1  
ATOM 1347  H HG23 . VAL A 1 90  ? -7.099  -3.546  -4.214  1.00 0.00 ? 90  VAL A HG23 1  
ATOM 1348  N N    . SER A 1 91  ? -5.669  -3.554  -7.580  1.00 0.00 ? 91  SER A N    1  
ATOM 1349  C CA   . SER A 1 91  ? -4.343  -4.086  -7.874  1.00 0.00 ? 91  SER A CA   1  
ATOM 1350  C C    . SER A 1 91  ? -3.297  -3.482  -6.946  1.00 0.00 ? 91  SER A C    1  
ATOM 1351  O O    . SER A 1 91  ? -3.213  -2.264  -6.804  1.00 0.00 ? 91  SER A O    1  
ATOM 1352  C CB   . SER A 1 91  ? -3.972  -3.805  -9.331  1.00 0.00 ? 91  SER A CB   1  
ATOM 1353  O OG   . SER A 1 91  ? -5.004  -4.219  -10.210 1.00 0.00 ? 91  SER A OG   1  
ATOM 1354  H H    . SER A 1 91  ? -5.941  -2.698  -7.966  1.00 0.00 ? 91  SER A H    1  
ATOM 1355  H HA   . SER A 1 91  ? -4.375  -5.153  -7.718  1.00 0.00 ? 91  SER A HA   1  
ATOM 1356  H HB2  . SER A 1 91  ? -3.809  -2.746  -9.461  1.00 0.00 ? 91  SER A HB2  1  
ATOM 1357  H HB3  . SER A 1 91  ? -3.068  -4.341  -9.578  1.00 0.00 ? 91  SER A HB3  1  
ATOM 1358  H HG   . SER A 1 91  ? -4.877  -3.811  -11.068 1.00 0.00 ? 91  SER A HG   1  
ATOM 1359  N N    . VAL A 1 92  ? -2.500  -4.341  -6.317  1.00 0.00 ? 92  VAL A N    1  
ATOM 1360  C CA   . VAL A 1 92  ? -1.459  -3.881  -5.406  1.00 0.00 ? 92  VAL A CA   1  
ATOM 1361  C C    . VAL A 1 92  ? -0.093  -4.412  -5.817  1.00 0.00 ? 92  VAL A C    1  
ATOM 1362  O O    . VAL A 1 92  ? 0.071   -5.605  -6.054  1.00 0.00 ? 92  VAL A O    1  
ATOM 1363  C CB   . VAL A 1 92  ? -1.742  -4.318  -3.956  1.00 0.00 ? 92  VAL A CB   1  
ATOM 1364  C CG1  . VAL A 1 92  ? -0.604  -3.897  -3.036  1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1365  C CG2  . VAL A 1 92  ? -3.069  -3.750  -3.473  1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1366  H H    . VAL A 1 92  ? -2.609  -5.304  -6.471  1.00 0.00 ? 92  VAL A H    1  
ATOM 1367  H HA   . VAL A 1 92  ? -1.439  -2.801  -5.437  1.00 0.00 ? 92  VAL A HA   1  
ATOM 1368  H HB   . VAL A 1 92  ? -1.810  -5.395  -3.935  1.00 0.00 ? 92  VAL A HB   1  
ATOM 1369  H HG11 . VAL A 1 92  ? 0.343   -4.068  -3.531  1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1370  H HG12 . VAL A 1 92  ? -0.643  -4.477  -2.124  1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1371  H HG13 . VAL A 1 92  ? -0.701  -2.847  -2.798  1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1372  H HG21 . VAL A 1 92  ? -3.775  -3.740  -4.289  1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1373  H HG22 . VAL A 1 92  ? -2.918  -2.741  -3.116  1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1374  H HG23 . VAL A 1 92  ? -3.453  -4.362  -2.671  1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1375  N N    . TRP A 1 93  ? 0.888   -3.518  -5.890  1.00 0.00 ? 93  TRP A N    1  
ATOM 1376  C CA   . TRP A 1 93  ? 2.244   -3.910  -6.257  1.00 0.00 ? 93  TRP A CA   1  
ATOM 1377  C C    . TRP A 1 93  ? 3.271   -3.152  -5.425  1.00 0.00 ? 93  TRP A C    1  
ATOM 1378  O O    . TRP A 1 93  ? 3.459   -1.946  -5.595  1.00 0.00 ? 93  TRP A O    1  
ATOM 1379  C CB   . TRP A 1 93  ? 2.520   -3.704  -7.754  1.00 0.00 ? 93  TRP A CB   1  
ATOM 1380  C CG   . TRP A 1 93  ? 1.527   -2.832  -8.471  1.00 0.00 ? 93  TRP A CG   1  
ATOM 1381  C CD1  . TRP A 1 93  ? 0.203   -3.089  -8.691  1.00 0.00 ? 93  TRP A CD1  1  
ATOM 1382  C CD2  . TRP A 1 93  ? 1.797   -1.571  -9.095  1.00 0.00 ? 93  TRP A CD2  1  
ATOM 1383  N NE1  . TRP A 1 93  ? -0.369  -2.059  -9.396  1.00 0.00 ? 93  TRP A NE1  1  
ATOM 1384  C CE2  . TRP A 1 93  ? 0.591   -1.117  -9.659  1.00 0.00 ? 93  TRP A CE2  1  
ATOM 1385  C CE3  . TRP A 1 93  ? 2.942   -0.780  -9.226  1.00 0.00 ? 93  TRP A CE3  1  
ATOM 1386  C CZ2  . TRP A 1 93  ? 0.498   0.092   -10.344 1.00 0.00 ? 93  TRP A CZ2  1  
ATOM 1387  C CZ3  . TRP A 1 93  ? 2.848   0.419   -9.907  1.00 0.00 ? 93  TRP A CZ3  1  
ATOM 1388  C CH2  . TRP A 1 93  ? 1.634   0.846   -10.459 1.00 0.00 ? 93  TRP A CH2  1  
ATOM 1389  H H    . TRP A 1 93  ? 0.689   -2.581  -5.682  1.00 0.00 ? 93  TRP A H    1  
ATOM 1390  H HA   . TRP A 1 93  ? 2.341   -4.962  -6.030  1.00 0.00 ? 93  TRP A HA   1  
ATOM 1391  H HB2  . TRP A 1 93  ? 3.492   -3.251  -7.869  1.00 0.00 ? 93  TRP A HB2  1  
ATOM 1392  H HB3  . TRP A 1 93  ? 2.524   -4.668  -8.240  1.00 0.00 ? 93  TRP A HB3  1  
ATOM 1393  H HD1  . TRP A 1 93  ? -0.310  -3.975  -8.344  1.00 0.00 ? 93  TRP A HD1  1  
ATOM 1394  H HE1  . TRP A 1 93  ? -1.308  -2.008  -9.670  1.00 0.00 ? 93  TRP A HE1  1  
ATOM 1395  H HE3  . TRP A 1 93  ? 3.887   -1.089  -8.809  1.00 0.00 ? 93  TRP A HE3  1  
ATOM 1396  H HZ2  . TRP A 1 93  ? -0.432  0.435   -10.772 1.00 0.00 ? 93  TRP A HZ2  1  
ATOM 1397  H HZ3  . TRP A 1 93  ? 3.722   1.043   -10.020 1.00 0.00 ? 93  TRP A HZ3  1  
ATOM 1398  H HH2  . TRP A 1 93  ? 1.607   1.790   -10.982 1.00 0.00 ? 93  TRP A HH2  1  
ATOM 1399  N N    . MET A 1 94  ? 3.934   -3.872  -4.521  1.00 0.00 ? 94  MET A N    1  
ATOM 1400  C CA   . MET A 1 94  ? 4.943   -3.277  -3.656  1.00 0.00 ? 94  MET A CA   1  
ATOM 1401  C C    . MET A 1 94  ? 6.344   -3.538  -4.199  1.00 0.00 ? 94  MET A C    1  
ATOM 1402  O O    . MET A 1 94  ? 6.654   -4.647  -4.635  1.00 0.00 ? 94  MET A O    1  
ATOM 1403  C CB   . MET A 1 94  ? 4.823   -3.835  -2.234  1.00 0.00 ? 94  MET A CB   1  
ATOM 1404  C CG   . MET A 1 94  ? 5.261   -2.855  -1.161  1.00 0.00 ? 94  MET A CG   1  
ATOM 1405  S SD   . MET A 1 94  ? 5.083   -3.522  0.506   1.00 0.00 ? 94  MET A SD   1  
ATOM 1406  C CE   . MET A 1 94  ? 5.186   -2.022  1.483   1.00 0.00 ? 94  MET A CE   1  
ATOM 1407  H H    . MET A 1 94  ? 3.734   -4.827  -4.434  1.00 0.00 ? 94  MET A H    1  
ATOM 1408  H HA   . MET A 1 94  ? 4.773   -2.211  -3.629  1.00 0.00 ? 94  MET A HA   1  
ATOM 1409  H HB2  . MET A 1 94  ? 3.793   -4.102  -2.050  1.00 0.00 ? 94  MET A HB2  1  
ATOM 1410  H HB3  . MET A 1 94  ? 5.435   -4.721  -2.157  1.00 0.00 ? 94  MET A HB3  1  
ATOM 1411  H HG2  . MET A 1 94  ? 6.299   -2.604  -1.322  1.00 0.00 ? 94  MET A HG2  1  
ATOM 1412  H HG3  . MET A 1 94  ? 4.661   -1.961  -1.241  1.00 0.00 ? 94  MET A HG3  1  
ATOM 1413  H HE1  . MET A 1 94  ? 5.989   -2.113  2.201   1.00 0.00 ? 94  MET A HE1  1  
ATOM 1414  H HE2  . MET A 1 94  ? 4.252   -1.868  2.004   1.00 0.00 ? 94  MET A HE2  1  
ATOM 1415  H HE3  . MET A 1 94  ? 5.379   -1.182  0.834   1.00 0.00 ? 94  MET A HE3  1  
ATOM 1416  N N    . LYS A 1 95  ? 7.184   -2.508  -4.173  1.00 0.00 ? 95  LYS A N    1  
ATOM 1417  C CA   . LYS A 1 95  ? 8.553   -2.628  -4.669  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1418  C C    . LYS A 1 95  ? 9.444   -1.520  -4.116  1.00 0.00 ? 95  LYS A C    1  
ATOM 1419  O O    . LYS A 1 95  ? 9.004   -0.384  -3.938  1.00 0.00 ? 95  LYS A O    1  
ATOM 1420  C CB   . LYS A 1 95  ? 8.567   -2.591  -6.199  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1421  C CG   . LYS A 1 95  ? 7.836   -1.396  -6.785  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1422  C CD   . LYS A 1 95  ? 6.643   -1.827  -7.620  1.00 0.00 ? 95  LYS A CD   1  
ATOM 1423  C CE   . LYS A 1 95  ? 6.777   -1.364  -9.062  1.00 0.00 ? 95  LYS A CE   1  
ATOM 1424  N NZ   . LYS A 1 95  ? 7.697   -2.234  -9.844  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1425  H H    . LYS A 1 95  ? 6.875   -1.648  -3.813  1.00 0.00 ? 95  LYS A H    1  
ATOM 1426  H HA   . LYS A 1 95  ? 8.941   -3.580  -4.340  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1427  H HB2  . LYS A 1 95  ? 9.593   -2.559  -6.536  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1428  H HB3  . LYS A 1 95  ? 8.100   -3.490  -6.573  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1429  H HG2  . LYS A 1 95  ? 7.488   -0.768  -5.977  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1430  H HG3  . LYS A 1 95  ? 8.519   -0.838  -7.409  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1431  H HD2  . LYS A 1 95  ? 6.575   -2.905  -7.604  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1432  H HD3  . LYS A 1 95  ? 5.745   -1.402  -7.195  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1433  H HE2  . LYS A 1 95  ? 5.799   -1.380  -9.523  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1434  H HE3  . LYS A 1 95  ? 7.157   -0.352  -9.067  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1435  H HZ1  . LYS A 1 95  ? 7.320   -2.383  -10.801 1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1436  H HZ2  . LYS A 1 95  ? 7.799   -3.157  -9.375  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1437  H HZ3  . LYS A 1 95  ? 8.635   -1.788  -9.916  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1438  N N    . ARG A 1 96  ? 10.702  -1.861  -3.849  1.00 0.00 ? 96  ARG A N    1  
ATOM 1439  C CA   . ARG A 1 96  ? 11.665  -0.899  -3.321  1.00 0.00 ? 96  ARG A CA   1  
ATOM 1440  C C    . ARG A 1 96  ? 12.218  -0.012  -4.434  1.00 0.00 ? 96  ARG A C    1  
ATOM 1441  O O    . ARG A 1 96  ? 13.005  -0.460  -5.268  1.00 0.00 ? 96  ARG A O    1  
ATOM 1442  C CB   . ARG A 1 96  ? 12.806  -1.631  -2.618  1.00 0.00 ? 96  ARG A CB   1  
ATOM 1443  C CG   . ARG A 1 96  ? 12.461  -2.098  -1.215  1.00 0.00 ? 96  ARG A CG   1  
ATOM 1444  C CD   . ARG A 1 96  ? 12.983  -3.501  -0.951  1.00 0.00 ? 96  ARG A CD   1  
ATOM 1445  N NE   . ARG A 1 96  ? 11.948  -4.377  -0.408  1.00 0.00 ? 96  ARG A NE   1  
ATOM 1446  C CZ   . ARG A 1 96  ? 11.571  -5.518  -0.979  1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1447  N NH1  . ARG A 1 96  ? 12.141  -5.921  -2.107  1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1448  N NH2  . ARG A 1 96  ? 10.622  -6.257  -0.421  1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1449  H H    . ARG A 1 96  ? 10.989  -2.782  -4.016  1.00 0.00 ? 96  ARG A H    1  
ATOM 1450  H HA   . ARG A 1 96  ? 11.151  -0.277  -2.603  1.00 0.00 ? 96  ARG A HA   1  
ATOM 1451  H HB2  . ARG A 1 96  ? 13.073  -2.497  -3.203  1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1452  H HB3  . ARG A 1 96  ? 13.661  -0.972  -2.556  1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1453  H HG2  . ARG A 1 96  ? 12.906  -1.421  -0.501  1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1454  H HG3  . ARG A 1 96  ? 11.388  -2.093  -1.099  1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1455  H HD2  . ARG A 1 96  ? 13.340  -3.919  -1.881  1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1456  H HD3  . ARG A 1 96  ? 13.798  -3.441  -0.247  1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1457  H HE   . ARG A 1 96  ? 11.511  -4.100  0.425   1.00 0.00 ? 96  ARG A HE   1  
ATOM 1458  H HH11 . ARG A 1 96  ? 12.856  -5.366  -2.532  1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1459  H HH12 . ARG A 1 96  ? 11.856  -6.779  -2.532  1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1460  H HH21 . ARG A 1 96  ? 10.190  -5.956  0.428   1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1461  H HH22 . ARG A 1 96  ? 10.340  -7.115  -0.849  1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1462  N N    . MET A 1 97  ? 11.785  1.245   -4.445  1.00 0.00 ? 97  MET A N    1  
ATOM 1463  C CA   . MET A 1 97  ? 12.216  2.203   -5.461  1.00 0.00 ? 97  MET A CA   1  
ATOM 1464  C C    . MET A 1 97  ? 12.997  3.358   -4.841  1.00 0.00 ? 97  MET A C    1  
ATOM 1465  O O    . MET A 1 97  ? 13.387  4.295   -5.540  1.00 0.00 ? 97  MET A O    1  
ATOM 1466  C CB   . MET A 1 97  ? 10.994  2.768   -6.170  1.00 0.00 ? 97  MET A CB   1  
ATOM 1467  C CG   . MET A 1 97  ? 10.129  3.607   -5.250  1.00 0.00 ? 97  MET A CG   1  
ATOM 1468  S SD   . MET A 1 97  ? 9.907   5.292   -5.845  1.00 0.00 ? 97  MET A SD   1  
ATOM 1469  C CE   . MET A 1 97  ? 8.595   5.061   -7.042  1.00 0.00 ? 97  MET A CE   1  
ATOM 1470  H H    . MET A 1 97  ? 11.146  1.528   -3.762  1.00 0.00 ? 97  MET A H    1  
ATOM 1471  H HA   . MET A 1 97  ? 12.840  1.689   -6.174  1.00 0.00 ? 97  MET A HA   1  
ATOM 1472  H HB2  . MET A 1 97  ? 11.319  3.385   -6.996  1.00 0.00 ? 97  MET A HB2  1  
ATOM 1473  H HB3  . MET A 1 97  ? 10.397  1.951   -6.551  1.00 0.00 ? 97  MET A HB3  1  
ATOM 1474  H HG2  . MET A 1 97  ? 9.160   3.138   -5.162  1.00 0.00 ? 97  MET A HG2  1  
ATOM 1475  H HG3  . MET A 1 97  ? 10.606  3.640   -4.274  1.00 0.00 ? 97  MET A HG3  1  
ATOM 1476  H HE1  . MET A 1 97  ? 7.638   5.169   -6.551  1.00 0.00 ? 97  MET A HE1  1  
ATOM 1477  H HE2  . MET A 1 97  ? 8.668   4.073   -7.471  1.00 0.00 ? 97  MET A HE2  1  
ATOM 1478  H HE3  . MET A 1 97  ? 8.684   5.800   -7.821  1.00 0.00 ? 97  MET A HE3  1  
ATOM 1479  N N    . ARG A 1 98  ? 13.218  3.290   -3.534  1.00 0.00 ? 98  ARG A N    1  
ATOM 1480  C CA   . ARG A 1 98  ? 13.948  4.335   -2.819  1.00 0.00 ? 98  ARG A CA   1  
ATOM 1481  C C    . ARG A 1 98  ? 13.250  5.686   -2.967  1.00 0.00 ? 98  ARG A C    1  
ATOM 1482  O O    . ARG A 1 98  ? 12.214  5.793   -3.621  1.00 0.00 ? 98  ARG A O    1  
ATOM 1483  C CB   . ARG A 1 98  ? 15.388  4.429   -3.331  1.00 0.00 ? 98  ARG A CB   1  
ATOM 1484  C CG   . ARG A 1 98  ? 16.235  3.211   -2.997  1.00 0.00 ? 98  ARG A CG   1  
ATOM 1485  C CD   . ARG A 1 98  ? 17.638  3.606   -2.564  1.00 0.00 ? 98  ARG A CD   1  
ATOM 1486  N NE   . ARG A 1 98  ? 18.427  4.128   -3.676  1.00 0.00 ? 98  ARG A NE   1  
ATOM 1487  C CZ   . ARG A 1 98  ? 19.223  3.382   -4.437  1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1488  N NH1  . ARG A 1 98  ? 19.340  2.081   -4.202  1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1489  N NH2  . ARG A 1 98  ? 19.903  3.934   -5.431  1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1490  H H    . ARG A 1 98  ? 12.886  2.516   -3.034  1.00 0.00 ? 98  ARG A H    1  
ATOM 1491  H HA   . ARG A 1 98  ? 13.965  4.068   -1.773  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1492  H HB2  . ARG A 1 98  ? 15.369  4.544   -4.405  1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1493  H HB3  . ARG A 1 98  ? 15.858  5.298   -2.894  1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1494  H HG2  . ARG A 1 98  ? 15.761  2.666   -2.193  1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1495  H HG3  . ARG A 1 98  ? 16.300  2.580   -3.871  1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1496  H HD2  . ARG A 1 98  ? 17.566  4.362   -1.798  1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1497  H HD3  . ARG A 1 98  ? 18.135  2.733   -2.162  1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1498  H HE   . ARG A 1 98  ? 18.359  5.088   -3.867  1.00 0.00 ? 98  ARG A HE   1  
ATOM 1499  H HH11 . ARG A 1 98  ? 18.830  1.660   -3.451  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1500  H HH12 . ARG A 1 98  ? 19.938  1.520   -4.776  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1501  H HH21 . ARG A 1 98  ? 19.818  4.914   -5.612  1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1502  H HH22 . ARG A 1 98  ? 20.499  3.371   -6.004  1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1503  N N    . GLN A 1 99  ? 13.824  6.715   -2.350  1.00 0.00 ? 99  GLN A N    1  
ATOM 1504  C CA   . GLN A 1 99  ? 13.255  8.057   -2.413  1.00 0.00 ? 99  GLN A CA   1  
ATOM 1505  C C    . GLN A 1 99  ? 14.245  9.096   -1.894  1.00 0.00 ? 99  GLN A C    1  
ATOM 1506  O O    . GLN A 1 99  ? 14.112  10.288  -2.174  1.00 0.00 ? 99  GLN A O    1  
ATOM 1507  C CB   . GLN A 1 99  ? 11.959  8.123   -1.600  1.00 0.00 ? 99  GLN A CB   1  
ATOM 1508  C CG   . GLN A 1 99  ? 11.044  9.269   -2.003  1.00 0.00 ? 99  GLN A CG   1  
ATOM 1509  C CD   . GLN A 1 99  ? 10.073  8.881   -3.100  1.00 0.00 ? 99  GLN A CD   1  
ATOM 1510  O OE1  . GLN A 1 99  ? 10.430  8.848   -4.278  1.00 0.00 ? 99  GLN A OE1  1  
ATOM 1511  N NE2  . GLN A 1 99  ? 8.837   8.585   -2.718  1.00 0.00 ? 99  GLN A NE2  1  
ATOM 1512  H H    . GLN A 1 99  ? 14.648  6.569   -1.840  1.00 0.00 ? 99  GLN A H    1  
ATOM 1513  H HA   . GLN A 1 99  ? 13.031  8.275   -3.447  1.00 0.00 ? 99  GLN A HA   1  
ATOM 1514  H HB2  . GLN A 1 99  ? 11.419  7.196   -1.731  1.00 0.00 ? 99  GLN A HB2  1  
ATOM 1515  H HB3  . GLN A 1 99  ? 12.209  8.240   -0.556  1.00 0.00 ? 99  GLN A HB3  1  
ATOM 1516  H HG2  . GLN A 1 99  ? 10.480  9.582   -1.138  1.00 0.00 ? 99  GLN A HG2  1  
ATOM 1517  H HG3  . GLN A 1 99  ? 11.653  10.090  -2.352  1.00 0.00 ? 99  GLN A HG3  1  
ATOM 1518  H HE21 . GLN A 1 99  ? 8.623   8.632   -1.762  1.00 0.00 ? 99  GLN A HE21 1  
ATOM 1519  H HE22 . GLN A 1 99  ? 8.186   8.330   -3.408  1.00 0.00 ? 99  GLN A HE22 1  
ATOM 1520  N N    . GLU A 1 100 ? 15.237  8.634   -1.141  1.00 0.00 ? 100 GLU A N    1  
ATOM 1521  C CA   . GLU A 1 100 ? 16.251  9.522   -0.582  1.00 0.00 ? 100 GLU A CA   1  
ATOM 1522  C C    . GLU A 1 100 ? 17.583  8.795   -0.431  1.00 0.00 ? 100 GLU A C    1  
ATOM 1523  O O    . GLU A 1 100 ? 18.489  8.960   -1.248  1.00 0.00 ? 100 GLU A O    1  
ATOM 1524  C CB   . GLU A 1 100 ? 15.793  10.060  0.777   1.00 0.00 ? 100 GLU A CB   1  
ATOM 1525  C CG   . GLU A 1 100 ? 15.558  11.562  0.792   1.00 0.00 ? 100 GLU A CG   1  
ATOM 1526  C CD   . GLU A 1 100 ? 14.096  11.922  0.965   1.00 0.00 ? 100 GLU A CD   1  
ATOM 1527  O OE1  . GLU A 1 100 ? 13.586  11.810  2.100   1.00 0.00 ? 100 GLU A OE1  1  
ATOM 1528  O OE2  . GLU A 1 100 ? 13.458  12.314  -0.035  1.00 0.00 ? 100 GLU A OE2  1  
ATOM 1529  H H    . GLU A 1 100 ? 15.288  7.674   -0.953  1.00 0.00 ? 100 GLU A H    1  
ATOM 1530  H HA   . GLU A 1 100 ? 16.379  10.348  -1.262  1.00 0.00 ? 100 GLU A HA   1  
ATOM 1531  H HB2  . GLU A 1 100 ? 14.869  9.571   1.050   1.00 0.00 ? 100 GLU A HB2  1  
ATOM 1532  H HB3  . GLU A 1 100 ? 16.545  9.827   1.515   1.00 0.00 ? 100 GLU A HB3  1  
ATOM 1533  H HG2  . GLU A 1 100 ? 16.117  11.992  1.610   1.00 0.00 ? 100 GLU A HG2  1  
ATOM 1534  H HG3  . GLU A 1 100 ? 15.909  11.979  -0.141  1.00 0.00 ? 100 GLU A HG3  1  
ATOM 1535  N N    . ARG A 1 101 ? 17.691  7.988   0.619   1.00 0.00 ? 101 ARG A N    1  
ATOM 1536  C CA   . ARG A 1 101 ? 18.908  7.230   0.883   1.00 0.00 ? 101 ARG A CA   1  
ATOM 1537  C C    . ARG A 1 101 ? 18.572  5.887   1.519   1.00 0.00 ? 101 ARG A C    1  
ATOM 1538  O O    . ARG A 1 101 ? 19.451  5.186   2.021   1.00 0.00 ? 101 ARG A O    1  
ATOM 1539  C CB   . ARG A 1 101 ? 19.839  8.022   1.803   1.00 0.00 ? 101 ARG A CB   1  
ATOM 1540  C CG   . ARG A 1 101 ? 20.728  9.011   1.067   1.00 0.00 ? 101 ARG A CG   1  
ATOM 1541  C CD   . ARG A 1 101 ? 22.192  8.813   1.420   1.00 0.00 ? 101 ARG A CD   1  
ATOM 1542  N NE   . ARG A 1 101 ? 23.035  9.868   0.865   1.00 0.00 ? 101 ARG A NE   1  
ATOM 1543  C CZ   . ARG A 1 101 ? 23.820  9.704   -0.196  1.00 0.00 ? 101 ARG A CZ   1  
ATOM 1544  N NH1  . ARG A 1 101 ? 23.863  8.531   -0.816  1.00 0.00 ? 101 ARG A NH1  1  
ATOM 1545  N NH2  . ARG A 1 101 ? 24.557  10.712  -0.640  1.00 0.00 ? 101 ARG A NH2  1  
ATOM 1546  H H    . ARG A 1 101 ? 16.932  7.899   1.232   1.00 0.00 ? 101 ARG A H    1  
ATOM 1547  H HA   . ARG A 1 101 ? 19.404  7.057   -0.060  1.00 0.00 ? 101 ARG A HA   1  
ATOM 1548  H HB2  . ARG A 1 101 ? 19.240  8.571   2.515   1.00 0.00 ? 101 ARG A HB2  1  
ATOM 1549  H HB3  . ARG A 1 101 ? 20.473  7.329   2.336   1.00 0.00 ? 101 ARG A HB3  1  
ATOM 1550  H HG2  . ARG A 1 101 ? 20.601  8.872   0.004   1.00 0.00 ? 101 ARG A HG2  1  
ATOM 1551  H HG3  . ARG A 1 101 ? 20.433  10.014  1.339   1.00 0.00 ? 101 ARG A HG3  1  
ATOM 1552  H HD2  . ARG A 1 101 ? 22.293  8.814   2.496   1.00 0.00 ? 101 ARG A HD2  1  
ATOM 1553  H HD3  . ARG A 1 101 ? 22.518  7.861   1.029   1.00 0.00 ? 101 ARG A HD3  1  
ATOM 1554  H HE   . ARG A 1 101 ? 23.017  10.744  1.305   1.00 0.00 ? 101 ARG A HE   1  
ATOM 1555  H HH11 . ARG A 1 101 ? 23.307  7.769   -0.486  1.00 0.00 ? 101 ARG A HH11 1  
ATOM 1556  H HH12 . ARG A 1 101 ? 24.453  8.410   -1.614  1.00 0.00 ? 101 ARG A HH12 1  
ATOM 1557  H HH21 . ARG A 1 101 ? 24.527  11.597  -0.176  1.00 0.00 ? 101 ARG A HH21 1  
ATOM 1558  H HH22 . ARG A 1 101 ? 25.148  10.586  -1.439  1.00 0.00 ? 101 ARG A HH22 1  
ATOM 1559  N N    . ARG A 1 102 ? 17.290  5.538   1.497   1.00 0.00 ? 102 ARG A N    1  
ATOM 1560  C CA   . ARG A 1 102 ? 16.823  4.284   2.076   1.00 0.00 ? 102 ARG A CA   1  
ATOM 1561  C C    . ARG A 1 102 ? 15.830  3.592   1.144   1.00 0.00 ? 102 ARG A C    1  
ATOM 1562  O O    . ARG A 1 102 ? 14.978  4.244   0.542   1.00 0.00 ? 102 ARG A O    1  
ATOM 1563  C CB   . ARG A 1 102 ? 16.172  4.550   3.441   1.00 0.00 ? 102 ARG A CB   1  
ATOM 1564  C CG   . ARG A 1 102 ? 15.158  3.495   3.867   1.00 0.00 ? 102 ARG A CG   1  
ATOM 1565  C CD   . ARG A 1 102 ? 13.896  4.127   4.435   1.00 0.00 ? 102 ARG A CD   1  
ATOM 1566  N NE   . ARG A 1 102 ? 14.196  5.153   5.428   1.00 0.00 ? 102 ARG A NE   1  
ATOM 1567  C CZ   . ARG A 1 102 ? 13.806  6.422   5.321   1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1568  N NH1  . ARG A 1 102 ? 13.105  6.817   4.268   1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1569  N NH2  . ARG A 1 102 ? 14.119  7.296   6.268   1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1570  H H    . ARG A 1 102 ? 16.637  6.145   1.086   1.00 0.00 ? 102 ARG A H    1  
ATOM 1571  H HA   . ARG A 1 102 ? 17.680  3.642   2.215   1.00 0.00 ? 102 ARG A HA   1  
ATOM 1572  H HB2  . ARG A 1 102 ? 16.947  4.592   4.191   1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1573  H HB3  . ARG A 1 102 ? 15.668  5.504   3.403   1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1574  H HG2  . ARG A 1 102 ? 14.892  2.895   3.008   1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1575  H HG3  . ARG A 1 102 ? 15.604  2.865   4.622   1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1576  H HD2  . ARG A 1 102 ? 13.334  4.577   3.626   1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1577  H HD3  . ARG A 1 102 ? 13.299  3.353   4.898   1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1578  H HE   . ARG A 1 102 ? 14.714  4.885   6.216   1.00 0.00 ? 102 ARG A HE   1  
ATOM 1579  H HH11 . ARG A 1 102 ? 12.867  6.162   3.551   1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1580  H HH12 . ARG A 1 102 ? 12.814  7.771   4.190   1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1581  H HH21 . ARG A 1 102 ? 14.648  7.002   7.066   1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1582  H HH22 . ARG A 1 102 ? 13.825  8.248   6.186   1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1583  N N    . LEU A 1 103 ? 15.943  2.270   1.039   1.00 0.00 ? 103 LEU A N    1  
ATOM 1584  C CA   . LEU A 1 103 ? 15.043  1.495   0.191   1.00 0.00 ? 103 LEU A CA   1  
ATOM 1585  C C    . LEU A 1 103 ? 13.599  1.776   0.575   1.00 0.00 ? 103 LEU A C    1  
ATOM 1586  O O    . LEU A 1 103 ? 13.124  1.314   1.614   1.00 0.00 ? 103 LEU A O    1  
ATOM 1587  C CB   . LEU A 1 103 ? 15.335  -0.003  0.324   1.00 0.00 ? 103 LEU A CB   1  
ATOM 1588  C CG   . LEU A 1 103 ? 16.811  -0.389  0.249   1.00 0.00 ? 103 LEU A CG   1  
ATOM 1589  C CD1  . LEU A 1 103 ? 17.020  -1.794  0.791   1.00 0.00 ? 103 LEU A CD1  1  
ATOM 1590  C CD2  . LEU A 1 103 ? 17.316  -0.286  -1.183  1.00 0.00 ? 103 LEU A CD2  1  
ATOM 1591  H H    . LEU A 1 103 ? 16.637  1.805   1.551   1.00 0.00 ? 103 LEU A H    1  
ATOM 1592  H HA   . LEU A 1 103 ? 15.201  1.799   -0.832  1.00 0.00 ? 103 LEU A HA   1  
ATOM 1593  H HB2  . LEU A 1 103 ? 14.944  -0.340  1.273   1.00 0.00 ? 103 LEU A HB2  1  
ATOM 1594  H HB3  . LEU A 1 103 ? 14.811  -0.521  -0.464  1.00 0.00 ? 103 LEU A HB3  1  
ATOM 1595  H HG   . LEU A 1 103 ? 17.388  0.291   0.858   1.00 0.00 ? 103 LEU A HG   1  
ATOM 1596  H HD11 . LEU A 1 103 ? 17.953  -1.838  1.329   1.00 0.00 ? 103 LEU A HD11 1  
ATOM 1597  H HD12 . LEU A 1 103 ? 17.044  -2.496  -0.031  1.00 0.00 ? 103 LEU A HD12 1  
ATOM 1598  H HD13 . LEU A 1 103 ? 16.207  -2.048  1.455   1.00 0.00 ? 103 LEU A HD13 1  
ATOM 1599  H HD21 . LEU A 1 103 ? 17.567  -1.271  -1.549  1.00 0.00 ? 103 LEU A HD21 1  
ATOM 1600  H HD22 . LEU A 1 103 ? 18.193  0.344   -1.212  1.00 0.00 ? 103 LEU A HD22 1  
ATOM 1601  H HD23 . LEU A 1 103 ? 16.545  0.143   -1.806  1.00 0.00 ? 103 LEU A HD23 1  
ATOM 1602  N N    . CYS A 1 104 ? 12.905  2.550   -0.251  1.00 0.00 ? 104 CYS A N    1  
ATOM 1603  C CA   . CYS A 1 104 ? 11.524  2.900   0.029   1.00 0.00 ? 104 CYS A CA   1  
ATOM 1604  C C    . CYS A 1 104 ? 10.556  1.972   -0.691  1.00 0.00 ? 104 CYS A C    1  
ATOM 1605  O O    . CYS A 1 104 ? 10.560  1.870   -1.919  1.00 0.00 ? 104 CYS A O    1  
ATOM 1606  C CB   . CYS A 1 104 ? 11.265  4.366   -0.348  1.00 0.00 ? 104 CYS A CB   1  
ATOM 1607  S SG   . CYS A 1 104 ? 10.098  4.604   -1.710  1.00 0.00 ? 104 CYS A SG   1  
ATOM 1608  H H    . CYS A 1 104 ? 13.339  2.901   -1.058  1.00 0.00 ? 104 CYS A H    1  
ATOM 1609  H HA   . CYS A 1 104 ? 11.374  2.788   1.094   1.00 0.00 ? 104 CYS A HA   1  
ATOM 1610  H HB2  . CYS A 1 104 ? 10.867  4.883   0.512   1.00 0.00 ? 104 CYS A HB2  1  
ATOM 1611  H HB3  . CYS A 1 104 ? 12.200  4.825   -0.634  1.00 0.00 ? 104 CYS A HB3  1  
ATOM 1612  H HG   . CYS A 1 104 ? 8.984   3.949   -1.415  1.00 0.00 ? 104 CYS A HG   1  
ATOM 1613  N N    . CYS A 1 105 ? 9.720   1.300   0.088   1.00 0.00 ? 105 CYS A N    1  
ATOM 1614  C CA   . CYS A 1 105 ? 8.729   0.386   -0.452  1.00 0.00 ? 105 CYS A CA   1  
ATOM 1615  C C    . CYS A 1 105 ? 7.494   1.174   -0.888  1.00 0.00 ? 105 CYS A C    1  
ATOM 1616  O O    . CYS A 1 105 ? 6.903   1.900   -0.090  1.00 0.00 ? 105 CYS A O    1  
ATOM 1617  C CB   . CYS A 1 105 ? 8.353   -0.657  0.604   1.00 0.00 ? 105 CYS A CB   1  
ATOM 1618  S SG   . CYS A 1 105 ? 8.334   -2.357  -0.010  1.00 0.00 ? 105 CYS A SG   1  
ATOM 1619  H H    . CYS A 1 105 ? 9.768   1.427   1.059   1.00 0.00 ? 105 CYS A H    1  
ATOM 1620  H HA   . CYS A 1 105 ? 9.159   -0.112  -1.313  1.00 0.00 ? 105 CYS A HA   1  
ATOM 1621  H HB2  . CYS A 1 105 ? 9.070   -0.610  1.410   1.00 0.00 ? 105 CYS A HB2  1  
ATOM 1622  H HB3  . CYS A 1 105 ? 7.369   -0.431  0.994   1.00 0.00 ? 105 CYS A HB3  1  
ATOM 1623  H HG   . CYS A 1 105 ? 8.116   -2.316  -1.317  1.00 0.00 ? 105 CYS A HG   1  
ATOM 1624  N N    . VAL A 1 106 ? 7.115   1.039   -2.154  1.00 0.00 ? 106 VAL A N    1  
ATOM 1625  C CA   . VAL A 1 106 ? 5.958   1.755   -2.681  1.00 0.00 ? 106 VAL A CA   1  
ATOM 1626  C C    . VAL A 1 106 ? 4.850   0.795   -3.099  1.00 0.00 ? 106 VAL A C    1  
ATOM 1627  O O    . VAL A 1 106 ? 5.111   -0.258  -3.680  1.00 0.00 ? 106 VAL A O    1  
ATOM 1628  C CB   . VAL A 1 106 ? 6.346   2.638   -3.886  1.00 0.00 ? 106 VAL A CB   1  
ATOM 1629  C CG1  . VAL A 1 106 ? 5.109   3.199   -4.573  1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1630  C CG2  . VAL A 1 106 ? 7.269   3.763   -3.445  1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1631  H H    . VAL A 1 106 ? 7.624   0.449   -2.745  1.00 0.00 ? 106 VAL A H    1  
ATOM 1632  H HA   . VAL A 1 106 ? 5.582   2.400   -1.900  1.00 0.00 ? 106 VAL A HA   1  
ATOM 1633  H HB   . VAL A 1 106 ? 6.878   2.025   -4.598  1.00 0.00 ? 106 VAL A HB   1  
ATOM 1634  H HG11 . VAL A 1 106 ? 4.689   2.451   -5.230  1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1635  H HG12 . VAL A 1 106 ? 5.381   4.072   -5.149  1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1636  H HG13 . VAL A 1 106 ? 4.377   3.475   -3.828  1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1637  H HG21 . VAL A 1 106 ? 7.994   3.957   -4.220  1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1638  H HG22 . VAL A 1 106 ? 7.780   3.475   -2.538  1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1639  H HG23 . VAL A 1 106 ? 6.688   4.655   -3.264  1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1640  N N    . VAL A 1 107 ? 3.611   1.179   -2.808  1.00 0.00 ? 107 VAL A N    1  
ATOM 1641  C CA   . VAL A 1 107 ? 2.448   0.374   -3.154  1.00 0.00 ? 107 VAL A CA   1  
ATOM 1642  C C    . VAL A 1 107 ? 1.452   1.216   -3.952  1.00 0.00 ? 107 VAL A C    1  
ATOM 1643  O O    . VAL A 1 107 ? 1.068   2.306   -3.525  1.00 0.00 ? 107 VAL A O    1  
ATOM 1644  C CB   . VAL A 1 107 ? 1.770   -0.199  -1.885  1.00 0.00 ? 107 VAL A CB   1  
ATOM 1645  C CG1  . VAL A 1 107 ? 0.255   -0.042  -1.928  1.00 0.00 ? 107 VAL A CG1  1  
ATOM 1646  C CG2  . VAL A 1 107 ? 2.151   -1.657  -1.702  1.00 0.00 ? 107 VAL A CG2  1  
ATOM 1647  H H    . VAL A 1 107 ? 3.472   2.036   -2.354  1.00 0.00 ? 107 VAL A H    1  
ATOM 1648  H HA   . VAL A 1 107 ? 2.780   -0.454  -3.768  1.00 0.00 ? 107 VAL A HA   1  
ATOM 1649  H HB   . VAL A 1 107 ? 2.139   0.353   -1.031  1.00 0.00 ? 107 VAL A HB   1  
ATOM 1650  H HG11 . VAL A 1 107 ? -0.119  -0.424  -2.866  1.00 0.00 ? 107 VAL A HG11 1  
ATOM 1651  H HG12 . VAL A 1 107 ? -0.002  1.004   -1.838  1.00 0.00 ? 107 VAL A HG12 1  
ATOM 1652  H HG13 . VAL A 1 107 ? -0.187  -0.592  -1.111  1.00 0.00 ? 107 VAL A HG13 1  
ATOM 1653  H HG21 . VAL A 1 107 ? 1.394   -2.285  -2.146  1.00 0.00 ? 107 VAL A HG21 1  
ATOM 1654  H HG22 . VAL A 1 107 ? 2.230   -1.878  -0.647  1.00 0.00 ? 107 VAL A HG22 1  
ATOM 1655  H HG23 . VAL A 1 107 ? 3.101   -1.844  -2.181  1.00 0.00 ? 107 VAL A HG23 1  
ATOM 1656  N N    . VAL A 1 108 ? 1.047   0.714   -5.112  1.00 0.00 ? 108 VAL A N    1  
ATOM 1657  C CA   . VAL A 1 108 ? 0.106   1.435   -5.958  1.00 0.00 ? 108 VAL A CA   1  
ATOM 1658  C C    . VAL A 1 108 ? -1.189  0.655   -6.137  1.00 0.00 ? 108 VAL A C    1  
ATOM 1659  O O    . VAL A 1 108 ? -1.211  -0.398  -6.774  1.00 0.00 ? 108 VAL A O    1  
ATOM 1660  C CB   . VAL A 1 108 ? 0.708   1.742   -7.341  1.00 0.00 ? 108 VAL A CB   1  
ATOM 1661  C CG1  . VAL A 1 108 ? -0.129  2.786   -8.066  1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1662  C CG2  . VAL A 1 108 ? 2.151   2.205   -7.206  1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1663  H H    . VAL A 1 108 ? 1.392   -0.154  -5.408  1.00 0.00 ? 108 VAL A H    1  
ATOM 1664  H HA   . VAL A 1 108 ? -0.117  2.373   -5.474  1.00 0.00 ? 108 VAL A HA   1  
ATOM 1665  H HB   . VAL A 1 108 ? 0.696   0.834   -7.927  1.00 0.00 ? 108 VAL A HB   1  
ATOM 1666  H HG11 . VAL A 1 108 ? 0.296   2.976   -9.041  1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1667  H HG12 . VAL A 1 108 ? -0.139  3.701   -7.493  1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1668  H HG13 . VAL A 1 108 ? -1.139  2.421   -8.180  1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1669  H HG21 . VAL A 1 108 ? 2.812   1.432   -7.569  1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1670  H HG22 . VAL A 1 108 ? 2.369   2.411   -6.169  1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1671  H HG23 . VAL A 1 108 ? 2.295   3.104   -7.790  1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1672  N N    . LEU A 1 109 ? -2.269  1.181   -5.566  1.00 0.00 ? 109 LEU A N    1  
ATOM 1673  C CA   . LEU A 1 109 ? -3.572  0.539   -5.654  1.00 0.00 ? 109 LEU A CA   1  
ATOM 1674  C C    . LEU A 1 109 ? -4.350  1.044   -6.864  1.00 0.00 ? 109 LEU A C    1  
ATOM 1675  O O    . LEU A 1 109 ? -4.636  2.236   -6.977  1.00 0.00 ? 109 LEU A O    1  
ATOM 1676  C CB   . LEU A 1 109 ? -4.363  0.804   -4.379  1.00 0.00 ? 109 LEU A CB   1  
ATOM 1677  C CG   . LEU A 1 109 ? -3.505  0.939   -3.124  1.00 0.00 ? 109 LEU A CG   1  
ATOM 1678  C CD1  . LEU A 1 109 ? -4.184  1.833   -2.104  1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1679  C CD2  . LEU A 1 109 ? -3.216  -0.432  -2.541  1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1680  H H    . LEU A 1 109 ? -2.189  2.024   -5.067  1.00 0.00 ? 109 LEU A H    1  
ATOM 1681  H HA   . LEU A 1 109 ? -3.414  -0.524  -5.753  1.00 0.00 ? 109 LEU A HA   1  
ATOM 1682  H HB2  . LEU A 1 109 ? -4.927  1.714   -4.511  1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1683  H HB3  . LEU A 1 109 ? -5.054  -0.011  -4.230  1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1684  H HG   . LEU A 1 109 ? -2.561  1.394   -3.391  1.00 0.00 ? 109 LEU A HG   1  
ATOM 1685  H HD11 . LEU A 1 109 ? -3.567  1.901   -1.219  1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1686  H HD12 . LEU A 1 109 ? -5.144  1.414   -1.843  1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1687  H HD13 . LEU A 1 109 ? -4.322  2.818   -2.525  1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1688  H HD21 . LEU A 1 109 ? -2.361  -0.372  -1.884  1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1689  H HD22 . LEU A 1 109 ? -3.007  -1.126  -3.345  1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1690  H HD23 . LEU A 1 109 ? -4.076  -0.775  -1.985  1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1691  N N    . GLU A 1 110 ? -4.694  0.129   -7.760  1.00 0.00 ? 110 GLU A N    1  
ATOM 1692  C CA   . GLU A 1 110 ? -5.445  0.481   -8.957  1.00 0.00 ? 110 GLU A CA   1  
ATOM 1693  C C    . GLU A 1 110 ? -6.772  -0.268  -8.994  1.00 0.00 ? 110 GLU A C    1  
ATOM 1694  O O    . GLU A 1 110 ? -6.794  -1.493  -9.107  1.00 0.00 ? 110 GLU A O    1  
ATOM 1695  C CB   . GLU A 1 110 ? -4.627  0.156   -10.207 1.00 0.00 ? 110 GLU A CB   1  
ATOM 1696  C CG   . GLU A 1 110 ? -4.685  1.235   -11.275 1.00 0.00 ? 110 GLU A CG   1  
ATOM 1697  C CD   . GLU A 1 110 ? -4.427  0.692   -12.667 1.00 0.00 ? 110 GLU A CD   1  
ATOM 1698  O OE1  . GLU A 1 110 ? -3.313  0.180   -12.906 1.00 0.00 ? 110 GLU A OE1  1  
ATOM 1699  O OE2  . GLU A 1 110 ? -5.337  0.775   -13.514 1.00 0.00 ? 110 GLU A OE2  1  
ATOM 1700  H H    . GLU A 1 110 ? -4.441  -0.805  -7.610  1.00 0.00 ? 110 GLU A H    1  
ATOM 1701  H HA   . GLU A 1 110 ? -5.641  1.542   -8.929  1.00 0.00 ? 110 GLU A HA   1  
ATOM 1702  H HB2  . GLU A 1 110 ? -3.594  0.020   -9.922  1.00 0.00 ? 110 GLU A HB2  1  
ATOM 1703  H HB3  . GLU A 1 110 ? -4.996  -0.764  -10.636 1.00 0.00 ? 110 GLU A HB3  1  
ATOM 1704  H HG2  . GLU A 1 110 ? -5.665  1.688   -11.259 1.00 0.00 ? 110 GLU A HG2  1  
ATOM 1705  H HG3  . GLU A 1 110 ? -3.940  1.984   -11.053 1.00 0.00 ? 110 GLU A HG3  1  
ATOM 1706  N N    . PRO A 1 111 ? -7.902  0.455   -8.906  1.00 0.00 ? 111 PRO A N    1  
ATOM 1707  C CA   . PRO A 1 111 ? -9.226  -0.165  -8.934  1.00 0.00 ? 111 PRO A CA   1  
ATOM 1708  C C    . PRO A 1 111 ? -9.416  -1.043  -10.167 1.00 0.00 ? 111 PRO A C    1  
ATOM 1709  O O    . PRO A 1 111 ? -9.040  -0.657  -11.275 1.00 0.00 ? 111 PRO A O    1  
ATOM 1710  C CB   . PRO A 1 111 ? -10.184 1.027   -8.972  1.00 0.00 ? 111 PRO A CB   1  
ATOM 1711  C CG   . PRO A 1 111 ? -9.411  2.157   -8.384  1.00 0.00 ? 111 PRO A CG   1  
ATOM 1712  C CD   . PRO A 1 111 ? -7.979  1.922   -8.773  1.00 0.00 ? 111 PRO A CD   1  
ATOM 1713  H HA   . PRO A 1 111 ? -9.406  -0.751  -8.040  1.00 0.00 ? 111 PRO A HA   1  
ATOM 1714  H HB2  . PRO A 1 111 ? -10.467 1.233   -9.993  1.00 0.00 ? 111 PRO A HB2  1  
ATOM 1715  H HB3  . PRO A 1 111 ? -11.065 0.805   -8.387  1.00 0.00 ? 111 PRO A HB3  1  
ATOM 1716  H HG2  . PRO A 1 111 ? -9.763  3.094   -8.789  1.00 0.00 ? 111 PRO A HG2  1  
ATOM 1717  H HG3  . PRO A 1 111 ? -9.512  2.151   -7.308  1.00 0.00 ? 111 PRO A HG3  1  
ATOM 1718  H HD2  . PRO A 1 111 ? -7.760  2.408   -9.715  1.00 0.00 ? 111 PRO A HD2  1  
ATOM 1719  H HD3  . PRO A 1 111 ? -7.314  2.275   -7.999  1.00 0.00 ? 111 PRO A HD3  1  
ATOM 1720  N N    . VAL A 1 112 ? -9.997  -2.221  -9.972  1.00 0.00 ? 112 VAL A N    1  
ATOM 1721  C CA   . VAL A 1 112 ? -10.229 -3.144  -11.078 1.00 0.00 ? 112 VAL A CA   1  
ATOM 1722  C C    . VAL A 1 112 ? -11.326 -2.631  -12.003 1.00 0.00 ? 112 VAL A C    1  
ATOM 1723  O O    . VAL A 1 112 ? -12.372 -2.168  -11.548 1.00 0.00 ? 112 VAL A O    1  
ATOM 1724  C CB   . VAL A 1 112 ? -10.613 -4.549  -10.569 1.00 0.00 ? 112 VAL A CB   1  
ATOM 1725  C CG1  . VAL A 1 112 ? -9.435  -5.201  -9.865  1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1726  C CG2  . VAL A 1 112 ? -11.822 -4.475  -9.648  1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1727  H H    . VAL A 1 112 ? -10.276 -2.476  -9.069  1.00 0.00 ? 112 VAL A H    1  
ATOM 1728  H HA   . VAL A 1 112 ? -9.310  -3.229  -11.639 1.00 0.00 ? 112 VAL A HA   1  
ATOM 1729  H HB   . VAL A 1 112 ? -10.874 -5.158  -11.422 1.00 0.00 ? 112 VAL A HB   1  
ATOM 1730  H HG11 . VAL A 1 112 ? -8.931  -4.468  -9.251  1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1731  H HG12 . VAL A 1 112 ? -8.746  -5.591  -10.599 1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1732  H HG13 . VAL A 1 112 ? -9.791  -6.008  -9.242  1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1733  H HG21 . VAL A 1 112 ? -11.667 -5.127  -8.800  1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1734  H HG22 . VAL A 1 112 ? -12.704 -4.788  -10.185 1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1735  H HG23 . VAL A 1 112 ? -11.949 -3.460  -9.302  1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1736  N N    . GLU A 1 113 ? -11.078 -2.720  -13.308 1.00 0.00 ? 113 GLU A N    1  
ATOM 1737  C CA   . GLU A 1 113 ? -12.039 -2.267  -14.310 1.00 0.00 ? 113 GLU A CA   1  
ATOM 1738  C C    . GLU A 1 113 ? -12.438 -0.812  -14.075 1.00 0.00 ? 113 GLU A C    1  
ATOM 1739  O O    . GLU A 1 113 ? -13.534 -0.392  -14.448 1.00 0.00 ? 113 GLU A O    1  
ATOM 1740  C CB   . GLU A 1 113 ? -13.284 -3.158  -14.297 1.00 0.00 ? 113 GLU A CB   1  
ATOM 1741  C CG   . GLU A 1 113 ? -12.970 -4.645  -14.330 1.00 0.00 ? 113 GLU A CG   1  
ATOM 1742  C CD   . GLU A 1 113 ? -14.046 -5.481  -13.665 1.00 0.00 ? 113 GLU A CD   1  
ATOM 1743  O OE1  . GLU A 1 113 ? -14.409 -5.173  -12.510 1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1744  O OE2  . GLU A 1 113 ? -14.528 -6.441  -14.299 1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1745  H H    . GLU A 1 113 ? -10.225 -3.100  -13.605 1.00 0.00 ? 113 GLU A H    1  
ATOM 1746  H HA   . GLU A 1 113 ? -11.566 -2.344  -15.279 1.00 0.00 ? 113 GLU A HA   1  
ATOM 1747  H HB2  . GLU A 1 113 ? -13.849 -2.951  -13.401 1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1748  H HB3  . GLU A 1 113 ? -13.892 -2.922  -15.158 1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1749  H HG2  . GLU A 1 113 ? -12.877 -4.958  -15.359 1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1750  H HG3  . GLU A 1 113 ? -12.034 -4.814  -13.815 1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1751  N N    . ARG A 1 114 ? -11.543 -0.049  -13.457 1.00 0.00 ? 114 ARG A N    1  
ATOM 1752  C CA   . ARG A 1 114 ? -11.804 1.358   -13.174 1.00 0.00 ? 114 ARG A CA   1  
ATOM 1753  C C    . ARG A 1 114 ? -10.589 2.214   -13.516 1.00 0.00 ? 114 ARG A C    1  
ATOM 1754  O O    . ARG A 1 114 ? -10.584 3.406   -13.144 1.00 0.00 ? 114 ARG A O    1  
ATOM 1755  C CB   . ARG A 1 114 ? -12.174 1.544   -11.702 1.00 0.00 ? 114 ARG A CB   1  
ATOM 1756  C CG   . ARG A 1 114 ? -13.622 1.948   -11.482 1.00 0.00 ? 114 ARG A CG   1  
ATOM 1757  C CD   . ARG A 1 114 ? -14.035 1.772   -10.030 1.00 0.00 ? 114 ARG A CD   1  
ATOM 1758  N NE   . ARG A 1 114 ? -14.925 2.839   -9.580  1.00 0.00 ? 114 ARG A NE   1  
ATOM 1759  C CZ   . ARG A 1 114 ? -15.001 3.256   -8.319  1.00 0.00 ? 114 ARG A CZ   1  
ATOM 1760  N NH1  . ARG A 1 114 ? -14.240 2.699   -7.385  1.00 0.00 ? 114 ARG A NH1  1  
ATOM 1761  N NH2  . ARG A 1 114 ? -15.836 4.232   -7.992  1.00 0.00 ? 114 ARG A NH2  1  
ATOM 1762  O OXT  . ARG A 1 114 ? -9.655  1.686   -14.156 1.00 0.00 ? 114 ARG A OXT  1  
ATOM 1763  H H    . ARG A 1 114 ? -10.688 -0.440  -13.184 1.00 0.00 ? 114 ARG A H    1  
ATOM 1764  H HA   . ARG A 1 114 ? -12.635 1.670   -13.787 1.00 0.00 ? 114 ARG A HA   1  
ATOM 1765  H HB2  . ARG A 1 114 ? -11.998 0.616   -11.178 1.00 0.00 ? 114 ARG A HB2  1  
ATOM 1766  H HB3  . ARG A 1 114 ? -11.541 2.311   -11.278 1.00 0.00 ? 114 ARG A HB3  1  
ATOM 1767  H HG2  . ARG A 1 114 ? -13.743 2.985   -11.757 1.00 0.00 ? 114 ARG A HG2  1  
ATOM 1768  H HG3  . ARG A 1 114 ? -14.256 1.332   -12.105 1.00 0.00 ? 114 ARG A HG3  1  
ATOM 1769  H HD2  . ARG A 1 114 ? -14.542 0.825   -9.923  1.00 0.00 ? 114 ARG A HD2  1  
ATOM 1770  H HD3  . ARG A 1 114 ? -13.148 1.775   -9.413  1.00 0.00 ? 114 ARG A HD3  1  
ATOM 1771  H HE   . ARG A 1 114 ? -15.497 3.267   -10.251 1.00 0.00 ? 114 ARG A HE   1  
ATOM 1772  H HH11 . ARG A 1 114 ? -13.608 1.962   -7.626  1.00 0.00 ? 114 ARG A HH11 1  
ATOM 1773  H HH12 . ARG A 1 114 ? -14.300 3.016   -6.437  1.00 0.00 ? 114 ARG A HH12 1  
ATOM 1774  H HH21 . ARG A 1 114 ? -16.411 4.653   -8.692  1.00 0.00 ? 114 ARG A HH21 1  
ATOM 1775  H HH22 . ARG A 1 114 ? -15.891 4.544   -7.044  1.00 0.00 ? 114 ARG A HH22 1  
ATOM 1776  N N    . GLY A 1 1   ? -1.395  16.907  -17.844 1.00 0.00 ? 1   GLY A N    2  
ATOM 1777  C CA   . GLY A 1 1   ? -1.707  15.509  -17.442 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1778  C C    . GLY A 1 1   ? -3.174  15.313  -17.115 1.00 0.00 ? 1   GLY A C    2  
ATOM 1779  O O    . GLY A 1 1   ? -3.773  16.119  -16.403 1.00 0.00 ? 1   GLY A O    2  
ATOM 1780  H H1   . GLY A 1 1   ? -0.671  17.308  -17.214 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1781  H H2   . GLY A 1 1   ? -2.252  17.495  -17.790 1.00 0.00 ? 1   GLY A H2   2  
ATOM 1782  H H3   . GLY A 1 1   ? -1.038  16.926  -18.821 1.00 0.00 ? 1   GLY A H3   2  
ATOM 1783  H HA2  . GLY A 1 1   ? -1.437  14.844  -18.247 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1784  H HA3  . GLY A 1 1   ? -1.120  15.259  -16.571 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1785  N N    . ALA A 1 2   ? -3.754  14.236  -17.640 1.00 0.00 ? 2   ALA A N    2  
ATOM 1786  C CA   . ALA A 1 2   ? -5.160  13.930  -17.403 1.00 0.00 ? 2   ALA A CA   2  
ATOM 1787  C C    . ALA A 1 2   ? -5.491  12.508  -17.842 1.00 0.00 ? 2   ALA A C    2  
ATOM 1788  O O    . ALA A 1 2   ? -6.080  12.297  -18.903 1.00 0.00 ? 2   ALA A O    2  
ATOM 1789  C CB   . ALA A 1 2   ? -6.047  14.931  -18.130 1.00 0.00 ? 2   ALA A CB   2  
ATOM 1790  H H    . ALA A 1 2   ? -3.221  13.633  -18.198 1.00 0.00 ? 2   ALA A H    2  
ATOM 1791  H HA   . ALA A 1 2   ? -5.348  14.022  -16.343 1.00 0.00 ? 2   ALA A HA   2  
ATOM 1792  H HB1  . ALA A 1 2   ? -7.010  14.484  -18.325 1.00 0.00 ? 2   ALA A HB1  2  
ATOM 1793  H HB2  . ALA A 1 2   ? -5.585  15.211  -19.064 1.00 0.00 ? 2   ALA A HB2  2  
ATOM 1794  H HB3  . ALA A 1 2   ? -6.178  15.811  -17.515 1.00 0.00 ? 2   ALA A HB3  2  
ATOM 1795  N N    . MET A 1 3   ? -5.100  11.534  -17.025 1.00 0.00 ? 3   MET A N    2  
ATOM 1796  C CA   . MET A 1 3   ? -5.350  10.131  -17.335 1.00 0.00 ? 3   MET A CA   2  
ATOM 1797  C C    . MET A 1 3   ? -5.392  9.286   -16.064 1.00 0.00 ? 3   MET A C    2  
ATOM 1798  O O    . MET A 1 3   ? -6.463  8.875   -15.617 1.00 0.00 ? 3   MET A O    2  
ATOM 1799  C CB   . MET A 1 3   ? -4.274  9.598   -18.281 1.00 0.00 ? 3   MET A CB   2  
ATOM 1800  C CG   . MET A 1 3   ? -4.825  9.057   -19.589 1.00 0.00 ? 3   MET A CG   2  
ATOM 1801  S SD   . MET A 1 3   ? -4.123  7.455   -20.027 1.00 0.00 ? 3   MET A SD   2  
ATOM 1802  C CE   . MET A 1 3   ? -4.688  7.286   -21.719 1.00 0.00 ? 3   MET A CE   2  
ATOM 1803  H H    . MET A 1 3   ? -4.629  11.765  -16.196 1.00 0.00 ? 3   MET A H    2  
ATOM 1804  H HA   . MET A 1 3   ? -6.309  10.069  -17.826 1.00 0.00 ? 3   MET A HA   2  
ATOM 1805  H HB2  . MET A 1 3   ? -3.584  10.399  -18.510 1.00 0.00 ? 3   MET A HB2  2  
ATOM 1806  H HB3  . MET A 1 3   ? -3.735  8.804   -17.784 1.00 0.00 ? 3   MET A HB3  2  
ATOM 1807  H HG2  . MET A 1 3   ? -5.896  8.951   -19.496 1.00 0.00 ? 3   MET A HG2  2  
ATOM 1808  H HG3  . MET A 1 3   ? -4.600  9.760   -20.378 1.00 0.00 ? 3   MET A HG3  2  
ATOM 1809  H HE1  . MET A 1 3   ? -5.443  6.515   -21.772 1.00 0.00 ? 3   MET A HE1  2  
ATOM 1810  H HE2  . MET A 1 3   ? -3.854  7.018   -22.351 1.00 0.00 ? 3   MET A HE2  2  
ATOM 1811  H HE3  . MET A 1 3   ? -5.108  8.224   -22.054 1.00 0.00 ? 3   MET A HE3  2  
ATOM 1812  N N    . ASP A 1 4   ? -4.220  9.026   -15.493 1.00 0.00 ? 4   ASP A N    2  
ATOM 1813  C CA   . ASP A 1 4   ? -4.122  8.221   -14.275 1.00 0.00 ? 4   ASP A CA   2  
ATOM 1814  C C    . ASP A 1 4   ? -2.907  8.613   -13.424 1.00 0.00 ? 4   ASP A C    2  
ATOM 1815  O O    . ASP A 1 4   ? -3.043  8.830   -12.220 1.00 0.00 ? 4   ASP A O    2  
ATOM 1816  C CB   . ASP A 1 4   ? -4.060  6.726   -14.615 1.00 0.00 ? 4   ASP A CB   2  
ATOM 1817  C CG   . ASP A 1 4   ? -4.254  6.455   -16.095 1.00 0.00 ? 4   ASP A CG   2  
ATOM 1818  O OD1  . ASP A 1 4   ? -5.418  6.336   -16.531 1.00 0.00 ? 4   ASP A OD1  2  
ATOM 1819  O OD2  . ASP A 1 4   ? -3.240  6.355   -16.818 1.00 0.00 ? 4   ASP A OD2  2  
ATOM 1820  H H    . ASP A 1 4   ? -3.403  9.378   -15.900 1.00 0.00 ? 4   ASP A H    2  
ATOM 1821  H HA   . ASP A 1 4   ? -5.017  8.403   -13.695 1.00 0.00 ? 4   ASP A HA   2  
ATOM 1822  H HB2  . ASP A 1 4   ? -3.096  6.338   -14.322 1.00 0.00 ? 4   ASP A HB2  2  
ATOM 1823  H HB3  . ASP A 1 4   ? -4.833  6.207   -14.068 1.00 0.00 ? 4   ASP A HB3  2  
ATOM 1824  N N    . PRO A 1 5   ? -1.695  8.701   -14.027 1.00 0.00 ? 5   PRO A N    2  
ATOM 1825  C CA   . PRO A 1 5   ? -0.469  9.057   -13.300 1.00 0.00 ? 5   PRO A CA   2  
ATOM 1826  C C    . PRO A 1 5   ? -0.659  10.198  -12.302 1.00 0.00 ? 5   PRO A C    2  
ATOM 1827  O O    . PRO A 1 5   ? 0.065   10.286  -11.310 1.00 0.00 ? 5   PRO A O    2  
ATOM 1828  C CB   . PRO A 1 5   ? 0.476   9.484   -14.420 1.00 0.00 ? 5   PRO A CB   2  
ATOM 1829  C CG   . PRO A 1 5   ? 0.070   8.649   -15.583 1.00 0.00 ? 5   PRO A CG   2  
ATOM 1830  C CD   . PRO A 1 5   ? -1.418  8.444   -15.458 1.00 0.00 ? 5   PRO A CD   2  
ATOM 1831  H HA   . PRO A 1 5   ? -0.054  8.201   -12.789 1.00 0.00 ? 5   PRO A HA   2  
ATOM 1832  H HB2  . PRO A 1 5   ? 0.348   10.536  -14.622 1.00 0.00 ? 5   PRO A HB2  2  
ATOM 1833  H HB3  . PRO A 1 5   ? 1.497   9.288   -14.131 1.00 0.00 ? 5   PRO A HB3  2  
ATOM 1834  H HG2  . PRO A 1 5   ? 0.299   9.167   -16.504 1.00 0.00 ? 5   PRO A HG2  2  
ATOM 1835  H HG3  . PRO A 1 5   ? 0.584   7.699   -15.551 1.00 0.00 ? 5   PRO A HG3  2  
ATOM 1836  H HD2  . PRO A 1 5   ? -1.949  9.146   -16.084 1.00 0.00 ? 5   PRO A HD2  2  
ATOM 1837  H HD3  . PRO A 1 5   ? -1.679  7.430   -15.723 1.00 0.00 ? 5   PRO A HD3  2  
ATOM 1838  N N    . GLU A 1 6   ? -1.629  11.068  -12.564 1.00 0.00 ? 6   GLU A N    2  
ATOM 1839  C CA   . GLU A 1 6   ? -1.894  12.196  -11.678 1.00 0.00 ? 6   GLU A CA   2  
ATOM 1840  C C    . GLU A 1 6   ? -3.394  12.389  -11.460 1.00 0.00 ? 6   GLU A C    2  
ATOM 1841  O O    . GLU A 1 6   ? -3.809  13.250  -10.684 1.00 0.00 ? 6   GLU A O    2  
ATOM 1842  C CB   . GLU A 1 6   ? -1.280  13.474  -12.253 1.00 0.00 ? 6   GLU A CB   2  
ATOM 1843  C CG   . GLU A 1 6   ? -2.099  14.085  -13.378 1.00 0.00 ? 6   GLU A CG   2  
ATOM 1844  C CD   . GLU A 1 6   ? -1.982  15.596  -13.432 1.00 0.00 ? 6   GLU A CD   2  
ATOM 1845  O OE1  . GLU A 1 6   ? -0.906  16.122  -13.081 1.00 0.00 ? 6   GLU A OE1  2  
ATOM 1846  O OE2  . GLU A 1 6   ? -2.967  16.253  -13.827 1.00 0.00 ? 6   GLU A OE2  2  
ATOM 1847  H H    . GLU A 1 6   ? -2.174  10.950  -13.370 1.00 0.00 ? 6   GLU A H    2  
ATOM 1848  H HA   . GLU A 1 6   ? -1.430  11.985  -10.726 1.00 0.00 ? 6   GLU A HA   2  
ATOM 1849  H HB2  . GLU A 1 6   ? -1.194  14.206  -11.463 1.00 0.00 ? 6   GLU A HB2  2  
ATOM 1850  H HB3  . GLU A 1 6   ? -0.296  13.249  -12.633 1.00 0.00 ? 6   GLU A HB3  2  
ATOM 1851  H HG2  . GLU A 1 6   ? -1.753  13.680  -14.319 1.00 0.00 ? 6   GLU A HG2  2  
ATOM 1852  H HG3  . GLU A 1 6   ? -3.136  13.821  -13.232 1.00 0.00 ? 6   GLU A HG3  2  
ATOM 1853  N N    . PHE A 1 7   ? -4.200  11.590  -12.150 1.00 0.00 ? 7   PHE A N    2  
ATOM 1854  C CA   . PHE A 1 7   ? -5.651  11.682  -12.027 1.00 0.00 ? 7   PHE A CA   2  
ATOM 1855  C C    . PHE A 1 7   ? -6.116  11.153  -10.675 1.00 0.00 ? 7   PHE A C    2  
ATOM 1856  O O    . PHE A 1 7   ? -6.862  11.820  -9.958  1.00 0.00 ? 7   PHE A O    2  
ATOM 1857  C CB   . PHE A 1 7   ? -6.333  10.902  -13.155 1.00 0.00 ? 7   PHE A CB   2  
ATOM 1858  C CG   . PHE A 1 7   ? -7.599  11.542  -13.657 1.00 0.00 ? 7   PHE A CG   2  
ATOM 1859  C CD1  . PHE A 1 7   ? -8.540  12.044  -12.771 1.00 0.00 ? 7   PHE A CD1  2  
ATOM 1860  C CD2  . PHE A 1 7   ? -7.847  11.639  -15.017 1.00 0.00 ? 7   PHE A CD2  2  
ATOM 1861  C CE1  . PHE A 1 7   ? -9.703  12.630  -13.232 1.00 0.00 ? 7   PHE A CE1  2  
ATOM 1862  C CE2  . PHE A 1 7   ? -9.009  12.224  -15.483 1.00 0.00 ? 7   PHE A CE2  2  
ATOM 1863  C CZ   . PHE A 1 7   ? -9.938  12.720  -14.589 1.00 0.00 ? 7   PHE A CZ   2  
ATOM 1864  H H    . PHE A 1 7   ? -3.812  10.926  -12.756 1.00 0.00 ? 7   PHE A H    2  
ATOM 1865  H HA   . PHE A 1 7   ? -5.924  12.725  -12.106 1.00 0.00 ? 7   PHE A HA   2  
ATOM 1866  H HB2  . PHE A 1 7   ? -5.651  10.822  -13.988 1.00 0.00 ? 7   PHE A HB2  2  
ATOM 1867  H HB3  . PHE A 1 7   ? -6.577  9.913   -12.800 1.00 0.00 ? 7   PHE A HB3  2  
ATOM 1868  H HD1  . PHE A 1 7   ? -8.357  11.974  -11.708 1.00 0.00 ? 7   PHE A HD1  2  
ATOM 1869  H HD2  . PHE A 1 7   ? -7.121  11.251  -15.716 1.00 0.00 ? 7   PHE A HD2  2  
ATOM 1870  H HE1  . PHE A 1 7   ? -10.428 13.017  -12.530 1.00 0.00 ? 7   PHE A HE1  2  
ATOM 1871  H HE2  . PHE A 1 7   ? -9.189  12.294  -16.545 1.00 0.00 ? 7   PHE A HE2  2  
ATOM 1872  H HZ   . PHE A 1 7   ? -10.846 13.178  -14.951 1.00 0.00 ? 7   PHE A HZ   2  
ATOM 1873  N N    . ASN A 1 8   ? -5.669  9.949   -10.336 1.00 0.00 ? 8   ASN A N    2  
ATOM 1874  C CA   . ASN A 1 8   ? -6.036  9.321   -9.072  1.00 0.00 ? 8   ASN A CA   2  
ATOM 1875  C C    . ASN A 1 8   ? -5.095  8.163   -8.759  1.00 0.00 ? 8   ASN A C    2  
ATOM 1876  O O    . ASN A 1 8   ? -5.531  7.077   -8.379  1.00 0.00 ? 8   ASN A O    2  
ATOM 1877  C CB   . ASN A 1 8   ? -7.482  8.822   -9.129  1.00 0.00 ? 8   ASN A CB   2  
ATOM 1878  C CG   . ASN A 1 8   ? -8.224  9.046   -7.826  1.00 0.00 ? 8   ASN A CG   2  
ATOM 1879  O OD1  . ASN A 1 8   ? -7.905  8.437   -6.803  1.00 0.00 ? 8   ASN A OD1  2  
ATOM 1880  N ND2  . ASN A 1 8   ? -9.220  9.923   -7.855  1.00 0.00 ? 8   ASN A ND2  2  
ATOM 1881  H H    . ASN A 1 8   ? -5.078  9.469   -10.952 1.00 0.00 ? 8   ASN A H    2  
ATOM 1882  H HA   . ASN A 1 8   ? -5.949  10.064  -8.294  1.00 0.00 ? 8   ASN A HA   2  
ATOM 1883  H HB2  . ASN A 1 8   ? -8.007  9.346   -9.913  1.00 0.00 ? 8   ASN A HB2  2  
ATOM 1884  H HB3  . ASN A 1 8   ? -7.482  7.765   -9.345  1.00 0.00 ? 8   ASN A HB3  2  
ATOM 1885  H HD21 . ASN A 1 8   ? -9.418  10.370  -8.704  1.00 0.00 ? 8   ASN A HD21 2  
ATOM 1886  H HD22 . ASN A 1 8   ? -9.716  10.087  -7.026  1.00 0.00 ? 8   ASN A HD22 2  
ATOM 1887  N N    . LYS A 1 9   ? -3.797  8.400   -8.934  1.00 0.00 ? 9   LYS A N    2  
ATOM 1888  C CA   . LYS A 1 9   ? -2.793  7.371   -8.684  1.00 0.00 ? 9   LYS A CA   2  
ATOM 1889  C C    . LYS A 1 9   ? -2.595  7.120   -7.190  1.00 0.00 ? 9   LYS A C    2  
ATOM 1890  O O    . LYS A 1 9   ? -2.149  7.998   -6.444  1.00 0.00 ? 9   LYS A O    2  
ATOM 1891  C CB   . LYS A 1 9   ? -1.460  7.761   -9.325  1.00 0.00 ? 9   LYS A CB   2  
ATOM 1892  C CG   . LYS A 1 9   ? -1.125  6.951   -10.567 1.00 0.00 ? 9   LYS A CG   2  
ATOM 1893  C CD   . LYS A 1 9   ? -0.181  5.802   -10.246 1.00 0.00 ? 9   LYS A CD   2  
ATOM 1894  C CE   . LYS A 1 9   ? -0.123  4.794   -11.384 1.00 0.00 ? 9   LYS A CE   2  
ATOM 1895  N NZ   . LYS A 1 9   ? 1.274   4.522   -11.817 1.00 0.00 ? 9   LYS A NZ   2  
ATOM 1896  H H    . LYS A 1 9   ? -3.510  9.285   -9.250  1.00 0.00 ? 9   LYS A H    2  
ATOM 1897  H HA   . LYS A 1 9   ? -3.141  6.458   -9.140  1.00 0.00 ? 9   LYS A HA   2  
ATOM 1898  H HB2  . LYS A 1 9   ? -1.498  8.805   -9.602  1.00 0.00 ? 9   LYS A HB2  2  
ATOM 1899  H HB3  . LYS A 1 9   ? -0.670  7.617   -8.604  1.00 0.00 ? 9   LYS A HB3  2  
ATOM 1900  H HG2  . LYS A 1 9   ? -2.037  6.547   -10.979 1.00 0.00 ? 9   LYS A HG2  2  
ATOM 1901  H HG3  . LYS A 1 9   ? -0.655  7.598   -11.293 1.00 0.00 ? 9   LYS A HG3  2  
ATOM 1902  H HD2  . LYS A 1 9   ? 0.809   6.197   -10.080 1.00 0.00 ? 9   LYS A HD2  2  
ATOM 1903  H HD3  . LYS A 1 9   ? -0.527  5.304   -9.353  1.00 0.00 ? 9   LYS A HD3  2  
ATOM 1904  H HE2  . LYS A 1 9   ? -0.572  3.870   -11.053 1.00 0.00 ? 9   LYS A HE2  2  
ATOM 1905  H HE3  . LYS A 1 9   ? -0.682  5.184   -12.223 1.00 0.00 ? 9   LYS A HE3  2  
ATOM 1906  H HZ1  . LYS A 1 9   ? 1.604   5.272   -12.459 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 1907  H HZ2  . LYS A 1 9   ? 1.324   3.611   -12.313 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 1908  H HZ3  . LYS A 1 9   ? 1.906   4.488   -10.989 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 1909  N N    . ALA A 1 10  ? -2.934  5.915   -6.756  1.00 0.00 ? 10  ALA A N    2  
ATOM 1910  C CA   . ALA A 1 10  ? -2.789  5.551   -5.358  1.00 0.00 ? 10  ALA A CA   2  
ATOM 1911  C C    . ALA A 1 10  ? -1.335  5.246   -5.023  1.00 0.00 ? 10  ALA A C    2  
ATOM 1912  O O    . ALA A 1 10  ? -0.899  4.102   -5.102  1.00 0.00 ? 10  ALA A O    2  
ATOM 1913  C CB   . ALA A 1 10  ? -3.677  4.361   -5.022  1.00 0.00 ? 10  ALA A CB   2  
ATOM 1914  H H    . ALA A 1 10  ? -3.295  5.257   -7.387  1.00 0.00 ? 10  ALA A H    2  
ATOM 1915  H HA   . ALA A 1 10  ? -3.114  6.390   -4.765  1.00 0.00 ? 10  ALA A HA   2  
ATOM 1916  H HB1  . ALA A 1 10  ? -4.680  4.548   -5.376  1.00 0.00 ? 10  ALA A HB1  2  
ATOM 1917  H HB2  . ALA A 1 10  ? -3.694  4.217   -3.950  1.00 0.00 ? 10  ALA A HB2  2  
ATOM 1918  H HB3  . ALA A 1 10  ? -3.285  3.473   -5.497  1.00 0.00 ? 10  ALA A HB3  2  
ATOM 1919  N N    . ILE A 1 11  ? -0.582  6.279   -4.652  1.00 0.00 ? 11  ILE A N    2  
ATOM 1920  C CA   . ILE A 1 11  ? 0.826   6.112   -4.314  1.00 0.00 ? 11  ILE A CA   2  
ATOM 1921  C C    . ILE A 1 11  ? 1.057   6.184   -2.808  1.00 0.00 ? 11  ILE A C    2  
ATOM 1922  O O    . ILE A 1 11  ? 0.833   7.222   -2.182  1.00 0.00 ? 11  ILE A O    2  
ATOM 1923  C CB   . ILE A 1 11  ? 1.698   7.178   -5.009  1.00 0.00 ? 11  ILE A CB   2  
ATOM 1924  C CG1  . ILE A 1 11  ? 1.515   7.105   -6.526  1.00 0.00 ? 11  ILE A CG1  2  
ATOM 1925  C CG2  . ILE A 1 11  ? 3.163   6.994   -4.638  1.00 0.00 ? 11  ILE A CG2  2  
ATOM 1926  C CD1  . ILE A 1 11  ? 1.346   8.460   -7.179  1.00 0.00 ? 11  ILE A CD1  2  
ATOM 1927  H H    . ILE A 1 11  ? -0.983  7.174   -4.606  1.00 0.00 ? 11  ILE A H    2  
ATOM 1928  H HA   . ILE A 1 11  ? 1.138   5.140   -4.666  1.00 0.00 ? 11  ILE A HA   2  
ATOM 1929  H HB   . ILE A 1 11  ? 1.384   8.151   -4.661  1.00 0.00 ? 11  ILE A HB   2  
ATOM 1930  H HG12 . ILE A 1 11  ? 2.381   6.633   -6.964  1.00 0.00 ? 11  ILE A HG12 2  
ATOM 1931  H HG13 . ILE A 1 11  ? 0.638   6.516   -6.749  1.00 0.00 ? 11  ILE A HG13 2  
ATOM 1932  H HG21 . ILE A 1 11  ? 3.786   7.315   -5.460  1.00 0.00 ? 11  ILE A HG21 2  
ATOM 1933  H HG22 . ILE A 1 11  ? 3.355   5.954   -4.427  1.00 0.00 ? 11  ILE A HG22 2  
ATOM 1934  H HG23 . ILE A 1 11  ? 3.390   7.586   -3.764  1.00 0.00 ? 11  ILE A HG23 2  
ATOM 1935  H HD11 . ILE A 1 11  ? 2.127   9.124   -6.841  1.00 0.00 ? 11  ILE A HD11 2  
ATOM 1936  H HD12 . ILE A 1 11  ? 0.382   8.870   -6.915  1.00 0.00 ? 11  ILE A HD12 2  
ATOM 1937  H HD13 . ILE A 1 11  ? 1.407   8.351   -8.252  1.00 0.00 ? 11  ILE A HD13 2  
ATOM 1938  N N    . PHE A 1 12  ? 1.524   5.079   -2.235  1.00 0.00 ? 12  PHE A N    2  
ATOM 1939  C CA   . PHE A 1 12  ? 1.813   5.009   -0.807  1.00 0.00 ? 12  PHE A CA   2  
ATOM 1940  C C    . PHE A 1 12  ? 3.299   4.737   -0.594  1.00 0.00 ? 12  PHE A C    2  
ATOM 1941  O O    . PHE A 1 12  ? 3.780   3.637   -0.869  1.00 0.00 ? 12  PHE A O    2  
ATOM 1942  C CB   . PHE A 1 12  ? 0.984   3.902   -0.145  1.00 0.00 ? 12  PHE A CB   2  
ATOM 1943  C CG   . PHE A 1 12  ? -0.354  4.351   0.381   1.00 0.00 ? 12  PHE A CG   2  
ATOM 1944  C CD1  . PHE A 1 12  ? -1.465  4.371   -0.446  1.00 0.00 ? 12  PHE A CD1  2  
ATOM 1945  C CD2  . PHE A 1 12  ? -0.501  4.740   1.704   1.00 0.00 ? 12  PHE A CD2  2  
ATOM 1946  C CE1  . PHE A 1 12  ? -2.699  4.770   0.035   1.00 0.00 ? 12  PHE A CE1  2  
ATOM 1947  C CE2  . PHE A 1 12  ? -1.732  5.143   2.192   1.00 0.00 ? 12  PHE A CE2  2  
ATOM 1948  C CZ   . PHE A 1 12  ? -2.832  5.156   1.356   1.00 0.00 ? 12  PHE A CZ   2  
ATOM 1949  H H    . PHE A 1 12  ? 1.696   4.289   -2.791  1.00 0.00 ? 12  PHE A H    2  
ATOM 1950  H HA   . PHE A 1 12  ? 1.557   5.961   -0.363  1.00 0.00 ? 12  PHE A HA   2  
ATOM 1951  H HB2  . PHE A 1 12  ? 0.805   3.120   -0.867  1.00 0.00 ? 12  PHE A HB2  2  
ATOM 1952  H HB3  . PHE A 1 12  ? 1.545   3.492   0.684   1.00 0.00 ? 12  PHE A HB3  2  
ATOM 1953  H HD1  . PHE A 1 12  ? -1.364  4.069   -1.478  1.00 0.00 ? 12  PHE A HD1  2  
ATOM 1954  H HD2  . PHE A 1 12  ? 0.358   4.728   2.357   1.00 0.00 ? 12  PHE A HD2  2  
ATOM 1955  H HE1  . PHE A 1 12  ? -3.557  4.781   -0.619  1.00 0.00 ? 12  PHE A HE1  2  
ATOM 1956  H HE2  . PHE A 1 12  ? -1.832  5.446   3.230   1.00 0.00 ? 12  PHE A HE2  2  
ATOM 1957  H HZ   . PHE A 1 12  ? -3.797  5.468   1.733   1.00 0.00 ? 12  PHE A HZ   2  
ATOM 1958  N N    . THR A 1 13  ? 4.027   5.740   -0.109  1.00 0.00 ? 13  THR A N    2  
ATOM 1959  C CA   . THR A 1 13  ? 5.460   5.594   0.129   1.00 0.00 ? 13  THR A CA   2  
ATOM 1960  C C    . THR A 1 13  ? 5.738   5.206   1.576   1.00 0.00 ? 13  THR A C    2  
ATOM 1961  O O    . THR A 1 13  ? 5.341   5.911   2.502   1.00 0.00 ? 13  THR A O    2  
ATOM 1962  C CB   . THR A 1 13  ? 6.225   6.889   -0.200  1.00 0.00 ? 13  THR A CB   2  
ATOM 1963  O OG1  . THR A 1 13  ? 5.761   7.428   -1.443  1.00 0.00 ? 13  THR A OG1  2  
ATOM 1964  C CG2  . THR A 1 13  ? 7.722   6.630   -0.280  1.00 0.00 ? 13  THR A CG2  2  
ATOM 1965  H H    . THR A 1 13  ? 3.592   6.595   0.090   1.00 0.00 ? 13  THR A H    2  
ATOM 1966  H HA   . THR A 1 13  ? 5.826   4.809   -0.518  1.00 0.00 ? 13  THR A HA   2  
ATOM 1967  H HB   . THR A 1 13  ? 6.042   7.608   0.586   1.00 0.00 ? 13  THR A HB   2  
ATOM 1968  H HG1  . THR A 1 13  ? 4.953   6.981   -1.705  1.00 0.00 ? 13  THR A HG1  2  
ATOM 1969  H HG21 . THR A 1 13  ? 8.184   7.383   -0.900  1.00 0.00 ? 13  THR A HG21 2  
ATOM 1970  H HG22 . THR A 1 13  ? 7.896   5.653   -0.711  1.00 0.00 ? 13  THR A HG22 2  
ATOM 1971  H HG23 . THR A 1 13  ? 8.148   6.667   0.711   1.00 0.00 ? 13  THR A HG23 2  
ATOM 1972  N N    . VAL A 1 14  ? 6.411   4.074   1.763   1.00 0.00 ? 14  VAL A N    2  
ATOM 1973  C CA   . VAL A 1 14  ? 6.728   3.581   3.099   1.00 0.00 ? 14  VAL A CA   2  
ATOM 1974  C C    . VAL A 1 14  ? 8.129   2.976   3.153   1.00 0.00 ? 14  VAL A C    2  
ATOM 1975  O O    . VAL A 1 14  ? 8.797   2.849   2.131   1.00 0.00 ? 14  VAL A O    2  
ATOM 1976  C CB   . VAL A 1 14  ? 5.707   2.510   3.558   1.00 0.00 ? 14  VAL A CB   2  
ATOM 1977  C CG1  . VAL A 1 14  ? 4.337   2.779   2.962   1.00 0.00 ? 14  VAL A CG1  2  
ATOM 1978  C CG2  . VAL A 1 14  ? 6.174   1.110   3.181   1.00 0.00 ? 14  VAL A CG2  2  
ATOM 1979  H H    . VAL A 1 14  ? 6.690   3.550   0.983   1.00 0.00 ? 14  VAL A H    2  
ATOM 1980  H HA   . VAL A 1 14  ? 6.677   4.413   3.785   1.00 0.00 ? 14  VAL A HA   2  
ATOM 1981  H HB   . VAL A 1 14  ? 5.623   2.561   4.634   1.00 0.00 ? 14  VAL A HB   2  
ATOM 1982  H HG11 . VAL A 1 14  ? 3.774   1.860   2.930   1.00 0.00 ? 14  VAL A HG11 2  
ATOM 1983  H HG12 . VAL A 1 14  ? 4.451   3.166   1.962   1.00 0.00 ? 14  VAL A HG12 2  
ATOM 1984  H HG13 . VAL A 1 14  ? 3.816   3.501   3.571   1.00 0.00 ? 14  VAL A HG13 2  
ATOM 1985  H HG21 . VAL A 1 14  ? 5.339   0.426   3.238   1.00 0.00 ? 14  VAL A HG21 2  
ATOM 1986  H HG22 . VAL A 1 14  ? 6.945   0.791   3.866   1.00 0.00 ? 14  VAL A HG22 2  
ATOM 1987  H HG23 . VAL A 1 14  ? 6.564   1.117   2.176   1.00 0.00 ? 14  VAL A HG23 2  
ATOM 1988  N N    . ASP A 1 15  ? 8.549   2.585   4.352   1.00 0.00 ? 15  ASP A N    2  
ATOM 1989  C CA   . ASP A 1 15  ? 9.853   1.962   4.549   1.00 0.00 ? 15  ASP A CA   2  
ATOM 1990  C C    . ASP A 1 15  ? 9.694   0.444   4.499   1.00 0.00 ? 15  ASP A C    2  
ATOM 1991  O O    . ASP A 1 15  ? 8.628   -0.075  4.808   1.00 0.00 ? 15  ASP A O    2  
ATOM 1992  C CB   . ASP A 1 15  ? 10.447  2.400   5.892   1.00 0.00 ? 15  ASP A CB   2  
ATOM 1993  C CG   . ASP A 1 15  ? 11.664  1.588   6.294   1.00 0.00 ? 15  ASP A CG   2  
ATOM 1994  O OD1  . ASP A 1 15  ? 12.428  1.174   5.399   1.00 0.00 ? 15  ASP A OD1  2  
ATOM 1995  O OD2  . ASP A 1 15  ? 11.854  1.374   7.509   1.00 0.00 ? 15  ASP A OD2  2  
ATOM 1996  H H    . ASP A 1 15  ? 7.958   2.704   5.126   1.00 0.00 ? 15  ASP A H    2  
ATOM 1997  H HA   . ASP A 1 15  ? 10.503  2.278   3.746   1.00 0.00 ? 15  ASP A HA   2  
ATOM 1998  H HB2  . ASP A 1 15  ? 10.737  3.437   5.826   1.00 0.00 ? 15  ASP A HB2  2  
ATOM 1999  H HB3  . ASP A 1 15  ? 9.696   2.290   6.661   1.00 0.00 ? 15  ASP A HB3  2  
ATOM 2000  N N    . ALA A 1 16  ? 10.733  -0.269  4.086   1.00 0.00 ? 16  ALA A N    2  
ATOM 2001  C CA   . ALA A 1 16  ? 10.651  -1.724  3.987   1.00 0.00 ? 16  ALA A CA   2  
ATOM 2002  C C    . ALA A 1 16  ? 10.882  -2.408  5.327   1.00 0.00 ? 16  ALA A C    2  
ATOM 2003  O O    . ALA A 1 16  ? 10.567  -3.588  5.488   1.00 0.00 ? 16  ALA A O    2  
ATOM 2004  C CB   . ALA A 1 16  ? 11.633  -2.240  2.946   1.00 0.00 ? 16  ALA A CB   2  
ATOM 2005  H H    . ALA A 1 16  ? 11.564  0.182   3.827   1.00 0.00 ? 16  ALA A H    2  
ATOM 2006  H HA   . ALA A 1 16  ? 9.653   -1.971  3.659   1.00 0.00 ? 16  ALA A HA   2  
ATOM 2007  H HB1  . ALA A 1 16  ? 11.707  -1.525  2.138   1.00 0.00 ? 16  ALA A HB1  2  
ATOM 2008  H HB2  . ALA A 1 16  ? 11.285  -3.186  2.559   1.00 0.00 ? 16  ALA A HB2  2  
ATOM 2009  H HB3  . ALA A 1 16  ? 12.604  -2.370  3.401   1.00 0.00 ? 16  ALA A HB3  2  
ATOM 2010  N N    . LYS A 1 17  ? 11.418  -1.673  6.288   1.00 0.00 ? 17  LYS A N    2  
ATOM 2011  C CA   . LYS A 1 17  ? 11.669  -2.235  7.605   1.00 0.00 ? 17  LYS A CA   2  
ATOM 2012  C C    . LYS A 1 17  ? 10.370  -2.350  8.398   1.00 0.00 ? 17  LYS A C    2  
ATOM 2013  O O    . LYS A 1 17  ? 10.056  -3.408  8.947   1.00 0.00 ? 17  LYS A O    2  
ATOM 2014  C CB   . LYS A 1 17  ? 12.675  -1.374  8.370   1.00 0.00 ? 17  LYS A CB   2  
ATOM 2015  C CG   . LYS A 1 17  ? 13.184  -2.023  9.648   1.00 0.00 ? 17  LYS A CG   2  
ATOM 2016  C CD   . LYS A 1 17  ? 13.494  -0.983  10.712  1.00 0.00 ? 17  LYS A CD   2  
ATOM 2017  C CE   . LYS A 1 17  ? 12.281  -0.699  11.583  1.00 0.00 ? 17  LYS A CE   2  
ATOM 2018  N NZ   . LYS A 1 17  ? 12.618  -0.731  13.033  1.00 0.00 ? 17  LYS A NZ   2  
ATOM 2019  H H    . LYS A 1 17  ? 11.647  -0.734  6.109   1.00 0.00 ? 17  LYS A H    2  
ATOM 2020  H HA   . LYS A 1 17  ? 12.083  -3.224  7.471   1.00 0.00 ? 17  LYS A HA   2  
ATOM 2021  H HB2  . LYS A 1 17  ? 13.522  -1.178  7.731   1.00 0.00 ? 17  LYS A HB2  2  
ATOM 2022  H HB3  . LYS A 1 17  ? 12.206  -0.436  8.630   1.00 0.00 ? 17  LYS A HB3  2  
ATOM 2023  H HG2  . LYS A 1 17  ? 12.428  -2.695  10.025  1.00 0.00 ? 17  LYS A HG2  2  
ATOM 2024  H HG3  . LYS A 1 17  ? 14.084  -2.577  9.425   1.00 0.00 ? 17  LYS A HG3  2  
ATOM 2025  H HD2  . LYS A 1 17  ? 14.295  -1.350  11.337  1.00 0.00 ? 17  LYS A HD2  2  
ATOM 2026  H HD3  . LYS A 1 17  ? 13.802  -0.067  10.229  1.00 0.00 ? 17  LYS A HD3  2  
ATOM 2027  H HE2  . LYS A 1 17  ? 11.896  0.279   11.333  1.00 0.00 ? 17  LYS A HE2  2  
ATOM 2028  H HE3  . LYS A 1 17  ? 11.527  -1.444  11.381  1.00 0.00 ? 17  LYS A HE3  2  
ATOM 2029  H HZ1  . LYS A 1 17  ? 12.254  -1.603  13.464  1.00 0.00 ? 17  LYS A HZ1  2  
ATOM 2030  H HZ2  . LYS A 1 17  ? 12.195  0.088   13.516  1.00 0.00 ? 17  LYS A HZ2  2  
ATOM 2031  H HZ3  . LYS A 1 17  ? 13.652  -0.697  13.159  1.00 0.00 ? 17  LYS A HZ3  2  
ATOM 2032  N N    . THR A 1 18  ? 9.636   -1.244  8.479   1.00 0.00 ? 18  THR A N    2  
ATOM 2033  C CA   . THR A 1 18  ? 8.390   -1.230  9.240   1.00 0.00 ? 18  THR A CA   2  
ATOM 2034  C C    . THR A 1 18  ? 7.150   -1.003  8.387   1.00 0.00 ? 18  THR A C    2  
ATOM 2035  O O    . THR A 1 18  ? 6.028   -1.155  8.869   1.00 0.00 ? 18  THR A O    2  
ATOM 2036  C CB   . THR A 1 18  ? 8.430   -0.185  10.370  1.00 0.00 ? 18  THR A CB   2  
ATOM 2037  O OG1  . THR A 1 18  ? 7.143   -0.078  10.989  1.00 0.00 ? 18  THR A OG1  2  
ATOM 2038  C CG2  . THR A 1 18  ? 8.858   1.173   9.836   1.00 0.00 ? 18  THR A CG2  2  
ATOM 2039  H H    . THR A 1 18  ? 9.972   -0.436  8.041   1.00 0.00 ? 18  THR A H    2  
ATOM 2040  H HA   . THR A 1 18  ? 8.299   -2.195  9.683   1.00 0.00 ? 18  THR A HA   2  
ATOM 2041  H HB   . THR A 1 18  ? 9.149   -0.505  11.110  1.00 0.00 ? 18  THR A HB   2  
ATOM 2042  H HG1  . THR A 1 18  ? 7.123   0.696   11.556  1.00 0.00 ? 18  THR A HG1  2  
ATOM 2043  H HG21 . THR A 1 18  ? 8.748   1.917   10.613  1.00 0.00 ? 18  THR A HG21 2  
ATOM 2044  H HG22 . THR A 1 18  ? 8.236   1.441   8.993   1.00 0.00 ? 18  THR A HG22 2  
ATOM 2045  H HG23 . THR A 1 18  ? 9.890   1.131   9.523   1.00 0.00 ? 18  THR A HG23 2  
ATOM 2046  N N    . THR A 1 19  ? 7.351   -0.629  7.139   1.00 0.00 ? 19  THR A N    2  
ATOM 2047  C CA   . THR A 1 19  ? 6.239   -0.368  6.224   1.00 0.00 ? 19  THR A CA   2  
ATOM 2048  C C    . THR A 1 19  ? 5.520   0.925   6.590   1.00 0.00 ? 19  THR A C    2  
ATOM 2049  O O    . THR A 1 19  ? 4.479   1.252   6.017   1.00 0.00 ? 19  THR A O    2  
ATOM 2050  C CB   . THR A 1 19  ? 5.220   -1.523  6.200   1.00 0.00 ? 19  THR A CB   2  
ATOM 2051  O OG1  . THR A 1 19  ? 5.876   -2.767  6.473   1.00 0.00 ? 19  THR A OG1  2  
ATOM 2052  C CG2  . THR A 1 19  ? 4.521   -1.599  4.852   1.00 0.00 ? 19  THR A CG2  2  
ATOM 2053  H H    . THR A 1 19  ? 8.269   -0.505  6.827   1.00 0.00 ? 19  THR A H    2  
ATOM 2054  H HA   . THR A 1 19  ? 6.651   -0.264  5.230   1.00 0.00 ? 19  THR A HA   2  
ATOM 2055  H HB   . THR A 1 19  ? 4.478   -1.340  6.964   1.00 0.00 ? 19  THR A HB   2  
ATOM 2056  H HG1  . THR A 1 19  ? 6.028   -2.850  7.417   1.00 0.00 ? 19  THR A HG1  2  
ATOM 2057  H HG21 . THR A 1 19  ? 4.959   -0.876  4.178   1.00 0.00 ? 19  THR A HG21 2  
ATOM 2058  H HG22 . THR A 1 19  ? 3.469   -1.383  4.978   1.00 0.00 ? 19  THR A HG22 2  
ATOM 2059  H HG23 . THR A 1 19  ? 4.637   -2.591  4.440   1.00 0.00 ? 19  THR A HG23 2  
ATOM 2060  N N    . GLU A 1 20  ? 6.088   1.660   7.539   1.00 0.00 ? 20  GLU A N    2  
ATOM 2061  C CA   . GLU A 1 20  ? 5.512   2.923   7.977   1.00 0.00 ? 20  GLU A CA   2  
ATOM 2062  C C    . GLU A 1 20  ? 5.434   3.897   6.808   1.00 0.00 ? 20  GLU A C    2  
ATOM 2063  O O    . GLU A 1 20  ? 6.456   4.334   6.283   1.00 0.00 ? 20  GLU A O    2  
ATOM 2064  C CB   . GLU A 1 20  ? 6.346   3.527   9.108   1.00 0.00 ? 20  GLU A CB   2  
ATOM 2065  C CG   . GLU A 1 20  ? 5.763   3.284   10.490  1.00 0.00 ? 20  GLU A CG   2  
ATOM 2066  C CD   . GLU A 1 20  ? 6.446   4.105   11.566  1.00 0.00 ? 20  GLU A CD   2  
ATOM 2067  O OE1  . GLU A 1 20  ? 6.555   5.336   11.392  1.00 0.00 ? 20  GLU A OE1  2  
ATOM 2068  O OE2  . GLU A 1 20  ? 6.872   3.516   12.581  1.00 0.00 ? 20  GLU A OE2  2  
ATOM 2069  H H    . GLU A 1 20  ? 6.916   1.346   7.949   1.00 0.00 ? 20  GLU A H    2  
ATOM 2070  H HA   . GLU A 1 20  ? 4.514   2.728   8.338   1.00 0.00 ? 20  GLU A HA   2  
ATOM 2071  H HB2  . GLU A 1 20  ? 7.337   3.098   9.079   1.00 0.00 ? 20  GLU A HB2  2  
ATOM 2072  H HB3  . GLU A 1 20  ? 6.421   4.595   8.956   1.00 0.00 ? 20  GLU A HB3  2  
ATOM 2073  H HG2  . GLU A 1 20  ? 4.714   3.541   10.475  1.00 0.00 ? 20  GLU A HG2  2  
ATOM 2074  H HG3  . GLU A 1 20  ? 5.871   2.236   10.732  1.00 0.00 ? 20  GLU A HG3  2  
ATOM 2075  N N    . ILE A 1 21  ? 4.214   4.217   6.398   1.00 0.00 ? 21  ILE A N    2  
ATOM 2076  C CA   . ILE A 1 21  ? 3.999   5.124   5.280   1.00 0.00 ? 21  ILE A CA   2  
ATOM 2077  C C    . ILE A 1 21  ? 4.588   6.501   5.554   1.00 0.00 ? 21  ILE A C    2  
ATOM 2078  O O    . ILE A 1 21  ? 4.011   7.307   6.285   1.00 0.00 ? 21  ILE A O    2  
ATOM 2079  C CB   . ILE A 1 21  ? 2.503   5.266   4.934   1.00 0.00 ? 21  ILE A CB   2  
ATOM 2080  C CG1  . ILE A 1 21  ? 1.720   4.029   5.383   1.00 0.00 ? 21  ILE A CG1  2  
ATOM 2081  C CG2  . ILE A 1 21  ? 2.337   5.477   3.439   1.00 0.00 ? 21  ILE A CG2  2  
ATOM 2082  C CD1  . ILE A 1 21  ? 0.518   4.348   6.244   1.00 0.00 ? 21  ILE A CD1  2  
ATOM 2083  H H    . ILE A 1 21  ? 3.442   3.825   6.852   1.00 0.00 ? 21  ILE A H    2  
ATOM 2084  H HA   . ILE A 1 21  ? 4.500   4.704   4.420   1.00 0.00 ? 21  ILE A HA   2  
ATOM 2085  H HB   . ILE A 1 21  ? 2.117   6.136   5.444   1.00 0.00 ? 21  ILE A HB   2  
ATOM 2086  H HG12 . ILE A 1 21  ? 1.370   3.498   4.512   1.00 0.00 ? 21  ILE A HG12 2  
ATOM 2087  H HG13 . ILE A 1 21  ? 2.375   3.383   5.952   1.00 0.00 ? 21  ILE A HG13 2  
ATOM 2088  H HG21 . ILE A 1 21  ? 2.033   4.547   2.977   1.00 0.00 ? 21  ILE A HG21 2  
ATOM 2089  H HG22 . ILE A 1 21  ? 3.274   5.799   3.013   1.00 0.00 ? 21  ILE A HG22 2  
ATOM 2090  H HG23 . ILE A 1 21  ? 1.582   6.230   3.261   1.00 0.00 ? 21  ILE A HG23 2  
ATOM 2091  H HD11 . ILE A 1 21  ? 0.737   5.208   6.861   1.00 0.00 ? 21  ILE A HD11 2  
ATOM 2092  H HD12 . ILE A 1 21  ? 0.291   3.500   6.875   1.00 0.00 ? 21  ILE A HD12 2  
ATOM 2093  H HD13 . ILE A 1 21  ? -0.330  4.564   5.613   1.00 0.00 ? 21  ILE A HD13 2  
ATOM 2094  N N    . LEU A 1 22  ? 5.746   6.758   4.954   1.00 0.00 ? 22  LEU A N    2  
ATOM 2095  C CA   . LEU A 1 22  ? 6.434   8.034   5.117   1.00 0.00 ? 22  LEU A CA   2  
ATOM 2096  C C    . LEU A 1 22  ? 5.551   9.194   4.666   1.00 0.00 ? 22  LEU A C    2  
ATOM 2097  O O    . LEU A 1 22  ? 5.582   10.271  5.262   1.00 0.00 ? 22  LEU A O    2  
ATOM 2098  C CB   . LEU A 1 22  ? 7.747   8.039   4.326   1.00 0.00 ? 22  LEU A CB   2  
ATOM 2099  C CG   . LEU A 1 22  ? 8.388   6.664   4.109   1.00 0.00 ? 22  LEU A CG   2  
ATOM 2100  C CD1  . LEU A 1 22  ? 9.550   6.767   3.133   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2101  C CD2  . LEU A 1 22  ? 8.855   6.077   5.432   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2102  H H    . LEU A 1 22  ? 6.147   6.068   4.386   1.00 0.00 ? 22  LEU A H    2  
ATOM 2103  H HA   . LEU A 1 22  ? 6.658   8.156   6.166   1.00 0.00 ? 22  LEU A HA   2  
ATOM 2104  H HB2  . LEU A 1 22  ? 7.557   8.480   3.360   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2105  H HB3  . LEU A 1 22  ? 8.455   8.660   4.853   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2106  H HG   . LEU A 1 22  ? 7.653   5.994   3.684   1.00 0.00 ? 22  LEU A HG   2  
ATOM 2107  H HD11 . LEU A 1 22  ? 10.474  6.856   3.684   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2108  H HD12 . LEU A 1 22  ? 9.418   7.637   2.507   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2109  H HD13 . LEU A 1 22  ? 9.582   5.882   2.518   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2110  H HD21 . LEU A 1 22  ? 8.907   5.002   5.351   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2111  H HD22 . LEU A 1 22  ? 8.156   6.346   6.211   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2112  H HD23 . LEU A 1 22  ? 9.832   6.468   5.675   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2113  N N    . VAL A 1 23  ? 4.764   8.967   3.615   1.00 0.00 ? 23  VAL A N    2  
ATOM 2114  C CA   . VAL A 1 23  ? 3.874   9.998   3.092   1.00 0.00 ? 23  VAL A CA   2  
ATOM 2115  C C    . VAL A 1 23  ? 3.008   9.461   1.950   1.00 0.00 ? 23  VAL A C    2  
ATOM 2116  O O    . VAL A 1 23  ? 3.371   8.489   1.287   1.00 0.00 ? 23  VAL A O    2  
ATOM 2117  C CB   . VAL A 1 23  ? 4.671   11.234  2.605   1.00 0.00 ? 23  VAL A CB   2  
ATOM 2118  C CG1  . VAL A 1 23  ? 4.709   11.313  1.082   1.00 0.00 ? 23  VAL A CG1  2  
ATOM 2119  C CG2  . VAL A 1 23  ? 4.086   12.510  3.189   1.00 0.00 ? 23  VAL A CG2  2  
ATOM 2120  H H    . VAL A 1 23  ? 4.779   8.087   3.185   1.00 0.00 ? 23  VAL A H    2  
ATOM 2121  H HA   . VAL A 1 23  ? 3.226   10.314  3.896   1.00 0.00 ? 23  VAL A HA   2  
ATOM 2122  H HB   . VAL A 1 23  ? 5.686   11.139  2.958   1.00 0.00 ? 23  VAL A HB   2  
ATOM 2123  H HG11 . VAL A 1 23  ? 5.052   10.371  0.680   1.00 0.00 ? 23  VAL A HG11 2  
ATOM 2124  H HG12 . VAL A 1 23  ? 5.383   12.101  0.779   1.00 0.00 ? 23  VAL A HG12 2  
ATOM 2125  H HG13 . VAL A 1 23  ? 3.717   11.525  0.707   1.00 0.00 ? 23  VAL A HG13 2  
ATOM 2126  H HG21 . VAL A 1 23  ? 3.599   12.285  4.127   1.00 0.00 ? 23  VAL A HG21 2  
ATOM 2127  H HG22 . VAL A 1 23  ? 3.366   12.925  2.501   1.00 0.00 ? 23  VAL A HG22 2  
ATOM 2128  H HG23 . VAL A 1 23  ? 4.878   13.226  3.356   1.00 0.00 ? 23  VAL A HG23 2  
ATOM 2129  N N    . ALA A 1 24  ? 1.872   10.112  1.722   1.00 0.00 ? 24  ALA A N    2  
ATOM 2130  C CA   . ALA A 1 24  ? 0.959   9.721   0.653   1.00 0.00 ? 24  ALA A CA   2  
ATOM 2131  C C    . ALA A 1 24  ? 0.408   10.955  -0.053  1.00 0.00 ? 24  ALA A C    2  
ATOM 2132  O O    . ALA A 1 24  ? 0.424   12.052  0.501   1.00 0.00 ? 24  ALA A O    2  
ATOM 2133  C CB   . ALA A 1 24  ? -0.171  8.862   1.196   1.00 0.00 ? 24  ALA A CB   2  
ATOM 2134  H H    . ALA A 1 24  ? 1.647   10.887  2.279   1.00 0.00 ? 24  ALA A H    2  
ATOM 2135  H HA   . ALA A 1 24  ? 1.519   9.131   -0.061  1.00 0.00 ? 24  ALA A HA   2  
ATOM 2136  H HB1  . ALA A 1 24  ? 0.158   8.354   2.090   1.00 0.00 ? 24  ALA A HB1  2  
ATOM 2137  H HB2  . ALA A 1 24  ? -0.461  8.135   0.453   1.00 0.00 ? 24  ALA A HB2  2  
ATOM 2138  H HB3  . ALA A 1 24  ? -1.018  9.491   1.433   1.00 0.00 ? 24  ALA A HB3  2  
ATOM 2139  N N    . ASN A 1 25  ? -0.050  10.776  -1.286  1.00 0.00 ? 25  ASN A N    2  
ATOM 2140  C CA   . ASN A 1 25  ? -0.568  11.893  -2.068  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2141  C C    . ASN A 1 25  ? -2.087  12.036  -1.968  1.00 0.00 ? 25  ASN A C    2  
ATOM 2142  O O    . ASN A 1 25  ? -2.767  11.224  -1.340  1.00 0.00 ? 25  ASN A O    2  
ATOM 2143  C CB   . ASN A 1 25  ? -0.153  11.748  -3.534  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2144  C CG   . ASN A 1 25  ? -0.635  10.450  -4.156  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2145  O OD1  . ASN A 1 25  ? -0.759  9.428   -3.481  1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2146  N ND2  . ASN A 1 25  ? -0.907  10.483  -5.454  1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2147  H H    . ASN A 1 25  ? -0.011  9.885   -1.688  1.00 0.00 ? 25  ASN A H    2  
ATOM 2148  H HA   . ASN A 1 25  ? -0.121  12.795  -1.673  1.00 0.00 ? 25  ASN A HA   2  
ATOM 2149  H HB2  . ASN A 1 25  ? -0.566  12.568  -4.101  1.00 0.00 ? 25  ASN A HB2  2  
ATOM 2150  H HB3  . ASN A 1 25  ? 0.925   11.779  -3.600  1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2151  H HD21 . ASN A 1 25  ? -0.785  11.331  -5.929  1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2152  H HD22 . ASN A 1 25  ? -1.219  9.660   -5.883  1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2153  N N    . ASP A 1 26  ? -2.590  13.098  -2.591  1.00 0.00 ? 26  ASP A N    2  
ATOM 2154  C CA   . ASP A 1 26  ? -4.019  13.414  -2.599  1.00 0.00 ? 26  ASP A CA   2  
ATOM 2155  C C    . ASP A 1 26  ? -4.808  12.444  -3.466  1.00 0.00 ? 26  ASP A C    2  
ATOM 2156  O O    . ASP A 1 26  ? -6.039  12.481  -3.486  1.00 0.00 ? 26  ASP A O    2  
ATOM 2157  C CB   . ASP A 1 26  ? -4.249  14.847  -3.083  1.00 0.00 ? 26  ASP A CB   2  
ATOM 2158  C CG   . ASP A 1 26  ? -3.006  15.709  -2.964  1.00 0.00 ? 26  ASP A CG   2  
ATOM 2159  O OD1  . ASP A 1 26  ? -2.497  15.861  -1.834  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2160  O OD2  . ASP A 1 26  ? -2.545  16.233  -4.000  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2161  H H    . ASP A 1 26  ? -1.966  13.693  -3.059  1.00 0.00 ? 26  ASP A H    2  
ATOM 2162  H HA   . ASP A 1 26  ? -4.378  13.326  -1.586  1.00 0.00 ? 26  ASP A HA   2  
ATOM 2163  H HB2  . ASP A 1 26  ? -4.550  14.826  -4.121  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2164  H HB3  . ASP A 1 26  ? -5.035  15.296  -2.494  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2165  N N    . LYS A 1 27  ? -4.107  11.556  -4.158  1.00 0.00 ? 27  LYS A N    2  
ATOM 2166  C CA   . LYS A 1 27  ? -4.763  10.562  -4.990  1.00 0.00 ? 27  LYS A CA   2  
ATOM 2167  C C    . LYS A 1 27  ? -4.976  9.298   -4.170  1.00 0.00 ? 27  LYS A C    2  
ATOM 2168  O O    . LYS A 1 27  ? -6.107  8.938   -3.850  1.00 0.00 ? 27  LYS A O    2  
ATOM 2169  C CB   . LYS A 1 27  ? -3.930  10.276  -6.237  1.00 0.00 ? 27  LYS A CB   2  
ATOM 2170  C CG   . LYS A 1 27  ? -3.345  11.529  -6.874  1.00 0.00 ? 27  LYS A CG   2  
ATOM 2171  C CD   . LYS A 1 27  ? -4.261  12.090  -7.949  1.00 0.00 ? 27  LYS A CD   2  
ATOM 2172  C CE   . LYS A 1 27  ? -5.396  12.901  -7.346  1.00 0.00 ? 27  LYS A CE   2  
ATOM 2173  N NZ   . LYS A 1 27  ? -5.412  14.300  -7.854  1.00 0.00 ? 27  LYS A NZ   2  
ATOM 2174  H H    . LYS A 1 27  ? -3.132  11.537  -4.075  1.00 0.00 ? 27  LYS A H    2  
ATOM 2175  H HA   . LYS A 1 27  ? -5.724  10.956  -5.284  1.00 0.00 ? 27  LYS A HA   2  
ATOM 2176  H HB2  . LYS A 1 27  ? -3.115  9.621   -5.970  1.00 0.00 ? 27  LYS A HB2  2  
ATOM 2177  H HB3  . LYS A 1 27  ? -4.553  9.784   -6.968  1.00 0.00 ? 27  LYS A HB3  2  
ATOM 2178  H HG2  . LYS A 1 27  ? -3.205  12.278  -6.111  1.00 0.00 ? 27  LYS A HG2  2  
ATOM 2179  H HG3  . LYS A 1 27  ? -2.391  11.282  -7.319  1.00 0.00 ? 27  LYS A HG3  2  
ATOM 2180  H HD2  . LYS A 1 27  ? -3.685  12.728  -8.603  1.00 0.00 ? 27  LYS A HD2  2  
ATOM 2181  H HD3  . LYS A 1 27  ? -4.677  11.271  -8.518  1.00 0.00 ? 27  LYS A HD3  2  
ATOM 2182  H HE2  . LYS A 1 27  ? -6.333  12.427  -7.598  1.00 0.00 ? 27  LYS A HE2  2  
ATOM 2183  H HE3  . LYS A 1 27  ? -5.278  12.917  -6.273  1.00 0.00 ? 27  LYS A HE3  2  
ATOM 2184  H HZ1  . LYS A 1 27  ? -6.224  14.442  -8.488  1.00 0.00 ? 27  LYS A HZ1  2  
ATOM 2185  H HZ2  . LYS A 1 27  ? -4.537  14.499  -8.381  1.00 0.00 ? 27  LYS A HZ2  2  
ATOM 2186  H HZ3  . LYS A 1 27  ? -5.483  14.967  -7.059  1.00 0.00 ? 27  LYS A HZ3  2  
ATOM 2187  N N    . ALA A 1 28  ? -3.871  8.649   -3.804  1.00 0.00 ? 28  ALA A N    2  
ATOM 2188  C CA   . ALA A 1 28  ? -3.926  7.445   -2.979  1.00 0.00 ? 28  ALA A CA   2  
ATOM 2189  C C    . ALA A 1 28  ? -4.844  7.659   -1.782  1.00 0.00 ? 28  ALA A C    2  
ATOM 2190  O O    . ALA A 1 28  ? -5.693  6.821   -1.471  1.00 0.00 ? 28  ALA A O    2  
ATOM 2191  C CB   . ALA A 1 28  ? -2.533  7.081   -2.497  1.00 0.00 ? 28  ALA A CB   2  
ATOM 2192  H H    . ALA A 1 28  ? -2.996  9.001   -4.085  1.00 0.00 ? 28  ALA A H    2  
ATOM 2193  H HA   . ALA A 1 28  ? -4.305  6.634   -3.582  1.00 0.00 ? 28  ALA A HA   2  
ATOM 2194  H HB1  . ALA A 1 28  ? -2.427  6.007   -2.482  1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2195  H HB2  . ALA A 1 28  ? -2.385  7.474   -1.501  1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2196  H HB3  . ALA A 1 28  ? -1.798  7.508   -3.164  1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2197  N N    . CYS A 1 29  ? -4.660  8.793   -1.115  1.00 0.00 ? 29  CYS A N    2  
ATOM 2198  C CA   . CYS A 1 29  ? -5.464  9.140   0.047   1.00 0.00 ? 29  CYS A CA   2  
ATOM 2199  C C    . CYS A 1 29  ? -6.939  9.158   -0.318  1.00 0.00 ? 29  CYS A C    2  
ATOM 2200  O O    . CYS A 1 29  ? -7.787  8.718   0.455   1.00 0.00 ? 29  CYS A O    2  
ATOM 2201  C CB   . CYS A 1 29  ? -5.027  10.501  0.593   1.00 0.00 ? 29  CYS A CB   2  
ATOM 2202  S SG   . CYS A 1 29  ? -6.095  11.879  0.111   1.00 0.00 ? 29  CYS A SG   2  
ATOM 2203  H H    . CYS A 1 29  ? -3.968  9.416   -1.422  1.00 0.00 ? 29  CYS A H    2  
ATOM 2204  H HA   . CYS A 1 29  ? -5.304  8.384   0.801   1.00 0.00 ? 29  CYS A HA   2  
ATOM 2205  H HB2  . CYS A 1 29  ? -5.013  10.460  1.671   1.00 0.00 ? 29  CYS A HB2  2  
ATOM 2206  H HB3  . CYS A 1 29  ? -4.030  10.718  0.235   1.00 0.00 ? 29  CYS A HB3  2  
ATOM 2207  H HG   . CYS A 1 29  ? -7.325  11.607  0.523   1.00 0.00 ? 29  CYS A HG   2  
ATOM 2208  N N    . GLY A 1 30  ? -7.233  9.658   -1.513  1.00 0.00 ? 30  GLY A N    2  
ATOM 2209  C CA   . GLY A 1 30  ? -8.607  9.703   -1.972  1.00 0.00 ? 30  GLY A CA   2  
ATOM 2210  C C    . GLY A 1 30  ? -9.193  8.311   -2.079  1.00 0.00 ? 30  GLY A C    2  
ATOM 2211  O O    . GLY A 1 30  ? -10.354 8.085   -1.737  1.00 0.00 ? 30  GLY A O    2  
ATOM 2212  H H    . GLY A 1 30  ? -6.508  9.981   -2.091  1.00 0.00 ? 30  GLY A H    2  
ATOM 2213  H HA2  . GLY A 1 30  ? -9.195  10.283  -1.276  1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2214  H HA3  . GLY A 1 30  ? -8.640  10.173  -2.944  1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2215  N N    . LEU A 1 31  ? -8.369  7.379   -2.549  1.00 0.00 ? 31  LEU A N    2  
ATOM 2216  C CA   . LEU A 1 31  ? -8.777  5.987   -2.702  1.00 0.00 ? 31  LEU A CA   2  
ATOM 2217  C C    . LEU A 1 31  ? -9.430  5.481   -1.414  1.00 0.00 ? 31  LEU A C    2  
ATOM 2218  O O    . LEU A 1 31  ? -10.569 5.012   -1.435  1.00 0.00 ? 31  LEU A O    2  
ATOM 2219  C CB   . LEU A 1 31  ? -7.560  5.131   -3.089  1.00 0.00 ? 31  LEU A CB   2  
ATOM 2220  C CG   . LEU A 1 31  ? -7.783  3.614   -3.195  1.00 0.00 ? 31  LEU A CG   2  
ATOM 2221  C CD1  . LEU A 1 31  ? -7.414  2.946   -1.883  1.00 0.00 ? 31  LEU A CD1  2  
ATOM 2222  C CD2  . LEU A 1 31  ? -9.216  3.275   -3.596  1.00 0.00 ? 31  LEU A CD2  2  
ATOM 2223  H H    . LEU A 1 31  ? -7.460  7.642   -2.799  1.00 0.00 ? 31  LEU A H    2  
ATOM 2224  H HA   . LEU A 1 31  ? -9.504  5.945   -3.497  1.00 0.00 ? 31  LEU A HA   2  
ATOM 2225  H HB2  . LEU A 1 31  ? -7.199  5.481   -4.044  1.00 0.00 ? 31  LEU A HB2  2  
ATOM 2226  H HB3  . LEU A 1 31  ? -6.788  5.303   -2.355  1.00 0.00 ? 31  LEU A HB3  2  
ATOM 2227  H HG   . LEU A 1 31  ? -7.125  3.219   -3.958  1.00 0.00 ? 31  LEU A HG   2  
ATOM 2228  H HD11 . LEU A 1 31  ? -7.133  3.704   -1.164  1.00 0.00 ? 31  LEU A HD11 2  
ATOM 2229  H HD12 . LEU A 1 31  ? -6.578  2.278   -2.044  1.00 0.00 ? 31  LEU A HD12 2  
ATOM 2230  H HD13 . LEU A 1 31  ? -8.258  2.386   -1.508  1.00 0.00 ? 31  LEU A HD13 2  
ATOM 2231  H HD21 . LEU A 1 31  ? -9.207  2.702   -4.513  1.00 0.00 ? 31  LEU A HD21 2  
ATOM 2232  H HD22 . LEU A 1 31  ? -9.776  4.187   -3.750  1.00 0.00 ? 31  LEU A HD22 2  
ATOM 2233  H HD23 . LEU A 1 31  ? -9.682  2.694   -2.813  1.00 0.00 ? 31  LEU A HD23 2  
ATOM 2234  N N    . LEU A 1 32  ? -8.721  5.596   -0.290  1.00 0.00 ? 32  LEU A N    2  
ATOM 2235  C CA   . LEU A 1 32  ? -9.288  5.158   0.988   1.00 0.00 ? 32  LEU A CA   2  
ATOM 2236  C C    . LEU A 1 32  ? -9.988  6.313   1.698   1.00 0.00 ? 32  LEU A C    2  
ATOM 2237  O O    . LEU A 1 32  ? -11.217 6.342   1.783   1.00 0.00 ? 32  LEU A O    2  
ATOM 2238  C CB   . LEU A 1 32  ? -8.246  4.532   1.925   1.00 0.00 ? 32  LEU A CB   2  
ATOM 2239  C CG   . LEU A 1 32  ? -6.778  4.642   1.512   1.00 0.00 ? 32  LEU A CG   2  
ATOM 2240  C CD1  . LEU A 1 32  ? -6.302  6.086   1.566   1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2241  C CD2  . LEU A 1 32  ? -5.937  3.769   2.428   1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2242  H H    . LEU A 1 32  ? -7.822  5.993   -0.336  1.00 0.00 ? 32  LEU A H    2  
ATOM 2243  H HA   . LEU A 1 32  ? -10.033 4.408   0.759   1.00 0.00 ? 32  LEU A HA   2  
ATOM 2244  H HB2  . LEU A 1 32  ? -8.352  4.995   2.894   1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2245  H HB3  . LEU A 1 32  ? -8.483  3.481   2.025   1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2246  H HG   . LEU A 1 32  ? -6.657  4.284   0.502   1.00 0.00 ? 32  LEU A HG   2  
ATOM 2247  H HD11 . LEU A 1 32  ? -5.394  6.187   0.990   1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2248  H HD12 . LEU A 1 32  ? -6.111  6.364   2.590   1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2249  H HD13 . LEU A 1 32  ? -7.063  6.732   1.153   1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2250  H HD21 . LEU A 1 32  ? -5.082  4.328   2.779   1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2251  H HD22 . LEU A 1 32  ? -5.600  2.897   1.888   1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2252  H HD23 . LEU A 1 32  ? -6.538  3.457   3.277   1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2253  N N    . GLY A 1 33  ? -9.208  7.260   2.208   1.00 0.00 ? 33  GLY A N    2  
ATOM 2254  C CA   . GLY A 1 33  ? -9.782  8.399   2.903   1.00 0.00 ? 33  GLY A CA   2  
ATOM 2255  C C    . GLY A 1 33  ? -8.811  9.030   3.881   1.00 0.00 ? 33  GLY A C    2  
ATOM 2256  O O    . GLY A 1 33  ? -9.220  9.698   4.831   1.00 0.00 ? 33  GLY A O    2  
ATOM 2257  H H    . GLY A 1 33  ? -8.236  7.186   2.112   1.00 0.00 ? 33  GLY A H    2  
ATOM 2258  H HA2  . GLY A 1 33  ? -10.077 9.141   2.177   1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2259  H HA3  . GLY A 1 33  ? -10.659 8.072   3.443   1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2260  N N    . TYR A 1 34  ? -7.522  8.815   3.645   1.00 0.00 ? 34  TYR A N    2  
ATOM 2261  C CA   . TYR A 1 34  ? -6.480  9.364   4.505   1.00 0.00 ? 34  TYR A CA   2  
ATOM 2262  C C    . TYR A 1 34  ? -5.770  10.526  3.813   1.00 0.00 ? 34  TYR A C    2  
ATOM 2263  O O    . TYR A 1 34  ? -6.383  11.268  3.045   1.00 0.00 ? 34  TYR A O    2  
ATOM 2264  C CB   . TYR A 1 34  ? -5.460  8.275   4.853   1.00 0.00 ? 34  TYR A CB   2  
ATOM 2265  C CG   . TYR A 1 34  ? -5.972  7.225   5.812   1.00 0.00 ? 34  TYR A CG   2  
ATOM 2266  C CD1  . TYR A 1 34  ? -6.933  6.305   5.416   1.00 0.00 ? 34  TYR A CD1  2  
ATOM 2267  C CD2  . TYR A 1 34  ? -5.486  7.151   7.111   1.00 0.00 ? 34  TYR A CD2  2  
ATOM 2268  C CE1  . TYR A 1 34  ? -7.396  5.342   6.289   1.00 0.00 ? 34  TYR A CE1  2  
ATOM 2269  C CE2  . TYR A 1 34  ? -5.945  6.190   7.989   1.00 0.00 ? 34  TYR A CE2  2  
ATOM 2270  C CZ   . TYR A 1 34  ? -6.901  5.289   7.575   1.00 0.00 ? 34  TYR A CZ   2  
ATOM 2271  O OH   . TYR A 1 34  ? -7.362  4.329   8.445   1.00 0.00 ? 34  TYR A OH   2  
ATOM 2272  H H    . TYR A 1 34  ? -7.264  8.274   2.869   1.00 0.00 ? 34  TYR A H    2  
ATOM 2273  H HA   . TYR A 1 34  ? -6.943  9.720   5.412   1.00 0.00 ? 34  TYR A HA   2  
ATOM 2274  H HB2  . TYR A 1 34  ? -5.162  7.772   3.945   1.00 0.00 ? 34  TYR A HB2  2  
ATOM 2275  H HB3  . TYR A 1 34  ? -4.593  8.737   5.301   1.00 0.00 ? 34  TYR A HB3  2  
ATOM 2276  H HD1  . TYR A 1 34  ? -7.320  6.351   4.409   1.00 0.00 ? 34  TYR A HD1  2  
ATOM 2277  H HD2  . TYR A 1 34  ? -4.736  7.859   7.430   1.00 0.00 ? 34  TYR A HD2  2  
ATOM 2278  H HE1  . TYR A 1 34  ? -8.144  4.634   5.963   1.00 0.00 ? 34  TYR A HE1  2  
ATOM 2279  H HE2  . TYR A 1 34  ? -5.557  6.151   8.998   1.00 0.00 ? 34  TYR A HE2  2  
ATOM 2280  H HH   . TYR A 1 34  ? -7.318  4.664   9.344   1.00 0.00 ? 34  TYR A HH   2  
ATOM 2281  N N    . SER A 1 35  ? -4.471  10.659  4.081   1.00 0.00 ? 35  SER A N    2  
ATOM 2282  C CA   . SER A 1 35  ? -3.644  11.701  3.483   1.00 0.00 ? 35  SER A CA   2  
ATOM 2283  C C    . SER A 1 35  ? -2.243  11.658  4.073   1.00 0.00 ? 35  SER A C    2  
ATOM 2284  O O    . SER A 1 35  ? -2.007  10.990  5.077   1.00 0.00 ? 35  SER A O    2  
ATOM 2285  C CB   . SER A 1 35  ? -4.250  13.085  3.678   1.00 0.00 ? 35  SER A CB   2  
ATOM 2286  O OG   . SER A 1 35  ? -4.399  13.396  5.053   1.00 0.00 ? 35  SER A OG   2  
ATOM 2287  H H    . SER A 1 35  ? -4.048  10.023  4.694   1.00 0.00 ? 35  SER A H    2  
ATOM 2288  H HA   . SER A 1 35  ? -3.582  11.500  2.427   1.00 0.00 ? 35  SER A HA   2  
ATOM 2289  H HB2  . SER A 1 35  ? -3.603  13.822  3.220   1.00 0.00 ? 35  SER A HB2  2  
ATOM 2290  H HB3  . SER A 1 35  ? -5.218  13.112  3.205   1.00 0.00 ? 35  SER A HB3  2  
ATOM 2291  H HG   . SER A 1 35  ? -4.552  14.339  5.153   1.00 0.00 ? 35  SER A HG   2  
ATOM 2292  N N    . SER A 1 36  ? -1.318  12.366  3.443   1.00 0.00 ? 36  SER A N    2  
ATOM 2293  C CA   . SER A 1 36  ? 0.067   12.403  3.898   1.00 0.00 ? 36  SER A CA   2  
ATOM 2294  C C    . SER A 1 36  ? 0.171   12.616  5.408   1.00 0.00 ? 36  SER A C    2  
ATOM 2295  O O    . SER A 1 36  ? 1.053   12.057  6.058   1.00 0.00 ? 36  SER A O    2  
ATOM 2296  C CB   . SER A 1 36  ? 0.826   13.512  3.168   1.00 0.00 ? 36  SER A CB   2  
ATOM 2297  O OG   . SER A 1 36  ? -0.068  14.467  2.622   1.00 0.00 ? 36  SER A OG   2  
ATOM 2298  H H    . SER A 1 36  ? -1.571  12.873  2.643   1.00 0.00 ? 36  SER A H    2  
ATOM 2299  H HA   . SER A 1 36  ? 0.520   11.454  3.650   1.00 0.00 ? 36  SER A HA   2  
ATOM 2300  H HB2  . SER A 1 36  ? 1.486   14.011  3.863   1.00 0.00 ? 36  SER A HB2  2  
ATOM 2301  H HB3  . SER A 1 36  ? 1.406   13.081  2.366   1.00 0.00 ? 36  SER A HB3  2  
ATOM 2302  H HG   . SER A 1 36  ? 0.429   15.218  2.291   1.00 0.00 ? 36  SER A HG   2  
ATOM 2303  N N    . GLN A 1 37  ? -0.714  13.441  5.958   1.00 0.00 ? 37  GLN A N    2  
ATOM 2304  C CA   . GLN A 1 37  ? -0.699  13.738  7.389   1.00 0.00 ? 37  GLN A CA   2  
ATOM 2305  C C    . GLN A 1 37  ? -1.743  12.941  8.173   1.00 0.00 ? 37  GLN A C    2  
ATOM 2306  O O    . GLN A 1 37  ? -1.800  13.028  9.399   1.00 0.00 ? 37  GLN A O    2  
ATOM 2307  C CB   . GLN A 1 37  ? -0.921  15.234  7.618   1.00 0.00 ? 37  GLN A CB   2  
ATOM 2308  C CG   . GLN A 1 37  ? -2.117  15.793  6.863   1.00 0.00 ? 37  GLN A CG   2  
ATOM 2309  C CD   . GLN A 1 37  ? -1.716  16.797  5.798   1.00 0.00 ? 37  GLN A CD   2  
ATOM 2310  O OE1  . GLN A 1 37  ? -2.176  16.724  4.658   1.00 0.00 ? 37  GLN A OE1  2  
ATOM 2311  N NE2  . GLN A 1 37  ? -0.856  17.738  6.165   1.00 0.00 ? 37  GLN A NE2  2  
ATOM 2312  H H    . GLN A 1 37  ? -1.387  13.868  5.388   1.00 0.00 ? 37  GLN A H    2  
ATOM 2313  H HA   . GLN A 1 37  ? 0.281   13.477  7.765   1.00 0.00 ? 37  GLN A HA   2  
ATOM 2314  H HB2  . GLN A 1 37  ? -1.074  15.409  8.671   1.00 0.00 ? 37  GLN A HB2  2  
ATOM 2315  H HB3  . GLN A 1 37  ? -0.039  15.769  7.298   1.00 0.00 ? 37  GLN A HB3  2  
ATOM 2316  H HG2  . GLN A 1 37  ? -2.640  14.977  6.388   1.00 0.00 ? 37  GLN A HG2  2  
ATOM 2317  H HG3  . GLN A 1 37  ? -2.774  16.280  7.566   1.00 0.00 ? 37  GLN A HG3  2  
ATOM 2318  H HE21 . GLN A 1 37  ? -0.530  17.733  7.091   1.00 0.00 ? 37  GLN A HE21 2  
ATOM 2319  H HE22 . GLN A 1 37  ? -0.579  18.399  5.497   1.00 0.00 ? 37  GLN A HE22 2  
ATOM 2320  N N    . ASP A 1 38  ? -2.583  12.184  7.472   1.00 0.00 ? 38  ASP A N    2  
ATOM 2321  C CA   . ASP A 1 38  ? -3.630  11.409  8.134   1.00 0.00 ? 38  ASP A CA   2  
ATOM 2322  C C    . ASP A 1 38  ? -3.322  9.913   8.169   1.00 0.00 ? 38  ASP A C    2  
ATOM 2323  O O    . ASP A 1 38  ? -3.972  9.160   8.895   1.00 0.00 ? 38  ASP A O    2  
ATOM 2324  C CB   . ASP A 1 38  ? -4.973  11.639  7.441   1.00 0.00 ? 38  ASP A CB   2  
ATOM 2325  C CG   . ASP A 1 38  ? -5.559  13.003  7.751   1.00 0.00 ? 38  ASP A CG   2  
ATOM 2326  O OD1  . ASP A 1 38  ? -4.792  13.988  7.777   1.00 0.00 ? 38  ASP A OD1  2  
ATOM 2327  O OD2  . ASP A 1 38  ? -6.786  13.086  7.965   1.00 0.00 ? 38  ASP A OD2  2  
ATOM 2328  H H    . ASP A 1 38  ? -2.510  12.160  6.496   1.00 0.00 ? 38  ASP A H    2  
ATOM 2329  H HA   . ASP A 1 38  ? -3.705  11.766  9.150   1.00 0.00 ? 38  ASP A HA   2  
ATOM 2330  H HB2  . ASP A 1 38  ? -4.837  11.563  6.372   1.00 0.00 ? 38  ASP A HB2  2  
ATOM 2331  H HB3  . ASP A 1 38  ? -5.675  10.884  7.765   1.00 0.00 ? 38  ASP A HB3  2  
ATOM 2332  N N    . LEU A 1 39  ? -2.342  9.477   7.384   1.00 0.00 ? 39  LEU A N    2  
ATOM 2333  C CA   . LEU A 1 39  ? -1.982  8.063   7.342   1.00 0.00 ? 39  LEU A CA   2  
ATOM 2334  C C    . LEU A 1 39  ? -0.527  7.844   7.749   1.00 0.00 ? 39  LEU A C    2  
ATOM 2335  O O    . LEU A 1 39  ? -0.112  6.716   8.007   1.00 0.00 ? 39  LEU A O    2  
ATOM 2336  C CB   . LEU A 1 39  ? -2.232  7.494   5.940   1.00 0.00 ? 39  LEU A CB   2  
ATOM 2337  C CG   . LEU A 1 39  ? -1.455  8.169   4.815   1.00 0.00 ? 39  LEU A CG   2  
ATOM 2338  C CD1  . LEU A 1 39  ? -0.207  7.374   4.477   1.00 0.00 ? 39  LEU A CD1  2  
ATOM 2339  C CD2  . LEU A 1 39  ? -2.338  8.324   3.589   1.00 0.00 ? 39  LEU A CD2  2  
ATOM 2340  H H    . LEU A 1 39  ? -1.857  10.116  6.820   1.00 0.00 ? 39  LEU A H    2  
ATOM 2341  H HA   . LEU A 1 39  ? -2.615  7.545   8.045   1.00 0.00 ? 39  LEU A HA   2  
ATOM 2342  H HB2  . LEU A 1 39  ? -1.978  6.445   5.941   1.00 0.00 ? 39  LEU A HB2  2  
ATOM 2343  H HB3  . LEU A 1 39  ? -3.285  7.589   5.723   1.00 0.00 ? 39  LEU A HB3  2  
ATOM 2344  H HG   . LEU A 1 39  ? -1.148  9.154   5.136   1.00 0.00 ? 39  LEU A HG   2  
ATOM 2345  H HD11 . LEU A 1 39  ? 0.600   8.052   4.238   1.00 0.00 ? 39  LEU A HD11 2  
ATOM 2346  H HD12 . LEU A 1 39  ? -0.405  6.736   3.627   1.00 0.00 ? 39  LEU A HD12 2  
ATOM 2347  H HD13 . LEU A 1 39  ? 0.073   6.765   5.323   1.00 0.00 ? 39  LEU A HD13 2  
ATOM 2348  H HD21 . LEU A 1 39  ? -3.319  8.658   3.894   1.00 0.00 ? 39  LEU A HD21 2  
ATOM 2349  H HD22 . LEU A 1 39  ? -2.423  7.371   3.087   1.00 0.00 ? 39  LEU A HD22 2  
ATOM 2350  H HD23 . LEU A 1 39  ? -1.901  9.049   2.920   1.00 0.00 ? 39  LEU A HD23 2  
ATOM 2351  N N    . ILE A 1 40  ? 0.243   8.927   7.812   1.00 0.00 ? 40  ILE A N    2  
ATOM 2352  C CA   . ILE A 1 40  ? 1.647   8.839   8.193   1.00 0.00 ? 40  ILE A CA   2  
ATOM 2353  C C    . ILE A 1 40  ? 1.795   8.350   9.630   1.00 0.00 ? 40  ILE A C    2  
ATOM 2354  O O    . ILE A 1 40  ? 1.028   8.732   10.513  1.00 0.00 ? 40  ILE A O    2  
ATOM 2355  C CB   . ILE A 1 40  ? 2.363   10.200  8.030   1.00 0.00 ? 40  ILE A CB   2  
ATOM 2356  C CG1  . ILE A 1 40  ? 3.889   10.013  8.064   1.00 0.00 ? 40  ILE A CG1  2  
ATOM 2357  C CG2  . ILE A 1 40  ? 1.897   11.191  9.092   1.00 0.00 ? 40  ILE A CG2  2  
ATOM 2358  C CD1  . ILE A 1 40  ? 4.492   10.004  9.456   1.00 0.00 ? 40  ILE A CD1  2  
ATOM 2359  H H    . ILE A 1 40  ? -0.143  9.803   7.599   1.00 0.00 ? 40  ILE A H    2  
ATOM 2360  H HA   . ILE A 1 40  ? 2.124   8.129   7.533   1.00 0.00 ? 40  ILE A HA   2  
ATOM 2361  H HB   . ILE A 1 40  ? 2.087   10.601  7.067   1.00 0.00 ? 40  ILE A HB   2  
ATOM 2362  H HG12 . ILE A 1 40  ? 4.138   9.075   7.595   1.00 0.00 ? 40  ILE A HG12 2  
ATOM 2363  H HG13 . ILE A 1 40  ? 4.351   10.819  7.511   1.00 0.00 ? 40  ILE A HG13 2  
ATOM 2364  H HG21 . ILE A 1 40  ? 1.383   12.013  8.616   1.00 0.00 ? 40  ILE A HG21 2  
ATOM 2365  H HG22 . ILE A 1 40  ? 2.751   11.568  9.633   1.00 0.00 ? 40  ILE A HG22 2  
ATOM 2366  H HG23 . ILE A 1 40  ? 1.227   10.696  9.779   1.00 0.00 ? 40  ILE A HG23 2  
ATOM 2367  H HD11 . ILE A 1 40  ? 5.314   9.304   9.487   1.00 0.00 ? 40  ILE A HD11 2  
ATOM 2368  H HD12 . ILE A 1 40  ? 3.740   9.707   10.172  1.00 0.00 ? 40  ILE A HD12 2  
ATOM 2369  H HD13 . ILE A 1 40  ? 4.851   10.993  9.700   1.00 0.00 ? 40  ILE A HD13 2  
ATOM 2370  N N    . GLY A 1 41  ? 2.790   7.494   9.855   1.00 0.00 ? 41  GLY A N    2  
ATOM 2371  C CA   . GLY A 1 41  ? 3.023   6.959   11.183  1.00 0.00 ? 41  GLY A CA   2  
ATOM 2372  C C    . GLY A 1 41  ? 2.586   5.514   11.310  1.00 0.00 ? 41  GLY A C    2  
ATOM 2373  O O    . GLY A 1 41  ? 3.047   4.794   12.197  1.00 0.00 ? 41  GLY A O    2  
ATOM 2374  H H    . GLY A 1 41  ? 3.366   7.221   9.109   1.00 0.00 ? 41  GLY A H    2  
ATOM 2375  H HA2  . GLY A 1 41  ? 4.078   7.026   11.405  1.00 0.00 ? 41  GLY A HA2  2  
ATOM 2376  H HA3  . GLY A 1 41  ? 2.479   7.553   11.900  1.00 0.00 ? 41  GLY A HA3  2  
ATOM 2377  N N    . GLN A 1 42  ? 1.696   5.089   10.420  1.00 0.00 ? 42  GLN A N    2  
ATOM 2378  C CA   . GLN A 1 42  ? 1.195   3.720   10.431  1.00 0.00 ? 42  GLN A CA   2  
ATOM 2379  C C    . GLN A 1 42  ? 1.670   2.965   9.194   1.00 0.00 ? 42  GLN A C    2  
ATOM 2380  O O    . GLN A 1 42  ? 2.535   3.442   8.463   1.00 0.00 ? 42  GLN A O    2  
ATOM 2381  C CB   . GLN A 1 42  ? -0.334  3.714   10.494  1.00 0.00 ? 42  GLN A CB   2  
ATOM 2382  C CG   . GLN A 1 42  ? -0.910  4.798   11.390  1.00 0.00 ? 42  GLN A CG   2  
ATOM 2383  C CD   . GLN A 1 42  ? -2.346  5.143   11.039  1.00 0.00 ? 42  GLN A CD   2  
ATOM 2384  O OE1  . GLN A 1 42  ? -3.279  4.453   11.453  1.00 0.00 ? 42  GLN A OE1  2  
ATOM 2385  N NE2  . GLN A 1 42  ? -2.530  6.213   10.278  1.00 0.00 ? 42  GLN A NE2  2  
ATOM 2386  H H    . GLN A 1 42  ? 1.369   5.712   9.735   1.00 0.00 ? 42  GLN A H    2  
ATOM 2387  H HA   . GLN A 1 42  ? 1.586   3.231   11.310  1.00 0.00 ? 42  GLN A HA   2  
ATOM 2388  H HB2  . GLN A 1 42  ? -0.725  3.855   9.496   1.00 0.00 ? 42  GLN A HB2  2  
ATOM 2389  H HB3  . GLN A 1 42  ? -0.664  2.757   10.866  1.00 0.00 ? 42  GLN A HB3  2  
ATOM 2390  H HG2  . GLN A 1 42  ? -0.880  4.456   12.413  1.00 0.00 ? 42  GLN A HG2  2  
ATOM 2391  H HG3  . GLN A 1 42  ? -0.308  5.688   11.290  1.00 0.00 ? 42  GLN A HG3  2  
ATOM 2392  H HE21 . GLN A 1 42  ? -1.740  6.715   9.985   1.00 0.00 ? 42  GLN A HE21 2  
ATOM 2393  H HE22 . GLN A 1 42  ? -3.447  6.458   10.035  1.00 0.00 ? 42  GLN A HE22 2  
ATOM 2394  N N    . LYS A 1 43  ? 1.096   1.789   8.964   1.00 0.00 ? 43  LYS A N    2  
ATOM 2395  C CA   . LYS A 1 43  ? 1.457   0.971   7.812   1.00 0.00 ? 43  LYS A CA   2  
ATOM 2396  C C    . LYS A 1 43  ? 0.280   0.870   6.851   1.00 0.00 ? 43  LYS A C    2  
ATOM 2397  O O    . LYS A 1 43  ? -0.842  0.596   7.271   1.00 0.00 ? 43  LYS A O    2  
ATOM 2398  C CB   . LYS A 1 43  ? 1.893   -0.425  8.264   1.00 0.00 ? 43  LYS A CB   2  
ATOM 2399  C CG   . LYS A 1 43  ? 2.552   -0.440  9.634   1.00 0.00 ? 43  LYS A CG   2  
ATOM 2400  C CD   . LYS A 1 43  ? 3.185   -1.788  9.937   1.00 0.00 ? 43  LYS A CD   2  
ATOM 2401  C CE   . LYS A 1 43  ? 2.375   -2.568  10.960  1.00 0.00 ? 43  LYS A CE   2  
ATOM 2402  N NZ   . LYS A 1 43  ? 2.598   -2.067  12.345  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2403  H H    . LYS A 1 43  ? 0.408   1.464   9.584   1.00 0.00 ? 43  LYS A H    2  
ATOM 2404  H HA   . LYS A 1 43  ? 2.281   1.454   7.306   1.00 0.00 ? 43  LYS A HA   2  
ATOM 2405  H HB2  . LYS A 1 43  ? 1.027   -1.068  8.295   1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2406  H HB3  . LYS A 1 43  ? 2.598   -0.818  7.545   1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2407  H HG2  . LYS A 1 43  ? 3.317   0.319   9.664   1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2408  H HG3  . LYS A 1 43  ? 1.804   -0.228  10.383  1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2409  H HD2  . LYS A 1 43  ? 3.239   -2.362  9.024   1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2410  H HD3  . LYS A 1 43  ? 4.180   -1.630  10.324  1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2411  H HE2  . LYS A 1 43  ? 1.326   -2.475  10.719  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2412  H HE3  . LYS A 1 43  ? 2.662   -3.608  10.911  1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2413  H HZ1  . LYS A 1 43  ? 1.804   -1.461  12.639  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2414  H HZ2  . LYS A 1 43  ? 3.478   -1.513  12.387  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2415  H HZ3  . LYS A 1 43  ? 2.674   -2.866  13.005  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2416  N N    . LEU A 1 44  ? 0.527   1.137   5.570   1.00 0.00 ? 44  LEU A N    2  
ATOM 2417  C CA   . LEU A 1 44  ? -0.536  1.110   4.564   1.00 0.00 ? 44  LEU A CA   2  
ATOM 2418  C C    . LEU A 1 44  ? -1.438  -0.120  4.689   1.00 0.00 ? 44  LEU A C    2  
ATOM 2419  O O    . LEU A 1 44  ? -2.657  -0.004  4.600   1.00 0.00 ? 44  LEU A O    2  
ATOM 2420  C CB   . LEU A 1 44  ? 0.035   1.187   3.139   1.00 0.00 ? 44  LEU A CB   2  
ATOM 2421  C CG   . LEU A 1 44  ? 1.454   0.639   2.938   1.00 0.00 ? 44  LEU A CG   2  
ATOM 2422  C CD1  . LEU A 1 44  ? 1.484   -0.872  3.095   1.00 0.00 ? 44  LEU A CD1  2  
ATOM 2423  C CD2  . LEU A 1 44  ? 1.972   1.030   1.562   1.00 0.00 ? 44  LEU A CD2  2  
ATOM 2424  H H    . LEU A 1 44  ? 1.438   1.394   5.302   1.00 0.00 ? 44  LEU A H    2  
ATOM 2425  H HA   . LEU A 1 44  ? -1.146  1.986   4.726   1.00 0.00 ? 44  LEU A HA   2  
ATOM 2426  H HB2  . LEU A 1 44  ? -0.626  0.639   2.484   1.00 0.00 ? 44  LEU A HB2  2  
ATOM 2427  H HB3  . LEU A 1 44  ? 0.032   2.223   2.833   1.00 0.00 ? 44  LEU A HB3  2  
ATOM 2428  H HG   . LEU A 1 44  ? 2.110   1.068   3.678   1.00 0.00 ? 44  LEU A HG   2  
ATOM 2429  H HD11 . LEU A 1 44  ? 2.139   -1.135  3.912   1.00 0.00 ? 44  LEU A HD11 2  
ATOM 2430  H HD12 . LEU A 1 44  ? 1.848   -1.325  2.182   1.00 0.00 ? 44  LEU A HD12 2  
ATOM 2431  H HD13 . LEU A 1 44  ? 0.488   -1.233  3.302   1.00 0.00 ? 44  LEU A HD13 2  
ATOM 2432  H HD21 . LEU A 1 44  ? 1.577   0.350   0.823   1.00 0.00 ? 44  LEU A HD21 2  
ATOM 2433  H HD22 . LEU A 1 44  ? 3.050   0.982   1.555   1.00 0.00 ? 44  LEU A HD22 2  
ATOM 2434  H HD23 . LEU A 1 44  ? 1.654   2.036   1.331   1.00 0.00 ? 44  LEU A HD23 2  
ATOM 2435  N N    . THR A 1 45  ? -0.838  -1.293  4.870   1.00 0.00 ? 45  THR A N    2  
ATOM 2436  C CA   . THR A 1 45  ? -1.598  -2.539  4.973   1.00 0.00 ? 45  THR A CA   2  
ATOM 2437  C C    . THR A 1 45  ? -2.666  -2.483  6.056   1.00 0.00 ? 45  THR A C    2  
ATOM 2438  O O    . THR A 1 45  ? -3.622  -3.260  6.029   1.00 0.00 ? 45  THR A O    2  
ATOM 2439  C CB   . THR A 1 45  ? -0.684  -3.738  5.237   1.00 0.00 ? 45  THR A CB   2  
ATOM 2440  O OG1  . THR A 1 45  ? 0.072   -3.538  6.436   1.00 0.00 ? 45  THR A OG1  2  
ATOM 2441  C CG2  . THR A 1 45  ? 0.252   -3.938  4.063   1.00 0.00 ? 45  THR A CG2  2  
ATOM 2442  H H    . THR A 1 45  ? 0.139   -1.320  4.912   1.00 0.00 ? 45  THR A H    2  
ATOM 2443  H HA   . THR A 1 45  ? -2.086  -2.701  4.024   1.00 0.00 ? 45  THR A HA   2  
ATOM 2444  H HB   . THR A 1 45  ? -1.295  -4.621  5.340   1.00 0.00 ? 45  THR A HB   2  
ATOM 2445  H HG1  . THR A 1 45  ? -0.490  -3.141  7.107   1.00 0.00 ? 45  THR A HG1  2  
ATOM 2446  H HG21 . THR A 1 45  ? 0.327   -3.014  3.510   1.00 0.00 ? 45  THR A HG21 2  
ATOM 2447  H HG22 . THR A 1 45  ? -0.141  -4.714  3.423   1.00 0.00 ? 45  THR A HG22 2  
ATOM 2448  H HG23 . THR A 1 45  ? 1.227   -4.225  4.424   1.00 0.00 ? 45  THR A HG23 2  
ATOM 2449  N N    . GLN A 1 46  ? -2.518  -1.564  6.996   1.00 0.00 ? 46  GLN A N    2  
ATOM 2450  C CA   . GLN A 1 46  ? -3.493  -1.420  8.066   1.00 0.00 ? 46  GLN A CA   2  
ATOM 2451  C C    . GLN A 1 46  ? -4.854  -1.101  7.470   1.00 0.00 ? 46  GLN A C    2  
ATOM 2452  O O    . GLN A 1 46  ? -5.895  -1.362  8.073   1.00 0.00 ? 46  GLN A O    2  
ATOM 2453  C CB   . GLN A 1 46  ? -3.069  -0.319  9.041   1.00 0.00 ? 46  GLN A CB   2  
ATOM 2454  C CG   . GLN A 1 46  ? -3.277  -0.685  10.501  1.00 0.00 ? 46  GLN A CG   2  
ATOM 2455  C CD   . GLN A 1 46  ? -2.979  0.467   11.440  1.00 0.00 ? 46  GLN A CD   2  
ATOM 2456  O OE1  . GLN A 1 46  ? -3.840  0.896   12.209  1.00 0.00 ? 46  GLN A OE1  2  
ATOM 2457  N NE2  . GLN A 1 46  ? -1.752  0.974   11.382  1.00 0.00 ? 46  GLN A NE2  2  
ATOM 2458  H H    . GLN A 1 46  ? -1.749  -0.962  6.961   1.00 0.00 ? 46  GLN A H    2  
ATOM 2459  H HA   . GLN A 1 46  ? -3.551  -2.361  8.593   1.00 0.00 ? 46  GLN A HA   2  
ATOM 2460  H HB2  . GLN A 1 46  ? -2.019  -0.106  8.892   1.00 0.00 ? 46  GLN A HB2  2  
ATOM 2461  H HB3  . GLN A 1 46  ? -3.642  0.573   8.831   1.00 0.00 ? 46  GLN A HB3  2  
ATOM 2462  H HG2  . GLN A 1 46  ? -4.305  -0.986  10.639  1.00 0.00 ? 46  GLN A HG2  2  
ATOM 2463  H HG3  . GLN A 1 46  ? -2.626  -1.510  10.749  1.00 0.00 ? 46  GLN A HG3  2  
ATOM 2464  H HE21 . GLN A 1 46  ? -1.119  0.581   10.746  1.00 0.00 ? 46  GLN A HE21 2  
ATOM 2465  H HE22 . GLN A 1 46  ? -1.531  1.718   11.980  1.00 0.00 ? 46  GLN A HE22 2  
ATOM 2466  N N    . PHE A 1 47  ? -4.825  -0.514  6.278   1.00 0.00 ? 47  PHE A N    2  
ATOM 2467  C CA   . PHE A 1 47  ? -6.043  -0.129  5.577   1.00 0.00 ? 47  PHE A CA   2  
ATOM 2468  C C    . PHE A 1 47  ? -6.234  -0.955  4.307   1.00 0.00 ? 47  PHE A C    2  
ATOM 2469  O O    . PHE A 1 47  ? -6.676  -0.433  3.284   1.00 0.00 ? 47  PHE A O    2  
ATOM 2470  C CB   . PHE A 1 47  ? -5.992  1.361   5.226   1.00 0.00 ? 47  PHE A CB   2  
ATOM 2471  C CG   . PHE A 1 47  ? -4.970  2.137   6.011   1.00 0.00 ? 47  PHE A CG   2  
ATOM 2472  C CD1  . PHE A 1 47  ? -5.118  2.326   7.375   1.00 0.00 ? 47  PHE A CD1  2  
ATOM 2473  C CD2  . PHE A 1 47  ? -3.858  2.674   5.381   1.00 0.00 ? 47  PHE A CD2  2  
ATOM 2474  C CE1  . PHE A 1 47  ? -4.176  3.038   8.098   1.00 0.00 ? 47  PHE A CE1  2  
ATOM 2475  C CE2  . PHE A 1 47  ? -2.915  3.385   6.096   1.00 0.00 ? 47  PHE A CE2  2  
ATOM 2476  C CZ   . PHE A 1 47  ? -3.073  3.569   7.456   1.00 0.00 ? 47  PHE A CZ   2  
ATOM 2477  H H    . PHE A 1 47  ? -3.958  -0.316  5.869   1.00 0.00 ? 47  PHE A H    2  
ATOM 2478  H HA   . PHE A 1 47  ? -6.877  -0.305  6.238   1.00 0.00 ? 47  PHE A HA   2  
ATOM 2479  H HB2  . PHE A 1 47  ? -5.749  1.466   4.179   1.00 0.00 ? 47  PHE A HB2  2  
ATOM 2480  H HB3  . PHE A 1 47  ? -6.961  1.801   5.413   1.00 0.00 ? 47  PHE A HB3  2  
ATOM 2481  H HD1  . PHE A 1 47  ? -5.979  1.911   7.878   1.00 0.00 ? 47  PHE A HD1  2  
ATOM 2482  H HD2  . PHE A 1 47  ? -3.733  2.532   4.318   1.00 0.00 ? 47  PHE A HD2  2  
ATOM 2483  H HE1  . PHE A 1 47  ? -4.302  3.179   9.161   1.00 0.00 ? 47  PHE A HE1  2  
ATOM 2484  H HE2  . PHE A 1 47  ? -2.052  3.798   5.593   1.00 0.00 ? 47  PHE A HE2  2  
ATOM 2485  H HZ   . PHE A 1 47  ? -2.336  4.125   8.017   1.00 0.00 ? 47  PHE A HZ   2  
ATOM 2486  N N    . PHE A 1 48  ? -5.907  -2.245  4.379   1.00 0.00 ? 48  PHE A N    2  
ATOM 2487  C CA   . PHE A 1 48  ? -6.053  -3.140  3.231   1.00 0.00 ? 48  PHE A CA   2  
ATOM 2488  C C    . PHE A 1 48  ? -6.482  -4.533  3.676   1.00 0.00 ? 48  PHE A C    2  
ATOM 2489  O O    . PHE A 1 48  ? -6.267  -4.917  4.825   1.00 0.00 ? 48  PHE A O    2  
ATOM 2490  C CB   . PHE A 1 48  ? -4.742  -3.218  2.439   1.00 0.00 ? 48  PHE A CB   2  
ATOM 2491  C CG   . PHE A 1 48  ? -4.344  -1.907  1.820   1.00 0.00 ? 48  PHE A CG   2  
ATOM 2492  C CD1  . PHE A 1 48  ? -5.200  -1.243  0.956   1.00 0.00 ? 48  PHE A CD1  2  
ATOM 2493  C CD2  . PHE A 1 48  ? -3.118  -1.335  2.107   1.00 0.00 ? 48  PHE A CD2  2  
ATOM 2494  C CE1  . PHE A 1 48  ? -4.840  -0.034  0.397   1.00 0.00 ? 48  PHE A CE1  2  
ATOM 2495  C CE2  . PHE A 1 48  ? -2.751  -0.126  1.548   1.00 0.00 ? 48  PHE A CE2  2  
ATOM 2496  C CZ   . PHE A 1 48  ? -3.614  0.525   0.692   1.00 0.00 ? 48  PHE A CZ   2  
ATOM 2497  H H    . PHE A 1 48  ? -5.566  -2.603  5.225   1.00 0.00 ? 48  PHE A H    2  
ATOM 2498  H HA   . PHE A 1 48  ? -6.819  -2.731  2.592   1.00 0.00 ? 48  PHE A HA   2  
ATOM 2499  H HB2  . PHE A 1 48  ? -3.948  -3.530  3.099   1.00 0.00 ? 48  PHE A HB2  2  
ATOM 2500  H HB3  . PHE A 1 48  ? -4.852  -3.944  1.643   1.00 0.00 ? 48  PHE A HB3  2  
ATOM 2501  H HD1  . PHE A 1 48  ? -6.159  -1.679  0.725   1.00 0.00 ? 48  PHE A HD1  2  
ATOM 2502  H HD2  . PHE A 1 48  ? -2.441  -1.844  2.776   1.00 0.00 ? 48  PHE A HD2  2  
ATOM 2503  H HE1  . PHE A 1 48  ? -5.519  0.472   -0.274  1.00 0.00 ? 48  PHE A HE1  2  
ATOM 2504  H HE2  . PHE A 1 48  ? -1.792  0.309   1.781   1.00 0.00 ? 48  PHE A HE2  2  
ATOM 2505  H HZ   . PHE A 1 48  ? -3.332  1.470   0.255   1.00 0.00 ? 48  PHE A HZ   2  
ATOM 2506  N N    . LEU A 1 49  ? -7.091  -5.276  2.747   1.00 0.00 ? 49  LEU A N    2  
ATOM 2507  C CA   . LEU A 1 49  ? -7.578  -6.638  2.996   1.00 0.00 ? 49  LEU A CA   2  
ATOM 2508  C C    . LEU A 1 49  ? -7.974  -6.849  4.455   1.00 0.00 ? 49  LEU A C    2  
ATOM 2509  O O    . LEU A 1 49  ? -9.101  -6.551  4.849   1.00 0.00 ? 49  LEU A O    2  
ATOM 2510  C CB   . LEU A 1 49  ? -6.533  -7.682  2.577   1.00 0.00 ? 49  LEU A CB   2  
ATOM 2511  C CG   . LEU A 1 49  ? -5.228  -7.124  2.000   1.00 0.00 ? 49  LEU A CG   2  
ATOM 2512  C CD1  . LEU A 1 49  ? -4.294  -6.678  3.115   1.00 0.00 ? 49  LEU A CD1  2  
ATOM 2513  C CD2  . LEU A 1 49  ? -4.545  -8.164  1.129   1.00 0.00 ? 49  LEU A CD2  2  
ATOM 2514  H H    . LEU A 1 49  ? -7.221  -4.891  1.856   1.00 0.00 ? 49  LEU A H    2  
ATOM 2515  H HA   . LEU A 1 49  ? -8.458  -6.775  2.388   1.00 0.00 ? 49  LEU A HA   2  
ATOM 2516  H HB2  . LEU A 1 49  ? -6.293  -8.283  3.438   1.00 0.00 ? 49  LEU A HB2  2  
ATOM 2517  H HB3  . LEU A 1 49  ? -6.981  -8.321  1.829   1.00 0.00 ? 49  LEU A HB3  2  
ATOM 2518  H HG   . LEU A 1 49  ? -5.452  -6.266  1.383   1.00 0.00 ? 49  LEU A HG   2  
ATOM 2519  H HD11 . LEU A 1 49  ? -3.652  -5.889  2.752   1.00 0.00 ? 49  LEU A HD11 2  
ATOM 2520  H HD12 . LEU A 1 49  ? -3.692  -7.515  3.437   1.00 0.00 ? 49  LEU A HD12 2  
ATOM 2521  H HD13 . LEU A 1 49  ? -4.877  -6.313  3.947   1.00 0.00 ? 49  LEU A HD13 2  
ATOM 2522  H HD21 . LEU A 1 49  ? -3.472  -8.039  1.194   1.00 0.00 ? 49  LEU A HD21 2  
ATOM 2523  H HD22 . LEU A 1 49  ? -4.859  -8.039  0.103   1.00 0.00 ? 49  LEU A HD22 2  
ATOM 2524  H HD23 . LEU A 1 49  ? -4.812  -9.153  1.469   1.00 0.00 ? 49  LEU A HD23 2  
ATOM 2525  N N    . ARG A 1 50  ? -7.044  -7.368  5.250   1.00 0.00 ? 50  ARG A N    2  
ATOM 2526  C CA   . ARG A 1 50  ? -7.300  -7.619  6.662   1.00 0.00 ? 50  ARG A CA   2  
ATOM 2527  C C    . ARG A 1 50  ? -6.192  -7.029  7.526   1.00 0.00 ? 50  ARG A C    2  
ATOM 2528  O O    . ARG A 1 50  ? -5.037  -7.447  7.449   1.00 0.00 ? 50  ARG A O    2  
ATOM 2529  C CB   . ARG A 1 50  ? -7.422  -9.122  6.917   1.00 0.00 ? 50  ARG A CB   2  
ATOM 2530  C CG   . ARG A 1 50  ? -8.518  -9.481  7.904   1.00 0.00 ? 50  ARG A CG   2  
ATOM 2531  C CD   . ARG A 1 50  ? -8.033  -10.487 8.936   1.00 0.00 ? 50  ARG A CD   2  
ATOM 2532  N NE   . ARG A 1 50  ? -8.911  -11.651 9.022   1.00 0.00 ? 50  ARG A NE   2  
ATOM 2533  C CZ   . ARG A 1 50  ? -9.878  -11.780 9.924   1.00 0.00 ? 50  ARG A CZ   2  
ATOM 2534  N NH1  . ARG A 1 50  ? -10.094 -10.817 10.811  1.00 0.00 ? 50  ARG A NH1  2  
ATOM 2535  N NH2  . ARG A 1 50  ? -10.632 -12.869 9.940   1.00 0.00 ? 50  ARG A NH2  2  
ATOM 2536  H H    . ARG A 1 50  ? -6.164  -7.585  4.879   1.00 0.00 ? 50  ARG A H    2  
ATOM 2537  H HA   . ARG A 1 50  ? -8.233  -7.142  6.918   1.00 0.00 ? 50  ARG A HA   2  
ATOM 2538  H HB2  . ARG A 1 50  ? -7.632  -9.619  5.983   1.00 0.00 ? 50  ARG A HB2  2  
ATOM 2539  H HB3  . ARG A 1 50  ? -6.483  -9.486  7.308   1.00 0.00 ? 50  ARG A HB3  2  
ATOM 2540  H HG2  . ARG A 1 50  ? -8.840  -8.585  8.414   1.00 0.00 ? 50  ARG A HG2  2  
ATOM 2541  H HG3  . ARG A 1 50  ? -9.351  -9.907  7.363   1.00 0.00 ? 50  ARG A HG3  2  
ATOM 2542  H HD2  . ARG A 1 50  ? -7.042  -10.815 8.660   1.00 0.00 ? 50  ARG A HD2  2  
ATOM 2543  H HD3  . ARG A 1 50  ? -7.995  -10.004 9.900   1.00 0.00 ? 50  ARG A HD3  2  
ATOM 2544  H HE   . ARG A 1 50  ? -8.770  -12.373 8.376   1.00 0.00 ? 50  ARG A HE   2  
ATOM 2545  H HH11 . ARG A 1 50  ? -9.528  -9.993  10.803  1.00 0.00 ? 50  ARG A HH11 2  
ATOM 2546  H HH12 . ARG A 1 50  ? -10.823 -10.917 11.489  1.00 0.00 ? 50  ARG A HH12 2  
ATOM 2547  H HH21 . ARG A 1 50  ? -10.473 -13.597 9.271   1.00 0.00 ? 50  ARG A HH21 2  
ATOM 2548  H HH22 . ARG A 1 50  ? -11.360 -12.966 10.618  1.00 0.00 ? 50  ARG A HH22 2  
ATOM 2549  N N    . SER A 1 51  ? -6.554  -6.052  8.350   1.00 0.00 ? 51  SER A N    2  
ATOM 2550  C CA   . SER A 1 51  ? -5.594  -5.398  9.232   1.00 0.00 ? 51  SER A CA   2  
ATOM 2551  C C    . SER A 1 51  ? -5.363  -6.216  10.495  1.00 0.00 ? 51  SER A C    2  
ATOM 2552  O O    . SER A 1 51  ? -4.538  -5.857  11.336  1.00 0.00 ? 51  SER A O    2  
ATOM 2553  C CB   . SER A 1 51  ? -6.085  -3.999  9.603   1.00 0.00 ? 51  SER A CB   2  
ATOM 2554  O OG   . SER A 1 51  ? -7.146  -4.063  10.542  1.00 0.00 ? 51  SER A OG   2  
ATOM 2555  H H    . SER A 1 51  ? -7.490  -5.763  8.365   1.00 0.00 ? 51  SER A H    2  
ATOM 2556  H HA   . SER A 1 51  ? -4.661  -5.310  8.697   1.00 0.00 ? 51  SER A HA   2  
ATOM 2557  H HB2  . SER A 1 51  ? -5.271  -3.439  10.038  1.00 0.00 ? 51  SER A HB2  2  
ATOM 2558  H HB3  . SER A 1 51  ? -6.435  -3.494  8.716   1.00 0.00 ? 51  SER A HB3  2  
ATOM 2559  H HG   . SER A 1 51  ? -6.870  -3.656  11.366  1.00 0.00 ? 51  SER A HG   2  
ATOM 2560  N N    . ASP A 1 52  ? -6.107  -7.307  10.632  1.00 0.00 ? 52  ASP A N    2  
ATOM 2561  C CA   . ASP A 1 52  ? -5.994  -8.164  11.805  1.00 0.00 ? 52  ASP A CA   2  
ATOM 2562  C C    . ASP A 1 52  ? -4.884  -9.204  11.653  1.00 0.00 ? 52  ASP A C    2  
ATOM 2563  O O    . ASP A 1 52  ? -3.863  -9.133  12.336  1.00 0.00 ? 52  ASP A O    2  
ATOM 2564  C CB   . ASP A 1 52  ? -7.327  -8.865  12.074  1.00 0.00 ? 52  ASP A CB   2  
ATOM 2565  C CG   . ASP A 1 52  ? -7.942  -8.451  13.396  1.00 0.00 ? 52  ASP A CG   2  
ATOM 2566  O OD1  . ASP A 1 52  ? -7.373  -8.806  14.452  1.00 0.00 ? 52  ASP A OD1  2  
ATOM 2567  O OD2  . ASP A 1 52  ? -8.990  -7.774  13.377  1.00 0.00 ? 52  ASP A OD2  2  
ATOM 2568  H H    . ASP A 1 52  ? -6.757  -7.535  9.935   1.00 0.00 ? 52  ASP A H    2  
ATOM 2569  H HA   . ASP A 1 52  ? -5.760  -7.533  12.650  1.00 0.00 ? 52  ASP A HA   2  
ATOM 2570  H HB2  . ASP A 1 52  ? -8.021  -8.620  11.283  1.00 0.00 ? 52  ASP A HB2  2  
ATOM 2571  H HB3  . ASP A 1 52  ? -7.169  -9.934  12.088  1.00 0.00 ? 52  ASP A HB3  2  
ATOM 2572  N N    . SER A 1 53  ? -5.102  -10.185 10.781  1.00 0.00 ? 53  SER A N    2  
ATOM 2573  C CA   . SER A 1 53  ? -4.127  -11.255 10.571  1.00 0.00 ? 53  SER A CA   2  
ATOM 2574  C C    . SER A 1 53  ? -3.160  -10.956 9.424   1.00 0.00 ? 53  SER A C    2  
ATOM 2575  O O    . SER A 1 53  ? -1.942  -11.020 9.599   1.00 0.00 ? 53  SER A O    2  
ATOM 2576  C CB   . SER A 1 53  ? -4.851  -12.574 10.302  1.00 0.00 ? 53  SER A CB   2  
ATOM 2577  O OG   . SER A 1 53  ? -5.620  -12.505 9.114   1.00 0.00 ? 53  SER A OG   2  
ATOM 2578  H H    . SER A 1 53  ? -5.945  -10.202 10.281  1.00 0.00 ? 53  SER A H    2  
ATOM 2579  H HA   . SER A 1 53  ? -3.559  -11.358 11.481  1.00 0.00 ? 53  SER A HA   2  
ATOM 2580  H HB2  . SER A 1 53  ? -4.125  -13.367 10.200  1.00 0.00 ? 53  SER A HB2  2  
ATOM 2581  H HB3  . SER A 1 53  ? -5.508  -12.792 11.131  1.00 0.00 ? 53  SER A HB3  2  
ATOM 2582  H HG   . SER A 1 53  ? -5.598  -13.356 8.669   1.00 0.00 ? 53  SER A HG   2  
ATOM 2583  N N    . ASP A 1 54  ? -3.711  -10.664 8.251   1.00 0.00 ? 54  ASP A N    2  
ATOM 2584  C CA   . ASP A 1 54  ? -2.909  -10.389 7.057   1.00 0.00 ? 54  ASP A CA   2  
ATOM 2585  C C    . ASP A 1 54  ? -1.721  -9.473  7.344   1.00 0.00 ? 54  ASP A C    2  
ATOM 2586  O O    . ASP A 1 54  ? -0.577  -9.853  7.114   1.00 0.00 ? 54  ASP A O    2  
ATOM 2587  C CB   . ASP A 1 54  ? -3.785  -9.771  5.965   1.00 0.00 ? 54  ASP A CB   2  
ATOM 2588  C CG   . ASP A 1 54  ? -4.179  -10.778 4.903   1.00 0.00 ? 54  ASP A CG   2  
ATOM 2589  O OD1  . ASP A 1 54  ? -3.276  -11.442 4.351   1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2590  O OD2  . ASP A 1 54  ? -5.390  -10.904 4.624   1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2591  H H    . ASP A 1 54  ? -4.688  -10.656 8.175   1.00 0.00 ? 54  ASP A H    2  
ATOM 2592  H HA   . ASP A 1 54  ? -2.527  -11.331 6.697   1.00 0.00 ? 54  ASP A HA   2  
ATOM 2593  H HB2  . ASP A 1 54  ? -4.685  -9.381  6.415   1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2594  H HB3  . ASP A 1 54  ? -3.244  -8.967  5.492   1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2595  N N    . VAL A 1 55  ? -1.996  -8.267  7.822   1.00 0.00 ? 55  VAL A N    2  
ATOM 2596  C CA   . VAL A 1 55  ? -0.944  -7.293  8.115   1.00 0.00 ? 55  VAL A CA   2  
ATOM 2597  C C    . VAL A 1 55  ? 0.170   -7.882  8.986   1.00 0.00 ? 55  VAL A C    2  
ATOM 2598  O O    . VAL A 1 55  ? 1.312   -7.424  8.937   1.00 0.00 ? 55  VAL A O    2  
ATOM 2599  C CB   . VAL A 1 55  ? -1.530  -6.045  8.807   1.00 0.00 ? 55  VAL A CB   2  
ATOM 2600  C CG1  . VAL A 1 55  ? -0.427  -5.110  9.282   1.00 0.00 ? 55  VAL A CG1  2  
ATOM 2601  C CG2  . VAL A 1 55  ? -2.476  -5.320  7.867   1.00 0.00 ? 55  VAL A CG2  2  
ATOM 2602  H H    . VAL A 1 55  ? -2.932  -8.014  7.968   1.00 0.00 ? 55  VAL A H    2  
ATOM 2603  H HA   . VAL A 1 55  ? -0.515  -6.982  7.173   1.00 0.00 ? 55  VAL A HA   2  
ATOM 2604  H HB   . VAL A 1 55  ? -2.093  -6.368  9.670   1.00 0.00 ? 55  VAL A HB   2  
ATOM 2605  H HG11 . VAL A 1 55  ? 0.318   -5.676  9.825   1.00 0.00 ? 55  VAL A HG11 2  
ATOM 2606  H HG12 . VAL A 1 55  ? -0.848  -4.356  9.930   1.00 0.00 ? 55  VAL A HG12 2  
ATOM 2607  H HG13 . VAL A 1 55  ? 0.035   -4.634  8.429   1.00 0.00 ? 55  VAL A HG13 2  
ATOM 2608  H HG21 . VAL A 1 55  ? -3.023  -6.042  7.279   1.00 0.00 ? 55  VAL A HG21 2  
ATOM 2609  H HG22 . VAL A 1 55  ? -1.908  -4.677  7.210   1.00 0.00 ? 55  VAL A HG22 2  
ATOM 2610  H HG23 . VAL A 1 55  ? -3.168  -4.724  8.442   1.00 0.00 ? 55  VAL A HG23 2  
ATOM 2611  N N    . VAL A 1 56  ? -0.165  -8.883  9.792   1.00 0.00 ? 56  VAL A N    2  
ATOM 2612  C CA   . VAL A 1 56  ? 0.816   -9.505  10.679  1.00 0.00 ? 56  VAL A CA   2  
ATOM 2613  C C    . VAL A 1 56  ? 1.791   -10.415 9.931   1.00 0.00 ? 56  VAL A C    2  
ATOM 2614  O O    . VAL A 1 56  ? 2.977   -10.449 10.255  1.00 0.00 ? 56  VAL A O    2  
ATOM 2615  C CB   . VAL A 1 56  ? 0.131   -10.318 11.794  1.00 0.00 ? 56  VAL A CB   2  
ATOM 2616  C CG1  . VAL A 1 56  ? 1.157   -10.841 12.788  1.00 0.00 ? 56  VAL A CG1  2  
ATOM 2617  C CG2  . VAL A 1 56  ? -0.918  -9.472  12.502  1.00 0.00 ? 56  VAL A CG2  2  
ATOM 2618  H H    . VAL A 1 56  ? -1.090  -9.204  9.801   1.00 0.00 ? 56  VAL A H    2  
ATOM 2619  H HA   . VAL A 1 56  ? 1.380   -8.712  11.148  1.00 0.00 ? 56  VAL A HA   2  
ATOM 2620  H HB   . VAL A 1 56  ? -0.366  -11.165 11.344  1.00 0.00 ? 56  VAL A HB   2  
ATOM 2621  H HG11 . VAL A 1 56  ? 1.472   -11.830 12.493  1.00 0.00 ? 56  VAL A HG11 2  
ATOM 2622  H HG12 . VAL A 1 56  ? 0.717   -10.883 13.773  1.00 0.00 ? 56  VAL A HG12 2  
ATOM 2623  H HG13 . VAL A 1 56  ? 2.011   -10.180 12.803  1.00 0.00 ? 56  VAL A HG13 2  
ATOM 2624  H HG21 . VAL A 1 56  ? -1.730  -10.104 12.827  1.00 0.00 ? 56  VAL A HG21 2  
ATOM 2625  H HG22 . VAL A 1 56  ? -1.293  -8.722  11.820  1.00 0.00 ? 56  VAL A HG22 2  
ATOM 2626  H HG23 . VAL A 1 56  ? -0.471  -8.989  13.359  1.00 0.00 ? 56  VAL A HG23 2  
ATOM 2627  N N    . GLU A 1 57  ? 1.297   -11.155 8.941   1.00 0.00 ? 57  GLU A N    2  
ATOM 2628  C CA   . GLU A 1 57  ? 2.147   -12.062 8.171   1.00 0.00 ? 57  GLU A CA   2  
ATOM 2629  C C    . GLU A 1 57  ? 2.738   -11.376 6.944   1.00 0.00 ? 57  GLU A C    2  
ATOM 2630  O O    . GLU A 1 57  ? 3.825   -11.727 6.485   1.00 0.00 ? 57  GLU A O    2  
ATOM 2631  C CB   . GLU A 1 57  ? 1.352   -13.296 7.740   1.00 0.00 ? 57  GLU A CB   2  
ATOM 2632  C CG   . GLU A 1 57  ? 0.001   -12.966 7.125   1.00 0.00 ? 57  GLU A CG   2  
ATOM 2633  C CD   . GLU A 1 57  ? -1.076  -13.963 7.509   1.00 0.00 ? 57  GLU A CD   2  
ATOM 2634  O OE1  . GLU A 1 57  ? -0.730  -15.033 8.051   1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2635  O OE2  . GLU A 1 57  ? -2.267  -13.671 7.270   1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2636  H H    . GLU A 1 57  ? 0.344   -11.088 8.718   1.00 0.00 ? 57  GLU A H    2  
ATOM 2637  H HA   . GLU A 1 57  ? 2.957   -12.377 8.813   1.00 0.00 ? 57  GLU A HA   2  
ATOM 2638  H HB2  . GLU A 1 57  ? 1.929   -13.846 7.011   1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2639  H HB3  . GLU A 1 57  ? 1.186   -13.924 8.603   1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2640  H HG2  . GLU A 1 57  ? -0.302  -11.985 7.459   1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2641  H HG3  . GLU A 1 57  ? 0.101   -12.965 6.050   1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2642  N N    . ALA A 1 58  ? 2.002   -10.412 6.406   1.00 0.00 ? 58  ALA A N    2  
ATOM 2643  C CA   . ALA A 1 58  ? 2.425   -9.685  5.215   1.00 0.00 ? 58  ALA A CA   2  
ATOM 2644  C C    . ALA A 1 58  ? 3.739   -8.939  5.422   1.00 0.00 ? 58  ALA A C    2  
ATOM 2645  O O    . ALA A 1 58  ? 4.635   -9.002  4.578   1.00 0.00 ? 58  ALA A O    2  
ATOM 2646  C CB   . ALA A 1 58  ? 1.336   -8.715  4.780   1.00 0.00 ? 58  ALA A CB   2  
ATOM 2647  H H    . ALA A 1 58  ? 1.138   -10.195 6.810   1.00 0.00 ? 58  ALA A H    2  
ATOM 2648  H HA   . ALA A 1 58  ? 2.559   -10.404 4.424   1.00 0.00 ? 58  ALA A HA   2  
ATOM 2649  H HB1  . ALA A 1 58  ? 0.825   -9.113  3.916   1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2650  H HB2  . ALA A 1 58  ? 1.780   -7.763  4.531   1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2651  H HB3  . ALA A 1 58  ? 0.629   -8.584  5.587   1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2652  N N    . LEU A 1 59  ? 3.844   -8.216  6.529   1.00 0.00 ? 59  LEU A N    2  
ATOM 2653  C CA   . LEU A 1 59  ? 5.045   -7.438  6.817   1.00 0.00 ? 59  LEU A CA   2  
ATOM 2654  C C    . LEU A 1 59  ? 5.978   -8.162  7.787   1.00 0.00 ? 59  LEU A C    2  
ATOM 2655  O O    . LEU A 1 59  ? 7.067   -7.672  8.085   1.00 0.00 ? 59  LEU A O    2  
ATOM 2656  C CB   . LEU A 1 59  ? 4.651   -6.073  7.385   1.00 0.00 ? 59  LEU A CB   2  
ATOM 2657  C CG   . LEU A 1 59  ? 3.249   -5.597  6.993   1.00 0.00 ? 59  LEU A CG   2  
ATOM 2658  C CD1  . LEU A 1 59  ? 2.745   -4.556  7.976   1.00 0.00 ? 59  LEU A CD1  2  
ATOM 2659  C CD2  . LEU A 1 59  ? 3.251   -5.041  5.574   1.00 0.00 ? 59  LEU A CD2  2  
ATOM 2660  H H    . LEU A 1 59  ? 3.092   -8.186  7.155   1.00 0.00 ? 59  LEU A H    2  
ATOM 2661  H HA   . LEU A 1 59  ? 5.568   -7.285  5.885   1.00 0.00 ? 59  LEU A HA   2  
ATOM 2662  H HB2  . LEU A 1 59  ? 4.703   -6.125  8.463   1.00 0.00 ? 59  LEU A HB2  2  
ATOM 2663  H HB3  . LEU A 1 59  ? 5.366   -5.341  7.039   1.00 0.00 ? 59  LEU A HB3  2  
ATOM 2664  H HG   . LEU A 1 59  ? 2.572   -6.438  7.021   1.00 0.00 ? 59  LEU A HG   2  
ATOM 2665  H HD11 . LEU A 1 59  ? 3.575   -4.170  8.551   1.00 0.00 ? 59  LEU A HD11 2  
ATOM 2666  H HD12 . LEU A 1 59  ? 2.026   -5.009  8.642   1.00 0.00 ? 59  LEU A HD12 2  
ATOM 2667  H HD13 . LEU A 1 59  ? 2.275   -3.749  7.436   1.00 0.00 ? 59  LEU A HD13 2  
ATOM 2668  H HD21 . LEU A 1 59  ? 2.269   -4.662  5.335   1.00 0.00 ? 59  LEU A HD21 2  
ATOM 2669  H HD22 . LEU A 1 59  ? 3.513   -5.826  4.881   1.00 0.00 ? 59  LEU A HD22 2  
ATOM 2670  H HD23 . LEU A 1 59  ? 3.973   -4.243  5.501   1.00 0.00 ? 59  LEU A HD23 2  
ATOM 2671  N N    . SER A 1 60  ? 5.547   -9.319  8.281   1.00 0.00 ? 60  SER A N    2  
ATOM 2672  C CA   . SER A 1 60  ? 6.352   -10.095 9.223   1.00 0.00 ? 60  SER A CA   2  
ATOM 2673  C C    . SER A 1 60  ? 7.761   -10.332 8.691   1.00 0.00 ? 60  SER A C    2  
ATOM 2674  O O    . SER A 1 60  ? 8.723   -10.388 9.456   1.00 0.00 ? 60  SER A O    2  
ATOM 2675  C CB   . SER A 1 60  ? 5.683   -11.440 9.515   1.00 0.00 ? 60  SER A CB   2  
ATOM 2676  O OG   . SER A 1 60  ? 5.874   -12.348 8.445   1.00 0.00 ? 60  SER A OG   2  
ATOM 2677  H H    . SER A 1 60  ? 4.665   -9.657  8.018   1.00 0.00 ? 60  SER A H    2  
ATOM 2678  H HA   . SER A 1 60  ? 6.420   -9.531  10.136  1.00 0.00 ? 60  SER A HA   2  
ATOM 2679  H HB2  . SER A 1 60  ? 6.110   -11.868 10.412  1.00 0.00 ? 60  SER A HB2  2  
ATOM 2680  H HB3  . SER A 1 60  ? 4.625   -11.290 9.658   1.00 0.00 ? 60  SER A HB3  2  
ATOM 2681  H HG   . SER A 1 60  ? 6.140   -13.202 8.791   1.00 0.00 ? 60  SER A HG   2  
ATOM 2682  N N    . GLU A 1 61  ? 7.871   -10.469 7.377   1.00 0.00 ? 61  GLU A N    2  
ATOM 2683  C CA   . GLU A 1 61  ? 9.160   -10.697 6.738   1.00 0.00 ? 61  GLU A CA   2  
ATOM 2684  C C    . GLU A 1 61  ? 9.125   -10.205 5.299   1.00 0.00 ? 61  GLU A C    2  
ATOM 2685  O O    . GLU A 1 61  ? 9.924   -10.632 4.467   1.00 0.00 ? 61  GLU A O    2  
ATOM 2686  C CB   . GLU A 1 61  ? 9.521   -12.182 6.778   1.00 0.00 ? 61  GLU A CB   2  
ATOM 2687  C CG   . GLU A 1 61  ? 10.901  -12.458 7.354   1.00 0.00 ? 61  GLU A CG   2  
ATOM 2688  C CD   . GLU A 1 61  ? 10.880  -12.638 8.859   1.00 0.00 ? 61  GLU A CD   2  
ATOM 2689  O OE1  . GLU A 1 61  ? 10.031  -13.409 9.354   1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2690  O OE2  . GLU A 1 61  ? 11.712  -12.007 9.544   1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2691  H H    . GLU A 1 61  ? 7.068   -10.410 6.821   1.00 0.00 ? 61  GLU A H    2  
ATOM 2692  H HA   . GLU A 1 61  ? 9.904   -10.137 7.282   1.00 0.00 ? 61  GLU A HA   2  
ATOM 2693  H HB2  . GLU A 1 61  ? 8.792   -12.704 7.382   1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2694  H HB3  . GLU A 1 61  ? 9.489   -12.576 5.772   1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2695  H HG2  . GLU A 1 61  ? 11.291  -13.359 6.906   1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2696  H HG3  . GLU A 1 61  ? 11.549  -11.628 7.114   1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2697  N N    . GLU A 1 62  ? 8.188   -9.305  5.019   1.00 0.00 ? 62  GLU A N    2  
ATOM 2698  C CA   . GLU A 1 62  ? 8.032   -8.744  3.679   1.00 0.00 ? 62  GLU A CA   2  
ATOM 2699  C C    . GLU A 1 62  ? 7.771   -9.844  2.652   1.00 0.00 ? 62  GLU A C    2  
ATOM 2700  O O    . GLU A 1 62  ? 7.523   -10.994 3.016   1.00 0.00 ? 62  GLU A O    2  
ATOM 2701  C CB   . GLU A 1 62  ? 9.278   -7.946  3.288   1.00 0.00 ? 62  GLU A CB   2  
ATOM 2702  C CG   . GLU A 1 62  ? 9.138   -6.450  3.513   1.00 0.00 ? 62  GLU A CG   2  
ATOM 2703  C CD   . GLU A 1 62  ? 9.008   -5.673  2.219   1.00 0.00 ? 62  GLU A CD   2  
ATOM 2704  O OE1  . GLU A 1 62  ? 8.199   -6.083  1.358   1.00 0.00 ? 62  GLU A OE1  2  
ATOM 2705  O OE2  . GLU A 1 62  ? 9.712   -4.655  2.065   1.00 0.00 ? 62  GLU A OE2  2  
ATOM 2706  H H    . GLU A 1 62  ? 7.581   -9.010  5.735   1.00 0.00 ? 62  GLU A H    2  
ATOM 2707  H HA   . GLU A 1 62  ? 7.183   -8.079  3.696   1.00 0.00 ? 62  GLU A HA   2  
ATOM 2708  H HB2  . GLU A 1 62  ? 10.116  -8.301  3.872   1.00 0.00 ? 62  GLU A HB2  2  
ATOM 2709  H HB3  . GLU A 1 62  ? 9.485   -8.113  2.241   1.00 0.00 ? 62  GLU A HB3  2  
ATOM 2710  H HG2  . GLU A 1 62  ? 8.259   -6.271  4.114   1.00 0.00 ? 62  GLU A HG2  2  
ATOM 2711  H HG3  . GLU A 1 62  ? 10.013  -6.096  4.042   1.00 0.00 ? 62  GLU A HG3  2  
ATOM 2712  N N    . HIS A 1 63  ? 7.832   -9.472  1.370   1.00 0.00 ? 63  HIS A N    2  
ATOM 2713  C CA   . HIS A 1 63  ? 7.604   -10.401 0.257   1.00 0.00 ? 63  HIS A CA   2  
ATOM 2714  C C    . HIS A 1 63  ? 6.644   -11.531 0.639   1.00 0.00 ? 63  HIS A C    2  
ATOM 2715  O O    . HIS A 1 63  ? 5.443   -11.305 0.790   1.00 0.00 ? 63  HIS A O    2  
ATOM 2716  C CB   . HIS A 1 63  ? 8.932   -10.976 -0.257  1.00 0.00 ? 63  HIS A CB   2  
ATOM 2717  C CG   . HIS A 1 63  ? 9.984   -11.138 0.799   1.00 0.00 ? 63  HIS A CG   2  
ATOM 2718  N ND1  . HIS A 1 63  ? 10.981  -10.211 1.017   1.00 0.00 ? 63  HIS A ND1  2  
ATOM 2719  C CD2  . HIS A 1 63  ? 10.193  -12.131 1.696   1.00 0.00 ? 63  HIS A CD2  2  
ATOM 2720  C CE1  . HIS A 1 63  ? 11.759  -10.627 2.000   1.00 0.00 ? 63  HIS A CE1  2  
ATOM 2721  N NE2  . HIS A 1 63  ? 11.302  -11.788 2.429   1.00 0.00 ? 63  HIS A NE2  2  
ATOM 2722  H H    . HIS A 1 63  ? 8.037   -8.537  1.164   1.00 0.00 ? 63  HIS A H    2  
ATOM 2723  H HA   . HIS A 1 63  ? 7.151   -9.835  -0.543  1.00 0.00 ? 63  HIS A HA   2  
ATOM 2724  H HB2  . HIS A 1 63  ? 8.750   -11.948 -0.689  1.00 0.00 ? 63  HIS A HB2  2  
ATOM 2725  H HB3  . HIS A 1 63  ? 9.326   -10.321 -1.019  1.00 0.00 ? 63  HIS A HB3  2  
ATOM 2726  H HD1  . HIS A 1 63  ? 11.100  -9.373  0.524   1.00 0.00 ? 63  HIS A HD1  2  
ATOM 2727  H HD2  . HIS A 1 63  ? 9.599   -13.026 1.813   1.00 0.00 ? 63  HIS A HD2  2  
ATOM 2728  H HE1  . HIS A 1 63  ? 12.620  -10.103 2.389   1.00 0.00 ? 63  HIS A HE1  2  
ATOM 2729  H HE2  . HIS A 1 63  ? 11.728  -12.346 3.112   1.00 0.00 ? 63  HIS A HE2  2  
ATOM 2730  N N    . MET A 1 64  ? 7.173   -12.745 0.788   1.00 0.00 ? 64  MET A N    2  
ATOM 2731  C CA   . MET A 1 64  ? 6.354   -13.899 1.147   1.00 0.00 ? 64  MET A CA   2  
ATOM 2732  C C    . MET A 1 64  ? 6.990   -14.688 2.286   1.00 0.00 ? 64  MET A C    2  
ATOM 2733  O O    . MET A 1 64  ? 6.882   -15.914 2.340   1.00 0.00 ? 64  MET A O    2  
ATOM 2734  C CB   . MET A 1 64  ? 6.156   -14.809 -0.067  1.00 0.00 ? 64  MET A CB   2  
ATOM 2735  C CG   . MET A 1 64  ? 5.986   -14.055 -1.377  1.00 0.00 ? 64  MET A CG   2  
ATOM 2736  S SD   . MET A 1 64  ? 6.046   -15.138 -2.816  1.00 0.00 ? 64  MET A SD   2  
ATOM 2737  C CE   . MET A 1 64  ? 4.648   -14.530 -3.754  1.00 0.00 ? 64  MET A CE   2  
ATOM 2738  H H    . MET A 1 64  ? 8.134   -12.868 0.652   1.00 0.00 ? 64  MET A H    2  
ATOM 2739  H HA   . MET A 1 64  ? 5.394   -13.535 1.473   1.00 0.00 ? 64  MET A HA   2  
ATOM 2740  H HB2  . MET A 1 64  ? 7.015   -15.458 -0.160  1.00 0.00 ? 64  MET A HB2  2  
ATOM 2741  H HB3  . MET A 1 64  ? 5.276   -15.415 0.091   1.00 0.00 ? 64  MET A HB3  2  
ATOM 2742  H HG2  . MET A 1 64  ? 5.031   -13.551 -1.364  1.00 0.00 ? 64  MET A HG2  2  
ATOM 2743  H HG3  . MET A 1 64  ? 6.778   -13.325 -1.461  1.00 0.00 ? 64  MET A HG3  2  
ATOM 2744  H HE1  . MET A 1 64  ? 3.732   -14.894 -3.313  1.00 0.00 ? 64  MET A HE1  2  
ATOM 2745  H HE2  . MET A 1 64  ? 4.720   -14.880 -4.774  1.00 0.00 ? 64  MET A HE2  2  
ATOM 2746  H HE3  . MET A 1 64  ? 4.650   -13.451 -3.745  1.00 0.00 ? 64  MET A HE3  2  
ATOM 2747  N N    . GLU A 1 65  ? 7.658   -13.972 3.193   1.00 0.00 ? 65  GLU A N    2  
ATOM 2748  C CA   . GLU A 1 65  ? 8.325   -14.587 4.341   1.00 0.00 ? 65  GLU A CA   2  
ATOM 2749  C C    . GLU A 1 65  ? 9.555   -15.382 3.913   1.00 0.00 ? 65  GLU A C    2  
ATOM 2750  O O    . GLU A 1 65  ? 10.436  -15.662 4.726   1.00 0.00 ? 65  GLU A O    2  
ATOM 2751  C CB   . GLU A 1 65  ? 7.360   -15.495 5.108   1.00 0.00 ? 65  GLU A CB   2  
ATOM 2752  C CG   . GLU A 1 65  ? 6.266   -14.739 5.842   1.00 0.00 ? 65  GLU A CG   2  
ATOM 2753  C CD   . GLU A 1 65  ? 5.825   -15.436 7.115   1.00 0.00 ? 65  GLU A CD   2  
ATOM 2754  O OE1  . GLU A 1 65  ? 6.342   -16.537 7.400   1.00 0.00 ? 65  GLU A OE1  2  
ATOM 2755  O OE2  . GLU A 1 65  ? 4.961   -14.881 7.827   1.00 0.00 ? 65  GLU A OE2  2  
ATOM 2756  H H    . GLU A 1 65  ? 7.705   -13.000 3.084   1.00 0.00 ? 65  GLU A H    2  
ATOM 2757  H HA   . GLU A 1 65  ? 8.643   -13.791 4.998   1.00 0.00 ? 65  GLU A HA   2  
ATOM 2758  H HB2  . GLU A 1 65  ? 6.892   -16.174 4.410   1.00 0.00 ? 65  GLU A HB2  2  
ATOM 2759  H HB3  . GLU A 1 65  ? 7.920   -16.069 5.832   1.00 0.00 ? 65  GLU A HB3  2  
ATOM 2760  H HG2  . GLU A 1 65  ? 6.636   -13.757 6.098   1.00 0.00 ? 65  GLU A HG2  2  
ATOM 2761  H HG3  . GLU A 1 65  ? 5.413   -14.642 5.188   1.00 0.00 ? 65  GLU A HG3  2  
ATOM 2762  N N    . ALA A 1 66  ? 9.613   -15.742 2.635   1.00 0.00 ? 66  ALA A N    2  
ATOM 2763  C CA   . ALA A 1 66  ? 10.740  -16.504 2.108   1.00 0.00 ? 66  ALA A CA   2  
ATOM 2764  C C    . ALA A 1 66  ? 10.738  -16.512 0.582   1.00 0.00 ? 66  ALA A C    2  
ATOM 2765  O O    . ALA A 1 66  ? 11.334  -17.390 -0.043  1.00 0.00 ? 66  ALA A O    2  
ATOM 2766  C CB   . ALA A 1 66  ? 10.711  -17.927 2.644   1.00 0.00 ? 66  ALA A CB   2  
ATOM 2767  H H    . ALA A 1 66  ? 8.882   -15.490 2.032   1.00 0.00 ? 66  ALA A H    2  
ATOM 2768  H HA   . ALA A 1 66  ? 11.650  -16.033 2.452   1.00 0.00 ? 66  ALA A HA   2  
ATOM 2769  H HB1  . ALA A 1 66  ? 10.608  -18.620 1.822   1.00 0.00 ? 66  ALA A HB1  2  
ATOM 2770  H HB2  . ALA A 1 66  ? 9.875   -18.040 3.319   1.00 0.00 ? 66  ALA A HB2  2  
ATOM 2771  H HB3  . ALA A 1 66  ? 11.630  -18.130 3.173   1.00 0.00 ? 66  ALA A HB3  2  
ATOM 2772  N N    . ASP A 1 67  ? 10.068  -15.527 -0.009  1.00 0.00 ? 67  ASP A N    2  
ATOM 2773  C CA   . ASP A 1 67  ? 9.989   -15.414 -1.463  1.00 0.00 ? 67  ASP A CA   2  
ATOM 2774  C C    . ASP A 1 67  ? 9.426   -16.690 -2.082  1.00 0.00 ? 67  ASP A C    2  
ATOM 2775  O O    . ASP A 1 67  ? 9.915   -17.162 -3.111  1.00 0.00 ? 67  ASP A O    2  
ATOM 2776  C CB   . ASP A 1 67  ? 11.370  -15.109 -2.046  1.00 0.00 ? 67  ASP A CB   2  
ATOM 2777  C CG   . ASP A 1 67  ? 11.421  -13.762 -2.741  1.00 0.00 ? 67  ASP A CG   2  
ATOM 2778  O OD1  . ASP A 1 67  ? 10.839  -12.795 -2.204  1.00 0.00 ? 67  ASP A OD1  2  
ATOM 2779  O OD2  . ASP A 1 67  ? 12.042  -13.674 -3.822  1.00 0.00 ? 67  ASP A OD2  2  
ATOM 2780  H H    . ASP A 1 67  ? 9.618   -14.856 0.546   1.00 0.00 ? 67  ASP A H    2  
ATOM 2781  H HA   . ASP A 1 67  ? 9.323   -14.595 -1.694  1.00 0.00 ? 67  ASP A HA   2  
ATOM 2782  H HB2  . ASP A 1 67  ? 12.098  -15.107 -1.248  1.00 0.00 ? 67  ASP A HB2  2  
ATOM 2783  H HB3  . ASP A 1 67  ? 11.629  -15.874 -2.763  1.00 0.00 ? 67  ASP A HB3  2  
ATOM 2784  N N    . GLY A 1 68  ? 8.397   -17.245 -1.450  1.00 0.00 ? 68  GLY A N    2  
ATOM 2785  C CA   . GLY A 1 68  ? 7.783   -18.460 -1.954  1.00 0.00 ? 68  GLY A CA   2  
ATOM 2786  C C    . GLY A 1 68  ? 6.956   -19.172 -0.902  1.00 0.00 ? 68  GLY A C    2  
ATOM 2787  O O    . GLY A 1 68  ? 7.314   -20.262 -0.454  1.00 0.00 ? 68  GLY A O    2  
ATOM 2788  H H    . GLY A 1 68  ? 8.048   -16.824 -0.637  1.00 0.00 ? 68  GLY A H    2  
ATOM 2789  H HA2  . GLY A 1 68  ? 7.145   -18.209 -2.789  1.00 0.00 ? 68  GLY A HA2  2  
ATOM 2790  H HA3  . GLY A 1 68  ? 8.560   -19.127 -2.296  1.00 0.00 ? 68  GLY A HA3  2  
ATOM 2791  N N    . HIS A 1 69  ? 5.846   -18.554 -0.504  1.00 0.00 ? 69  HIS A N    2  
ATOM 2792  C CA   . HIS A 1 69  ? 4.966   -19.134 0.502   1.00 0.00 ? 69  HIS A CA   2  
ATOM 2793  C C    . HIS A 1 69  ? 3.518   -18.723 0.259   1.00 0.00 ? 69  HIS A C    2  
ATOM 2794  O O    . HIS A 1 69  ? 3.243   -17.808 -0.517  1.00 0.00 ? 69  HIS A O    2  
ATOM 2795  C CB   . HIS A 1 69  ? 5.402   -18.699 1.902   1.00 0.00 ? 69  HIS A CB   2  
ATOM 2796  C CG   . HIS A 1 69  ? 6.285   -19.694 2.588   1.00 0.00 ? 69  HIS A CG   2  
ATOM 2797  N ND1  . HIS A 1 69  ? 5.800   -20.791 3.268   1.00 0.00 ? 69  HIS A ND1  2  
ATOM 2798  C CD2  . HIS A 1 69  ? 7.634   -19.753 2.697   1.00 0.00 ? 69  HIS A CD2  2  
ATOM 2799  C CE1  . HIS A 1 69  ? 6.809   -21.482 3.765   1.00 0.00 ? 69  HIS A CE1  2  
ATOM 2800  N NE2  . HIS A 1 69  ? 7.934   -20.873 3.432   1.00 0.00 ? 69  HIS A NE2  2  
ATOM 2801  H H    . HIS A 1 69  ? 5.616   -17.687 -0.899  1.00 0.00 ? 69  HIS A H    2  
ATOM 2802  H HA   . HIS A 1 69  ? 5.039   -20.209 0.429   1.00 0.00 ? 69  HIS A HA   2  
ATOM 2803  H HB2  . HIS A 1 69  ? 5.944   -17.769 1.829   1.00 0.00 ? 69  HIS A HB2  2  
ATOM 2804  H HB3  . HIS A 1 69  ? 4.525   -18.553 2.517   1.00 0.00 ? 69  HIS A HB3  2  
ATOM 2805  H HD1  . HIS A 1 69  ? 4.854   -21.027 3.369   1.00 0.00 ? 69  HIS A HD1  2  
ATOM 2806  H HD2  . HIS A 1 69  ? 8.342   -19.051 2.282   1.00 0.00 ? 69  HIS A HD2  2  
ATOM 2807  H HE1  . HIS A 1 69  ? 6.730   -22.390 4.343   1.00 0.00 ? 69  HIS A HE1  2  
ATOM 2808  H HE2  . HIS A 1 69  ? 8.835   -21.223 3.598   1.00 0.00 ? 69  HIS A HE2  2  
ATOM 2809  N N    . ALA A 1 70  ? 2.594   -19.405 0.929   1.00 0.00 ? 70  ALA A N    2  
ATOM 2810  C CA   . ALA A 1 70  ? 1.173   -19.111 0.789   1.00 0.00 ? 70  ALA A CA   2  
ATOM 2811  C C    . ALA A 1 70  ? 0.562   -18.712 2.127   1.00 0.00 ? 70  ALA A C    2  
ATOM 2812  O O    . ALA A 1 70  ? -0.082  -19.524 2.795   1.00 0.00 ? 70  ALA A O    2  
ATOM 2813  C CB   . ALA A 1 70  ? 0.441   -20.312 0.207   1.00 0.00 ? 70  ALA A CB   2  
ATOM 2814  H H    . ALA A 1 70  ? 2.875   -20.123 1.534   1.00 0.00 ? 70  ALA A H    2  
ATOM 2815  H HA   . ALA A 1 70  ? 1.069   -18.288 0.098   1.00 0.00 ? 70  ALA A HA   2  
ATOM 2816  H HB1  . ALA A 1 70  ? -0.616  -20.101 0.159   1.00 0.00 ? 70  ALA A HB1  2  
ATOM 2817  H HB2  . ALA A 1 70  ? 0.607   -21.174 0.836   1.00 0.00 ? 70  ALA A HB2  2  
ATOM 2818  H HB3  . ALA A 1 70  ? 0.814   -20.514 -0.786  1.00 0.00 ? 70  ALA A HB3  2  
ATOM 2819  N N    . ALA A 1 71  ? 0.769   -17.458 2.517   1.00 0.00 ? 71  ALA A N    2  
ATOM 2820  C CA   . ALA A 1 71  ? 0.240   -16.949 3.777   1.00 0.00 ? 71  ALA A CA   2  
ATOM 2821  C C    . ALA A 1 71  ? 0.207   -15.425 3.780   1.00 0.00 ? 71  ALA A C    2  
ATOM 2822  O O    . ALA A 1 71  ? -0.527  -14.811 4.555   1.00 0.00 ? 71  ALA A O    2  
ATOM 2823  C CB   . ALA A 1 71  ? 1.072   -17.463 4.941   1.00 0.00 ? 71  ALA A CB   2  
ATOM 2824  H H    . ALA A 1 71  ? 1.291   -16.861 1.942   1.00 0.00 ? 71  ALA A H    2  
ATOM 2825  H HA   . ALA A 1 71  ? -0.767  -17.322 3.891   1.00 0.00 ? 71  ALA A HA   2  
ATOM 2826  H HB1  . ALA A 1 71  ? 0.417   -17.780 5.740   1.00 0.00 ? 71  ALA A HB1  2  
ATOM 2827  H HB2  . ALA A 1 71  ? 1.719   -16.675 5.298   1.00 0.00 ? 71  ALA A HB2  2  
ATOM 2828  H HB3  . ALA A 1 71  ? 1.671   -18.300 4.614   1.00 0.00 ? 71  ALA A HB3  2  
ATOM 2829  N N    . VAL A 1 72  ? 1.011   -14.821 2.910   1.00 0.00 ? 72  VAL A N    2  
ATOM 2830  C CA   . VAL A 1 72  ? 1.080   -13.366 2.812   1.00 0.00 ? 72  VAL A CA   2  
ATOM 2831  C C    . VAL A 1 72  ? 0.882   -12.907 1.369   1.00 0.00 ? 72  VAL A C    2  
ATOM 2832  O O    . VAL A 1 72  ? 1.645   -13.279 0.478   1.00 0.00 ? 72  VAL A O    2  
ATOM 2833  C CB   . VAL A 1 72  ? 2.428   -12.828 3.351   1.00 0.00 ? 72  VAL A CB   2  
ATOM 2834  C CG1  . VAL A 1 72  ? 3.484   -13.920 3.328   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2835  C CG2  . VAL A 1 72  ? 2.899   -11.616 2.556   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2836  H H    . VAL A 1 72  ? 1.574   -15.365 2.323   1.00 0.00 ? 72  VAL A H    2  
ATOM 2837  H HA   . VAL A 1 72  ? 0.286   -12.956 3.418   1.00 0.00 ? 72  VAL A HA   2  
ATOM 2838  H HB   . VAL A 1 72  ? 2.281   -12.523 4.382   1.00 0.00 ? 72  VAL A HB   2  
ATOM 2839  H HG11 . VAL A 1 72  ? 4.445   -13.488 3.095   1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2840  H HG12 . VAL A 1 72  ? 3.226   -14.649 2.575   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2841  H HG13 . VAL A 1 72  ? 3.528   -14.400 4.294   1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2842  H HG21 . VAL A 1 72  ? 3.501   -10.981 3.190   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2843  H HG22 . VAL A 1 72  ? 2.042   -11.061 2.204   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2844  H HG23 . VAL A 1 72  ? 3.488   -11.944 1.713   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2845  N N    . VAL A 1 73  ? -0.147  -12.098 1.154   1.00 0.00 ? 73  VAL A N    2  
ATOM 2846  C CA   . VAL A 1 73  ? -0.447  -11.581 -0.176  1.00 0.00 ? 73  VAL A CA   2  
ATOM 2847  C C    . VAL A 1 73  ? -0.867  -10.111 -0.121  1.00 0.00 ? 73  VAL A C    2  
ATOM 2848  O O    . VAL A 1 73  ? -1.825  -9.753  0.564   1.00 0.00 ? 73  VAL A O    2  
ATOM 2849  C CB   . VAL A 1 73  ? -1.551  -12.408 -0.866  1.00 0.00 ? 73  VAL A CB   2  
ATOM 2850  C CG1  . VAL A 1 73  ? -2.810  -12.453 -0.012  1.00 0.00 ? 73  VAL A CG1  2  
ATOM 2851  C CG2  . VAL A 1 73  ? -1.854  -11.852 -2.249  1.00 0.00 ? 73  VAL A CG2  2  
ATOM 2852  H H    . VAL A 1 73  ? -0.715  -11.840 1.907   1.00 0.00 ? 73  VAL A H    2  
ATOM 2853  H HA   . VAL A 1 73  ? 0.452   -11.661 -0.769  1.00 0.00 ? 73  VAL A HA   2  
ATOM 2854  H HB   . VAL A 1 73  ? -1.190  -13.421 -0.983  1.00 0.00 ? 73  VAL A HB   2  
ATOM 2855  H HG11 . VAL A 1 73  ? -3.538  -13.098 -0.480  1.00 0.00 ? 73  VAL A HG11 2  
ATOM 2856  H HG12 . VAL A 1 73  ? -3.216  -11.458 0.082   1.00 0.00 ? 73  VAL A HG12 2  
ATOM 2857  H HG13 . VAL A 1 73  ? -2.566  -12.837 0.968   1.00 0.00 ? 73  VAL A HG13 2  
ATOM 2858  H HG21 . VAL A 1 73  ? -2.903  -11.603 -2.316  1.00 0.00 ? 73  VAL A HG21 2  
ATOM 2859  H HG22 . VAL A 1 73  ? -1.612  -12.592 -2.997  1.00 0.00 ? 73  VAL A HG22 2  
ATOM 2860  H HG23 . VAL A 1 73  ? -1.260  -10.964 -2.417  1.00 0.00 ? 73  VAL A HG23 2  
ATOM 2861  N N    . PHE A 1 74  ? -0.146  -9.266  -0.853  1.00 0.00 ? 74  PHE A N    2  
ATOM 2862  C CA   . PHE A 1 74  ? -0.448  -7.838  -0.898  1.00 0.00 ? 74  PHE A CA   2  
ATOM 2863  C C    . PHE A 1 74  ? 0.089   -7.216  -2.183  1.00 0.00 ? 74  PHE A C    2  
ATOM 2864  O O    . PHE A 1 74  ? -0.508  -6.293  -2.730  1.00 0.00 ? 74  PHE A O    2  
ATOM 2865  C CB   . PHE A 1 74  ? 0.132   -7.119  0.325   1.00 0.00 ? 74  PHE A CB   2  
ATOM 2866  C CG   . PHE A 1 74  ? -0.190  -5.644  0.379   1.00 0.00 ? 74  PHE A CG   2  
ATOM 2867  C CD1  . PHE A 1 74  ? -1.481  -5.183  0.145   1.00 0.00 ? 74  PHE A CD1  2  
ATOM 2868  C CD2  . PHE A 1 74  ? 0.805   -4.718  0.658   1.00 0.00 ? 74  PHE A CD2  2  
ATOM 2869  C CE1  . PHE A 1 74  ? -1.765  -3.832  0.192   1.00 0.00 ? 74  PHE A CE1  2  
ATOM 2870  C CE2  . PHE A 1 74  ? 0.524   -3.368  0.703   1.00 0.00 ? 74  PHE A CE2  2  
ATOM 2871  C CZ   . PHE A 1 74  ? -0.762  -2.925  0.469   1.00 0.00 ? 74  PHE A CZ   2  
ATOM 2872  H H    . PHE A 1 74  ? 0.602   -9.612  -1.383  1.00 0.00 ? 74  PHE A H    2  
ATOM 2873  H HA   . PHE A 1 74  ? -1.523  -7.731  -0.889  1.00 0.00 ? 74  PHE A HA   2  
ATOM 2874  H HB2  . PHE A 1 74  ? -0.262  -7.575  1.222   1.00 0.00 ? 74  PHE A HB2  2  
ATOM 2875  H HB3  . PHE A 1 74  ? 1.208   -7.224  0.319   1.00 0.00 ? 74  PHE A HB3  2  
ATOM 2876  H HD1  . PHE A 1 74  ? -2.272  -5.886  -0.068  1.00 0.00 ? 74  PHE A HD1  2  
ATOM 2877  H HD2  . PHE A 1 74  ? 1.813   -5.056  0.843   1.00 0.00 ? 74  PHE A HD2  2  
ATOM 2878  H HE1  . PHE A 1 74  ? -2.770  -3.485  0.010   1.00 0.00 ? 74  PHE A HE1  2  
ATOM 2879  H HE2  . PHE A 1 74  ? 1.308   -2.660  0.924   1.00 0.00 ? 74  PHE A HE2  2  
ATOM 2880  H HZ   . PHE A 1 74  ? -0.984  -1.869  0.504   1.00 0.00 ? 74  PHE A HZ   2  
ATOM 2881  N N    . GLY A 1 75  ? 1.214   -7.742  -2.671  1.00 0.00 ? 75  GLY A N    2  
ATOM 2882  C CA   . GLY A 1 75  ? 1.801   -7.231  -3.901  1.00 0.00 ? 75  GLY A CA   2  
ATOM 2883  C C    . GLY A 1 75  ? 1.131   -7.810  -5.133  1.00 0.00 ? 75  GLY A C    2  
ATOM 2884  O O    . GLY A 1 75  ? 1.780   -8.068  -6.145  1.00 0.00 ? 75  GLY A O    2  
ATOM 2885  H H    . GLY A 1 75  ? 1.640   -8.486  -2.198  1.00 0.00 ? 75  GLY A H    2  
ATOM 2886  H HA2  . GLY A 1 75  ? 1.700   -6.156  -3.919  1.00 0.00 ? 75  GLY A HA2  2  
ATOM 2887  H HA3  . GLY A 1 75  ? 2.850   -7.487  -3.921  1.00 0.00 ? 75  GLY A HA3  2  
ATOM 2888  N N    . THR A 1 76  ? -0.175  -8.017  -5.031  1.00 0.00 ? 76  THR A N    2  
ATOM 2889  C CA   . THR A 1 76  ? -0.969  -8.572  -6.121  1.00 0.00 ? 76  THR A CA   2  
ATOM 2890  C C    . THR A 1 76  ? -2.387  -8.017  -6.086  1.00 0.00 ? 76  THR A C    2  
ATOM 2891  O O    . THR A 1 76  ? -2.794  -7.405  -5.098  1.00 0.00 ? 76  THR A O    2  
ATOM 2892  C CB   . THR A 1 76  ? -1.029  -10.108 -6.050  1.00 0.00 ? 76  THR A CB   2  
ATOM 2893  O OG1  . THR A 1 76  ? 0.041   -10.607 -5.241  1.00 0.00 ? 76  THR A OG1  2  
ATOM 2894  C CG2  . THR A 1 76  ? -0.945  -10.718 -7.443  1.00 0.00 ? 76  THR A CG2  2  
ATOM 2895  H H    . THR A 1 76  ? -0.623  -7.785  -4.191  1.00 0.00 ? 76  THR A H    2  
ATOM 2896  H HA   . THR A 1 76  ? -0.502  -8.290  -7.053  1.00 0.00 ? 76  THR A HA   2  
ATOM 2897  H HB   . THR A 1 76  ? -1.971  -10.397 -5.606  1.00 0.00 ? 76  THR A HB   2  
ATOM 2898  H HG1  . THR A 1 76  ? 0.849   -10.631 -5.759  1.00 0.00 ? 76  THR A HG1  2  
ATOM 2899  H HG21 . THR A 1 76  ? -1.203  -9.973  -8.179  1.00 0.00 ? 76  THR A HG21 2  
ATOM 2900  H HG22 . THR A 1 76  ? -1.632  -11.549 -7.514  1.00 0.00 ? 76  THR A HG22 2  
ATOM 2901  H HG23 . THR A 1 76  ? 0.061   -11.068 -7.622  1.00 0.00 ? 76  THR A HG23 2  
ATOM 2902  N N    . VAL A 1 77  ? -3.144  -8.236  -7.156  1.00 0.00 ? 77  VAL A N    2  
ATOM 2903  C CA   . VAL A 1 77  ? -4.519  -7.761  -7.205  1.00 0.00 ? 77  VAL A CA   2  
ATOM 2904  C C    . VAL A 1 77  ? -5.331  -8.471  -6.128  1.00 0.00 ? 77  VAL A C    2  
ATOM 2905  O O    . VAL A 1 77  ? -5.738  -9.621  -6.298  1.00 0.00 ? 77  VAL A O    2  
ATOM 2906  C CB   . VAL A 1 77  ? -5.162  -8.022  -8.582  1.00 0.00 ? 77  VAL A CB   2  
ATOM 2907  C CG1  . VAL A 1 77  ? -6.494  -7.295  -8.698  1.00 0.00 ? 77  VAL A CG1  2  
ATOM 2908  C CG2  . VAL A 1 77  ? -4.220  -7.605  -9.700  1.00 0.00 ? 77  VAL A CG2  2  
ATOM 2909  H H    . VAL A 1 77  ? -2.775  -8.735  -7.915  1.00 0.00 ? 77  VAL A H    2  
ATOM 2910  H HA   . VAL A 1 77  ? -4.522  -6.697  -7.013  1.00 0.00 ? 77  VAL A HA   2  
ATOM 2911  H HB   . VAL A 1 77  ? -5.347  -9.080  -8.675  1.00 0.00 ? 77  VAL A HB   2  
ATOM 2912  H HG11 . VAL A 1 77  ? -7.207  -7.741  -8.024  1.00 0.00 ? 77  VAL A HG11 2  
ATOM 2913  H HG12 . VAL A 1 77  ? -6.859  -7.374  -9.713  1.00 0.00 ? 77  VAL A HG12 2  
ATOM 2914  H HG13 . VAL A 1 77  ? -6.359  -6.254  -8.446  1.00 0.00 ? 77  VAL A HG13 2  
ATOM 2915  H HG21 . VAL A 1 77  ? -3.989  -8.462  -10.316 1.00 0.00 ? 77  VAL A HG21 2  
ATOM 2916  H HG22 . VAL A 1 77  ? -3.309  -7.210  -9.275  1.00 0.00 ? 77  VAL A HG22 2  
ATOM 2917  H HG23 . VAL A 1 77  ? -4.693  -6.845  -10.305 1.00 0.00 ? 77  VAL A HG23 2  
ATOM 2918  N N    . VAL A 1 78  ? -5.538  -7.787  -5.006  1.00 0.00 ? 78  VAL A N    2  
ATOM 2919  C CA   . VAL A 1 78  ? -6.272  -8.357  -3.883  1.00 0.00 ? 78  VAL A CA   2  
ATOM 2920  C C    . VAL A 1 78  ? -7.468  -7.501  -3.494  1.00 0.00 ? 78  VAL A C    2  
ATOM 2921  O O    . VAL A 1 78  ? -7.766  -6.493  -4.133  1.00 0.00 ? 78  VAL A O    2  
ATOM 2922  C CB   . VAL A 1 78  ? -5.363  -8.501  -2.646  1.00 0.00 ? 78  VAL A CB   2  
ATOM 2923  C CG1  . VAL A 1 78  ? -4.142  -9.342  -2.968  1.00 0.00 ? 78  VAL A CG1  2  
ATOM 2924  C CG2  . VAL A 1 78  ? -4.948  -7.132  -2.126  1.00 0.00 ? 78  VAL A CG2  2  
ATOM 2925  H H    . VAL A 1 78  ? -5.176  -6.879  -4.924  1.00 0.00 ? 78  VAL A H    2  
ATOM 2926  H HA   . VAL A 1 78  ? -6.615  -9.341  -4.167  1.00 0.00 ? 78  VAL A HA   2  
ATOM 2927  H HB   . VAL A 1 78  ? -5.922  -9.002  -1.869  1.00 0.00 ? 78  VAL A HB   2  
ATOM 2928  H HG11 . VAL A 1 78  ? -4.298  -9.862  -3.901  1.00 0.00 ? 78  VAL A HG11 2  
ATOM 2929  H HG12 . VAL A 1 78  ? -3.981  -10.060 -2.176  1.00 0.00 ? 78  VAL A HG12 2  
ATOM 2930  H HG13 . VAL A 1 78  ? -3.277  -8.700  -3.052  1.00 0.00 ? 78  VAL A HG13 2  
ATOM 2931  H HG21 . VAL A 1 78  ? -3.871  -7.043  -2.162  1.00 0.00 ? 78  VAL A HG21 2  
ATOM 2932  H HG22 . VAL A 1 78  ? -5.285  -7.017  -1.108  1.00 0.00 ? 78  VAL A HG22 2  
ATOM 2933  H HG23 . VAL A 1 78  ? -5.393  -6.364  -2.742  1.00 0.00 ? 78  VAL A HG23 2  
ATOM 2934  N N    . ASP A 1 79  ? -8.132  -7.905  -2.416  1.00 0.00 ? 79  ASP A N    2  
ATOM 2935  C CA   . ASP A 1 79  ? -9.280  -7.177  -1.900  1.00 0.00 ? 79  ASP A CA   2  
ATOM 2936  C C    . ASP A 1 79  ? -8.837  -6.314  -0.731  1.00 0.00 ? 79  ASP A C    2  
ATOM 2937  O O    . ASP A 1 79  ? -8.208  -6.809  0.200   1.00 0.00 ? 79  ASP A O    2  
ATOM 2938  C CB   . ASP A 1 79  ? -10.374 -8.145  -1.449  1.00 0.00 ? 79  ASP A CB   2  
ATOM 2939  C CG   . ASP A 1 79  ? -11.474 -8.293  -2.481  1.00 0.00 ? 79  ASP A CG   2  
ATOM 2940  O OD1  . ASP A 1 79  ? -11.157 -8.601  -3.648  1.00 0.00 ? 79  ASP A OD1  2  
ATOM 2941  O OD2  . ASP A 1 79  ? -12.655 -8.098  -2.121  1.00 0.00 ? 79  ASP A OD2  2  
ATOM 2942  H H    . ASP A 1 79  ? -7.823  -8.705  -1.943  1.00 0.00 ? 79  ASP A H    2  
ATOM 2943  H HA   . ASP A 1 79  ? -9.662  -6.542  -2.688  1.00 0.00 ? 79  ASP A HA   2  
ATOM 2944  H HB2  . ASP A 1 79  ? -9.935  -9.117  -1.276  1.00 0.00 ? 79  ASP A HB2  2  
ATOM 2945  H HB3  . ASP A 1 79  ? -10.810 -7.785  -0.528  1.00 0.00 ? 79  ASP A HB3  2  
ATOM 2946  N N    . ILE A 1 80  ? -9.147  -5.026  -0.785  1.00 0.00 ? 80  ILE A N    2  
ATOM 2947  C CA   . ILE A 1 80  ? -8.750  -4.118  0.278   1.00 0.00 ? 80  ILE A CA   2  
ATOM 2948  C C    . ILE A 1 80  ? -9.957  -3.491  0.964   1.00 0.00 ? 80  ILE A C    2  
ATOM 2949  O O    . ILE A 1 80  ? -11.086 -3.593  0.482   1.00 0.00 ? 80  ILE A O    2  
ATOM 2950  C CB   . ILE A 1 80  ? -7.830  -3.002  -0.253  1.00 0.00 ? 80  ILE A CB   2  
ATOM 2951  C CG1  . ILE A 1 80  ? -8.627  -1.977  -1.065  1.00 0.00 ? 80  ILE A CG1  2  
ATOM 2952  C CG2  . ILE A 1 80  ? -6.712  -3.598  -1.095  1.00 0.00 ? 80  ILE A CG2  2  
ATOM 2953  C CD1  . ILE A 1 80  ? -8.120  -0.560  -0.911  1.00 0.00 ? 80  ILE A CD1  2  
ATOM 2954  H H    . ILE A 1 80  ? -9.638  -4.678  -1.554  1.00 0.00 ? 80  ILE A H    2  
ATOM 2955  H HA   . ILE A 1 80  ? -8.191  -4.691  1.007   1.00 0.00 ? 80  ILE A HA   2  
ATOM 2956  H HB   . ILE A 1 80  ? -7.380  -2.506  0.595   1.00 0.00 ? 80  ILE A HB   2  
ATOM 2957  H HG12 . ILE A 1 80  ? -8.571  -2.235  -2.112  1.00 0.00 ? 80  ILE A HG12 2  
ATOM 2958  H HG13 . ILE A 1 80  ? -9.658  -1.998  -0.749  1.00 0.00 ? 80  ILE A HG13 2  
ATOM 2959  H HG21 . ILE A 1 80  ? -6.753  -4.676  -1.036  1.00 0.00 ? 80  ILE A HG21 2  
ATOM 2960  H HG22 . ILE A 1 80  ? -5.757  -3.254  -0.721  1.00 0.00 ? 80  ILE A HG22 2  
ATOM 2961  H HG23 . ILE A 1 80  ? -6.828  -3.289  -2.121  1.00 0.00 ? 80  ILE A HG23 2  
ATOM 2962  H HD11 . ILE A 1 80  ? -7.182  -0.453  -1.435  1.00 0.00 ? 80  ILE A HD11 2  
ATOM 2963  H HD12 . ILE A 1 80  ? -7.974  -0.342  0.138   1.00 0.00 ? 80  ILE A HD12 2  
ATOM 2964  H HD13 . ILE A 1 80  ? -8.843  0.128   -1.323  1.00 0.00 ? 80  ILE A HD13 2  
ATOM 2965  N N    . ILE A 1 81  ? -9.700  -2.830  2.084   1.00 0.00 ? 81  ILE A N    2  
ATOM 2966  C CA   . ILE A 1 81  ? -10.744 -2.163  2.849   1.00 0.00 ? 81  ILE A CA   2  
ATOM 2967  C C    . ILE A 1 81  ? -10.224 -0.834  3.378   1.00 0.00 ? 81  ILE A C    2  
ATOM 2968  O O    . ILE A 1 81  ? -9.103  -0.753  3.875   1.00 0.00 ? 81  ILE A O    2  
ATOM 2969  C CB   . ILE A 1 81  ? -11.231 -3.028  4.027   1.00 0.00 ? 81  ILE A CB   2  
ATOM 2970  C CG1  . ILE A 1 81  ? -10.041 -3.541  4.836   1.00 0.00 ? 81  ILE A CG1  2  
ATOM 2971  C CG2  . ILE A 1 81  ? -12.077 -4.189  3.523   1.00 0.00 ? 81  ILE A CG2  2  
ATOM 2972  C CD1  . ILE A 1 81  ? -10.425 -4.135  6.174   1.00 0.00 ? 81  ILE A CD1  2  
ATOM 2973  H H    . ILE A 1 81  ? -8.774  -2.782  2.402   1.00 0.00 ? 81  ILE A H    2  
ATOM 2974  H HA   . ILE A 1 81  ? -11.578 -1.978  2.187   1.00 0.00 ? 81  ILE A HA   2  
ATOM 2975  H HB   . ILE A 1 81  ? -11.851 -2.414  4.665   1.00 0.00 ? 81  ILE A HB   2  
ATOM 2976  H HG12 . ILE A 1 81  ? -9.531  -4.306  4.266   1.00 0.00 ? 81  ILE A HG12 2  
ATOM 2977  H HG13 . ILE A 1 81  ? -9.362  -2.723  5.018   1.00 0.00 ? 81  ILE A HG13 2  
ATOM 2978  H HG21 . ILE A 1 81  ? -11.449 -5.053  3.373   1.00 0.00 ? 81  ILE A HG21 2  
ATOM 2979  H HG22 . ILE A 1 81  ? -12.541 -3.915  2.586   1.00 0.00 ? 81  ILE A HG22 2  
ATOM 2980  H HG23 . ILE A 1 81  ? -12.842 -4.419  4.248   1.00 0.00 ? 81  ILE A HG23 2  
ATOM 2981  H HD11 . ILE A 1 81  ? -11.346 -4.690  6.072   1.00 0.00 ? 81  ILE A HD11 2  
ATOM 2982  H HD12 . ILE A 1 81  ? -10.561 -3.342  6.894   1.00 0.00 ? 81  ILE A HD12 2  
ATOM 2983  H HD13 . ILE A 1 81  ? -9.641  -4.798  6.514   1.00 0.00 ? 81  ILE A HD13 2  
ATOM 2984  N N    . SER A 1 82  ? -11.037 0.206   3.271   1.00 0.00 ? 82  SER A N    2  
ATOM 2985  C CA   . SER A 1 82  ? -10.637 1.525   3.741   1.00 0.00 ? 82  SER A CA   2  
ATOM 2986  C C    . SER A 1 82  ? -11.006 1.718   5.207   1.00 0.00 ? 82  SER A C    2  
ATOM 2987  O O    . SER A 1 82  ? -11.684 0.880   5.800   1.00 0.00 ? 82  SER A O    2  
ATOM 2988  C CB   . SER A 1 82  ? -11.288 2.616   2.887   1.00 0.00 ? 82  SER A CB   2  
ATOM 2989  O OG   . SER A 1 82  ? -12.307 3.289   3.603   1.00 0.00 ? 82  SER A OG   2  
ATOM 2990  H H    . SER A 1 82  ? -11.924 0.084   2.872   1.00 0.00 ? 82  SER A H    2  
ATOM 2991  H HA   . SER A 1 82  ? -9.565  1.598   3.642   1.00 0.00 ? 82  SER A HA   2  
ATOM 2992  H HB2  . SER A 1 82  ? -10.536 3.335   2.593   1.00 0.00 ? 82  SER A HB2  2  
ATOM 2993  H HB3  . SER A 1 82  ? -11.719 2.169   2.003   1.00 0.00 ? 82  SER A HB3  2  
ATOM 2994  H HG   . SER A 1 82  ? -13.035 2.685   3.768   1.00 0.00 ? 82  SER A HG   2  
ATOM 2995  N N    . ARG A 1 83  ? -10.538 2.821   5.784   1.00 0.00 ? 83  ARG A N    2  
ATOM 2996  C CA   . ARG A 1 83  ? -10.805 3.133   7.189   1.00 0.00 ? 83  ARG A CA   2  
ATOM 2997  C C    . ARG A 1 83  ? -12.266 2.871   7.558   1.00 0.00 ? 83  ARG A C    2  
ATOM 2998  O O    . ARG A 1 83  ? -12.567 2.475   8.684   1.00 0.00 ? 83  ARG A O    2  
ATOM 2999  C CB   . ARG A 1 83  ? -10.460 4.595   7.482   1.00 0.00 ? 83  ARG A CB   2  
ATOM 3000  C CG   . ARG A 1 83  ? -11.395 5.590   6.813   1.00 0.00 ? 83  ARG A CG   2  
ATOM 3001  C CD   . ARG A 1 83  ? -10.644 6.808   6.303   1.00 0.00 ? 83  ARG A CD   2  
ATOM 3002  N NE   . ARG A 1 83  ? -10.907 7.994   7.113   1.00 0.00 ? 83  ARG A NE   2  
ATOM 3003  C CZ   . ARG A 1 83  ? -9.966  8.658   7.777   1.00 0.00 ? 83  ARG A CZ   2  
ATOM 3004  N NH1  . ARG A 1 83  ? -8.705  8.249   7.731   1.00 0.00 ? 83  ARG A NH1  2  
ATOM 3005  N NH2  . ARG A 1 83  ? -10.285 9.729   8.490   1.00 0.00 ? 83  ARG A NH2  2  
ATOM 3006  H H    . ARG A 1 83  ? -9.982  3.432   5.254   1.00 0.00 ? 83  ARG A H    2  
ATOM 3007  H HA   . ARG A 1 83  ? -10.176 2.498   7.794   1.00 0.00 ? 83  ARG A HA   2  
ATOM 3008  H HB2  . ARG A 1 83  ? -10.501 4.755   8.549   1.00 0.00 ? 83  ARG A HB2  2  
ATOM 3009  H HB3  . ARG A 1 83  ? -9.456  4.789   7.136   1.00 0.00 ? 83  ARG A HB3  2  
ATOM 3010  H HG2  . ARG A 1 83  ? -11.884 5.106   5.980   1.00 0.00 ? 83  ARG A HG2  2  
ATOM 3011  H HG3  . ARG A 1 83  ? -12.136 5.910   7.531   1.00 0.00 ? 83  ARG A HG3  2  
ATOM 3012  H HD2  . ARG A 1 83  ? -9.585  6.597   6.325   1.00 0.00 ? 83  ARG A HD2  2  
ATOM 3013  H HD3  . ARG A 1 83  ? -10.947 7.004   5.285   1.00 0.00 ? 83  ARG A HD3  2  
ATOM 3014  H HE   . ARG A 1 83  ? -11.833 8.314   7.163   1.00 0.00 ? 83  ARG A HE   2  
ATOM 3015  H HH11 . ARG A 1 83  ? -8.460  7.442   7.195   1.00 0.00 ? 83  ARG A HH11 2  
ATOM 3016  H HH12 . ARG A 1 83  ? -7.999  8.750   8.232   1.00 0.00 ? 83  ARG A HH12 2  
ATOM 3017  H HH21 . ARG A 1 83  ? -11.235 10.040  8.528   1.00 0.00 ? 83  ARG A HH21 2  
ATOM 3018  H HH22 . ARG A 1 83  ? -9.577  10.229  8.988   1.00 0.00 ? 83  ARG A HH22 2  
ATOM 3019  N N    . SER A 1 84  ? -13.168 3.099   6.605   1.00 0.00 ? 84  SER A N    2  
ATOM 3020  C CA   . SER A 1 84  ? -14.594 2.893   6.838   1.00 0.00 ? 84  SER A CA   2  
ATOM 3021  C C    . SER A 1 84  ? -15.024 1.493   6.414   1.00 0.00 ? 84  SER A C    2  
ATOM 3022  O O    . SER A 1 84  ? -16.046 0.984   6.874   1.00 0.00 ? 84  SER A O    2  
ATOM 3023  C CB   . SER A 1 84  ? -15.409 3.942   6.078   1.00 0.00 ? 84  SER A CB   2  
ATOM 3024  O OG   . SER A 1 84  ? -16.801 3.707   6.215   1.00 0.00 ? 84  SER A OG   2  
ATOM 3025  H H    . SER A 1 84  ? -12.869 3.417   5.728   1.00 0.00 ? 84  SER A H    2  
ATOM 3026  H HA   . SER A 1 84  ? -14.777 3.008   7.895   1.00 0.00 ? 84  SER A HA   2  
ATOM 3027  H HB2  . SER A 1 84  ? -15.184 4.923   6.469   1.00 0.00 ? 84  SER A HB2  2  
ATOM 3028  H HB3  . SER A 1 84  ? -15.152 3.904   5.030   1.00 0.00 ? 84  SER A HB3  2  
ATOM 3029  H HG   . SER A 1 84  ? -16.945 2.814   6.536   1.00 0.00 ? 84  SER A HG   2  
ATOM 3030  N N    . GLY A 1 85  ? -14.242 0.877   5.532   1.00 0.00 ? 85  GLY A N    2  
ATOM 3031  C CA   . GLY A 1 85  ? -14.561 -0.456  5.062   1.00 0.00 ? 85  GLY A CA   2  
ATOM 3032  C C    . GLY A 1 85  ? -15.414 -0.416  3.814   1.00 0.00 ? 85  GLY A C    2  
ATOM 3033  O O    . GLY A 1 85  ? -16.563 0.021   3.854   1.00 0.00 ? 85  GLY A O    2  
ATOM 3034  H H    . GLY A 1 85  ? -13.441 1.327   5.195   1.00 0.00 ? 85  GLY A H    2  
ATOM 3035  H HA2  . GLY A 1 85  ? -13.641 -0.978  4.841   1.00 0.00 ? 85  GLY A HA2  2  
ATOM 3036  H HA3  . GLY A 1 85  ? -15.090 -0.989  5.836   1.00 0.00 ? 85  GLY A HA3  2  
ATOM 3037  N N    . GLU A 1 86  ? -14.845 -0.860  2.703   1.00 0.00 ? 86  GLU A N    2  
ATOM 3038  C CA   . GLU A 1 86  ? -15.556 -0.855  1.434   1.00 0.00 ? 86  GLU A CA   2  
ATOM 3039  C C    . GLU A 1 86  ? -15.491 -2.218  0.750   1.00 0.00 ? 86  GLU A C    2  
ATOM 3040  O O    . GLU A 1 86  ? -16.402 -2.592  0.011   1.00 0.00 ? 86  GLU A O    2  
ATOM 3041  C CB   . GLU A 1 86  ? -14.972 0.222   0.521   1.00 0.00 ? 86  GLU A CB   2  
ATOM 3042  C CG   . GLU A 1 86  ? -15.656 1.573   0.654   1.00 0.00 ? 86  GLU A CG   2  
ATOM 3043  C CD   . GLU A 1 86  ? -16.180 2.095   -0.670  1.00 0.00 ? 86  GLU A CD   2  
ATOM 3044  O OE1  . GLU A 1 86  ? -15.359 2.537   -1.501  1.00 0.00 ? 86  GLU A OE1  2  
ATOM 3045  O OE2  . GLU A 1 86  ? -17.412 2.063   -0.875  1.00 0.00 ? 86  GLU A OE2  2  
ATOM 3046  H H    . GLU A 1 86  ? -13.921 -1.186  2.735   1.00 0.00 ? 86  GLU A H    2  
ATOM 3047  H HA   . GLU A 1 86  ? -16.591 -0.618  1.636   1.00 0.00 ? 86  GLU A HA   2  
ATOM 3048  H HB2  . GLU A 1 86  ? -13.926 0.348   0.757   1.00 0.00 ? 86  GLU A HB2  2  
ATOM 3049  H HB3  . GLU A 1 86  ? -15.062 -0.104  -0.502  1.00 0.00 ? 86  GLU A HB3  2  
ATOM 3050  H HG2  . GLU A 1 86  ? -16.487 1.477   1.338   1.00 0.00 ? 86  GLU A HG2  2  
ATOM 3051  H HG3  . GLU A 1 86  ? -14.946 2.284   1.050   1.00 0.00 ? 86  GLU A HG3  2  
ATOM 3052  N N    . LYS A 1 87  ? -14.410 -2.954  0.998   1.00 0.00 ? 87  LYS A N    2  
ATOM 3053  C CA   . LYS A 1 87  ? -14.225 -4.275  0.399   1.00 0.00 ? 87  LYS A CA   2  
ATOM 3054  C C    . LYS A 1 87  ? -14.377 -4.202  -1.118  1.00 0.00 ? 87  LYS A C    2  
ATOM 3055  O O    . LYS A 1 87  ? -15.460 -4.433  -1.657  1.00 0.00 ? 87  LYS A O    2  
ATOM 3056  C CB   . LYS A 1 87  ? -15.227 -5.275  0.981   1.00 0.00 ? 87  LYS A CB   2  
ATOM 3057  C CG   . LYS A 1 87  ? -15.371 -5.184  2.493   1.00 0.00 ? 87  LYS A CG   2  
ATOM 3058  C CD   . LYS A 1 87  ? -16.696 -4.553  2.892   1.00 0.00 ? 87  LYS A CD   2  
ATOM 3059  C CE   . LYS A 1 87  ? -16.754 -4.285  4.387   1.00 0.00 ? 87  LYS A CE   2  
ATOM 3060  N NZ   . LYS A 1 87  ? -18.049 -3.675  4.795   1.00 0.00 ? 87  LYS A NZ   2  
ATOM 3061  H H    . LYS A 1 87  ? -13.717 -2.598  1.593   1.00 0.00 ? 87  LYS A H    2  
ATOM 3062  H HA   . LYS A 1 87  ? -13.223 -4.603  0.632   1.00 0.00 ? 87  LYS A HA   2  
ATOM 3063  H HB2  . LYS A 1 87  ? -16.195 -5.098  0.536   1.00 0.00 ? 87  LYS A HB2  2  
ATOM 3064  H HB3  . LYS A 1 87  ? -14.903 -6.275  0.732   1.00 0.00 ? 87  LYS A HB3  2  
ATOM 3065  H HG2  . LYS A 1 87  ? -15.319 -6.179  2.909   1.00 0.00 ? 87  LYS A HG2  2  
ATOM 3066  H HG3  . LYS A 1 87  ? -14.564 -4.586  2.886   1.00 0.00 ? 87  LYS A HG3  2  
ATOM 3067  H HD2  . LYS A 1 87  ? -16.811 -3.618  2.363   1.00 0.00 ? 87  LYS A HD2  2  
ATOM 3068  H HD3  . LYS A 1 87  ? -17.498 -5.223  2.624   1.00 0.00 ? 87  LYS A HD3  2  
ATOM 3069  H HE2  . LYS A 1 87  ? -16.625 -5.219  4.914   1.00 0.00 ? 87  LYS A HE2  2  
ATOM 3070  H HE3  . LYS A 1 87  ? -15.949 -3.611  4.650   1.00 0.00 ? 87  LYS A HE3  2  
ATOM 3071  H HZ1  . LYS A 1 87  ? -18.112 -2.698  4.445   1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 3072  H HZ2  . LYS A 1 87  ? -18.128 -3.663  5.832   1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 3073  H HZ3  . LYS A 1 87  ? -18.842 -4.224  4.404   1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 3074  N N    . ILE A 1 88  ? -13.283 -3.874  -1.797  1.00 0.00 ? 88  ILE A N    2  
ATOM 3075  C CA   . ILE A 1 88  ? -13.293 -3.762  -3.251  1.00 0.00 ? 88  ILE A CA   2  
ATOM 3076  C C    . ILE A 1 88  ? -12.038 -4.374  -3.869  1.00 0.00 ? 88  ILE A C    2  
ATOM 3077  O O    . ILE A 1 88  ? -10.952 -4.300  -3.293  1.00 0.00 ? 88  ILE A O    2  
ATOM 3078  C CB   . ILE A 1 88  ? -13.414 -2.293  -3.708  1.00 0.00 ? 88  ILE A CB   2  
ATOM 3079  C CG1  . ILE A 1 88  ? -12.184 -1.482  -3.269  1.00 0.00 ? 88  ILE A CG1  2  
ATOM 3080  C CG2  . ILE A 1 88  ? -14.697 -1.672  -3.173  1.00 0.00 ? 88  ILE A CG2  2  
ATOM 3081  C CD1  . ILE A 1 88  ? -12.166 -1.125  -1.797  1.00 0.00 ? 88  ILE A CD1  2  
ATOM 3082  H H    . ILE A 1 88  ? -12.455 -3.703  -1.302  1.00 0.00 ? 88  ILE A H    2  
ATOM 3083  H HA   . ILE A 1 88  ? -14.155 -4.300  -3.617  1.00 0.00 ? 88  ILE A HA   2  
ATOM 3084  H HB   . ILE A 1 88  ? -13.469 -2.285  -4.786  1.00 0.00 ? 88  ILE A HB   2  
ATOM 3085  H HG12 . ILE A 1 88  ? -11.294 -2.054  -3.479  1.00 0.00 ? 88  ILE A HG12 2  
ATOM 3086  H HG13 . ILE A 1 88  ? -12.152 -0.561  -3.833  1.00 0.00 ? 88  ILE A HG13 2  
ATOM 3087  H HG21 . ILE A 1 88  ? -14.463 -0.767  -2.635  1.00 0.00 ? 88  ILE A HG21 2  
ATOM 3088  H HG22 . ILE A 1 88  ? -15.184 -2.370  -2.508  1.00 0.00 ? 88  ILE A HG22 2  
ATOM 3089  H HG23 . ILE A 1 88  ? -15.356 -1.441  -3.997  1.00 0.00 ? 88  ILE A HG23 2  
ATOM 3090  H HD11 . ILE A 1 88  ? -12.824 -0.287  -1.621  1.00 0.00 ? 88  ILE A HD11 2  
ATOM 3091  H HD12 . ILE A 1 88  ? -11.161 -0.862  -1.501  1.00 0.00 ? 88  ILE A HD12 2  
ATOM 3092  H HD13 . ILE A 1 88  ? -12.500 -1.973  -1.215  1.00 0.00 ? 88  ILE A HD13 2  
ATOM 3093  N N    . PRO A 1 89  ? -12.169 -4.983  -5.062  1.00 0.00 ? 89  PRO A N    2  
ATOM 3094  C CA   . PRO A 1 89  ? -11.047 -5.599  -5.764  1.00 0.00 ? 89  PRO A CA   2  
ATOM 3095  C C    . PRO A 1 89  ? -10.135 -4.552  -6.392  1.00 0.00 ? 89  PRO A C    2  
ATOM 3096  O O    . PRO A 1 89  ? -10.599 -3.648  -7.086  1.00 0.00 ? 89  PRO A O    2  
ATOM 3097  C CB   . PRO A 1 89  ? -11.707 -6.454  -6.854  1.00 0.00 ? 89  PRO A CB   2  
ATOM 3098  C CG   . PRO A 1 89  ? -13.184 -6.366  -6.619  1.00 0.00 ? 89  PRO A CG   2  
ATOM 3099  C CD   . PRO A 1 89  ? -13.414 -5.112  -5.826  1.00 0.00 ? 89  PRO A CD   2  
ATOM 3100  H HA   . PRO A 1 89  ? -10.468 -6.231  -5.111  1.00 0.00 ? 89  PRO A HA   2  
ATOM 3101  H HB2  . PRO A 1 89  ? -11.440 -6.064  -7.822  1.00 0.00 ? 89  PRO A HB2  2  
ATOM 3102  H HB3  . PRO A 1 89  ? -11.358 -7.474  -6.771  1.00 0.00 ? 89  PRO A HB3  2  
ATOM 3103  H HG2  . PRO A 1 89  ? -13.701 -6.310  -7.564  1.00 0.00 ? 89  PRO A HG2  2  
ATOM 3104  H HG3  . PRO A 1 89  ? -13.515 -7.227  -6.059  1.00 0.00 ? 89  PRO A HG3  2  
ATOM 3105  H HD2  . PRO A 1 89  ? -13.555 -4.268  -6.486  1.00 0.00 ? 89  PRO A HD2  2  
ATOM 3106  H HD3  . PRO A 1 89  ? -14.261 -5.230  -5.168  1.00 0.00 ? 89  PRO A HD3  2  
ATOM 3107  N N    . VAL A 1 90  ? -8.837  -4.676  -6.140  1.00 0.00 ? 90  VAL A N    2  
ATOM 3108  C CA   . VAL A 1 90  ? -7.865  -3.732  -6.682  1.00 0.00 ? 90  VAL A CA   2  
ATOM 3109  C C    . VAL A 1 90  ? -6.520  -4.400  -6.935  1.00 0.00 ? 90  VAL A C    2  
ATOM 3110  O O    . VAL A 1 90  ? -6.191  -5.414  -6.323  1.00 0.00 ? 90  VAL A O    2  
ATOM 3111  C CB   . VAL A 1 90  ? -7.648  -2.537  -5.735  1.00 0.00 ? 90  VAL A CB   2  
ATOM 3112  C CG1  . VAL A 1 90  ? -8.517  -1.360  -6.146  1.00 0.00 ? 90  VAL A CG1  2  
ATOM 3113  C CG2  . VAL A 1 90  ? -7.924  -2.936  -4.295  1.00 0.00 ? 90  VAL A CG2  2  
ATOM 3114  H H    . VAL A 1 90  ? -8.522  -5.414  -5.581  1.00 0.00 ? 90  VAL A H    2  
ATOM 3115  H HA   . VAL A 1 90  ? -8.253  -3.356  -7.618  1.00 0.00 ? 90  VAL A HA   2  
ATOM 3116  H HB   . VAL A 1 90  ? -6.613  -2.232  -5.807  1.00 0.00 ? 90  VAL A HB   2  
ATOM 3117  H HG11 . VAL A 1 90  ? -8.706  -0.734  -5.286  1.00 0.00 ? 90  VAL A HG11 2  
ATOM 3118  H HG12 . VAL A 1 90  ? -9.455  -1.723  -6.539  1.00 0.00 ? 90  VAL A HG12 2  
ATOM 3119  H HG13 . VAL A 1 90  ? -8.006  -0.784  -6.904  1.00 0.00 ? 90  VAL A HG13 2  
ATOM 3120  H HG21 . VAL A 1 90  ? -7.256  -3.734  -4.006  1.00 0.00 ? 90  VAL A HG21 2  
ATOM 3121  H HG22 . VAL A 1 90  ? -8.946  -3.274  -4.204  1.00 0.00 ? 90  VAL A HG22 2  
ATOM 3122  H HG23 . VAL A 1 90  ? -7.767  -2.086  -3.649  1.00 0.00 ? 90  VAL A HG23 2  
ATOM 3123  N N    . SER A 1 91  ? -5.743  -3.804  -7.830  1.00 0.00 ? 91  SER A N    2  
ATOM 3124  C CA   . SER A 1 91  ? -4.420  -4.315  -8.163  1.00 0.00 ? 91  SER A CA   2  
ATOM 3125  C C    . SER A 1 91  ? -3.363  -3.601  -7.333  1.00 0.00 ? 91  SER A C    2  
ATOM 3126  O O    . SER A 1 91  ? -3.285  -2.371  -7.344  1.00 0.00 ? 91  SER A O    2  
ATOM 3127  C CB   . SER A 1 91  ? -4.134  -4.124  -9.655  1.00 0.00 ? 91  SER A CB   2  
ATOM 3128  O OG   . SER A 1 91  ? -5.276  -4.433  -10.436 1.00 0.00 ? 91  SER A OG   2  
ATOM 3129  H H    . SER A 1 91  ? -6.068  -2.988  -8.264  1.00 0.00 ? 91  SER A H    2  
ATOM 3130  H HA   . SER A 1 91  ? -4.400  -5.369  -7.929  1.00 0.00 ? 91  SER A HA   2  
ATOM 3131  H HB2  . SER A 1 91  ? -3.858  -3.097  -9.838  1.00 0.00 ? 91  SER A HB2  2  
ATOM 3132  H HB3  . SER A 1 91  ? -3.324  -4.774  -9.949  1.00 0.00 ? 91  SER A HB3  2  
ATOM 3133  H HG   . SER A 1 91  ? -5.109  -5.230  -10.945 1.00 0.00 ? 91  SER A HG   2  
ATOM 3134  N N    . VAL A 1 92  ? -2.551  -4.365  -6.610  1.00 0.00 ? 92  VAL A N    2  
ATOM 3135  C CA   . VAL A 1 92  ? -1.510  -3.779  -5.778  1.00 0.00 ? 92  VAL A CA   2  
ATOM 3136  C C    . VAL A 1 92  ? -0.134  -4.321  -6.144  1.00 0.00 ? 92  VAL A C    2  
ATOM 3137  O O    . VAL A 1 92  ? 0.040   -5.520  -6.356  1.00 0.00 ? 92  VAL A O    2  
ATOM 3138  C CB   . VAL A 1 92  ? -1.767  -4.036  -4.282  1.00 0.00 ? 92  VAL A CB   2  
ATOM 3139  C CG1  . VAL A 1 92  ? -0.645  -3.450  -3.437  1.00 0.00 ? 92  VAL A CG1  2  
ATOM 3140  C CG2  . VAL A 1 92  ? -3.115  -3.466  -3.866  1.00 0.00 ? 92  VAL A CG2  2  
ATOM 3141  H H    . VAL A 1 92  ? -2.652  -5.345  -6.636  1.00 0.00 ? 92  VAL A H    2  
ATOM 3142  H HA   . VAL A 1 92  ? -1.518  -2.712  -5.943  1.00 0.00 ? 92  VAL A HA   2  
ATOM 3143  H HB   . VAL A 1 92  ? -1.787  -5.105  -4.119  1.00 0.00 ? 92  VAL A HB   2  
ATOM 3144  H HG11 . VAL A 1 92  ? 0.307   -3.675  -3.899  1.00 0.00 ? 92  VAL A HG11 2  
ATOM 3145  H HG12 . VAL A 1 92  ? -0.678  -3.879  -2.446  1.00 0.00 ? 92  VAL A HG12 2  
ATOM 3146  H HG13 . VAL A 1 92  ? -0.768  -2.379  -3.371  1.00 0.00 ? 92  VAL A HG13 2  
ATOM 3147  H HG21 . VAL A 1 92  ? -3.180  -3.447  -2.787  1.00 0.00 ? 92  VAL A HG21 2  
ATOM 3148  H HG22 . VAL A 1 92  ? -3.907  -4.085  -4.263  1.00 0.00 ? 92  VAL A HG22 2  
ATOM 3149  H HG23 . VAL A 1 92  ? -3.215  -2.462  -4.249  1.00 0.00 ? 92  VAL A HG23 2  
ATOM 3150  N N    . TRP A 1 93  ? 0.843   -3.422  -6.203  1.00 0.00 ? 93  TRP A N    2  
ATOM 3151  C CA   . TRP A 1 93  ? 2.209   -3.804  -6.526  1.00 0.00 ? 93  TRP A CA   2  
ATOM 3152  C C    . TRP A 1 93  ? 3.200   -3.071  -5.629  1.00 0.00 ? 93  TRP A C    2  
ATOM 3153  O O    . TRP A 1 93  ? 3.360   -1.854  -5.723  1.00 0.00 ? 93  TRP A O    2  
ATOM 3154  C CB   . TRP A 1 93  ? 2.540   -3.545  -8.005  1.00 0.00 ? 93  TRP A CB   2  
ATOM 3155  C CG   . TRP A 1 93  ? 1.582   -2.629  -8.720  1.00 0.00 ? 93  TRP A CG   2  
ATOM 3156  C CD1  . TRP A 1 93  ? 0.255   -2.848  -8.966  1.00 0.00 ? 93  TRP A CD1  2  
ATOM 3157  C CD2  . TRP A 1 93  ? 1.893   -1.361  -9.307  1.00 0.00 ? 93  TRP A CD2  2  
ATOM 3158  N NE1  . TRP A 1 93  ? -0.279  -1.785  -9.657  1.00 0.00 ? 93  TRP A NE1  2  
ATOM 3159  C CE2  . TRP A 1 93  ? 0.707   -0.860  -9.879  1.00 0.00 ? 93  TRP A CE2  2  
ATOM 3160  C CE3  . TRP A 1 93  ? 3.059   -0.595  -9.399  1.00 0.00 ? 93  TRP A CE3  2  
ATOM 3161  C CZ2  . TRP A 1 93  ? 0.657   0.367   -10.535 1.00 0.00 ? 93  TRP A CZ2  2  
ATOM 3162  C CZ3  . TRP A 1 93  ? 3.008   0.624   -10.050 1.00 0.00 ? 93  TRP A CZ3  2  
ATOM 3163  C CH2  . TRP A 1 93  ? 1.813   1.094   -10.610 1.00 0.00 ? 93  TRP A CH2  2  
ATOM 3164  H H    . TRP A 1 93  ? 0.631   -2.484  -6.012  1.00 0.00 ? 93  TRP A H    2  
ATOM 3165  H HA   . TRP A 1 93  ? 2.299   -4.862  -6.332  1.00 0.00 ? 93  TRP A HA   2  
ATOM 3166  H HB2  . TRP A 1 93  ? 3.522   -3.100  -8.070  1.00 0.00 ? 93  TRP A HB2  2  
ATOM 3167  H HB3  . TRP A 1 93  ? 2.548   -4.488  -8.530  1.00 0.00 ? 93  TRP A HB3  2  
ATOM 3168  H HD1  . TRP A 1 93  ? -0.285  -3.728  -8.650  1.00 0.00 ? 93  TRP A HD1  2  
ATOM 3169  H HE1  . TRP A 1 93  ? -1.213  -1.704  -9.944  1.00 0.00 ? 93  TRP A HE1  2  
ATOM 3170  H HE3  . TRP A 1 93  ? 3.989   -0.938  -8.972  1.00 0.00 ? 93  TRP A HE3  2  
ATOM 3171  H HZ2  . TRP A 1 93  ? -0.256  0.743   -10.972 1.00 0.00 ? 93  TRP A HZ2  2  
ATOM 3172  H HZ3  . TRP A 1 93  ? 3.897   1.227   -10.130 1.00 0.00 ? 93  TRP A HZ3  2  
ATOM 3173  H HH2  . TRP A 1 93  ? 1.821   2.051   -11.107 1.00 0.00 ? 93  TRP A HH2  2  
ATOM 3174  N N    . MET A 1 94  ? 3.853   -3.825  -4.748  1.00 0.00 ? 94  MET A N    2  
ATOM 3175  C CA   . MET A 1 94  ? 4.821   -3.258  -3.821  1.00 0.00 ? 94  MET A CA   2  
ATOM 3176  C C    . MET A 1 94  ? 6.248   -3.452  -4.323  1.00 0.00 ? 94  MET A C    2  
ATOM 3177  O O    . MET A 1 94  ? 6.557   -4.450  -4.976  1.00 0.00 ? 94  MET A O    2  
ATOM 3178  C CB   . MET A 1 94  ? 4.663   -3.901  -2.443  1.00 0.00 ? 94  MET A CB   2  
ATOM 3179  C CG   . MET A 1 94  ? 5.041   -2.981  -1.297  1.00 0.00 ? 94  MET A CG   2  
ATOM 3180  S SD   . MET A 1 94  ? 4.479   -3.595  0.303   1.00 0.00 ? 94  MET A SD   2  
ATOM 3181  C CE   . MET A 1 94  ? 4.439   -2.077  1.252   1.00 0.00 ? 94  MET A CE   2  
ATOM 3182  H H    . MET A 1 94  ? 3.673   -4.786  -4.720  1.00 0.00 ? 94  MET A H    2  
ATOM 3183  H HA   . MET A 1 94  ? 4.621   -2.201  -3.738  1.00 0.00 ? 94  MET A HA   2  
ATOM 3184  H HB2  . MET A 1 94  ? 3.632   -4.199  -2.313  1.00 0.00 ? 94  MET A HB2  2  
ATOM 3185  H HB3  . MET A 1 94  ? 5.290   -4.779  -2.394  1.00 0.00 ? 94  MET A HB3  2  
ATOM 3186  H HG2  . MET A 1 94  ? 6.115   -2.886  -1.273  1.00 0.00 ? 94  MET A HG2  2  
ATOM 3187  H HG3  . MET A 1 94  ? 4.598   -2.011  -1.471  1.00 0.00 ? 94  MET A HG3  2  
ATOM 3188  H HE1  . MET A 1 94  ? 3.879   -2.235  2.162   1.00 0.00 ? 94  MET A HE1  2  
ATOM 3189  H HE2  . MET A 1 94  ? 3.971   -1.298  0.670   1.00 0.00 ? 94  MET A HE2  2  
ATOM 3190  H HE3  . MET A 1 94  ? 5.449   -1.782  1.501   1.00 0.00 ? 94  MET A HE3  2  
ATOM 3191  N N    . LYS A 1 95  ? 7.112   -2.491  -4.009  1.00 0.00 ? 95  LYS A N    2  
ATOM 3192  C CA   . LYS A 1 95  ? 8.512   -2.552  -4.422  1.00 0.00 ? 95  LYS A CA   2  
ATOM 3193  C C    . LYS A 1 95  ? 9.417   -1.948  -3.352  1.00 0.00 ? 95  LYS A C    2  
ATOM 3194  O O    . LYS A 1 95  ? 9.302   -0.769  -3.019  1.00 0.00 ? 95  LYS A O    2  
ATOM 3195  C CB   . LYS A 1 95  ? 8.709   -1.817  -5.750  1.00 0.00 ? 95  LYS A CB   2  
ATOM 3196  C CG   . LYS A 1 95  ? 8.000   -0.473  -5.815  1.00 0.00 ? 95  LYS A CG   2  
ATOM 3197  C CD   . LYS A 1 95  ? 6.829   -0.506  -6.783  1.00 0.00 ? 95  LYS A CD   2  
ATOM 3198  C CE   . LYS A 1 95  ? 7.278   -0.238  -8.211  1.00 0.00 ? 95  LYS A CE   2  
ATOM 3199  N NZ   . LYS A 1 95  ? 7.119   1.194   -8.586  1.00 0.00 ? 95  LYS A NZ   2  
ATOM 3200  H H    . LYS A 1 95  ? 6.804   -1.725  -3.483  1.00 0.00 ? 95  LYS A H    2  
ATOM 3201  H HA   . LYS A 1 95  ? 8.774   -3.590  -4.553  1.00 0.00 ? 95  LYS A HA   2  
ATOM 3202  H HB2  . LYS A 1 95  ? 9.765   -1.650  -5.901  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 3203  H HB3  . LYS A 1 95  ? 8.333   -2.437  -6.550  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 3204  H HG2  . LYS A 1 95  ? 7.633   -0.224  -4.831  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 3205  H HG3  . LYS A 1 95  ? 8.704   0.278   -6.141  1.00 0.00 ? 95  LYS A HG3  2  
ATOM 3206  H HD2  . LYS A 1 95  ? 6.365   -1.479  -6.741  1.00 0.00 ? 95  LYS A HD2  2  
ATOM 3207  H HD3  . LYS A 1 95  ? 6.114   0.249   -6.494  1.00 0.00 ? 95  LYS A HD3  2  
ATOM 3208  H HE2  . LYS A 1 95  ? 8.319   -0.512  -8.305  1.00 0.00 ? 95  LYS A HE2  2  
ATOM 3209  H HE3  . LYS A 1 95  ? 6.686   -0.844  -8.881  1.00 0.00 ? 95  LYS A HE3  2  
ATOM 3210  H HZ1  . LYS A 1 95  ? 7.070   1.783   -7.730  1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 3211  H HZ2  . LYS A 1 95  ? 6.246   1.326   -9.134  1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 3212  H HZ3  . LYS A 1 95  ? 7.928   1.505   -9.162  1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 3213  N N    . ARG A 1 96  ? 10.313  -2.767  -2.810  1.00 0.00 ? 96  ARG A N    2  
ATOM 3214  C CA   . ARG A 1 96  ? 11.234  -2.321  -1.773  1.00 0.00 ? 96  ARG A CA   2  
ATOM 3215  C C    . ARG A 1 96  ? 12.473  -1.664  -2.378  1.00 0.00 ? 96  ARG A C    2  
ATOM 3216  O O    . ARG A 1 96  ? 13.584  -1.845  -1.883  1.00 0.00 ? 96  ARG A O    2  
ATOM 3217  C CB   . ARG A 1 96  ? 11.645  -3.500  -0.888  1.00 0.00 ? 96  ARG A CB   2  
ATOM 3218  C CG   . ARG A 1 96  ? 12.281  -4.644  -1.657  1.00 0.00 ? 96  ARG A CG   2  
ATOM 3219  C CD   . ARG A 1 96  ? 11.418  -5.895  -1.609  1.00 0.00 ? 96  ARG A CD   2  
ATOM 3220  N NE   . ARG A 1 96  ? 12.190  -7.081  -1.246  1.00 0.00 ? 96  ARG A NE   2  
ATOM 3221  C CZ   . ARG A 1 96  ? 12.939  -7.766  -2.104  1.00 0.00 ? 96  ARG A CZ   2  
ATOM 3222  N NH1  . ARG A 1 96  ? 13.014  -7.388  -3.372  1.00 0.00 ? 96  ARG A NH1  2  
ATOM 3223  N NH2  . ARG A 1 96  ? 13.611  -8.832  -1.694  1.00 0.00 ? 96  ARG A NH2  2  
ATOM 3224  H H    . ARG A 1 96  ? 10.354  -3.698  -3.113  1.00 0.00 ? 96  ARG A H    2  
ATOM 3225  H HA   . ARG A 1 96  ? 10.718  -1.592  -1.165  1.00 0.00 ? 96  ARG A HA   2  
ATOM 3226  H HB2  . ARG A 1 96  ? 12.355  -3.150  -0.152  1.00 0.00 ? 96  ARG A HB2  2  
ATOM 3227  H HB3  . ARG A 1 96  ? 10.770  -3.877  -0.379  1.00 0.00 ? 96  ARG A HB3  2  
ATOM 3228  H HG2  . ARG A 1 96  ? 12.407  -4.347  -2.686  1.00 0.00 ? 96  ARG A HG2  2  
ATOM 3229  H HG3  . ARG A 1 96  ? 13.245  -4.866  -1.223  1.00 0.00 ? 96  ARG A HG3  2  
ATOM 3230  H HD2  . ARG A 1 96  ? 10.635  -5.749  -0.879  1.00 0.00 ? 96  ARG A HD2  2  
ATOM 3231  H HD3  . ARG A 1 96  ? 10.975  -6.049  -2.582  1.00 0.00 ? 96  ARG A HD3  2  
ATOM 3232  H HE   . ARG A 1 96  ? 12.146  -7.380  -0.313  1.00 0.00 ? 96  ARG A HE   2  
ATOM 3233  H HH11 . ARG A 1 96  ? 12.507  -6.584  -3.686  1.00 0.00 ? 96  ARG A HH11 2  
ATOM 3234  H HH12 . ARG A 1 96  ? 13.581  -7.903  -4.015  1.00 0.00 ? 96  ARG A HH12 2  
ATOM 3235  H HH21 . ARG A 1 96  ? 13.556  -9.122  -0.739  1.00 0.00 ? 96  ARG A HH21 2  
ATOM 3236  H HH22 . ARG A 1 96  ? 14.175  -9.346  -2.340  1.00 0.00 ? 96  ARG A HH22 2  
ATOM 3237  N N    . MET A 1 97  ? 12.275  -0.887  -3.439  1.00 0.00 ? 97  MET A N    2  
ATOM 3238  C CA   . MET A 1 97  ? 13.379  -0.195  -4.092  1.00 0.00 ? 97  MET A CA   2  
ATOM 3239  C C    . MET A 1 97  ? 13.826  0.987   -3.241  1.00 0.00 ? 97  MET A C    2  
ATOM 3240  O O    . MET A 1 97  ? 13.287  1.209   -2.159  1.00 0.00 ? 97  MET A O    2  
ATOM 3241  C CB   . MET A 1 97  ? 12.963  0.280   -5.488  1.00 0.00 ? 97  MET A CB   2  
ATOM 3242  C CG   . MET A 1 97  ? 12.098  1.530   -5.478  1.00 0.00 ? 97  MET A CG   2  
ATOM 3243  S SD   . MET A 1 97  ? 11.865  2.228   -7.124  1.00 0.00 ? 97  MET A SD   2  
ATOM 3244  C CE   . MET A 1 97  ? 10.587  1.152   -7.772  1.00 0.00 ? 97  MET A CE   2  
ATOM 3245  H H    . MET A 1 97  ? 11.365  -0.769  -3.783  1.00 0.00 ? 97  MET A H    2  
ATOM 3246  H HA   . MET A 1 97  ? 14.200  -0.890  -4.185  1.00 0.00 ? 97  MET A HA   2  
ATOM 3247  H HB2  . MET A 1 97  ? 13.854  0.491   -6.063  1.00 0.00 ? 97  MET A HB2  2  
ATOM 3248  H HB3  . MET A 1 97  ? 12.411  -0.509  -5.974  1.00 0.00 ? 97  MET A HB3  2  
ATOM 3249  H HG2  . MET A 1 97  ? 11.131  1.278   -5.071  1.00 0.00 ? 97  MET A HG2  2  
ATOM 3250  H HG3  . MET A 1 97  ? 12.569  2.272   -4.851  1.00 0.00 ? 97  MET A HG3  2  
ATOM 3251  H HE1  . MET A 1 97  ? 10.095  0.646   -6.954  1.00 0.00 ? 97  MET A HE1  2  
ATOM 3252  H HE2  . MET A 1 97  ? 11.031  0.424   -8.434  1.00 0.00 ? 97  MET A HE2  2  
ATOM 3253  H HE3  . MET A 1 97  ? 9.865   1.740   -8.318  1.00 0.00 ? 97  MET A HE3  2  
ATOM 3254  N N    . ARG A 1 98  ? 14.804  1.748   -3.722  1.00 0.00 ? 98  ARG A N    2  
ATOM 3255  C CA   . ARG A 1 98  ? 15.300  2.899   -2.978  1.00 0.00 ? 98  ARG A CA   2  
ATOM 3256  C C    . ARG A 1 98  ? 14.769  4.203   -3.565  1.00 0.00 ? 98  ARG A C    2  
ATOM 3257  O O    . ARG A 1 98  ? 14.701  4.367   -4.783  1.00 0.00 ? 98  ARG A O    2  
ATOM 3258  C CB   . ARG A 1 98  ? 16.829  2.912   -2.974  1.00 0.00 ? 98  ARG A CB   2  
ATOM 3259  C CG   . ARG A 1 98  ? 17.432  2.151   -1.807  1.00 0.00 ? 98  ARG A CG   2  
ATOM 3260  C CD   . ARG A 1 98  ? 18.301  3.049   -0.943  1.00 0.00 ? 98  ARG A CD   2  
ATOM 3261  N NE   . ARG A 1 98  ? 19.665  3.149   -1.453  1.00 0.00 ? 98  ARG A NE   2  
ATOM 3262  C CZ   . ARG A 1 98  ? 20.081  4.116   -2.266  1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3263  N NH1  . ARG A 1 98  ? 19.239  5.064   -2.658  1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3264  N NH2  . ARG A 1 98  ? 21.338  4.138   -2.686  1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3265  H H    . ARG A 1 98  ? 15.205  1.535   -4.591  1.00 0.00 ? 98  ARG A H    2  
ATOM 3266  H HA   . ARG A 1 98  ? 14.949  2.811   -1.961  1.00 0.00 ? 98  ARG A HA   2  
ATOM 3267  H HB2  . ARG A 1 98  ? 17.185  2.467   -3.890  1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3268  H HB3  . ARG A 1 98  ? 17.168  3.935   -2.923  1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3269  H HG2  . ARG A 1 98  ? 16.634  1.751   -1.201  1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3270  H HG3  . ARG A 1 98  ? 18.036  1.342   -2.191  1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3271  H HD2  . ARG A 1 98  ? 17.863  4.036   -0.918  1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3272  H HD3  . ARG A 1 98  ? 18.330  2.645   0.058   1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3273  H HE   . ARG A 1 98  ? 20.305  2.461   -1.179  1.00 0.00 ? 98  ARG A HE   2  
ATOM 3274  H HH11 . ARG A 1 98  ? 18.291  5.053   -2.344  1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3275  H HH12 . ARG A 1 98  ? 19.556  5.792   -3.267  1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3276  H HH21 . ARG A 1 98  ? 21.977  3.427   -2.393  1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3277  H HH22 . ARG A 1 98  ? 21.649  4.866   -3.298  1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3278  N N    . GLN A 1 99  ? 14.396  5.126   -2.686  1.00 0.00 ? 99  GLN A N    2  
ATOM 3279  C CA   . GLN A 1 99  ? 13.871  6.419   -3.109  1.00 0.00 ? 99  GLN A CA   2  
ATOM 3280  C C    . GLN A 1 99  ? 14.796  7.551   -2.670  1.00 0.00 ? 99  GLN A C    2  
ATOM 3281  O O    . GLN A 1 99  ? 14.796  8.631   -3.260  1.00 0.00 ? 99  GLN A O    2  
ATOM 3282  C CB   . GLN A 1 99  ? 12.470  6.640   -2.534  1.00 0.00 ? 99  GLN A CB   2  
ATOM 3283  C CG   . GLN A 1 99  ? 11.463  5.582   -2.963  1.00 0.00 ? 99  GLN A CG   2  
ATOM 3284  C CD   . GLN A 1 99  ? 10.293  6.167   -3.728  1.00 0.00 ? 99  GLN A CD   2  
ATOM 3285  O OE1  . GLN A 1 99  ? 10.424  6.546   -4.892  1.00 0.00 ? 99  GLN A OE1  2  
ATOM 3286  N NE2  . GLN A 1 99  ? 9.138   6.242   -3.077  1.00 0.00 ? 99  GLN A NE2  2  
ATOM 3287  H H    . GLN A 1 99  ? 14.477  4.933   -1.728  1.00 0.00 ? 99  GLN A H    2  
ATOM 3288  H HA   . GLN A 1 99  ? 13.813  6.417   -4.188  1.00 0.00 ? 99  GLN A HA   2  
ATOM 3289  H HB2  . GLN A 1 99  ? 12.529  6.634   -1.457  1.00 0.00 ? 99  GLN A HB2  2  
ATOM 3290  H HB3  . GLN A 1 99  ? 12.106  7.602   -2.862  1.00 0.00 ? 99  GLN A HB3  2  
ATOM 3291  H HG2  . GLN A 1 99  ? 11.962  4.862   -3.592  1.00 0.00 ? 99  GLN A HG2  2  
ATOM 3292  H HG3  . GLN A 1 99  ? 11.087  5.086   -2.080  1.00 0.00 ? 99  GLN A HG3  2  
ATOM 3293  H HE21 . GLN A 1 99  ? 9.107   5.921   -2.151  1.00 0.00 ? 99  GLN A HE21 2  
ATOM 3294  H HE22 . GLN A 1 99  ? 8.363   6.614   -3.548  1.00 0.00 ? 99  GLN A HE22 2  
ATOM 3295  N N    . GLU A 1 100 ? 15.585  7.293   -1.629  1.00 0.00 ? 100 GLU A N    2  
ATOM 3296  C CA   . GLU A 1 100 ? 16.516  8.288   -1.111  1.00 0.00 ? 100 GLU A CA   2  
ATOM 3297  C C    . GLU A 1 100 ? 17.809  7.630   -0.640  1.00 0.00 ? 100 GLU A C    2  
ATOM 3298  O O    . GLU A 1 100 ? 18.802  7.602   -1.367  1.00 0.00 ? 100 GLU A O    2  
ATOM 3299  C CB   . GLU A 1 100 ? 15.873  9.068   0.038   1.00 0.00 ? 100 GLU A CB   2  
ATOM 3300  C CG   . GLU A 1 100 ? 15.781  10.563  -0.219  1.00 0.00 ? 100 GLU A CG   2  
ATOM 3301  C CD   . GLU A 1 100 ? 14.369  11.016  -0.530  1.00 0.00 ? 100 GLU A CD   2  
ATOM 3302  O OE1  . GLU A 1 100 ? 13.448  10.645  0.227   1.00 0.00 ? 100 GLU A OE1  2  
ATOM 3303  O OE2  . GLU A 1 100 ? 14.183  11.742  -1.530  1.00 0.00 ? 100 GLU A OE2  2  
ATOM 3304  H H    . GLU A 1 100 ? 15.539  6.413   -1.203  1.00 0.00 ? 100 GLU A H    2  
ATOM 3305  H HA   . GLU A 1 100 ? 16.749  8.973   -1.912  1.00 0.00 ? 100 GLU A HA   2  
ATOM 3306  H HB2  . GLU A 1 100 ? 14.875  8.691   0.198   1.00 0.00 ? 100 GLU A HB2  2  
ATOM 3307  H HB3  . GLU A 1 100 ? 16.456  8.914   0.933   1.00 0.00 ? 100 GLU A HB3  2  
ATOM 3308  H HG2  . GLU A 1 100 ? 16.127  11.089  0.658   1.00 0.00 ? 100 GLU A HG2  2  
ATOM 3309  H HG3  . GLU A 1 100 ? 16.415  10.811  -1.059  1.00 0.00 ? 100 GLU A HG3  2  
ATOM 3310  N N    . ARG A 1 101 ? 17.792  7.101   0.580   1.00 0.00 ? 101 ARG A N    2  
ATOM 3311  C CA   . ARG A 1 101 ? 18.965  6.442   1.146   1.00 0.00 ? 101 ARG A CA   2  
ATOM 3312  C C    . ARG A 1 101 ? 18.585  5.104   1.770   1.00 0.00 ? 101 ARG A C    2  
ATOM 3313  O O    . ARG A 1 101 ? 19.443  4.367   2.255   1.00 0.00 ? 101 ARG A O    2  
ATOM 3314  C CB   . ARG A 1 101 ? 19.625  7.338   2.196   1.00 0.00 ? 101 ARG A CB   2  
ATOM 3315  C CG   . ARG A 1 101 ? 18.646  7.922   3.204   1.00 0.00 ? 101 ARG A CG   2  
ATOM 3316  C CD   . ARG A 1 101 ? 19.002  7.518   4.625   1.00 0.00 ? 101 ARG A CD   2  
ATOM 3317  N NE   . ARG A 1 101 ? 20.437  7.597   4.876   1.00 0.00 ? 101 ARG A NE   2  
ATOM 3318  C CZ   . ARG A 1 101 ? 21.058  8.704   5.277   1.00 0.00 ? 101 ARG A CZ   2  
ATOM 3319  N NH1  . ARG A 1 101 ? 20.369  9.820   5.477   1.00 0.00 ? 101 ARG A NH1  2  
ATOM 3320  N NH2  . ARG A 1 101 ? 22.368  8.694   5.479   1.00 0.00 ? 101 ARG A NH2  2  
ATOM 3321  H H    . ARG A 1 101 ? 16.971  7.155   1.113   1.00 0.00 ? 101 ARG A H    2  
ATOM 3322  H HA   . ARG A 1 101 ? 19.665  6.266   0.344   1.00 0.00 ? 101 ARG A HA   2  
ATOM 3323  H HB2  . ARG A 1 101 ? 20.360  6.759   2.735   1.00 0.00 ? 101 ARG A HB2  2  
ATOM 3324  H HB3  . ARG A 1 101 ? 20.123  8.155   1.693   1.00 0.00 ? 101 ARG A HB3  2  
ATOM 3325  H HG2  . ARG A 1 101 ? 18.670  8.998   3.130   1.00 0.00 ? 101 ARG A HG2  2  
ATOM 3326  H HG3  . ARG A 1 101 ? 17.653  7.565   2.973   1.00 0.00 ? 101 ARG A HG3  2  
ATOM 3327  H HD2  . ARG A 1 101 ? 18.490  8.176   5.312   1.00 0.00 ? 101 ARG A HD2  2  
ATOM 3328  H HD3  . ARG A 1 101 ? 18.671  6.503   4.790   1.00 0.00 ? 101 ARG A HD3  2  
ATOM 3329  H HE   . ARG A 1 101 ? 20.968  6.785   4.736   1.00 0.00 ? 101 ARG A HE   2  
ATOM 3330  H HH11 . ARG A 1 101 ? 19.380  9.831   5.327   1.00 0.00 ? 101 ARG A HH11 2  
ATOM 3331  H HH12 . ARG A 1 101 ? 20.838  10.649  5.780   1.00 0.00 ? 101 ARG A HH12 2  
ATOM 3332  H HH21 . ARG A 1 101 ? 22.889  7.855   5.330   1.00 0.00 ? 101 ARG A HH21 2  
ATOM 3333  H HH22 . ARG A 1 101 ? 22.833  9.525   5.780   1.00 0.00 ? 101 ARG A HH22 2  
ATOM 3334  N N    . ARG A 1 102 ? 17.293  4.798   1.749   1.00 0.00 ? 102 ARG A N    2  
ATOM 3335  C CA   . ARG A 1 102 ? 16.788  3.549   2.307   1.00 0.00 ? 102 ARG A CA   2  
ATOM 3336  C C    . ARG A 1 102 ? 15.756  2.924   1.373   1.00 0.00 ? 102 ARG A C    2  
ATOM 3337  O O    . ARG A 1 102 ? 15.004  3.635   0.705   1.00 0.00 ? 102 ARG A O    2  
ATOM 3338  C CB   . ARG A 1 102 ? 16.177  3.803   3.694   1.00 0.00 ? 102 ARG A CB   2  
ATOM 3339  C CG   . ARG A 1 102 ? 14.900  3.018   3.976   1.00 0.00 ? 102 ARG A CG   2  
ATOM 3340  C CD   . ARG A 1 102 ? 14.052  3.689   5.046   1.00 0.00 ? 102 ARG A CD   2  
ATOM 3341  N NE   . ARG A 1 102 ? 14.864  4.242   6.126   1.00 0.00 ? 102 ARG A NE   2  
ATOM 3342  C CZ   . ARG A 1 102 ? 15.483  3.499   7.038   1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3343  N NH1  . ARG A 1 102 ? 15.392  2.177   6.994   1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3344  N NH2  . ARG A 1 102 ? 16.197  4.078   7.994   1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3345  H H    . ARG A 1 102 ? 16.659  5.429   1.344   1.00 0.00 ? 102 ARG A H    2  
ATOM 3346  H HA   . ARG A 1 102 ? 17.622  2.871   2.409   1.00 0.00 ? 102 ARG A HA   2  
ATOM 3347  H HB2  . ARG A 1 102 ? 16.904  3.538   4.446   1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3348  H HB3  . ARG A 1 102 ? 15.952  4.855   3.786   1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3349  H HG2  . ARG A 1 102 ? 14.323  2.951   3.066   1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3350  H HG3  . ARG A 1 102 ? 15.166  2.024   4.310   1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3351  H HD2  . ARG A 1 102 ? 13.485  4.488   4.589   1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3352  H HD3  . ARG A 1 102 ? 13.373  2.957   5.457   1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3353  H HE   . ARG A 1 102 ? 14.949  5.217   6.177   1.00 0.00 ? 102 ARG A HE   2  
ATOM 3354  H HH11 . ARG A 1 102 ? 14.856  1.735   6.274   1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3355  H HH12 . ARG A 1 102 ? 15.861  1.620   7.681   1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3356  H HH21 . ARG A 1 102 ? 16.269  5.074   8.030   1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3357  H HH22 . ARG A 1 102 ? 16.662  3.517   8.680   1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3358  N N    . LEU A 1 103 ? 15.720  1.595   1.331   1.00 0.00 ? 103 LEU A N    2  
ATOM 3359  C CA   . LEU A 1 103 ? 14.767  0.894   0.475   1.00 0.00 ? 103 LEU A CA   2  
ATOM 3360  C C    . LEU A 1 103 ? 13.343  1.187   0.926   1.00 0.00 ? 103 LEU A C    2  
ATOM 3361  O O    . LEU A 1 103 ? 12.863  0.625   1.911   1.00 0.00 ? 103 LEU A O    2  
ATOM 3362  C CB   . LEU A 1 103 ? 15.007  -0.621  0.488   1.00 0.00 ? 103 LEU A CB   2  
ATOM 3363  C CG   . LEU A 1 103 ? 16.279  -1.083  1.201   1.00 0.00 ? 103 LEU A CG   2  
ATOM 3364  C CD1  . LEU A 1 103 ? 16.010  -2.355  1.993   1.00 0.00 ? 103 LEU A CD1  2  
ATOM 3365  C CD2  . LEU A 1 103 ? 17.396  -1.304  0.194   1.00 0.00 ? 103 LEU A CD2  2  
ATOM 3366  H H    . LEU A 1 103 ? 16.338  1.080   1.887   1.00 0.00 ? 103 LEU A H    2  
ATOM 3367  H HA   . LEU A 1 103 ? 14.897  1.262   -0.532  1.00 0.00 ? 103 LEU A HA   2  
ATOM 3368  H HB2  . LEU A 1 103 ? 14.161  -1.094  0.963   1.00 0.00 ? 103 LEU A HB2  2  
ATOM 3369  H HB3  . LEU A 1 103 ? 15.056  -0.960  -0.536  1.00 0.00 ? 103 LEU A HB3  2  
ATOM 3370  H HG   . LEU A 1 103 ? 16.597  -0.319  1.894   1.00 0.00 ? 103 LEU A HG   2  
ATOM 3371  H HD11 . LEU A 1 103 ? 16.414  -3.202  1.459   1.00 0.00 ? 103 LEU A HD11 2  
ATOM 3372  H HD12 . LEU A 1 103 ? 14.945  -2.482  2.116   1.00 0.00 ? 103 LEU A HD12 2  
ATOM 3373  H HD13 . LEU A 1 103 ? 16.480  -2.280  2.962   1.00 0.00 ? 103 LEU A HD13 2  
ATOM 3374  H HD21 . LEU A 1 103 ? 17.626  -0.370  -0.298  1.00 0.00 ? 103 LEU A HD21 2  
ATOM 3375  H HD22 . LEU A 1 103 ? 17.077  -2.029  -0.543  1.00 0.00 ? 103 LEU A HD22 2  
ATOM 3376  H HD23 . LEU A 1 103 ? 18.275  -1.670  0.703   1.00 0.00 ? 103 LEU A HD23 2  
ATOM 3377  N N    . CYS A 1 104 ? 12.669  2.074   0.201   1.00 0.00 ? 104 CYS A N    2  
ATOM 3378  C CA   . CYS A 1 104 ? 11.302  2.442   0.529   1.00 0.00 ? 104 CYS A CA   2  
ATOM 3379  C C    . CYS A 1 104 ? 10.305  1.599   -0.259  1.00 0.00 ? 104 CYS A C    2  
ATOM 3380  O O    . CYS A 1 104 ? 10.382  1.510   -1.484  1.00 0.00 ? 104 CYS A O    2  
ATOM 3381  C CB   . CYS A 1 104 ? 11.069  3.926   0.243   1.00 0.00 ? 104 CYS A CB   2  
ATOM 3382  S SG   . CYS A 1 104 ? 12.276  5.027   1.018   1.00 0.00 ? 104 CYS A SG   2  
ATOM 3383  H H    . CYS A 1 104 ? 13.102  2.489   -0.574  1.00 0.00 ? 104 CYS A H    2  
ATOM 3384  H HA   . CYS A 1 104 ? 11.154  2.261   1.583   1.00 0.00 ? 104 CYS A HA   2  
ATOM 3385  H HB2  . CYS A 1 104 ? 11.113  4.090   -0.823  1.00 0.00 ? 104 CYS A HB2  2  
ATOM 3386  H HB3  . CYS A 1 104 ? 10.089  4.204   0.604   1.00 0.00 ? 104 CYS A HB3  2  
ATOM 3387  H HG   . CYS A 1 104 ? 13.179  4.277   1.632   1.00 0.00 ? 104 CYS A HG   2  
ATOM 3388  N N    . CYS A 1 105 ? 9.368   0.990   0.458   1.00 0.00 ? 105 CYS A N    2  
ATOM 3389  C CA   . CYS A 1 105 ? 8.346   0.162   -0.165  1.00 0.00 ? 105 CYS A CA   2  
ATOM 3390  C C    . CYS A 1 105 ? 7.239   1.036   -0.743  1.00 0.00 ? 105 CYS A C    2  
ATOM 3391  O O    . CYS A 1 105 ? 6.594   1.797   -0.022  1.00 0.00 ? 105 CYS A O    2  
ATOM 3392  C CB   . CYS A 1 105 ? 7.767   -0.812  0.863   1.00 0.00 ? 105 CYS A CB   2  
ATOM 3393  S SG   . CYS A 1 105 ? 7.909   -2.553  0.394   1.00 0.00 ? 105 CYS A SG   2  
ATOM 3394  H H    . CYS A 1 105 ? 9.360   1.107   1.430   1.00 0.00 ? 105 CYS A H    2  
ATOM 3395  H HA   . CYS A 1 105 ? 8.809   -0.400  -0.963  1.00 0.00 ? 105 CYS A HA   2  
ATOM 3396  H HB2  . CYS A 1 105 ? 8.290   -0.683  1.798   1.00 0.00 ? 105 CYS A HB2  2  
ATOM 3397  H HB3  . CYS A 1 105 ? 6.719   -0.592  1.009   1.00 0.00 ? 105 CYS A HB3  2  
ATOM 3398  H HG   . CYS A 1 105 ? 7.097   -3.253  1.172   1.00 0.00 ? 105 CYS A HG   2  
ATOM 3399  N N    . VAL A 1 106 ? 7.024   0.924   -2.049  1.00 0.00 ? 106 VAL A N    2  
ATOM 3400  C CA   . VAL A 1 106 ? 5.999   1.703   -2.729  1.00 0.00 ? 106 VAL A CA   2  
ATOM 3401  C C    . VAL A 1 106 ? 4.842   0.817   -3.173  1.00 0.00 ? 106 VAL A C    2  
ATOM 3402  O O    . VAL A 1 106 ? 5.053   -0.247  -3.754  1.00 0.00 ? 106 VAL A O    2  
ATOM 3403  C CB   . VAL A 1 106 ? 6.576   2.435   -3.958  1.00 0.00 ? 106 VAL A CB   2  
ATOM 3404  C CG1  . VAL A 1 106 ? 5.483   3.183   -4.706  1.00 0.00 ? 106 VAL A CG1  2  
ATOM 3405  C CG2  . VAL A 1 106 ? 7.689   3.384   -3.539  1.00 0.00 ? 106 VAL A CG2  2  
ATOM 3406  H H    . VAL A 1 106 ? 7.569   0.297   -2.567  1.00 0.00 ? 106 VAL A H    2  
ATOM 3407  H HA   . VAL A 1 106 ? 5.627   2.445   -2.036  1.00 0.00 ? 106 VAL A HA   2  
ATOM 3408  H HB   . VAL A 1 106 ? 6.996   1.697   -4.625  1.00 0.00 ? 106 VAL A HB   2  
ATOM 3409  H HG11 . VAL A 1 106 ? 4.561   3.130   -4.145  1.00 0.00 ? 106 VAL A HG11 2  
ATOM 3410  H HG12 . VAL A 1 106 ? 5.339   2.732   -5.677  1.00 0.00 ? 106 VAL A HG12 2  
ATOM 3411  H HG13 . VAL A 1 106 ? 5.773   4.216   -4.829  1.00 0.00 ? 106 VAL A HG13 2  
ATOM 3412  H HG21 . VAL A 1 106 ? 8.599   2.825   -3.385  1.00 0.00 ? 106 VAL A HG21 2  
ATOM 3413  H HG22 . VAL A 1 106 ? 7.412   3.882   -2.622  1.00 0.00 ? 106 VAL A HG22 2  
ATOM 3414  H HG23 . VAL A 1 106 ? 7.844   4.120   -4.315  1.00 0.00 ? 106 VAL A HG23 2  
ATOM 3415  N N    . VAL A 1 107 ? 3.620   1.260   -2.900  1.00 0.00 ? 107 VAL A N    2  
ATOM 3416  C CA   . VAL A 1 107 ? 2.429   0.505   -3.272  1.00 0.00 ? 107 VAL A CA   2  
ATOM 3417  C C    . VAL A 1 107 ? 1.486   1.363   -4.111  1.00 0.00 ? 107 VAL A C    2  
ATOM 3418  O O    . VAL A 1 107 ? 1.256   2.532   -3.800  1.00 0.00 ? 107 VAL A O    2  
ATOM 3419  C CB   . VAL A 1 107 ? 1.693   -0.026  -2.017  1.00 0.00 ? 107 VAL A CB   2  
ATOM 3420  C CG1  . VAL A 1 107 ? 0.190   0.218   -2.096  1.00 0.00 ? 107 VAL A CG1  2  
ATOM 3421  C CG2  . VAL A 1 107 ? 1.984   -1.505  -1.822  1.00 0.00 ? 107 VAL A CG2  2  
ATOM 3422  H H    . VAL A 1 107 ? 3.509   2.118   -2.438  1.00 0.00 ? 107 VAL A H    2  
ATOM 3423  H HA   . VAL A 1 107 ? 2.747   -0.342  -3.863  1.00 0.00 ? 107 VAL A HA   2  
ATOM 3424  H HB   . VAL A 1 107 ? 2.071   0.505   -1.155  1.00 0.00 ? 107 VAL A HB   2  
ATOM 3425  H HG11 . VAL A 1 107 ? -0.289  -0.198  -1.222  1.00 0.00 ? 107 VAL A HG11 2  
ATOM 3426  H HG12 . VAL A 1 107 ? -0.206  -0.257  -2.982  1.00 0.00 ? 107 VAL A HG12 2  
ATOM 3427  H HG13 . VAL A 1 107 ? -0.002  1.280   -2.140  1.00 0.00 ? 107 VAL A HG13 2  
ATOM 3428  H HG21 . VAL A 1 107 ? 1.701   -1.798  -0.822  1.00 0.00 ? 107 VAL A HG21 2  
ATOM 3429  H HG22 . VAL A 1 107 ? 3.039   -1.684  -1.965  1.00 0.00 ? 107 VAL A HG22 2  
ATOM 3430  H HG23 . VAL A 1 107 ? 1.420   -2.081  -2.540  1.00 0.00 ? 107 VAL A HG23 2  
ATOM 3431  N N    . VAL A 1 108 ? 0.941   0.778   -5.172  1.00 0.00 ? 108 VAL A N    2  
ATOM 3432  C CA   . VAL A 1 108 ? 0.024   1.495   -6.046  1.00 0.00 ? 108 VAL A CA   2  
ATOM 3433  C C    . VAL A 1 108 ? -1.291  0.744   -6.208  1.00 0.00 ? 108 VAL A C    2  
ATOM 3434  O O    . VAL A 1 108 ? -1.334  -0.333  -6.805  1.00 0.00 ? 108 VAL A O    2  
ATOM 3435  C CB   . VAL A 1 108 ? 0.635   1.747   -7.435  1.00 0.00 ? 108 VAL A CB   2  
ATOM 3436  C CG1  . VAL A 1 108 ? -0.194  2.761   -8.208  1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3437  C CG2  . VAL A 1 108 ? 2.079   2.213   -7.312  1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3438  H H    . VAL A 1 108 ? 1.161   -0.157  -5.369  1.00 0.00 ? 108 VAL A H    2  
ATOM 3439  H HA   . VAL A 1 108 ? -0.179  2.453   -5.593  1.00 0.00 ? 108 VAL A HA   2  
ATOM 3440  H HB   . VAL A 1 108 ? 0.627   0.815   -7.984  1.00 0.00 ? 108 VAL A HB   2  
ATOM 3441  H HG11 . VAL A 1 108 ? 0.159   2.816   -9.226  1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3442  H HG12 . VAL A 1 108 ? -0.102  3.730   -7.742  1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3443  H HG13 . VAL A 1 108 ? -1.230  2.455   -8.204  1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3444  H HG21 . VAL A 1 108 ? 2.730   1.501   -7.801  1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3445  H HG22 . VAL A 1 108 ? 2.346   2.288   -6.269  1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3446  H HG23 . VAL A 1 108 ? 2.185   3.178   -7.783  1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3447  N N    . LEU A 1 109 ? -2.363  1.318   -5.669  1.00 0.00 ? 109 LEU A N    2  
ATOM 3448  C CA   . LEU A 1 109 ? -3.683  0.709   -5.744  1.00 0.00 ? 109 LEU A CA   2  
ATOM 3449  C C    . LEU A 1 109 ? -4.448  1.216   -6.958  1.00 0.00 ? 109 LEU A C    2  
ATOM 3450  O O    . LEU A 1 109 ? -4.698  2.414   -7.094  1.00 0.00 ? 109 LEU A O    2  
ATOM 3451  C CB   . LEU A 1 109 ? -4.456  1.015   -4.470  1.00 0.00 ? 109 LEU A CB   2  
ATOM 3452  C CG   . LEU A 1 109 ? -3.580  1.148   -3.225  1.00 0.00 ? 109 LEU A CG   2  
ATOM 3453  C CD1  . LEU A 1 109 ? -4.224  2.074   -2.209  1.00 0.00 ? 109 LEU A CD1  2  
ATOM 3454  C CD2  . LEU A 1 109 ? -3.316  -0.223  -2.628  1.00 0.00 ? 109 LEU A CD2  2  
ATOM 3455  H H    . LEU A 1 109 ? -2.264  2.174   -5.201  1.00 0.00 ? 109 LEU A H    2  
ATOM 3456  H HA   . LEU A 1 109 ? -3.553  -0.360  -5.829  1.00 0.00 ? 109 LEU A HA   2  
ATOM 3457  H HB2  . LEU A 1 109 ? -4.996  1.939   -4.612  1.00 0.00 ? 109 LEU A HB2  2  
ATOM 3458  H HB3  . LEU A 1 109 ? -5.167  0.221   -4.301  1.00 0.00 ? 109 LEU A HB3  2  
ATOM 3459  H HG   . LEU A 1 109 ? -2.631  1.576   -3.510  1.00 0.00 ? 109 LEU A HG   2  
ATOM 3460  H HD11 . LEU A 1 109 ? -3.619  2.102   -1.315  1.00 0.00 ? 109 LEU A HD11 2  
ATOM 3461  H HD12 . LEU A 1 109 ? -5.211  1.708   -1.963  1.00 0.00 ? 109 LEU A HD12 2  
ATOM 3462  H HD13 . LEU A 1 109 ? -4.299  3.067   -2.625  1.00 0.00 ? 109 LEU A HD13 2  
ATOM 3463  H HD21 . LEU A 1 109 ? -2.431  -0.184  -2.011  1.00 0.00 ? 109 LEU A HD21 2  
ATOM 3464  H HD22 . LEU A 1 109 ? -3.169  -0.939  -3.425  1.00 0.00 ? 109 LEU A HD22 2  
ATOM 3465  H HD23 . LEU A 1 109 ? -4.161  -0.523  -2.027  1.00 0.00 ? 109 LEU A HD23 2  
ATOM 3466  N N    . GLU A 1 110 ? -4.820  0.297   -7.838  1.00 0.00 ? 110 GLU A N    2  
ATOM 3467  C CA   . GLU A 1 110 ? -5.561  0.647   -9.042  1.00 0.00 ? 110 GLU A CA   2  
ATOM 3468  C C    . GLU A 1 110 ? -6.851  -0.159  -9.137  1.00 0.00 ? 110 GLU A C    2  
ATOM 3469  O O    . GLU A 1 110 ? -6.819  -1.388  -9.192  1.00 0.00 ? 110 GLU A O    2  
ATOM 3470  C CB   . GLU A 1 110 ? -4.701  0.408   -10.285 1.00 0.00 ? 110 GLU A CB   2  
ATOM 3471  C CG   . GLU A 1 110 ? -4.863  1.477   -11.352 1.00 0.00 ? 110 GLU A CG   2  
ATOM 3472  C CD   . GLU A 1 110 ? -3.677  1.547   -12.294 1.00 0.00 ? 110 GLU A CD   2  
ATOM 3473  O OE1  . GLU A 1 110 ? -2.965  0.530   -12.430 1.00 0.00 ? 110 GLU A OE1  2  
ATOM 3474  O OE2  . GLU A 1 110 ? -3.462  2.618   -12.899 1.00 0.00 ? 110 GLU A OE2  2  
ATOM 3475  H H    . GLU A 1 110 ? -4.593  -0.642  -7.674  1.00 0.00 ? 110 GLU A H    2  
ATOM 3476  H HA   . GLU A 1 110 ? -5.811  1.696   -8.983  1.00 0.00 ? 110 GLU A HA   2  
ATOM 3477  H HB2  . GLU A 1 110 ? -3.662  0.378   -9.989  1.00 0.00 ? 110 GLU A HB2  2  
ATOM 3478  H HB3  . GLU A 1 110 ? -4.970  -0.545  -10.716 1.00 0.00 ? 110 GLU A HB3  2  
ATOM 3479  H HG2  . GLU A 1 110 ? -5.749  1.261   -11.930 1.00 0.00 ? 110 GLU A HG2  2  
ATOM 3480  H HG3  . GLU A 1 110 ? -4.976  2.437   -10.868 1.00 0.00 ? 110 GLU A HG3  2  
ATOM 3481  N N    . PRO A 1 111 ? -8.009  0.524   -9.156  1.00 0.00 ? 111 PRO A N    2  
ATOM 3482  C CA   . PRO A 1 111 ? -9.310  -0.140  -9.242  1.00 0.00 ? 111 PRO A CA   2  
ATOM 3483  C C    . PRO A 1 111 ? -9.384  -1.090  -10.433 1.00 0.00 ? 111 PRO A C    2  
ATOM 3484  O O    . PRO A 1 111 ? -8.977  -0.741  -11.542 1.00 0.00 ? 111 PRO A O    2  
ATOM 3485  C CB   . PRO A 1 111 ? -10.313 1.010   -9.403  1.00 0.00 ? 111 PRO A CB   2  
ATOM 3486  C CG   . PRO A 1 111 ? -9.500  2.233   -9.680  1.00 0.00 ? 111 PRO A CG   2  
ATOM 3487  C CD   . PRO A 1 111 ? -8.139  1.985   -9.095  1.00 0.00 ? 111 PRO A CD   2  
ATOM 3488  H HA   . PRO A 1 111 ? -9.529  -0.686  -8.336  1.00 0.00 ? 111 PRO A HA   2  
ATOM 3489  H HB2  . PRO A 1 111 ? -10.981 0.793   -10.223 1.00 0.00 ? 111 PRO A HB2  2  
ATOM 3490  H HB3  . PRO A 1 111 ? -10.884 1.120   -8.493  1.00 0.00 ? 111 PRO A HB3  2  
ATOM 3491  H HG2  . PRO A 1 111 ? -9.423  2.388   -10.746 1.00 0.00 ? 111 PRO A HG2  2  
ATOM 3492  H HG3  . PRO A 1 111 ? -9.957  3.091   -9.208  1.00 0.00 ? 111 PRO A HG3  2  
ATOM 3493  H HD2  . PRO A 1 111 ? -7.379  2.466   -9.693  1.00 0.00 ? 111 PRO A HD2  2  
ATOM 3494  H HD3  . PRO A 1 111 ? -8.094  2.334   -8.074  1.00 0.00 ? 111 PRO A HD3  2  
ATOM 3495  N N    . VAL A 1 112 ? -9.893  -2.294  -10.195 1.00 0.00 ? 112 VAL A N    2  
ATOM 3496  C CA   . VAL A 1 112 ? -10.004 -3.296  -11.251 1.00 0.00 ? 112 VAL A CA   2  
ATOM 3497  C C    . VAL A 1 112 ? -11.022 -2.880  -12.307 1.00 0.00 ? 112 VAL A C    2  
ATOM 3498  O O    . VAL A 1 112 ? -11.954 -2.128  -12.026 1.00 0.00 ? 112 VAL A O    2  
ATOM 3499  C CB   . VAL A 1 112 ? -10.407 -4.671  -10.682 1.00 0.00 ? 112 VAL A CB   2  
ATOM 3500  C CG1  . VAL A 1 112 ? -9.343  -5.189  -9.728  1.00 0.00 ? 112 VAL A CG1  2  
ATOM 3501  C CG2  . VAL A 1 112 ? -11.760 -4.592  -9.992  1.00 0.00 ? 112 VAL A CG2  2  
ATOM 3502  H H    . VAL A 1 112 ? -10.192 -2.517  -9.289  1.00 0.00 ? 112 VAL A H    2  
ATOM 3503  H HA   . VAL A 1 112 ? -9.036  -3.394  -11.718 1.00 0.00 ? 112 VAL A HA   2  
ATOM 3504  H HB   . VAL A 1 112 ? -10.489 -5.366  -11.506 1.00 0.00 ? 112 VAL A HB   2  
ATOM 3505  H HG11 . VAL A 1 112 ? -9.613  -6.181  -9.394  1.00 0.00 ? 112 VAL A HG11 2  
ATOM 3506  H HG12 . VAL A 1 112 ? -9.271  -4.530  -8.876  1.00 0.00 ? 112 VAL A HG12 2  
ATOM 3507  H HG13 . VAL A 1 112 ? -8.391  -5.227  -10.237 1.00 0.00 ? 112 VAL A HG13 2  
ATOM 3508  H HG21 . VAL A 1 112 ? -11.618 -4.570  -8.923  1.00 0.00 ? 112 VAL A HG21 2  
ATOM 3509  H HG22 . VAL A 1 112 ? -12.352 -5.456  -10.260 1.00 0.00 ? 112 VAL A HG22 2  
ATOM 3510  H HG23 . VAL A 1 112 ? -12.273 -3.694  -10.306 1.00 0.00 ? 112 VAL A HG23 2  
ATOM 3511  N N    . GLU A 1 113 ? -10.831 -3.379  -13.525 1.00 0.00 ? 113 GLU A N    2  
ATOM 3512  C CA   . GLU A 1 113 ? -11.727 -3.064  -14.633 1.00 0.00 ? 113 GLU A CA   2  
ATOM 3513  C C    . GLU A 1 113 ? -12.868 -4.072  -14.714 1.00 0.00 ? 113 GLU A C    2  
ATOM 3514  O O    . GLU A 1 113 ? -12.767 -5.182  -14.188 1.00 0.00 ? 113 GLU A O    2  
ATOM 3515  C CB   . GLU A 1 113 ? -10.953 -3.050  -15.953 1.00 0.00 ? 113 GLU A CB   2  
ATOM 3516  C CG   . GLU A 1 113 ? -10.024 -4.241  -16.129 1.00 0.00 ? 113 GLU A CG   2  
ATOM 3517  C CD   . GLU A 1 113 ? -8.915  -3.972  -17.130 1.00 0.00 ? 113 GLU A CD   2  
ATOM 3518  O OE1  . GLU A 1 113 ? -9.232  -3.650  -18.294 1.00 0.00 ? 113 GLU A OE1  2  
ATOM 3519  O OE2  . GLU A 1 113 ? -7.731  -4.084  -16.746 1.00 0.00 ? 113 GLU A OE2  2  
ATOM 3520  H H    . GLU A 1 113 ? -10.067 -3.974  -13.683 1.00 0.00 ? 113 GLU A H    2  
ATOM 3521  H HA   . GLU A 1 113 ? -12.140 -2.083  -14.457 1.00 0.00 ? 113 GLU A HA   2  
ATOM 3522  H HB2  . GLU A 1 113 ? -11.659 -3.048  -16.771 1.00 0.00 ? 113 GLU A HB2  2  
ATOM 3523  H HB3  . GLU A 1 113 ? -10.360 -2.148  -15.999 1.00 0.00 ? 113 GLU A HB3  2  
ATOM 3524  H HG2  . GLU A 1 113 ? -9.577  -4.476  -15.176 1.00 0.00 ? 113 GLU A HG2  2  
ATOM 3525  H HG3  . GLU A 1 113 ? -10.602 -5.085  -16.474 1.00 0.00 ? 113 GLU A HG3  2  
ATOM 3526  N N    . ARG A 1 114 ? -13.951 -3.679  -15.376 1.00 0.00 ? 114 ARG A N    2  
ATOM 3527  C CA   . ARG A 1 114 ? -15.112 -4.549  -15.527 1.00 0.00 ? 114 ARG A CA   2  
ATOM 3528  C C    . ARG A 1 114 ? -15.237 -5.045  -16.964 1.00 0.00 ? 114 ARG A C    2  
ATOM 3529  O O    . ARG A 1 114 ? -14.909 -4.270  -17.888 1.00 0.00 ? 114 ARG A O    2  
ATOM 3530  C CB   . ARG A 1 114 ? -16.385 -3.807  -15.120 1.00 0.00 ? 114 ARG A CB   2  
ATOM 3531  C CG   . ARG A 1 114 ? -16.511 -2.426  -15.741 1.00 0.00 ? 114 ARG A CG   2  
ATOM 3532  C CD   . ARG A 1 114 ? -16.264 -1.329  -14.719 1.00 0.00 ? 114 ARG A CD   2  
ATOM 3533  N NE   . ARG A 1 114 ? -16.123 -0.018  -15.345 1.00 0.00 ? 114 ARG A NE   2  
ATOM 3534  C CZ   . ARG A 1 114 ? -14.950 0.554   -15.606 1.00 0.00 ? 114 ARG A CZ   2  
ATOM 3535  N NH1  . ARG A 1 114 ? -13.821 -0.072  -15.299 1.00 0.00 ? 114 ARG A NH1  2  
ATOM 3536  N NH2  . ARG A 1 114 ? -14.907 1.749   -16.175 1.00 0.00 ? 114 ARG A NH2  2  
ATOM 3537  O OXT  . ARG A 1 114 ? -15.660 -6.204  -17.154 1.00 0.00 ? 114 ARG A OXT  2  
ATOM 3538  H H    . ARG A 1 114 ? -13.968 -2.784  -15.773 1.00 0.00 ? 114 ARG A H    2  
ATOM 3539  H HA   . ARG A 1 114 ? -14.978 -5.398  -14.876 1.00 0.00 ? 114 ARG A HA   2  
ATOM 3540  H HB2  . ARG A 1 114 ? -17.242 -4.393  -15.422 1.00 0.00 ? 114 ARG A HB2  2  
ATOM 3541  H HB3  . ARG A 1 114 ? -16.397 -3.696  -14.046 1.00 0.00 ? 114 ARG A HB3  2  
ATOM 3542  H HG2  . ARG A 1 114 ? -15.787 -2.333  -16.537 1.00 0.00 ? 114 ARG A HG2  2  
ATOM 3543  H HG3  . ARG A 1 114 ? -17.506 -2.313  -16.146 1.00 0.00 ? 114 ARG A HG3  2  
ATOM 3544  H HD2  . ARG A 1 114 ? -17.097 -1.302  -14.033 1.00 0.00 ? 114 ARG A HD2  2  
ATOM 3545  H HD3  . ARG A 1 114 ? -15.359 -1.559  -14.176 1.00 0.00 ? 114 ARG A HD3  2  
ATOM 3546  H HE   . ARG A 1 114 ? -16.944 0.462   -15.583 1.00 0.00 ? 114 ARG A HE   2  
ATOM 3547  H HH11 . ARG A 1 114 ? -13.849 -0.975  -14.871 1.00 0.00 ? 114 ARG A HH11 2  
ATOM 3548  H HH12 . ARG A 1 114 ? -12.941 0.360   -15.497 1.00 0.00 ? 114 ARG A HH12 2  
ATOM 3549  H HH21 . ARG A 1 114 ? -15.756 2.224   -16.410 1.00 0.00 ? 114 ARG A HH21 2  
ATOM 3550  H HH22 . ARG A 1 114 ? -14.025 2.179   -16.371 1.00 0.00 ? 114 ARG A HH22 2  
ATOM 3551  N N    . GLY A 1 1   ? -12.813 18.166  -10.876 1.00 0.00 ? 1   GLY A N    3  
ATOM 3552  C CA   . GLY A 1 1   ? -11.805 17.430  -11.687 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3553  C C    . GLY A 1 1   ? -10.754 18.347  -12.280 1.00 0.00 ? 1   GLY A C    3  
ATOM 3554  O O    . GLY A 1 1   ? -11.007 19.533  -12.498 1.00 0.00 ? 1   GLY A O    3  
ATOM 3555  H H1   . GLY A 1 1   ? -13.737 18.151  -11.352 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3556  H H2   . GLY A 1 1   ? -12.518 19.156  -10.749 1.00 0.00 ? 1   GLY A H2   3  
ATOM 3557  H H3   . GLY A 1 1   ? -12.910 17.725  -9.939  1.00 0.00 ? 1   GLY A H3   3  
ATOM 3558  H HA2  . GLY A 1 1   ? -11.317 16.700  -11.059 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3559  H HA3  . GLY A 1 1   ? -12.312 16.916  -12.492 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3560  N N    . ALA A 1 2   ? -9.571  17.799  -12.543 1.00 0.00 ? 2   ALA A N    3  
ATOM 3561  C CA   . ALA A 1 2   ? -8.475  18.574  -13.117 1.00 0.00 ? 2   ALA A CA   3  
ATOM 3562  C C    . ALA A 1 2   ? -7.340  17.659  -13.572 1.00 0.00 ? 2   ALA A C    3  
ATOM 3563  O O    . ALA A 1 2   ? -7.464  16.963  -14.578 1.00 0.00 ? 2   ALA A O    3  
ATOM 3564  C CB   . ALA A 1 2   ? -7.975  19.604  -12.111 1.00 0.00 ? 2   ALA A CB   3  
ATOM 3565  H H    . ALA A 1 2   ? -9.432  16.846  -12.348 1.00 0.00 ? 2   ALA A H    3  
ATOM 3566  H HA   . ALA A 1 2   ? -8.859  19.105  -13.976 1.00 0.00 ? 2   ALA A HA   3  
ATOM 3567  H HB1  . ALA A 1 2   ? -7.240  19.147  -11.464 1.00 0.00 ? 2   ALA A HB1  3  
ATOM 3568  H HB2  . ALA A 1 2   ? -8.804  19.961  -11.519 1.00 0.00 ? 2   ALA A HB2  3  
ATOM 3569  H HB3  . ALA A 1 2   ? -7.525  20.431  -12.638 1.00 0.00 ? 2   ALA A HB3  3  
ATOM 3570  N N    . MET A 1 3   ? -6.235  17.658  -12.825 1.00 0.00 ? 3   MET A N    3  
ATOM 3571  C CA   . MET A 1 3   ? -5.091  16.818  -13.161 1.00 0.00 ? 3   MET A CA   3  
ATOM 3572  C C    . MET A 1 3   ? -5.482  15.345  -13.100 1.00 0.00 ? 3   MET A C    3  
ATOM 3573  O O    . MET A 1 3   ? -5.778  14.731  -14.124 1.00 0.00 ? 3   MET A O    3  
ATOM 3574  C CB   . MET A 1 3   ? -3.927  17.096  -12.208 1.00 0.00 ? 3   MET A CB   3  
ATOM 3575  C CG   . MET A 1 3   ? -2.762  17.819  -12.865 1.00 0.00 ? 3   MET A CG   3  
ATOM 3576  S SD   . MET A 1 3   ? -3.237  19.416  -13.554 1.00 0.00 ? 3   MET A SD   3  
ATOM 3577  C CE   . MET A 1 3   ? -2.204  19.475  -15.017 1.00 0.00 ? 3   MET A CE   3  
ATOM 3578  H H    . MET A 1 3   ? -6.191  18.229  -12.030 1.00 0.00 ? 3   MET A H    3  
ATOM 3579  H HA   . MET A 1 3   ? -4.789  17.058  -14.169 1.00 0.00 ? 3   MET A HA   3  
ATOM 3580  H HB2  . MET A 1 3   ? -4.283  17.703  -11.389 1.00 0.00 ? 3   MET A HB2  3  
ATOM 3581  H HB3  . MET A 1 3   ? -3.565  16.156  -11.816 1.00 0.00 ? 3   MET A HB3  3  
ATOM 3582  H HG2  . MET A 1 3   ? -1.990  17.976  -12.126 1.00 0.00 ? 3   MET A HG2  3  
ATOM 3583  H HG3  . MET A 1 3   ? -2.374  17.198  -13.661 1.00 0.00 ? 3   MET A HG3  3  
ATOM 3584  H HE1  . MET A 1 3   ? -2.693  20.064  -15.779 1.00 0.00 ? 3   MET A HE1  3  
ATOM 3585  H HE2  . MET A 1 3   ? -2.044  18.471  -15.386 1.00 0.00 ? 3   MET A HE2  3  
ATOM 3586  H HE3  . MET A 1 3   ? -1.253  19.925  -14.770 1.00 0.00 ? 3   MET A HE3  3  
ATOM 3587  N N    . ASP A 1 4   ? -5.491  14.790  -11.889 1.00 0.00 ? 4   ASP A N    3  
ATOM 3588  C CA   . ASP A 1 4   ? -5.859  13.392  -11.686 1.00 0.00 ? 4   ASP A CA   3  
ATOM 3589  C C    . ASP A 1 4   ? -5.106  12.475  -12.646 1.00 0.00 ? 4   ASP A C    3  
ATOM 3590  O O    . ASP A 1 4   ? -5.677  11.993  -13.626 1.00 0.00 ? 4   ASP A O    3  
ATOM 3591  C CB   . ASP A 1 4   ? -7.368  13.214  -11.869 1.00 0.00 ? 4   ASP A CB   3  
ATOM 3592  C CG   . ASP A 1 4   ? -8.146  14.481  -11.574 1.00 0.00 ? 4   ASP A CG   3  
ATOM 3593  O OD1  . ASP A 1 4   ? -7.904  15.092  -10.514 1.00 0.00 ? 4   ASP A OD1  3  
ATOM 3594  O OD2  . ASP A 1 4   ? -8.998  14.860  -12.405 1.00 0.00 ? 4   ASP A OD2  3  
ATOM 3595  H H    . ASP A 1 4   ? -5.254  15.338  -11.112 1.00 0.00 ? 4   ASP A H    3  
ATOM 3596  H HA   . ASP A 1 4   ? -5.597  13.120  -10.671 1.00 0.00 ? 4   ASP A HA   3  
ATOM 3597  H HB2  . ASP A 1 4   ? -7.568  12.921  -12.890 1.00 0.00 ? 4   ASP A HB2  3  
ATOM 3598  H HB3  . ASP A 1 4   ? -7.714  12.438  -11.204 1.00 0.00 ? 4   ASP A HB3  3  
ATOM 3599  N N    . PRO A 1 5   ? -3.817  12.203  -12.369 1.00 0.00 ? 5   PRO A N    3  
ATOM 3600  C CA   . PRO A 1 5   ? -3.001  11.318  -13.205 1.00 0.00 ? 5   PRO A CA   3  
ATOM 3601  C C    . PRO A 1 5   ? -3.712  9.999   -13.460 1.00 0.00 ? 5   PRO A C    3  
ATOM 3602  O O    . PRO A 1 5   ? -3.541  9.369   -14.505 1.00 0.00 ? 5   PRO A O    3  
ATOM 3603  C CB   . PRO A 1 5   ? -1.729  11.087  -12.374 1.00 0.00 ? 5   PRO A CB   3  
ATOM 3604  C CG   . PRO A 1 5   ? -2.028  11.640  -11.017 1.00 0.00 ? 5   PRO A CG   3  
ATOM 3605  C CD   . PRO A 1 5   ? -3.059  12.708  -11.218 1.00 0.00 ? 5   PRO A CD   3  
ATOM 3606  H HA   . PRO A 1 5   ? -2.746  11.782  -14.147 1.00 0.00 ? 5   PRO A HA   3  
ATOM 3607  H HB2  . PRO A 1 5   ? -1.521  10.030  -12.328 1.00 0.00 ? 5   PRO A HB2  3  
ATOM 3608  H HB3  . PRO A 1 5   ? -0.899  11.603  -12.835 1.00 0.00 ? 5   PRO A HB3  3  
ATOM 3609  H HG2  . PRO A 1 5   ? -2.417  10.859  -10.382 1.00 0.00 ? 5   PRO A HG2  3  
ATOM 3610  H HG3  . PRO A 1 5   ? -1.130  12.060  -10.587 1.00 0.00 ? 5   PRO A HG3  3  
ATOM 3611  H HD2  . PRO A 1 5   ? -3.688  12.800  -10.346 1.00 0.00 ? 5   PRO A HD2  3  
ATOM 3612  H HD3  . PRO A 1 5   ? -2.589  13.653  -11.451 1.00 0.00 ? 5   PRO A HD3  3  
ATOM 3613  N N    . GLU A 1 6   ? -4.529  9.606   -12.493 1.00 0.00 ? 6   GLU A N    3  
ATOM 3614  C CA   . GLU A 1 6   ? -5.305  8.379   -12.575 1.00 0.00 ? 6   GLU A CA   3  
ATOM 3615  C C    . GLU A 1 6   ? -6.649  8.575   -11.894 1.00 0.00 ? 6   GLU A C    3  
ATOM 3616  O O    . GLU A 1 6   ? -7.460  7.651   -11.818 1.00 0.00 ? 6   GLU A O    3  
ATOM 3617  C CB   . GLU A 1 6   ? -4.550  7.217   -11.927 1.00 0.00 ? 6   GLU A CB   3  
ATOM 3618  C CG   . GLU A 1 6   ? -3.610  6.495   -12.878 1.00 0.00 ? 6   GLU A CG   3  
ATOM 3619  C CD   . GLU A 1 6   ? -4.336  5.872   -14.056 1.00 0.00 ? 6   GLU A CD   3  
ATOM 3620  O OE1  . GLU A 1 6   ? -5.204  5.005   -13.826 1.00 0.00 ? 6   GLU A OE1  3  
ATOM 3621  O OE2  . GLU A 1 6   ? -4.032  6.250   -15.207 1.00 0.00 ? 6   GLU A OE2  3  
ATOM 3622  H H    . GLU A 1 6   ? -4.622  10.168  -11.695 1.00 0.00 ? 6   GLU A H    3  
ATOM 3623  H HA   . GLU A 1 6   ? -5.468  8.158   -13.612 1.00 0.00 ? 6   GLU A HA   3  
ATOM 3624  H HB2  . GLU A 1 6   ? -3.968  7.598   -11.100 1.00 0.00 ? 6   GLU A HB2  3  
ATOM 3625  H HB3  . GLU A 1 6   ? -5.268  6.502   -11.552 1.00 0.00 ? 6   GLU A HB3  3  
ATOM 3626  H HG2  . GLU A 1 6   ? -2.886  7.202   -13.255 1.00 0.00 ? 6   GLU A HG2  3  
ATOM 3627  H HG3  . GLU A 1 6   ? -3.099  5.714   -12.334 1.00 0.00 ? 6   GLU A HG3  3  
ATOM 3628  N N    . PHE A 1 7   ? -6.867  9.788   -11.385 1.00 0.00 ? 7   PHE A N    3  
ATOM 3629  C CA   . PHE A 1 7   ? -8.106  10.118  -10.685 1.00 0.00 ? 7   PHE A CA   3  
ATOM 3630  C C    . PHE A 1 7   ? -8.302  9.165   -9.515  1.00 0.00 ? 7   PHE A C    3  
ATOM 3631  O O    . PHE A 1 7   ? -9.378  9.088   -8.924  1.00 0.00 ? 7   PHE A O    3  
ATOM 3632  C CB   . PHE A 1 7   ? -9.299  10.049  -11.641 1.00 0.00 ? 7   PHE A CB   3  
ATOM 3633  C CG   . PHE A 1 7   ? -10.553 10.681  -11.099 1.00 0.00 ? 7   PHE A CG   3  
ATOM 3634  C CD1  . PHE A 1 7   ? -10.634 12.053  -10.920 1.00 0.00 ? 7   PHE A CD1  3  
ATOM 3635  C CD2  . PHE A 1 7   ? -11.649 9.900   -10.771 1.00 0.00 ? 7   PHE A CD2  3  
ATOM 3636  C CE1  . PHE A 1 7   ? -11.784 12.633  -10.423 1.00 0.00 ? 7   PHE A CE1  3  
ATOM 3637  C CE2  . PHE A 1 7   ? -12.803 10.476  -10.273 1.00 0.00 ? 7   PHE A CE2  3  
ATOM 3638  C CZ   . PHE A 1 7   ? -12.870 11.844  -10.098 1.00 0.00 ? 7   PHE A CZ   3  
ATOM 3639  H H    . PHE A 1 7   ? -6.168  10.473  -11.472 1.00 0.00 ? 7   PHE A H    3  
ATOM 3640  H HA   . PHE A 1 7   ? -8.014  11.124  -10.304 1.00 0.00 ? 7   PHE A HA   3  
ATOM 3641  H HB2  . PHE A 1 7   ? -9.044  10.560  -12.558 1.00 0.00 ? 7   PHE A HB2  3  
ATOM 3642  H HB3  . PHE A 1 7   ? -9.515  9.014   -11.856 1.00 0.00 ? 7   PHE A HB3  3  
ATOM 3643  H HD1  . PHE A 1 7   ? -9.785  12.672  -11.172 1.00 0.00 ? 7   PHE A HD1  3  
ATOM 3644  H HD2  . PHE A 1 7   ? -11.597 8.831   -10.906 1.00 0.00 ? 7   PHE A HD2  3  
ATOM 3645  H HE1  . PHE A 1 7   ? -11.835 13.704  -10.286 1.00 0.00 ? 7   PHE A HE1  3  
ATOM 3646  H HE2  . PHE A 1 7   ? -13.651 9.856   -10.021 1.00 0.00 ? 7   PHE A HE2  3  
ATOM 3647  H HZ   . PHE A 1 7   ? -13.772 12.296  -9.709  1.00 0.00 ? 7   PHE A HZ   3  
ATOM 3648  N N    . ASN A 1 8   ? -7.235  8.445   -9.192  1.00 0.00 ? 8   ASN A N    3  
ATOM 3649  C CA   . ASN A 1 8   ? -7.251  7.489   -8.100  1.00 0.00 ? 8   ASN A CA   3  
ATOM 3650  C C    . ASN A 1 8   ? -5.838  6.987   -7.819  1.00 0.00 ? 8   ASN A C    3  
ATOM 3651  O O    . ASN A 1 8   ? -5.638  6.146   -6.943  1.00 0.00 ? 8   ASN A O    3  
ATOM 3652  C CB   . ASN A 1 8   ? -8.167  6.309   -8.437  1.00 0.00 ? 8   ASN A CB   3  
ATOM 3653  C CG   . ASN A 1 8   ? -9.161  6.014   -7.331  1.00 0.00 ? 8   ASN A CG   3  
ATOM 3654  O OD1  . ASN A 1 8   ? -8.833  5.350   -6.347  1.00 0.00 ? 8   ASN A OD1  3  
ATOM 3655  N ND2  . ASN A 1 8   ? -10.384 6.507   -7.487  1.00 0.00 ? 8   ASN A ND2  3  
ATOM 3656  H H    . ASN A 1 8   ? -6.411  8.563   -9.706  1.00 0.00 ? 8   ASN A H    3  
ATOM 3657  H HA   . ASN A 1 8   ? -7.628  7.991   -7.225  1.00 0.00 ? 8   ASN A HA   3  
ATOM 3658  H HB2  . ASN A 1 8   ? -8.716  6.534   -9.338  1.00 0.00 ? 8   ASN A HB2  3  
ATOM 3659  H HB3  . ASN A 1 8   ? -7.563  5.429   -8.599  1.00 0.00 ? 8   ASN A HB3  3  
ATOM 3660  H HD21 . ASN A 1 8   ? -10.574 7.025   -8.297  1.00 0.00 ? 8   ASN A HD21 3  
ATOM 3661  H HD22 . ASN A 1 8   ? -11.047 6.329   -6.786  1.00 0.00 ? 8   ASN A HD22 3  
ATOM 3662  N N    . LYS A 1 9   ? -4.864  7.503   -8.580  1.00 0.00 ? 9   LYS A N    3  
ATOM 3663  C CA   . LYS A 1 9   ? -3.460  7.105   -8.423  1.00 0.00 ? 9   LYS A CA   3  
ATOM 3664  C C    . LYS A 1 9   ? -3.057  7.002   -6.949  1.00 0.00 ? 9   LYS A C    3  
ATOM 3665  O O    . LYS A 1 9   ? -2.659  7.990   -6.322  1.00 0.00 ? 9   LYS A O    3  
ATOM 3666  C CB   . LYS A 1 9   ? -2.542  8.093   -9.144  1.00 0.00 ? 9   LYS A CB   3  
ATOM 3667  C CG   . LYS A 1 9   ? -1.621  7.435   -10.159 1.00 0.00 ? 9   LYS A CG   3  
ATOM 3668  C CD   . LYS A 1 9   ? -0.174  7.455   -9.696  1.00 0.00 ? 9   LYS A CD   3  
ATOM 3669  C CE   . LYS A 1 9   ? 0.479   6.092   -9.854  1.00 0.00 ? 9   LYS A CE   3  
ATOM 3670  N NZ   . LYS A 1 9   ? 0.477   5.638   -11.273 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 3671  H H    . LYS A 1 9   ? -5.096  8.167   -9.274  1.00 0.00 ? 9   LYS A H    3  
ATOM 3672  H HA   . LYS A 1 9   ? -3.347  6.132   -8.876  1.00 0.00 ? 9   LYS A HA   3  
ATOM 3673  H HB2  . LYS A 1 9   ? -3.151  8.822   -9.660  1.00 0.00 ? 9   LYS A HB2  3  
ATOM 3674  H HB3  . LYS A 1 9   ? -1.932  8.602   -8.412  1.00 0.00 ? 9   LYS A HB3  3  
ATOM 3675  H HG2  . LYS A 1 9   ? -1.929  6.410   -10.295 1.00 0.00 ? 9   LYS A HG2  3  
ATOM 3676  H HG3  . LYS A 1 9   ? -1.698  7.965   -11.097 1.00 0.00 ? 9   LYS A HG3  3  
ATOM 3677  H HD2  . LYS A 1 9   ? 0.373   8.175   -10.287 1.00 0.00 ? 9   LYS A HD2  3  
ATOM 3678  H HD3  . LYS A 1 9   ? -0.142  7.741   -8.655  1.00 0.00 ? 9   LYS A HD3  3  
ATOM 3679  H HE2  . LYS A 1 9   ? 1.499   6.153   -9.507  1.00 0.00 ? 9   LYS A HE2  3  
ATOM 3680  H HE3  . LYS A 1 9   ? -0.063  5.376   -9.255  1.00 0.00 ? 9   LYS A HE3  3  
ATOM 3681  H HZ1  . LYS A 1 9   ? 0.609   6.449   -11.909 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 3682  H HZ2  . LYS A 1 9   ? -0.427  5.178   -11.501 1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 3683  H HZ3  . LYS A 1 9   ? 1.248   4.958   -11.430 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 3684  N N    . ALA A 1 10  ? -3.182  5.802   -6.395  1.00 0.00 ? 10  ALA A N    3  
ATOM 3685  C CA   . ALA A 1 10  ? -2.851  5.568   -4.998  1.00 0.00 ? 10  ALA A CA   3  
ATOM 3686  C C    . ALA A 1 10  ? -1.365  5.286   -4.805  1.00 0.00 ? 10  ALA A C    3  
ATOM 3687  O O    . ALA A 1 10  ? -0.896  4.185   -5.084  1.00 0.00 ? 10  ALA A O    3  
ATOM 3688  C CB   . ALA A 1 10  ? -3.682  4.421   -4.445  1.00 0.00 ? 10  ALA A CB   3  
ATOM 3689  H H    . ALA A 1 10  ? -3.530  5.061   -6.933  1.00 0.00 ? 10  ALA A H    3  
ATOM 3690  H HA   . ALA A 1 10  ? -3.105  6.460   -4.448  1.00 0.00 ? 10  ALA A HA   3  
ATOM 3691  H HB1  . ALA A 1 10  ? -4.211  4.749   -3.561  1.00 0.00 ? 10  ALA A HB1  3  
ATOM 3692  H HB2  . ALA A 1 10  ? -3.033  3.596   -4.190  1.00 0.00 ? 10  ALA A HB2  3  
ATOM 3693  H HB3  . ALA A 1 10  ? -4.395  4.101   -5.192  1.00 0.00 ? 10  ALA A HB3  3  
ATOM 3694  N N    . ILE A 1 11  ? -0.631  6.283   -4.319  1.00 0.00 ? 11  ILE A N    3  
ATOM 3695  C CA   . ILE A 1 11  ? 0.802   6.131   -4.082  1.00 0.00 ? 11  ILE A CA   3  
ATOM 3696  C C    . ILE A 1 11  ? 1.120   6.175   -2.591  1.00 0.00 ? 11  ILE A C    3  
ATOM 3697  O O    . ILE A 1 11  ? 0.979   7.214   -1.947  1.00 0.00 ? 11  ILE A O    3  
ATOM 3698  C CB   . ILE A 1 11  ? 1.616   7.230   -4.796  1.00 0.00 ? 11  ILE A CB   3  
ATOM 3699  C CG1  . ILE A 1 11  ? 1.213   7.321   -6.269  1.00 0.00 ? 11  ILE A CG1  3  
ATOM 3700  C CG2  . ILE A 1 11  ? 3.109   6.957   -4.665  1.00 0.00 ? 11  ILE A CG2  3  
ATOM 3701  C CD1  . ILE A 1 11  ? 1.076   8.744   -6.766  1.00 0.00 ? 11  ILE A CD1  3  
ATOM 3702  H H    . ILE A 1 11  ? -1.057  7.141   -4.111  1.00 0.00 ? 11  ILE A H    3  
ATOM 3703  H HA   . ILE A 1 11  ? 1.105   5.172   -4.478  1.00 0.00 ? 11  ILE A HA   3  
ATOM 3704  H HB   . ILE A 1 11  ? 1.406   8.172   -4.313  1.00 0.00 ? 11  ILE A HB   3  
ATOM 3705  H HG12 . ILE A 1 11  ? 1.962   6.830   -6.870  1.00 0.00 ? 11  ILE A HG12 3  
ATOM 3706  H HG13 . ILE A 1 11  ? 0.264   6.829   -6.407  1.00 0.00 ? 11  ILE A HG13 3  
ATOM 3707  H HG21 . ILE A 1 11  ? 3.634   7.425   -5.484  1.00 0.00 ? 11  ILE A HG21 3  
ATOM 3708  H HG22 . ILE A 1 11  ? 3.284   5.891   -4.689  1.00 0.00 ? 11  ILE A HG22 3  
ATOM 3709  H HG23 . ILE A 1 11  ? 3.469   7.359   -3.728  1.00 0.00 ? 11  ILE A HG23 3  
ATOM 3710  H HD11 . ILE A 1 11  ? 0.249   9.223   -6.264  1.00 0.00 ? 11  ILE A HD11 3  
ATOM 3711  H HD12 . ILE A 1 11  ? 0.896   8.736   -7.831  1.00 0.00 ? 11  ILE A HD12 3  
ATOM 3712  H HD13 . ILE A 1 11  ? 1.987   9.288   -6.558  1.00 0.00 ? 11  ILE A HD13 3  
ATOM 3713  N N    . PHE A 1 12  ? 1.565   5.043   -2.053  1.00 0.00 ? 12  PHE A N    3  
ATOM 3714  C CA   . PHE A 1 12  ? 1.921   4.951   -0.641  1.00 0.00 ? 12  PHE A CA   3  
ATOM 3715  C C    . PHE A 1 12  ? 3.405   4.618   -0.499  1.00 0.00 ? 12  PHE A C    3  
ATOM 3716  O O    . PHE A 1 12  ? 3.829   3.503   -0.800  1.00 0.00 ? 12  PHE A O    3  
ATOM 3717  C CB   . PHE A 1 12  ? 1.082   3.875   0.054   1.00 0.00 ? 12  PHE A CB   3  
ATOM 3718  C CG   . PHE A 1 12  ? -0.283  4.338   0.487   1.00 0.00 ? 12  PHE A CG   3  
ATOM 3719  C CD1  . PHE A 1 12  ? -1.313  4.466   -0.433  1.00 0.00 ? 12  PHE A CD1  3  
ATOM 3720  C CD2  . PHE A 1 12  ? -0.540  4.633   1.818   1.00 0.00 ? 12  PHE A CD2  3  
ATOM 3721  C CE1  . PHE A 1 12  ? -2.571  4.880   -0.032  1.00 0.00 ? 12  PHE A CE1  3  
ATOM 3722  C CE2  . PHE A 1 12  ? -1.794  5.050   2.223   1.00 0.00 ? 12  PHE A CE2  3  
ATOM 3723  C CZ   . PHE A 1 12  ? -2.811  5.173   1.294   1.00 0.00 ? 12  PHE A CZ   3  
ATOM 3724  H H    . PHE A 1 12  ? 1.668   4.252   -2.620  1.00 0.00 ? 12  PHE A H    3  
ATOM 3725  H HA   . PHE A 1 12  ? 1.727   5.908   -0.181  1.00 0.00 ? 12  PHE A HA   3  
ATOM 3726  H HB2  . PHE A 1 12  ? 0.948   3.042   -0.620  1.00 0.00 ? 12  PHE A HB2  3  
ATOM 3727  H HB3  . PHE A 1 12  ? 1.610   3.533   0.934   1.00 0.00 ? 12  PHE A HB3  3  
ATOM 3728  H HD1  . PHE A 1 12  ? -1.126  4.239   -1.472  1.00 0.00 ? 12  PHE A HD1  3  
ATOM 3729  H HD2  . PHE A 1 12  ? 0.254   4.536   2.543   1.00 0.00 ? 12  PHE A HD2  3  
ATOM 3730  H HE1  . PHE A 1 12  ? -3.363  4.979   -0.760  1.00 0.00 ? 12  PHE A HE1  3  
ATOM 3731  H HE2  . PHE A 1 12  ? -1.979  5.280   3.266   1.00 0.00 ? 12  PHE A HE2  3  
ATOM 3732  H HZ   . PHE A 1 12  ? -3.795  5.495   1.608   1.00 0.00 ? 12  PHE A HZ   3  
ATOM 3733  N N    . THR A 1 13  ? 4.192   5.587   -0.044  1.00 0.00 ? 13  THR A N    3  
ATOM 3734  C CA   . THR A 1 13  ? 5.627   5.385   0.130   1.00 0.00 ? 13  THR A CA   3  
ATOM 3735  C C    . THR A 1 13  ? 5.952   4.925   1.541   1.00 0.00 ? 13  THR A C    3  
ATOM 3736  O O    . THR A 1 13  ? 5.599   5.586   2.513   1.00 0.00 ? 13  THR A O    3  
ATOM 3737  C CB   . THR A 1 13  ? 6.423   6.667   -0.175  1.00 0.00 ? 13  THR A CB   3  
ATOM 3738  O OG1  . THR A 1 13  ? 5.958   7.255   -1.396  1.00 0.00 ? 13  THR A OG1  3  
ATOM 3739  C CG2  . THR A 1 13  ? 7.908   6.364   -0.286  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3740  H H    . THR A 1 13  ? 3.800   6.458   0.180   1.00 0.00 ? 13  THR A H    3  
ATOM 3741  H HA   . THR A 1 13  ? 5.938   4.620   -0.565  1.00 0.00 ? 13  THR A HA   3  
ATOM 3742  H HB   . THR A 1 13  ? 6.272   7.366   0.635   1.00 0.00 ? 13  THR A HB   3  
ATOM 3743  H HG1  . THR A 1 13  ? 5.400   6.629   -1.862  1.00 0.00 ? 13  THR A HG1  3  
ATOM 3744  H HG21 . THR A 1 13  ? 8.404   7.173   -0.802  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3745  H HG22 . THR A 1 13  ? 8.048   5.445   -0.837  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3746  H HG23 . THR A 1 13  ? 8.329   6.256   0.704   1.00 0.00 ? 13  THR A HG23 3  
ATOM 3747  N N    . VAL A 1 14  ? 6.618   3.777   1.647   1.00 0.00 ? 14  VAL A N    3  
ATOM 3748  C CA   . VAL A 1 14  ? 6.982   3.214   2.945   1.00 0.00 ? 14  VAL A CA   3  
ATOM 3749  C C    . VAL A 1 14  ? 8.366   2.572   2.901   1.00 0.00 ? 14  VAL A C    3  
ATOM 3750  O O    . VAL A 1 14  ? 8.980   2.478   1.841   1.00 0.00 ? 14  VAL A O    3  
ATOM 3751  C CB   . VAL A 1 14  ? 5.953   2.154   3.409   1.00 0.00 ? 14  VAL A CB   3  
ATOM 3752  C CG1  . VAL A 1 14  ? 4.567   2.484   2.887   1.00 0.00 ? 14  VAL A CG1  3  
ATOM 3753  C CG2  . VAL A 1 14  ? 6.361   0.754   2.961   1.00 0.00 ? 14  VAL A CG2  3  
ATOM 3754  H H    . VAL A 1 14  ? 6.862   3.288   0.835   1.00 0.00 ? 14  VAL A H    3  
ATOM 3755  H HA   . VAL A 1 14  ? 6.991   4.017   3.668   1.00 0.00 ? 14  VAL A HA   3  
ATOM 3756  H HB   . VAL A 1 14  ? 5.918   2.165   4.488   1.00 0.00 ? 14  VAL A HB   3  
ATOM 3757  H HG11 . VAL A 1 14  ? 3.946   2.823   3.702   1.00 0.00 ? 14  VAL A HG11 3  
ATOM 3758  H HG12 . VAL A 1 14  ? 4.134   1.599   2.445   1.00 0.00 ? 14  VAL A HG12 3  
ATOM 3759  H HG13 . VAL A 1 14  ? 4.639   3.260   2.140   1.00 0.00 ? 14  VAL A HG13 3  
ATOM 3760  H HG21 . VAL A 1 14  ? 6.391   0.717   1.882   1.00 0.00 ? 14  VAL A HG21 3  
ATOM 3761  H HG22 . VAL A 1 14  ? 5.643   0.036   3.325   1.00 0.00 ? 14  VAL A HG22 3  
ATOM 3762  H HG23 . VAL A 1 14  ? 7.337   0.520   3.357   1.00 0.00 ? 14  VAL A HG23 3  
ATOM 3763  N N    . ASP A 1 15  ? 8.837   2.111   4.055   1.00 0.00 ? 15  ASP A N    3  
ATOM 3764  C CA   . ASP A 1 15  ? 10.133  1.447   4.145   1.00 0.00 ? 15  ASP A CA   3  
ATOM 3765  C C    . ASP A 1 15  ? 9.931   -0.065  4.154   1.00 0.00 ? 15  ASP A C    3  
ATOM 3766  O O    . ASP A 1 15  ? 8.821   -0.540  4.375   1.00 0.00 ? 15  ASP A O    3  
ATOM 3767  C CB   . ASP A 1 15  ? 10.875  1.885   5.410   1.00 0.00 ? 15  ASP A CB   3  
ATOM 3768  C CG   . ASP A 1 15  ? 11.042  3.389   5.494   1.00 0.00 ? 15  ASP A CG   3  
ATOM 3769  O OD1  . ASP A 1 15  ? 11.208  4.028   4.432   1.00 0.00 ? 15  ASP A OD1  3  
ATOM 3770  O OD2  . ASP A 1 15  ? 11.009  3.929   6.619   1.00 0.00 ? 15  ASP A OD2  3  
ATOM 3771  H H    . ASP A 1 15  ? 8.291   2.203   4.864   1.00 0.00 ? 15  ASP A H    3  
ATOM 3772  H HA   . ASP A 1 15  ? 10.711  1.721   3.276   1.00 0.00 ? 15  ASP A HA   3  
ATOM 3773  H HB2  . ASP A 1 15  ? 10.321  1.555   6.277   1.00 0.00 ? 15  ASP A HB2  3  
ATOM 3774  H HB3  . ASP A 1 15  ? 11.855  1.429   5.420   1.00 0.00 ? 15  ASP A HB3  3  
ATOM 3775  N N    . ALA A 1 16  ? 10.988  -0.824  3.898   1.00 0.00 ? 16  ALA A N    3  
ATOM 3776  C CA   . ALA A 1 16  ? 10.875  -2.278  3.874   1.00 0.00 ? 16  ALA A CA   3  
ATOM 3777  C C    . ALA A 1 16  ? 11.139  -2.886  5.242   1.00 0.00 ? 16  ALA A C    3  
ATOM 3778  O O    . ALA A 1 16  ? 10.806  -4.045  5.487   1.00 0.00 ? 16  ALA A O    3  
ATOM 3779  C CB   . ALA A 1 16  ? 11.813  -2.869  2.833   1.00 0.00 ? 16  ALA A CB   3  
ATOM 3780  H H    . ALA A 1 16  ? 11.855  -0.405  3.709   1.00 0.00 ? 16  ALA A H    3  
ATOM 3781  H HA   . ALA A 1 16  ? 9.861   -2.521  3.594   1.00 0.00 ? 16  ALA A HA   3  
ATOM 3782  H HB1  . ALA A 1 16  ? 12.356  -2.073  2.345   1.00 0.00 ? 16  ALA A HB1  3  
ATOM 3783  H HB2  . ALA A 1 16  ? 11.240  -3.415  2.099   1.00 0.00 ? 16  ALA A HB2  3  
ATOM 3784  H HB3  . ALA A 1 16  ? 12.511  -3.537  3.314   1.00 0.00 ? 16  ALA A HB3  3  
ATOM 3785  N N    . LYS A 1 17  ? 11.721  -2.100  6.134   1.00 0.00 ? 17  LYS A N    3  
ATOM 3786  C CA   . LYS A 1 17  ? 12.006  -2.575  7.477   1.00 0.00 ? 17  LYS A CA   3  
ATOM 3787  C C    . LYS A 1 17  ? 10.738  -2.548  8.326   1.00 0.00 ? 17  LYS A C    3  
ATOM 3788  O O    . LYS A 1 17  ? 10.413  -3.524  9.005   1.00 0.00 ? 17  LYS A O    3  
ATOM 3789  C CB   . LYS A 1 17  ? 13.096  -1.723  8.126   1.00 0.00 ? 17  LYS A CB   3  
ATOM 3790  C CG   . LYS A 1 17  ? 12.876  -0.233  7.958   1.00 0.00 ? 17  LYS A CG   3  
ATOM 3791  C CD   . LYS A 1 17  ? 13.709  0.571   8.939   1.00 0.00 ? 17  LYS A CD   3  
ATOM 3792  C CE   . LYS A 1 17  ? 12.874  1.064   10.109  1.00 0.00 ? 17  LYS A CE   3  
ATOM 3793  N NZ   . LYS A 1 17  ? 13.721  1.550   11.233  1.00 0.00 ? 17  LYS A NZ   3  
ATOM 3794  H H    . LYS A 1 17  ? 11.956  -1.182  5.886   1.00 0.00 ? 17  LYS A H    3  
ATOM 3795  H HA   . LYS A 1 17  ? 12.352  -3.592  7.403   1.00 0.00 ? 17  LYS A HA   3  
ATOM 3796  H HB2  . LYS A 1 17  ? 13.131  -1.944  9.183   1.00 0.00 ? 17  LYS A HB2  3  
ATOM 3797  H HB3  . LYS A 1 17  ? 14.049  -1.978  7.681   1.00 0.00 ? 17  LYS A HB3  3  
ATOM 3798  H HG2  . LYS A 1 17  ? 13.148  0.051   6.951   1.00 0.00 ? 17  LYS A HG2  3  
ATOM 3799  H HG3  . LYS A 1 17  ? 11.832  -0.020  8.123   1.00 0.00 ? 17  LYS A HG3  3  
ATOM 3800  H HD2  . LYS A 1 17  ? 14.504  -0.055  9.318   1.00 0.00 ? 17  LYS A HD2  3  
ATOM 3801  H HD3  . LYS A 1 17  ? 14.133  1.422   8.425   1.00 0.00 ? 17  LYS A HD3  3  
ATOM 3802  H HE2  . LYS A 1 17  ? 12.244  1.872   9.768   1.00 0.00 ? 17  LYS A HE2  3  
ATOM 3803  H HE3  . LYS A 1 17  ? 12.256  0.251   10.461  1.00 0.00 ? 17  LYS A HE3  3  
ATOM 3804  H HZ1  . LYS A 1 17  ? 14.270  2.382   10.931  1.00 0.00 ? 17  LYS A HZ1  3  
ATOM 3805  H HZ2  . LYS A 1 17  ? 14.380  0.804   11.533  1.00 0.00 ? 17  LYS A HZ2  3  
ATOM 3806  H HZ3  . LYS A 1 17  ? 13.124  1.816   12.041  1.00 0.00 ? 17  LYS A HZ3  3  
ATOM 3807  N N    . THR A 1 18  ? 10.042  -1.416  8.303   1.00 0.00 ? 18  THR A N    3  
ATOM 3808  C CA   . THR A 1 18  ? 8.827   -1.269  9.099   1.00 0.00 ? 18  THR A CA   3  
ATOM 3809  C C    . THR A 1 18  ? 7.559   -1.152  8.268   1.00 0.00 ? 18  THR A C    3  
ATOM 3810  O O    . THR A 1 18  ? 6.455   -1.326  8.787   1.00 0.00 ? 18  THR A O    3  
ATOM 3811  C CB   . THR A 1 18  ? 8.923   -0.073  10.064  1.00 0.00 ? 18  THR A CB   3  
ATOM 3812  O OG1  . THR A 1 18  ? 7.653   0.163   10.683  1.00 0.00 ? 18  THR A OG1  3  
ATOM 3813  C CG2  . THR A 1 18  ? 9.375   1.180   9.328   1.00 0.00 ? 18  THR A CG2  3  
ATOM 3814  H H    . THR A 1 18  ? 10.384  -0.673  7.763   1.00 0.00 ? 18  THR A H    3  
ATOM 3815  H HA   . THR A 1 18  ? 8.744   -2.157  9.678   1.00 0.00 ? 18  THR A HA   3  
ATOM 3816  H HB   . THR A 1 18  ? 9.650   -0.305  10.829  1.00 0.00 ? 18  THR A HB   3  
ATOM 3817  H HG1  . THR A 1 18  ? 7.785   0.429   11.594  1.00 0.00 ? 18  THR A HG1  3  
ATOM 3818  H HG21 . THR A 1 18  ? 9.907   0.900   8.432   1.00 0.00 ? 18  THR A HG21 3  
ATOM 3819  H HG22 . THR A 1 18  ? 10.025  1.759   9.968   1.00 0.00 ? 18  THR A HG22 3  
ATOM 3820  H HG23 . THR A 1 18  ? 8.511   1.772   9.064   1.00 0.00 ? 18  THR A HG23 3  
ATOM 3821  N N    . THR A 1 19  ? 7.714   -0.848  6.996   1.00 0.00 ? 19  THR A N    3  
ATOM 3822  C CA   . THR A 1 19  ? 6.570   -0.698  6.096   1.00 0.00 ? 19  THR A CA   3  
ATOM 3823  C C    . THR A 1 19  ? 5.766   0.556   6.432   1.00 0.00 ? 19  THR A C    3  
ATOM 3824  O O    . THR A 1 19  ? 4.720   0.815   5.835   1.00 0.00 ? 19  THR A O    3  
ATOM 3825  C CB   . THR A 1 19  ? 5.635   -1.924  6.145   1.00 0.00 ? 19  THR A CB   3  
ATOM 3826  O OG1  . THR A 1 19  ? 6.403   -3.120  6.333   1.00 0.00 ? 19  THR A OG1  3  
ATOM 3827  C CG2  . THR A 1 19  ? 4.817   -2.040  4.866   1.00 0.00 ? 19  THR A CG2  3  
ATOM 3828  H H    . THR A 1 19  ? 8.617   -0.707  6.655   1.00 0.00 ? 19  THR A H    3  
ATOM 3829  H HA   . THR A 1 19  ? 6.951   -0.605  5.087   1.00 0.00 ? 19  THR A HA   3  
ATOM 3830  H HB   . THR A 1 19  ? 4.957   -1.806  6.979   1.00 0.00 ? 19  THR A HB   3  
ATOM 3831  H HG1  . THR A 1 19  ? 7.327   -2.891  6.451   1.00 0.00 ? 19  THR A HG1  3  
ATOM 3832  H HG21 . THR A 1 19  ? 3.799   -1.734  5.062   1.00 0.00 ? 19  THR A HG21 3  
ATOM 3833  H HG22 . THR A 1 19  ? 4.826   -3.064  4.525   1.00 0.00 ? 19  THR A HG22 3  
ATOM 3834  H HG23 . THR A 1 19  ? 5.245   -1.401  4.107   1.00 0.00 ? 19  THR A HG23 3  
ATOM 3835  N N    . GLU A 1 20  ? 6.268   1.335   7.386   1.00 0.00 ? 20  GLU A N    3  
ATOM 3836  C CA   . GLU A 1 20  ? 5.607   2.569   7.798   1.00 0.00 ? 20  GLU A CA   3  
ATOM 3837  C C    . GLU A 1 20  ? 5.508   3.533   6.622   1.00 0.00 ? 20  GLU A C    3  
ATOM 3838  O O    . GLU A 1 20  ? 6.513   3.860   5.992   1.00 0.00 ? 20  GLU A O    3  
ATOM 3839  C CB   . GLU A 1 20  ? 6.371   3.222   8.953   1.00 0.00 ? 20  GLU A CB   3  
ATOM 3840  C CG   . GLU A 1 20  ? 5.693   4.465   9.508   1.00 0.00 ? 20  GLU A CG   3  
ATOM 3841  C CD   . GLU A 1 20  ? 6.657   5.370   10.252  1.00 0.00 ? 20  GLU A CD   3  
ATOM 3842  O OE1  . GLU A 1 20  ? 7.516   5.992   9.595   1.00 0.00 ? 20  GLU A OE1  3  
ATOM 3843  O OE2  . GLU A 1 20  ? 6.548   5.458   11.494  1.00 0.00 ? 20  GLU A OE2  3  
ATOM 3844  H H    . GLU A 1 20  ? 7.105   1.077   7.818   1.00 0.00 ? 20  GLU A H    3  
ATOM 3845  H HA   . GLU A 1 20  ? 4.610   2.318   8.131   1.00 0.00 ? 20  GLU A HA   3  
ATOM 3846  H HB2  . GLU A 1 20  ? 6.473   2.505   9.753   1.00 0.00 ? 20  GLU A HB2  3  
ATOM 3847  H HB3  . GLU A 1 20  ? 7.356   3.502   8.604   1.00 0.00 ? 20  GLU A HB3  3  
ATOM 3848  H HG2  . GLU A 1 20  ? 5.261   5.019   8.690   1.00 0.00 ? 20  GLU A HG2  3  
ATOM 3849  H HG3  . GLU A 1 20  ? 4.913   4.158   10.187  1.00 0.00 ? 20  GLU A HG3  3  
ATOM 3850  N N    . ILE A 1 21  ? 4.293   3.972   6.322   1.00 0.00 ? 21  ILE A N    3  
ATOM 3851  C CA   . ILE A 1 21  ? 4.068   4.884   5.207   1.00 0.00 ? 21  ILE A CA   3  
ATOM 3852  C C    . ILE A 1 21  ? 4.664   6.262   5.476   1.00 0.00 ? 21  ILE A C    3  
ATOM 3853  O O    . ILE A 1 21  ? 4.093   7.070   6.208   1.00 0.00 ? 21  ILE A O    3  
ATOM 3854  C CB   . ILE A 1 21  ? 2.571   5.035   4.877   1.00 0.00 ? 21  ILE A CB   3  
ATOM 3855  C CG1  . ILE A 1 21  ? 1.784   3.805   5.338   1.00 0.00 ? 21  ILE A CG1  3  
ATOM 3856  C CG2  . ILE A 1 21  ? 2.391   5.248   3.383   1.00 0.00 ? 21  ILE A CG2  3  
ATOM 3857  C CD1  . ILE A 1 21  ? 0.742   4.110   6.389   1.00 0.00 ? 21  ILE A CD1  3  
ATOM 3858  H H    . ILE A 1 21  ? 3.528   3.666   6.852   1.00 0.00 ? 21  ILE A H    3  
ATOM 3859  H HA   . ILE A 1 21  ? 4.560   4.464   4.341   1.00 0.00 ? 21  ILE A HA   3  
ATOM 3860  H HB   . ILE A 1 21  ? 2.197   5.908   5.390   1.00 0.00 ? 21  ILE A HB   3  
ATOM 3861  H HG12 . ILE A 1 21  ? 1.277   3.370   4.488   1.00 0.00 ? 21  ILE A HG12 3  
ATOM 3862  H HG13 . ILE A 1 21  ? 2.470   3.079   5.750   1.00 0.00 ? 21  ILE A HG13 3  
ATOM 3863  H HG21 . ILE A 1 21  ? 3.102   5.984   3.034   1.00 0.00 ? 21  ILE A HG21 3  
ATOM 3864  H HG22 . ILE A 1 21  ? 1.387   5.598   3.188   1.00 0.00 ? 21  ILE A HG22 3  
ATOM 3865  H HG23 . ILE A 1 21  ? 2.554   4.315   2.863   1.00 0.00 ? 21  ILE A HG23 3  
ATOM 3866  H HD11 . ILE A 1 21  ? -0.029  4.732   5.962   1.00 0.00 ? 21  ILE A HD11 3  
ATOM 3867  H HD12 . ILE A 1 21  ? 1.206   4.627   7.217   1.00 0.00 ? 21  ILE A HD12 3  
ATOM 3868  H HD13 . ILE A 1 21  ? 0.305   3.187   6.743   1.00 0.00 ? 21  ILE A HD13 3  
ATOM 3869  N N    . LEU A 1 22  ? 5.820   6.516   4.870   1.00 0.00 ? 22  LEU A N    3  
ATOM 3870  C CA   . LEU A 1 22  ? 6.514   7.788   5.022   1.00 0.00 ? 22  LEU A CA   3  
ATOM 3871  C C    . LEU A 1 22  ? 5.619   8.957   4.620   1.00 0.00 ? 22  LEU A C    3  
ATOM 3872  O O    . LEU A 1 22  ? 5.640   10.011  5.255   1.00 0.00 ? 22  LEU A O    3  
ATOM 3873  C CB   . LEU A 1 22  ? 7.794   7.802   4.179   1.00 0.00 ? 22  LEU A CB   3  
ATOM 3874  C CG   . LEU A 1 22  ? 8.471   6.440   3.997   1.00 0.00 ? 22  LEU A CG   3  
ATOM 3875  C CD1  . LEU A 1 22  ? 9.694   6.568   3.101   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 3876  C CD2  . LEU A 1 22  ? 8.856   5.854   5.346   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 3877  H H    . LEU A 1 22  ? 6.215   5.823   4.303   1.00 0.00 ? 22  LEU A H    3  
ATOM 3878  H HA   . LEU A 1 22  ? 6.780   7.897   6.063   1.00 0.00 ? 22  LEU A HA   3  
ATOM 3879  H HB2  . LEU A 1 22  ? 7.551   8.193   3.201   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3880  H HB3  . LEU A 1 22  ? 8.502   8.470   4.646   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 3881  H HG   . LEU A 1 22  ? 7.779   5.763   3.520   1.00 0.00 ? 22  LEU A HG   3  
ATOM 3882  H HD11 . LEU A 1 22  ? 10.453  5.872   3.426   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 3883  H HD12 . LEU A 1 22  ? 10.080  7.575   3.159   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 3884  H HD13 . LEU A 1 22  ? 9.417   6.348   2.082   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 3885  H HD21 . LEU A 1 22  ? 7.990   5.841   5.993   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 3886  H HD22 . LEU A 1 22  ? 9.631   6.459   5.795   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 3887  H HD23 . LEU A 1 22  ? 9.219   4.847   5.211   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 3888  N N    . VAL A 1 23  ? 4.827   8.764   3.563   1.00 0.00 ? 23  VAL A N    3  
ATOM 3889  C CA   . VAL A 1 23  ? 3.927   9.806   3.084   1.00 0.00 ? 23  VAL A CA   3  
ATOM 3890  C C    . VAL A 1 23  ? 3.053   9.302   1.934   1.00 0.00 ? 23  VAL A C    3  
ATOM 3891  O O    . VAL A 1 23  ? 3.399   8.332   1.257   1.00 0.00 ? 23  VAL A O    3  
ATOM 3892  C CB   . VAL A 1 23  ? 4.713   11.064  2.634   1.00 0.00 ? 23  VAL A CB   3  
ATOM 3893  C CG1  . VAL A 1 23  ? 4.666   11.246  1.121   1.00 0.00 ? 23  VAL A CG1  3  
ATOM 3894  C CG2  . VAL A 1 23  ? 4.181   12.302  3.340   1.00 0.00 ? 23  VAL A CG2  3  
ATOM 3895  H H    . VAL A 1 23  ? 4.851   7.901   3.097   1.00 0.00 ? 23  VAL A H    3  
ATOM 3896  H HA   . VAL A 1 23  ? 3.284   10.088  3.906   1.00 0.00 ? 23  VAL A HA   3  
ATOM 3897  H HB   . VAL A 1 23  ? 5.745   10.933  2.920   1.00 0.00 ? 23  VAL A HB   3  
ATOM 3898  H HG11 . VAL A 1 23  ? 5.261   12.103  0.843   1.00 0.00 ? 23  VAL A HG11 3  
ATOM 3899  H HG12 . VAL A 1 23  ? 3.643   11.402  0.808   1.00 0.00 ? 23  VAL A HG12 3  
ATOM 3900  H HG13 . VAL A 1 23  ? 5.057   10.364  0.638   1.00 0.00 ? 23  VAL A HG13 3  
ATOM 3901  H HG21 . VAL A 1 23  ? 4.881   12.607  4.107   1.00 0.00 ? 23  VAL A HG21 3  
ATOM 3902  H HG22 . VAL A 1 23  ? 3.228   12.075  3.794   1.00 0.00 ? 23  VAL A HG22 3  
ATOM 3903  H HG23 . VAL A 1 23  ? 4.059   13.100  2.625   1.00 0.00 ? 23  VAL A HG23 3  
ATOM 3904  N N    . ALA A 1 24  ? 1.932   9.981   1.713   1.00 0.00 ? 24  ALA A N    3  
ATOM 3905  C CA   . ALA A 1 24  ? 1.012   9.625   0.640   1.00 0.00 ? 24  ALA A CA   3  
ATOM 3906  C C    . ALA A 1 24  ? 0.424   10.883  0.007   1.00 0.00 ? 24  ALA A C    3  
ATOM 3907  O O    . ALA A 1 24  ? 0.419   11.947  0.624   1.00 0.00 ? 24  ALA A O    3  
ATOM 3908  C CB   . ALA A 1 24  ? -0.092  8.718   1.159   1.00 0.00 ? 24  ALA A CB   3  
ATOM 3909  H H    . ALA A 1 24  ? 1.723   10.752  2.282   1.00 0.00 ? 24  ALA A H    3  
ATOM 3910  H HA   . ALA A 1 24  ? 1.572   9.081   -0.111  1.00 0.00 ? 24  ALA A HA   3  
ATOM 3911  H HB1  . ALA A 1 24  ? -0.135  7.820   0.558   1.00 0.00 ? 24  ALA A HB1  3  
ATOM 3912  H HB2  . ALA A 1 24  ? -1.039  9.235   1.099   1.00 0.00 ? 24  ALA A HB2  3  
ATOM 3913  H HB3  . ALA A 1 24  ? 0.111   8.455   2.186   1.00 0.00 ? 24  ALA A HB3  3  
ATOM 3914  N N    . ASN A 1 25  ? -0.051  10.765  -1.227  1.00 0.00 ? 25  ASN A N    3  
ATOM 3915  C CA   . ASN A 1 25  ? -0.615  11.912  -1.932  1.00 0.00 ? 25  ASN A CA   3  
ATOM 3916  C C    . ASN A 1 25  ? -2.138  11.958  -1.831  1.00 0.00 ? 25  ASN A C    3  
ATOM 3917  O O    . ASN A 1 25  ? -2.754  11.164  -1.121  1.00 0.00 ? 25  ASN A O    3  
ATOM 3918  C CB   . ASN A 1 25  ? -0.193  11.885  -3.402  1.00 0.00 ? 25  ASN A CB   3  
ATOM 3919  C CG   . ASN A 1 25  ? -0.915  10.808  -4.191  1.00 0.00 ? 25  ASN A CG   3  
ATOM 3920  O OD1  . ASN A 1 25  ? -0.932  9.641   -3.801  1.00 0.00 ? 25  ASN A OD1  3  
ATOM 3921  N ND2  . ASN A 1 25  ? -1.516  11.197  -5.308  1.00 0.00 ? 25  ASN A ND2  3  
ATOM 3922  H H    . ASN A 1 25  ? -0.005  9.896   -1.678  1.00 0.00 ? 25  ASN A H    3  
ATOM 3923  H HA   . ASN A 1 25  ? -0.216  12.804  -1.471  1.00 0.00 ? 25  ASN A HA   3  
ATOM 3924  H HB2  . ASN A 1 25  ? -0.412  12.843  -3.851  1.00 0.00 ? 25  ASN A HB2  3  
ATOM 3925  H HB3  . ASN A 1 25  ? 0.868   11.698  -3.461  1.00 0.00 ? 25  ASN A HB3  3  
ATOM 3926  H HD21 . ASN A 1 25  ? -1.461  12.141  -5.560  1.00 0.00 ? 25  ASN A HD21 3  
ATOM 3927  H HD22 . ASN A 1 25  ? -1.992  10.522  -5.839  1.00 0.00 ? 25  ASN A HD22 3  
ATOM 3928  N N    . ASP A 1 26  ? -2.729  12.909  -2.552  1.00 0.00 ? 26  ASP A N    3  
ATOM 3929  C CA   . ASP A 1 26  ? -4.179  13.080  -2.553  1.00 0.00 ? 26  ASP A CA   3  
ATOM 3930  C C    . ASP A 1 26  ? -4.864  11.834  -3.090  1.00 0.00 ? 26  ASP A C    3  
ATOM 3931  O O    . ASP A 1 26  ? -5.500  11.111  -2.330  1.00 0.00 ? 26  ASP A O    3  
ATOM 3932  C CB   . ASP A 1 26  ? -4.572  14.299  -3.390  1.00 0.00 ? 26  ASP A CB   3  
ATOM 3933  C CG   . ASP A 1 26  ? -3.662  15.486  -3.145  1.00 0.00 ? 26  ASP A CG   3  
ATOM 3934  O OD1  . ASP A 1 26  ? -3.501  15.878  -1.971  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 3935  O OD2  . ASP A 1 26  ? -3.109  16.022  -4.128  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 3936  H H    . ASP A 1 26  ? -2.162  13.502  -3.088  1.00 0.00 ? 26  ASP A H    3  
ATOM 3937  H HA   . ASP A 1 26  ? -4.500  13.232  -1.534  1.00 0.00 ? 26  ASP A HA   3  
ATOM 3938  H HB2  . ASP A 1 26  ? -4.523  14.041  -4.438  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 3939  H HB3  . ASP A 1 26  ? -5.584  14.587  -3.142  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 3940  N N    . LYS A 1 27  ? -4.738  11.599  -4.398  1.00 0.00 ? 27  LYS A N    3  
ATOM 3941  C CA   . LYS A 1 27  ? -5.359  10.438  -5.038  1.00 0.00 ? 27  LYS A CA   3  
ATOM 3942  C C    . LYS A 1 27  ? -5.388  9.241   -4.088  1.00 0.00 ? 27  LYS A C    3  
ATOM 3943  O O    . LYS A 1 27  ? -6.462  8.786   -3.694  1.00 0.00 ? 27  LYS A O    3  
ATOM 3944  C CB   . LYS A 1 27  ? -4.615  10.083  -6.322  1.00 0.00 ? 27  LYS A CB   3  
ATOM 3945  C CG   . LYS A 1 27  ? -4.581  11.213  -7.338  1.00 0.00 ? 27  LYS A CG   3  
ATOM 3946  C CD   . LYS A 1 27  ? -5.757  11.137  -8.300  1.00 0.00 ? 27  LYS A CD   3  
ATOM 3947  C CE   . LYS A 1 27  ? -7.027  11.698  -7.675  1.00 0.00 ? 27  LYS A CE   3  
ATOM 3948  N NZ   . LYS A 1 27  ? -7.765  12.583  -8.616  1.00 0.00 ? 27  LYS A NZ   3  
ATOM 3949  H H    . LYS A 1 27  ? -4.246  12.240  -4.953  1.00 0.00 ? 27  LYS A H    3  
ATOM 3950  H HA   . LYS A 1 27  ? -6.376  10.704  -5.285  1.00 0.00 ? 27  LYS A HA   3  
ATOM 3951  H HB2  . LYS A 1 27  ? -3.596  9.822   -6.073  1.00 0.00 ? 27  LYS A HB2  3  
ATOM 3952  H HB3  . LYS A 1 27  ? -5.092  9.230   -6.778  1.00 0.00 ? 27  LYS A HB3  3  
ATOM 3953  H HG2  . LYS A 1 27  ? -4.621  12.156  -6.814  1.00 0.00 ? 27  LYS A HG2  3  
ATOM 3954  H HG3  . LYS A 1 27  ? -3.664  11.151  -7.902  1.00 0.00 ? 27  LYS A HG3  3  
ATOM 3955  H HD2  . LYS A 1 27  ? -5.524  11.707  -9.186  1.00 0.00 ? 27  LYS A HD2  3  
ATOM 3956  H HD3  . LYS A 1 27  ? -5.925  10.103  -8.567  1.00 0.00 ? 27  LYS A HD3  3  
ATOM 3957  H HE2  . LYS A 1 27  ? -7.667  10.875  -7.392  1.00 0.00 ? 27  LYS A HE2  3  
ATOM 3958  H HE3  . LYS A 1 27  ? -6.759  12.263  -6.796  1.00 0.00 ? 27  LYS A HE3  3  
ATOM 3959  H HZ1  . LYS A 1 27  ? -7.518  12.350  -9.599  1.00 0.00 ? 27  LYS A HZ1  3  
ATOM 3960  H HZ2  . LYS A 1 27  ? -7.523  13.579  -8.435  1.00 0.00 ? 27  LYS A HZ2  3  
ATOM 3961  H HZ3  . LYS A 1 27  ? -8.791  12.461  -8.492  1.00 0.00 ? 27  LYS A HZ3  3  
ATOM 3962  N N    . ALA A 1 28  ? -4.208  8.750   -3.707  1.00 0.00 ? 28  ALA A N    3  
ATOM 3963  C CA   . ALA A 1 28  ? -4.110  7.621   -2.782  1.00 0.00 ? 28  ALA A CA   3  
ATOM 3964  C C    . ALA A 1 28  ? -5.047  7.802   -1.589  1.00 0.00 ? 28  ALA A C    3  
ATOM 3965  O O    . ALA A 1 28  ? -5.892  6.950   -1.311  1.00 0.00 ? 28  ALA A O    3  
ATOM 3966  C CB   . ALA A 1 28  ? -2.677  7.467   -2.295  1.00 0.00 ? 28  ALA A CB   3  
ATOM 3967  H H    . ALA A 1 28  ? -3.382  9.157   -4.051  1.00 0.00 ? 28  ALA A H    3  
ATOM 3968  H HA   . ALA A 1 28  ? -4.385  6.724   -3.315  1.00 0.00 ? 28  ALA A HA   3  
ATOM 3969  H HB1  . ALA A 1 28  ? -2.678  7.215   -1.244  1.00 0.00 ? 28  ALA A HB1  3  
ATOM 3970  H HB2  . ALA A 1 28  ? -2.146  8.397   -2.441  1.00 0.00 ? 28  ALA A HB2  3  
ATOM 3971  H HB3  . ALA A 1 28  ? -2.188  6.683   -2.853  1.00 0.00 ? 28  ALA A HB3  3  
ATOM 3972  N N    . CYS A 1 29  ? -4.885  8.919   -0.893  1.00 0.00 ? 29  CYS A N    3  
ATOM 3973  C CA   . CYS A 1 29  ? -5.708  9.229   0.270   1.00 0.00 ? 29  CYS A CA   3  
ATOM 3974  C C    . CYS A 1 29  ? -7.189  9.159   -0.089  1.00 0.00 ? 29  CYS A C    3  
ATOM 3975  O O    . CYS A 1 29  ? -8.003  8.669   0.693   1.00 0.00 ? 29  CYS A O    3  
ATOM 3976  C CB   . CYS A 1 29  ? -5.350  10.618  0.802   1.00 0.00 ? 29  CYS A CB   3  
ATOM 3977  S SG   . CYS A 1 29  ? -6.631  11.871  0.550   1.00 0.00 ? 29  CYS A SG   3  
ATOM 3978  H H    . CYS A 1 29  ? -4.191  9.554   -1.167  1.00 0.00 ? 29  CYS A H    3  
ATOM 3979  H HA   . CYS A 1 29  ? -5.502  8.489   1.030   1.00 0.00 ? 29  CYS A HA   3  
ATOM 3980  H HB2  . CYS A 1 29  ? -5.162  10.552  1.864   1.00 0.00 ? 29  CYS A HB2  3  
ATOM 3981  H HB3  . CYS A 1 29  ? -4.454  10.962  0.307   1.00 0.00 ? 29  CYS A HB3  3  
ATOM 3982  H HG   . CYS A 1 29  ? -7.751  11.426  1.099   1.00 0.00 ? 29  CYS A HG   3  
ATOM 3983  N N    . GLY A 1 30  ? -7.524  9.638   -1.284  1.00 0.00 ? 30  GLY A N    3  
ATOM 3984  C CA   . GLY A 1 30  ? -8.901  9.606   -1.735  1.00 0.00 ? 30  GLY A CA   3  
ATOM 3985  C C    . GLY A 1 30  ? -9.416  8.186   -1.828  1.00 0.00 ? 30  GLY A C    3  
ATOM 3986  O O    . GLY A 1 30  ? -10.565 7.908   -1.486  1.00 0.00 ? 30  GLY A O    3  
ATOM 3987  H H    . GLY A 1 30  ? -6.826  10.005  -1.865  1.00 0.00 ? 30  GLY A H    3  
ATOM 3988  H HA2  . GLY A 1 30  ? -9.513  10.161  -1.040  1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3989  H HA3  . GLY A 1 30  ? -8.965  10.067  -2.710  1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3990  N N    . LEU A 1 31  ? -8.546  7.288   -2.281  1.00 0.00 ? 31  LEU A N    3  
ATOM 3991  C CA   . LEU A 1 31  ? -8.886  5.877   -2.411  1.00 0.00 ? 31  LEU A CA   3  
ATOM 3992  C C    . LEU A 1 31  ? -9.495  5.368   -1.103  1.00 0.00 ? 31  LEU A C    3  
ATOM 3993  O O    . LEU A 1 31  ? -10.632 4.893   -1.089  1.00 0.00 ? 31  LEU A O    3  
ATOM 3994  C CB   . LEU A 1 31  ? -7.627  5.082   -2.803  1.00 0.00 ? 31  LEU A CB   3  
ATOM 3995  C CG   . LEU A 1 31  ? -7.730  3.550   -2.801  1.00 0.00 ? 31  LEU A CG   3  
ATOM 3996  C CD1  . LEU A 1 31  ? -7.245  2.998   -1.473  1.00 0.00 ? 31  LEU A CD1  3  
ATOM 3997  C CD2  . LEU A 1 31  ? -9.148  3.074   -3.106  1.00 0.00 ? 31  LEU A CD2  3  
ATOM 3998  H H    . LEU A 1 31  ? -7.646  7.586   -2.528  1.00 0.00 ? 31  LEU A H    3  
ATOM 3999  H HA   . LEU A 1 31  ? -9.620  5.785   -3.196  1.00 0.00 ? 31  LEU A HA   3  
ATOM 4000  H HB2  . LEU A 1 31  ? -7.339  5.390   -3.796  1.00 0.00 ? 31  LEU A HB2  3  
ATOM 4001  H HB3  . LEU A 1 31  ? -6.835  5.361   -2.123  1.00 0.00 ? 31  LEU A HB3  3  
ATOM 4002  H HG   . LEU A 1 31  ? -7.079  3.159   -3.573  1.00 0.00 ? 31  LEU A HG   3  
ATOM 4003  H HD11 . LEU A 1 31  ? -6.177  2.833   -1.523  1.00 0.00 ? 31  LEU A HD11 3  
ATOM 4004  H HD12 . LEU A 1 31  ? -7.744  2.064   -1.263  1.00 0.00 ? 31  LEU A HD12 3  
ATOM 4005  H HD13 . LEU A 1 31  ? -7.462  3.709   -0.688  1.00 0.00 ? 31  LEU A HD13 3  
ATOM 4006  H HD21 . LEU A 1 31  ? -9.824  3.452   -2.355  1.00 0.00 ? 31  LEU A HD21 3  
ATOM 4007  H HD22 . LEU A 1 31  ? -9.171  1.995   -3.103  1.00 0.00 ? 31  LEU A HD22 3  
ATOM 4008  H HD23 . LEU A 1 31  ? -9.448  3.439   -4.077  1.00 0.00 ? 31  LEU A HD23 3  
ATOM 4009  N N    . LEU A 1 32  ? -8.753  5.492   -0.004  1.00 0.00 ? 32  LEU A N    3  
ATOM 4010  C CA   . LEU A 1 32  ? -9.274  5.058   1.292   1.00 0.00 ? 32  LEU A CA   3  
ATOM 4011  C C    . LEU A 1 32  ? -9.988  6.206   2.002   1.00 0.00 ? 32  LEU A C    3  
ATOM 4012  O O    . LEU A 1 32  ? -11.217 6.250   2.051   1.00 0.00 ? 32  LEU A O    3  
ATOM 4013  C CB   . LEU A 1 32  ? -8.185  4.488   2.212   1.00 0.00 ? 32  LEU A CB   3  
ATOM 4014  C CG   . LEU A 1 32  ? -6.735  4.604   1.735   1.00 0.00 ? 32  LEU A CG   3  
ATOM 4015  C CD1  . LEU A 1 32  ? -6.282  6.056   1.717   1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4016  C CD2  . LEU A 1 32  ? -5.841  3.778   2.646   1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4017  H H    . LEU A 1 32  ? -7.857  5.895   -0.075  1.00 0.00 ? 32  LEU A H    3  
ATOM 4018  H HA   . LEU A 1 32  ? -10.000 4.281   1.099   1.00 0.00 ? 32  LEU A HA   3  
ATOM 4019  H HB2  . LEU A 1 32  ? -8.260  4.990   3.164   1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4020  H HB3  . LEU A 1 32  ? -8.400  3.440   2.368   1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4021  H HG   . LEU A 1 32  ? -6.653  4.212   0.735   1.00 0.00 ? 32  LEU A HG   3  
ATOM 4022  H HD11 . LEU A 1 32  ? -5.960  6.345   2.706   1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4023  H HD12 . LEU A 1 32  ? -7.103  6.687   1.408   1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4024  H HD13 . LEU A 1 32  ? -5.461  6.168   1.024   1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4025  H HD21 . LEU A 1 32  ? -5.473  2.915   2.107   1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4026  H HD22 . LEU A 1 32  ? -6.412  3.448   3.506   1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4027  H HD23 . LEU A 1 32  ? -5.006  4.380   2.976   1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4028  N N    . GLY A 1 33  ? -9.205  7.128   2.552   1.00 0.00 ? 33  GLY A N    3  
ATOM 4029  C CA   . GLY A 1 33  ? -9.769  8.264   3.257   1.00 0.00 ? 33  GLY A CA   3  
ATOM 4030  C C    . GLY A 1 33  ? -8.781  8.866   4.232   1.00 0.00 ? 33  GLY A C    3  
ATOM 4031  O O    . GLY A 1 33  ? -9.165  9.433   5.257   1.00 0.00 ? 33  GLY A O    3  
ATOM 4032  H H    . GLY A 1 33  ? -8.234  7.034   2.481   1.00 0.00 ? 33  GLY A H    3  
ATOM 4033  H HA2  . GLY A 1 33  ? -10.056 9.018   2.537   1.00 0.00 ? 33  GLY A HA2  3  
ATOM 4034  H HA3  . GLY A 1 33  ? -10.645 7.943   3.800   1.00 0.00 ? 33  GLY A HA3  3  
ATOM 4035  N N    . TYR A 1 34  ? -7.499  8.732   3.911   1.00 0.00 ? 34  TYR A N    3  
ATOM 4036  C CA   . TYR A 1 34  ? -6.429  9.254   4.756   1.00 0.00 ? 34  TYR A CA   3  
ATOM 4037  C C    . TYR A 1 34  ? -5.753  10.449  4.090   1.00 0.00 ? 34  TYR A C    3  
ATOM 4038  O O    . TYR A 1 34  ? -6.410  11.260  3.437   1.00 0.00 ? 34  TYR A O    3  
ATOM 4039  C CB   . TYR A 1 34  ? -5.394  8.156   5.021   1.00 0.00 ? 34  TYR A CB   3  
ATOM 4040  C CG   . TYR A 1 34  ? -5.881  7.046   5.924   1.00 0.00 ? 34  TYR A CG   3  
ATOM 4041  C CD1  . TYR A 1 34  ? -6.886  6.181   5.514   1.00 0.00 ? 34  TYR A CD1  3  
ATOM 4042  C CD2  . TYR A 1 34  ? -5.328  6.861   7.184   1.00 0.00 ? 34  TYR A CD2  3  
ATOM 4043  C CE1  . TYR A 1 34  ? -7.328  5.163   6.336   1.00 0.00 ? 34  TYR A CE1  3  
ATOM 4044  C CE2  . TYR A 1 34  ? -5.764  5.844   8.013   1.00 0.00 ? 34  TYR A CE2  3  
ATOM 4045  C CZ   . TYR A 1 34  ? -6.763  4.998   7.583   1.00 0.00 ? 34  TYR A CZ   3  
ATOM 4046  O OH   . TYR A 1 34  ? -7.201  3.984   8.404   1.00 0.00 ? 34  TYR A OH   3  
ATOM 4047  H H    . TYR A 1 34  ? -7.264  8.266   3.080   1.00 0.00 ? 34  TYR A H    3  
ATOM 4048  H HA   . TYR A 1 34  ? -6.863  9.567   5.691   1.00 0.00 ? 34  TYR A HA   3  
ATOM 4049  H HB2  . TYR A 1 34  ? -5.106  7.710   4.081   1.00 0.00 ? 34  TYR A HB2  3  
ATOM 4050  H HB3  . TYR A 1 34  ? -4.524  8.600   5.482   1.00 0.00 ? 34  TYR A HB3  3  
ATOM 4051  H HD1  . TYR A 1 34  ? -7.327  6.313   4.537   1.00 0.00 ? 34  TYR A HD1  3  
ATOM 4052  H HD2  . TYR A 1 34  ? -4.542  7.523   7.516   1.00 0.00 ? 34  TYR A HD2  3  
ATOM 4053  H HE1  . TYR A 1 34  ? -8.110  4.500   5.999   1.00 0.00 ? 34  TYR A HE1  3  
ATOM 4054  H HE2  . TYR A 1 34  ? -5.322  5.717   8.989   1.00 0.00 ? 34  TYR A HE2  3  
ATOM 4055  H HH   . TYR A 1 34  ? -8.101  4.166   8.688   1.00 0.00 ? 34  TYR A HH   3  
ATOM 4056  N N    . SER A 1 35  ? -4.433  10.536  4.258   1.00 0.00 ? 35  SER A N    3  
ATOM 4057  C CA   . SER A 1 35  ? -3.626  11.605  3.674   1.00 0.00 ? 35  SER A CA   3  
ATOM 4058  C C    . SER A 1 35  ? -2.210  11.546  4.224   1.00 0.00 ? 35  SER A C    3  
ATOM 4059  O O    . SER A 1 35  ? -1.953  10.867  5.215   1.00 0.00 ? 35  SER A O    3  
ATOM 4060  C CB   . SER A 1 35  ? -4.229  12.980  3.944   1.00 0.00 ? 35  SER A CB   3  
ATOM 4061  O OG   . SER A 1 35  ? -4.341  13.230  5.332   1.00 0.00 ? 35  SER A OG   3  
ATOM 4062  H H    . SER A 1 35  ? -3.977  9.847   4.784   1.00 0.00 ? 35  SER A H    3  
ATOM 4063  H HA   . SER A 1 35  ? -3.594  11.446  2.608   1.00 0.00 ? 35  SER A HA   3  
ATOM 4064  H HB2  . SER A 1 35  ? -3.594  13.736  3.501   1.00 0.00 ? 35  SER A HB2  3  
ATOM 4065  H HB3  . SER A 1 35  ? -5.207  13.026  3.495   1.00 0.00 ? 35  SER A HB3  3  
ATOM 4066  H HG   . SER A 1 35  ? -4.228  14.169  5.499   1.00 0.00 ? 35  SER A HG   3  
ATOM 4067  N N    . SER A 1 36  ? -1.296  12.254  3.577   1.00 0.00 ? 36  SER A N    3  
ATOM 4068  C CA   . SER A 1 36  ? 0.099   12.272  4.004   1.00 0.00 ? 36  SER A CA   3  
ATOM 4069  C C    . SER A 1 36  ? 0.228   12.544  5.502   1.00 0.00 ? 36  SER A C    3  
ATOM 4070  O O    . SER A 1 36  ? 1.149   12.050  6.150   1.00 0.00 ? 36  SER A O    3  
ATOM 4071  C CB   . SER A 1 36  ? 0.878   13.331  3.221   1.00 0.00 ? 36  SER A CB   3  
ATOM 4072  O OG   . SER A 1 36  ? 0.012   14.108  2.411   1.00 0.00 ? 36  SER A OG   3  
ATOM 4073  H H    . SER A 1 36  ? -1.564  12.772  2.790   1.00 0.00 ? 36  SER A H    3  
ATOM 4074  H HA   . SER A 1 36  ? 0.521   11.302  3.790   1.00 0.00 ? 36  SER A HA   3  
ATOM 4075  H HB2  . SER A 1 36  ? 1.386   13.985  3.913   1.00 0.00 ? 36  SER A HB2  3  
ATOM 4076  H HB3  . SER A 1 36  ? 1.605   12.844  2.587   1.00 0.00 ? 36  SER A HB3  3  
ATOM 4077  H HG   . SER A 1 36  ? -0.595  14.597  2.969   1.00 0.00 ? 36  SER A HG   3  
ATOM 4078  N N    . GLN A 1 37  ? -0.684  13.348  6.041   1.00 0.00 ? 37  GLN A N    3  
ATOM 4079  C CA   . GLN A 1 37  ? -0.654  13.700  7.461   1.00 0.00 ? 37  GLN A CA   3  
ATOM 4080  C C    . GLN A 1 37  ? -1.640  12.878  8.295   1.00 0.00 ? 37  GLN A C    3  
ATOM 4081  O O    . GLN A 1 37  ? -1.677  13.011  9.519   1.00 0.00 ? 37  GLN A O    3  
ATOM 4082  C CB   . GLN A 1 37  ? -0.951  15.189  7.635   1.00 0.00 ? 37  GLN A CB   3  
ATOM 4083  C CG   . GLN A 1 37  ? -2.305  15.609  7.087   1.00 0.00 ? 37  GLN A CG   3  
ATOM 4084  C CD   . GLN A 1 37  ? -2.254  16.936  6.354   1.00 0.00 ? 37  GLN A CD   3  
ATOM 4085  O OE1  . GLN A 1 37  ? -2.893  17.113  5.318   1.00 0.00 ? 37  GLN A OE1  3  
ATOM 4086  N NE2  . GLN A 1 37  ? -1.488  17.880  6.891   1.00 0.00 ? 37  GLN A NE2  3  
ATOM 4087  H H    . GLN A 1 37  ? -1.386  13.724  5.471   1.00 0.00 ? 37  GLN A H    3  
ATOM 4088  H HA   . GLN A 1 37  ? 0.344   13.504  7.823   1.00 0.00 ? 37  GLN A HA   3  
ATOM 4089  H HB2  . GLN A 1 37  ? -0.922  15.430  8.688   1.00 0.00 ? 37  GLN A HB2  3  
ATOM 4090  H HB3  . GLN A 1 37  ? -0.188  15.759  7.124   1.00 0.00 ? 37  GLN A HB3  3  
ATOM 4091  H HG2  . GLN A 1 37  ? -2.650  14.851  6.401   1.00 0.00 ? 37  GLN A HG2  3  
ATOM 4092  H HG3  . GLN A 1 37  ? -3.001  15.694  7.908   1.00 0.00 ? 37  GLN A HG3  3  
ATOM 4093  H HE21 . GLN A 1 37  ? -1.005  17.672  7.720   1.00 0.00 ? 37  GLN A HE21 3  
ATOM 4094  H HE22 . GLN A 1 37  ? -1.436  18.748  6.438   1.00 0.00 ? 37  GLN A HE22 3  
ATOM 4095  N N    . ASP A 1 38  ? -2.455  12.052  7.643   1.00 0.00 ? 38  ASP A N    3  
ATOM 4096  C CA   . ASP A 1 38  ? -3.447  11.250  8.359   1.00 0.00 ? 38  ASP A CA   3  
ATOM 4097  C C    . ASP A 1 38  ? -3.134  9.753   8.321   1.00 0.00 ? 38  ASP A C    3  
ATOM 4098  O O    . ASP A 1 38  ? -3.779  8.968   9.018   1.00 0.00 ? 38  ASP A O    3  
ATOM 4099  C CB   . ASP A 1 38  ? -4.841  11.497  7.779   1.00 0.00 ? 38  ASP A CB   3  
ATOM 4100  C CG   . ASP A 1 38  ? -5.392  12.860  8.155   1.00 0.00 ? 38  ASP A CG   3  
ATOM 4101  O OD1  . ASP A 1 38  ? -5.015  13.377  9.228   1.00 0.00 ? 38  ASP A OD1  3  
ATOM 4102  O OD2  . ASP A 1 38  ? -6.201  13.407  7.378   1.00 0.00 ? 38  ASP A OD2  3  
ATOM 4103  H H    . ASP A 1 38  ? -2.402  11.995  6.668   1.00 0.00 ? 38  ASP A H    3  
ATOM 4104  H HA   . ASP A 1 38  ? -3.442  11.574  9.388   1.00 0.00 ? 38  ASP A HA   3  
ATOM 4105  H HB2  . ASP A 1 38  ? -4.793  11.435  6.703   1.00 0.00 ? 38  ASP A HB2  3  
ATOM 4106  H HB3  . ASP A 1 38  ? -5.517  10.740  8.148   1.00 0.00 ? 38  ASP A HB3  3  
ATOM 4107  N N    . LEU A 1 39  ? -2.158  9.353   7.514   1.00 0.00 ? 39  LEU A N    3  
ATOM 4108  C CA   . LEU A 1 39  ? -1.797  7.940   7.415   1.00 0.00 ? 39  LEU A CA   3  
ATOM 4109  C C    . LEU A 1 39  ? -0.332  7.717   7.777   1.00 0.00 ? 39  LEU A C    3  
ATOM 4110  O O    . LEU A 1 39  ? 0.077   6.594   8.079   1.00 0.00 ? 39  LEU A O    3  
ATOM 4111  C CB   . LEU A 1 39  ? -2.090  7.409   6.006   1.00 0.00 ? 39  LEU A CB   3  
ATOM 4112  C CG   . LEU A 1 39  ? -1.296  8.066   4.880   1.00 0.00 ? 39  LEU A CG   3  
ATOM 4113  C CD1  . LEU A 1 39  ? -0.084  7.222   4.519   1.00 0.00 ? 39  LEU A CD1  3  
ATOM 4114  C CD2  . LEU A 1 39  ? -2.183  8.273   3.663   1.00 0.00 ? 39  LEU A CD2  3  
ATOM 4115  H H    . LEU A 1 39  ? -1.672  10.014  6.979   1.00 0.00 ? 39  LEU A H    3  
ATOM 4116  H HA   . LEU A 1 39  ? -2.408  7.400   8.122   1.00 0.00 ? 39  LEU A HA   3  
ATOM 4117  H HB2  . LEU A 1 39  ? -1.888  6.349   5.989   1.00 0.00 ? 39  LEU A HB2  3  
ATOM 4118  H HB3  . LEU A 1 39  ? -3.141  7.557   5.805   1.00 0.00 ? 39  LEU A HB3  3  
ATOM 4119  H HG   . LEU A 1 39  ? -0.944  9.034   5.209   1.00 0.00 ? 39  LEU A HG   3  
ATOM 4120  H HD11 . LEU A 1 39  ? 0.447   6.951   5.420   1.00 0.00 ? 39  LEU A HD11 3  
ATOM 4121  H HD12 . LEU A 1 39  ? 0.569   7.787   3.873   1.00 0.00 ? 39  LEU A HD12 3  
ATOM 4122  H HD13 . LEU A 1 39  ? -0.407  6.326   4.010   1.00 0.00 ? 39  LEU A HD13 3  
ATOM 4123  H HD21 . LEU A 1 39  ? -2.221  9.323   3.420   1.00 0.00 ? 39  LEU A HD21 3  
ATOM 4124  H HD22 . LEU A 1 39  ? -3.179  7.915   3.881   1.00 0.00 ? 39  LEU A HD22 3  
ATOM 4125  H HD23 . LEU A 1 39  ? -1.779  7.723   2.826   1.00 0.00 ? 39  LEU A HD23 3  
ATOM 4126  N N    . ILE A 1 40  ? 0.454   8.788   7.756   1.00 0.00 ? 40  ILE A N    3  
ATOM 4127  C CA   . ILE A 1 40  ? 1.869   8.697   8.093   1.00 0.00 ? 40  ILE A CA   3  
ATOM 4128  C C    . ILE A 1 40  ? 2.056   8.244   9.539   1.00 0.00 ? 40  ILE A C    3  
ATOM 4129  O O    . ILE A 1 40  ? 1.348   8.700   10.438  1.00 0.00 ? 40  ILE A O    3  
ATOM 4130  C CB   . ILE A 1 40  ? 2.592   10.044  7.872   1.00 0.00 ? 40  ILE A CB   3  
ATOM 4131  C CG1  . ILE A 1 40  ? 4.116   9.856   7.931   1.00 0.00 ? 40  ILE A CG1  3  
ATOM 4132  C CG2  . ILE A 1 40  ? 2.118   11.086  8.880   1.00 0.00 ? 40  ILE A CG2  3  
ATOM 4133  C CD1  . ILE A 1 40  ? 4.711   9.972   9.322   1.00 0.00 ? 40  ILE A CD1  3  
ATOM 4134  H H    . ILE A 1 40  ? 0.073   9.657   7.515   1.00 0.00 ? 40  ILE A H    3  
ATOM 4135  H HA   . ILE A 1 40  ? 2.316   7.961   7.437   1.00 0.00 ? 40  ILE A HA   3  
ATOM 4136  H HB   . ILE A 1 40  ? 2.325   10.400  6.887   1.00 0.00 ? 40  ILE A HB   3  
ATOM 4137  H HG12 . ILE A 1 40  ? 4.363   8.876   7.552   1.00 0.00 ? 40  ILE A HG12 3  
ATOM 4138  H HG13 . ILE A 1 40  ? 4.586   10.602  7.308   1.00 0.00 ? 40  ILE A HG13 3  
ATOM 4139  H HG21 . ILE A 1 40  ? 1.042   11.168  8.836   1.00 0.00 ? 40  ILE A HG21 3  
ATOM 4140  H HG22 . ILE A 1 40  ? 2.561   12.043  8.644   1.00 0.00 ? 40  ILE A HG22 3  
ATOM 4141  H HG23 . ILE A 1 40  ? 2.416   10.787  9.874   1.00 0.00 ? 40  ILE A HG23 3  
ATOM 4142  H HD11 . ILE A 1 40  ? 4.866   11.014  9.562   1.00 0.00 ? 40  ILE A HD11 3  
ATOM 4143  H HD12 . ILE A 1 40  ? 5.656   9.451   9.355   1.00 0.00 ? 40  ILE A HD12 3  
ATOM 4144  H HD13 . ILE A 1 40  ? 4.034   9.533   10.042  1.00 0.00 ? 40  ILE A HD13 3  
ATOM 4145  N N    . GLY A 1 41  ? 3.010   7.342   9.754   1.00 0.00 ? 41  GLY A N    3  
ATOM 4146  C CA   . GLY A 1 41  ? 3.271   6.847   11.091  1.00 0.00 ? 41  GLY A CA   3  
ATOM 4147  C C    . GLY A 1 41  ? 2.932   5.377   11.248  1.00 0.00 ? 41  GLY A C    3  
ATOM 4148  O O    . GLY A 1 41  ? 3.603   4.656   11.985  1.00 0.00 ? 41  GLY A O    3  
ATOM 4149  H H    . GLY A 1 41  ? 3.540   7.014   8.997   1.00 0.00 ? 41  GLY A H    3  
ATOM 4150  H HA2  . GLY A 1 41  ? 4.318   6.986   11.314  1.00 0.00 ? 41  GLY A HA2  3  
ATOM 4151  H HA3  . GLY A 1 41  ? 2.685   7.417   11.796  1.00 0.00 ? 41  GLY A HA3  3  
ATOM 4152  N N    . GLN A 1 42  ? 1.887   4.931   10.555  1.00 0.00 ? 42  GLN A N    3  
ATOM 4153  C CA   . GLN A 1 42  ? 1.470   3.532   10.626  1.00 0.00 ? 42  GLN A CA   3  
ATOM 4154  C C    . GLN A 1 42  ? 1.875   2.781   9.364   1.00 0.00 ? 42  GLN A C    3  
ATOM 4155  O O    . GLN A 1 42  ? 2.694   3.261   8.582   1.00 0.00 ? 42  GLN A O    3  
ATOM 4156  C CB   . GLN A 1 42  ? -0.044  3.431   10.836  1.00 0.00 ? 42  GLN A CB   3  
ATOM 4157  C CG   . GLN A 1 42  ? -0.822  4.588   10.236  1.00 0.00 ? 42  GLN A CG   3  
ATOM 4158  C CD   . GLN A 1 42  ? -1.161  5.656   11.259  1.00 0.00 ? 42  GLN A CD   3  
ATOM 4159  O OE1  . GLN A 1 42  ? -1.436  5.355   12.420  1.00 0.00 ? 42  GLN A OE1  3  
ATOM 4160  N NE2  . GLN A 1 42  ? -1.144  6.911   10.828  1.00 0.00 ? 42  GLN A NE2  3  
ATOM 4161  H H    . GLN A 1 42  ? 1.390   5.551   9.981   1.00 0.00 ? 42  GLN A H    3  
ATOM 4162  H HA   . GLN A 1 42  ? 1.968   3.084   11.471  1.00 0.00 ? 42  GLN A HA   3  
ATOM 4163  H HB2  . GLN A 1 42  ? -0.397  2.517   10.383  1.00 0.00 ? 42  GLN A HB2  3  
ATOM 4164  H HB3  . GLN A 1 42  ? -0.249  3.400   11.894  1.00 0.00 ? 42  GLN A HB3  3  
ATOM 4165  H HG2  . GLN A 1 42  ? -0.230  5.038   9.452   1.00 0.00 ? 42  GLN A HG2  3  
ATOM 4166  H HG3  . GLN A 1 42  ? -1.741  4.207   9.816   1.00 0.00 ? 42  GLN A HG3  3  
ATOM 4167  H HE21 . GLN A 1 42  ? -0.915  7.074   9.888   1.00 0.00 ? 42  GLN A HE21 3  
ATOM 4168  H HE22 . GLN A 1 42  ? -1.359  7.622   11.465  1.00 0.00 ? 42  GLN A HE22 3  
ATOM 4169  N N    . LYS A 1 43  ? 1.297   1.601   9.172   1.00 0.00 ? 43  LYS A N    3  
ATOM 4170  C CA   . LYS A 1 43  ? 1.595   0.780   8.003   1.00 0.00 ? 43  LYS A CA   3  
ATOM 4171  C C    . LYS A 1 43  ? 0.377   0.686   7.092   1.00 0.00 ? 43  LYS A C    3  
ATOM 4172  O O    . LYS A 1 43  ? -0.730  0.420   7.556   1.00 0.00 ? 43  LYS A O    3  
ATOM 4173  C CB   . LYS A 1 43  ? 2.043   -0.615  8.439   1.00 0.00 ? 43  LYS A CB   3  
ATOM 4174  C CG   . LYS A 1 43  ? 3.007   -0.595  9.615   1.00 0.00 ? 43  LYS A CG   3  
ATOM 4175  C CD   . LYS A 1 43  ? 2.962   -1.895  10.401  1.00 0.00 ? 43  LYS A CD   3  
ATOM 4176  C CE   . LYS A 1 43  ? 1.851   -1.881  11.439  1.00 0.00 ? 43  LYS A CE   3  
ATOM 4177  N NZ   . LYS A 1 43  ? 2.337   -2.316  12.777  1.00 0.00 ? 43  LYS A NZ   3  
ATOM 4178  H H    . LYS A 1 43  ? 0.650   1.274   9.831   1.00 0.00 ? 43  LYS A H    3  
ATOM 4179  H HA   . LYS A 1 43  ? 2.399   1.255   7.462   1.00 0.00 ? 43  LYS A HA   3  
ATOM 4180  H HB2  . LYS A 1 43  ? 1.173   -1.189  8.723   1.00 0.00 ? 43  LYS A HB2  3  
ATOM 4181  H HB3  . LYS A 1 43  ? 2.532   -1.103  7.609   1.00 0.00 ? 43  LYS A HB3  3  
ATOM 4182  H HG2  . LYS A 1 43  ? 4.010   -0.447  9.243   1.00 0.00 ? 43  LYS A HG2  3  
ATOM 4183  H HG3  . LYS A 1 43  ? 2.741   0.221   10.272  1.00 0.00 ? 43  LYS A HG3  3  
ATOM 4184  H HD2  . LYS A 1 43  ? 2.792   -2.713  9.717   1.00 0.00 ? 43  LYS A HD2  3  
ATOM 4185  H HD3  . LYS A 1 43  ? 3.909   -2.035  10.901  1.00 0.00 ? 43  LYS A HD3  3  
ATOM 4186  H HE2  . LYS A 1 43  ? 1.461   -0.877  11.516  1.00 0.00 ? 43  LYS A HE2  3  
ATOM 4187  H HE3  . LYS A 1 43  ? 1.066   -2.549  11.114  1.00 0.00 ? 43  LYS A HE3  3  
ATOM 4188  H HZ1  . LYS A 1 43  ? 3.364   -2.170  12.850  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 4189  H HZ2  . LYS A 1 43  ? 2.131   -3.325  12.924  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 4190  H HZ3  . LYS A 1 43  ? 1.866   -1.765  13.524  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 4191  N N    . LEU A 1 44  ? 0.583   0.943   5.801   1.00 0.00 ? 44  LEU A N    3  
ATOM 4192  C CA   . LEU A 1 44  ? -0.511  0.922   4.828   1.00 0.00 ? 44  LEU A CA   3  
ATOM 4193  C C    . LEU A 1 44  ? -1.400  -0.315  4.965   1.00 0.00 ? 44  LEU A C    3  
ATOM 4194  O O    . LEU A 1 44  ? -2.620  -0.220  4.864   1.00 0.00 ? 44  LEU A O    3  
ATOM 4195  C CB   . LEU A 1 44  ? 0.020   1.007   3.389   1.00 0.00 ? 44  LEU A CB   3  
ATOM 4196  C CG   . LEU A 1 44  ? 1.447   0.503   3.153   1.00 0.00 ? 44  LEU A CG   3  
ATOM 4197  C CD1  . LEU A 1 44  ? 1.526   -1.012  3.294   1.00 0.00 ? 44  LEU A CD1  3  
ATOM 4198  C CD2  . LEU A 1 44  ? 1.922   0.923   1.774   1.00 0.00 ? 44  LEU A CD2  3  
ATOM 4199  H H    . LEU A 1 44  ? 1.487   1.187   5.504   1.00 0.00 ? 44  LEU A H    3  
ATOM 4200  H HA   . LEU A 1 44  ? -1.121  1.791   5.015   1.00 0.00 ? 44  LEU A HA   3  
ATOM 4201  H HB2  . LEU A 1 44  ? -0.645  0.438   2.755   1.00 0.00 ? 44  LEU A HB2  3  
ATOM 4202  H HB3  . LEU A 1 44  ? -0.025  2.041   3.080   1.00 0.00 ? 44  LEU A HB3  3  
ATOM 4203  H HG   . LEU A 1 44  ? 2.105   0.944   3.886   1.00 0.00 ? 44  LEU A HG   3  
ATOM 4204  H HD11 . LEU A 1 44  ? 2.558   -1.307  3.412   1.00 0.00 ? 44  LEU A HD11 3  
ATOM 4205  H HD12 . LEU A 1 44  ? 1.118   -1.483  2.409   1.00 0.00 ? 44  LEU A HD12 3  
ATOM 4206  H HD13 . LEU A 1 44  ? 0.962   -1.323  4.159   1.00 0.00 ? 44  LEU A HD13 3  
ATOM 4207  H HD21 . LEU A 1 44  ? 1.239   0.548   1.026   1.00 0.00 ? 44  LEU A HD21 3  
ATOM 4208  H HD22 . LEU A 1 44  ? 2.909   0.520   1.593   1.00 0.00 ? 44  LEU A HD22 3  
ATOM 4209  H HD23 . LEU A 1 44  ? 1.958   2.002   1.718   1.00 0.00 ? 44  LEU A HD23 3  
ATOM 4210  N N    . THR A 1 45  ? -0.783  -1.473  5.170   1.00 0.00 ? 45  THR A N    3  
ATOM 4211  C CA   . THR A 1 45  ? -1.516  -2.733  5.285   1.00 0.00 ? 45  THR A CA   3  
ATOM 4212  C C    . THR A 1 45  ? -2.591  -2.698  6.364   1.00 0.00 ? 45  THR A C    3  
ATOM 4213  O O    . THR A 1 45  ? -3.492  -3.538  6.376   1.00 0.00 ? 45  THR A O    3  
ATOM 4214  C CB   . THR A 1 45  ? -0.559  -3.896  5.564   1.00 0.00 ? 45  THR A CB   3  
ATOM 4215  O OG1  . THR A 1 45  ? 0.133   -3.684  6.800   1.00 0.00 ? 45  THR A OG1  3  
ATOM 4216  C CG2  . THR A 1 45  ? 0.439   -4.019  4.435   1.00 0.00 ? 45  THR A CG2  3  
ATOM 4217  H H    . THR A 1 45  ? 0.195   -1.485  5.220   1.00 0.00 ? 45  THR A H    3  
ATOM 4218  H HA   . THR A 1 45  ? -1.992  -2.922  4.335   1.00 0.00 ? 45  THR A HA   3  
ATOM 4219  H HB   . THR A 1 45  ? -1.130  -4.809  5.622   1.00 0.00 ? 45  THR A HB   3  
ATOM 4220  H HG1  . THR A 1 45  ? 1.035   -3.415  6.619   1.00 0.00 ? 45  THR A HG1  3  
ATOM 4221  H HG21 . THR A 1 45  ? 0.333   -4.985  3.968   1.00 0.00 ? 45  THR A HG21 3  
ATOM 4222  H HG22 . THR A 1 45  ? 1.440   -3.912  4.827   1.00 0.00 ? 45  THR A HG22 3  
ATOM 4223  H HG23 . THR A 1 45  ? 0.250   -3.241  3.711   1.00 0.00 ? 45  THR A HG23 3  
ATOM 4224  N N    . GLN A 1 46  ? -2.511  -1.722  7.257   1.00 0.00 ? 46  GLN A N    3  
ATOM 4225  C CA   . GLN A 1 46  ? -3.499  -1.594  8.317   1.00 0.00 ? 46  GLN A CA   3  
ATOM 4226  C C    . GLN A 1 46  ? -4.846  -1.251  7.707   1.00 0.00 ? 46  GLN A C    3  
ATOM 4227  O O    . GLN A 1 46  ? -5.898  -1.495  8.301   1.00 0.00 ? 46  GLN A O    3  
ATOM 4228  C CB   . GLN A 1 46  ? -3.083  -0.510  9.315   1.00 0.00 ? 46  GLN A CB   3  
ATOM 4229  C CG   . GLN A 1 46  ? -2.993  -1.007  10.748  1.00 0.00 ? 46  GLN A CG   3  
ATOM 4230  C CD   . GLN A 1 46  ? -2.210  -0.067  11.643  1.00 0.00 ? 46  GLN A CD   3  
ATOM 4231  O OE1  . GLN A 1 46  ? -2.660  0.293   12.731  1.00 0.00 ? 46  GLN A OE1  3  
ATOM 4232  N NE2  . GLN A 1 46  ? -1.029  0.337   11.187  1.00 0.00 ? 46  GLN A NE2  3  
ATOM 4233  H H    . GLN A 1 46  ? -1.783  -1.072  7.189   1.00 0.00 ? 46  GLN A H    3  
ATOM 4234  H HA   . GLN A 1 46  ? -3.572  -2.545  8.829   1.00 0.00 ? 46  GLN A HA   3  
ATOM 4235  H HB2  . GLN A 1 46  ? -2.117  -0.125  9.028   1.00 0.00 ? 46  GLN A HB2  3  
ATOM 4236  H HB3  . GLN A 1 46  ? -3.807  0.292   9.279   1.00 0.00 ? 46  GLN A HB3  3  
ATOM 4237  H HG2  . GLN A 1 46  ? -3.992  -1.108  11.144  1.00 0.00 ? 46  GLN A HG2  3  
ATOM 4238  H HG3  . GLN A 1 46  ? -2.507  -1.973  10.751  1.00 0.00 ? 46  GLN A HG3  3  
ATOM 4239  H HE21 . GLN A 1 46  ? -0.733  0.009   10.313  1.00 0.00 ? 46  GLN A HE21 3  
ATOM 4240  H HE22 . GLN A 1 46  ? -0.501  0.944   11.746  1.00 0.00 ? 46  GLN A HE22 3  
ATOM 4241  N N    . PHE A 1 47  ? -4.799  -0.668  6.517   1.00 0.00 ? 47  PHE A N    3  
ATOM 4242  C CA   . PHE A 1 47  ? -6.005  -0.263  5.808   1.00 0.00 ? 47  PHE A CA   3  
ATOM 4243  C C    . PHE A 1 47  ? -6.193  -1.072  4.526   1.00 0.00 ? 47  PHE A C    3  
ATOM 4244  O O    . PHE A 1 47  ? -6.533  -0.516  3.482   1.00 0.00 ? 47  PHE A O    3  
ATOM 4245  C CB   . PHE A 1 47  ? -5.947  1.232   5.479   1.00 0.00 ? 47  PHE A CB   3  
ATOM 4246  C CG   . PHE A 1 47  ? -4.844  1.974   6.186   1.00 0.00 ? 47  PHE A CG   3  
ATOM 4247  C CD1  . PHE A 1 47  ? -4.863  2.130   7.565   1.00 0.00 ? 47  PHE A CD1  3  
ATOM 4248  C CD2  . PHE A 1 47  ? -3.790  2.517   5.471   1.00 0.00 ? 47  PHE A CD2  3  
ATOM 4249  C CE1  . PHE A 1 47  ? -3.849  2.812   8.213   1.00 0.00 ? 47  PHE A CE1  3  
ATOM 4250  C CE2  . PHE A 1 47  ? -2.774  3.199   6.113   1.00 0.00 ? 47  PHE A CE2  3  
ATOM 4251  C CZ   . PHE A 1 47  ? -2.803  3.346   7.486   1.00 0.00 ? 47  PHE A CZ   3  
ATOM 4252  H H    . PHE A 1 47  ? -3.924  -0.484  6.114   1.00 0.00 ? 47  PHE A H    3  
ATOM 4253  H HA   . PHE A 1 47  ? -6.845  -0.442  6.457   1.00 0.00 ? 47  PHE A HA   3  
ATOM 4254  H HB2  . PHE A 1 47  ? -5.793  1.345   4.420   1.00 0.00 ? 47  PHE A HB2  3  
ATOM 4255  H HB3  . PHE A 1 47  ? -6.886  1.689   5.752   1.00 0.00 ? 47  PHE A HB3  3  
ATOM 4256  H HD1  . PHE A 1 47  ? -5.679  1.711   8.134   1.00 0.00 ? 47  PHE A HD1  3  
ATOM 4257  H HD2  . PHE A 1 47  ? -3.764  2.405   4.397   1.00 0.00 ? 47  PHE A HD2  3  
ATOM 4258  H HE1  . PHE A 1 47  ? -3.873  2.924   9.288   1.00 0.00 ? 47  PHE A HE1  3  
ATOM 4259  H HE2  . PHE A 1 47  ? -1.957  3.616   5.543   1.00 0.00 ? 47  PHE A HE2  3  
ATOM 4260  H HZ   . PHE A 1 47  ? -2.011  3.879   7.989   1.00 0.00 ? 47  PHE A HZ   3  
ATOM 4261  N N    . PHE A 1 48  ? -5.979  -2.383  4.614   1.00 0.00 ? 48  PHE A N    3  
ATOM 4262  C CA   . PHE A 1 48  ? -6.135  -3.270  3.460   1.00 0.00 ? 48  PHE A CA   3  
ATOM 4263  C C    . PHE A 1 48  ? -6.618  -4.648  3.901   1.00 0.00 ? 48  PHE A C    3  
ATOM 4264  O O    . PHE A 1 48  ? -6.261  -5.111  4.984   1.00 0.00 ? 48  PHE A O    3  
ATOM 4265  C CB   . PHE A 1 48  ? -4.816  -3.400  2.691   1.00 0.00 ? 48  PHE A CB   3  
ATOM 4266  C CG   . PHE A 1 48  ? -4.369  -2.115  2.053   1.00 0.00 ? 48  PHE A CG   3  
ATOM 4267  C CD1  . PHE A 1 48  ? -5.168  -1.477  1.118   1.00 0.00 ? 48  PHE A CD1  3  
ATOM 4268  C CD2  . PHE A 1 48  ? -3.158  -1.545  2.392   1.00 0.00 ? 48  PHE A CD2  3  
ATOM 4269  C CE1  . PHE A 1 48  ? -4.765  -0.293  0.535   1.00 0.00 ? 48  PHE A CE1  3  
ATOM 4270  C CE2  . PHE A 1 48  ? -2.748  -0.359  1.811   1.00 0.00 ? 48  PHE A CE2  3  
ATOM 4271  C CZ   . PHE A 1 48  ? -3.553  0.266   0.882   1.00 0.00 ? 48  PHE A CZ   3  
ATOM 4272  H H    . PHE A 1 48  ? -5.717  -2.765  5.477   1.00 0.00 ? 48  PHE A H    3  
ATOM 4273  H HA   . PHE A 1 48  ? -6.877  -2.838  2.808   1.00 0.00 ? 48  PHE A HA   3  
ATOM 4274  H HB2  . PHE A 1 48  ? -4.041  -3.721  3.372   1.00 0.00 ? 48  PHE A HB2  3  
ATOM 4275  H HB3  . PHE A 1 48  ? -4.933  -4.139  1.908   1.00 0.00 ? 48  PHE A HB3  3  
ATOM 4276  H HD1  . PHE A 1 48  ? -6.116  -1.915  0.847   1.00 0.00 ? 48  PHE A HD1  3  
ATOM 4277  H HD2  . PHE A 1 48  ? -2.527  -2.032  3.119   1.00 0.00 ? 48  PHE A HD2  3  
ATOM 4278  H HE1  . PHE A 1 48  ? -5.397  0.194   -0.191  1.00 0.00 ? 48  PHE A HE1  3  
ATOM 4279  H HE2  . PHE A 1 48  ? -1.799  0.077   2.086   1.00 0.00 ? 48  PHE A HE2  3  
ATOM 4280  H HZ   . PHE A 1 48  ? -3.233  1.193   0.427   1.00 0.00 ? 48  PHE A HZ   3  
ATOM 4281  N N    . LEU A 1 49  ? -7.425  -5.283  3.043   1.00 0.00 ? 49  LEU A N    3  
ATOM 4282  C CA   . LEU A 1 49  ? -7.988  -6.620  3.292   1.00 0.00 ? 49  LEU A CA   3  
ATOM 4283  C C    . LEU A 1 49  ? -7.779  -7.090  4.731   1.00 0.00 ? 49  LEU A C    3  
ATOM 4284  O O    . LEU A 1 49  ? -6.723  -7.616  5.074   1.00 0.00 ? 49  LEU A O    3  
ATOM 4285  C CB   . LEU A 1 49  ? -7.407  -7.658  2.312   1.00 0.00 ? 49  LEU A CB   3  
ATOM 4286  C CG   . LEU A 1 49  ? -6.018  -7.360  1.720   1.00 0.00 ? 49  LEU A CG   3  
ATOM 4287  C CD1  . LEU A 1 49  ? -6.069  -6.183  0.757   1.00 0.00 ? 49  LEU A CD1  3  
ATOM 4288  C CD2  . LEU A 1 49  ? -4.991  -7.114  2.818   1.00 0.00 ? 49  LEU A CD2  3  
ATOM 4289  H H    . LEU A 1 49  ? -7.652  -4.836  2.200   1.00 0.00 ? 49  LEU A H    3  
ATOM 4290  H HA   . LEU A 1 49  ? -9.051  -6.551  3.116   1.00 0.00 ? 49  LEU A HA   3  
ATOM 4291  H HB2  . LEU A 1 49  ? -7.350  -8.605  2.828   1.00 0.00 ? 49  LEU A HB2  3  
ATOM 4292  H HB3  . LEU A 1 49  ? -8.102  -7.765  1.493   1.00 0.00 ? 49  LEU A HB3  3  
ATOM 4293  H HG   . LEU A 1 49  ? -5.691  -8.224  1.157   1.00 0.00 ? 49  LEU A HG   3  
ATOM 4294  H HD11 . LEU A 1 49  ? -6.207  -6.549  -0.250  1.00 0.00 ? 49  LEU A HD11 3  
ATOM 4295  H HD12 . LEU A 1 49  ? -5.143  -5.631  0.815   1.00 0.00 ? 49  LEU A HD12 3  
ATOM 4296  H HD13 . LEU A 1 49  ? -6.891  -5.536  1.022   1.00 0.00 ? 49  LEU A HD13 3  
ATOM 4297  H HD21 . LEU A 1 49  ? -5.484  -6.689  3.681   1.00 0.00 ? 49  LEU A HD21 3  
ATOM 4298  H HD22 . LEU A 1 49  ? -4.239  -6.426  2.459   1.00 0.00 ? 49  LEU A HD22 3  
ATOM 4299  H HD23 . LEU A 1 49  ? -4.525  -8.048  3.091   1.00 0.00 ? 49  LEU A HD23 3  
ATOM 4300  N N    . ARG A 1 50  ? -8.798  -6.897  5.567   1.00 0.00 ? 50  ARG A N    3  
ATOM 4301  C CA   . ARG A 1 50  ? -8.736  -7.297  6.972   1.00 0.00 ? 50  ARG A CA   3  
ATOM 4302  C C    . ARG A 1 50  ? -7.654  -6.519  7.713   1.00 0.00 ? 50  ARG A C    3  
ATOM 4303  O O    . ARG A 1 50  ? -6.460  -6.752  7.527   1.00 0.00 ? 50  ARG A O    3  
ATOM 4304  C CB   . ARG A 1 50  ? -8.484  -8.802  7.095   1.00 0.00 ? 50  ARG A CB   3  
ATOM 4305  C CG   . ARG A 1 50  ? -9.239  -9.448  8.244   1.00 0.00 ? 50  ARG A CG   3  
ATOM 4306  C CD   . ARG A 1 50  ? -8.793  -10.882 8.466   1.00 0.00 ? 50  ARG A CD   3  
ATOM 4307  N NE   . ARG A 1 50  ? -9.207  -11.389 9.772   1.00 0.00 ? 50  ARG A NE   3  
ATOM 4308  C CZ   . ARG A 1 50  ? -9.635  -12.631 9.979   1.00 0.00 ? 50  ARG A CZ   3  
ATOM 4309  N NH1  . ARG A 1 50  ? -9.706  -13.488 8.968   1.00 0.00 ? 50  ARG A NH1  3  
ATOM 4310  N NH2  . ARG A 1 50  ? -9.992  -13.018 11.198  1.00 0.00 ? 50  ARG A NH2  3  
ATOM 4311  H H    . ARG A 1 50  ? -9.615  -6.473  5.229   1.00 0.00 ? 50  ARG A H    3  
ATOM 4312  H HA   . ARG A 1 50  ? -9.692  -7.066  7.417   1.00 0.00 ? 50  ARG A HA   3  
ATOM 4313  H HB2  . ARG A 1 50  ? -8.788  -9.282  6.177   1.00 0.00 ? 50  ARG A HB2  3  
ATOM 4314  H HB3  . ARG A 1 50  ? -7.429  -8.968  7.246   1.00 0.00 ? 50  ARG A HB3  3  
ATOM 4315  H HG2  . ARG A 1 50  ? -9.059  -8.880  9.145   1.00 0.00 ? 50  ARG A HG2  3  
ATOM 4316  H HG3  . ARG A 1 50  ? -10.295 -9.440  8.018   1.00 0.00 ? 50  ARG A HG3  3  
ATOM 4317  H HD2  . ARG A 1 50  ? -9.224  -11.504 7.697   1.00 0.00 ? 50  ARG A HD2  3  
ATOM 4318  H HD3  . ARG A 1 50  ? -7.716  -10.925 8.401   1.00 0.00 ? 50  ARG A HD3  3  
ATOM 4319  H HE   . ARG A 1 50  ? -9.165  -10.773 10.533  1.00 0.00 ? 50  ARG A HE   3  
ATOM 4320  H HH11 . ARG A 1 50  ? -9.437  -13.199 8.048   1.00 0.00 ? 50  ARG A HH11 3  
ATOM 4321  H HH12 . ARG A 1 50  ? -10.028 -14.421 9.127   1.00 0.00 ? 50  ARG A HH12 3  
ATOM 4322  H HH21 . ARG A 1 50  ? -9.940  -12.374 11.960  1.00 0.00 ? 50  ARG A HH21 3  
ATOM 4323  H HH22 . ARG A 1 50  ? -10.317 -13.951 11.351  1.00 0.00 ? 50  ARG A HH22 3  
ATOM 4324  N N    . SER A 1 51  ? -8.089  -5.582  8.548   1.00 0.00 ? 51  SER A N    3  
ATOM 4325  C CA   . SER A 1 51  ? -7.178  -4.745  9.320   1.00 0.00 ? 51  SER A CA   3  
ATOM 4326  C C    . SER A 1 51  ? -6.815  -5.382  10.659  1.00 0.00 ? 51  SER A C    3  
ATOM 4327  O O    . SER A 1 51  ? -6.035  -4.816  11.426  1.00 0.00 ? 51  SER A O    3  
ATOM 4328  C CB   . SER A 1 51  ? -7.809  -3.372  9.556   1.00 0.00 ? 51  SER A CB   3  
ATOM 4329  O OG   . SER A 1 51  ? -8.852  -3.449  10.514  1.00 0.00 ? 51  SER A OG   3  
ATOM 4330  H H    . SER A 1 51  ? -9.055  -5.442  8.641   1.00 0.00 ? 51  SER A H    3  
ATOM 4331  H HA   . SER A 1 51  ? -6.277  -4.617  8.740   1.00 0.00 ? 51  SER A HA   3  
ATOM 4332  H HB2  . SER A 1 51  ? -7.054  -2.690  9.919   1.00 0.00 ? 51  SER A HB2  3  
ATOM 4333  H HB3  . SER A 1 51  ? -8.214  -2.999  8.628   1.00 0.00 ? 51  SER A HB3  3  
ATOM 4334  H HG   . SER A 1 51  ? -9.251  -4.323  10.482  1.00 0.00 ? 51  SER A HG   3  
ATOM 4335  N N    . ASP A 1 52  ? -7.406  -6.533  10.958  1.00 0.00 ? 52  ASP A N    3  
ATOM 4336  C CA   . ASP A 1 52  ? -7.150  -7.200  12.232  1.00 0.00 ? 52  ASP A CA   3  
ATOM 4337  C C    . ASP A 1 52  ? -5.947  -8.145  12.176  1.00 0.00 ? 52  ASP A C    3  
ATOM 4338  O O    . ASP A 1 52  ? -4.908  -7.869  12.775  1.00 0.00 ? 52  ASP A O    3  
ATOM 4339  C CB   . ASP A 1 52  ? -8.393  -7.975  12.672  1.00 0.00 ? 52  ASP A CB   3  
ATOM 4340  C CG   . ASP A 1 52  ? -9.333  -7.132  13.513  1.00 0.00 ? 52  ASP A CG   3  
ATOM 4341  O OD1  . ASP A 1 52  ? -8.845  -6.224  14.220  1.00 0.00 ? 52  ASP A OD1  3  
ATOM 4342  O OD2  . ASP A 1 52  ? -10.556 -7.378  13.464  1.00 0.00 ? 52  ASP A OD2  3  
ATOM 4343  H H    . ASP A 1 52  ? -8.040  -6.929  10.326  1.00 0.00 ? 52  ASP A H    3  
ATOM 4344  H HA   . ASP A 1 52  ? -6.947  -6.434  12.964  1.00 0.00 ? 52  ASP A HA   3  
ATOM 4345  H HB2  . ASP A 1 52  ? -8.929  -8.312  11.797  1.00 0.00 ? 52  ASP A HB2  3  
ATOM 4346  H HB3  . ASP A 1 52  ? -8.089  -8.831  13.255  1.00 0.00 ? 52  ASP A HB3  3  
ATOM 4347  N N    . SER A 1 53  ? -6.104  -9.275  11.488  1.00 0.00 ? 53  SER A N    3  
ATOM 4348  C CA   . SER A 1 53  ? -5.034  -10.272 11.400  1.00 0.00 ? 53  SER A CA   3  
ATOM 4349  C C    . SER A 1 53  ? -4.156  -10.102 10.159  1.00 0.00 ? 53  SER A C    3  
ATOM 4350  O O    . SER A 1 53  ? -2.931  -10.169 10.250  1.00 0.00 ? 53  SER A O    3  
ATOM 4351  C CB   . SER A 1 53  ? -5.634  -11.676 11.416  1.00 0.00 ? 53  SER A CB   3  
ATOM 4352  O OG   . SER A 1 53  ? -6.517  -11.869 10.326  1.00 0.00 ? 53  SER A OG   3  
ATOM 4353  H H    . SER A 1 53  ? -6.964  -9.455  11.053  1.00 0.00 ? 53  SER A H    3  
ATOM 4354  H HA   . SER A 1 53  ? -4.413  -10.158 12.275  1.00 0.00 ? 53  SER A HA   3  
ATOM 4355  H HB2  . SER A 1 53  ? -4.839  -12.405 11.351  1.00 0.00 ? 53  SER A HB2  3  
ATOM 4356  H HB3  . SER A 1 53  ? -6.178  -11.821 12.338  1.00 0.00 ? 53  SER A HB3  3  
ATOM 4357  H HG   . SER A 1 53  ? -6.668  -12.809 10.197  1.00 0.00 ? 53  SER A HG   3  
ATOM 4358  N N    . ASP A 1 54  ? -4.787  -9.927  9.004   1.00 0.00 ? 54  ASP A N    3  
ATOM 4359  C CA   . ASP A 1 54  ? -4.069  -9.794  7.735   1.00 0.00 ? 54  ASP A CA   3  
ATOM 4360  C C    . ASP A 1 54  ? -2.879  -8.834  7.821   1.00 0.00 ? 54  ASP A C    3  
ATOM 4361  O O    . ASP A 1 54  ? -1.760  -9.199  7.471   1.00 0.00 ? 54  ASP A O    3  
ATOM 4362  C CB   . ASP A 1 54  ? -5.023  -9.335  6.636   1.00 0.00 ? 54  ASP A CB   3  
ATOM 4363  C CG   . ASP A 1 54  ? -5.453  -10.472 5.732   1.00 0.00 ? 54  ASP A CG   3  
ATOM 4364  O OD1  . ASP A 1 54  ? -4.738  -10.748 4.746   1.00 0.00 ? 54  ASP A OD1  3  
ATOM 4365  O OD2  . ASP A 1 54  ? -6.504  -11.087 6.008   1.00 0.00 ? 54  ASP A OD2  3  
ATOM 4366  H H    . ASP A 1 54  ? -5.769  -9.914  8.997   1.00 0.00 ? 54  ASP A H    3  
ATOM 4367  H HA   . ASP A 1 54  ? -3.696  -10.772 7.472   1.00 0.00 ? 54  ASP A HA   3  
ATOM 4368  H HB2  . ASP A 1 54  ? -5.905  -8.908  7.091   1.00 0.00 ? 54  ASP A HB2  3  
ATOM 4369  H HB3  . ASP A 1 54  ? -4.534  -8.583  6.034   1.00 0.00 ? 54  ASP A HB3  3  
ATOM 4370  N N    . VAL A 1 55  ? -3.129  -7.606  8.261   1.00 0.00 ? 55  VAL A N    3  
ATOM 4371  C CA   . VAL A 1 55  ? -2.072  -6.600  8.363   1.00 0.00 ? 55  VAL A CA   3  
ATOM 4372  C C    . VAL A 1 55  ? -0.910  -7.075  9.240   1.00 0.00 ? 55  VAL A C    3  
ATOM 4373  O O    . VAL A 1 55  ? 0.205   -6.564  9.139   1.00 0.00 ? 55  VAL A O    3  
ATOM 4374  C CB   . VAL A 1 55  ? -2.627  -5.268  8.913   1.00 0.00 ? 55  VAL A CB   3  
ATOM 4375  C CG1  . VAL A 1 55  ? -3.465  -5.510  10.154  1.00 0.00 ? 55  VAL A CG1  3  
ATOM 4376  C CG2  . VAL A 1 55  ? -1.505  -4.282  9.211   1.00 0.00 ? 55  VAL A CG2  3  
ATOM 4377  H H    . VAL A 1 55  ? -4.046  -7.364  8.511   1.00 0.00 ? 55  VAL A H    3  
ATOM 4378  H HA   . VAL A 1 55  ? -1.697  -6.417  7.366   1.00 0.00 ? 55  VAL A HA   3  
ATOM 4379  H HB   . VAL A 1 55  ? -3.265  -4.832  8.158   1.00 0.00 ? 55  VAL A HB   3  
ATOM 4380  H HG11 . VAL A 1 55  ? -2.827  -5.808  10.971  1.00 0.00 ? 55  VAL A HG11 3  
ATOM 4381  H HG12 . VAL A 1 55  ? -4.188  -6.288  9.956   1.00 0.00 ? 55  VAL A HG12 3  
ATOM 4382  H HG13 . VAL A 1 55  ? -3.983  -4.596  10.417  1.00 0.00 ? 55  VAL A HG13 3  
ATOM 4383  H HG21 . VAL A 1 55  ? -0.816  -4.261  8.382   1.00 0.00 ? 55  VAL A HG21 3  
ATOM 4384  H HG22 . VAL A 1 55  ? -0.984  -4.589  10.105  1.00 0.00 ? 55  VAL A HG22 3  
ATOM 4385  H HG23 . VAL A 1 55  ? -1.922  -3.297  9.358   1.00 0.00 ? 55  VAL A HG23 3  
ATOM 4386  N N    . VAL A 1 56  ? -1.174  -8.049  10.104  1.00 0.00 ? 56  VAL A N    3  
ATOM 4387  C CA   . VAL A 1 56  ? -0.147  -8.572  11.000  1.00 0.00 ? 56  VAL A CA   3  
ATOM 4388  C C    . VAL A 1 56  ? 0.695   -9.670  10.348  1.00 0.00 ? 56  VAL A C    3  
ATOM 4389  O O    . VAL A 1 56  ? 1.872   -9.829  10.675  1.00 0.00 ? 56  VAL A O    3  
ATOM 4390  C CB   . VAL A 1 56  ? -0.768  -9.125  12.296  1.00 0.00 ? 56  VAL A CB   3  
ATOM 4391  C CG1  . VAL A 1 56  ? 0.307   -9.377  13.341  1.00 0.00 ? 56  VAL A CG1  3  
ATOM 4392  C CG2  . VAL A 1 56  ? -1.828  -8.172  12.829  1.00 0.00 ? 56  VAL A CG2  3  
ATOM 4393  H H    . VAL A 1 56  ? -2.081  -8.417  10.147  1.00 0.00 ? 56  VAL A H    3  
ATOM 4394  H HA   . VAL A 1 56  ? 0.504   -7.752  11.269  1.00 0.00 ? 56  VAL A HA   3  
ATOM 4395  H HB   . VAL A 1 56  ? -1.245  -10.066 12.068  1.00 0.00 ? 56  VAL A HB   3  
ATOM 4396  H HG11 . VAL A 1 56  ? 1.022   -8.568  13.325  1.00 0.00 ? 56  VAL A HG11 3  
ATOM 4397  H HG12 . VAL A 1 56  ? 0.809   -10.306 13.123  1.00 0.00 ? 56  VAL A HG12 3  
ATOM 4398  H HG13 . VAL A 1 56  ? -0.149  -9.435  14.319  1.00 0.00 ? 56  VAL A HG13 3  
ATOM 4399  H HG21 . VAL A 1 56  ? -2.319  -8.619  13.681  1.00 0.00 ? 56  VAL A HG21 3  
ATOM 4400  H HG22 . VAL A 1 56  ? -2.556  -7.975  12.057  1.00 0.00 ? 56  VAL A HG22 3  
ATOM 4401  H HG23 . VAL A 1 56  ? -1.362  -7.245  13.128  1.00 0.00 ? 56  VAL A HG23 3  
ATOM 4402  N N    . GLU A 1 57  ? 0.092   -10.437 9.444   1.00 0.00 ? 57  GLU A N    3  
ATOM 4403  C CA   . GLU A 1 57  ? 0.804   -11.528 8.777   1.00 0.00 ? 57  GLU A CA   3  
ATOM 4404  C C    . GLU A 1 57  ? 1.497   -11.059 7.498   1.00 0.00 ? 57  GLU A C    3  
ATOM 4405  O O    . GLU A 1 57  ? 2.628   -11.455 7.213   1.00 0.00 ? 57  GLU A O    3  
ATOM 4406  C CB   . GLU A 1 57  ? -0.159  -12.675 8.456   1.00 0.00 ? 57  GLU A CB   3  
ATOM 4407  C CG   . GLU A 1 57  ? -1.504  -12.211 7.917   1.00 0.00 ? 57  GLU A CG   3  
ATOM 4408  C CD   . GLU A 1 57  ? -2.668  -12.962 8.533   1.00 0.00 ? 57  GLU A CD   3  
ATOM 4409  O OE1  . GLU A 1 57  ? -2.798  -12.938 9.776   1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4410  O OE2  . GLU A 1 57  ? -3.448  -13.573 7.774   1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4411  H H    . GLU A 1 57  ? -0.850  -10.275 9.228   1.00 0.00 ? 57  GLU A H    3  
ATOM 4412  H HA   . GLU A 1 57  ? 1.557   -11.891 9.460   1.00 0.00 ? 57  GLU A HA   3  
ATOM 4413  H HB2  . GLU A 1 57  ? 0.298   -13.316 7.716   1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4414  H HB3  . GLU A 1 57  ? -0.334  -13.244 9.356   1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4415  H HG2  . GLU A 1 57  ? -1.619  -11.160 8.130   1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4416  H HG3  . GLU A 1 57  ? -1.521  -12.365 6.847   1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4417  N N    . ALA A 1 58  ? 0.804   -10.229 6.727   1.00 0.00 ? 58  ALA A N    3  
ATOM 4418  C CA   . ALA A 1 58  ? 1.337   -9.715  5.470   1.00 0.00 ? 58  ALA A CA   3  
ATOM 4419  C C    . ALA A 1 58  ? 2.728   -9.112  5.646   1.00 0.00 ? 58  ALA A C    3  
ATOM 4420  O O    . ALA A 1 58  ? 3.558   -9.168  4.738   1.00 0.00 ? 58  ALA A O    3  
ATOM 4421  C CB   . ALA A 1 58  ? 0.388   -8.681  4.884   1.00 0.00 ? 58  ALA A CB   3  
ATOM 4422  H H    . ALA A 1 58  ? -0.093  -9.964  7.007   1.00 0.00 ? 58  ALA A H    3  
ATOM 4423  H HA   . ALA A 1 58  ? 1.402   -10.539 4.776   1.00 0.00 ? 58  ALA A HA   3  
ATOM 4424  H HB1  . ALA A 1 58  ? -0.163  -8.205  5.682   1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4425  H HB2  . ALA A 1 58  ? -0.302  -9.166  4.209   1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4426  H HB3  . ALA A 1 58  ? 0.954   -7.935  4.346   1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4427  N N    . LEU A 1 59  ? 2.978   -8.533  6.816   1.00 0.00 ? 59  LEU A N    3  
ATOM 4428  C CA   . LEU A 1 59  ? 4.270   -7.918  7.101   1.00 0.00 ? 59  LEU A CA   3  
ATOM 4429  C C    . LEU A 1 59  ? 5.164   -8.859  7.904   1.00 0.00 ? 59  LEU A C    3  
ATOM 4430  O O    . LEU A 1 59  ? 6.370   -8.639  8.013   1.00 0.00 ? 59  LEU A O    3  
ATOM 4431  C CB   . LEU A 1 59  ? 4.075   -6.604  7.858   1.00 0.00 ? 59  LEU A CB   3  
ATOM 4432  C CG   . LEU A 1 59  ? 2.905   -5.749  7.371   1.00 0.00 ? 59  LEU A CG   3  
ATOM 4433  C CD1  . LEU A 1 59  ? 2.561   -4.680  8.397   1.00 0.00 ? 59  LEU A CD1  3  
ATOM 4434  C CD2  . LEU A 1 59  ? 3.229   -5.117  6.024   1.00 0.00 ? 59  LEU A CD2  3  
ATOM 4435  H H    . LEU A 1 59  ? 2.278   -8.516  7.499   1.00 0.00 ? 59  LEU A H    3  
ATOM 4436  H HA   . LEU A 1 59  ? 4.750   -7.709  6.156   1.00 0.00 ? 59  LEU A HA   3  
ATOM 4437  H HB2  . LEU A 1 59  ? 3.918   -6.833  8.902   1.00 0.00 ? 59  LEU A HB2  3  
ATOM 4438  H HB3  . LEU A 1 59  ? 4.979   -6.021  7.767   1.00 0.00 ? 59  LEU A HB3  3  
ATOM 4439  H HG   . LEU A 1 59  ? 2.036   -6.379  7.245   1.00 0.00 ? 59  LEU A HG   3  
ATOM 4440  H HD11 . LEU A 1 59  ? 1.971   -5.116  9.186   1.00 0.00 ? 59  LEU A HD11 3  
ATOM 4441  H HD12 . LEU A 1 59  ? 2.000   -3.890  7.920   1.00 0.00 ? 59  LEU A HD12 3  
ATOM 4442  H HD13 . LEU A 1 59  ? 3.474   -4.274  8.811   1.00 0.00 ? 59  LEU A HD13 3  
ATOM 4443  H HD21 . LEU A 1 59  ? 4.300   -5.053  5.903   1.00 0.00 ? 59  LEU A HD21 3  
ATOM 4444  H HD22 . LEU A 1 59  ? 2.801   -4.125  5.979   1.00 0.00 ? 59  LEU A HD22 3  
ATOM 4445  H HD23 . LEU A 1 59  ? 2.813   -5.722  5.231   1.00 0.00 ? 59  LEU A HD23 3  
ATOM 4446  N N    . SER A 1 60  ? 4.567   -9.910  8.459   1.00 0.00 ? 60  SER A N    3  
ATOM 4447  C CA   . SER A 1 60  ? 5.316   -10.883 9.246   1.00 0.00 ? 60  SER A CA   3  
ATOM 4448  C C    . SER A 1 60  ? 5.997   -11.901 8.339   1.00 0.00 ? 60  SER A C    3  
ATOM 4449  O O    . SER A 1 60  ? 5.336   -12.754 7.745   1.00 0.00 ? 60  SER A O    3  
ATOM 4450  C CB   . SER A 1 60  ? 4.388   -11.600 10.230  1.00 0.00 ? 60  SER A CB   3  
ATOM 4451  O OG   . SER A 1 60  ? 5.031   -12.721 10.814  1.00 0.00 ? 60  SER A OG   3  
ATOM 4452  H H    . SER A 1 60  ? 3.602   -10.034 8.336   1.00 0.00 ? 60  SER A H    3  
ATOM 4453  H HA   . SER A 1 60  ? 6.075   -10.349 9.800   1.00 0.00 ? 60  SER A HA   3  
ATOM 4454  H HB2  . SER A 1 60  ? 4.102   -10.917 11.016  1.00 0.00 ? 60  SER A HB2  3  
ATOM 4455  H HB3  . SER A 1 60  ? 3.505   -11.937 9.708   1.00 0.00 ? 60  SER A HB3  3  
ATOM 4456  H HG   . SER A 1 60  ? 5.982   -12.599 10.779  1.00 0.00 ? 60  SER A HG   3  
ATOM 4457  N N    . GLU A 1 61  ? 7.323   -11.799 8.233   1.00 0.00 ? 61  GLU A N    3  
ATOM 4458  C CA   . GLU A 1 61  ? 8.117   -12.701 7.396   1.00 0.00 ? 61  GLU A CA   3  
ATOM 4459  C C    . GLU A 1 61  ? 7.883   -12.436 5.911   1.00 0.00 ? 61  GLU A C    3  
ATOM 4460  O O    . GLU A 1 61  ? 8.601   -12.966 5.063   1.00 0.00 ? 61  GLU A O    3  
ATOM 4461  C CB   . GLU A 1 61  ? 7.801   -14.164 7.724   1.00 0.00 ? 61  GLU A CB   3  
ATOM 4462  C CG   . GLU A 1 61  ? 8.797   -14.798 8.682   1.00 0.00 ? 61  GLU A CG   3  
ATOM 4463  C CD   . GLU A 1 61  ? 9.452   -16.038 8.104   1.00 0.00 ? 61  GLU A CD   3  
ATOM 4464  O OE1  . GLU A 1 61  ? 10.432  -15.891 7.344   1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4465  O OE2  . GLU A 1 61  ? 8.985   -17.155 8.411   1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4466  H H    . GLU A 1 61  ? 7.784   -11.092 8.730   1.00 0.00 ? 61  GLU A H    3  
ATOM 4467  H HA   . GLU A 1 61  ? 9.158   -12.515 7.615   1.00 0.00 ? 61  GLU A HA   3  
ATOM 4468  H HB2  . GLU A 1 61  ? 6.820   -14.216 8.171   1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4469  H HB3  . GLU A 1 61  ? 7.801   -14.735 6.808   1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4470  H HG2  . GLU A 1 61  ? 9.566   -14.077 8.912   1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4471  H HG3  . GLU A 1 61  ? 8.278   -15.072 9.589   1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4472  N N    . GLU A 1 62  ? 6.860   -11.633 5.609   1.00 0.00 ? 62  GLU A N    3  
ATOM 4473  C CA   . GLU A 1 62  ? 6.499   -11.299 4.229   1.00 0.00 ? 62  GLU A CA   3  
ATOM 4474  C C    . GLU A 1 62  ? 5.766   -12.463 3.582   1.00 0.00 ? 62  GLU A C    3  
ATOM 4475  O O    . GLU A 1 62  ? 5.601   -13.511 4.207   1.00 0.00 ? 62  GLU A O    3  
ATOM 4476  C CB   . GLU A 1 62  ? 7.732   -10.916 3.406   1.00 0.00 ? 62  GLU A CB   3  
ATOM 4477  C CG   . GLU A 1 62  ? 8.199   -9.489  3.637   1.00 0.00 ? 62  GLU A CG   3  
ATOM 4478  C CD   . GLU A 1 62  ? 7.328   -8.469  2.931   1.00 0.00 ? 62  GLU A CD   3  
ATOM 4479  O OE1  . GLU A 1 62  ? 6.151   -8.322  3.323   1.00 0.00 ? 62  GLU A OE1  3  
ATOM 4480  O OE2  . GLU A 1 62  ? 7.822   -7.818  1.987   1.00 0.00 ? 62  GLU A OE2  3  
ATOM 4481  H H    . GLU A 1 62  ? 6.315   -11.272 6.337   1.00 0.00 ? 62  GLU A H    3  
ATOM 4482  H HA   . GLU A 1 62  ? 5.828   -10.451 4.266   1.00 0.00 ? 62  GLU A HA   3  
ATOM 4483  H HB2  . GLU A 1 62  ? 8.543   -11.583 3.660   1.00 0.00 ? 62  GLU A HB2  3  
ATOM 4484  H HB3  . GLU A 1 62  ? 7.501   -11.031 2.357   1.00 0.00 ? 62  GLU A HB3  3  
ATOM 4485  H HG2  . GLU A 1 62  ? 8.179   -9.286  4.698   1.00 0.00 ? 62  GLU A HG2  3  
ATOM 4486  H HG3  . GLU A 1 62  ? 9.210   -9.391  3.273   1.00 0.00 ? 62  GLU A HG3  3  
ATOM 4487  N N    . HIS A 1 63  ? 5.315   -12.269 2.339   1.00 0.00 ? 63  HIS A N    3  
ATOM 4488  C CA   . HIS A 1 63  ? 4.575   -13.302 1.610   1.00 0.00 ? 63  HIS A CA   3  
ATOM 4489  C C    . HIS A 1 63  ? 3.669   -14.076 2.564   1.00 0.00 ? 63  HIS A C    3  
ATOM 4490  O O    . HIS A 1 63  ? 3.071   -13.491 3.466   1.00 0.00 ? 63  HIS A O    3  
ATOM 4491  C CB   . HIS A 1 63  ? 5.532   -14.259 0.880   1.00 0.00 ? 63  HIS A CB   3  
ATOM 4492  C CG   . HIS A 1 63  ? 6.593   -14.861 1.750   1.00 0.00 ? 63  HIS A CG   3  
ATOM 4493  N ND1  . HIS A 1 63  ? 7.876   -14.362 1.825   1.00 0.00 ? 63  HIS A ND1  3  
ATOM 4494  C CD2  . HIS A 1 63  ? 6.559   -15.930 2.583   1.00 0.00 ? 63  HIS A CD2  3  
ATOM 4495  C CE1  . HIS A 1 63  ? 8.586   -15.099 2.662   1.00 0.00 ? 63  HIS A CE1  3  
ATOM 4496  N NE2  . HIS A 1 63  ? 7.809   -16.055 3.135   1.00 0.00 ? 63  HIS A NE2  3  
ATOM 4497  H H    . HIS A 1 63  ? 5.474   -11.404 1.906   1.00 0.00 ? 63  HIS A H    3  
ATOM 4498  H HA   . HIS A 1 63  ? 3.955   -12.803 0.880   1.00 0.00 ? 63  HIS A HA   3  
ATOM 4499  H HB2  . HIS A 1 63  ? 4.959   -15.070 0.455   1.00 0.00 ? 63  HIS A HB2  3  
ATOM 4500  H HB3  . HIS A 1 63  ? 6.023   -13.720 0.081   1.00 0.00 ? 63  HIS A HB3  3  
ATOM 4501  H HD1  . HIS A 1 63  ? 8.218   -13.583 1.337   1.00 0.00 ? 63  HIS A HD1  3  
ATOM 4502  H HD2  . HIS A 1 63  ? 5.703   -16.565 2.778   1.00 0.00 ? 63  HIS A HD2  3  
ATOM 4503  H HE1  . HIS A 1 63  ? 9.623   -14.945 2.918   1.00 0.00 ? 63  HIS A HE1  3  
ATOM 4504  H HE2  . HIS A 1 63  ? 8.095   -16.771 3.740   1.00 0.00 ? 63  HIS A HE2  3  
ATOM 4505  N N    . MET A 1 64  ? 3.582   -15.388 2.381   1.00 0.00 ? 64  MET A N    3  
ATOM 4506  C CA   . MET A 1 64  ? 2.761   -16.215 3.256   1.00 0.00 ? 64  MET A CA   3  
ATOM 4507  C C    . MET A 1 64  ? 3.250   -16.080 4.694   1.00 0.00 ? 64  MET A C    3  
ATOM 4508  O O    . MET A 1 64  ? 4.435   -15.843 4.930   1.00 0.00 ? 64  MET A O    3  
ATOM 4509  C CB   . MET A 1 64  ? 2.815   -17.679 2.814   1.00 0.00 ? 64  MET A CB   3  
ATOM 4510  C CG   . MET A 1 64  ? 3.069   -17.858 1.325   1.00 0.00 ? 64  MET A CG   3  
ATOM 4511  S SD   . MET A 1 64  ? 3.072   -19.589 0.822   1.00 0.00 ? 64  MET A SD   3  
ATOM 4512  C CE   . MET A 1 64  ? 2.107   -19.506 -0.686  1.00 0.00 ? 64  MET A CE   3  
ATOM 4513  H H    . MET A 1 64  ? 4.090   -15.809 1.658   1.00 0.00 ? 64  MET A H    3  
ATOM 4514  H HA   . MET A 1 64  ? 1.745   -15.861 3.195   1.00 0.00 ? 64  MET A HA   3  
ATOM 4515  H HB2  . MET A 1 64  ? 3.608   -18.178 3.355   1.00 0.00 ? 64  MET A HB2  3  
ATOM 4516  H HB3  . MET A 1 64  ? 1.876   -18.151 3.057   1.00 0.00 ? 64  MET A HB3  3  
ATOM 4517  H HG2  . MET A 1 64  ? 2.294   -17.341 0.778   1.00 0.00 ? 64  MET A HG2  3  
ATOM 4518  H HG3  . MET A 1 64  ? 4.028   -17.425 1.083   1.00 0.00 ? 64  MET A HG3  3  
ATOM 4519  H HE1  . MET A 1 64  ? 1.055   -19.505 -0.441  1.00 0.00 ? 64  MET A HE1  3  
ATOM 4520  H HE2  . MET A 1 64  ? 2.332   -20.361 -1.304  1.00 0.00 ? 64  MET A HE2  3  
ATOM 4521  H HE3  . MET A 1 64  ? 2.353   -18.598 -1.219  1.00 0.00 ? 64  MET A HE3  3  
ATOM 4522  N N    . GLU A 1 65  ? 2.339   -16.223 5.651   1.00 0.00 ? 65  GLU A N    3  
ATOM 4523  C CA   . GLU A 1 65  ? 2.693   -16.107 7.066   1.00 0.00 ? 65  GLU A CA   3  
ATOM 4524  C C    . GLU A 1 65  ? 3.881   -17.004 7.405   1.00 0.00 ? 65  GLU A C    3  
ATOM 4525  O O    . GLU A 1 65  ? 4.570   -16.787 8.402   1.00 0.00 ? 65  GLU A O    3  
ATOM 4526  C CB   . GLU A 1 65  ? 1.501   -16.477 7.952   1.00 0.00 ? 65  GLU A CB   3  
ATOM 4527  C CG   . GLU A 1 65  ? 0.162   -15.997 7.414   1.00 0.00 ? 65  GLU A CG   3  
ATOM 4528  C CD   . GLU A 1 65  ? -0.985  -16.313 8.353   1.00 0.00 ? 65  GLU A CD   3  
ATOM 4529  O OE1  . GLU A 1 65  ? -1.258  -15.495 9.255   1.00 0.00 ? 65  GLU A OE1  3  
ATOM 4530  O OE2  . GLU A 1 65  ? -1.609  -17.383 8.186   1.00 0.00 ? 65  GLU A OE2  3  
ATOM 4531  H H    . GLU A 1 65  ? 1.408   -16.405 5.403   1.00 0.00 ? 65  GLU A H    3  
ATOM 4532  H HA   . GLU A 1 65  ? 2.968   -15.078 7.255   1.00 0.00 ? 65  GLU A HA   3  
ATOM 4533  H HB2  . GLU A 1 65  ? 1.459   -17.553 8.046   1.00 0.00 ? 65  GLU A HB2  3  
ATOM 4534  H HB3  . GLU A 1 65  ? 1.647   -16.045 8.931   1.00 0.00 ? 65  GLU A HB3  3  
ATOM 4535  H HG2  . GLU A 1 65  ? 0.208   -14.927 7.273   1.00 0.00 ? 65  GLU A HG2  3  
ATOM 4536  H HG3  . GLU A 1 65  ? -0.024  -16.478 6.465   1.00 0.00 ? 65  GLU A HG3  3  
ATOM 4537  N N    . ALA A 1 66  ? 4.113   -18.008 6.566   1.00 0.00 ? 66  ALA A N    3  
ATOM 4538  C CA   . ALA A 1 66  ? 5.216   -18.938 6.766   1.00 0.00 ? 66  ALA A CA   3  
ATOM 4539  C C    . ALA A 1 66  ? 5.469   -19.762 5.507   1.00 0.00 ? 66  ALA A C    3  
ATOM 4540  O O    . ALA A 1 66  ? 6.392   -19.477 4.745   1.00 0.00 ? 66  ALA A O    3  
ATOM 4541  C CB   . ALA A 1 66  ? 4.927   -19.855 7.948   1.00 0.00 ? 66  ALA A CB   3  
ATOM 4542  H H    . ALA A 1 66  ? 3.526   -18.122 5.786   1.00 0.00 ? 66  ALA A H    3  
ATOM 4543  H HA   . ALA A 1 66  ? 6.101   -18.364 6.994   1.00 0.00 ? 66  ALA A HA   3  
ATOM 4544  H HB1  . ALA A 1 66  ? 4.008   -20.393 7.769   1.00 0.00 ? 66  ALA A HB1  3  
ATOM 4545  H HB2  . ALA A 1 66  ? 4.829   -19.263 8.845   1.00 0.00 ? 66  ALA A HB2  3  
ATOM 4546  H HB3  . ALA A 1 66  ? 5.739   -20.558 8.064   1.00 0.00 ? 66  ALA A HB3  3  
ATOM 4547  N N    . ASP A 1 67  ? 4.642   -20.781 5.298   1.00 0.00 ? 67  ASP A N    3  
ATOM 4548  C CA   . ASP A 1 67  ? 4.771   -21.647 4.134   1.00 0.00 ? 67  ASP A CA   3  
ATOM 4549  C C    . ASP A 1 67  ? 3.490   -22.444 3.912   1.00 0.00 ? 67  ASP A C    3  
ATOM 4550  O O    . ASP A 1 67  ? 3.068   -23.210 4.779   1.00 0.00 ? 67  ASP A O    3  
ATOM 4551  C CB   . ASP A 1 67  ? 5.955   -22.598 4.305   1.00 0.00 ? 67  ASP A CB   3  
ATOM 4552  C CG   . ASP A 1 67  ? 6.858   -22.624 3.088   1.00 0.00 ? 67  ASP A CG   3  
ATOM 4553  O OD1  . ASP A 1 67  ? 7.803   -21.809 3.032   1.00 0.00 ? 67  ASP A OD1  3  
ATOM 4554  O OD2  . ASP A 1 67  ? 6.622   -23.458 2.190   1.00 0.00 ? 67  ASP A OD2  3  
ATOM 4555  H H    . ASP A 1 67  ? 3.925   -20.954 5.944   1.00 0.00 ? 67  ASP A H    3  
ATOM 4556  H HA   . ASP A 1 67  ? 4.944   -21.021 3.270   1.00 0.00 ? 67  ASP A HA   3  
ATOM 4557  H HB2  . ASP A 1 67  ? 6.540   -22.285 5.157   1.00 0.00 ? 67  ASP A HB2  3  
ATOM 4558  H HB3  . ASP A 1 67  ? 5.583   -23.599 4.476   1.00 0.00 ? 67  ASP A HB3  3  
ATOM 4559  N N    . GLY A 1 68  ? 2.872   -22.255 2.749   1.00 0.00 ? 68  GLY A N    3  
ATOM 4560  C CA   . GLY A 1 68  ? 1.642   -22.961 2.440   1.00 0.00 ? 68  GLY A CA   3  
ATOM 4561  C C    . GLY A 1 68  ? 0.460   -22.430 3.226   1.00 0.00 ? 68  GLY A C    3  
ATOM 4562  O O    . GLY A 1 68  ? -0.637  -22.982 3.161   1.00 0.00 ? 68  GLY A O    3  
ATOM 4563  H H    . GLY A 1 68  ? 3.255   -21.630 2.100   1.00 0.00 ? 68  GLY A H    3  
ATOM 4564  H HA2  . GLY A 1 68  ? 1.436   -22.855 1.385   1.00 0.00 ? 68  GLY A HA2  3  
ATOM 4565  H HA3  . GLY A 1 68  ? 1.773   -24.009 2.667   1.00 0.00 ? 68  GLY A HA3  3  
ATOM 4566  N N    . HIS A 1 69  ? 0.687   -21.352 3.972   1.00 0.00 ? 69  HIS A N    3  
ATOM 4567  C CA   . HIS A 1 69  ? -0.364  -20.740 4.778   1.00 0.00 ? 69  HIS A CA   3  
ATOM 4568  C C    . HIS A 1 69  ? -1.439  -20.124 3.891   1.00 0.00 ? 69  HIS A C    3  
ATOM 4569  O O    . HIS A 1 69  ? -2.612  -20.492 3.973   1.00 0.00 ? 69  HIS A O    3  
ATOM 4570  C CB   . HIS A 1 69  ? 0.231   -19.672 5.698   1.00 0.00 ? 69  HIS A CB   3  
ATOM 4571  C CG   . HIS A 1 69  ? 0.118   -20.005 7.154   1.00 0.00 ? 69  HIS A CG   3  
ATOM 4572  N ND1  . HIS A 1 69  ? -1.085  -20.252 7.779   1.00 0.00 ? 69  HIS A ND1  3  
ATOM 4573  C CD2  . HIS A 1 69  ? 1.070   -20.133 8.111   1.00 0.00 ? 69  HIS A CD2  3  
ATOM 4574  C CE1  . HIS A 1 69  ? -0.871  -20.516 9.056   1.00 0.00 ? 69  HIS A CE1  3  
ATOM 4575  N NE2  . HIS A 1 69  ? 0.428   -20.449 9.283   1.00 0.00 ? 69  HIS A NE2  3  
ATOM 4576  H H    . HIS A 1 69  ? 1.584   -20.959 3.981   1.00 0.00 ? 69  HIS A H    3  
ATOM 4577  H HA   . HIS A 1 69  ? -0.813  -21.516 5.382   1.00 0.00 ? 69  HIS A HA   3  
ATOM 4578  H HB2  . HIS A 1 69  ? 1.279   -19.547 5.465   1.00 0.00 ? 69  HIS A HB2  3  
ATOM 4579  H HB3  . HIS A 1 69  ? -0.283  -18.737 5.530   1.00 0.00 ? 69  HIS A HB3  3  
ATOM 4580  H HD1  . HIS A 1 69  ? -1.966  -20.236 7.350   1.00 0.00 ? 69  HIS A HD1  3  
ATOM 4581  H HD2  . HIS A 1 69  ? 2.135   -20.007 7.978   1.00 0.00 ? 69  HIS A HD2  3  
ATOM 4582  H HE1  . HIS A 1 69  ? -1.630  -20.745 9.790   1.00 0.00 ? 69  HIS A HE1  3  
ATOM 4583  H HE2  . HIS A 1 69  ? 0.857   -20.577 10.154  1.00 0.00 ? 69  HIS A HE2  3  
ATOM 4584  N N    . ALA A 1 70  ? -1.030  -19.182 3.046   1.00 0.00 ? 70  ALA A N    3  
ATOM 4585  C CA   . ALA A 1 70  ? -1.954  -18.507 2.138   1.00 0.00 ? 70  ALA A CA   3  
ATOM 4586  C C    . ALA A 1 70  ? -3.048  -17.774 2.907   1.00 0.00 ? 70  ALA A C    3  
ATOM 4587  O O    . ALA A 1 70  ? -4.229  -18.109 2.800   1.00 0.00 ? 70  ALA A O    3  
ATOM 4588  C CB   . ALA A 1 70  ? -2.560  -19.508 1.163   1.00 0.00 ? 70  ALA A CB   3  
ATOM 4589  H H    . ALA A 1 70  ? -0.082  -18.933 3.031   1.00 0.00 ? 70  ALA A H    3  
ATOM 4590  H HA   . ALA A 1 70  ? -1.386  -17.786 1.566   1.00 0.00 ? 70  ALA A HA   3  
ATOM 4591  H HB1  . ALA A 1 70  ? -2.400  -19.167 0.152   1.00 0.00 ? 70  ALA A HB1  3  
ATOM 4592  H HB2  . ALA A 1 70  ? -3.622  -19.591 1.350   1.00 0.00 ? 70  ALA A HB2  3  
ATOM 4593  H HB3  . ALA A 1 70  ? -2.095  -20.472 1.299   1.00 0.00 ? 70  ALA A HB3  3  
ATOM 4594  N N    . ALA A 1 71  ? -2.648  -16.772 3.682   1.00 0.00 ? 71  ALA A N    3  
ATOM 4595  C CA   . ALA A 1 71  ? -3.589  -15.986 4.469   1.00 0.00 ? 71  ALA A CA   3  
ATOM 4596  C C    . ALA A 1 71  ? -3.397  -14.495 4.224   1.00 0.00 ? 71  ALA A C    3  
ATOM 4597  O O    . ALA A 1 71  ? -4.345  -13.713 4.310   1.00 0.00 ? 71  ALA A O    3  
ATOM 4598  C CB   . ALA A 1 71  ? -3.436  -16.305 5.948   1.00 0.00 ? 71  ALA A CB   3  
ATOM 4599  H H    . ALA A 1 71  ? -1.693  -16.553 3.724   1.00 0.00 ? 71  ALA A H    3  
ATOM 4600  H HA   . ALA A 1 71  ? -4.590  -16.264 4.167   1.00 0.00 ? 71  ALA A HA   3  
ATOM 4601  H HB1  . ALA A 1 71  ? -3.512  -15.393 6.523   1.00 0.00 ? 71  ALA A HB1  3  
ATOM 4602  H HB2  . ALA A 1 71  ? -2.472  -16.760 6.120   1.00 0.00 ? 71  ALA A HB2  3  
ATOM 4603  H HB3  . ALA A 1 71  ? -4.217  -16.987 6.252   1.00 0.00 ? 71  ALA A HB3  3  
ATOM 4604  N N    . VAL A 1 72  ? -2.164  -14.107 3.911   1.00 0.00 ? 72  VAL A N    3  
ATOM 4605  C CA   . VAL A 1 72  ? -1.846  -12.708 3.648   1.00 0.00 ? 72  VAL A CA   3  
ATOM 4606  C C    . VAL A 1 72  ? -2.153  -12.353 2.194   1.00 0.00 ? 72  VAL A C    3  
ATOM 4607  O O    . VAL A 1 72  ? -2.025  -13.193 1.303   1.00 0.00 ? 72  VAL A O    3  
ATOM 4608  C CB   . VAL A 1 72  ? -0.364  -12.388 3.971   1.00 0.00 ? 72  VAL A CB   3  
ATOM 4609  C CG1  . VAL A 1 72  ? 0.226   -13.441 4.900   1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4610  C CG2  . VAL A 1 72  ? 0.471   -12.272 2.702   1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4611  H H    . VAL A 1 72  ? -1.452  -14.777 3.854   1.00 0.00 ? 72  VAL A H    3  
ATOM 4612  H HA   . VAL A 1 72  ? -2.470  -12.102 4.290   1.00 0.00 ? 72  VAL A HA   3  
ATOM 4613  H HB   . VAL A 1 72  ? -0.330  -11.437 4.484   1.00 0.00 ? 72  VAL A HB   3  
ATOM 4614  H HG11 . VAL A 1 72  ? 0.723   -14.202 4.315   1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4615  H HG12 . VAL A 1 72  ? -0.563  -13.892 5.482   1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4616  H HG13 . VAL A 1 72  ? 0.942   -12.975 5.564   1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4617  H HG21 . VAL A 1 72  ? 0.388   -13.185 2.131   1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4618  H HG22 . VAL A 1 72  ? 1.505   -12.103 2.963   1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4619  H HG23 . VAL A 1 72  ? 0.110   -11.444 2.109   1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4620  N N    . VAL A 1 73  ? -2.567  -11.111 1.960   1.00 0.00 ? 73  VAL A N    3  
ATOM 4621  C CA   . VAL A 1 73  ? -2.897  -10.664 0.610   1.00 0.00 ? 73  VAL A CA   3  
ATOM 4622  C C    . VAL A 1 73  ? -2.376  -9.255  0.337   1.00 0.00 ? 73  VAL A C    3  
ATOM 4623  O O    . VAL A 1 73  ? -2.978  -8.267  0.755   1.00 0.00 ? 73  VAL A O    3  
ATOM 4624  C CB   . VAL A 1 73  ? -4.416  -10.695 0.357   1.00 0.00 ? 73  VAL A CB   3  
ATOM 4625  C CG1  . VAL A 1 73  ? -4.792  -11.904 -0.485  1.00 0.00 ? 73  VAL A CG1  3  
ATOM 4626  C CG2  . VAL A 1 73  ? -5.182  -10.695 1.671   1.00 0.00 ? 73  VAL A CG2  3  
ATOM 4627  H H    . VAL A 1 73  ? -2.658  -10.486 2.709   1.00 0.00 ? 73  VAL A H    3  
ATOM 4628  H HA   . VAL A 1 73  ? -2.427  -11.347 -0.085  1.00 0.00 ? 73  VAL A HA   3  
ATOM 4629  H HB   . VAL A 1 73  ? -4.687  -9.806  -0.192  1.00 0.00 ? 73  VAL A HB   3  
ATOM 4630  H HG11 . VAL A 1 73  ? -5.816  -12.178 -0.284  1.00 0.00 ? 73  VAL A HG11 3  
ATOM 4631  H HG12 . VAL A 1 73  ? -4.142  -12.731 -0.237  1.00 0.00 ? 73  VAL A HG12 3  
ATOM 4632  H HG13 . VAL A 1 73  ? -4.684  -11.662 -1.533  1.00 0.00 ? 73  VAL A HG13 3  
ATOM 4633  H HG21 . VAL A 1 73  ? -4.769  -11.446 2.329   1.00 0.00 ? 73  VAL A HG21 3  
ATOM 4634  H HG22 . VAL A 1 73  ? -6.222  -10.916 1.483   1.00 0.00 ? 73  VAL A HG22 3  
ATOM 4635  H HG23 . VAL A 1 73  ? -5.099  -9.724  2.137   1.00 0.00 ? 73  VAL A HG23 3  
ATOM 4636  N N    . PHE A 1 74  ? -1.262  -9.176  -0.384  1.00 0.00 ? 74  PHE A N    3  
ATOM 4637  C CA   . PHE A 1 74  ? -0.659  -7.893  -0.735  1.00 0.00 ? 74  PHE A CA   3  
ATOM 4638  C C    . PHE A 1 74  ? 0.383   -8.081  -1.836  1.00 0.00 ? 74  PHE A C    3  
ATOM 4639  O O    . PHE A 1 74  ? 0.828   -9.199  -2.092  1.00 0.00 ? 74  PHE A O    3  
ATOM 4640  C CB   . PHE A 1 74  ? -0.028  -7.229  0.492   1.00 0.00 ? 74  PHE A CB   3  
ATOM 4641  C CG   . PHE A 1 74  ? -0.276  -5.743  0.570   1.00 0.00 ? 74  PHE A CG   3  
ATOM 4642  C CD1  . PHE A 1 74  ? -1.526  -5.212  0.273   1.00 0.00 ? 74  PHE A CD1  3  
ATOM 4643  C CD2  . PHE A 1 74  ? 0.745   -4.876  0.933   1.00 0.00 ? 74  PHE A CD2  3  
ATOM 4644  C CE1  . PHE A 1 74  ? -1.748  -3.850  0.338   1.00 0.00 ? 74  PHE A CE1  3  
ATOM 4645  C CE2  . PHE A 1 74  ? 0.525   -3.515  1.001   1.00 0.00 ? 74  PHE A CE2  3  
ATOM 4646  C CZ   . PHE A 1 74  ? -0.720  -3.002  0.703   1.00 0.00 ? 74  PHE A CZ   3  
ATOM 4647  H H    . PHE A 1 74  ? -0.836  -10.002 -0.696  1.00 0.00 ? 74  PHE A H    3  
ATOM 4648  H HA   . PHE A 1 74  ? -1.446  -7.256  -1.114  1.00 0.00 ? 74  PHE A HA   3  
ATOM 4649  H HB2  . PHE A 1 74  ? -0.435  -7.679  1.385   1.00 0.00 ? 74  PHE A HB2  3  
ATOM 4650  H HB3  . PHE A 1 74  ? 1.040   -7.387  0.469   1.00 0.00 ? 74  PHE A HB3  3  
ATOM 4651  H HD1  . PHE A 1 74  ? -2.334  -5.873  -0.009  1.00 0.00 ? 74  PHE A HD1  3  
ATOM 4652  H HD2  . PHE A 1 74  ? 1.720   -5.270  1.168   1.00 0.00 ? 74  PHE A HD2  3  
ATOM 4653  H HE1  . PHE A 1 74  ? -2.725  -3.450  0.104   1.00 0.00 ? 74  PHE A HE1  3  
ATOM 4654  H HE2  . PHE A 1 74  ? 1.328   -2.853  1.289   1.00 0.00 ? 74  PHE A HE2  3  
ATOM 4655  H HZ   . PHE A 1 74  ? -0.893  -1.936  0.753   1.00 0.00 ? 74  PHE A HZ   3  
ATOM 4656  N N    . GLY A 1 75  ? 0.753   -6.986  -2.496  1.00 0.00 ? 75  GLY A N    3  
ATOM 4657  C CA   . GLY A 1 75  ? 1.724   -7.068  -3.573  1.00 0.00 ? 75  GLY A CA   3  
ATOM 4658  C C    . GLY A 1 75  ? 1.111   -7.666  -4.825  1.00 0.00 ? 75  GLY A C    3  
ATOM 4659  O O    . GLY A 1 75  ? 1.809   -7.961  -5.795  1.00 0.00 ? 75  GLY A O    3  
ATOM 4660  H H    . GLY A 1 75  ? 0.355   -6.123  -2.259  1.00 0.00 ? 75  GLY A H    3  
ATOM 4661  H HA2  . GLY A 1 75  ? 2.087   -6.076  -3.797  1.00 0.00 ? 75  GLY A HA2  3  
ATOM 4662  H HA3  . GLY A 1 75  ? 2.549   -7.687  -3.257  1.00 0.00 ? 75  GLY A HA3  3  
ATOM 4663  N N    . THR A 1 76  ? -0.206  -7.836  -4.787  1.00 0.00 ? 76  THR A N    3  
ATOM 4664  C CA   . THR A 1 76  ? -0.957  -8.392  -5.906  1.00 0.00 ? 76  THR A CA   3  
ATOM 4665  C C    . THR A 1 76  ? -2.359  -7.793  -5.957  1.00 0.00 ? 76  THR A C    3  
ATOM 4666  O O    . THR A 1 76  ? -2.807  -7.172  -4.993  1.00 0.00 ? 76  THR A O    3  
ATOM 4667  C CB   . THR A 1 76  ? -1.065  -9.926  -5.807  1.00 0.00 ? 76  THR A CB   3  
ATOM 4668  O OG1  . THR A 1 76  ? -0.252  -10.407 -4.730  1.00 0.00 ? 76  THR A OG1  3  
ATOM 4669  C CG2  . THR A 1 76  ? -0.634  -10.581 -7.108  1.00 0.00 ? 76  THR A CG2  3  
ATOM 4670  H H    . THR A 1 76  ? -0.691  -7.567  -3.979  1.00 0.00 ? 76  THR A H    3  
ATOM 4671  H HA   . THR A 1 76  ? -0.434  -8.144  -6.818  1.00 0.00 ? 76  THR A HA   3  
ATOM 4672  H HB   . THR A 1 76  ? -2.095  -10.187 -5.612  1.00 0.00 ? 76  THR A HB   3  
ATOM 4673  H HG1  . THR A 1 76  ? 0.057   -11.293 -4.933  1.00 0.00 ? 76  THR A HG1  3  
ATOM 4674  H HG21 . THR A 1 76  ? -0.832  -11.643 -7.061  1.00 0.00 ? 76  THR A HG21 3  
ATOM 4675  H HG22 . THR A 1 76  ? 0.424   -10.419 -7.260  1.00 0.00 ? 76  THR A HG22 3  
ATOM 4676  H HG23 . THR A 1 76  ? -1.186  -10.149 -7.929  1.00 0.00 ? 76  THR A HG23 3  
ATOM 4677  N N    . VAL A 1 77  ? -3.055  -7.986  -7.071  1.00 0.00 ? 77  VAL A N    3  
ATOM 4678  C CA   . VAL A 1 77  ? -4.410  -7.466  -7.207  1.00 0.00 ? 77  VAL A CA   3  
ATOM 4679  C C    . VAL A 1 77  ? -5.325  -8.157  -6.203  1.00 0.00 ? 77  VAL A C    3  
ATOM 4680  O O    . VAL A 1 77  ? -5.760  -9.288  -6.420  1.00 0.00 ? 77  VAL A O    3  
ATOM 4681  C CB   . VAL A 1 77  ? -4.963  -7.675  -8.631  1.00 0.00 ? 77  VAL A CB   3  
ATOM 4682  C CG1  . VAL A 1 77  ? -6.249  -6.885  -8.826  1.00 0.00 ? 77  VAL A CG1  3  
ATOM 4683  C CG2  . VAL A 1 77  ? -3.925  -7.284  -9.671  1.00 0.00 ? 77  VAL A CG2  3  
ATOM 4684  H H    . VAL A 1 77  ? -2.657  -8.494  -7.809  1.00 0.00 ? 77  VAL A H    3  
ATOM 4685  H HA   . VAL A 1 77  ? -4.387  -6.406  -6.996  1.00 0.00 ? 77  VAL A HA   3  
ATOM 4686  H HB   . VAL A 1 77  ? -5.189  -8.722  -8.756  1.00 0.00 ? 77  VAL A HB   3  
ATOM 4687  H HG11 . VAL A 1 77  ? -7.072  -7.422  -8.380  1.00 0.00 ? 77  VAL A HG11 3  
ATOM 4688  H HG12 . VAL A 1 77  ? -6.434  -6.757  -9.884  1.00 0.00 ? 77  VAL A HG12 3  
ATOM 4689  H HG13 . VAL A 1 77  ? -6.153  -5.918  -8.358  1.00 0.00 ? 77  VAL A HG13 3  
ATOM 4690  H HG21 . VAL A 1 77  ? -3.154  -6.686  -9.204  1.00 0.00 ? 77  VAL A HG21 3  
ATOM 4691  H HG22 . VAL A 1 77  ? -4.399  -6.710  -10.454 1.00 0.00 ? 77  VAL A HG22 3  
ATOM 4692  H HG23 . VAL A 1 77  ? -3.484  -8.175  -10.093 1.00 0.00 ? 77  VAL A HG23 3  
ATOM 4693  N N    . VAL A 1 78  ? -5.592  -7.477  -5.091  1.00 0.00 ? 78  VAL A N    3  
ATOM 4694  C CA   . VAL A 1 78  ? -6.429  -8.034  -4.035  1.00 0.00 ? 78  VAL A CA   3  
ATOM 4695  C C    . VAL A 1 78  ? -7.588  -7.111  -3.675  1.00 0.00 ? 78  VAL A C    3  
ATOM 4696  O O    . VAL A 1 78  ? -7.644  -5.962  -4.114  1.00 0.00 ? 78  VAL A O    3  
ATOM 4697  C CB   . VAL A 1 78  ? -5.604  -8.271  -2.756  1.00 0.00 ? 78  VAL A CB   3  
ATOM 4698  C CG1  . VAL A 1 78  ? -4.633  -9.421  -2.946  1.00 0.00 ? 78  VAL A CG1  3  
ATOM 4699  C CG2  . VAL A 1 78  ? -4.863  -7.004  -2.363  1.00 0.00 ? 78  VAL A CG2  3  
ATOM 4700  H H    . VAL A 1 78  ? -5.203  -6.586  -4.969  1.00 0.00 ? 78  VAL A H    3  
ATOM 4701  H HA   . VAL A 1 78  ? -6.816  -8.983  -4.370  1.00 0.00 ? 78  VAL A HA   3  
ATOM 4702  H HB   . VAL A 1 78  ? -6.282  -8.529  -1.957  1.00 0.00 ? 78  VAL A HB   3  
ATOM 4703  H HG11 . VAL A 1 78  ? -4.130  -9.313  -3.893  1.00 0.00 ? 78  VAL A HG11 3  
ATOM 4704  H HG12 . VAL A 1 78  ? -5.174  -10.354 -2.928  1.00 0.00 ? 78  VAL A HG12 3  
ATOM 4705  H HG13 . VAL A 1 78  ? -3.906  -9.407  -2.146  1.00 0.00 ? 78  VAL A HG13 3  
ATOM 4706  H HG21 . VAL A 1 78  ? -5.035  -6.240  -3.108  1.00 0.00 ? 78  VAL A HG21 3  
ATOM 4707  H HG22 . VAL A 1 78  ? -3.806  -7.210  -2.296  1.00 0.00 ? 78  VAL A HG22 3  
ATOM 4708  H HG23 . VAL A 1 78  ? -5.224  -6.658  -1.406  1.00 0.00 ? 78  VAL A HG23 3  
ATOM 4709  N N    . ASP A 1 79  ? -8.485  -7.619  -2.839  1.00 0.00 ? 79  ASP A N    3  
ATOM 4710  C CA   . ASP A 1 79  ? -9.625  -6.844  -2.372  1.00 0.00 ? 79  ASP A CA   3  
ATOM 4711  C C    . ASP A 1 79  ? -9.224  -6.090  -1.112  1.00 0.00 ? 79  ASP A C    3  
ATOM 4712  O O    . ASP A 1 79  ? -8.944  -6.700  -0.082  1.00 0.00 ? 79  ASP A O    3  
ATOM 4713  C CB   . ASP A 1 79  ? -10.820 -7.757  -2.086  1.00 0.00 ? 79  ASP A CB   3  
ATOM 4714  C CG   . ASP A 1 79  ? -11.639 -8.044  -3.328  1.00 0.00 ? 79  ASP A CG   3  
ATOM 4715  O OD1  . ASP A 1 79  ? -11.330 -9.033  -4.027  1.00 0.00 ? 79  ASP A OD1  3  
ATOM 4716  O OD2  . ASP A 1 79  ? -12.588 -7.281  -3.606  1.00 0.00 ? 79  ASP A OD2  3  
ATOM 4717  H H    . ASP A 1 79  ? -8.356  -8.532  -2.506  1.00 0.00 ? 79  ASP A H    3  
ATOM 4718  H HA   . ASP A 1 79  ? -9.889  -6.134  -3.141  1.00 0.00 ? 79  ASP A HA   3  
ATOM 4719  H HB2  . ASP A 1 79  ? -10.463 -8.694  -1.688  1.00 0.00 ? 79  ASP A HB2  3  
ATOM 4720  H HB3  . ASP A 1 79  ? -11.460 -7.283  -1.357  1.00 0.00 ? 79  ASP A HB3  3  
ATOM 4721  N N    . ILE A 1 80  ? -9.172  -4.768  -1.202  1.00 0.00 ? 80  ILE A N    3  
ATOM 4722  C CA   . ILE A 1 80  ? -8.770  -3.950  -0.066  1.00 0.00 ? 80  ILE A CA   3  
ATOM 4723  C C    . ILE A 1 80  ? -9.967  -3.333  0.649   1.00 0.00 ? 80  ILE A C    3  
ATOM 4724  O O    . ILE A 1 80  ? -11.098 -3.396  0.171   1.00 0.00 ? 80  ILE A O    3  
ATOM 4725  C CB   . ILE A 1 80  ? -7.808  -2.829  -0.502  1.00 0.00 ? 80  ILE A CB   3  
ATOM 4726  C CG1  . ILE A 1 80  ? -8.548  -1.771  -1.324  1.00 0.00 ? 80  ILE A CG1  3  
ATOM 4727  C CG2  . ILE A 1 80  ? -6.646  -3.407  -1.296  1.00 0.00 ? 80  ILE A CG2  3  
ATOM 4728  C CD1  . ILE A 1 80  ? -7.915  -0.399  -1.252  1.00 0.00 ? 80  ILE A CD1  3  
ATOM 4729  H H    . ILE A 1 80  ? -9.395  -4.334  -2.050  1.00 0.00 ? 80  ILE A H    3  
ATOM 4730  H HA   . ILE A 1 80  ? -8.242  -4.588  0.628   1.00 0.00 ? 80  ILE A HA   3  
ATOM 4731  H HB   . ILE A 1 80  ? -7.407  -2.367  0.387   1.00 0.00 ? 80  ILE A HB   3  
ATOM 4732  H HG12 . ILE A 1 80  ? -8.564  -2.075  -2.360  1.00 0.00 ? 80  ILE A HG12 3  
ATOM 4733  H HG13 . ILE A 1 80  ? -9.563  -1.688  -0.963  1.00 0.00 ? 80  ILE A HG13 3  
ATOM 4734  H HG21 . ILE A 1 80  ? -5.718  -3.202  -0.780  1.00 0.00 ? 80  ILE A HG21 3  
ATOM 4735  H HG22 . ILE A 1 80  ? -6.619  -2.954  -2.276  1.00 0.00 ? 80  ILE A HG22 3  
ATOM 4736  H HG23 . ILE A 1 80  ? -6.774  -4.476  -1.396  1.00 0.00 ? 80  ILE A HG23 3  
ATOM 4737  H HD11 . ILE A 1 80  ? -6.885  -0.461  -1.573  1.00 0.00 ? 80  ILE A HD11 3  
ATOM 4738  H HD12 . ILE A 1 80  ? -7.956  -0.037  -0.235  1.00 0.00 ? 80  ILE A HD12 3  
ATOM 4739  H HD13 . ILE A 1 80  ? -8.452  0.280   -1.898  1.00 0.00 ? 80  ILE A HD13 3  
ATOM 4740  N N    . ILE A 1 81  ? -9.692  -2.727  1.799   1.00 0.00 ? 81  ILE A N    3  
ATOM 4741  C CA   . ILE A 1 81  ? -10.720 -2.078  2.601   1.00 0.00 ? 81  ILE A CA   3  
ATOM 4742  C C    . ILE A 1 81  ? -10.175 -0.793  3.211   1.00 0.00 ? 81  ILE A C    3  
ATOM 4743  O O    . ILE A 1 81  ? -9.026  -0.743  3.642   1.00 0.00 ? 81  ILE A O    3  
ATOM 4744  C CB   . ILE A 1 81  ? -11.230 -2.996  3.730   1.00 0.00 ? 81  ILE A CB   3  
ATOM 4745  C CG1  . ILE A 1 81  ? -10.107 -3.913  4.223   1.00 0.00 ? 81  ILE A CG1  3  
ATOM 4746  C CG2  . ILE A 1 81  ? -12.417 -3.814  3.249   1.00 0.00 ? 81  ILE A CG2  3  
ATOM 4747  C CD1  . ILE A 1 81  ? -9.870  -3.827  5.716   1.00 0.00 ? 81  ILE A CD1  3  
ATOM 4748  H H    . ILE A 1 81  ? -8.764  -2.709  2.116   1.00 0.00 ? 81  ILE A H    3  
ATOM 4749  H HA   . ILE A 1 81  ? -11.550 -1.837  1.953   1.00 0.00 ? 81  ILE A HA   3  
ATOM 4750  H HB   . ILE A 1 81  ? -11.561 -2.374  4.548   1.00 0.00 ? 81  ILE A HB   3  
ATOM 4751  H HG12 . ILE A 1 81  ? -10.357 -4.937  3.987   1.00 0.00 ? 81  ILE A HG12 3  
ATOM 4752  H HG13 . ILE A 1 81  ? -9.187  -3.645  3.725   1.00 0.00 ? 81  ILE A HG13 3  
ATOM 4753  H HG21 . ILE A 1 81  ? -12.943 -4.223  4.100   1.00 0.00 ? 81  ILE A HG21 3  
ATOM 4754  H HG22 . ILE A 1 81  ? -12.068 -4.620  2.620   1.00 0.00 ? 81  ILE A HG22 3  
ATOM 4755  H HG23 . ILE A 1 81  ? -13.086 -3.181  2.683   1.00 0.00 ? 81  ILE A HG23 3  
ATOM 4756  H HD11 . ILE A 1 81  ? -8.885  -3.426  5.900   1.00 0.00 ? 81  ILE A HD11 3  
ATOM 4757  H HD12 . ILE A 1 81  ? -9.945  -4.814  6.149   1.00 0.00 ? 81  ILE A HD12 3  
ATOM 4758  H HD13 . ILE A 1 81  ? -10.612 -3.180  6.162   1.00 0.00 ? 81  ILE A HD13 3  
ATOM 4759  N N    . SER A 1 82  ? -10.997 0.249   3.236   1.00 0.00 ? 82  SER A N    3  
ATOM 4760  C CA   . SER A 1 82  ? -10.576 1.532   3.784   1.00 0.00 ? 82  SER A CA   3  
ATOM 4761  C C    . SER A 1 82  ? -10.992 1.676   5.243   1.00 0.00 ? 82  SER A C    3  
ATOM 4762  O O    . SER A 1 82  ? -11.711 0.834   5.781   1.00 0.00 ? 82  SER A O    3  
ATOM 4763  C CB   . SER A 1 82  ? -11.165 2.679   2.958   1.00 0.00 ? 82  SER A CB   3  
ATOM 4764  O OG   . SER A 1 82  ? -12.215 3.324   3.656   1.00 0.00 ? 82  SER A OG   3  
ATOM 4765  H H    . SER A 1 82  ? -11.903 0.154   2.875   1.00 0.00 ? 82  SER A H    3  
ATOM 4766  H HA   . SER A 1 82  ? -9.498  1.578   3.726   1.00 0.00 ? 82  SER A HA   3  
ATOM 4767  H HB2  . SER A 1 82  ? -10.390 3.400   2.748   1.00 0.00 ? 82  SER A HB2  3  
ATOM 4768  H HB3  . SER A 1 82  ? -11.552 2.286   2.031   1.00 0.00 ? 82  SER A HB3  3  
ATOM 4769  H HG   . SER A 1 82  ? -11.886 4.132   4.056   1.00 0.00 ? 82  SER A HG   3  
ATOM 4770  N N    . ARG A 1 83  ? -10.517 2.747   5.878   1.00 0.00 ? 83  ARG A N    3  
ATOM 4771  C CA   . ARG A 1 83  ? -10.822 3.015   7.284   1.00 0.00 ? 83  ARG A CA   3  
ATOM 4772  C C    . ARG A 1 83  ? -12.315 2.852   7.589   1.00 0.00 ? 83  ARG A C    3  
ATOM 4773  O O    . ARG A 1 83  ? -12.691 2.538   8.718   1.00 0.00 ? 83  ARG A O    3  
ATOM 4774  C CB   . ARG A 1 83  ? -10.374 4.428   7.661   1.00 0.00 ? 83  ARG A CB   3  
ATOM 4775  C CG   . ARG A 1 83  ? -11.259 5.525   7.083   1.00 0.00 ? 83  ARG A CG   3  
ATOM 4776  C CD   . ARG A 1 83  ? -10.443 6.733   6.652   1.00 0.00 ? 83  ARG A CD   3  
ATOM 4777  N NE   . ARG A 1 83  ? -10.616 7.865   7.559   1.00 0.00 ? 83  ARG A NE   3  
ATOM 4778  C CZ   . ARG A 1 83  ? -11.668 8.676   7.540   1.00 0.00 ? 83  ARG A CZ   3  
ATOM 4779  N NH1  . ARG A 1 83  ? -12.644 8.482   6.662   1.00 0.00 ? 83  ARG A NH1  3  
ATOM 4780  N NH2  . ARG A 1 83  ? -11.748 9.681   8.400   1.00 0.00 ? 83  ARG A NH2  3  
ATOM 4781  H H    . ARG A 1 83  ? -9.929  3.366   5.389   1.00 0.00 ? 83  ARG A H    3  
ATOM 4782  H HA   . ARG A 1 83  ? -10.271 2.304   7.881   1.00 0.00 ? 83  ARG A HA   3  
ATOM 4783  H HB2  . ARG A 1 83  ? -10.382 4.521   8.736   1.00 0.00 ? 83  ARG A HB2  3  
ATOM 4784  H HB3  . ARG A 1 83  ? -9.369  4.583   7.303   1.00 0.00 ? 83  ARG A HB3  3  
ATOM 4785  H HG2  . ARG A 1 83  ? -11.785 5.134   6.226   1.00 0.00 ? 83  ARG A HG2  3  
ATOM 4786  H HG3  . ARG A 1 83  ? -11.970 5.832   7.835   1.00 0.00 ? 83  ARG A HG3  3  
ATOM 4787  H HD2  . ARG A 1 83  ? -9.401  6.458   6.627   1.00 0.00 ? 83  ARG A HD2  3  
ATOM 4788  H HD3  . ARG A 1 83  ? -10.758 7.029   5.661   1.00 0.00 ? 83  ARG A HD3  3  
ATOM 4789  H HE   . ARG A 1 83  ? -9.908  8.026   8.219   1.00 0.00 ? 83  ARG A HE   3  
ATOM 4790  H HH11 . ARG A 1 83  ? -12.589 7.725   6.013   1.00 0.00 ? 83  ARG A HH11 3  
ATOM 4791  H HH12 . ARG A 1 83  ? -13.434 9.095   6.652   1.00 0.00 ? 83  ARG A HH12 3  
ATOM 4792  H HH21 . ARG A 1 83  ? -11.014 9.830   9.064   1.00 0.00 ? 83  ARG A HH21 3  
ATOM 4793  H HH22 . ARG A 1 83  ? -12.538 10.293  8.383   1.00 0.00 ? 83  ARG A HH22 3  
ATOM 4794  N N    . SER A 1 84  ? -13.161 3.080   6.586   1.00 0.00 ? 84  SER A N    3  
ATOM 4795  C CA   . SER A 1 84  ? -14.607 2.966   6.767   1.00 0.00 ? 84  SER A CA   3  
ATOM 4796  C C    . SER A 1 84  ? -15.112 1.585   6.366   1.00 0.00 ? 84  SER A C    3  
ATOM 4797  O O    . SER A 1 84  ? -16.183 1.156   6.801   1.00 0.00 ? 84  SER A O    3  
ATOM 4798  C CB   . SER A 1 84  ? -15.329 4.039   5.949   1.00 0.00 ? 84  SER A CB   3  
ATOM 4799  O OG   . SER A 1 84  ? -16.729 3.985   6.159   1.00 0.00 ? 84  SER A OG   3  
ATOM 4800  H H    . SER A 1 84  ? -12.810 3.335   5.706   1.00 0.00 ? 84  SER A H    3  
ATOM 4801  H HA   . SER A 1 84  ? -14.821 3.123   7.814   1.00 0.00 ? 84  SER A HA   3  
ATOM 4802  H HB2  . SER A 1 84  ? -14.972 5.014   6.244   1.00 0.00 ? 84  SER A HB2  3  
ATOM 4803  H HB3  . SER A 1 84  ? -15.129 3.884   4.899   1.00 0.00 ? 84  SER A HB3  3  
ATOM 4804  H HG   . SER A 1 84  ? -16.910 3.852   7.092   1.00 0.00 ? 84  SER A HG   3  
ATOM 4805  N N    . GLY A 1 85  ? -14.339 0.889   5.540   1.00 0.00 ? 85  GLY A N    3  
ATOM 4806  C CA   . GLY A 1 85  ? -14.728 -0.438  5.099   1.00 0.00 ? 85  GLY A CA   3  
ATOM 4807  C C    . GLY A 1 85  ? -15.348 -0.427  3.720   1.00 0.00 ? 85  GLY A C    3  
ATOM 4808  O O    . GLY A 1 85  ? -16.504 -0.034  3.556   1.00 0.00 ? 85  GLY A O    3  
ATOM 4809  H H    . GLY A 1 85  ? -13.495 1.279   5.228   1.00 0.00 ? 85  GLY A H    3  
ATOM 4810  H HA2  . GLY A 1 85  ? -13.853 -1.072  5.084   1.00 0.00 ? 85  GLY A HA2  3  
ATOM 4811  H HA3  . GLY A 1 85  ? -15.442 -0.844  5.796   1.00 0.00 ? 85  GLY A HA3  3  
ATOM 4812  N N    . GLU A 1 86  ? -14.580 -0.862  2.728   1.00 0.00 ? 86  GLU A N    3  
ATOM 4813  C CA   . GLU A 1 86  ? -15.063 -0.904  1.354   1.00 0.00 ? 86  GLU A CA   3  
ATOM 4814  C C    . GLU A 1 86  ? -14.419 -2.053  0.586   1.00 0.00 ? 86  GLU A C    3  
ATOM 4815  O O    . GLU A 1 86  ? -13.373 -1.885  -0.041  1.00 0.00 ? 86  GLU A O    3  
ATOM 4816  C CB   . GLU A 1 86  ? -14.765 0.420   0.642   1.00 0.00 ? 86  GLU A CB   3  
ATOM 4817  C CG   . GLU A 1 86  ? -15.229 1.652   1.405   1.00 0.00 ? 86  GLU A CG   3  
ATOM 4818  C CD   . GLU A 1 86  ? -15.007 2.936   0.629   1.00 0.00 ? 86  GLU A CD   3  
ATOM 4819  O OE1  . GLU A 1 86  ? -14.801 2.862   -0.601  1.00 0.00 ? 86  GLU A OE1  3  
ATOM 4820  O OE2  . GLU A 1 86  ? -15.038 4.018   1.253   1.00 0.00 ? 86  GLU A OE2  3  
ATOM 4821  H H    . GLU A 1 86  ? -13.671 -1.166  2.926   1.00 0.00 ? 86  GLU A H    3  
ATOM 4822  H HA   . GLU A 1 86  ? -16.130 -1.056  1.379   1.00 0.00 ? 86  GLU A HA   3  
ATOM 4823  H HB2  . GLU A 1 86  ? -13.700 0.499   0.489   1.00 0.00 ? 86  GLU A HB2  3  
ATOM 4824  H HB3  . GLU A 1 86  ? -15.258 0.411   -0.313  1.00 0.00 ? 86  GLU A HB3  3  
ATOM 4825  H HG2  . GLU A 1 86  ? -16.284 1.555   1.613   1.00 0.00 ? 86  GLU A HG2  3  
ATOM 4826  H HG3  . GLU A 1 86  ? -14.684 1.711   2.335   1.00 0.00 ? 86  GLU A HG3  3  
ATOM 4827  N N    . LYS A 1 87  ? -15.051 -3.223  0.631   1.00 0.00 ? 87  LYS A N    3  
ATOM 4828  C CA   . LYS A 1 87  ? -14.533 -4.393  -0.070  1.00 0.00 ? 87  LYS A CA   3  
ATOM 4829  C C    . LYS A 1 87  ? -14.619 -4.190  -1.579  1.00 0.00 ? 87  LYS A C    3  
ATOM 4830  O O    . LYS A 1 87  ? -15.701 -4.270  -2.164  1.00 0.00 ? 87  LYS A O    3  
ATOM 4831  C CB   . LYS A 1 87  ? -15.296 -5.662  0.329   1.00 0.00 ? 87  LYS A CB   3  
ATOM 4832  C CG   . LYS A 1 87  ? -16.150 -5.511  1.578   1.00 0.00 ? 87  LYS A CG   3  
ATOM 4833  C CD   . LYS A 1 87  ? -15.325 -5.679  2.845   1.00 0.00 ? 87  LYS A CD   3  
ATOM 4834  C CE   . LYS A 1 87  ? -14.831 -7.108  3.008   1.00 0.00 ? 87  LYS A CE   3  
ATOM 4835  N NZ   . LYS A 1 87  ? -13.361 -7.216  2.796   1.00 0.00 ? 87  LYS A NZ   3  
ATOM 4836  H H    . LYS A 1 87  ? -15.884 -3.297  1.143   1.00 0.00 ? 87  LYS A H    3  
ATOM 4837  H HA   . LYS A 1 87  ? -13.495 -4.508  0.203   1.00 0.00 ? 87  LYS A HA   3  
ATOM 4838  H HB2  . LYS A 1 87  ? -15.941 -5.950  -0.488  1.00 0.00 ? 87  LYS A HB2  3  
ATOM 4839  H HB3  . LYS A 1 87  ? -14.581 -6.454  0.503   1.00 0.00 ? 87  LYS A HB3  3  
ATOM 4840  H HG2  . LYS A 1 87  ? -16.597 -4.527  1.581   1.00 0.00 ? 87  LYS A HG2  3  
ATOM 4841  H HG3  . LYS A 1 87  ? -16.927 -6.261  1.565   1.00 0.00 ? 87  LYS A HG3  3  
ATOM 4842  H HD2  . LYS A 1 87  ? -14.471 -5.020  2.797   1.00 0.00 ? 87  LYS A HD2  3  
ATOM 4843  H HD3  . LYS A 1 87  ? -15.934 -5.419  3.698   1.00 0.00 ? 87  LYS A HD3  3  
ATOM 4844  H HE2  . LYS A 1 87  ? -15.066 -7.448  4.006   1.00 0.00 ? 87  LYS A HE2  3  
ATOM 4845  H HE3  . LYS A 1 87  ? -15.336 -7.735  2.286   1.00 0.00 ? 87  LYS A HE3  3  
ATOM 4846  H HZ1  . LYS A 1 87  ? -13.118 -6.926  1.827   1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 4847  H HZ2  . LYS A 1 87  ? -13.049 -8.197  2.941   1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 4848  H HZ3  . LYS A 1 87  ? -12.858 -6.601  3.467   1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 4849  N N    . ILE A 1 88  ? -13.475 -3.923  -2.201  1.00 0.00 ? 88  ILE A N    3  
ATOM 4850  C CA   . ILE A 1 88  ? -13.424 -3.704  -3.642  1.00 0.00 ? 88  ILE A CA   3  
ATOM 4851  C C    . ILE A 1 88  ? -12.134 -4.250  -4.245  1.00 0.00 ? 88  ILE A C    3  
ATOM 4852  O O    . ILE A 1 88  ? -11.061 -4.129  -3.653  1.00 0.00 ? 88  ILE A O    3  
ATOM 4853  C CB   . ILE A 1 88  ? -13.539 -2.206  -3.988  1.00 0.00 ? 88  ILE A CB   3  
ATOM 4854  C CG1  . ILE A 1 88  ? -12.585 -1.383  -3.120  1.00 0.00 ? 88  ILE A CG1  3  
ATOM 4855  C CG2  . ILE A 1 88  ? -14.973 -1.729  -3.810  1.00 0.00 ? 88  ILE A CG2  3  
ATOM 4856  C CD1  . ILE A 1 88  ? -12.244 -0.031  -3.709  1.00 0.00 ? 88  ILE A CD1  3  
ATOM 4857  H H    . ILE A 1 88  ? -12.650 -3.873  -1.677  1.00 0.00 ? 88  ILE A H    3  
ATOM 4858  H HA   . ILE A 1 88  ? -14.264 -4.218  -4.087  1.00 0.00 ? 88  ILE A HA   3  
ATOM 4859  H HB   . ILE A 1 88  ? -13.270 -2.079  -5.025  1.00 0.00 ? 88  ILE A HB   3  
ATOM 4860  H HG12 . ILE A 1 88  ? -13.037 -1.218  -2.154  1.00 0.00 ? 88  ILE A HG12 3  
ATOM 4861  H HG13 . ILE A 1 88  ? -11.663 -1.931  -2.992  1.00 0.00 ? 88  ILE A HG13 3  
ATOM 4862  H HG21 . ILE A 1 88  ? -15.394 -2.176  -2.922  1.00 0.00 ? 88  ILE A HG21 3  
ATOM 4863  H HG22 . ILE A 1 88  ? -15.558 -2.016  -4.671  1.00 0.00 ? 88  ILE A HG22 3  
ATOM 4864  H HG23 . ILE A 1 88  ? -14.983 -0.653  -3.711  1.00 0.00 ? 88  ILE A HG23 3  
ATOM 4865  H HD11 . ILE A 1 88  ? -11.783 0.586   -2.952  1.00 0.00 ? 88  ILE A HD11 3  
ATOM 4866  H HD12 . ILE A 1 88  ? -13.147 0.446   -4.062  1.00 0.00 ? 88  ILE A HD12 3  
ATOM 4867  H HD13 . ILE A 1 88  ? -11.559 -0.159  -4.535  1.00 0.00 ? 88  ILE A HD13 3  
ATOM 4868  N N    . PRO A 1 89  ? -12.219 -4.858  -5.444  1.00 0.00 ? 89  PRO A N    3  
ATOM 4869  C CA   . PRO A 1 89  ? -11.050 -5.417  -6.132  1.00 0.00 ? 89  PRO A CA   3  
ATOM 4870  C C    . PRO A 1 89  ? -10.100 -4.326  -6.618  1.00 0.00 ? 89  PRO A C    3  
ATOM 4871  O O    . PRO A 1 89  ? -10.502 -3.420  -7.350  1.00 0.00 ? 89  PRO A O    3  
ATOM 4872  C CB   . PRO A 1 89  ? -11.657 -6.170  -7.316  1.00 0.00 ? 89  PRO A CB   3  
ATOM 4873  C CG   . PRO A 1 89  ? -12.961 -5.496  -7.567  1.00 0.00 ? 89  PRO A CG   3  
ATOM 4874  C CD   . PRO A 1 89  ? -13.458 -5.039  -6.225  1.00 0.00 ? 89  PRO A CD   3  
ATOM 4875  H HA   . PRO A 1 89  ? -10.511 -6.107  -5.499  1.00 0.00 ? 89  PRO A HA   3  
ATOM 4876  H HB2  . PRO A 1 89  ? -11.002 -6.093  -8.172  1.00 0.00 ? 89  PRO A HB2  3  
ATOM 4877  H HB3  . PRO A 1 89  ? -11.796 -7.208  -7.055  1.00 0.00 ? 89  PRO A HB3  3  
ATOM 4878  H HG2  . PRO A 1 89  ? -12.818 -4.649  -8.222  1.00 0.00 ? 89  PRO A HG2  3  
ATOM 4879  H HG3  . PRO A 1 89  ? -13.658 -6.195  -8.007  1.00 0.00 ? 89  PRO A HG3  3  
ATOM 4880  H HD2  . PRO A 1 89  ? -13.995 -4.106  -6.318  1.00 0.00 ? 89  PRO A HD2  3  
ATOM 4881  H HD3  . PRO A 1 89  ? -14.087 -5.795  -5.778  1.00 0.00 ? 89  PRO A HD3  3  
ATOM 4882  N N    . VAL A 1 90  ? -8.838  -4.418  -6.206  1.00 0.00 ? 90  VAL A N    3  
ATOM 4883  C CA   . VAL A 1 90  ? -7.832  -3.437  -6.597  1.00 0.00 ? 90  VAL A CA   3  
ATOM 4884  C C    . VAL A 1 90  ? -6.488  -4.109  -6.866  1.00 0.00 ? 90  VAL A C    3  
ATOM 4885  O O    . VAL A 1 90  ? -6.197  -5.175  -6.325  1.00 0.00 ? 90  VAL A O    3  
ATOM 4886  C CB   . VAL A 1 90  ? -7.644  -2.358  -5.507  1.00 0.00 ? 90  VAL A CB   3  
ATOM 4887  C CG1  . VAL A 1 90  ? -6.771  -1.220  -6.016  1.00 0.00 ? 90  VAL A CG1  3  
ATOM 4888  C CG2  . VAL A 1 90  ? -8.991  -1.826  -5.034  1.00 0.00 ? 90  VAL A CG2  3  
ATOM 4889  H H    . VAL A 1 90  ? -8.575  -5.163  -5.628  1.00 0.00 ? 90  VAL A H    3  
ATOM 4890  H HA   . VAL A 1 90  ? -8.169  -2.952  -7.501  1.00 0.00 ? 90  VAL A HA   3  
ATOM 4891  H HB   . VAL A 1 90  ? -7.147  -2.811  -4.663  1.00 0.00 ? 90  VAL A HB   3  
ATOM 4892  H HG11 . VAL A 1 90  ? -6.440  -1.443  -7.020  1.00 0.00 ? 90  VAL A HG11 3  
ATOM 4893  H HG12 . VAL A 1 90  ? -5.914  -1.109  -5.370  1.00 0.00 ? 90  VAL A HG12 3  
ATOM 4894  H HG13 . VAL A 1 90  ? -7.341  -0.304  -6.020  1.00 0.00 ? 90  VAL A HG13 3  
ATOM 4895  H HG21 . VAL A 1 90  ? -8.849  -0.884  -4.527  1.00 0.00 ? 90  VAL A HG21 3  
ATOM 4896  H HG22 . VAL A 1 90  ? -9.440  -2.536  -4.356  1.00 0.00 ? 90  VAL A HG22 3  
ATOM 4897  H HG23 . VAL A 1 90  ? -9.640  -1.683  -5.886  1.00 0.00 ? 90  VAL A HG23 3  
ATOM 4898  N N    . SER A 1 91  ? -5.671  -3.471  -7.697  1.00 0.00 ? 91  SER A N    3  
ATOM 4899  C CA   . SER A 1 91  ? -4.352  -3.998  -8.034  1.00 0.00 ? 91  SER A CA   3  
ATOM 4900  C C    . SER A 1 91  ? -3.285  -3.395  -7.128  1.00 0.00 ? 91  SER A C    3  
ATOM 4901  O O    . SER A 1 91  ? -3.188  -2.173  -6.997  1.00 0.00 ? 91  SER A O    3  
ATOM 4902  C CB   . SER A 1 91  ? -4.020  -3.705  -9.498  1.00 0.00 ? 91  SER A CB   3  
ATOM 4903  O OG   . SER A 1 91  ? -5.190  -3.685  -10.295 1.00 0.00 ? 91  SER A OG   3  
ATOM 4904  H H    . SER A 1 91  ? -5.964  -2.621  -8.083  1.00 0.00 ? 91  SER A H    3  
ATOM 4905  H HA   . SER A 1 91  ? -4.373  -5.067  -7.885  1.00 0.00 ? 91  SER A HA   3  
ATOM 4906  H HB2  . SER A 1 91  ? -3.534  -2.741  -9.568  1.00 0.00 ? 91  SER A HB2  3  
ATOM 4907  H HB3  . SER A 1 91  ? -3.354  -4.469  -9.875  1.00 0.00 ? 91  SER A HB3  3  
ATOM 4908  H HG   . SER A 1 91  ? -5.827  -4.308  -9.942  1.00 0.00 ? 91  SER A HG   3  
ATOM 4909  N N    . VAL A 1 92  ? -2.492  -4.253  -6.494  1.00 0.00 ? 92  VAL A N    3  
ATOM 4910  C CA   . VAL A 1 92  ? -1.440  -3.795  -5.595  1.00 0.00 ? 92  VAL A CA   3  
ATOM 4911  C C    . VAL A 1 92  ? -0.076  -4.343  -5.996  1.00 0.00 ? 92  VAL A C    3  
ATOM 4912  O O    . VAL A 1 92  ? 0.076   -5.537  -6.249  1.00 0.00 ? 92  VAL A O    3  
ATOM 4913  C CB   . VAL A 1 92  ? -1.731  -4.217  -4.140  1.00 0.00 ? 92  VAL A CB   3  
ATOM 4914  C CG1  . VAL A 1 92  ? -0.590  -3.802  -3.219  1.00 0.00 ? 92  VAL A CG1  3  
ATOM 4915  C CG2  . VAL A 1 92  ? -3.051  -3.628  -3.669  1.00 0.00 ? 92  VAL A CG2  3  
ATOM 4916  H H    . VAL A 1 92  ? -2.617  -5.218  -6.632  1.00 0.00 ? 92  VAL A H    3  
ATOM 4917  H HA   . VAL A 1 92  ? -1.413  -2.717  -5.635  1.00 0.00 ? 92  VAL A HA   3  
ATOM 4918  H HB   . VAL A 1 92  ? -1.811  -5.293  -4.111  1.00 0.00 ? 92  VAL A HB   3  
ATOM 4919  H HG11 . VAL A 1 92  ? -0.678  -4.329  -2.279  1.00 0.00 ? 92  VAL A HG11 3  
ATOM 4920  H HG12 . VAL A 1 92  ? -0.640  -2.739  -3.040  1.00 0.00 ? 92  VAL A HG12 3  
ATOM 4921  H HG13 . VAL A 1 92  ? 0.355   -4.046  -3.682  1.00 0.00 ? 92  VAL A HG13 3  
ATOM 4922  H HG21 . VAL A 1 92  ? -3.689  -3.446  -4.520  1.00 0.00 ? 92  VAL A HG21 3  
ATOM 4923  H HG22 . VAL A 1 92  ? -2.867  -2.699  -3.150  1.00 0.00 ? 92  VAL A HG22 3  
ATOM 4924  H HG23 . VAL A 1 92  ? -3.536  -4.323  -2.998  1.00 0.00 ? 92  VAL A HG23 3  
ATOM 4925  N N    . TRP A 1 93  ? 0.917   -3.461  -6.032  1.00 0.00 ? 93  TRP A N    3  
ATOM 4926  C CA   . TRP A 1 93  ? 2.278   -3.862  -6.373  1.00 0.00 ? 93  TRP A CA   3  
ATOM 4927  C C    . TRP A 1 93  ? 3.286   -3.130  -5.497  1.00 0.00 ? 93  TRP A C    3  
ATOM 4928  O O    . TRP A 1 93  ? 3.418   -1.908  -5.563  1.00 0.00 ? 93  TRP A O    3  
ATOM 4929  C CB   . TRP A 1 93  ? 2.594   -3.630  -7.858  1.00 0.00 ? 93  TRP A CB   3  
ATOM 4930  C CG   . TRP A 1 93  ? 1.744   -2.594  -8.533  1.00 0.00 ? 93  TRP A CG   3  
ATOM 4931  C CD1  . TRP A 1 93  ? 0.404   -2.668  -8.797  1.00 0.00 ? 93  TRP A CD1  3  
ATOM 4932  C CD2  . TRP A 1 93  ? 2.188   -1.340  -9.063  1.00 0.00 ? 93  TRP A CD2  3  
ATOM 4933  N NE1  . TRP A 1 93  ? -0.011  -1.532  -9.447  1.00 0.00 ? 93  TRP A NE1  3  
ATOM 4934  C CE2  . TRP A 1 93  ? 1.065   -0.703  -9.624  1.00 0.00 ? 93  TRP A CE2  3  
ATOM 4935  C CE3  . TRP A 1 93  ? 3.426   -0.694  -9.114  1.00 0.00 ? 93  TRP A CE3  3  
ATOM 4936  C CZ2  . TRP A 1 93  ? 1.147   0.549   -10.228 1.00 0.00 ? 93  TRP A CZ2  3  
ATOM 4937  C CZ3  . TRP A 1 93  ? 3.505   0.548   -9.714  1.00 0.00 ? 93  TRP A CZ3  3  
ATOM 4938  C CH2  . TRP A 1 93  ? 2.371   1.158   -10.264 1.00 0.00 ? 93  TRP A CH2  3  
ATOM 4939  H H    . TRP A 1 93  ? 0.728   -2.527  -5.806  1.00 0.00 ? 93  TRP A H    3  
ATOM 4940  H HA   . TRP A 1 93  ? 2.357   -4.920  -6.166  1.00 0.00 ? 93  TRP A HA   3  
ATOM 4941  H HB2  . TRP A 1 93  ? 3.621   -3.315  -7.947  1.00 0.00 ? 93  TRP A HB2  3  
ATOM 4942  H HB3  . TRP A 1 93  ? 2.466   -4.562  -8.389  1.00 0.00 ? 93  TRP A HB3  3  
ATOM 4943  H HD1  . TRP A 1 93  ? -0.223  -3.500  -8.521  1.00 0.00 ? 93  TRP A HD1  3  
ATOM 4944  H HE1  . TRP A 1 93  ? -0.930  -1.345  -9.737  1.00 0.00 ? 93  TRP A HE1  3  
ATOM 4945  H HE3  . TRP A 1 93  ? 4.310   -1.147  -8.693  1.00 0.00 ? 93  TRP A HE3  3  
ATOM 4946  H HZ2  . TRP A 1 93  ? 0.282   1.032   -10.655 1.00 0.00 ? 93  TRP A HZ2  3  
ATOM 4947  H HZ3  . TRP A 1 93  ? 4.454   1.063   -9.761  1.00 0.00 ? 93  TRP A HZ3  3  
ATOM 4948  H HH2  . TRP A 1 93  ? 2.479   2.131   -10.723 1.00 0.00 ? 93  TRP A HH2  3  
ATOM 4949  N N    . MET A 1 94  ? 3.989   -3.895  -4.667  1.00 0.00 ? 94  MET A N    3  
ATOM 4950  C CA   . MET A 1 94  ? 4.984   -3.343  -3.761  1.00 0.00 ? 94  MET A CA   3  
ATOM 4951  C C    . MET A 1 94  ? 6.385   -3.475  -4.344  1.00 0.00 ? 94  MET A C    3  
ATOM 4952  O O    . MET A 1 94  ? 6.788   -4.556  -4.776  1.00 0.00 ? 94  MET A O    3  
ATOM 4953  C CB   . MET A 1 94  ? 4.914   -4.063  -2.413  1.00 0.00 ? 94  MET A CB   3  
ATOM 4954  C CG   . MET A 1 94  ? 4.761   -3.127  -1.230  1.00 0.00 ? 94  MET A CG   3  
ATOM 4955  S SD   . MET A 1 94  ? 4.021   -3.936  0.203   1.00 0.00 ? 94  MET A SD   3  
ATOM 4956  C CE   . MET A 1 94  ? 4.919   -3.151  1.539   1.00 0.00 ? 94  MET A CE   3  
ATOM 4957  H H    . MET A 1 94  ? 3.827   -4.858  -4.659  1.00 0.00 ? 94  MET A H    3  
ATOM 4958  H HA   . MET A 1 94  ? 4.760   -2.298  -3.612  1.00 0.00 ? 94  MET A HA   3  
ATOM 4959  H HB2  . MET A 1 94  ? 4.071   -4.738  -2.423  1.00 0.00 ? 94  MET A HB2  3  
ATOM 4960  H HB3  . MET A 1 94  ? 5.820   -4.634  -2.278  1.00 0.00 ? 94  MET A HB3  3  
ATOM 4961  H HG2  . MET A 1 94  ? 5.734   -2.759  -0.955  1.00 0.00 ? 94  MET A HG2  3  
ATOM 4962  H HG3  . MET A 1 94  ? 4.134   -2.297  -1.522  1.00 0.00 ? 94  MET A HG3  3  
ATOM 4963  H HE1  . MET A 1 94  ? 4.425   -3.362  2.477   1.00 0.00 ? 94  MET A HE1  3  
ATOM 4964  H HE2  . MET A 1 94  ? 4.946   -2.085  1.379   1.00 0.00 ? 94  MET A HE2  3  
ATOM 4965  H HE3  . MET A 1 94  ? 5.927   -3.537  1.569   1.00 0.00 ? 94  MET A HE3  3  
ATOM 4966  N N    . LYS A 1 95  ? 7.118   -2.368  -4.363  1.00 0.00 ? 95  LYS A N    3  
ATOM 4967  C CA   . LYS A 1 95  ? 8.471   -2.358  -4.904  1.00 0.00 ? 95  LYS A CA   3  
ATOM 4968  C C    . LYS A 1 95  ? 9.466   -1.842  -3.871  1.00 0.00 ? 95  LYS A C    3  
ATOM 4969  O O    . LYS A 1 95  ? 9.372   -0.702  -3.415  1.00 0.00 ? 95  LYS A O    3  
ATOM 4970  C CB   . LYS A 1 95  ? 8.523   -1.501  -6.167  1.00 0.00 ? 95  LYS A CB   3  
ATOM 4971  C CG   . LYS A 1 95  ? 7.156   -1.265  -6.784  1.00 0.00 ? 95  LYS A CG   3  
ATOM 4972  C CD   . LYS A 1 95  ? 7.217   -1.254  -8.302  1.00 0.00 ? 95  LYS A CD   3  
ATOM 4973  C CE   . LYS A 1 95  ? 6.651   -2.536  -8.891  1.00 0.00 ? 95  LYS A CE   3  
ATOM 4974  N NZ   . LYS A 1 95  ? 6.978   -2.674  -10.337 1.00 0.00 ? 95  LYS A NZ   3  
ATOM 4975  H H    . LYS A 1 95  ? 6.737   -1.537  -4.008  1.00 0.00 ? 95  LYS A H    3  
ATOM 4976  H HA   . LYS A 1 95  ? 8.731   -3.373  -5.158  1.00 0.00 ? 95  LYS A HA   3  
ATOM 4977  H HB2  . LYS A 1 95  ? 8.958   -0.543  -5.924  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 4978  H HB3  . LYS A 1 95  ? 9.146   -1.995  -6.899  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 4979  H HG2  . LYS A 1 95  ? 6.490   -2.053  -6.469  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 4980  H HG3  . LYS A 1 95  ? 6.779   -0.315  -6.439  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 4981  H HD2  . LYS A 1 95  ? 6.641   -0.418  -8.668  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 4982  H HD3  . LYS A 1 95  ? 8.246   -1.150  -8.611  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 4983  H HE2  . LYS A 1 95  ? 7.067   -3.378  -8.355  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 4984  H HE3  . LYS A 1 95  ? 5.578   -2.529  -8.772  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 4985  H HZ1  . LYS A 1 95  ? 7.228   -1.747  -10.736 1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 4986  H HZ2  . LYS A 1 95  ? 6.158   -3.052  -10.855 1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 4987  H HZ3  . LYS A 1 95  ? 7.783   -3.322  -10.462 1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 4988  N N    . ARG A 1 96  ? 10.415  -2.695  -3.497  1.00 0.00 ? 96  ARG A N    3  
ATOM 4989  C CA   . ARG A 1 96  ? 11.425  -2.335  -2.507  1.00 0.00 ? 96  ARG A CA   3  
ATOM 4990  C C    . ARG A 1 96  ? 12.572  -1.551  -3.136  1.00 0.00 ? 96  ARG A C    3  
ATOM 4991  O O    . ARG A 1 96  ? 13.738  -1.770  -2.804  1.00 0.00 ? 96  ARG A O    3  
ATOM 4992  C CB   . ARG A 1 96  ? 11.969  -3.594  -1.829  1.00 0.00 ? 96  ARG A CB   3  
ATOM 4993  C CG   . ARG A 1 96  ? 12.577  -4.592  -2.801  1.00 0.00 ? 96  ARG A CG   3  
ATOM 4994  C CD   . ARG A 1 96  ? 11.870  -5.935  -2.733  1.00 0.00 ? 96  ARG A CD   3  
ATOM 4995  N NE   . ARG A 1 96  ? 10.420  -5.798  -2.834  1.00 0.00 ? 96  ARG A NE   3  
ATOM 4996  C CZ   . ARG A 1 96  ? 9.588   -6.008  -1.821  1.00 0.00 ? 96  ARG A CZ   3  
ATOM 4997  N NH1  . ARG A 1 96  ? 10.057  -6.364  -0.632  1.00 0.00 ? 96  ARG A NH1  3  
ATOM 4998  N NH2  . ARG A 1 96  ? 8.281   -5.861  -1.994  1.00 0.00 ? 96  ARG A NH2  3  
ATOM 4999  H H    . ARG A 1 96  ? 10.430  -3.592  -3.891  1.00 0.00 ? 96  ARG A H    3  
ATOM 5000  H HA   . ARG A 1 96  ? 10.950  -1.717  -1.762  1.00 0.00 ? 96  ARG A HA   3  
ATOM 5001  H HB2  . ARG A 1 96  ? 12.731  -3.305  -1.120  1.00 0.00 ? 96  ARG A HB2  3  
ATOM 5002  H HB3  . ARG A 1 96  ? 11.164  -4.082  -1.302  1.00 0.00 ? 96  ARG A HB3  3  
ATOM 5003  H HG2  . ARG A 1 96  ? 12.490  -4.199  -3.804  1.00 0.00 ? 96  ARG A HG2  3  
ATOM 5004  H HG3  . ARG A 1 96  ? 13.619  -4.728  -2.555  1.00 0.00 ? 96  ARG A HG3  3  
ATOM 5005  H HD2  . ARG A 1 96  ? 12.221  -6.552  -3.546  1.00 0.00 ? 96  ARG A HD2  3  
ATOM 5006  H HD3  . ARG A 1 96  ? 12.113  -6.405  -1.791  1.00 0.00 ? 96  ARG A HD3  3  
ATOM 5007  H HE   . ARG A 1 96  ? 10.049  -5.534  -3.703  1.00 0.00 ? 96  ARG A HE   3  
ATOM 5008  H HH11 . ARG A 1 96  ? 11.042  -6.474  -0.497  1.00 0.00 ? 96  ARG A HH11 3  
ATOM 5009  H HH12 . ARG A 1 96  ? 9.428   -6.521  0.128   1.00 0.00 ? 96  ARG A HH12 3  
ATOM 5010  H HH21 . ARG A 1 96  ? 7.922   -5.592  -2.888  1.00 0.00 ? 96  ARG A HH21 3  
ATOM 5011  H HH22 . ARG A 1 96  ? 7.654   -6.021  -1.232  1.00 0.00 ? 96  ARG A HH22 3  
ATOM 5012  N N    . MET A 1 97  ? 12.244  -0.626  -4.035  1.00 0.00 ? 97  MET A N    3  
ATOM 5013  C CA   . MET A 1 97  ? 13.261  0.192   -4.685  1.00 0.00 ? 97  MET A CA   3  
ATOM 5014  C C    . MET A 1 97  ? 13.848  1.189   -3.692  1.00 0.00 ? 97  MET A C    3  
ATOM 5015  O O    . MET A 1 97  ? 13.593  1.097   -2.493  1.00 0.00 ? 97  MET A O    3  
ATOM 5016  C CB   . MET A 1 97  ? 12.664  0.929   -5.887  1.00 0.00 ? 97  MET A CB   3  
ATOM 5017  C CG   . MET A 1 97  ? 11.753  2.086   -5.506  1.00 0.00 ? 97  MET A CG   3  
ATOM 5018  S SD   . MET A 1 97  ? 11.647  3.342   -6.797  1.00 0.00 ? 97  MET A SD   3  
ATOM 5019  C CE   . MET A 1 97  ? 10.299  2.698   -7.784  1.00 0.00 ? 97  MET A CE   3  
ATOM 5020  H H    . MET A 1 97  ? 11.303  -0.478  -4.258  1.00 0.00 ? 97  MET A H    3  
ATOM 5021  H HA   . MET A 1 97  ? 14.047  -0.464  -5.028  1.00 0.00 ? 97  MET A HA   3  
ATOM 5022  H HB2  . MET A 1 97  ? 13.469  1.320   -6.492  1.00 0.00 ? 97  MET A HB2  3  
ATOM 5023  H HB3  . MET A 1 97  ? 12.091  0.229   -6.478  1.00 0.00 ? 97  MET A HB3  3  
ATOM 5024  H HG2  . MET A 1 97  ? 10.764  1.701   -5.316  1.00 0.00 ? 97  MET A HG2  3  
ATOM 5025  H HG3  . MET A 1 97  ? 12.136  2.546   -4.607  1.00 0.00 ? 97  MET A HG3  3  
ATOM 5026  H HE1  . MET A 1 97  ? 9.704   2.025   -7.187  1.00 0.00 ? 97  MET A HE1  3  
ATOM 5027  H HE2  . MET A 1 97  ? 10.697  2.169   -8.637  1.00 0.00 ? 97  MET A HE2  3  
ATOM 5028  H HE3  . MET A 1 97  ? 9.682   3.518   -8.127  1.00 0.00 ? 97  MET A HE3  3  
ATOM 5029  N N    . ARG A 1 98  ? 14.634  2.138   -4.189  1.00 0.00 ? 98  ARG A N    3  
ATOM 5030  C CA   . ARG A 1 98  ? 15.247  3.140   -3.324  1.00 0.00 ? 98  ARG A CA   3  
ATOM 5031  C C    . ARG A 1 98  ? 14.780  4.543   -3.693  1.00 0.00 ? 98  ARG A C    3  
ATOM 5032  O O    . ARG A 1 98  ? 14.792  4.927   -4.862  1.00 0.00 ? 98  ARG A O    3  
ATOM 5033  C CB   . ARG A 1 98  ? 16.771  3.062   -3.420  1.00 0.00 ? 98  ARG A CB   3  
ATOM 5034  C CG   . ARG A 1 98  ? 17.356  1.809   -2.791  1.00 0.00 ? 98  ARG A CG   3  
ATOM 5035  C CD   . ARG A 1 98  ? 18.492  2.145   -1.837  1.00 0.00 ? 98  ARG A CD   3  
ATOM 5036  N NE   . ARG A 1 98  ? 19.765  1.589   -2.288  1.00 0.00 ? 98  ARG A NE   3  
ATOM 5037  C CZ   . ARG A 1 98  ? 20.891  1.662   -1.584  1.00 0.00 ? 98  ARG A CZ   3  
ATOM 5038  N NH1  . ARG A 1 98  ? 20.903  2.268   -0.404  1.00 0.00 ? 98  ARG A NH1  3  
ATOM 5039  N NH2  . ARG A 1 98  ? 22.007  1.127   -2.062  1.00 0.00 ? 98  ARG A NH2  3  
ATOM 5040  H H    . ARG A 1 98  ? 14.811  2.168   -5.152  1.00 0.00 ? 98  ARG A H    3  
ATOM 5041  H HA   . ARG A 1 98  ? 14.949  2.928   -2.309  1.00 0.00 ? 98  ARG A HA   3  
ATOM 5042  H HB2  . ARG A 1 98  ? 17.056  3.083   -4.462  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 5043  H HB3  . ARG A 1 98  ? 17.195  3.921   -2.923  1.00 0.00 ? 98  ARG A HB3  3  
ATOM 5044  H HG2  . ARG A 1 98  ? 16.580  1.297   -2.243  1.00 0.00 ? 98  ARG A HG2  3  
ATOM 5045  H HG3  . ARG A 1 98  ? 17.731  1.167   -3.574  1.00 0.00 ? 98  ARG A HG3  3  
ATOM 5046  H HD2  . ARG A 1 98  ? 18.582  3.219   -1.770  1.00 0.00 ? 98  ARG A HD2  3  
ATOM 5047  H HD3  . ARG A 1 98  ? 18.258  1.742   -0.863  1.00 0.00 ? 98  ARG A HD3  3  
ATOM 5048  H HE   . ARG A 1 98  ? 19.781  1.138   -3.157  1.00 0.00 ? 98  ARG A HE   3  
ATOM 5049  H HH11 . ARG A 1 98  ? 20.062  2.673   -0.042  1.00 0.00 ? 98  ARG A HH11 3  
ATOM 5050  H HH12 . ARG A 1 98  ? 21.750  2.319   0.123   1.00 0.00 ? 98  ARG A HH12 3  
ATOM 5051  H HH21 . ARG A 1 98  ? 22.002  0.669   -2.950  1.00 0.00 ? 98  ARG A HH21 3  
ATOM 5052  H HH22 . ARG A 1 98  ? 22.852  1.183   -1.532  1.00 0.00 ? 98  ARG A HH22 3  
ATOM 5053  N N    . GLN A 1 99  ? 14.373  5.307   -2.683  1.00 0.00 ? 99  GLN A N    3  
ATOM 5054  C CA   . GLN A 1 99  ? 13.909  6.673   -2.897  1.00 0.00 ? 99  GLN A CA   3  
ATOM 5055  C C    . GLN A 1 99  ? 14.848  7.668   -2.221  1.00 0.00 ? 99  GLN A C    3  
ATOM 5056  O O    . GLN A 1 99  ? 14.733  8.878   -2.418  1.00 0.00 ? 99  GLN A O    3  
ATOM 5057  C CB   . GLN A 1 99  ? 12.485  6.848   -2.364  1.00 0.00 ? 99  GLN A CB   3  
ATOM 5058  C CG   . GLN A 1 99  ? 11.490  5.850   -2.940  1.00 0.00 ? 99  GLN A CG   3  
ATOM 5059  C CD   . GLN A 1 99  ? 10.351  6.522   -3.684  1.00 0.00 ? 99  GLN A CD   3  
ATOM 5060  O OE1  . GLN A 1 99  ? 10.564  7.180   -4.702  1.00 0.00 ? 99  GLN A OE1  3  
ATOM 5061  N NE2  . GLN A 1 99  ? 9.132   6.356   -3.178  1.00 0.00 ? 99  GLN A NE2  3  
ATOM 5062  H H    . GLN A 1 99  ? 14.390  4.947   -1.774  1.00 0.00 ? 99  GLN A H    3  
ATOM 5063  H HA   . GLN A 1 99  ? 13.912  6.860   -3.961  1.00 0.00 ? 99  GLN A HA   3  
ATOM 5064  H HB2  . GLN A 1 99  ? 12.498  6.730   -1.290  1.00 0.00 ? 99  GLN A HB2  3  
ATOM 5065  H HB3  . GLN A 1 99  ? 12.142  7.842   -2.604  1.00 0.00 ? 99  GLN A HB3  3  
ATOM 5066  H HG2  . GLN A 1 99  ? 12.011  5.197   -3.623  1.00 0.00 ? 99  GLN A HG2  3  
ATOM 5067  H HG3  . GLN A 1 99  ? 11.076  5.267   -2.131  1.00 0.00 ? 99  GLN A HG3  3  
ATOM 5068  H HE21 . GLN A 1 99  ? 9.039   5.818   -2.365  1.00 0.00 ? 99  GLN A HE21 3  
ATOM 5069  H HE22 . GLN A 1 99  ? 8.377   6.776   -3.642  1.00 0.00 ? 99  GLN A HE22 3  
ATOM 5070  N N    . GLU A 1 100 ? 15.778  7.147   -1.423  1.00 0.00 ? 100 GLU A N    3  
ATOM 5071  C CA   . GLU A 1 100 ? 16.739  7.985   -0.718  1.00 0.00 ? 100 GLU A CA   3  
ATOM 5072  C C    . GLU A 1 100 ? 18.039  7.229   -0.453  1.00 0.00 ? 100 GLU A C    3  
ATOM 5073  O O    . GLU A 1 100 ? 18.981  7.298   -1.245  1.00 0.00 ? 100 GLU A O    3  
ATOM 5074  C CB   . GLU A 1 100 ? 16.145  8.487   0.600   1.00 0.00 ? 100 GLU A CB   3  
ATOM 5075  C CG   . GLU A 1 100 ? 16.986  9.555   1.280   1.00 0.00 ? 100 GLU A CG   3  
ATOM 5076  C CD   . GLU A 1 100 ? 16.591  9.776   2.727   1.00 0.00 ? 100 GLU A CD   3  
ATOM 5077  O OE1  . GLU A 1 100 ? 16.642  8.807   3.513   1.00 0.00 ? 100 GLU A OE1  3  
ATOM 5078  O OE2  . GLU A 1 100 ? 16.229  10.920  3.075   1.00 0.00 ? 100 GLU A OE2  3  
ATOM 5079  H H    . GLU A 1 100 ? 15.819  6.173   -1.308  1.00 0.00 ? 100 GLU A H    3  
ATOM 5080  H HA   . GLU A 1 100 ? 16.959  8.834   -1.347  1.00 0.00 ? 100 GLU A HA   3  
ATOM 5081  H HB2  . GLU A 1 100 ? 15.166  8.900   0.406   1.00 0.00 ? 100 GLU A HB2  3  
ATOM 5082  H HB3  . GLU A 1 100 ? 16.044  7.652   1.277   1.00 0.00 ? 100 GLU A HB3  3  
ATOM 5083  H HG2  . GLU A 1 100 ? 18.022  9.251   1.250   1.00 0.00 ? 100 GLU A HG2  3  
ATOM 5084  H HG3  . GLU A 1 100 ? 16.868  10.485  0.743   1.00 0.00 ? 100 GLU A HG3  3  
ATOM 5085  N N    . ARG A 1 101 ? 18.087  6.507   0.663   1.00 0.00 ? 101 ARG A N    3  
ATOM 5086  C CA   . ARG A 1 101 ? 19.272  5.739   1.029   1.00 0.00 ? 101 ARG A CA   3  
ATOM 5087  C C    . ARG A 1 101 ? 18.883  4.378   1.595   1.00 0.00 ? 101 ARG A C    3  
ATOM 5088  O O    . ARG A 1 101 ? 19.740  3.597   2.008   1.00 0.00 ? 101 ARG A O    3  
ATOM 5089  C CB   . ARG A 1 101 ? 20.109  6.507   2.056   1.00 0.00 ? 101 ARG A CB   3  
ATOM 5090  C CG   . ARG A 1 101 ? 21.138  7.436   1.434   1.00 0.00 ? 101 ARG A CG   3  
ATOM 5091  C CD   . ARG A 1 101 ? 21.853  8.258   2.494   1.00 0.00 ? 101 ARG A CD   3  
ATOM 5092  N NE   . ARG A 1 101 ? 23.306  8.142   2.393   1.00 0.00 ? 101 ARG A NE   3  
ATOM 5093  C CZ   . ARG A 1 101 ? 24.133  9.183   2.397   1.00 0.00 ? 101 ARG A CZ   3  
ATOM 5094  N NH1  . ARG A 1 101 ? 23.655  10.415  2.501   1.00 0.00 ? 101 ARG A NH1  3  
ATOM 5095  N NH2  . ARG A 1 101 ? 25.442  8.991   2.303   1.00 0.00 ? 101 ARG A NH2  3  
ATOM 5096  H H    . ARG A 1 101 ? 17.307  6.489   1.255   1.00 0.00 ? 101 ARG A H    3  
ATOM 5097  H HA   . ARG A 1 101 ? 19.861  5.591   0.136   1.00 0.00 ? 101 ARG A HA   3  
ATOM 5098  H HB2  . ARG A 1 101 ? 19.447  7.098   2.670   1.00 0.00 ? 101 ARG A HB2  3  
ATOM 5099  H HB3  . ARG A 1 101 ? 20.629  5.796   2.681   1.00 0.00 ? 101 ARG A HB3  3  
ATOM 5100  H HG2  . ARG A 1 101 ? 21.866  6.844   0.900   1.00 0.00 ? 101 ARG A HG2  3  
ATOM 5101  H HG3  . ARG A 1 101 ? 20.638  8.103   0.747   1.00 0.00 ? 101 ARG A HG3  3  
ATOM 5102  H HD2  . ARG A 1 101 ? 21.577  9.296   2.372   1.00 0.00 ? 101 ARG A HD2  3  
ATOM 5103  H HD3  . ARG A 1 101 ? 21.541  7.916   3.469   1.00 0.00 ? 101 ARG A HD3  3  
ATOM 5104  H HE   . ARG A 1 101 ? 23.684  7.240   2.317   1.00 0.00 ? 101 ARG A HE   3  
ATOM 5105  H HH11 . ARG A 1 101 ? 22.668  10.565  2.574   1.00 0.00 ? 101 ARG A HH11 3  
ATOM 5106  H HH12 . ARG A 1 101 ? 24.279  11.197  2.504   1.00 0.00 ? 101 ARG A HH12 3  
ATOM 5107  H HH21 . ARG A 1 101 ? 25.808  8.064   2.226   1.00 0.00 ? 101 ARG A HH21 3  
ATOM 5108  H HH22 . ARG A 1 101 ? 26.064  9.775   2.306   1.00 0.00 ? 101 ARG A HH22 3  
ATOM 5109  N N    . ARG A 1 102 ? 17.584  4.100   1.609   1.00 0.00 ? 102 ARG A N    3  
ATOM 5110  C CA   . ARG A 1 102 ? 17.076  2.835   2.127   1.00 0.00 ? 102 ARG A CA   3  
ATOM 5111  C C    . ARG A 1 102 ? 16.025  2.250   1.187   1.00 0.00 ? 102 ARG A C    3  
ATOM 5112  O O    . ARG A 1 102 ? 15.221  2.982   0.610   1.00 0.00 ? 102 ARG A O    3  
ATOM 5113  C CB   . ARG A 1 102 ? 16.486  3.037   3.529   1.00 0.00 ? 102 ARG A CB   3  
ATOM 5114  C CG   . ARG A 1 102 ? 15.356  2.074   3.877   1.00 0.00 ? 102 ARG A CG   3  
ATOM 5115  C CD   . ARG A 1 102 ? 14.008  2.779   3.895   1.00 0.00 ? 102 ARG A CD   3  
ATOM 5116  N NE   . ARG A 1 102 ? 14.040  4.005   4.688   1.00 0.00 ? 102 ARG A NE   3  
ATOM 5117  C CZ   . ARG A 1 102 ? 14.156  4.027   6.012   1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5118  N NH1  . ARG A 1 102 ? 14.250  2.893   6.694   1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5119  N NH2  . ARG A 1 102 ? 14.175  5.186   6.658   1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5120  H H    . ARG A 1 102 ? 16.950  4.768   1.267   1.00 0.00 ? 102 ARG A H    3  
ATOM 5121  H HA   . ARG A 1 102 ? 17.906  2.147   2.191   1.00 0.00 ? 102 ARG A HA   3  
ATOM 5122  H HB2  . ARG A 1 102 ? 17.272  2.909   4.258   1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5123  H HB3  . ARG A 1 102 ? 16.103  4.044   3.601   1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5124  H HG2  . ARG A 1 102 ? 15.329  1.286   3.139   1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5125  H HG3  . ARG A 1 102 ? 15.545  1.650   4.853   1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5126  H HD2  . ARG A 1 102 ? 13.730  3.026   2.881   1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5127  H HD3  . ARG A 1 102 ? 13.272  2.109   4.315   1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5128  H HE   . ARG A 1 102 ? 13.970  4.857   4.208   1.00 0.00 ? 102 ARG A HE   3  
ATOM 5129  H HH11 . ARG A 1 102 ? 14.235  2.017   6.213   1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5130  H HH12 . ARG A 1 102 ? 14.337  2.914   7.691   1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5131  H HH21 . ARG A 1 102 ? 14.104  6.042   6.149   1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5132  H HH22 . ARG A 1 102 ? 14.264  5.201   7.654   1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5133  N N    . LEU A 1 103 ? 16.032  0.926   1.047   1.00 0.00 ? 103 LEU A N    3  
ATOM 5134  C CA   . LEU A 1 103 ? 15.070  0.248   0.186   1.00 0.00 ? 103 LEU A CA   3  
ATOM 5135  C C    . LEU A 1 103 ? 13.652  0.522   0.671   1.00 0.00 ? 103 LEU A C    3  
ATOM 5136  O O    . LEU A 1 103 ? 13.167  -0.127  1.598   1.00 0.00 ? 103 LEU A O    3  
ATOM 5137  C CB   . LEU A 1 103 ? 15.324  -1.264  0.152   1.00 0.00 ? 103 LEU A CB   3  
ATOM 5138  C CG   . LEU A 1 103 ? 16.320  -1.791  1.187   1.00 0.00 ? 103 LEU A CG   3  
ATOM 5139  C CD1  . LEU A 1 103 ? 16.022  -3.244  1.522   1.00 0.00 ? 103 LEU A CD1  3  
ATOM 5140  C CD2  . LEU A 1 103 ? 17.742  -1.642  0.672   1.00 0.00 ? 103 LEU A CD2  3  
ATOM 5141  H H    . LEU A 1 103 ? 16.693  0.399   1.539   1.00 0.00 ? 103 LEU A H    3  
ATOM 5142  H HA   . LEU A 1 103 ? 15.181  0.646   -0.812  1.00 0.00 ? 103 LEU A HA   3  
ATOM 5143  H HB2  . LEU A 1 103 ? 14.381  -1.768  0.306   1.00 0.00 ? 103 LEU A HB2  3  
ATOM 5144  H HB3  . LEU A 1 103 ? 15.691  -1.522  -0.831  1.00 0.00 ? 103 LEU A HB3  3  
ATOM 5145  H HG   . LEU A 1 103 ? 16.227  -1.213  2.094   1.00 0.00 ? 103 LEU A HG   3  
ATOM 5146  H HD11 . LEU A 1 103 ? 15.537  -3.300  2.486   1.00 0.00 ? 103 LEU A HD11 3  
ATOM 5147  H HD12 . LEU A 1 103 ? 16.947  -3.802  1.554   1.00 0.00 ? 103 LEU A HD12 3  
ATOM 5148  H HD13 . LEU A 1 103 ? 15.374  -3.664  0.767   1.00 0.00 ? 103 LEU A HD13 3  
ATOM 5149  H HD21 . LEU A 1 103 ? 17.946  -2.415  -0.052  1.00 0.00 ? 103 LEU A HD21 3  
ATOM 5150  H HD22 . LEU A 1 103 ? 18.433  -1.726  1.496   1.00 0.00 ? 103 LEU A HD22 3  
ATOM 5151  H HD23 . LEU A 1 103 ? 17.854  -0.673  0.207   1.00 0.00 ? 103 LEU A HD23 3  
ATOM 5152  N N    . CYS A 1 104 ? 12.998  1.492   0.045   1.00 0.00 ? 104 CYS A N    3  
ATOM 5153  C CA   . CYS A 1 104 ? 11.639  1.859   0.418   1.00 0.00 ? 104 CYS A CA   3  
ATOM 5154  C C    . CYS A 1 104 ? 10.611  1.086   -0.402  1.00 0.00 ? 104 CYS A C    3  
ATOM 5155  O O    . CYS A 1 104 ? 10.725  0.979   -1.623  1.00 0.00 ? 104 CYS A O    3  
ATOM 5156  C CB   . CYS A 1 104 ? 11.432  3.363   0.236   1.00 0.00 ? 104 CYS A CB   3  
ATOM 5157  S SG   . CYS A 1 104 ? 9.935   3.801   -0.682  1.00 0.00 ? 104 CYS A SG   3  
ATOM 5158  H H    . CYS A 1 104 ? 13.436  1.977   -0.685  1.00 0.00 ? 104 CYS A H    3  
ATOM 5159  H HA   . CYS A 1 104 ? 11.505  1.612   1.461   1.00 0.00 ? 104 CYS A HA   3  
ATOM 5160  H HB2  . CYS A 1 104 ? 11.367  3.830   1.208   1.00 0.00 ? 104 CYS A HB2  3  
ATOM 5161  H HB3  . CYS A 1 104 ? 12.277  3.772   -0.297  1.00 0.00 ? 104 CYS A HB3  3  
ATOM 5162  H HG   . CYS A 1 104 ? 9.990   3.201   -1.862  1.00 0.00 ? 104 CYS A HG   3  
ATOM 5163  N N    . CYS A 1 105 ? 9.602   0.564   0.283   1.00 0.00 ? 105 CYS A N    3  
ATOM 5164  C CA   . CYS A 1 105 ? 8.537   -0.187  -0.364  1.00 0.00 ? 105 CYS A CA   3  
ATOM 5165  C C    . CYS A 1 105 ? 7.433   0.756   -0.839  1.00 0.00 ? 105 CYS A C    3  
ATOM 5166  O O    . CYS A 1 105 ? 6.871   1.513   -0.048  1.00 0.00 ? 105 CYS A O    3  
ATOM 5167  C CB   . CYS A 1 105 ? 7.965   -1.221  0.608   1.00 0.00 ? 105 CYS A CB   3  
ATOM 5168  S SG   . CYS A 1 105 ? 7.930   -2.907  -0.043  1.00 0.00 ? 105 CYS A SG   3  
ATOM 5169  H H    . CYS A 1 105 ? 9.570   0.696   1.254   1.00 0.00 ? 105 CYS A H    3  
ATOM 5170  H HA   . CYS A 1 105 ? 8.956   -0.696  -1.219  1.00 0.00 ? 105 CYS A HA   3  
ATOM 5171  H HB2  . CYS A 1 105 ? 8.568   -1.231  1.503   1.00 0.00 ? 105 CYS A HB2  3  
ATOM 5172  H HB3  . CYS A 1 105 ? 6.952   -0.941  0.867   1.00 0.00 ? 105 CYS A HB3  3  
ATOM 5173  H HG   . CYS A 1 105 ? 7.626   -2.841  -1.333  1.00 0.00 ? 105 CYS A HG   3  
ATOM 5174  N N    . VAL A 1 106 ? 7.125   0.702   -2.129  1.00 0.00 ? 106 VAL A N    3  
ATOM 5175  C CA   . VAL A 1 106 ? 6.085   1.551   -2.702  1.00 0.00 ? 106 VAL A CA   3  
ATOM 5176  C C    . VAL A 1 106 ? 4.853   0.729   -3.068  1.00 0.00 ? 106 VAL A C    3  
ATOM 5177  O O    . VAL A 1 106 ? 4.959   -0.292  -3.745  1.00 0.00 ? 106 VAL A O    3  
ATOM 5178  C CB   . VAL A 1 106 ? 6.578   2.295   -3.965  1.00 0.00 ? 106 VAL A CB   3  
ATOM 5179  C CG1  . VAL A 1 106 ? 7.088   3.682   -3.608  1.00 0.00 ? 106 VAL A CG1  3  
ATOM 5180  C CG2  . VAL A 1 106 ? 7.655   1.494   -4.679  1.00 0.00 ? 106 VAL A CG2  3  
ATOM 5181  H H    . VAL A 1 106 ? 7.602   0.074   -2.708  1.00 0.00 ? 106 VAL A H    3  
ATOM 5182  H HA   . VAL A 1 106 ? 5.809   2.286   -1.953  1.00 0.00 ? 106 VAL A HA   3  
ATOM 5183  H HB   . VAL A 1 106 ? 5.741   2.410   -4.648  1.00 0.00 ? 106 VAL A HB   3  
ATOM 5184  H HG11 . VAL A 1 106 ? 7.704   4.058   -4.411  1.00 0.00 ? 106 VAL A HG11 3  
ATOM 5185  H HG12 . VAL A 1 106 ? 7.673   3.629   -2.702  1.00 0.00 ? 106 VAL A HG12 3  
ATOM 5186  H HG13 . VAL A 1 106 ? 6.250   4.347   -3.457  1.00 0.00 ? 106 VAL A HG13 3  
ATOM 5187  H HG21 . VAL A 1 106 ? 7.398   1.396   -5.724  1.00 0.00 ? 106 VAL A HG21 3  
ATOM 5188  H HG22 . VAL A 1 106 ? 7.730   0.513   -4.234  1.00 0.00 ? 106 VAL A HG22 3  
ATOM 5189  H HG23 . VAL A 1 106 ? 8.604   2.003   -4.588  1.00 0.00 ? 106 VAL A HG23 3  
ATOM 5190  N N    . VAL A 1 107 ? 3.687   1.188   -2.631  1.00 0.00 ? 107 VAL A N    3  
ATOM 5191  C CA   . VAL A 1 107 ? 2.435   0.501   -2.926  1.00 0.00 ? 107 VAL A CA   3  
ATOM 5192  C C    . VAL A 1 107 ? 1.552   1.377   -3.809  1.00 0.00 ? 107 VAL A C    3  
ATOM 5193  O O    . VAL A 1 107 ? 1.362   2.560   -3.531  1.00 0.00 ? 107 VAL A O    3  
ATOM 5194  C CB   . VAL A 1 107 ? 1.680   0.124   -1.626  1.00 0.00 ? 107 VAL A CB   3  
ATOM 5195  C CG1  . VAL A 1 107 ? 0.187   0.414   -1.738  1.00 0.00 ? 107 VAL A CG1  3  
ATOM 5196  C CG2  . VAL A 1 107 ? 1.912   -1.339  -1.287  1.00 0.00 ? 107 VAL A CG2  3  
ATOM 5197  H H    . VAL A 1 107 ? 3.657   2.015   -2.106  1.00 0.00 ? 107 VAL A H    3  
ATOM 5198  H HA   . VAL A 1 107 ? 2.673   -0.407  -3.459  1.00 0.00 ? 107 VAL A HA   3  
ATOM 5199  H HB   . VAL A 1 107 ? 2.077   0.721   -0.819  1.00 0.00 ? 107 VAL A HB   3  
ATOM 5200  H HG11 . VAL A 1 107 ? 0.013   1.467   -1.570  1.00 0.00 ? 107 VAL A HG11 3  
ATOM 5201  H HG12 . VAL A 1 107 ? -0.349  -0.161  -0.999  1.00 0.00 ? 107 VAL A HG12 3  
ATOM 5202  H HG13 . VAL A 1 107 ? -0.158  0.146   -2.725  1.00 0.00 ? 107 VAL A HG13 3  
ATOM 5203  H HG21 . VAL A 1 107 ? 0.967   -1.863  -1.289  1.00 0.00 ? 107 VAL A HG21 3  
ATOM 5204  H HG22 . VAL A 1 107 ? 2.362   -1.414  -0.307  1.00 0.00 ? 107 VAL A HG22 3  
ATOM 5205  H HG23 . VAL A 1 107 ? 2.569   -1.779  -2.021  1.00 0.00 ? 107 VAL A HG23 3  
ATOM 5206  N N    . VAL A 1 108 ? 1.023   0.793   -4.877  1.00 0.00 ? 108 VAL A N    3  
ATOM 5207  C CA   . VAL A 1 108 ? 0.170   1.534   -5.796  1.00 0.00 ? 108 VAL A CA   3  
ATOM 5208  C C    . VAL A 1 108 ? -1.144  0.809   -6.045  1.00 0.00 ? 108 VAL A C    3  
ATOM 5209  O O    . VAL A 1 108 ? -1.185  -0.208  -6.738  1.00 0.00 ? 108 VAL A O    3  
ATOM 5210  C CB   . VAL A 1 108 ? 0.875   1.783   -7.142  1.00 0.00 ? 108 VAL A CB   3  
ATOM 5211  C CG1  . VAL A 1 108 ? 0.261   2.982   -7.852  1.00 0.00 ? 108 VAL A CG1  3  
ATOM 5212  C CG2  . VAL A 1 108 ? 2.367   1.985   -6.935  1.00 0.00 ? 108 VAL A CG2  3  
ATOM 5213  H H    . VAL A 1 108 ? 1.214   -0.152  -5.054  1.00 0.00 ? 108 VAL A H    3  
ATOM 5214  H HA   . VAL A 1 108 ? -0.042  2.492   -5.345  1.00 0.00 ? 108 VAL A HA   3  
ATOM 5215  H HB   . VAL A 1 108 ? 0.734   0.913   -7.765  1.00 0.00 ? 108 VAL A HB   3  
ATOM 5216  H HG11 . VAL A 1 108 ? -0.583  2.656   -8.442  1.00 0.00 ? 108 VAL A HG11 3  
ATOM 5217  H HG12 . VAL A 1 108 ? 0.999   3.432   -8.499  1.00 0.00 ? 108 VAL A HG12 3  
ATOM 5218  H HG13 . VAL A 1 108 ? -0.067  3.704   -7.121  1.00 0.00 ? 108 VAL A HG13 3  
ATOM 5219  H HG21 . VAL A 1 108 ? 2.580   2.052   -5.879  1.00 0.00 ? 108 VAL A HG21 3  
ATOM 5220  H HG22 . VAL A 1 108 ? 2.680   2.896   -7.426  1.00 0.00 ? 108 VAL A HG22 3  
ATOM 5221  H HG23 . VAL A 1 108 ? 2.906   1.148   -7.359  1.00 0.00 ? 108 VAL A HG23 3  
ATOM 5222  N N    . LEU A 1 109 ? -2.219  1.338   -5.470  1.00 0.00 ? 109 LEU A N    3  
ATOM 5223  C CA   . LEU A 1 109 ? -3.542  0.748   -5.617  1.00 0.00 ? 109 LEU A CA   3  
ATOM 5224  C C    . LEU A 1 109 ? -4.266  1.325   -6.827  1.00 0.00 ? 109 LEU A C    3  
ATOM 5225  O O    . LEU A 1 109 ? -4.499  2.532   -6.908  1.00 0.00 ? 109 LEU A O    3  
ATOM 5226  C CB   . LEU A 1 109 ? -4.348  1.000   -4.352  1.00 0.00 ? 109 LEU A CB   3  
ATOM 5227  C CG   . LEU A 1 109 ? -3.509  1.020   -3.078  1.00 0.00 ? 109 LEU A CG   3  
ATOM 5228  C CD1  . LEU A 1 109 ? -4.122  1.946   -2.043  1.00 0.00 ? 109 LEU A CD1  3  
ATOM 5229  C CD2  . LEU A 1 109 ? -3.360  -0.389  -2.530  1.00 0.00 ? 109 LEU A CD2  3  
ATOM 5230  H H    . LEU A 1 109 ? -2.123  2.148   -4.924  1.00 0.00 ? 109 LEU A H    3  
ATOM 5231  H HA   . LEU A 1 109 ? -3.421  -0.317  -5.749  1.00 0.00 ? 109 LEU A HA   3  
ATOM 5232  H HB2  . LEU A 1 109 ? -4.851  1.950   -4.452  1.00 0.00 ? 109 LEU A HB2  3  
ATOM 5233  H HB3  . LEU A 1 109 ? -5.090  0.222   -4.258  1.00 0.00 ? 109 LEU A HB3  3  
ATOM 5234  H HG   . LEU A 1 109 ? -2.524  1.391   -3.313  1.00 0.00 ? 109 LEU A HG   3  
ATOM 5235  H HD11 . LEU A 1 109 ? -4.280  1.404   -1.123  1.00 0.00 ? 109 LEU A HD11 3  
ATOM 5236  H HD12 . LEU A 1 109 ? -5.068  2.317   -2.410  1.00 0.00 ? 109 LEU A HD12 3  
ATOM 5237  H HD13 . LEU A 1 109 ? -3.454  2.774   -1.865  1.00 0.00 ? 109 LEU A HD13 3  
ATOM 5238  H HD21 . LEU A 1 109 ? -4.212  -0.628  -1.911  1.00 0.00 ? 109 LEU A HD21 3  
ATOM 5239  H HD22 . LEU A 1 109 ? -2.456  -0.453  -1.942  1.00 0.00 ? 109 LEU A HD22 3  
ATOM 5240  H HD23 . LEU A 1 109 ? -3.306  -1.087  -3.355  1.00 0.00 ? 109 LEU A HD23 3  
ATOM 5241  N N    . GLU A 1 110 ? -4.618  0.456   -7.765  1.00 0.00 ? 110 GLU A N    3  
ATOM 5242  C CA   . GLU A 1 110 ? -5.313  0.874   -8.976  1.00 0.00 ? 110 GLU A CA   3  
ATOM 5243  C C    . GLU A 1 110 ? -6.650  0.150   -9.110  1.00 0.00 ? 110 GLU A C    3  
ATOM 5244  O O    . GLU A 1 110 ? -6.688  -1.073  -9.257  1.00 0.00 ? 110 GLU A O    3  
ATOM 5245  C CB   . GLU A 1 110 ? -4.448  0.600   -10.206 1.00 0.00 ? 110 GLU A CB   3  
ATOM 5246  C CG   . GLU A 1 110 ? -4.652  1.602   -11.331 1.00 0.00 ? 110 GLU A CG   3  
ATOM 5247  C CD   . GLU A 1 110 ? -4.812  0.938   -12.685 1.00 0.00 ? 110 GLU A CD   3  
ATOM 5248  O OE1  . GLU A 1 110 ? -4.001  0.045   -13.007 1.00 0.00 ? 110 GLU A OE1  3  
ATOM 5249  O OE2  . GLU A 1 110 ? -5.748  1.311   -13.423 1.00 0.00 ? 110 GLU A OE2  3  
ATOM 5250  H H    . GLU A 1 110 ? -4.402  -0.492  -7.640  1.00 0.00 ? 110 GLU A H    3  
ATOM 5251  H HA   . GLU A 1 110 ? -5.497  1.936   -8.903  1.00 0.00 ? 110 GLU A HA   3  
ATOM 5252  H HB2  . GLU A 1 110 ? -3.408  0.629   -9.914  1.00 0.00 ? 110 GLU A HB2  3  
ATOM 5253  H HB3  . GLU A 1 110 ? -4.680  -0.385  -10.584 1.00 0.00 ? 110 GLU A HB3  3  
ATOM 5254  H HG2  . GLU A 1 110 ? -5.542  2.180   -11.125 1.00 0.00 ? 110 GLU A HG2  3  
ATOM 5255  H HG3  . GLU A 1 110 ? -3.797  2.262   -11.368 1.00 0.00 ? 110 GLU A HG3  3  
ATOM 5256  N N    . PRO A 1 111 ? -7.772  0.893   -9.067  1.00 0.00 ? 111 PRO A N    3  
ATOM 5257  C CA   . PRO A 1 111 ? -9.109  0.304   -9.189  1.00 0.00 ? 111 PRO A CA   3  
ATOM 5258  C C    . PRO A 1 111 ? -9.252  -0.517  -10.467 1.00 0.00 ? 111 PRO A C    3  
ATOM 5259  O O    . PRO A 1 111 ? -8.929  -0.044  -11.554 1.00 0.00 ? 111 PRO A O    3  
ATOM 5260  C CB   . PRO A 1 111 ? -10.040 1.521   -9.229  1.00 0.00 ? 111 PRO A CB   3  
ATOM 5261  C CG   . PRO A 1 111 ? -9.270  2.615   -8.573  1.00 0.00 ? 111 PRO A CG   3  
ATOM 5262  C CD   . PRO A 1 111 ? -7.826  2.358   -8.900  1.00 0.00 ? 111 PRO A CD   3  
ATOM 5263  H HA   . PRO A 1 111 ? -9.349  -0.311  -8.334  1.00 0.00 ? 111 PRO A HA   3  
ATOM 5264  H HB2  . PRO A 1 111 ? -10.274 1.762   -10.255 1.00 0.00 ? 111 PRO A HB2  3  
ATOM 5265  H HB3  . PRO A 1 111 ? -10.948 1.300   -8.688  1.00 0.00 ? 111 PRO A HB3  3  
ATOM 5266  H HG2  . PRO A 1 111 ? -9.580  3.571   -8.970  1.00 0.00 ? 111 PRO A HG2  3  
ATOM 5267  H HG3  . PRO A 1 111 ? -9.424  2.584   -7.506  1.00 0.00 ? 111 PRO A HG3  3  
ATOM 5268  H HD2  . PRO A 1 111 ? -7.551  2.861   -9.813  1.00 0.00 ? 111 PRO A HD2  3  
ATOM 5269  H HD3  . PRO A 1 111 ? -7.192  2.676   -8.086  1.00 0.00 ? 111 PRO A HD3  3  
ATOM 5270  N N    . VAL A 1 112 ? -9.734  -1.751  -10.331 1.00 0.00 ? 112 VAL A N    3  
ATOM 5271  C CA   . VAL A 1 112 ? -9.910  -2.625  -11.485 1.00 0.00 ? 112 VAL A CA   3  
ATOM 5272  C C    . VAL A 1 112 ? -11.088 -2.178  -12.344 1.00 0.00 ? 112 VAL A C    3  
ATOM 5273  O O    . VAL A 1 112 ? -12.017 -1.535  -11.854 1.00 0.00 ? 112 VAL A O    3  
ATOM 5274  C CB   . VAL A 1 112 ? -10.122 -4.090  -11.059 1.00 0.00 ? 112 VAL A CB   3  
ATOM 5275  C CG1  . VAL A 1 112 ? -8.960  -4.574  -10.206 1.00 0.00 ? 112 VAL A CG1  3  
ATOM 5276  C CG2  . VAL A 1 112 ? -11.439 -4.247  -10.316 1.00 0.00 ? 112 VAL A CG2  3  
ATOM 5277  H H    . VAL A 1 112 ? -9.976  -2.079  -9.438  1.00 0.00 ? 112 VAL A H    3  
ATOM 5278  H HA   . VAL A 1 112 ? -9.008  -2.574  -12.078 1.00 0.00 ? 112 VAL A HA   3  
ATOM 5279  H HB   . VAL A 1 112 ? -10.162 -4.701  -11.950 1.00 0.00 ? 112 VAL A HB   3  
ATOM 5280  H HG11 . VAL A 1 112 ? -8.816  -5.634  -10.359 1.00 0.00 ? 112 VAL A HG11 3  
ATOM 5281  H HG12 . VAL A 1 112 ? -9.175  -4.387  -9.164  1.00 0.00 ? 112 VAL A HG12 3  
ATOM 5282  H HG13 . VAL A 1 112 ? -8.062  -4.044  -10.487 1.00 0.00 ? 112 VAL A HG13 3  
ATOM 5283  H HG21 . VAL A 1 112 ? -11.908 -3.280  -10.204 1.00 0.00 ? 112 VAL A HG21 3  
ATOM 5284  H HG22 . VAL A 1 112 ? -11.255 -4.672  -9.340  1.00 0.00 ? 112 VAL A HG22 3  
ATOM 5285  H HG23 . VAL A 1 112 ? -12.093 -4.902  -10.875 1.00 0.00 ? 112 VAL A HG23 3  
ATOM 5286  N N    . GLU A 1 113 ? -11.044 -2.525  -13.627 1.00 0.00 ? 113 GLU A N    3  
ATOM 5287  C CA   . GLU A 1 113 ? -12.108 -2.160  -14.555 1.00 0.00 ? 113 GLU A CA   3  
ATOM 5288  C C    . GLU A 1 113 ? -12.867 -3.397  -15.023 1.00 0.00 ? 113 GLU A C    3  
ATOM 5289  O O    . GLU A 1 113 ? -12.376 -4.520  -14.905 1.00 0.00 ? 113 GLU A O    3  
ATOM 5290  C CB   . GLU A 1 113 ? -11.532 -1.415  -15.760 1.00 0.00 ? 113 GLU A CB   3  
ATOM 5291  C CG   . GLU A 1 113 ? -10.287 -2.064  -16.342 1.00 0.00 ? 113 GLU A CG   3  
ATOM 5292  C CD   . GLU A 1 113 ? -9.947  -1.544  -17.724 1.00 0.00 ? 113 GLU A CD   3  
ATOM 5293  O OE1  . GLU A 1 113 ? -10.397 -0.430  -18.068 1.00 0.00 ? 113 GLU A OE1  3  
ATOM 5294  O OE2  . GLU A 1 113 ? -9.231  -2.251  -18.464 1.00 0.00 ? 113 GLU A OE2  3  
ATOM 5295  H H    . GLU A 1 113 ? -10.277 -3.038  -13.958 1.00 0.00 ? 113 GLU A H    3  
ATOM 5296  H HA   . GLU A 1 113 ? -12.794 -1.508  -14.034 1.00 0.00 ? 113 GLU A HA   3  
ATOM 5297  H HB2  . GLU A 1 113 ? -12.283 -1.371  -16.535 1.00 0.00 ? 113 GLU A HB2  3  
ATOM 5298  H HB3  . GLU A 1 113 ? -11.281 -0.408  -15.459 1.00 0.00 ? 113 GLU A HB3  3  
ATOM 5299  H HG2  . GLU A 1 113 ? -9.454  -1.865  -15.684 1.00 0.00 ? 113 GLU A HG2  3  
ATOM 5300  H HG3  . GLU A 1 113 ? -10.449 -3.130  -16.402 1.00 0.00 ? 113 GLU A HG3  3  
ATOM 5301  N N    . ARG A 1 114 ? -14.066 -3.182  -15.554 1.00 0.00 ? 114 ARG A N    3  
ATOM 5302  C CA   . ARG A 1 114 ? -14.894 -4.280  -16.039 1.00 0.00 ? 114 ARG A CA   3  
ATOM 5303  C C    . ARG A 1 114 ? -15.196 -4.117  -17.525 1.00 0.00 ? 114 ARG A C    3  
ATOM 5304  O O    . ARG A 1 114 ? -15.097 -5.117  -18.264 1.00 0.00 ? 114 ARG A O    3  
ATOM 5305  C CB   . ARG A 1 114 ? -16.203 -4.354  -15.248 1.00 0.00 ? 114 ARG A CB   3  
ATOM 5306  C CG   . ARG A 1 114 ? -16.098 -3.790  -13.840 1.00 0.00 ? 114 ARG A CG   3  
ATOM 5307  C CD   . ARG A 1 114 ? -17.461 -3.395  -13.297 1.00 0.00 ? 114 ARG A CD   3  
ATOM 5308  N NE   . ARG A 1 114 ? -17.360 -2.717  -12.009 1.00 0.00 ? 114 ARG A NE   3  
ATOM 5309  C CZ   . ARG A 1 114 ? -17.353 -1.393  -11.870 1.00 0.00 ? 114 ARG A CZ   3  
ATOM 5310  N NH1  . ARG A 1 114 ? -17.440 -0.610  -12.937 1.00 0.00 ? 114 ARG A NH1  3  
ATOM 5311  N NH2  . ARG A 1 114 ? -17.257 -0.852  -10.663 1.00 0.00 ? 114 ARG A NH2  3  
ATOM 5312  O OXT  . ARG A 1 114 ? -15.533 -2.985  -17.937 1.00 0.00 ? 114 ARG A OXT  3  
ATOM 5313  H H    . ARG A 1 114 ? -14.402 -2.265  -15.622 1.00 0.00 ? 114 ARG A H    3  
ATOM 5314  H HA   . ARG A 1 114 ? -14.344 -5.199  -15.896 1.00 0.00 ? 114 ARG A HA   3  
ATOM 5315  H HB2  . ARG A 1 114 ? -16.963 -3.801  -15.778 1.00 0.00 ? 114 ARG A HB2  3  
ATOM 5316  H HB3  . ARG A 1 114 ? -16.508 -5.387  -15.175 1.00 0.00 ? 114 ARG A HB3  3  
ATOM 5317  H HG2  . ARG A 1 114 ? -15.668 -4.538  -13.192 1.00 0.00 ? 114 ARG A HG2  3  
ATOM 5318  H HG3  . ARG A 1 114 ? -15.461 -2.918  -13.859 1.00 0.00 ? 114 ARG A HG3  3  
ATOM 5319  H HD2  . ARG A 1 114 ? -17.939 -2.732  -14.005 1.00 0.00 ? 114 ARG A HD2  3  
ATOM 5320  H HD3  . ARG A 1 114 ? -18.059 -4.286  -13.180 1.00 0.00 ? 114 ARG A HD3  3  
ATOM 5321  H HE   . ARG A 1 114 ? -17.295 -3.275  -11.205 1.00 0.00 ? 114 ARG A HE   3  
ATOM 5322  H HH11 . ARG A 1 114 ? -17.514 -1.014  -13.848 1.00 0.00 ? 114 ARG A HH11 3  
ATOM 5323  H HH12 . ARG A 1 114 ? -17.433 0.384   -12.829 1.00 0.00 ? 114 ARG A HH12 3  
ATOM 5324  H HH21 . ARG A 1 114 ? -17.191 -1.439  -9.856  1.00 0.00 ? 114 ARG A HH21 3  
ATOM 5325  H HH22 . ARG A 1 114 ? -17.249 0.142   -10.560 1.00 0.00 ? 114 ARG A HH22 3  
ATOM 5326  N N    . GLY A 1 1   ? -6.414  12.676  -18.935 1.00 0.00 ? 1   GLY A N    4  
ATOM 5327  C CA   . GLY A 1 1   ? -7.789  12.527  -18.386 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5328  C C    . GLY A 1 1   ? -8.423  11.201  -18.759 1.00 0.00 ? 1   GLY A C    4  
ATOM 5329  O O    . GLY A 1 1   ? -9.560  11.161  -19.235 1.00 0.00 ? 1   GLY A O    4  
ATOM 5330  H H1   . GLY A 1 1   ? -5.787  13.098  -18.221 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5331  H H2   . GLY A 1 1   ? -6.430  13.293  -19.772 1.00 0.00 ? 1   GLY A H2   4  
ATOM 5332  H H3   . GLY A 1 1   ? -6.036  11.747  -19.209 1.00 0.00 ? 1   GLY A H3   4  
ATOM 5333  H HA2  . GLY A 1 1   ? -7.745  12.600  -17.309 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5334  H HA3  . GLY A 1 1   ? -8.407  13.328  -18.764 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5335  N N    . ALA A 1 2   ? -7.689  10.115  -18.544 1.00 0.00 ? 2   ALA A N    4  
ATOM 5336  C CA   . ALA A 1 2   ? -8.183  8.781   -18.858 1.00 0.00 ? 2   ALA A CA   4  
ATOM 5337  C C    . ALA A 1 2   ? -7.318  7.709   -18.204 1.00 0.00 ? 2   ALA A C    4  
ATOM 5338  O O    . ALA A 1 2   ? -7.828  6.710   -17.696 1.00 0.00 ? 2   ALA A O    4  
ATOM 5339  C CB   . ALA A 1 2   ? -8.228  8.576   -20.366 1.00 0.00 ? 2   ALA A CB   4  
ATOM 5340  H H    . ALA A 1 2   ? -6.792  10.214  -18.160 1.00 0.00 ? 2   ALA A H    4  
ATOM 5341  H HA   . ALA A 1 2   ? -9.191  8.699   -18.477 1.00 0.00 ? 2   ALA A HA   4  
ATOM 5342  H HB1  . ALA A 1 2   ? -9.176  8.139   -20.642 1.00 0.00 ? 2   ALA A HB1  4  
ATOM 5343  H HB2  . ALA A 1 2   ? -7.428  7.916   -20.665 1.00 0.00 ? 2   ALA A HB2  4  
ATOM 5344  H HB3  . ALA A 1 2   ? -8.112  9.528   -20.862 1.00 0.00 ? 2   ALA A HB3  4  
ATOM 5345  N N    . MET A 1 3   ? -6.005  7.926   -18.221 1.00 0.00 ? 3   MET A N    4  
ATOM 5346  C CA   . MET A 1 3   ? -5.066  6.979   -17.629 1.00 0.00 ? 3   MET A CA   4  
ATOM 5347  C C    . MET A 1 3   ? -4.802  7.319   -16.166 1.00 0.00 ? 3   MET A C    4  
ATOM 5348  O O    . MET A 1 3   ? -5.488  8.158   -15.581 1.00 0.00 ? 3   MET A O    4  
ATOM 5349  C CB   . MET A 1 3   ? -3.749  6.980   -18.409 1.00 0.00 ? 3   MET A CB   4  
ATOM 5350  C CG   . MET A 1 3   ? -3.358  5.614   -18.945 1.00 0.00 ? 3   MET A CG   4  
ATOM 5351  S SD   . MET A 1 3   ? -3.593  5.472   -20.727 1.00 0.00 ? 3   MET A SD   4  
ATOM 5352  C CE   . MET A 1 3   ? -3.625  3.692   -20.922 1.00 0.00 ? 3   MET A CE   4  
ATOM 5353  H H    . MET A 1 3   ? -5.661  8.741   -18.641 1.00 0.00 ? 3   MET A H    4  
ATOM 5354  H HA   . MET A 1 3   ? -5.507  5.995   -17.684 1.00 0.00 ? 3   MET A HA   4  
ATOM 5355  H HB2  . MET A 1 3   ? -3.840  7.657   -19.246 1.00 0.00 ? 3   MET A HB2  4  
ATOM 5356  H HB3  . MET A 1 3   ? -2.959  7.327   -17.761 1.00 0.00 ? 3   MET A HB3  4  
ATOM 5357  H HG2  . MET A 1 3   ? -2.316  5.437   -18.719 1.00 0.00 ? 3   MET A HG2  4  
ATOM 5358  H HG3  . MET A 1 3   ? -3.961  4.864   -18.456 1.00 0.00 ? 3   MET A HG3  4  
ATOM 5359  H HE1  . MET A 1 3   ? -3.986  3.446   -21.911 1.00 0.00 ? 3   MET A HE1  4  
ATOM 5360  H HE2  . MET A 1 3   ? -4.283  3.260   -20.182 1.00 0.00 ? 3   MET A HE2  4  
ATOM 5361  H HE3  . MET A 1 3   ? -2.628  3.297   -20.792 1.00 0.00 ? 3   MET A HE3  4  
ATOM 5362  N N    . ASP A 1 4   ? -3.801  6.668   -15.580 1.00 0.00 ? 4   ASP A N    4  
ATOM 5363  C CA   . ASP A 1 4   ? -3.447  6.907   -14.184 1.00 0.00 ? 4   ASP A CA   4  
ATOM 5364  C C    . ASP A 1 4   ? -1.936  7.064   -14.015 1.00 0.00 ? 4   ASP A C    4  
ATOM 5365  O O    . ASP A 1 4   ? -1.308  6.320   -13.262 1.00 0.00 ? 4   ASP A O    4  
ATOM 5366  C CB   . ASP A 1 4   ? -3.958  5.764   -13.306 1.00 0.00 ? 4   ASP A CB   4  
ATOM 5367  C CG   . ASP A 1 4   ? -5.473  5.697   -13.267 1.00 0.00 ? 4   ASP A CG   4  
ATOM 5368  O OD1  . ASP A 1 4   ? -6.091  6.594   -12.654 1.00 0.00 ? 4   ASP A OD1  4  
ATOM 5369  O OD2  . ASP A 1 4   ? -6.042  4.750   -13.850 1.00 0.00 ? 4   ASP A OD2  4  
ATOM 5370  H H    . ASP A 1 4   ? -3.288  6.011   -16.097 1.00 0.00 ? 4   ASP A H    4  
ATOM 5371  H HA   . ASP A 1 4   ? -3.927  7.826   -13.876 1.00 0.00 ? 4   ASP A HA   4  
ATOM 5372  H HB2  . ASP A 1 4   ? -3.585  4.828   -13.693 1.00 0.00 ? 4   ASP A HB2  4  
ATOM 5373  H HB3  . ASP A 1 4   ? -3.595  5.902   -12.299 1.00 0.00 ? 4   ASP A HB3  4  
ATOM 5374  N N    . PRO A 1 5   ? -1.324  8.044   -14.713 1.00 0.00 ? 5   PRO A N    4  
ATOM 5375  C CA   . PRO A 1 5   ? 0.114   8.293   -14.624 1.00 0.00 ? 5   PRO A CA   4  
ATOM 5376  C C    . PRO A 1 5   ? 0.476   9.083   -13.372 1.00 0.00 ? 5   PRO A C    4  
ATOM 5377  O O    . PRO A 1 5   ? 1.449   8.773   -12.684 1.00 0.00 ? 5   PRO A O    4  
ATOM 5378  C CB   . PRO A 1 5   ? 0.400   9.116   -15.877 1.00 0.00 ? 5   PRO A CB   4  
ATOM 5379  C CG   . PRO A 1 5   ? -0.866  9.861   -16.135 1.00 0.00 ? 5   PRO A CG   4  
ATOM 5380  C CD   . PRO A 1 5   ? -1.989  8.989   -15.636 1.00 0.00 ? 5   PRO A CD   4  
ATOM 5381  H HA   . PRO A 1 5   ? 0.683   7.374   -14.652 1.00 0.00 ? 5   PRO A HA   4  
ATOM 5382  H HB2  . PRO A 1 5   ? 1.222   9.791   -15.687 1.00 0.00 ? 5   PRO A HB2  4  
ATOM 5383  H HB3  . PRO A 1 5   ? 0.645   8.459   -16.698 1.00 0.00 ? 5   PRO A HB3  4  
ATOM 5384  H HG2  . PRO A 1 5   ? -0.853  10.797  -15.597 1.00 0.00 ? 5   PRO A HG2  4  
ATOM 5385  H HG3  . PRO A 1 5   ? -0.974  10.040  -17.194 1.00 0.00 ? 5   PRO A HG3  4  
ATOM 5386  H HD2  . PRO A 1 5   ? -2.723  9.582   -15.113 1.00 0.00 ? 5   PRO A HD2  4  
ATOM 5387  H HD3  . PRO A 1 5   ? -2.448  8.461   -16.459 1.00 0.00 ? 5   PRO A HD3  4  
ATOM 5388  N N    . GLU A 1 6   ? -0.322  10.104  -13.088 1.00 0.00 ? 6   GLU A N    4  
ATOM 5389  C CA   . GLU A 1 6   ? -0.113  10.951  -11.923 1.00 0.00 ? 6   GLU A CA   4  
ATOM 5390  C C    . GLU A 1 6   ? -1.436  11.547  -11.464 1.00 0.00 ? 6   GLU A C    4  
ATOM 5391  O O    . GLU A 1 6   ? -1.470  12.429  -10.606 1.00 0.00 ? 6   GLU A O    4  
ATOM 5392  C CB   . GLU A 1 6   ? 0.885   12.067  -12.240 1.00 0.00 ? 6   GLU A CB   4  
ATOM 5393  C CG   . GLU A 1 6   ? 0.354   13.099  -13.220 1.00 0.00 ? 6   GLU A CG   4  
ATOM 5394  C CD   . GLU A 1 6   ? 0.831   14.505  -12.904 1.00 0.00 ? 6   GLU A CD   4  
ATOM 5395  O OE1  . GLU A 1 6   ? 1.926   14.645  -12.323 1.00 0.00 ? 6   GLU A OE1  4  
ATOM 5396  O OE2  . GLU A 1 6   ? 0.105   15.466  -13.238 1.00 0.00 ? 6   GLU A OE2  4  
ATOM 5397  H H    . GLU A 1 6   ? -1.082  10.290  -13.679 1.00 0.00 ? 6   GLU A H    4  
ATOM 5398  H HA   . GLU A 1 6   ? 0.284   10.334  -11.131 1.00 0.00 ? 6   GLU A HA   4  
ATOM 5399  H HB2  . GLU A 1 6   ? 1.146   12.573  -11.322 1.00 0.00 ? 6   GLU A HB2  4  
ATOM 5400  H HB3  . GLU A 1 6   ? 1.778   11.627  -12.661 1.00 0.00 ? 6   GLU A HB3  4  
ATOM 5401  H HG2  . GLU A 1 6   ? 0.684   12.839  -14.214 1.00 0.00 ? 6   GLU A HG2  4  
ATOM 5402  H HG3  . GLU A 1 6   ? -0.727  13.085  -13.187 1.00 0.00 ? 6   GLU A HG3  4  
ATOM 5403  N N    . PHE A 1 7   ? -2.523  11.051  -12.044 1.00 0.00 ? 7   PHE A N    4  
ATOM 5404  C CA   . PHE A 1 7   ? -3.859  11.522  -11.702 1.00 0.00 ? 7   PHE A CA   4  
ATOM 5405  C C    . PHE A 1 7   ? -4.634  10.442  -10.959 1.00 0.00 ? 7   PHE A C    4  
ATOM 5406  O O    . PHE A 1 7   ? -4.797  9.329   -11.459 1.00 0.00 ? 7   PHE A O    4  
ATOM 5407  C CB   . PHE A 1 7   ? -4.621  11.932  -12.961 1.00 0.00 ? 7   PHE A CB   4  
ATOM 5408  C CG   . PHE A 1 7   ? -4.653  13.417  -13.194 1.00 0.00 ? 7   PHE A CG   4  
ATOM 5409  C CD1  . PHE A 1 7   ? -3.485  14.163  -13.158 1.00 0.00 ? 7   PHE A CD1  4  
ATOM 5410  C CD2  . PHE A 1 7   ? -5.849  14.065  -13.450 1.00 0.00 ? 7   PHE A CD2  4  
ATOM 5411  C CE1  . PHE A 1 7   ? -3.512  15.527  -13.372 1.00 0.00 ? 7   PHE A CE1  4  
ATOM 5412  C CE2  . PHE A 1 7   ? -5.883  15.430  -13.666 1.00 0.00 ? 7   PHE A CE2  4  
ATOM 5413  C CZ   . PHE A 1 7   ? -4.712  16.161  -13.627 1.00 0.00 ? 7   PHE A CZ   4  
ATOM 5414  H H    . PHE A 1 7   ? -2.423  10.349  -12.721 1.00 0.00 ? 7   PHE A H    4  
ATOM 5415  H HA   . PHE A 1 7   ? -3.754  12.382  -11.057 1.00 0.00 ? 7   PHE A HA   4  
ATOM 5416  H HB2  . PHE A 1 7   ? -4.160  11.471  -13.820 1.00 0.00 ? 7   PHE A HB2  4  
ATOM 5417  H HB3  . PHE A 1 7   ? -5.643  11.586  -12.878 1.00 0.00 ? 7   PHE A HB3  4  
ATOM 5418  H HD1  . PHE A 1 7   ? -2.545  13.669  -12.959 1.00 0.00 ? 7   PHE A HD1  4  
ATOM 5419  H HD2  . PHE A 1 7   ? -6.765  13.494  -13.480 1.00 0.00 ? 7   PHE A HD2  4  
ATOM 5420  H HE1  . PHE A 1 7   ? -2.595  16.098  -13.341 1.00 0.00 ? 7   PHE A HE1  4  
ATOM 5421  H HE2  . PHE A 1 7   ? -6.821  15.922  -13.865 1.00 0.00 ? 7   PHE A HE2  4  
ATOM 5422  H HZ   . PHE A 1 7   ? -4.734  17.229  -13.796 1.00 0.00 ? 7   PHE A HZ   4  
ATOM 5423  N N    . ASN A 1 8   ? -5.106  10.777  -9.763  1.00 0.00 ? 8   ASN A N    4  
ATOM 5424  C CA   . ASN A 1 8   ? -5.862  9.838   -8.946  1.00 0.00 ? 8   ASN A CA   4  
ATOM 5425  C C    . ASN A 1 8   ? -5.044  8.579   -8.663  1.00 0.00 ? 8   ASN A C    4  
ATOM 5426  O O    . ASN A 1 8   ? -5.597  7.533   -8.328  1.00 0.00 ? 8   ASN A O    4  
ATOM 5427  C CB   . ASN A 1 8   ? -7.175  9.462   -9.639  1.00 0.00 ? 8   ASN A CB   4  
ATOM 5428  C CG   . ASN A 1 8   ? -8.146  10.624  -9.710  1.00 0.00 ? 8   ASN A CG   4  
ATOM 5429  O OD1  . ASN A 1 8   ? -9.021  10.770  -8.857  1.00 0.00 ? 8   ASN A OD1  4  
ATOM 5430  N ND2  . ASN A 1 8   ? -7.994  11.461  -10.731 1.00 0.00 ? 8   ASN A ND2  4  
ATOM 5431  H H    . ASN A 1 8   ? -4.941  11.681  -9.420  1.00 0.00 ? 8   ASN A H    4  
ATOM 5432  H HA   . ASN A 1 8   ? -6.088  10.324  -8.010  1.00 0.00 ? 8   ASN A HA   4  
ATOM 5433  H HB2  . ASN A 1 8   ? -6.961  9.133   -10.645 1.00 0.00 ? 8   ASN A HB2  4  
ATOM 5434  H HB3  . ASN A 1 8   ? -7.645  8.657   -9.094  1.00 0.00 ? 8   ASN A HB3  4  
ATOM 5435  H HD21 . ASN A 1 8   ? -7.274  11.283  -11.372 1.00 0.00 ? 8   ASN A HD21 4  
ATOM 5436  H HD22 . ASN A 1 8   ? -8.608  12.220  -10.801 1.00 0.00 ? 8   ASN A HD22 4  
ATOM 5437  N N    . LYS A 1 9   ? -3.725  8.689   -8.811  1.00 0.00 ? 9   LYS A N    4  
ATOM 5438  C CA   . LYS A 1 9   ? -2.836  7.555   -8.582  1.00 0.00 ? 9   LYS A CA   4  
ATOM 5439  C C    . LYS A 1 9   ? -2.608  7.309   -7.091  1.00 0.00 ? 9   LYS A C    4  
ATOM 5440  O O    . LYS A 1 9   ? -2.171  8.198   -6.351  1.00 0.00 ? 9   LYS A O    4  
ATOM 5441  C CB   . LYS A 1 9   ? -1.496  7.786   -9.281  1.00 0.00 ? 9   LYS A CB   4  
ATOM 5442  C CG   . LYS A 1 9   ? -1.075  6.634   -10.179 1.00 0.00 ? 9   LYS A CG   4  
ATOM 5443  C CD   . LYS A 1 9   ? 0.407   6.328   -10.037 1.00 0.00 ? 9   LYS A CD   4  
ATOM 5444  C CE   . LYS A 1 9   ? 0.759   4.983   -10.655 1.00 0.00 ? 9   LYS A CE   4  
ATOM 5445  N NZ   . LYS A 1 9   ? 1.873   5.099   -11.637 1.00 0.00 ? 9   LYS A NZ   4  
ATOM 5446  H H    . LYS A 1 9   ? -3.343  9.548   -9.092  1.00 0.00 ? 9   LYS A H    4  
ATOM 5447  H HA   . LYS A 1 9   ? -3.304  6.680   -9.007  1.00 0.00 ? 9   LYS A HA   4  
ATOM 5448  H HB2  . LYS A 1 9   ? -1.565  8.678   -9.883  1.00 0.00 ? 9   LYS A HB2  4  
ATOM 5449  H HB3  . LYS A 1 9   ? -0.730  7.925   -8.531  1.00 0.00 ? 9   LYS A HB3  4  
ATOM 5450  H HG2  . LYS A 1 9   ? -1.641  5.754   -9.910  1.00 0.00 ? 9   LYS A HG2  4  
ATOM 5451  H HG3  . LYS A 1 9   ? -1.282  6.899   -11.205 1.00 0.00 ? 9   LYS A HG3  4  
ATOM 5452  H HD2  . LYS A 1 9   ? 0.974   7.099   -10.534 1.00 0.00 ? 9   LYS A HD2  4  
ATOM 5453  H HD3  . LYS A 1 9   ? 0.662   6.309   -8.988  1.00 0.00 ? 9   LYS A HD3  4  
ATOM 5454  H HE2  . LYS A 1 9   ? 1.055   4.307   -9.868  1.00 0.00 ? 9   LYS A HE2  4  
ATOM 5455  H HE3  . LYS A 1 9   ? -0.113  4.592   -11.157 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 5456  H HZ1  . LYS A 1 9   ? 2.641   5.679   -11.239 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 5457  H HZ2  . LYS A 1 9   ? 1.533   5.547   -12.511 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 5458  H HZ3  . LYS A 1 9   ? 2.248   4.157   -11.867 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 5459  N N    . ALA A 1 10  ? -2.912  6.091   -6.655  1.00 0.00 ? 10  ALA A N    4  
ATOM 5460  C CA   . ALA A 1 10  ? -2.738  5.728   -5.258  1.00 0.00 ? 10  ALA A CA   4  
ATOM 5461  C C    . ALA A 1 10  ? -1.279  5.413   -4.957  1.00 0.00 ? 10  ALA A C    4  
ATOM 5462  O O    . ALA A 1 10  ? -0.820  4.294   -5.174  1.00 0.00 ? 10  ALA A O    4  
ATOM 5463  C CB   . ALA A 1 10  ? -3.624  4.544   -4.902  1.00 0.00 ? 10  ALA A CB   4  
ATOM 5464  H H    . ALA A 1 10  ? -3.270  5.429   -7.281  1.00 0.00 ? 10  ALA A H    4  
ATOM 5465  H HA   . ALA A 1 10  ? -3.045  6.569   -4.658  1.00 0.00 ? 10  ALA A HA   4  
ATOM 5466  H HB1  . ALA A 1 10  ? -3.724  3.897   -5.761  1.00 0.00 ? 10  ALA A HB1  4  
ATOM 5467  H HB2  . ALA A 1 10  ? -4.600  4.901   -4.605  1.00 0.00 ? 10  ALA A HB2  4  
ATOM 5468  H HB3  . ALA A 1 10  ? -3.178  3.995   -4.086  1.00 0.00 ? 10  ALA A HB3  4  
ATOM 5469  N N    . ILE A 1 11  ? -0.552  6.411   -4.465  1.00 0.00 ? 11  ILE A N    4  
ATOM 5470  C CA   . ILE A 1 11  ? 0.860   6.236   -4.145  1.00 0.00 ? 11  ILE A CA   4  
ATOM 5471  C C    . ILE A 1 11  ? 1.107   6.283   -2.641  1.00 0.00 ? 11  ILE A C    4  
ATOM 5472  O O    . ILE A 1 11  ? 0.907   7.315   -1.999  1.00 0.00 ? 11  ILE A O    4  
ATOM 5473  C CB   . ILE A 1 11  ? 1.722   7.314   -4.831  1.00 0.00 ? 11  ILE A CB   4  
ATOM 5474  C CG1  . ILE A 1 11  ? 1.564   7.234   -6.351  1.00 0.00 ? 11  ILE A CG1  4  
ATOM 5475  C CG2  . ILE A 1 11  ? 3.185   7.155   -4.437  1.00 0.00 ? 11  ILE A CG2  4  
ATOM 5476  C CD1  . ILE A 1 11  ? 1.314   8.575   -7.003  1.00 0.00 ? 11  ILE A CD1  4  
ATOM 5477  H H    . ILE A 1 11  ? -0.969  7.287   -4.318  1.00 0.00 ? 11  ILE A H    4  
ATOM 5478  H HA   . ILE A 1 11  ? 1.165   5.270   -4.519  1.00 0.00 ? 11  ILE A HA   4  
ATOM 5479  H HB   . ILE A 1 11  ? 1.388   8.281   -4.491  1.00 0.00 ? 11  ILE A HB   4  
ATOM 5480  H HG12 . ILE A 1 11  ? 2.465   6.820   -6.779  1.00 0.00 ? 11  ILE A HG12 4  
ATOM 5481  H HG13 . ILE A 1 11  ? 0.730   6.590   -6.585  1.00 0.00 ? 11  ILE A HG13 4  
ATOM 5482  H HG21 . ILE A 1 11  ? 3.559   6.215   -4.814  1.00 0.00 ? 11  ILE A HG21 4  
ATOM 5483  H HG22 . ILE A 1 11  ? 3.271   7.170   -3.359  1.00 0.00 ? 11  ILE A HG22 4  
ATOM 5484  H HG23 . ILE A 1 11  ? 3.762   7.966   -4.856  1.00 0.00 ? 11  ILE A HG23 4  
ATOM 5485  H HD11 . ILE A 1 11  ? 1.852   9.343   -6.466  1.00 0.00 ? 11  ILE A HD11 4  
ATOM 5486  H HD12 . ILE A 1 11  ? 0.256   8.797   -6.979  1.00 0.00 ? 11  ILE A HD12 4  
ATOM 5487  H HD13 . ILE A 1 11  ? 1.653   8.547   -8.027  1.00 0.00 ? 11  ILE A HD13 4  
ATOM 5488  N N    . PHE A 1 12  ? 1.563   5.162   -2.093  1.00 0.00 ? 12  PHE A N    4  
ATOM 5489  C CA   . PHE A 1 12  ? 1.868   5.064   -0.670  1.00 0.00 ? 12  PHE A CA   4  
ATOM 5490  C C    . PHE A 1 12  ? 3.348   4.747   -0.484  1.00 0.00 ? 12  PHE A C    4  
ATOM 5491  O O    . PHE A 1 12  ? 3.793   3.641   -0.786  1.00 0.00 ? 12  PHE A O    4  
ATOM 5492  C CB   . PHE A 1 12  ? 1.019   3.969   -0.013  1.00 0.00 ? 12  PHE A CB   4  
ATOM 5493  C CG   . PHE A 1 12  ? -0.366  4.408   0.380   1.00 0.00 ? 12  PHE A CG   4  
ATOM 5494  C CD1  . PHE A 1 12  ? -1.390  4.426   -0.553  1.00 0.00 ? 12  PHE A CD1  4  
ATOM 5495  C CD2  . PHE A 1 12  ? -0.645  4.790   1.684   1.00 0.00 ? 12  PHE A CD2  4  
ATOM 5496  C CE1  . PHE A 1 12  ? -2.666  4.819   -0.192  1.00 0.00 ? 12  PHE A CE1  4  
ATOM 5497  C CE2  . PHE A 1 12  ? -1.920  5.182   2.049   1.00 0.00 ? 12  PHE A CE2  4  
ATOM 5498  C CZ   . PHE A 1 12  ? -2.932  5.198   1.109   1.00 0.00 ? 12  PHE A CZ   4  
ATOM 5499  H H    . PHE A 1 12  ? 1.716   4.380   -2.663  1.00 0.00 ? 12  PHE A H    4  
ATOM 5500  H HA   . PHE A 1 12  ? 1.645   6.015   -0.209  1.00 0.00 ? 12  PHE A HA   4  
ATOM 5501  H HB2  . PHE A 1 12  ? 0.920   3.143   -0.702  1.00 0.00 ? 12  PHE A HB2  4  
ATOM 5502  H HB3  . PHE A 1 12  ? 1.524   3.624   0.878   1.00 0.00 ? 12  PHE A HB3  4  
ATOM 5503  H HD1  . PHE A 1 12  ? -1.186  4.130   -1.570  1.00 0.00 ? 12  PHE A HD1  4  
ATOM 5504  H HD2  . PHE A 1 12  ? 0.146   4.779   2.419   1.00 0.00 ? 12  PHE A HD2  4  
ATOM 5505  H HE1  . PHE A 1 12  ? -3.455  4.831   -0.930  1.00 0.00 ? 12  PHE A HE1  4  
ATOM 5506  H HE2  . PHE A 1 12  ? -2.123  5.477   3.071   1.00 0.00 ? 12  PHE A HE2  4  
ATOM 5507  H HZ   . PHE A 1 12  ? -3.930  5.503   1.390   1.00 0.00 ? 12  PHE A HZ   4  
ATOM 5508  N N    . THR A 1 13  ? 4.113   5.720   0.004   1.00 0.00 ? 13  THR A N    4  
ATOM 5509  C CA   . THR A 1 13  ? 5.544   5.521   0.211   1.00 0.00 ? 13  THR A CA   4  
ATOM 5510  C C    . THR A 1 13  ? 5.840   5.017   1.614   1.00 0.00 ? 13  THR A C    4  
ATOM 5511  O O    . THR A 1 13  ? 5.436   5.627   2.602   1.00 0.00 ? 13  THR A O    4  
ATOM 5512  C CB   . THR A 1 13  ? 6.343   6.811   -0.035  1.00 0.00 ? 13  THR A CB   4  
ATOM 5513  O OG1  . THR A 1 13  ? 5.937   7.415   -1.271  1.00 0.00 ? 13  THR A OG1  4  
ATOM 5514  C CG2  . THR A 1 13  ? 7.834   6.512   -0.078  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5515  H H    . THR A 1 13  ? 3.710   6.586   0.223   1.00 0.00 ? 13  THR A H    4  
ATOM 5516  H HA   . THR A 1 13  ? 5.877   4.778   -0.500  1.00 0.00 ? 13  THR A HA   4  
ATOM 5517  H HB   . THR A 1 13  ? 6.151   7.499   0.774   1.00 0.00 ? 13  THR A HB   4  
ATOM 5518  H HG1  . THR A 1 13  ? 5.056   7.112   -1.501  1.00 0.00 ? 13  THR A HG1  4  
ATOM 5519  H HG21 . THR A 1 13  ? 8.195   6.345   0.927   1.00 0.00 ? 13  THR A HG21 4  
ATOM 5520  H HG22 . THR A 1 13  ? 8.359   7.350   -0.513  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5521  H HG23 . THR A 1 13  ? 8.008   5.627   -0.674  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5522  N N    . VAL A 1 14  ? 6.542   3.892   1.687   1.00 0.00 ? 14  VAL A N    4  
ATOM 5523  C CA   . VAL A 1 14  ? 6.902   3.273   2.961   1.00 0.00 ? 14  VAL A CA   4  
ATOM 5524  C C    . VAL A 1 14  ? 8.297   2.665   2.878   1.00 0.00 ? 14  VAL A C    4  
ATOM 5525  O O    . VAL A 1 14  ? 8.906   2.661   1.815   1.00 0.00 ? 14  VAL A O    4  
ATOM 5526  C CB   . VAL A 1 14  ? 5.894   2.166   3.358   1.00 0.00 ? 14  VAL A CB   4  
ATOM 5527  C CG1  . VAL A 1 14  ? 4.519   2.454   2.785   1.00 0.00 ? 14  VAL A CG1  4  
ATOM 5528  C CG2  . VAL A 1 14  ? 6.369   0.792   2.896   1.00 0.00 ? 14  VAL A CG2  4  
ATOM 5529  H H    . VAL A 1 14  ? 6.821   3.455   0.856   1.00 0.00 ? 14  VAL A H    4  
ATOM 5530  H HA   . VAL A 1 14  ? 6.891   4.039   3.723   1.00 0.00 ? 14  VAL A HA   4  
ATOM 5531  H HB   . VAL A 1 14  ? 5.813   2.150   4.434   1.00 0.00 ? 14  VAL A HB   4  
ATOM 5532  H HG11 . VAL A 1 14  ? 4.605   3.189   1.996   1.00 0.00 ? 14  VAL A HG11 4  
ATOM 5533  H HG12 . VAL A 1 14  ? 3.874   2.834   3.565   1.00 0.00 ? 14  VAL A HG12 4  
ATOM 5534  H HG13 . VAL A 1 14  ? 4.104   1.543   2.382   1.00 0.00 ? 14  VAL A HG13 4  
ATOM 5535  H HG21 . VAL A 1 14  ? 6.715   0.858   1.874   1.00 0.00 ? 14  VAL A HG21 4  
ATOM 5536  H HG22 . VAL A 1 14  ? 5.551   0.089   2.955   1.00 0.00 ? 14  VAL A HG22 4  
ATOM 5537  H HG23 . VAL A 1 14  ? 7.177   0.460   3.529   1.00 0.00 ? 14  VAL A HG23 4  
ATOM 5538  N N    . ASP A 1 15  ? 8.785   2.135   3.995   1.00 0.00 ? 15  ASP A N    4  
ATOM 5539  C CA   . ASP A 1 15  ? 10.095  1.493   4.027   1.00 0.00 ? 15  ASP A CA   4  
ATOM 5540  C C    . ASP A 1 15  ? 9.930   -0.007  3.793   1.00 0.00 ? 15  ASP A C    4  
ATOM 5541  O O    . ASP A 1 15  ? 8.864   -0.559  4.043   1.00 0.00 ? 15  ASP A O    4  
ATOM 5542  C CB   . ASP A 1 15  ? 10.785  1.742   5.368   1.00 0.00 ? 15  ASP A CB   4  
ATOM 5543  C CG   . ASP A 1 15  ? 10.812  3.212   5.742   1.00 0.00 ? 15  ASP A CG   4  
ATOM 5544  O OD1  . ASP A 1 15  ? 11.067  4.045   4.847   1.00 0.00 ? 15  ASP A OD1  4  
ATOM 5545  O OD2  . ASP A 1 15  ? 10.577  3.528   6.926   1.00 0.00 ? 15  ASP A OD2  4  
ATOM 5546  H H    . ASP A 1 15  ? 8.244   2.158   4.811   1.00 0.00 ? 15  ASP A H    4  
ATOM 5547  H HA   . ASP A 1 15  ? 10.695  1.911   3.231   1.00 0.00 ? 15  ASP A HA   4  
ATOM 5548  H HB2  . ASP A 1 15  ? 10.256  1.205   6.144   1.00 0.00 ? 15  ASP A HB2  4  
ATOM 5549  H HB3  . ASP A 1 15  ? 11.801  1.382   5.317   1.00 0.00 ? 15  ASP A HB3  4  
ATOM 5550  N N    . ALA A 1 16  ? 10.968  -0.671  3.304   1.00 0.00 ? 16  ALA A N    4  
ATOM 5551  C CA   . ALA A 1 16  ? 10.878  -2.105  3.045   1.00 0.00 ? 16  ALA A CA   4  
ATOM 5552  C C    . ALA A 1 16  ? 11.280  -2.913  4.264   1.00 0.00 ? 16  ALA A C    4  
ATOM 5553  O O    . ALA A 1 16  ? 10.886  -4.070  4.411   1.00 0.00 ? 16  ALA A O    4  
ATOM 5554  C CB   . ALA A 1 16  ? 11.725  -2.485  1.842   1.00 0.00 ? 16  ALA A CB   4  
ATOM 5555  H H    . ALA A 1 16  ? 11.802  -0.200  3.106   1.00 0.00 ? 16  ALA A H    4  
ATOM 5556  H HA   . ALA A 1 16  ? 9.847   -2.332  2.824   1.00 0.00 ? 16  ALA A HA   4  
ATOM 5557  H HB1  . ALA A 1 16  ? 11.094  -2.916  1.078   1.00 0.00 ? 16  ALA A HB1  4  
ATOM 5558  H HB2  . ALA A 1 16  ? 12.473  -3.205  2.140   1.00 0.00 ? 16  ALA A HB2  4  
ATOM 5559  H HB3  . ALA A 1 16  ? 12.209  -1.603  1.450   1.00 0.00 ? 16  ALA A HB3  4  
ATOM 5560  N N    . LYS A 1 17  ? 12.046  -2.297  5.149   1.00 0.00 ? 17  LYS A N    4  
ATOM 5561  C CA   . LYS A 1 17  ? 12.470  -2.971  6.362   1.00 0.00 ? 17  LYS A CA   4  
ATOM 5562  C C    . LYS A 1 17  ? 11.280  -3.155  7.297   1.00 0.00 ? 17  LYS A C    4  
ATOM 5563  O O    . LYS A 1 17  ? 10.861  -4.279  7.574   1.00 0.00 ? 17  LYS A O    4  
ATOM 5564  C CB   . LYS A 1 17  ? 13.573  -2.172  7.061   1.00 0.00 ? 17  LYS A CB   4  
ATOM 5565  C CG   . LYS A 1 17  ? 14.323  -2.966  8.119   1.00 0.00 ? 17  LYS A CG   4  
ATOM 5566  C CD   . LYS A 1 17  ? 13.943  -2.521  9.524   1.00 0.00 ? 17  LYS A CD   4  
ATOM 5567  C CE   . LYS A 1 17  ? 14.653  -1.235  9.909   1.00 0.00 ? 17  LYS A CE   4  
ATOM 5568  N NZ   . LYS A 1 17  ? 14.759  -1.082  11.386  1.00 0.00 ? 17  LYS A NZ   4  
ATOM 5569  H H    . LYS A 1 17  ? 12.319  -1.369  4.988   1.00 0.00 ? 17  LYS A H    4  
ATOM 5570  H HA   . LYS A 1 17  ? 12.855  -3.942  6.088   1.00 0.00 ? 17  LYS A HA   4  
ATOM 5571  H HB2  . LYS A 1 17  ? 14.284  -1.838  6.321   1.00 0.00 ? 17  LYS A HB2  4  
ATOM 5572  H HB3  . LYS A 1 17  ? 13.129  -1.310  7.537   1.00 0.00 ? 17  LYS A HB3  4  
ATOM 5573  H HG2  . LYS A 1 17  ? 14.082  -4.013  8.006   1.00 0.00 ? 17  LYS A HG2  4  
ATOM 5574  H HG3  . LYS A 1 17  ? 15.382  -2.821  7.979   1.00 0.00 ? 17  LYS A HG3  4  
ATOM 5575  H HD2  . LYS A 1 17  ? 12.876  -2.359  9.562   1.00 0.00 ? 17  LYS A HD2  4  
ATOM 5576  H HD3  . LYS A 1 17  ? 14.216  -3.298  10.221  1.00 0.00 ? 17  LYS A HD3  4  
ATOM 5577  H HE2  . LYS A 1 17  ? 15.645  -1.244  9.485   1.00 0.00 ? 17  LYS A HE2  4  
ATOM 5578  H HE3  . LYS A 1 17  ? 14.098  -0.400  9.508   1.00 0.00 ? 17  LYS A HE3  4  
ATOM 5579  H HZ1  . LYS A 1 17  ? 15.323  -1.858  11.787  1.00 0.00 ? 17  LYS A HZ1  4  
ATOM 5580  H HZ2  . LYS A 1 17  ? 13.812  -1.096  11.817  1.00 0.00 ? 17  LYS A HZ2  4  
ATOM 5581  H HZ3  . LYS A 1 17  ? 15.219  -0.177  11.621  1.00 0.00 ? 17  LYS A HZ3  4  
ATOM 5582  N N    . THR A 1 18  ? 10.757  -2.041  7.797   1.00 0.00 ? 18  THR A N    4  
ATOM 5583  C CA   . THR A 1 18  ? 9.633   -2.096  8.726   1.00 0.00 ? 18  THR A CA   4  
ATOM 5584  C C    . THR A 1 18  ? 8.321   -1.589  8.140   1.00 0.00 ? 18  THR A C    4  
ATOM 5585  O O    . THR A 1 18  ? 7.274   -1.718  8.774   1.00 0.00 ? 18  THR A O    4  
ATOM 5586  C CB   . THR A 1 18  ? 9.938   -1.338  10.031  1.00 0.00 ? 18  THR A CB   4  
ATOM 5587  O OG1  . THR A 1 18  ? 8.826   -1.436  10.928  1.00 0.00 ? 18  THR A OG1  4  
ATOM 5588  C CG2  . THR A 1 18  ? 10.241  0.126   9.748   1.00 0.00 ? 18  THR A CG2  4  
ATOM 5589  H H    . THR A 1 18  ? 11.173  -1.188  7.555   1.00 0.00 ? 18  THR A H    4  
ATOM 5590  H HA   . THR A 1 18  ? 9.496   -3.127  8.963   1.00 0.00 ? 18  THR A HA   4  
ATOM 5591  H HB   . THR A 1 18  ? 10.805  -1.786  10.495  1.00 0.00 ? 18  THR A HB   4  
ATOM 5592  H HG1  . THR A 1 18  ? 8.813   -2.309  11.327  1.00 0.00 ? 18  THR A HG1  4  
ATOM 5593  H HG21 . THR A 1 18  ? 10.217  0.683   10.674  1.00 0.00 ? 18  THR A HG21 4  
ATOM 5594  H HG22 . THR A 1 18  ? 9.501   0.522   9.069   1.00 0.00 ? 18  THR A HG22 4  
ATOM 5595  H HG23 . THR A 1 18  ? 11.222  0.210   9.303   1.00 0.00 ? 18  THR A HG23 4  
ATOM 5596  N N    . THR A 1 19  ? 8.385   -1.004  6.952   1.00 0.00 ? 19  THR A N    4  
ATOM 5597  C CA   . THR A 1 19  ? 7.196   -0.462  6.283   1.00 0.00 ? 19  THR A CA   4  
ATOM 5598  C C    . THR A 1 19  ? 6.861   0.934   6.810   1.00 0.00 ? 19  THR A C    4  
ATOM 5599  O O    . THR A 1 19  ? 7.691   1.839   6.732   1.00 0.00 ? 19  THR A O    4  
ATOM 5600  C CB   . THR A 1 19  ? 5.969   -1.395  6.426   1.00 0.00 ? 19  THR A CB   4  
ATOM 5601  O OG1  . THR A 1 19  ? 6.387   -2.765  6.390   1.00 0.00 ? 19  THR A OG1  4  
ATOM 5602  C CG2  . THR A 1 19  ? 4.959   -1.144  5.316   1.00 0.00 ? 19  THR A CG2  4  
ATOM 5603  H H    . THR A 1 19  ? 9.257   -0.911  6.523   1.00 0.00 ? 19  THR A H    4  
ATOM 5604  H HA   . THR A 1 19  ? 7.428   -0.380  5.232   1.00 0.00 ? 19  THR A HA   4  
ATOM 5605  H HB   . THR A 1 19  ? 5.494   -1.197  7.376   1.00 0.00 ? 19  THR A HB   4  
ATOM 5606  H HG1  . THR A 1 19  ? 5.922   -3.223  5.686   1.00 0.00 ? 19  THR A HG1  4  
ATOM 5607  H HG21 . THR A 1 19  ? 4.752   -0.085  5.248   1.00 0.00 ? 19  THR A HG21 4  
ATOM 5608  H HG22 . THR A 1 19  ? 4.045   -1.676  5.532   1.00 0.00 ? 19  THR A HG22 4  
ATOM 5609  H HG23 . THR A 1 19  ? 5.364   -1.492  4.375   1.00 0.00 ? 19  THR A HG23 4  
ATOM 5610  N N    . GLU A 1 20  ? 5.648   1.112   7.338   1.00 0.00 ? 20  GLU A N    4  
ATOM 5611  C CA   . GLU A 1 20  ? 5.219   2.407   7.863   1.00 0.00 ? 20  GLU A CA   4  
ATOM 5612  C C    . GLU A 1 20  ? 5.185   3.452   6.751   1.00 0.00 ? 20  GLU A C    4  
ATOM 5613  O O    . GLU A 1 20  ? 6.226   3.864   6.238   1.00 0.00 ? 20  GLU A O    4  
ATOM 5614  C CB   . GLU A 1 20  ? 6.146   2.870   8.990   1.00 0.00 ? 20  GLU A CB   4  
ATOM 5615  C CG   . GLU A 1 20  ? 5.685   2.436   10.371  1.00 0.00 ? 20  GLU A CG   4  
ATOM 5616  C CD   . GLU A 1 20  ? 6.504   3.064   11.482  1.00 0.00 ? 20  GLU A CD   4  
ATOM 5617  O OE1  . GLU A 1 20  ? 7.718   3.280   11.278  1.00 0.00 ? 20  GLU A OE1  4  
ATOM 5618  O OE2  . GLU A 1 20  ? 5.934   3.342   12.558  1.00 0.00 ? 20  GLU A OE2  4  
ATOM 5619  H H    . GLU A 1 20  ? 5.024   0.357   7.372   1.00 0.00 ? 20  GLU A H    4  
ATOM 5620  H HA   . GLU A 1 20  ? 4.219   2.288   8.257   1.00 0.00 ? 20  GLU A HA   4  
ATOM 5621  H HB2  . GLU A 1 20  ? 7.131   2.465   8.819   1.00 0.00 ? 20  GLU A HB2  4  
ATOM 5622  H HB3  . GLU A 1 20  ? 6.201   3.948   8.974   1.00 0.00 ? 20  GLU A HB3  4  
ATOM 5623  H HG2  . GLU A 1 20  ? 4.653   2.725   10.502  1.00 0.00 ? 20  GLU A HG2  4  
ATOM 5624  H HG3  . GLU A 1 20  ? 5.769   1.362   10.446  1.00 0.00 ? 20  GLU A HG3  4  
ATOM 5625  N N    . ILE A 1 21  ? 3.981   3.868   6.375   1.00 0.00 ? 21  ILE A N    4  
ATOM 5626  C CA   . ILE A 1 21  ? 3.811   4.854   5.313   1.00 0.00 ? 21  ILE A CA   4  
ATOM 5627  C C    . ILE A 1 21  ? 4.423   6.198   5.687   1.00 0.00 ? 21  ILE A C    4  
ATOM 5628  O O    . ILE A 1 21  ? 3.885   6.931   6.519   1.00 0.00 ? 21  ILE A O    4  
ATOM 5629  C CB   . ILE A 1 21  ? 2.326   5.070   4.955   1.00 0.00 ? 21  ILE A CB   4  
ATOM 5630  C CG1  . ILE A 1 21  ? 1.483   3.855   5.347   1.00 0.00 ? 21  ILE A CG1  4  
ATOM 5631  C CG2  . ILE A 1 21  ? 2.188   5.353   3.469   1.00 0.00 ? 21  ILE A CG2  4  
ATOM 5632  C CD1  . ILE A 1 21  ? 0.263   4.208   6.168   1.00 0.00 ? 21  ILE A CD1  4  
ATOM 5633  H H    . ILE A 1 21  ? 3.190   3.497   6.815   1.00 0.00 ? 21  ILE A H    4  
ATOM 5634  H HA   . ILE A 1 21  ? 4.314   4.479   4.435   1.00 0.00 ? 21  ILE A HA   4  
ATOM 5635  H HB   . ILE A 1 21  ? 1.973   5.937   5.497   1.00 0.00 ? 21  ILE A HB   4  
ATOM 5636  H HG12 . ILE A 1 21  ? 1.145   3.356   4.451   1.00 0.00 ? 21  ILE A HG12 4  
ATOM 5637  H HG13 . ILE A 1 21  ? 2.089   3.176   5.927   1.00 0.00 ? 21  ILE A HG13 4  
ATOM 5638  H HG21 . ILE A 1 21  ? 2.114   4.420   2.931   1.00 0.00 ? 21  ILE A HG21 4  
ATOM 5639  H HG22 . ILE A 1 21  ? 3.054   5.900   3.124   1.00 0.00 ? 21  ILE A HG22 4  
ATOM 5640  H HG23 . ILE A 1 21  ? 1.298   5.940   3.294   1.00 0.00 ? 21  ILE A HG23 4  
ATOM 5641  H HD11 . ILE A 1 21  ? 0.242   5.273   6.342   1.00 0.00 ? 21  ILE A HD11 4  
ATOM 5642  H HD12 . ILE A 1 21  ? 0.303   3.690   7.116   1.00 0.00 ? 21  ILE A HD12 4  
ATOM 5643  H HD13 . ILE A 1 21  ? -0.629  3.912   5.634   1.00 0.00 ? 21  ILE A HD13 4  
ATOM 5644  N N    . LEU A 1 22  ? 5.546   6.519   5.054   1.00 0.00 ? 22  LEU A N    4  
ATOM 5645  C CA   . LEU A 1 22  ? 6.235   7.779   5.301   1.00 0.00 ? 22  LEU A CA   4  
ATOM 5646  C C    . LEU A 1 22  ? 5.346   8.958   4.919   1.00 0.00 ? 22  LEU A C    4  
ATOM 5647  O O    . LEU A 1 22  ? 5.380   10.007  5.565   1.00 0.00 ? 22  LEU A O    4  
ATOM 5648  C CB   . LEU A 1 22  ? 7.545   7.841   4.510   1.00 0.00 ? 22  LEU A CB   4  
ATOM 5649  C CG   . LEU A 1 22  ? 8.255   6.499   4.313   1.00 0.00 ? 22  LEU A CG   4  
ATOM 5650  C CD1  . LEU A 1 22  ? 9.499   6.676   3.457   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 5651  C CD2  . LEU A 1 22  ? 8.614   5.885   5.657   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 5652  H H    . LEU A 1 22  ? 5.915   5.889   4.400   1.00 0.00 ? 22  LEU A H    4  
ATOM 5653  H HA   . LEU A 1 22  ? 6.457   7.836   6.356   1.00 0.00 ? 22  LEU A HA   4  
ATOM 5654  H HB2  . LEU A 1 22  ? 7.332   8.257   3.536   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5655  H HB3  . LEU A 1 22  ? 8.220   8.506   5.027   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 5656  H HG   . LEU A 1 22  ? 7.590   5.820   3.799   1.00 0.00 ? 22  LEU A HG   4  
ATOM 5657  H HD11 . LEU A 1 22  ? 9.221   6.656   2.413   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 5658  H HD12 . LEU A 1 22  ? 10.192  5.873   3.662   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 5659  H HD13 . LEU A 1 22  ? 9.963   7.622   3.688   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 5660  H HD21 . LEU A 1 22  ? 7.810   6.060   6.358   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 5661  H HD22 . LEU A 1 22  ? 9.521   6.335   6.030   1.00 0.00 ? 22  LEU A HD22 4  
ATOM 5662  H HD23 . LEU A 1 22  ? 8.761   4.821   5.539   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 5663  N N    . VAL A 1 23  ? 4.546   8.777   3.867   1.00 0.00 ? 23  VAL A N    4  
ATOM 5664  C CA   . VAL A 1 23  ? 3.642   9.826   3.398   1.00 0.00 ? 23  VAL A CA   4  
ATOM 5665  C C    . VAL A 1 23  ? 2.802   9.353   2.211   1.00 0.00 ? 23  VAL A C    4  
ATOM 5666  O O    . VAL A 1 23  ? 3.168   8.404   1.515   1.00 0.00 ? 23  VAL A O    4  
ATOM 5667  C CB   . VAL A 1 23  ? 4.422   11.105  3.005   1.00 0.00 ? 23  VAL A CB   4  
ATOM 5668  C CG1  . VAL A 1 23  ? 4.558   11.238  1.493   1.00 0.00 ? 23  VAL A CG1  4  
ATOM 5669  C CG2  . VAL A 1 23  ? 3.754   12.335  3.596   1.00 0.00 ? 23  VAL A CG2  4  
ATOM 5670  H H    . VAL A 1 23  ? 4.561   7.916   3.397   1.00 0.00 ? 23  VAL A H    4  
ATOM 5671  H HA   . VAL A 1 23  ? 2.979   10.076  4.214   1.00 0.00 ? 23  VAL A HA   4  
ATOM 5672  H HB   . VAL A 1 23  ? 5.417   11.033  3.422   1.00 0.00 ? 23  VAL A HB   4  
ATOM 5673  H HG11 . VAL A 1 23  ? 3.601   11.512  1.068   1.00 0.00 ? 23  VAL A HG11 4  
ATOM 5674  H HG12 . VAL A 1 23  ? 4.879   10.296  1.075   1.00 0.00 ? 23  VAL A HG12 4  
ATOM 5675  H HG13 . VAL A 1 23  ? 5.286   12.002  1.261   1.00 0.00 ? 23  VAL A HG13 4  
ATOM 5676  H HG21 . VAL A 1 23  ? 3.319   12.086  4.551   1.00 0.00 ? 23  VAL A HG21 4  
ATOM 5677  H HG22 . VAL A 1 23  ? 2.979   12.681  2.926   1.00 0.00 ? 23  VAL A HG22 4  
ATOM 5678  H HG23 . VAL A 1 23  ? 4.489   13.116  3.728   1.00 0.00 ? 23  VAL A HG23 4  
ATOM 5679  N N    . ALA A 1 24  ? 1.683   10.035  1.980   1.00 0.00 ? 24  ALA A N    4  
ATOM 5680  C CA   . ALA A 1 24  ? 0.792   9.708   0.871   1.00 0.00 ? 24  ALA A CA   4  
ATOM 5681  C C    . ALA A 1 24  ? 0.308   10.984  0.191   1.00 0.00 ? 24  ALA A C    4  
ATOM 5682  O O    . ALA A 1 24  ? 0.398   12.069  0.763   1.00 0.00 ? 24  ALA A O    4  
ATOM 5683  C CB   . ALA A 1 24  ? -0.388  8.878   1.350   1.00 0.00 ? 24  ALA A CB   4  
ATOM 5684  H H    . ALA A 1 24  ? 1.456   10.788  2.564   1.00 0.00 ? 24  ALA A H    4  
ATOM 5685  H HA   . ALA A 1 24  ? 1.352   9.121   0.156   1.00 0.00 ? 24  ALA A HA   4  
ATOM 5686  H HB1  . ALA A 1 24  ? -0.419  8.884   2.430   1.00 0.00 ? 24  ALA A HB1  4  
ATOM 5687  H HB2  . ALA A 1 24  ? -0.284  7.863   0.997   1.00 0.00 ? 24  ALA A HB2  4  
ATOM 5688  H HB3  . ALA A 1 24  ? -1.305  9.299   0.963   1.00 0.00 ? 24  ALA A HB3  4  
ATOM 5689  N N    . ASN A 1 25  ? -0.168  10.861  -1.040  1.00 0.00 ? 25  ASN A N    4  
ATOM 5690  C CA   . ASN A 1 25  ? -0.621  12.027  -1.792  1.00 0.00 ? 25  ASN A CA   4  
ATOM 5691  C C    . ASN A 1 25  ? -2.140  12.204  -1.770  1.00 0.00 ? 25  ASN A C    4  
ATOM 5692  O O    . ASN A 1 25  ? -2.876  11.391  -1.210  1.00 0.00 ? 25  ASN A O    4  
ATOM 5693  C CB   . ASN A 1 25  ? -0.127  11.941  -3.237  1.00 0.00 ? 25  ASN A CB   4  
ATOM 5694  C CG   . ASN A 1 25  ? -0.634  10.706  -3.957  1.00 0.00 ? 25  ASN A CG   4  
ATOM 5695  O OD1  . ASN A 1 25  ? -0.744  9.626   -3.372  1.00 0.00 ? 25  ASN A OD1  4  
ATOM 5696  N ND2  . ASN A 1 25  ? -0.943  10.857  -5.238  1.00 0.00 ? 25  ASN A ND2  4  
ATOM 5697  H H    . ASN A 1 25  ? -0.186  9.978   -1.463  1.00 0.00 ? 25  ASN A H    4  
ATOM 5698  H HA   . ASN A 1 25  ? -0.176  12.896  -1.329  1.00 0.00 ? 25  ASN A HA   4  
ATOM 5699  H HB2  . ASN A 1 25  ? -0.463  12.813  -3.779  1.00 0.00 ? 25  ASN A HB2  4  
ATOM 5700  H HB3  . ASN A 1 25  ? 0.954   11.917  -3.241  1.00 0.00 ? 25  ASN A HB3  4  
ATOM 5701  H HD21 . ASN A 1 25  ? -0.825  11.743  -5.638  1.00 0.00 ? 25  ASN A HD21 4  
ATOM 5702  H HD22 . ASN A 1 25  ? -1.285  10.080  -5.729  1.00 0.00 ? 25  ASN A HD22 4  
ATOM 5703  N N    . ASP A 1 26  ? -2.580  13.300  -2.391  1.00 0.00 ? 26  ASP A N    4  
ATOM 5704  C CA   . ASP A 1 26  ? -3.998  13.656  -2.471  1.00 0.00 ? 26  ASP A CA   4  
ATOM 5705  C C    . ASP A 1 26  ? -4.766  12.718  -3.392  1.00 0.00 ? 26  ASP A C    4  
ATOM 5706  O O    . ASP A 1 26  ? -5.991  12.793  -3.482  1.00 0.00 ? 26  ASP A O    4  
ATOM 5707  C CB   . ASP A 1 26  ? -4.157  15.103  -2.945  1.00 0.00 ? 26  ASP A CB   4  
ATOM 5708  C CG   . ASP A 1 26  ? -3.668  15.303  -4.367  1.00 0.00 ? 26  ASP A CG   4  
ATOM 5709  O OD1  . ASP A 1 26  ? -2.437  15.293  -4.579  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 5710  O OD2  . ASP A 1 26  ? -4.516  15.471  -5.268  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 5711  H H    . ASP A 1 26  ? -1.916  13.892  -2.801  1.00 0.00 ? 26  ASP A H    4  
ATOM 5712  H HA   . ASP A 1 26  ? -4.415  13.566  -1.480  1.00 0.00 ? 26  ASP A HA   4  
ATOM 5713  H HB2  . ASP A 1 26  ? -5.201  15.378  -2.902  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 5714  H HB3  . ASP A 1 26  ? -3.591  15.753  -2.294  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 5715  N N    . LYS A 1 27  ? -4.051  11.818  -4.051  1.00 0.00 ? 27  LYS A N    4  
ATOM 5716  C CA   . LYS A 1 27  ? -4.682  10.848  -4.930  1.00 0.00 ? 27  LYS A CA   4  
ATOM 5717  C C    . LYS A 1 27  ? -4.955  9.579   -4.137  1.00 0.00 ? 27  LYS A C    4  
ATOM 5718  O O    . LYS A 1 27  ? -6.106  9.247   -3.856  1.00 0.00 ? 27  LYS A O    4  
ATOM 5719  C CB   . LYS A 1 27  ? -3.788  10.561  -6.132  1.00 0.00 ? 27  LYS A CB   4  
ATOM 5720  C CG   . LYS A 1 27  ? -3.728  11.711  -7.121  1.00 0.00 ? 27  LYS A CG   4  
ATOM 5721  C CD   . LYS A 1 27  ? -2.420  11.718  -7.890  1.00 0.00 ? 27  LYS A CD   4  
ATOM 5722  C CE   . LYS A 1 27  ? -1.576  12.932  -7.538  1.00 0.00 ? 27  LYS A CE   4  
ATOM 5723  N NZ   . LYS A 1 27  ? -2.232  14.203  -7.952  1.00 0.00 ? 27  LYS A NZ   4  
ATOM 5724  H H    . LYS A 1 27  ? -3.084  11.772  -3.909  1.00 0.00 ? 27  LYS A H    4  
ATOM 5725  H HA   . LYS A 1 27  ? -5.621  11.263  -5.268  1.00 0.00 ? 27  LYS A HA   4  
ATOM 5726  H HB2  . LYS A 1 27  ? -2.787  10.363  -5.782  1.00 0.00 ? 27  LYS A HB2  4  
ATOM 5727  H HB3  . LYS A 1 27  ? -4.159  9.689   -6.647  1.00 0.00 ? 27  LYS A HB3  4  
ATOM 5728  H HG2  . LYS A 1 27  ? -4.544  11.614  -7.820  1.00 0.00 ? 27  LYS A HG2  4  
ATOM 5729  H HG3  . LYS A 1 27  ? -3.822  12.640  -6.580  1.00 0.00 ? 27  LYS A HG3  4  
ATOM 5730  H HD2  . LYS A 1 27  ? -1.866  10.824  -7.647  1.00 0.00 ? 27  LYS A HD2  4  
ATOM 5731  H HD3  . LYS A 1 27  ? -2.637  11.735  -8.948  1.00 0.00 ? 27  LYS A HD3  4  
ATOM 5732  H HE2  . LYS A 1 27  ? -1.422  12.948  -6.468  1.00 0.00 ? 27  LYS A HE2  4  
ATOM 5733  H HE3  . LYS A 1 27  ? -0.622  12.850  -8.038  1.00 0.00 ? 27  LYS A HE3  4  
ATOM 5734  H HZ1  . LYS A 1 27  ? -2.456  14.778  -7.114  1.00 0.00 ? 27  LYS A HZ1  4  
ATOM 5735  H HZ2  . LYS A 1 27  ? -3.114  14.000  -8.464  1.00 0.00 ? 27  LYS A HZ2  4  
ATOM 5736  H HZ3  . LYS A 1 27  ? -1.601  14.747  -8.573  1.00 0.00 ? 27  LYS A HZ3  4  
ATOM 5737  N N    . ALA A 1 28  ? -3.880  8.898   -3.752  1.00 0.00 ? 28  ALA A N    4  
ATOM 5738  C CA   . ALA A 1 28  ? -3.981  7.685   -2.944  1.00 0.00 ? 28  ALA A CA   4  
ATOM 5739  C C    . ALA A 1 28  ? -4.961  7.883   -1.794  1.00 0.00 ? 28  ALA A C    4  
ATOM 5740  O O    . ALA A 1 28  ? -5.835  7.049   -1.546  1.00 0.00 ? 28  ALA A O    4  
ATOM 5741  C CB   . ALA A 1 28  ? -2.616  7.317   -2.393  1.00 0.00 ? 28  ALA A CB   4  
ATOM 5742  H H    . ALA A 1 28  ? -2.990  9.235   -4.002  1.00 0.00 ? 28  ALA A H    4  
ATOM 5743  H HA   . ALA A 1 28  ? -4.326  6.880   -3.577  1.00 0.00 ? 28  ALA A HA   4  
ATOM 5744  H HB1  . ALA A 1 28  ? -2.491  7.767   -1.419  1.00 0.00 ? 28  ALA A HB1  4  
ATOM 5745  H HB2  . ALA A 1 28  ? -1.849  7.680   -3.060  1.00 0.00 ? 28  ALA A HB2  4  
ATOM 5746  H HB3  . ALA A 1 28  ? -2.540  6.243   -2.305  1.00 0.00 ? 28  ALA A HB3  4  
ATOM 5747  N N    . CYS A 1 29  ? -4.806  9.003   -1.095  1.00 0.00 ? 29  CYS A N    4  
ATOM 5748  C CA   . CYS A 1 29  ? -5.671  9.329   0.027   1.00 0.00 ? 29  CYS A CA   4  
ATOM 5749  C C    . CYS A 1 29  ? -7.125  9.339   -0.420  1.00 0.00 ? 29  CYS A C    4  
ATOM 5750  O O    . CYS A 1 29  ? -8.001  8.830   0.277   1.00 0.00 ? 29  CYS A O    4  
ATOM 5751  C CB   . CYS A 1 29  ? -5.275  10.686  0.613   1.00 0.00 ? 29  CYS A CB   4  
ATOM 5752  S SG   . CYS A 1 29  ? -6.312  12.069  0.081   1.00 0.00 ? 29  CYS A SG   4  
ATOM 5753  H H    . CYS A 1 29  ? -4.092  9.624   -1.346  1.00 0.00 ? 29  CYS A H    4  
ATOM 5754  H HA   . CYS A 1 29  ? -5.547  8.565   0.780   1.00 0.00 ? 29  CYS A HA   4  
ATOM 5755  H HB2  . CYS A 1 29  ? -5.327  10.632  1.690   1.00 0.00 ? 29  CYS A HB2  4  
ATOM 5756  H HB3  . CYS A 1 29  ? -4.258  10.906  0.321   1.00 0.00 ? 29  CYS A HB3  4  
ATOM 5757  H HG   . CYS A 1 29  ? -6.475  11.977  -1.230  1.00 0.00 ? 29  CYS A HG   4  
ATOM 5758  N N    . GLY A 1 30  ? -7.368  9.905   -1.598  1.00 0.00 ? 30  GLY A N    4  
ATOM 5759  C CA   . GLY A 1 30  ? -8.718  9.942   -2.129  1.00 0.00 ? 30  GLY A CA   4  
ATOM 5760  C C    . GLY A 1 30  ? -9.286  8.545   -2.281  1.00 0.00 ? 30  GLY A C    4  
ATOM 5761  O O    . GLY A 1 30  ? -10.460 8.305   -1.996  1.00 0.00 ? 30  GLY A O    4  
ATOM 5762  H H    . GLY A 1 30  ? -6.622  10.283  -2.116  1.00 0.00 ? 30  GLY A H    4  
ATOM 5763  H HA2  . GLY A 1 30  ? -9.346  10.511  -1.459  1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5764  H HA3  . GLY A 1 30  ? -8.706  10.424  -3.097  1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5765  N N    . LEU A 1 31  ? -8.431  7.624   -2.722  1.00 0.00 ? 31  LEU A N    4  
ATOM 5766  C CA   . LEU A 1 31  ? -8.816  6.228   -2.908  1.00 0.00 ? 31  LEU A CA   4  
ATOM 5767  C C    . LEU A 1 31  ? -9.559  5.719   -1.671  1.00 0.00 ? 31  LEU A C    4  
ATOM 5768  O O    . LEU A 1 31  ? -10.703 5.271   -1.771  1.00 0.00 ? 31  LEU A O    4  
ATOM 5769  C CB   . LEU A 1 31  ? -7.560  5.386   -3.204  1.00 0.00 ? 31  LEU A CB   4  
ATOM 5770  C CG   . LEU A 1 31  ? -7.719  3.858   -3.219  1.00 0.00 ? 31  LEU A CG   4  
ATOM 5771  C CD1  . LEU A 1 31  ? -7.349  3.280   -1.864  1.00 0.00 ? 31  LEU A CD1  4  
ATOM 5772  C CD2  . LEU A 1 31  ? -9.127  3.436   -3.629  1.00 0.00 ? 31  LEU A CD2  4  
ATOM 5773  H H    . LEU A 1 31  ? -7.513  7.897   -2.924  1.00 0.00 ? 31  LEU A H    4  
ATOM 5774  H HA   . LEU A 1 31  ? -9.481  6.179   -3.758  1.00 0.00 ? 31  LEU A HA   4  
ATOM 5775  H HB2  . LEU A 1 31  ? -7.183  5.686   -4.170  1.00 0.00 ? 31  LEU A HB2  4  
ATOM 5776  H HB3  . LEU A 1 31  ? -6.816  5.634   -2.462  1.00 0.00 ? 31  LEU A HB3  4  
ATOM 5777  H HG   . LEU A 1 31  ? -7.028  3.448   -3.944  1.00 0.00 ? 31  LEU A HG   4  
ATOM 5778  H HD11 . LEU A 1 31  ? -6.538  2.575   -1.983  1.00 0.00 ? 31  LEU A HD11 4  
ATOM 5779  H HD12 . LEU A 1 31  ? -8.204  2.777   -1.436  1.00 0.00 ? 31  LEU A HD12 4  
ATOM 5780  H HD13 . LEU A 1 31  ? -7.033  4.079   -1.207  1.00 0.00 ? 31  LEU A HD13 4  
ATOM 5781  H HD21 . LEU A 1 31  ? -9.800  3.571   -2.797  1.00 0.00 ? 31  LEU A HD21 4  
ATOM 5782  H HD22 . LEU A 1 31  ? -9.120  2.397   -3.922  1.00 0.00 ? 31  LEU A HD22 4  
ATOM 5783  H HD23 . LEU A 1 31  ? -9.455  4.042   -4.461  1.00 0.00 ? 31  LEU A HD23 4  
ATOM 5784  N N    . LEU A 1 32  ? -8.922  5.810   -0.505  1.00 0.00 ? 32  LEU A N    4  
ATOM 5785  C CA   . LEU A 1 32  ? -9.575  5.369   0.729   1.00 0.00 ? 32  LEU A CA   4  
ATOM 5786  C C    . LEU A 1 32  ? -10.295 6.531   1.409   1.00 0.00 ? 32  LEU A C    4  
ATOM 5787  O O    . LEU A 1 32  ? -11.525 6.584   1.429   1.00 0.00 ? 32  LEU A O    4  
ATOM 5788  C CB   . LEU A 1 32  ? -8.603  4.717   1.721   1.00 0.00 ? 32  LEU A CB   4  
ATOM 5789  C CG   . LEU A 1 32  ? -7.113  4.779   1.383   1.00 0.00 ? 32  LEU A CG   4  
ATOM 5790  C CD1  . LEU A 1 32  ? -6.600  6.211   1.440   1.00 0.00 ? 32  LEU A CD1  4  
ATOM 5791  C CD2  . LEU A 1 32  ? -6.341  3.897   2.353   1.00 0.00 ? 32  LEU A CD2  4  
ATOM 5792  H H    . LEU A 1 32  ? -8.014  6.192   -0.490  1.00 0.00 ? 32  LEU A H    4  
ATOM 5793  H HA   . LEU A 1 32  ? -10.318 4.637   0.449   1.00 0.00 ? 32  LEU A HA   4  
ATOM 5794  H HB2  . LEU A 1 32  ? -8.744  5.189   2.682   1.00 0.00 ? 32  LEU A HB2  4  
ATOM 5795  H HB3  . LEU A 1 32  ? -8.878  3.675   1.816   1.00 0.00 ? 32  LEU A HB3  4  
ATOM 5796  H HG   . LEU A 1 32  ? -6.953  4.402   0.385   1.00 0.00 ? 32  LEU A HG   4  
ATOM 5797  H HD11 . LEU A 1 32  ? -7.339  6.875   1.018   1.00 0.00 ? 32  LEU A HD11 4  
ATOM 5798  H HD12 . LEU A 1 32  ? -5.682  6.288   0.876   1.00 0.00 ? 32  LEU A HD12 4  
ATOM 5799  H HD13 . LEU A 1 32  ? -6.414  6.486   2.468   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 5800  H HD21 . LEU A 1 32  ? -5.494  4.442   2.742   1.00 0.00 ? 32  LEU A HD21 4  
ATOM 5801  H HD22 . LEU A 1 32  ? -5.997  3.011   1.842   1.00 0.00 ? 32  LEU A HD22 4  
ATOM 5802  H HD23 . LEU A 1 32  ? -6.993  3.611   3.172   1.00 0.00 ? 32  LEU A HD23 4  
ATOM 5803  N N    . GLY A 1 33  ? -9.523  7.455   1.967   1.00 0.00 ? 33  GLY A N    4  
ATOM 5804  C CA   . GLY A 1 33  ? -10.100 8.602   2.645   1.00 0.00 ? 33  GLY A CA   4  
ATOM 5805  C C    . GLY A 1 33  ? -9.156  9.188   3.674   1.00 0.00 ? 33  GLY A C    4  
ATOM 5806  O O    . GLY A 1 33  ? -9.583  9.857   4.614   1.00 0.00 ? 33  GLY A O    4  
ATOM 5807  H H    . GLY A 1 33  ? -8.548  7.358   1.921   1.00 0.00 ? 33  GLY A H    4  
ATOM 5808  H HA2  . GLY A 1 33  ? -10.337 9.360   1.911   1.00 0.00 ? 33  GLY A HA2  4  
ATOM 5809  H HA3  . GLY A 1 33  ? -11.010 8.296   3.138   1.00 0.00 ? 33  GLY A HA3  4  
ATOM 5810  N N    . TYR A 1 34  ? -7.866  8.929   3.489   1.00 0.00 ? 34  TYR A N    4  
ATOM 5811  C CA   . TYR A 1 34  ? -6.840  9.425   4.399   1.00 0.00 ? 34  TYR A CA   4  
ATOM 5812  C C    . TYR A 1 34  ? -6.107  10.615  3.784   1.00 0.00 ? 34  TYR A C    4  
ATOM 5813  O O    . TYR A 1 34  ? -6.702  11.407  3.053   1.00 0.00 ? 34  TYR A O    4  
ATOM 5814  C CB   . TYR A 1 34  ? -5.839  8.308   4.713   1.00 0.00 ? 34  TYR A CB   4  
ATOM 5815  C CG   . TYR A 1 34  ? -6.367  7.232   5.632   1.00 0.00 ? 34  TYR A CG   4  
ATOM 5816  C CD1  . TYR A 1 34  ? -7.435  6.429   5.257   1.00 0.00 ? 34  TYR A CD1  4  
ATOM 5817  C CD2  . TYR A 1 34  ? -5.795  7.022   6.881   1.00 0.00 ? 34  TYR A CD2  4  
ATOM 5818  C CE1  . TYR A 1 34  ? -7.915  5.444   6.097   1.00 0.00 ? 34  TYR A CE1  4  
ATOM 5819  C CE2  . TYR A 1 34  ? -6.269  6.038   7.725   1.00 0.00 ? 34  TYR A CE2  4  
ATOM 5820  C CZ   . TYR A 1 34  ? -7.329  5.252   7.329   1.00 0.00 ? 34  TYR A CZ   4  
ATOM 5821  O OH   . TYR A 1 34  ? -7.807  4.273   8.170   1.00 0.00 ? 34  TYR A OH   4  
ATOM 5822  H H    . TYR A 1 34  ? -7.596  8.387   2.718   1.00 0.00 ? 34  TYR A H    4  
ATOM 5823  H HA   . TYR A 1 34  ? -7.321  9.738   5.312   1.00 0.00 ? 34  TYR A HA   4  
ATOM 5824  H HB2  . TYR A 1 34  ? -5.545  7.832   3.790   1.00 0.00 ? 34  TYR A HB2  4  
ATOM 5825  H HB3  . TYR A 1 34  ? -4.965  8.743   5.178   1.00 0.00 ? 34  TYR A HB3  4  
ATOM 5826  H HD1  . TYR A 1 34  ? -7.891  6.580   4.289   1.00 0.00 ? 34  TYR A HD1  4  
ATOM 5827  H HD2  . TYR A 1 34  ? -4.961  7.638   7.187   1.00 0.00 ? 34  TYR A HD2  4  
ATOM 5828  H HE1  . TYR A 1 34  ? -8.746  4.827   5.784   1.00 0.00 ? 34  TYR A HE1  4  
ATOM 5829  H HE2  . TYR A 1 34  ? -5.811  5.890   8.692   1.00 0.00 ? 34  TYR A HE2  4  
ATOM 5830  H HH   . TYR A 1 34  ? -8.555  3.834   7.760   1.00 0.00 ? 34  TYR A HH   4  
ATOM 5831  N N    . SER A 1 35  ? -4.808  10.714  4.073   1.00 0.00 ? 35  SER A N    4  
ATOM 5832  C CA   . SER A 1 35  ? -3.962  11.782  3.543   1.00 0.00 ? 35  SER A CA   4  
ATOM 5833  C C    . SER A 1 35  ? -2.571  11.707  4.156   1.00 0.00 ? 35  SER A C    4  
ATOM 5834  O O    . SER A 1 35  ? -2.355  11.001  5.138   1.00 0.00 ? 35  SER A O    4  
ATOM 5835  C CB   . SER A 1 35  ? -4.565  13.159  3.794   1.00 0.00 ? 35  SER A CB   4  
ATOM 5836  O OG   . SER A 1 35  ? -4.720  13.413  5.178   1.00 0.00 ? 35  SER A OG   4  
ATOM 5837  H H    . SER A 1 35  ? -4.400  10.038  4.651   1.00 0.00 ? 35  SER A H    4  
ATOM 5838  H HA   . SER A 1 35  ? -3.881  11.632  2.479   1.00 0.00 ? 35  SER A HA   4  
ATOM 5839  H HB2  . SER A 1 35  ? -3.913  13.912  3.368   1.00 0.00 ? 35  SER A HB2  4  
ATOM 5840  H HB3  . SER A 1 35  ? -5.530  13.209  3.317   1.00 0.00 ? 35  SER A HB3  4  
ATOM 5841  H HG   . SER A 1 35  ? -4.051  12.928  5.669   1.00 0.00 ? 35  SER A HG   4  
ATOM 5842  N N    . SER A 1 36  ? -1.631  12.435  3.566   1.00 0.00 ? 36  SER A N    4  
ATOM 5843  C CA   . SER A 1 36  ? -0.253  12.448  4.046   1.00 0.00 ? 36  SER A CA   4  
ATOM 5844  C C    . SER A 1 36  ? -0.179  12.662  5.556   1.00 0.00 ? 36  SER A C    4  
ATOM 5845  O O    . SER A 1 36  ? 0.717   12.142  6.216   1.00 0.00 ? 36  SER A O    4  
ATOM 5846  C CB   . SER A 1 36  ? 0.539   13.547  3.336   1.00 0.00 ? 36  SER A CB   4  
ATOM 5847  O OG   . SER A 1 36  ? -0.294  14.311  2.483   1.00 0.00 ? 36  SER A OG   4  
ATOM 5848  H H    . SER A 1 36  ? -1.869  12.972  2.781   1.00 0.00 ? 36  SER A H    4  
ATOM 5849  H HA   . SER A 1 36  ? 0.189   11.492  3.809   1.00 0.00 ? 36  SER A HA   4  
ATOM 5850  H HB2  . SER A 1 36  ? 0.978   14.206  4.072   1.00 0.00 ? 36  SER A HB2  4  
ATOM 5851  H HB3  . SER A 1 36  ? 1.325   13.097  2.744   1.00 0.00 ? 36  SER A HB3  4  
ATOM 5852  H HG   . SER A 1 36  ? 0.243   14.753  1.821   1.00 0.00 ? 36  SER A HG   4  
ATOM 5853  N N    . GLN A 1 37  ? -1.109  13.443  6.093   1.00 0.00 ? 37  GLN A N    4  
ATOM 5854  C CA   . GLN A 1 37  ? -1.127  13.737  7.524   1.00 0.00 ? 37  GLN A CA   4  
ATOM 5855  C C    . GLN A 1 37  ? -2.143  12.881  8.285   1.00 0.00 ? 37  GLN A C    4  
ATOM 5856  O O    . GLN A 1 37  ? -2.153  12.877  9.515   1.00 0.00 ? 37  GLN A O    4  
ATOM 5857  C CB   . GLN A 1 37  ? -1.432  15.218  7.749   1.00 0.00 ? 37  GLN A CB   4  
ATOM 5858  C CG   . GLN A 1 37  ? -2.832  15.624  7.317   1.00 0.00 ? 37  GLN A CG   4  
ATOM 5859  C CD   . GLN A 1 37  ? -2.873  17.002  6.685   1.00 0.00 ? 37  GLN A CD   4  
ATOM 5860  O OE1  . GLN A 1 37  ? -3.342  17.963  7.294   1.00 0.00 ? 37  GLN A OE1  4  
ATOM 5861  N NE2  . GLN A 1 37  ? -2.379  17.105  5.457   1.00 0.00 ? 37  GLN A NE2  4  
ATOM 5862  H H    . GLN A 1 37  ? -1.790  13.841  5.513   1.00 0.00 ? 37  GLN A H    4  
ATOM 5863  H HA   . GLN A 1 37  ? -0.143  13.526  7.913   1.00 0.00 ? 37  GLN A HA   4  
ATOM 5864  H HB2  . GLN A 1 37  ? -1.322  15.441  8.800   1.00 0.00 ? 37  GLN A HB2  4  
ATOM 5865  H HB3  . GLN A 1 37  ? -0.721  15.808  7.189   1.00 0.00 ? 37  GLN A HB3  4  
ATOM 5866  H HG2  . GLN A 1 37  ? -3.196  14.906  6.597   1.00 0.00 ? 37  GLN A HG2  4  
ATOM 5867  H HG3  . GLN A 1 37  ? -3.476  15.622  8.184   1.00 0.00 ? 37  GLN A HG3  4  
ATOM 5868  H HE21 . GLN A 1 37  ? -2.022  16.298  5.032   1.00 0.00 ? 37  GLN A HE21 4  
ATOM 5869  H HE22 . GLN A 1 37  ? -2.394  17.985  5.024   1.00 0.00 ? 37  GLN A HE22 4  
ATOM 5870  N N    . ASP A 1 38  ? -3.013  12.187  7.557   1.00 0.00 ? 38  ASP A N    4  
ATOM 5871  C CA   . ASP A 1 38  ? -4.042  11.364  8.193   1.00 0.00 ? 38  ASP A CA   4  
ATOM 5872  C C    . ASP A 1 38  ? -3.708  9.874   8.164   1.00 0.00 ? 38  ASP A C    4  
ATOM 5873  O O    . ASP A 1 38  ? -4.425  9.068   8.755   1.00 0.00 ? 38  ASP A O    4  
ATOM 5874  C CB   . ASP A 1 38  ? -5.393  11.594  7.513   1.00 0.00 ? 38  ASP A CB   4  
ATOM 5875  C CG   . ASP A 1 38  ? -6.091  12.843  8.012   1.00 0.00 ? 38  ASP A CG   4  
ATOM 5876  O OD1  . ASP A 1 38  ? -6.066  13.087  9.236   1.00 0.00 ? 38  ASP A OD1  4  
ATOM 5877  O OD2  . ASP A 1 38  ? -6.664  13.578  7.178   1.00 0.00 ? 38  ASP A OD2  4  
ATOM 5878  H H    . ASP A 1 38  ? -2.976  12.241  6.580   1.00 0.00 ? 38  ASP A H    4  
ATOM 5879  H HA   . ASP A 1 38  ? -4.122  11.678  9.223   1.00 0.00 ? 38  ASP A HA   4  
ATOM 5880  H HB2  . ASP A 1 38  ? -5.238  11.692  6.448   1.00 0.00 ? 38  ASP A HB2  4  
ATOM 5881  H HB3  . ASP A 1 38  ? -6.032  10.746  7.702   1.00 0.00 ? 38  ASP A HB3  4  
ATOM 5882  N N    . LEU A 1 39  ? -2.636  9.501   7.474   1.00 0.00 ? 39  LEU A N    4  
ATOM 5883  C CA   . LEU A 1 39  ? -2.256  8.090   7.386   1.00 0.00 ? 39  LEU A CA   4  
ATOM 5884  C C    . LEU A 1 39  ? -0.782  7.873   7.719   1.00 0.00 ? 39  LEU A C    4  
ATOM 5885  O O    . LEU A 1 39  ? -0.346  6.740   7.927   1.00 0.00 ? 39  LEU A O    4  
ATOM 5886  C CB   . LEU A 1 39  ? -2.575  7.543   5.991   1.00 0.00 ? 39  LEU A CB   4  
ATOM 5887  C CG   . LEU A 1 39  ? -1.766  8.150   4.844   1.00 0.00 ? 39  LEU A CG   4  
ATOM 5888  C CD1  . LEU A 1 39  ? -0.563  7.278   4.517   1.00 0.00 ? 39  LEU A CD1  4  
ATOM 5889  C CD2  . LEU A 1 39  ? -2.647  8.328   3.618   1.00 0.00 ? 39  LEU A CD2  4  
ATOM 5890  H H    . LEU A 1 39  ? -2.098  10.176  7.012   1.00 0.00 ? 39  LEU A H    4  
ATOM 5891  H HA   . LEU A 1 39  ? -2.851  7.551   8.110   1.00 0.00 ? 39  LEU A HA   4  
ATOM 5892  H HB2  . LEU A 1 39  ? -2.408  6.477   5.997   1.00 0.00 ? 39  LEU A HB2  4  
ATOM 5893  H HB3  . LEU A 1 39  ? -3.621  7.723   5.791   1.00 0.00 ? 39  LEU A HB3  4  
ATOM 5894  H HG   . LEU A 1 39  ? -1.404  9.125   5.142   1.00 0.00 ? 39  LEU A HG   4  
ATOM 5895  H HD11 . LEU A 1 39  ? -0.900  6.339   4.100   1.00 0.00 ? 39  LEU A HD11 4  
ATOM 5896  H HD12 . LEU A 1 39  ? 0.001   7.089   5.417   1.00 0.00 ? 39  LEU A HD12 4  
ATOM 5897  H HD13 . LEU A 1 39  ? 0.065   7.786   3.800   1.00 0.00 ? 39  LEU A HD13 4  
ATOM 5898  H HD21 . LEU A 1 39  ? -2.749  9.380   3.396   1.00 0.00 ? 39  LEU A HD21 4  
ATOM 5899  H HD22 . LEU A 1 39  ? -3.621  7.904   3.810   1.00 0.00 ? 39  LEU A HD22 4  
ATOM 5900  H HD23 . LEU A 1 39  ? -2.197  7.825   2.775   1.00 0.00 ? 39  LEU A HD23 4  
ATOM 5901  N N    . ILE A 1 40  ? -0.015  8.958   7.774   1.00 0.00 ? 40  ILE A N    4  
ATOM 5902  C CA   . ILE A 1 40  ? 1.409   8.869   8.084   1.00 0.00 ? 40  ILE A CA   4  
ATOM 5903  C C    . ILE A 1 40  ? 1.627   8.333   9.496   1.00 0.00 ? 40  ILE A C    4  
ATOM 5904  O O    . ILE A 1 40  ? 0.885   8.666   10.421  1.00 0.00 ? 40  ILE A O    4  
ATOM 5905  C CB   . ILE A 1 40  ? 2.104   10.239  7.943   1.00 0.00 ? 40  ILE A CB   4  
ATOM 5906  C CG1  . ILE A 1 40  ? 3.631   10.084  8.060   1.00 0.00 ? 40  ILE A CG1  4  
ATOM 5907  C CG2  . ILE A 1 40  ? 1.564   11.226  8.972   1.00 0.00 ? 40  ILE A CG2  4  
ATOM 5908  C CD1  . ILE A 1 40  ? 4.179   10.262  9.463   1.00 0.00 ? 40  ILE A CD1  4  
ATOM 5909  H H    . ILE A 1 40  ? -0.415  9.837   7.602   1.00 0.00 ? 40  ILE A H    4  
ATOM 5910  H HA   . ILE A 1 40  ? 1.859   8.184   7.378   1.00 0.00 ? 40  ILE A HA   4  
ATOM 5911  H HB   . ILE A 1 40  ? 1.868   10.628  6.965   1.00 0.00 ? 40  ILE A HB   4  
ATOM 5912  H HG12 . ILE A 1 40  ? 3.908   9.097   7.724   1.00 0.00 ? 40  ILE A HG12 4  
ATOM 5913  H HG13 . ILE A 1 40  ? 4.106   10.817  7.424   1.00 0.00 ? 40  ILE A HG13 4  
ATOM 5914  H HG21 . ILE A 1 40  ? 1.486   10.737  9.933   1.00 0.00 ? 40  ILE A HG21 4  
ATOM 5915  H HG22 . ILE A 1 40  ? 0.588   11.570  8.664   1.00 0.00 ? 40  ILE A HG22 4  
ATOM 5916  H HG23 . ILE A 1 40  ? 2.235   12.068  9.052   1.00 0.00 ? 40  ILE A HG23 4  
ATOM 5917  H HD11 . ILE A 1 40  ? 5.056   9.645   9.588   1.00 0.00 ? 40  ILE A HD11 4  
ATOM 5918  H HD12 . ILE A 1 40  ? 3.427   9.971   10.182  1.00 0.00 ? 40  ILE A HD12 4  
ATOM 5919  H HD13 . ILE A 1 40  ? 4.442   11.297  9.618   1.00 0.00 ? 40  ILE A HD13 4  
ATOM 5920  N N    . GLY A 1 41  ? 2.653   7.504   9.655   1.00 0.00 ? 41  GLY A N    4  
ATOM 5921  C CA   . GLY A 1 41  ? 2.957   6.937   10.956  1.00 0.00 ? 41  GLY A CA   4  
ATOM 5922  C C    . GLY A 1 41  ? 2.525   5.491   11.079  1.00 0.00 ? 41  GLY A C    4  
ATOM 5923  O O    . GLY A 1 41  ? 3.172   4.698   11.767  1.00 0.00 ? 41  GLY A O    4  
ATOM 5924  H H    . GLY A 1 41  ? 3.211   7.275   8.881   1.00 0.00 ? 41  GLY A H    4  
ATOM 5925  H HA2  . GLY A 1 41  ? 4.023   6.995   11.121  1.00 0.00 ? 41  GLY A HA2  4  
ATOM 5926  H HA3  . GLY A 1 41  ? 2.453   7.518   11.715  1.00 0.00 ? 41  GLY A HA3  4  
ATOM 5927  N N    . GLN A 1 42  ? 1.429   5.140   10.412  1.00 0.00 ? 42  GLN A N    4  
ATOM 5928  C CA   . GLN A 1 42  ? 0.913   3.776   10.451  1.00 0.00 ? 42  GLN A CA   4  
ATOM 5929  C C    . GLN A 1 42  ? 1.389   2.984   9.238   1.00 0.00 ? 42  GLN A C    4  
ATOM 5930  O O    . GLN A 1 42  ? 2.254   3.442   8.492   1.00 0.00 ? 42  GLN A O    4  
ATOM 5931  C CB   . GLN A 1 42  ? -0.617  3.786   10.495  1.00 0.00 ? 42  GLN A CB   4  
ATOM 5932  C CG   . GLN A 1 42  ? -1.201  5.009   11.185  1.00 0.00 ? 42  GLN A CG   4  
ATOM 5933  C CD   . GLN A 1 42  ? -2.680  5.188   10.897  1.00 0.00 ? 42  GLN A CD   4  
ATOM 5934  O OE1  . GLN A 1 42  ? -3.529  4.756   11.675  1.00 0.00 ? 42  GLN A OE1  4  
ATOM 5935  N NE2  . GLN A 1 42  ? -2.992  5.829   9.778   1.00 0.00 ? 42  GLN A NE2  4  
ATOM 5936  H H    . GLN A 1 42  ? 0.957   5.816   9.879   1.00 0.00 ? 42  GLN A H    4  
ATOM 5937  H HA   . GLN A 1 42  ? 1.290   3.304   11.346  1.00 0.00 ? 42  GLN A HA   4  
ATOM 5938  H HB2  . GLN A 1 42  ? -0.995  3.756   9.485   1.00 0.00 ? 42  GLN A HB2  4  
ATOM 5939  H HB3  . GLN A 1 42  ? -0.955  2.907   11.023  1.00 0.00 ? 42  GLN A HB3  4  
ATOM 5940  H HG2  . GLN A 1 42  ? -1.068  4.904   12.252  1.00 0.00 ? 42  GLN A HG2  4  
ATOM 5941  H HG3  . GLN A 1 42  ? -0.673  5.887   10.841  1.00 0.00 ? 42  GLN A HG3  4  
ATOM 5942  H HE21 . GLN A 1 42  ? -2.261  6.146   9.207   1.00 0.00 ? 42  GLN A HE21 4  
ATOM 5943  H HE22 . GLN A 1 42  ? -3.941  5.958   9.567   1.00 0.00 ? 42  GLN A HE22 4  
ATOM 5944  N N    . LYS A 1 43  ? 0.817   1.800   9.045   1.00 0.00 ? 43  LYS A N    4  
ATOM 5945  C CA   . LYS A 1 43  ? 1.177   0.950   7.917   1.00 0.00 ? 43  LYS A CA   4  
ATOM 5946  C C    . LYS A 1 43  ? 0.011   0.840   6.943   1.00 0.00 ? 43  LYS A C    4  
ATOM 5947  O O    . LYS A 1 43  ? -1.117  0.585   7.352   1.00 0.00 ? 43  LYS A O    4  
ATOM 5948  C CB   . LYS A 1 43  ? 1.585   -0.442  8.404   1.00 0.00 ? 43  LYS A CB   4  
ATOM 5949  C CG   . LYS A 1 43  ? 2.678   -0.424  9.459   1.00 0.00 ? 43  LYS A CG   4  
ATOM 5950  C CD   . LYS A 1 43  ? 2.109   -0.602  10.858  1.00 0.00 ? 43  LYS A CD   4  
ATOM 5951  C CE   . LYS A 1 43  ? 2.854   -1.680  11.629  1.00 0.00 ? 43  LYS A CE   4  
ATOM 5952  N NZ   . LYS A 1 43  ? 4.285   -1.328  11.831  1.00 0.00 ? 43  LYS A NZ   4  
ATOM 5953  H H    . LYS A 1 43  ? 0.129   1.494   9.673   1.00 0.00 ? 43  LYS A H    4  
ATOM 5954  H HA   . LYS A 1 43  ? 2.016   1.406   7.410   1.00 0.00 ? 43  LYS A HA   4  
ATOM 5955  H HB2  . LYS A 1 43  ? 0.717   -0.929  8.825   1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5956  H HB3  . LYS A 1 43  ? 1.935   -1.018  7.562   1.00 0.00 ? 43  LYS A HB3  4  
ATOM 5957  H HG2  . LYS A 1 43  ? 3.371   -1.226  9.259   1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5958  H HG3  . LYS A 1 43  ? 3.196   0.523   9.409   1.00 0.00 ? 43  LYS A HG3  4  
ATOM 5959  H HD2  . LYS A 1 43  ? 2.192   0.332   11.392  1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5960  H HD3  . LYS A 1 43  ? 1.068   -0.882  10.779  1.00 0.00 ? 43  LYS A HD3  4  
ATOM 5961  H HE2  . LYS A 1 43  ? 2.384   -1.805  12.593  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5962  H HE3  . LYS A 1 43  ? 2.792   -2.607  11.078  1.00 0.00 ? 43  LYS A HE3  4  
ATOM 5963  H HZ1  . LYS A 1 43  ? 4.851   -2.192  11.961  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5964  H HZ2  . LYS A 1 43  ? 4.392   -0.729  12.674  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 5965  H HZ3  . LYS A 1 43  ? 4.647   -0.812  11.004  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 5966  N N    . LEU A 1 44  ? 0.283   1.073   5.659   1.00 0.00 ? 44  LEU A N    4  
ATOM 5967  C CA   . LEU A 1 44  ? -0.755  1.031   4.629   1.00 0.00 ? 44  LEU A CA   4  
ATOM 5968  C C    . LEU A 1 44  ? -1.655  -0.196  4.762   1.00 0.00 ? 44  LEU A C    4  
ATOM 5969  O O    . LEU A 1 44  ? -2.867  -0.099  4.589   1.00 0.00 ? 44  LEU A O    4  
ATOM 5970  C CB   . LEU A 1 44  ? -0.138  1.064   3.223   1.00 0.00 ? 44  LEU A CB   4  
ATOM 5971  C CG   . LEU A 1 44  ? 1.307   0.565   3.101   1.00 0.00 ? 44  LEU A CG   4  
ATOM 5972  C CD1  . LEU A 1 44  ? 1.399   -0.928  3.387   1.00 0.00 ? 44  LEU A CD1  4  
ATOM 5973  C CD2  . LEU A 1 44  ? 1.847   0.868   1.712   1.00 0.00 ? 44  LEU A CD2  4  
ATOM 5974  H H    . LEU A 1 44  ? 1.199   1.312   5.403   1.00 0.00 ? 44  LEU A H    4  
ATOM 5975  H HA   . LEU A 1 44  ? -1.366  1.913   4.754   1.00 0.00 ? 44  LEU A HA   4  
ATOM 5976  H HB2  . LEU A 1 44  ? -0.754  0.462   2.574   1.00 0.00 ? 44  LEU A HB2  4  
ATOM 5977  H HB3  . LEU A 1 44  ? -0.170  2.085   2.870   1.00 0.00 ? 44  LEU A HB3  4  
ATOM 5978  H HG   . LEU A 1 44  ? 1.924   1.082   3.821   1.00 0.00 ? 44  LEU A HG   4  
ATOM 5979  H HD11 . LEU A 1 44  ? 1.516   -1.469  2.458   1.00 0.00 ? 44  LEU A HD11 4  
ATOM 5980  H HD12 . LEU A 1 44  ? 0.499   -1.256  3.882   1.00 0.00 ? 44  LEU A HD12 4  
ATOM 5981  H HD13 . LEU A 1 44  ? 2.251   -1.120  4.024   1.00 0.00 ? 44  LEU A HD13 4  
ATOM 5982  H HD21 . LEU A 1 44  ? 2.769   0.327   1.560   1.00 0.00 ? 44  LEU A HD21 4  
ATOM 5983  H HD22 . LEU A 1 44  ? 2.032   1.928   1.623   1.00 0.00 ? 44  LEU A HD22 4  
ATOM 5984  H HD23 . LEU A 1 44  ? 1.124   0.564   0.970   1.00 0.00 ? 44  LEU A HD23 4  
ATOM 5985  N N    . THR A 1 45  ? -1.057  -1.349  5.046   1.00 0.00 ? 45  THR A N    4  
ATOM 5986  C CA   . THR A 1 45  ? -1.804  -2.599  5.171   1.00 0.00 ? 45  THR A CA   4  
ATOM 5987  C C    . THR A 1 45  ? -2.917  -2.511  6.205   1.00 0.00 ? 45  THR A C    4  
ATOM 5988  O O    . THR A 1 45  ? -3.816  -3.353  6.230   1.00 0.00 ? 45  THR A O    4  
ATOM 5989  C CB   . THR A 1 45  ? -0.870  -3.763  5.515   1.00 0.00 ? 45  THR A CB   4  
ATOM 5990  O OG1  . THR A 1 45  ? -0.232  -3.535  6.776   1.00 0.00 ? 45  THR A OG1  4  
ATOM 5991  C CG2  . THR A 1 45  ? 0.170   -3.916  4.427   1.00 0.00 ? 45  THR A CG2  4  
ATOM 5992  H H    . THR A 1 45  ? -0.084  -1.360  5.156   1.00 0.00 ? 45  THR A H    4  
ATOM 5993  H HA   . THR A 1 45  ? -2.249  -2.809  4.209   1.00 0.00 ? 45  THR A HA   4  
ATOM 5994  H HB   . THR A 1 45  ? -1.449  -4.670  5.565   1.00 0.00 ? 45  THR A HB   4  
ATOM 5995  H HG1  . THR A 1 45  ? -0.112  -2.592  6.909   1.00 0.00 ? 45  THR A HG1  4  
ATOM 5996  H HG21 . THR A 1 45  ? -0.239  -3.558  3.495   1.00 0.00 ? 45  THR A HG21 4  
ATOM 5997  H HG22 . THR A 1 45  ? 0.438   -4.957  4.329   1.00 0.00 ? 45  THR A HG22 4  
ATOM 5998  H HG23 . THR A 1 45  ? 1.044   -3.339  4.683   1.00 0.00 ? 45  THR A HG23 4  
ATOM 5999  N N    . GLN A 1 46  ? -2.870  -1.485  7.039   1.00 0.00 ? 46  GLN A N    4  
ATOM 6000  C CA   . GLN A 1 46  ? -3.897  -1.290  8.050   1.00 0.00 ? 46  GLN A CA   4  
ATOM 6001  C C    . GLN A 1 46  ? -5.213  -0.961  7.367   1.00 0.00 ? 46  GLN A C    4  
ATOM 6002  O O    . GLN A 1 46  ? -6.292  -1.158  7.923   1.00 0.00 ? 46  GLN A O    4  
ATOM 6003  C CB   . GLN A 1 46  ? -3.498  -0.169  9.012   1.00 0.00 ? 46  GLN A CB   4  
ATOM 6004  C CG   . GLN A 1 46  ? -3.999  -0.379  10.433  1.00 0.00 ? 46  GLN A CG   4  
ATOM 6005  C CD   . GLN A 1 46  ? -3.572  0.730   11.373  1.00 0.00 ? 46  GLN A CD   4  
ATOM 6006  O OE1  . GLN A 1 46  ? -4.343  1.160   12.234  1.00 0.00 ? 46  GLN A OE1  4  
ATOM 6007  N NE2  . GLN A 1 46  ? -2.342  1.201   11.216  1.00 0.00 ? 46  GLN A NE2  4  
ATOM 6008  H H    . GLN A 1 46  ? -2.142  -0.838  6.959   1.00 0.00 ? 46  GLN A H    4  
ATOM 6009  H HA   . GLN A 1 46  ? -4.006  -2.212  8.600   1.00 0.00 ? 46  GLN A HA   4  
ATOM 6010  H HB2  . GLN A 1 46  ? -2.421  -0.101  9.041   1.00 0.00 ? 46  GLN A HB2  4  
ATOM 6011  H HB3  . GLN A 1 46  ? -3.898  0.765   8.646   1.00 0.00 ? 46  GLN A HB3  4  
ATOM 6012  H HG2  . GLN A 1 46  ? -5.078  -0.422  10.416  1.00 0.00 ? 46  GLN A HG2  4  
ATOM 6013  H HG3  . GLN A 1 46  ? -3.609  -1.316  10.803  1.00 0.00 ? 46  GLN A HG3  4  
ATOM 6014  H HE21 . GLN A 1 46  ? -1.785  0.812   10.511  1.00 0.00 ? 46  GLN A HE21 4  
ATOM 6015  H HE22 . GLN A 1 46  ? -2.040  1.918   11.814  1.00 0.00 ? 46  GLN A HE22 4  
ATOM 6016  N N    . PHE A 1 47  ? -5.112  -0.439  6.151   1.00 0.00 ? 47  PHE A N    4  
ATOM 6017  C CA   . PHE A 1 47  ? -6.290  -0.064  5.384   1.00 0.00 ? 47  PHE A CA   4  
ATOM 6018  C C    . PHE A 1 47  ? -6.519  -1.026  4.222   1.00 0.00 ? 47  PHE A C    4  
ATOM 6019  O O    . PHE A 1 47  ? -7.117  -0.659  3.211   1.00 0.00 ? 47  PHE A O    4  
ATOM 6020  C CB   . PHE A 1 47  ? -6.155  1.371   4.859   1.00 0.00 ? 47  PHE A CB   4  
ATOM 6021  C CG   . PHE A 1 47  ? -5.143  2.198   5.602   1.00 0.00 ? 47  PHE A CG   4  
ATOM 6022  C CD1  . PHE A 1 47  ? -5.296  2.451   6.959   1.00 0.00 ? 47  PHE A CD1  4  
ATOM 6023  C CD2  . PHE A 1 47  ? -4.040  2.722   4.949   1.00 0.00 ? 47  PHE A CD2  4  
ATOM 6024  C CE1  . PHE A 1 47  ? -4.367  3.209   7.645   1.00 0.00 ? 47  PHE A CE1  4  
ATOM 6025  C CE2  . PHE A 1 47  ? -3.108  3.481   5.632   1.00 0.00 ? 47  PHE A CE2  4  
ATOM 6026  C CZ   . PHE A 1 47  ? -3.270  3.724   6.979   1.00 0.00 ? 47  PHE A CZ   4  
ATOM 6027  H H    . PHE A 1 47  ? -4.221  -0.282  5.773   1.00 0.00 ? 47  PHE A H    4  
ATOM 6028  H HA   . PHE A 1 47  ? -7.142  -0.116  6.046   1.00 0.00 ? 47  PHE A HA   4  
ATOM 6029  H HB2  . PHE A 1 47  ? -5.857  1.341   3.822   1.00 0.00 ? 47  PHE A HB2  4  
ATOM 6030  H HB3  . PHE A 1 47  ? -7.111  1.866   4.938   1.00 0.00 ? 47  PHE A HB3  4  
ATOM 6031  H HD1  . PHE A 1 47  ? -6.152  2.048   7.477   1.00 0.00 ? 47  PHE A HD1  4  
ATOM 6032  H HD2  . PHE A 1 47  ? -3.912  2.533   3.893   1.00 0.00 ? 47  PHE A HD2  4  
ATOM 6033  H HE1  . PHE A 1 47  ? -4.498  3.400   8.700   1.00 0.00 ? 47  PHE A HE1  4  
ATOM 6034  H HE2  . PHE A 1 47  ? -2.251  3.884   5.108   1.00 0.00 ? 47  PHE A HE2  4  
ATOM 6035  H HZ   . PHE A 1 47  ? -2.544  4.318   7.516   1.00 0.00 ? 47  PHE A HZ   4  
ATOM 6036  N N    . PHE A 1 48  ? -6.047  -2.260  4.378   1.00 0.00 ? 48  PHE A N    4  
ATOM 6037  C CA   . PHE A 1 48  ? -6.208  -3.283  3.347   1.00 0.00 ? 48  PHE A CA   4  
ATOM 6038  C C    . PHE A 1 48  ? -6.518  -4.641  3.973   1.00 0.00 ? 48  PHE A C    4  
ATOM 6039  O O    . PHE A 1 48  ? -5.997  -4.971  5.039   1.00 0.00 ? 48  PHE A O    4  
ATOM 6040  C CB   . PHE A 1 48  ? -4.951  -3.389  2.474   1.00 0.00 ? 48  PHE A CB   4  
ATOM 6041  C CG   . PHE A 1 48  ? -4.501  -2.078  1.893   1.00 0.00 ? 48  PHE A CG   4  
ATOM 6042  C CD1  . PHE A 1 48  ? -5.339  -1.341  1.075   1.00 0.00 ? 48  PHE A CD1  4  
ATOM 6043  C CD2  . PHE A 1 48  ? -3.240  -1.583  2.168   1.00 0.00 ? 48  PHE A CD2  4  
ATOM 6044  C CE1  . PHE A 1 48  ? -4.930  -0.133  0.543   1.00 0.00 ? 48  PHE A CE1  4  
ATOM 6045  C CE2  . PHE A 1 48  ? -2.823  -0.376  1.638   1.00 0.00 ? 48  PHE A CE2  4  
ATOM 6046  C CZ   . PHE A 1 48  ? -3.668  0.348   0.827   1.00 0.00 ? 48  PHE A CZ   4  
ATOM 6047  H H    . PHE A 1 48  ? -5.585  -2.491  5.209   1.00 0.00 ? 48  PHE A H    4  
ATOM 6048  H HA   . PHE A 1 48  ? -7.041  -2.993  2.725   1.00 0.00 ? 48  PHE A HA   4  
ATOM 6049  H HB2  . PHE A 1 48  ? -4.141  -3.782  3.070   1.00 0.00 ? 48  PHE A HB2  4  
ATOM 6050  H HB3  . PHE A 1 48  ? -5.147  -4.066  1.652   1.00 0.00 ? 48  PHE A HB3  4  
ATOM 6051  H HD1  . PHE A 1 48  ? -6.327  -1.716  0.854   1.00 0.00 ? 48  PHE A HD1  4  
ATOM 6052  H HD2  . PHE A 1 48  ? -2.575  -2.149  2.802   1.00 0.00 ? 48  PHE A HD2  4  
ATOM 6053  H HE1  . PHE A 1 48  ? -5.593  0.432   -0.095  1.00 0.00 ? 48  PHE A HE1  4  
ATOM 6054  H HE2  . PHE A 1 48  ? -1.834  -0.001  1.860   1.00 0.00 ? 48  PHE A HE2  4  
ATOM 6055  H HZ   . PHE A 1 48  ? -3.344  1.292   0.411   1.00 0.00 ? 48  PHE A HZ   4  
ATOM 6056  N N    . LEU A 1 49  ? -7.365  -5.407  3.284   1.00 0.00 ? 49  LEU A N    4  
ATOM 6057  C CA   . LEU A 1 49  ? -7.792  -6.749  3.709   1.00 0.00 ? 49  LEU A CA   4  
ATOM 6058  C C    . LEU A 1 49  ? -7.385  -7.096  5.145   1.00 0.00 ? 49  LEU A C    4  
ATOM 6059  O O    . LEU A 1 49  ? -6.298  -7.617  5.386   1.00 0.00 ? 49  LEU A O    4  
ATOM 6060  C CB   . LEU A 1 49  ? -7.264  -7.826  2.741   1.00 0.00 ? 49  LEU A CB   4  
ATOM 6061  C CG   . LEU A 1 49  ? -5.939  -7.527  2.012   1.00 0.00 ? 49  LEU A CG   4  
ATOM 6062  C CD1  . LEU A 1 49  ? -6.125  -6.445  0.958   1.00 0.00 ? 49  LEU A CD1  4  
ATOM 6063  C CD2  . LEU A 1 49  ? -4.840  -7.138  2.990   1.00 0.00 ? 49  LEU A CD2  4  
ATOM 6064  H H    . LEU A 1 49  ? -7.723  -5.056  2.442   1.00 0.00 ? 49  LEU A H    4  
ATOM 6065  H HA   . LEU A 1 49  ? -8.870  -6.762  3.662   1.00 0.00 ? 49  LEU A HA   4  
ATOM 6066  H HB2  . LEU A 1 49  ? -7.136  -8.739  3.299   1.00 0.00 ? 49  LEU A HB2  4  
ATOM 6067  H HB3  . LEU A 1 49  ? -8.023  -7.994  1.992   1.00 0.00 ? 49  LEU A HB3  4  
ATOM 6068  H HG   . LEU A 1 49  ? -5.622  -8.424  1.501   1.00 0.00 ? 49  LEU A HG   4  
ATOM 6069  H HD11 . LEU A 1 49  ? -6.873  -5.741  1.290   1.00 0.00 ? 49  LEU A HD11 4  
ATOM 6070  H HD12 . LEU A 1 49  ? -6.444  -6.899  0.031   1.00 0.00 ? 49  LEU A HD12 4  
ATOM 6071  H HD13 . LEU A 1 49  ? -5.187  -5.930  0.803   1.00 0.00 ? 49  LEU A HD13 4  
ATOM 6072  H HD21 . LEU A 1 49  ? -4.942  -7.719  3.895   1.00 0.00 ? 49  LEU A HD21 4  
ATOM 6073  H HD22 . LEU A 1 49  ? -4.920  -6.087  3.225   1.00 0.00 ? 49  LEU A HD22 4  
ATOM 6074  H HD23 . LEU A 1 49  ? -3.876  -7.335  2.544   1.00 0.00 ? 49  LEU A HD23 4  
ATOM 6075  N N    . ARG A 1 50  ? -8.282  -6.819  6.091   1.00 0.00 ? 50  ARG A N    4  
ATOM 6076  C CA   . ARG A 1 50  ? -8.045  -7.115  7.507   1.00 0.00 ? 50  ARG A CA   4  
ATOM 6077  C C    . ARG A 1 50  ? -6.812  -6.390  8.042   1.00 0.00 ? 50  ARG A C    4  
ATOM 6078  O O    . ARG A 1 50  ? -5.680  -6.700  7.673   1.00 0.00 ? 50  ARG A O    4  
ATOM 6079  C CB   . ARG A 1 50  ? -7.896  -8.622  7.720   1.00 0.00 ? 50  ARG A CB   4  
ATOM 6080  C CG   . ARG A 1 50  ? -7.867  -9.029  9.185   1.00 0.00 ? 50  ARG A CG   4  
ATOM 6081  C CD   . ARG A 1 50  ? -7.815  -10.540 9.341   1.00 0.00 ? 50  ARG A CD   4  
ATOM 6082  N NE   . ARG A 1 50  ? -9.088  -11.084 9.803   1.00 0.00 ? 50  ARG A NE   4  
ATOM 6083  C CZ   . ARG A 1 50  ? -9.968  -11.682 9.003   1.00 0.00 ? 50  ARG A CZ   4  
ATOM 6084  N NH1  . ARG A 1 50  ? -9.713  -11.815 7.708   1.00 0.00 ? 50  ARG A NH1  4  
ATOM 6085  N NH2  . ARG A 1 50  ? -11.106 -12.147 9.500   1.00 0.00 ? 50  ARG A NH2  4  
ATOM 6086  H H    . ARG A 1 50  ? -9.138  -6.421  5.828   1.00 0.00 ? 50  ARG A H    4  
ATOM 6087  H HA   . ARG A 1 50  ? -8.908  -6.773  8.058   1.00 0.00 ? 50  ARG A HA   4  
ATOM 6088  H HB2  . ARG A 1 50  ? -8.725  -9.124  7.246   1.00 0.00 ? 50  ARG A HB2  4  
ATOM 6089  H HB3  . ARG A 1 50  ? -6.976  -8.951  7.259   1.00 0.00 ? 50  ARG A HB3  4  
ATOM 6090  H HG2  . ARG A 1 50  ? -6.993  -8.599  9.651   1.00 0.00 ? 50  ARG A HG2  4  
ATOM 6091  H HG3  . ARG A 1 50  ? -8.758  -8.656  9.668   1.00 0.00 ? 50  ARG A HG3  4  
ATOM 6092  H HD2  . ARG A 1 50  ? -7.572  -10.979 8.384   1.00 0.00 ? 50  ARG A HD2  4  
ATOM 6093  H HD3  . ARG A 1 50  ? -7.046  -10.789 10.057  1.00 0.00 ? 50  ARG A HD3  4  
ATOM 6094  H HE   . ARG A 1 50  ? -9.299  -11.000 10.756  1.00 0.00 ? 50  ARG A HE   4  
ATOM 6095  H HH11 . ARG A 1 50  ? -8.855  -11.466 7.329   1.00 0.00 ? 50  ARG A HH11 4  
ATOM 6096  H HH12 . ARG A 1 50  ? -10.377 -12.264 7.111   1.00 0.00 ? 50  ARG A HH12 4  
ATOM 6097  H HH21 . ARG A 1 50  ? -11.304 -12.049 10.476  1.00 0.00 ? 50  ARG A HH21 4  
ATOM 6098  H HH22 . ARG A 1 50  ? -11.768 -12.597 8.898   1.00 0.00 ? 50  ARG A HH22 4  
ATOM 6099  N N    . SER A 1 51  ? -7.047  -5.416  8.914   1.00 0.00 ? 51  SER A N    4  
ATOM 6100  C CA   . SER A 1 51  ? -5.971  -4.631  9.511   1.00 0.00 ? 51  SER A CA   4  
ATOM 6101  C C    . SER A 1 51  ? -5.442  -5.255  10.802  1.00 0.00 ? 51  SER A C    4  
ATOM 6102  O O    . SER A 1 51  ? -4.507  -4.730  11.406  1.00 0.00 ? 51  SER A O    4  
ATOM 6103  C CB   . SER A 1 51  ? -6.463  -3.216  9.801   1.00 0.00 ? 51  SER A CB   4  
ATOM 6104  O OG   . SER A 1 51  ? -6.803  -3.062  11.170  1.00 0.00 ? 51  SER A OG   4  
ATOM 6105  H H    . SER A 1 51  ? -7.974  -5.218  9.163   1.00 0.00 ? 51  SER A H    4  
ATOM 6106  H HA   . SER A 1 51  ? -5.166  -4.578  8.794   1.00 0.00 ? 51  SER A HA   4  
ATOM 6107  H HB2  . SER A 1 51  ? -5.687  -2.510  9.556   1.00 0.00 ? 51  SER A HB2  4  
ATOM 6108  H HB3  . SER A 1 51  ? -7.339  -3.012  9.203   1.00 0.00 ? 51  SER A HB3  4  
ATOM 6109  H HG   . SER A 1 51  ? -7.552  -2.466  11.249  1.00 0.00 ? 51  SER A HG   4  
ATOM 6110  N N    . ASP A 1 52  ? -6.059  -6.344  11.251  1.00 0.00 ? 52  ASP A N    4  
ATOM 6111  C CA   . ASP A 1 52  ? -5.649  -6.978  12.502  1.00 0.00 ? 52  ASP A CA   4  
ATOM 6112  C C    . ASP A 1 52  ? -4.478  -7.948  12.334  1.00 0.00 ? 52  ASP A C    4  
ATOM 6113  O O    . ASP A 1 52  ? -3.363  -7.663  12.772  1.00 0.00 ? 52  ASP A O    4  
ATOM 6114  C CB   . ASP A 1 52  ? -6.836  -7.711  13.126  1.00 0.00 ? 52  ASP A CB   4  
ATOM 6115  C CG   . ASP A 1 52  ? -6.990  -7.411  14.604  1.00 0.00 ? 52  ASP A CG   4  
ATOM 6116  O OD1  . ASP A 1 52  ? -6.184  -7.932  15.404  1.00 0.00 ? 52  ASP A OD1  4  
ATOM 6117  O OD2  . ASP A 1 52  ? -7.917  -6.655  14.964  1.00 0.00 ? 52  ASP A OD2  4  
ATOM 6118  H H    . ASP A 1 52  ? -6.820  -6.709  10.751  1.00 0.00 ? 52  ASP A H    4  
ATOM 6119  H HA   . ASP A 1 52  ? -5.344  -6.192  13.176  1.00 0.00 ? 52  ASP A HA   4  
ATOM 6120  H HB2  . ASP A 1 52  ? -7.743  -7.411  12.621  1.00 0.00 ? 52  ASP A HB2  4  
ATOM 6121  H HB3  . ASP A 1 52  ? -6.698  -8.775  13.006  1.00 0.00 ? 52  ASP A HB3  4  
ATOM 6122  N N    . SER A 1 53  ? -4.739  -9.108  11.736  1.00 0.00 ? 53  SER A N    4  
ATOM 6123  C CA   . SER A 1 53  ? -3.704  -10.127 11.559  1.00 0.00 ? 53  SER A CA   4  
ATOM 6124  C C    . SER A 1 53  ? -3.007  -10.040 10.202  1.00 0.00 ? 53  SER A C    4  
ATOM 6125  O O    . SER A 1 53  ? -1.813  -10.323 10.094  1.00 0.00 ? 53  SER A O    4  
ATOM 6126  C CB   . SER A 1 53  ? -4.308  -11.519 11.740  1.00 0.00 ? 53  SER A CB   4  
ATOM 6127  O OG   . SER A 1 53  ? -5.193  -11.835 10.679  1.00 0.00 ? 53  SER A OG   4  
ATOM 6128  H H    . SER A 1 53  ? -5.651  -9.294  11.430  1.00 0.00 ? 53  SER A H    4  
ATOM 6129  H HA   . SER A 1 53  ? -2.965  -9.975  12.330  1.00 0.00 ? 53  SER A HA   4  
ATOM 6130  H HB2  . SER A 1 53  ? -3.515  -12.253 11.761  1.00 0.00 ? 53  SER A HB2  4  
ATOM 6131  H HB3  . SER A 1 53  ? -4.854  -11.555 12.672  1.00 0.00 ? 53  SER A HB3  4  
ATOM 6132  H HG   . SER A 1 53  ? -5.736  -12.587 10.929  1.00 0.00 ? 53  SER A HG   4  
ATOM 6133  N N    . ASP A 1 54  ? -3.758  -9.689  9.166   1.00 0.00 ? 54  ASP A N    4  
ATOM 6134  C CA   . ASP A 1 54  ? -3.212  -9.613  7.814   1.00 0.00 ? 54  ASP A CA   4  
ATOM 6135  C C    . ASP A 1 54  ? -2.044  -8.635  7.699   1.00 0.00 ? 54  ASP A C    4  
ATOM 6136  O O    . ASP A 1 54  ? -1.236  -8.738  6.778   1.00 0.00 ? 54  ASP A O    4  
ATOM 6137  C CB   . ASP A 1 54  ? -4.308  -9.235  6.822   1.00 0.00 ? 54  ASP A CB   4  
ATOM 6138  C CG   . ASP A 1 54  ? -4.757  -10.413 5.979   1.00 0.00 ? 54  ASP A CG   4  
ATOM 6139  O OD1  . ASP A 1 54  ? -5.275  -11.392 6.557   1.00 0.00 ? 54  ASP A OD1  4  
ATOM 6140  O OD2  . ASP A 1 54  ? -4.592  -10.355 4.743   1.00 0.00 ? 54  ASP A OD2  4  
ATOM 6141  H H    . ASP A 1 54  ? -4.710  -9.504  9.309   1.00 0.00 ? 54  ASP A H    4  
ATOM 6142  H HA   . ASP A 1 54  ? -2.846  -10.597 7.564   1.00 0.00 ? 54  ASP A HA   4  
ATOM 6143  H HB2  . ASP A 1 54  ? -5.161  -8.859  7.366   1.00 0.00 ? 54  ASP A HB2  4  
ATOM 6144  H HB3  . ASP A 1 54  ? -3.937  -8.464  6.163   1.00 0.00 ? 54  ASP A HB3  4  
ATOM 6145  N N    . VAL A 1 55  ? -1.953  -7.683  8.619   1.00 0.00 ? 55  VAL A N    4  
ATOM 6146  C CA   . VAL A 1 55  ? -0.869  -6.705  8.576   1.00 0.00 ? 55  VAL A CA   4  
ATOM 6147  C C    . VAL A 1 55  ? 0.358   -7.204  9.336   1.00 0.00 ? 55  VAL A C    4  
ATOM 6148  O O    . VAL A 1 55  ? 1.432   -6.616  9.247   1.00 0.00 ? 55  VAL A O    4  
ATOM 6149  C CB   . VAL A 1 55  ? -1.305  -5.335  9.133   1.00 0.00 ? 55  VAL A CB   4  
ATOM 6150  C CG1  . VAL A 1 55  ? -2.742  -5.031  8.739   1.00 0.00 ? 55  VAL A CG1  4  
ATOM 6151  C CG2  . VAL A 1 55  ? -1.135  -5.270  10.642  1.00 0.00 ? 55  VAL A CG2  4  
ATOM 6152  H H    . VAL A 1 55  ? -2.620  -7.635  9.334   1.00 0.00 ? 55  VAL A H    4  
ATOM 6153  H HA   . VAL A 1 55  ? -0.595  -6.573  7.539   1.00 0.00 ? 55  VAL A HA   4  
ATOM 6154  H HB   . VAL A 1 55  ? -0.673  -4.576  8.691   1.00 0.00 ? 55  VAL A HB   4  
ATOM 6155  H HG11 . VAL A 1 55  ? -3.300  -5.953  8.683   1.00 0.00 ? 55  VAL A HG11 4  
ATOM 6156  H HG12 . VAL A 1 55  ? -2.757  -4.542  7.778   1.00 0.00 ? 55  VAL A HG12 4  
ATOM 6157  H HG13 . VAL A 1 55  ? -3.188  -4.386  9.480   1.00 0.00 ? 55  VAL A HG13 4  
ATOM 6158  H HG21 . VAL A 1 55  ? -2.041  -4.891  11.092  1.00 0.00 ? 55  VAL A HG21 4  
ATOM 6159  H HG22 . VAL A 1 55  ? -0.311  -4.613  10.882  1.00 0.00 ? 55  VAL A HG22 4  
ATOM 6160  H HG23 . VAL A 1 55  ? -0.929  -6.259  11.025  1.00 0.00 ? 55  VAL A HG23 4  
ATOM 6161  N N    . VAL A 1 56  ? 0.185   -8.281  10.094  1.00 0.00 ? 56  VAL A N    4  
ATOM 6162  C CA   . VAL A 1 56  ? 1.280   -8.840  10.877  1.00 0.00 ? 56  VAL A CA   4  
ATOM 6163  C C    . VAL A 1 56  ? 2.031   -9.933  10.115  1.00 0.00 ? 56  VAL A C    4  
ATOM 6164  O O    . VAL A 1 56  ? 3.234   -10.110 10.311  1.00 0.00 ? 56  VAL A O    4  
ATOM 6165  C CB   . VAL A 1 56  ? 0.774   -9.424  12.209  1.00 0.00 ? 56  VAL A CB   4  
ATOM 6166  C CG1  . VAL A 1 56  ? 1.939   -9.715  13.143  1.00 0.00 ? 56  VAL A CG1  4  
ATOM 6167  C CG2  . VAL A 1 56  ? -0.219  -8.475  12.865  1.00 0.00 ? 56  VAL A CG2  4  
ATOM 6168  H H    . VAL A 1 56  ? -0.698  -8.701  10.134  1.00 0.00 ? 56  VAL A H    4  
ATOM 6169  H HA   . VAL A 1 56  ? 1.968   -8.039  11.102  1.00 0.00 ? 56  VAL A HA   4  
ATOM 6170  H HB   . VAL A 1 56  ? 0.267   -10.354 12.003  1.00 0.00 ? 56  VAL A HB   4  
ATOM 6171  H HG11 . VAL A 1 56  ? 2.795   -9.128  12.845  1.00 0.00 ? 56  VAL A HG11 4  
ATOM 6172  H HG12 . VAL A 1 56  ? 2.189   -10.765 13.092  1.00 0.00 ? 56  VAL A HG12 4  
ATOM 6173  H HG13 . VAL A 1 56  ? 1.664   -9.460  14.155  1.00 0.00 ? 56  VAL A HG13 4  
ATOM 6174  H HG21 . VAL A 1 56  ? -0.076  -7.478  12.477  1.00 0.00 ? 56  VAL A HG21 4  
ATOM 6175  H HG22 . VAL A 1 56  ? -0.061  -8.471  13.935  1.00 0.00 ? 56  VAL A HG22 4  
ATOM 6176  H HG23 . VAL A 1 56  ? -1.225  -8.804  12.652  1.00 0.00 ? 56  VAL A HG23 4  
ATOM 6177  N N    . GLU A 1 57  ? 1.331   -10.668 9.253   1.00 0.00 ? 57  GLU A N    4  
ATOM 6178  C CA   . GLU A 1 57  ? 1.964   -11.736 8.487   1.00 0.00 ? 57  GLU A CA   4  
ATOM 6179  C C    . GLU A 1 57  ? 2.466   -11.228 7.139   1.00 0.00 ? 57  GLU A C    4  
ATOM 6180  O O    . GLU A 1 57  ? 3.571   -11.562 6.709   1.00 0.00 ? 57  GLU A O    4  
ATOM 6181  C CB   . GLU A 1 57  ? 0.993   -12.900 8.283   1.00 0.00 ? 57  GLU A CB   4  
ATOM 6182  C CG   . GLU A 1 57  ? -0.251  -12.821 9.151   1.00 0.00 ? 57  GLU A CG   4  
ATOM 6183  C CD   . GLU A 1 57  ? -0.344  -13.962 10.145  1.00 0.00 ? 57  GLU A CD   4  
ATOM 6184  O OE1  . GLU A 1 57  ? -0.820  -15.050 9.756   1.00 0.00 ? 57  GLU A OE1  4  
ATOM 6185  O OE2  . GLU A 1 57  ? 0.061   -13.767 11.309  1.00 0.00 ? 57  GLU A OE2  4  
ATOM 6186  H H    . GLU A 1 57  ? 0.372   -10.483 9.123   1.00 0.00 ? 57  GLU A H    4  
ATOM 6187  H HA   . GLU A 1 57  ? 2.811   -12.088 9.057   1.00 0.00 ? 57  GLU A HA   4  
ATOM 6188  H HB2  . GLU A 1 57  ? 0.683   -12.917 7.249   1.00 0.00 ? 57  GLU A HB2  4  
ATOM 6189  H HB3  . GLU A 1 57  ? 1.507   -13.823 8.510   1.00 0.00 ? 57  GLU A HB3  4  
ATOM 6190  H HG2  . GLU A 1 57  ? -0.235  -11.888 9.694   1.00 0.00 ? 57  GLU A HG2  4  
ATOM 6191  H HG3  . GLU A 1 57  ? -1.121  -12.847 8.510   1.00 0.00 ? 57  GLU A HG3  4  
ATOM 6192  N N    . ALA A 1 58  ? 1.637   -10.433 6.473   1.00 0.00 ? 58  ALA A N    4  
ATOM 6193  C CA   . ALA A 1 58  ? 1.980   -9.888  5.161   1.00 0.00 ? 58  ALA A CA   4  
ATOM 6194  C C    . ALA A 1 58  ? 3.143   -8.902  5.238   1.00 0.00 ? 58  ALA A C    4  
ATOM 6195  O O    . ALA A 1 58  ? 4.054   -8.941  4.410   1.00 0.00 ? 58  ALA A O    4  
ATOM 6196  C CB   . ALA A 1 58  ? 0.765   -9.219  4.540   1.00 0.00 ? 58  ALA A CB   4  
ATOM 6197  H H    . ALA A 1 58  ? 0.765   -10.217 6.869   1.00 0.00 ? 58  ALA A H    4  
ATOM 6198  H HA   . ALA A 1 58  ? 2.266   -10.713 4.525   1.00 0.00 ? 58  ALA A HA   4  
ATOM 6199  H HB1  . ALA A 1 58  ? 0.732   -9.443  3.484   1.00 0.00 ? 58  ALA A HB1  4  
ATOM 6200  H HB2  . ALA A 1 58  ? 0.832   -8.150  4.678   1.00 0.00 ? 58  ALA A HB2  4  
ATOM 6201  H HB3  . ALA A 1 58  ? -0.132  -9.588  5.015   1.00 0.00 ? 58  ALA A HB3  4  
ATOM 6202  N N    . LEU A 1 59  ? 3.106   -8.014  6.228   1.00 0.00 ? 59  LEU A N    4  
ATOM 6203  C CA   . LEU A 1 59  ? 4.155   -7.012  6.400   1.00 0.00 ? 59  LEU A CA   4  
ATOM 6204  C C    . LEU A 1 59  ? 5.507   -7.653  6.706   1.00 0.00 ? 59  LEU A C    4  
ATOM 6205  O O    . LEU A 1 59  ? 6.517   -6.959  6.820   1.00 0.00 ? 59  LEU A O    4  
ATOM 6206  C CB   . LEU A 1 59  ? 3.782   -6.026  7.509   1.00 0.00 ? 59  LEU A CB   4  
ATOM 6207  C CG   . LEU A 1 59  ? 2.735   -4.975  7.122   1.00 0.00 ? 59  LEU A CG   4  
ATOM 6208  C CD1  . LEU A 1 59  ? 2.536   -3.977  8.255   1.00 0.00 ? 59  LEU A CD1  4  
ATOM 6209  C CD2  . LEU A 1 59  ? 3.140   -4.255  5.846   1.00 0.00 ? 59  LEU A CD2  4  
ATOM 6210  H H    . LEU A 1 59  ? 2.352   -8.025  6.853   1.00 0.00 ? 59  LEU A H    4  
ATOM 6211  H HA   . LEU A 1 59  ? 4.240   -6.469  5.470   1.00 0.00 ? 59  LEU A HA   4  
ATOM 6212  H HB2  . LEU A 1 59  ? 3.401   -6.589  8.348   1.00 0.00 ? 59  LEU A HB2  4  
ATOM 6213  H HB3  . LEU A 1 59  ? 4.677   -5.510  7.819   1.00 0.00 ? 59  LEU A HB3  4  
ATOM 6214  H HG   . LEU A 1 59  ? 1.791   -5.467  6.943   1.00 0.00 ? 59  LEU A HG   4  
ATOM 6215  H HD11 . LEU A 1 59  ? 3.380   -4.025  8.927   1.00 0.00 ? 59  LEU A HD11 4  
ATOM 6216  H HD12 . LEU A 1 59  ? 1.633   -4.220  8.792   1.00 0.00 ? 59  LEU A HD12 4  
ATOM 6217  H HD13 . LEU A 1 59  ? 2.457   -2.981  7.847   1.00 0.00 ? 59  LEU A HD13 4  
ATOM 6218  H HD21 . LEU A 1 59  ? 2.353   -4.354  5.114   1.00 0.00 ? 59  LEU A HD21 4  
ATOM 6219  H HD22 . LEU A 1 59  ? 4.050   -4.689  5.460   1.00 0.00 ? 59  LEU A HD22 4  
ATOM 6220  H HD23 . LEU A 1 59  ? 3.303   -3.208  6.059   1.00 0.00 ? 59  LEU A HD23 4  
ATOM 6221  N N    . SER A 1 60  ? 5.528   -8.978  6.830   1.00 0.00 ? 60  SER A N    4  
ATOM 6222  C CA   . SER A 1 60  ? 6.766   -9.695  7.112   1.00 0.00 ? 60  SER A CA   4  
ATOM 6223  C C    . SER A 1 60  ? 7.653   -9.748  5.871   1.00 0.00 ? 60  SER A C    4  
ATOM 6224  O O    . SER A 1 60  ? 8.683   -10.421 5.862   1.00 0.00 ? 60  SER A O    4  
ATOM 6225  C CB   . SER A 1 60  ? 6.463   -11.113 7.602   1.00 0.00 ? 60  SER A CB   4  
ATOM 6226  O OG   . SER A 1 60  ? 7.645   -11.771 8.023   1.00 0.00 ? 60  SER A OG   4  
ATOM 6227  H H    . SER A 1 60  ? 4.696   -9.485  6.719   1.00 0.00 ? 60  SER A H    4  
ATOM 6228  H HA   . SER A 1 60  ? 7.289   -9.159  7.890   1.00 0.00 ? 60  SER A HA   4  
ATOM 6229  H HB2  . SER A 1 60  ? 5.778   -11.064 8.436   1.00 0.00 ? 60  SER A HB2  4  
ATOM 6230  H HB3  . SER A 1 60  ? 6.014   -11.680 6.799   1.00 0.00 ? 60  SER A HB3  4  
ATOM 6231  H HG   . SER A 1 60  ? 7.443   -12.684 8.243   1.00 0.00 ? 60  SER A HG   4  
ATOM 6232  N N    . GLU A 1 61  ? 7.222   -9.041  4.822   1.00 0.00 ? 61  GLU A N    4  
ATOM 6233  C CA   . GLU A 1 61  ? 7.941   -8.990  3.550   1.00 0.00 ? 61  GLU A CA   4  
ATOM 6234  C C    . GLU A 1 61  ? 7.682   -10.250 2.733   1.00 0.00 ? 61  GLU A C    4  
ATOM 6235  O O    . GLU A 1 61  ? 8.403   -10.545 1.780   1.00 0.00 ? 61  GLU A O    4  
ATOM 6236  C CB   . GLU A 1 61  ? 9.446   -8.800  3.770   1.00 0.00 ? 61  GLU A CB   4  
ATOM 6237  C CG   . GLU A 1 61  ? 10.147  -8.105  2.613   1.00 0.00 ? 61  GLU A CG   4  
ATOM 6238  C CD   . GLU A 1 61  ? 11.654  -8.265  2.664   1.00 0.00 ? 61  GLU A CD   4  
ATOM 6239  O OE1  . GLU A 1 61  ? 12.192  -8.483  3.770   1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6240  O OE2  . GLU A 1 61  ? 12.296  -8.171  1.598   1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6241  H H    . GLU A 1 61  ? 6.379   -8.549  4.907   1.00 0.00 ? 61  GLU A H    4  
ATOM 6242  H HA   . GLU A 1 61  ? 7.561   -8.144  2.998   1.00 0.00 ? 61  GLU A HA   4  
ATOM 6243  H HB2  . GLU A 1 61  ? 9.597   -8.210  4.661   1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6244  H HB3  . GLU A 1 61  ? 9.903   -9.769  3.909   1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6245  H HG2  . GLU A 1 61  ? 9.787   -8.527  1.685   1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6246  H HG3  . GLU A 1 61  ? 9.909   -7.052  2.644   1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6247  N N    . GLU A 1 62  ? 6.641   -10.985 3.112   1.00 0.00 ? 62  GLU A N    4  
ATOM 6248  C CA   . GLU A 1 62  ? 6.274   -12.211 2.419   1.00 0.00 ? 62  GLU A CA   4  
ATOM 6249  C C    . GLU A 1 62  ? 4.770   -12.453 2.538   1.00 0.00 ? 62  GLU A C    4  
ATOM 6250  O O    . GLU A 1 62  ? 4.180   -12.215 3.592   1.00 0.00 ? 62  GLU A O    4  
ATOM 6251  C CB   . GLU A 1 62  ? 7.053   -13.399 2.996   1.00 0.00 ? 62  GLU A CB   4  
ATOM 6252  C CG   . GLU A 1 62  ? 6.410   -14.750 2.728   1.00 0.00 ? 62  GLU A CG   4  
ATOM 6253  C CD   . GLU A 1 62  ? 7.278   -15.650 1.869   1.00 0.00 ? 62  GLU A CD   4  
ATOM 6254  O OE1  . GLU A 1 62  ? 7.267   -15.479 0.632   1.00 0.00 ? 62  GLU A OE1  4  
ATOM 6255  O OE2  . GLU A 1 62  ? 7.967   -16.526 2.434   1.00 0.00 ? 62  GLU A OE2  4  
ATOM 6256  H H    . GLU A 1 62  ? 6.102   -10.698 3.877   1.00 0.00 ? 62  GLU A H    4  
ATOM 6257  H HA   . GLU A 1 62  ? 6.528   -12.094 1.376   1.00 0.00 ? 62  GLU A HA   4  
ATOM 6258  H HB2  . GLU A 1 62  ? 8.043   -13.406 2.564   1.00 0.00 ? 62  GLU A HB2  4  
ATOM 6259  H HB3  . GLU A 1 62  ? 7.139   -13.270 4.065   1.00 0.00 ? 62  GLU A HB3  4  
ATOM 6260  H HG2  . GLU A 1 62  ? 6.234   -15.242 3.673   1.00 0.00 ? 62  GLU A HG2  4  
ATOM 6261  H HG3  . GLU A 1 62  ? 5.469   -14.593 2.225   1.00 0.00 ? 62  GLU A HG3  4  
ATOM 6262  N N    . HIS A 1 63  ? 4.158   -12.932 1.460   1.00 0.00 ? 63  HIS A N    4  
ATOM 6263  C CA   . HIS A 1 63  ? 2.727   -13.211 1.456   1.00 0.00 ? 63  HIS A CA   4  
ATOM 6264  C C    . HIS A 1 63  ? 2.468   -14.648 1.886   1.00 0.00 ? 63  HIS A C    4  
ATOM 6265  O O    . HIS A 1 63  ? 3.272   -15.541 1.613   1.00 0.00 ? 63  HIS A O    4  
ATOM 6266  C CB   . HIS A 1 63  ? 2.137   -12.966 0.063   1.00 0.00 ? 63  HIS A CB   4  
ATOM 6267  C CG   . HIS A 1 63  ? 2.947   -13.561 -1.047  1.00 0.00 ? 63  HIS A CG   4  
ATOM 6268  N ND1  . HIS A 1 63  ? 3.552   -12.802 -2.027  1.00 0.00 ? 63  HIS A ND1  4  
ATOM 6269  C CD2  . HIS A 1 63  ? 3.253   -14.850 -1.329  1.00 0.00 ? 63  HIS A CD2  4  
ATOM 6270  C CE1  . HIS A 1 63  ? 4.190   -13.598 -2.866  1.00 0.00 ? 63  HIS A CE1  4  
ATOM 6271  N NE2  . HIS A 1 63  ? 4.025   -14.845 -2.465  1.00 0.00 ? 63  HIS A NE2  4  
ATOM 6272  H H    . HIS A 1 63  ? 4.676   -13.113 0.651   1.00 0.00 ? 63  HIS A H    4  
ATOM 6273  H HA   . HIS A 1 63  ? 2.256   -12.544 2.163   1.00 0.00 ? 63  HIS A HA   4  
ATOM 6274  H HB2  . HIS A 1 63  ? 1.149   -13.396 0.020   1.00 0.00 ? 63  HIS A HB2  4  
ATOM 6275  H HB3  . HIS A 1 63  ? 2.068   -11.901 -0.107  1.00 0.00 ? 63  HIS A HB3  4  
ATOM 6276  H HD1  . HIS A 1 63  ? 3.518   -11.826 -2.097  1.00 0.00 ? 63  HIS A HD1  4  
ATOM 6277  H HD2  . HIS A 1 63  ? 2.948   -15.720 -0.765  1.00 0.00 ? 63  HIS A HD2  4  
ATOM 6278  H HE1  . HIS A 1 63  ? 4.753   -13.283 -3.732  1.00 0.00 ? 63  HIS A HE1  4  
ATOM 6279  H HE2  . HIS A 1 63  ? 4.447   -15.631 -2.871  1.00 0.00 ? 63  HIS A HE2  4  
ATOM 6280  N N    . MET A 1 64  ? 1.345   -14.867 2.567   1.00 0.00 ? 64  MET A N    4  
ATOM 6281  C CA   . MET A 1 64  ? 0.986   -16.200 3.043   1.00 0.00 ? 64  MET A CA   4  
ATOM 6282  C C    . MET A 1 64  ? 2.081   -16.761 3.939   1.00 0.00 ? 64  MET A C    4  
ATOM 6283  O O    . MET A 1 64  ? 2.112   -17.959 4.229   1.00 0.00 ? 64  MET A O    4  
ATOM 6284  C CB   . MET A 1 64  ? 0.735   -17.144 1.862   1.00 0.00 ? 64  MET A CB   4  
ATOM 6285  C CG   . MET A 1 64  ? 0.129   -16.455 0.648   1.00 0.00 ? 64  MET A CG   4  
ATOM 6286  S SD   . MET A 1 64  ? -1.071  -17.487 -0.213  1.00 0.00 ? 64  MET A SD   4  
ATOM 6287  C CE   . MET A 1 64  ? -0.839  -16.938 -1.901  1.00 0.00 ? 64  MET A CE   4  
ATOM 6288  H H    . MET A 1 64  ? 0.749   -14.115 2.758   1.00 0.00 ? 64  MET A H    4  
ATOM 6289  H HA   . MET A 1 64  ? 0.080   -16.111 3.619   1.00 0.00 ? 64  MET A HA   4  
ATOM 6290  H HB2  . MET A 1 64  ? 1.674   -17.586 1.564   1.00 0.00 ? 64  MET A HB2  4  
ATOM 6291  H HB3  . MET A 1 64  ? 0.062   -17.926 2.178   1.00 0.00 ? 64  MET A HB3  4  
ATOM 6292  H HG2  . MET A 1 64  ? -0.363  -15.551 0.974   1.00 0.00 ? 64  MET A HG2  4  
ATOM 6293  H HG3  . MET A 1 64  ? 0.924   -16.202 -0.039  1.00 0.00 ? 64  MET A HG3  4  
ATOM 6294  H HE1  . MET A 1 64  ? -0.649  -17.792 -2.535  1.00 0.00 ? 64  MET A HE1  4  
ATOM 6295  H HE2  . MET A 1 64  ? 0.001   -16.261 -1.948  1.00 0.00 ? 64  MET A HE2  4  
ATOM 6296  H HE3  . MET A 1 64  ? -1.731  -16.431 -2.240  1.00 0.00 ? 64  MET A HE3  4  
ATOM 6297  N N    . GLU A 1 65  ? 2.987   -15.883 4.370   1.00 0.00 ? 65  GLU A N    4  
ATOM 6298  C CA   . GLU A 1 65  ? 4.099   -16.269 5.230   1.00 0.00 ? 65  GLU A CA   4  
ATOM 6299  C C    . GLU A 1 65  ? 4.995   -17.294 4.539   1.00 0.00 ? 65  GLU A C    4  
ATOM 6300  O O    . GLU A 1 65  ? 5.945   -17.801 5.137   1.00 0.00 ? 65  GLU A O    4  
ATOM 6301  C CB   . GLU A 1 65  ? 3.584   -16.833 6.557   1.00 0.00 ? 65  GLU A CB   4  
ATOM 6302  C CG   . GLU A 1 65  ? 2.627   -15.900 7.283   1.00 0.00 ? 65  GLU A CG   4  
ATOM 6303  C CD   . GLU A 1 65  ? 1.846   -16.601 8.377   1.00 0.00 ? 65  GLU A CD   4  
ATOM 6304  O OE1  . GLU A 1 65  ? 0.925   -17.378 8.047   1.00 0.00 ? 65  GLU A OE1  4  
ATOM 6305  O OE2  . GLU A 1 65  ? 2.157   -16.373 9.567   1.00 0.00 ? 65  GLU A OE2  4  
ATOM 6306  H H    . GLU A 1 65  ? 2.904   -14.944 4.096   1.00 0.00 ? 65  GLU A H    4  
ATOM 6307  H HA   . GLU A 1 65  ? 4.681   -15.380 5.430   1.00 0.00 ? 65  GLU A HA   4  
ATOM 6308  H HB2  . GLU A 1 65  ? 3.069   -17.763 6.365   1.00 0.00 ? 65  GLU A HB2  4  
ATOM 6309  H HB3  . GLU A 1 65  ? 4.426   -17.024 7.205   1.00 0.00 ? 65  GLU A HB3  4  
ATOM 6310  H HG2  . GLU A 1 65  ? 3.196   -15.096 7.725   1.00 0.00 ? 65  GLU A HG2  4  
ATOM 6311  H HG3  . GLU A 1 65  ? 1.928   -15.495 6.565   1.00 0.00 ? 65  GLU A HG3  4  
ATOM 6312  N N    . ALA A 1 66  ? 4.687   -17.593 3.278   1.00 0.00 ? 66  ALA A N    4  
ATOM 6313  C CA   . ALA A 1 66  ? 5.467   -18.559 2.509   1.00 0.00 ? 66  ALA A CA   4  
ATOM 6314  C C    . ALA A 1 66  ? 5.046   -18.566 1.040   1.00 0.00 ? 66  ALA A C    4  
ATOM 6315  O O    . ALA A 1 66  ? 5.313   -17.613 0.307   1.00 0.00 ? 66  ALA A O    4  
ATOM 6316  C CB   . ALA A 1 66  ? 5.336   -19.948 3.117   1.00 0.00 ? 66  ALA A CB   4  
ATOM 6317  H H    . ALA A 1 66  ? 3.917   -17.155 2.856   1.00 0.00 ? 66  ALA A H    4  
ATOM 6318  H HA   . ALA A 1 66  ? 6.505   -18.264 2.569   1.00 0.00 ? 66  ALA A HA   4  
ATOM 6319  H HB1  . ALA A 1 66  ? 4.362   -20.353 2.883   1.00 0.00 ? 66  ALA A HB1  4  
ATOM 6320  H HB2  . ALA A 1 66  ? 5.448   -19.884 4.190   1.00 0.00 ? 66  ALA A HB2  4  
ATOM 6321  H HB3  . ALA A 1 66  ? 6.101   -20.593 2.712   1.00 0.00 ? 66  ALA A HB3  4  
ATOM 6322  N N    . ASP A 1 67  ? 4.390   -19.644 0.612   1.00 0.00 ? 67  ASP A N    4  
ATOM 6323  C CA   . ASP A 1 67  ? 3.938   -19.769 -0.770  1.00 0.00 ? 67  ASP A CA   4  
ATOM 6324  C C    . ASP A 1 67  ? 2.941   -20.914 -0.915  1.00 0.00 ? 67  ASP A C    4  
ATOM 6325  O O    . ASP A 1 67  ? 3.322   -22.048 -1.204  1.00 0.00 ? 67  ASP A O    4  
ATOM 6326  C CB   . ASP A 1 67  ? 5.133   -19.997 -1.699  1.00 0.00 ? 67  ASP A CB   4  
ATOM 6327  C CG   . ASP A 1 67  ? 5.132   -19.054 -2.888  1.00 0.00 ? 67  ASP A CG   4  
ATOM 6328  O OD1  . ASP A 1 67  ? 5.482   -17.869 -2.706  1.00 0.00 ? 67  ASP A OD1  4  
ATOM 6329  O OD2  . ASP A 1 67  ? 4.781   -19.500 -3.999  1.00 0.00 ? 67  ASP A OD2  4  
ATOM 6330  H H    . ASP A 1 67  ? 4.204   -20.373 1.238   1.00 0.00 ? 67  ASP A H    4  
ATOM 6331  H HA   . ASP A 1 67  ? 3.450   -18.844 -1.043  1.00 0.00 ? 67  ASP A HA   4  
ATOM 6332  H HB2  . ASP A 1 67  ? 6.046   -19.844 -1.146  1.00 0.00 ? 67  ASP A HB2  4  
ATOM 6333  H HB3  . ASP A 1 67  ? 5.105   -21.012 -2.068  1.00 0.00 ? 67  ASP A HB3  4  
ATOM 6334  N N    . GLY A 1 68  ? 1.663   -20.611 -0.708  1.00 0.00 ? 68  GLY A N    4  
ATOM 6335  C CA   . GLY A 1 68  ? 0.631   -21.626 -0.820  1.00 0.00 ? 68  GLY A CA   4  
ATOM 6336  C C    . GLY A 1 68  ? -0.273  -21.666 0.396   1.00 0.00 ? 68  GLY A C    4  
ATOM 6337  O O    . GLY A 1 68  ? -0.275  -22.642 1.145   1.00 0.00 ? 68  GLY A O    4  
ATOM 6338  H H    . GLY A 1 68  ? 1.419   -19.689 -0.480  1.00 0.00 ? 68  GLY A H    4  
ATOM 6339  H HA2  . GLY A 1 68  ? 0.032   -21.421 -1.695  1.00 0.00 ? 68  GLY A HA2  4  
ATOM 6340  H HA3  . GLY A 1 68  ? 1.103   -22.590 -0.937  1.00 0.00 ? 68  GLY A HA3  4  
ATOM 6341  N N    . HIS A 1 69  ? -1.043  -20.599 0.590   1.00 0.00 ? 69  HIS A N    4  
ATOM 6342  C CA   . HIS A 1 69  ? -1.956  -20.509 1.723   1.00 0.00 ? 69  HIS A CA   4  
ATOM 6343  C C    . HIS A 1 69  ? -3.150  -19.618 1.390   1.00 0.00 ? 69  HIS A C    4  
ATOM 6344  O O    . HIS A 1 69  ? -3.459  -19.390 0.220   1.00 0.00 ? 69  HIS A O    4  
ATOM 6345  C CB   . HIS A 1 69  ? -1.223  -19.963 2.949   1.00 0.00 ? 69  HIS A CB   4  
ATOM 6346  C CG   . HIS A 1 69  ? -0.655  -21.027 3.835   1.00 0.00 ? 69  HIS A CG   4  
ATOM 6347  N ND1  . HIS A 1 69  ? -1.419  -21.759 4.719   1.00 0.00 ? 69  HIS A ND1  4  
ATOM 6348  C CD2  . HIS A 1 69  ? 0.615   -21.482 3.973   1.00 0.00 ? 69  HIS A CD2  4  
ATOM 6349  C CE1  . HIS A 1 69  ? -0.645  -22.617 5.362   1.00 0.00 ? 69  HIS A CE1  4  
ATOM 6350  N NE2  . HIS A 1 69  ? 0.591   -22.468 4.927   1.00 0.00 ? 69  HIS A NE2  4  
ATOM 6351  H H    . HIS A 1 69  ? -0.994  -19.853 -0.044  1.00 0.00 ? 69  HIS A H    4  
ATOM 6352  H HA   . HIS A 1 69  ? -2.315  -21.504 1.943   1.00 0.00 ? 69  HIS A HA   4  
ATOM 6353  H HB2  . HIS A 1 69  ? -0.408  -19.333 2.623   1.00 0.00 ? 69  HIS A HB2  4  
ATOM 6354  H HB3  . HIS A 1 69  ? -1.911  -19.373 3.538   1.00 0.00 ? 69  HIS A HB3  4  
ATOM 6355  H HD1  . HIS A 1 69  ? -2.385  -21.665 4.854   1.00 0.00 ? 69  HIS A HD1  4  
ATOM 6356  H HD2  . HIS A 1 69  ? 1.483   -21.131 3.433   1.00 0.00 ? 69  HIS A HD2  4  
ATOM 6357  H HE1  . HIS A 1 69  ? -0.972  -23.319 6.114   1.00 0.00 ? 69  HIS A HE1  4  
ATOM 6358  H HE2  . HIS A 1 69  ? 1.378   -22.925 5.292   1.00 0.00 ? 69  HIS A HE2  4  
ATOM 6359  N N    . ALA A 1 70  ? -3.816  -19.113 2.426   1.00 0.00 ? 70  ALA A N    4  
ATOM 6360  C CA   . ALA A 1 70  ? -4.973  -18.246 2.244   1.00 0.00 ? 70  ALA A CA   4  
ATOM 6361  C C    . ALA A 1 70  ? -5.213  -17.391 3.484   1.00 0.00 ? 70  ALA A C    4  
ATOM 6362  O O    . ALA A 1 70  ? -6.176  -17.605 4.222   1.00 0.00 ? 70  ALA A O    4  
ATOM 6363  C CB   . ALA A 1 70  ? -6.207  -19.075 1.924   1.00 0.00 ? 70  ALA A CB   4  
ATOM 6364  H H    . ALA A 1 70  ? -3.520  -19.331 3.333   1.00 0.00 ? 70  ALA A H    4  
ATOM 6365  H HA   . ALA A 1 70  ? -4.774  -17.596 1.404   1.00 0.00 ? 70  ALA A HA   4  
ATOM 6366  H HB1  . ALA A 1 70  ? -6.100  -19.515 0.942   1.00 0.00 ? 70  ALA A HB1  4  
ATOM 6367  H HB2  . ALA A 1 70  ? -7.081  -18.441 1.939   1.00 0.00 ? 70  ALA A HB2  4  
ATOM 6368  H HB3  . ALA A 1 70  ? -6.317  -19.858 2.659   1.00 0.00 ? 70  ALA A HB3  4  
ATOM 6369  N N    . ALA A 1 71  ? -4.328  -16.425 3.714   1.00 0.00 ? 71  ALA A N    4  
ATOM 6370  C CA   . ALA A 1 71  ? -4.442  -15.542 4.868   1.00 0.00 ? 71  ALA A CA   4  
ATOM 6371  C C    . ALA A 1 71  ? -3.984  -14.125 4.534   1.00 0.00 ? 71  ALA A C    4  
ATOM 6372  O O    . ALA A 1 71  ? -4.794  -13.200 4.466   1.00 0.00 ? 71  ALA A O    4  
ATOM 6373  C CB   . ALA A 1 71  ? -3.636  -16.095 6.033   1.00 0.00 ? 71  ALA A CB   4  
ATOM 6374  H H    . ALA A 1 71  ? -3.578  -16.306 3.092   1.00 0.00 ? 71  ALA A H    4  
ATOM 6375  H HA   . ALA A 1 71  ? -5.481  -15.513 5.163   1.00 0.00 ? 71  ALA A HA   4  
ATOM 6376  H HB1  . ALA A 1 71  ? -2.704  -16.503 5.664   1.00 0.00 ? 71  ALA A HB1  4  
ATOM 6377  H HB2  . ALA A 1 71  ? -4.199  -16.874 6.524   1.00 0.00 ? 71  ALA A HB2  4  
ATOM 6378  H HB3  . ALA A 1 71  ? -3.428  -15.302 6.736   1.00 0.00 ? 71  ALA A HB3  4  
ATOM 6379  N N    . VAL A 1 72  ? -2.680  -13.962 4.332   1.00 0.00 ? 72  VAL A N    4  
ATOM 6380  C CA   . VAL A 1 72  ? -2.110  -12.656 4.010   1.00 0.00 ? 72  VAL A CA   4  
ATOM 6381  C C    . VAL A 1 72  ? -1.765  -12.552 2.532   1.00 0.00 ? 72  VAL A C    4  
ATOM 6382  O O    . VAL A 1 72  ? -0.954  -13.322 2.018   1.00 0.00 ? 72  VAL A O    4  
ATOM 6383  C CB   . VAL A 1 72  ? -0.852  -12.367 4.848   1.00 0.00 ? 72  VAL A CB   4  
ATOM 6384  C CG1  . VAL A 1 72  ? -1.233  -11.680 6.143   1.00 0.00 ? 72  VAL A CG1  4  
ATOM 6385  C CG2  . VAL A 1 72  ? -0.083  -13.653 5.119   1.00 0.00 ? 72  VAL A CG2  4  
ATOM 6386  H H    . VAL A 1 72  ? -2.085  -14.737 4.404   1.00 0.00 ? 72  VAL A H    4  
ATOM 6387  H HA   . VAL A 1 72  ? -2.852  -11.904 4.248   1.00 0.00 ? 72  VAL A HA   4  
ATOM 6388  H HB   . VAL A 1 72  ? -0.209  -11.700 4.294   1.00 0.00 ? 72  VAL A HB   4  
ATOM 6389  H HG11 . VAL A 1 72  ? -2.103  -11.060 5.976   1.00 0.00 ? 72  VAL A HG11 4  
ATOM 6390  H HG12 . VAL A 1 72  ? -0.412  -11.068 6.483   1.00 0.00 ? 72  VAL A HG12 4  
ATOM 6391  H HG13 . VAL A 1 72  ? -1.462  -12.423 6.892   1.00 0.00 ? 72  VAL A HG13 4  
ATOM 6392  H HG21 . VAL A 1 72  ? 0.372   -13.999 4.203   1.00 0.00 ? 72  VAL A HG21 4  
ATOM 6393  H HG22 . VAL A 1 72  ? -0.762  -14.406 5.491   1.00 0.00 ? 72  VAL A HG22 4  
ATOM 6394  H HG23 . VAL A 1 72  ? 0.685   -13.466 5.854   1.00 0.00 ? 72  VAL A HG23 4  
ATOM 6395  N N    . VAL A 1 73  ? -2.392  -11.599 1.853   1.00 0.00 ? 73  VAL A N    4  
ATOM 6396  C CA   . VAL A 1 73  ? -2.155  -11.397 0.428   1.00 0.00 ? 73  VAL A CA   4  
ATOM 6397  C C    . VAL A 1 73  ? -2.066  -9.915  0.071   1.00 0.00 ? 73  VAL A C    4  
ATOM 6398  O O    . VAL A 1 73  ? -3.086  -9.244  -0.088  1.00 0.00 ? 73  VAL A O    4  
ATOM 6399  C CB   . VAL A 1 73  ? -3.260  -12.050 -0.424  1.00 0.00 ? 73  VAL A CB   4  
ATOM 6400  C CG1  . VAL A 1 73  ? -2.864  -13.461 -0.827  1.00 0.00 ? 73  VAL A CG1  4  
ATOM 6401  C CG2  . VAL A 1 73  ? -4.585  -12.054 0.324   1.00 0.00 ? 73  VAL A CG2  4  
ATOM 6402  H H    . VAL A 1 73  ? -3.029  -11.018 2.320   1.00 0.00 ? 73  VAL A H    4  
ATOM 6403  H HA   . VAL A 1 73  ? -1.216  -11.871 0.180   1.00 0.00 ? 73  VAL A HA   4  
ATOM 6404  H HB   . VAL A 1 73  ? -3.383  -11.464 -1.324  1.00 0.00 ? 73  VAL A HB   4  
ATOM 6405  H HG11 . VAL A 1 73  ? -3.728  -14.108 -0.771  1.00 0.00 ? 73  VAL A HG11 4  
ATOM 6406  H HG12 . VAL A 1 73  ? -2.098  -13.826 -0.157  1.00 0.00 ? 73  VAL A HG12 4  
ATOM 6407  H HG13 . VAL A 1 73  ? -2.485  -13.454 -1.838  1.00 0.00 ? 73  VAL A HG13 4  
ATOM 6408  H HG21 . VAL A 1 73  ? -4.692  -12.984 0.863   1.00 0.00 ? 73  VAL A HG21 4  
ATOM 6409  H HG22 . VAL A 1 73  ? -5.398  -11.952 -0.381  1.00 0.00 ? 73  VAL A HG22 4  
ATOM 6410  H HG23 . VAL A 1 73  ? -4.608  -11.230 1.021   1.00 0.00 ? 73  VAL A HG23 4  
ATOM 6411  N N    . PHE A 1 74  ? -0.842  -9.420  -0.078  1.00 0.00 ? 74  PHE A N    4  
ATOM 6412  C CA   . PHE A 1 74  ? -0.618  -8.024  -0.447  1.00 0.00 ? 74  PHE A CA   4  
ATOM 6413  C C    . PHE A 1 74  ? 0.374   -7.944  -1.603  1.00 0.00 ? 74  PHE A C    4  
ATOM 6414  O O    . PHE A 1 74  ? 0.937   -8.959  -2.013  1.00 0.00 ? 74  PHE A O    4  
ATOM 6415  C CB   . PHE A 1 74  ? -0.115  -7.211  0.753   1.00 0.00 ? 74  PHE A CB   4  
ATOM 6416  C CG   . PHE A 1 74  ? -0.375  -5.731  0.626   1.00 0.00 ? 74  PHE A CG   4  
ATOM 6417  C CD1  . PHE A 1 74  ? -1.623  -5.259  0.238   1.00 0.00 ? 74  PHE A CD1  4  
ATOM 6418  C CD2  . PHE A 1 74  ? 0.632   -4.810  0.886   1.00 0.00 ? 74  PHE A CD2  4  
ATOM 6419  C CE1  . PHE A 1 74  ? -1.856  -3.902  0.111   1.00 0.00 ? 74  PHE A CE1  4  
ATOM 6420  C CE2  . PHE A 1 74  ? 0.400   -3.456  0.761   1.00 0.00 ? 74  PHE A CE2  4  
ATOM 6421  C CZ   . PHE A 1 74  ? -0.843  -3.001  0.372   1.00 0.00 ? 74  PHE A CZ   4  
ATOM 6422  H H    . PHE A 1 74  ? -0.069  -10.009 0.045   1.00 0.00 ? 74  PHE A H    4  
ATOM 6423  H HA   . PHE A 1 74  ? -1.563  -7.617  -0.774  1.00 0.00 ? 74  PHE A HA   4  
ATOM 6424  H HB2  . PHE A 1 74  ? -0.608  -7.558  1.648   1.00 0.00 ? 74  PHE A HB2  4  
ATOM 6425  H HB3  . PHE A 1 74  ? 0.951   -7.355  0.855   1.00 0.00 ? 74  PHE A HB3  4  
ATOM 6426  H HD1  . PHE A 1 74  ? -2.419  -5.960  0.035   1.00 0.00 ? 74  PHE A HD1  4  
ATOM 6427  H HD2  . PHE A 1 74  ? 1.607   -5.158  1.193   1.00 0.00 ? 74  PHE A HD2  4  
ATOM 6428  H HE1  . PHE A 1 74  ? -2.831  -3.548  -0.192  1.00 0.00 ? 74  PHE A HE1  4  
ATOM 6429  H HE2  . PHE A 1 74  ? 1.193   -2.750  0.966   1.00 0.00 ? 74  PHE A HE2  4  
ATOM 6430  H HZ   . PHE A 1 74  ? -1.024  -1.941  0.274   1.00 0.00 ? 74  PHE A HZ   4  
ATOM 6431  N N    . GLY A 1 75  ? 0.570   -6.745  -2.143  1.00 0.00 ? 75  GLY A N    4  
ATOM 6432  C CA   . GLY A 1 75  ? 1.481   -6.586  -3.263  1.00 0.00 ? 75  GLY A CA   4  
ATOM 6433  C C    . GLY A 1 75  ? 0.941   -7.251  -4.511  1.00 0.00 ? 75  GLY A C    4  
ATOM 6434  O O    . GLY A 1 75  ? 1.676   -7.505  -5.467  1.00 0.00 ? 75  GLY A O    4  
ATOM 6435  H H    . GLY A 1 75  ? 0.086   -5.971  -1.790  1.00 0.00 ? 75  GLY A H    4  
ATOM 6436  H HA2  . GLY A 1 75  ? 1.623   -5.534  -3.456  1.00 0.00 ? 75  GLY A HA2  4  
ATOM 6437  H HA3  . GLY A 1 75  ? 2.433   -7.030  -3.011  1.00 0.00 ? 75  GLY A HA3  4  
ATOM 6438  N N    . THR A 1 76  ? -0.357  -7.526  -4.490  1.00 0.00 ? 76  THR A N    4  
ATOM 6439  C CA   . THR A 1 76  ? -1.046  -8.164  -5.607  1.00 0.00 ? 76  THR A CA   4  
ATOM 6440  C C    . THR A 1 76  ? -2.490  -7.681  -5.682  1.00 0.00 ? 76  THR A C    4  
ATOM 6441  O O    . THR A 1 76  ? -2.992  -7.072  -4.736  1.00 0.00 ? 76  THR A O    4  
ATOM 6442  C CB   . THR A 1 76  ? -1.031  -9.697  -5.481  1.00 0.00 ? 76  THR A CB   4  
ATOM 6443  O OG1  . THR A 1 76  ? 0.116   -10.119 -4.735  1.00 0.00 ? 76  THR A OG1  4  
ATOM 6444  C CG2  . THR A 1 76  ? -1.016  -10.350 -6.856  1.00 0.00 ? 76  THR A CG2  4  
ATOM 6445  H H    . THR A 1 76  ? -0.873  -7.286  -3.692  1.00 0.00 ? 76  THR A H    4  
ATOM 6446  H HA   . THR A 1 76  ? -0.533  -7.887  -6.517  1.00 0.00 ? 76  THR A HA   4  
ATOM 6447  H HB   . THR A 1 76  ? -1.925  -10.009 -4.962  1.00 0.00 ? 76  THR A HB   4  
ATOM 6448  H HG1  . THR A 1 76  ? 0.012   -11.038 -4.478  1.00 0.00 ? 76  THR A HG1  4  
ATOM 6449  H HG21 . THR A 1 76  ? -1.953  -10.864 -7.021  1.00 0.00 ? 76  THR A HG21 4  
ATOM 6450  H HG22 . THR A 1 76  ? -0.204  -11.060 -6.909  1.00 0.00 ? 76  THR A HG22 4  
ATOM 6451  H HG23 . THR A 1 76  ? -0.884  -9.592  -7.614  1.00 0.00 ? 76  THR A HG23 4  
ATOM 6452  N N    . VAL A 1 77  ? -3.160  -7.947  -6.795  1.00 0.00 ? 77  VAL A N    4  
ATOM 6453  C CA   . VAL A 1 77  ? -4.548  -7.532  -6.946  1.00 0.00 ? 77  VAL A CA   4  
ATOM 6454  C C    . VAL A 1 77  ? -5.422  -8.282  -5.943  1.00 0.00 ? 77  VAL A C    4  
ATOM 6455  O O    . VAL A 1 77  ? -5.781  -9.440  -6.160  1.00 0.00 ? 77  VAL A O    4  
ATOM 6456  C CB   . VAL A 1 77  ? -5.074  -7.784  -8.372  1.00 0.00 ? 77  VAL A CB   4  
ATOM 6457  C CG1  . VAL A 1 77  ? -6.358  -7.004  -8.614  1.00 0.00 ? 77  VAL A CG1  4  
ATOM 6458  C CG2  . VAL A 1 77  ? -4.019  -7.422  -9.407  1.00 0.00 ? 77  VAL A CG2  4  
ATOM 6459  H H    . VAL A 1 77  ? -2.719  -8.436  -7.523  1.00 0.00 ? 77  VAL A H    4  
ATOM 6460  H HA   . VAL A 1 77  ? -4.606  -6.474  -6.741  1.00 0.00 ? 77  VAL A HA   4  
ATOM 6461  H HB   . VAL A 1 77  ? -5.298  -8.837  -8.471  1.00 0.00 ? 77  VAL A HB   4  
ATOM 6462  H HG11 . VAL A 1 77  ? -6.168  -6.211  -9.322  1.00 0.00 ? 77  VAL A HG11 4  
ATOM 6463  H HG12 . VAL A 1 77  ? -6.700  -6.578  -7.681  1.00 0.00 ? 77  VAL A HG12 4  
ATOM 6464  H HG13 . VAL A 1 77  ? -7.113  -7.665  -9.007  1.00 0.00 ? 77  VAL A HG13 4  
ATOM 6465  H HG21 . VAL A 1 77  ? -3.968  -8.197  -10.156 1.00 0.00 ? 77  VAL A HG21 4  
ATOM 6466  H HG22 . VAL A 1 77  ? -3.058  -7.327  -8.921  1.00 0.00 ? 77  VAL A HG22 4  
ATOM 6467  H HG23 . VAL A 1 77  ? -4.280  -6.484  -9.874  1.00 0.00 ? 77  VAL A HG23 4  
ATOM 6468  N N    . VAL A 1 78  ? -5.737  -7.619  -4.834  1.00 0.00 ? 78  VAL A N    4  
ATOM 6469  C CA   . VAL A 1 78  ? -6.543  -8.226  -3.779  1.00 0.00 ? 78  VAL A CA   4  
ATOM 6470  C C    . VAL A 1 78  ? -7.722  -7.348  -3.381  1.00 0.00 ? 78  VAL A C    4  
ATOM 6471  O O    . VAL A 1 78  ? -7.871  -6.226  -3.862  1.00 0.00 ? 78  VAL A O    4  
ATOM 6472  C CB   . VAL A 1 78  ? -5.698  -8.479  -2.517  1.00 0.00 ? 78  VAL A CB   4  
ATOM 6473  C CG1  . VAL A 1 78  ? -4.768  -9.661  -2.713  1.00 0.00 ? 78  VAL A CG1  4  
ATOM 6474  C CG2  . VAL A 1 78  ? -4.910  -7.230  -2.152  1.00 0.00 ? 78  VAL A CG2  4  
ATOM 6475  H H    . VAL A 1 78  ? -5.403  -6.706  -4.713  1.00 0.00 ? 78  VAL A H    4  
ATOM 6476  H HA   . VAL A 1 78  ? -6.911  -9.177  -4.137  1.00 0.00 ? 78  VAL A HA   4  
ATOM 6477  H HB   . VAL A 1 78  ? -6.367  -8.706  -1.701  1.00 0.00 ? 78  VAL A HB   4  
ATOM 6478  H HG11 . VAL A 1 78  ? -4.009  -9.648  -1.944  1.00 0.00 ? 78  VAL A HG11 4  
ATOM 6479  H HG12 . VAL A 1 78  ? -4.300  -9.595  -3.684  1.00 0.00 ? 78  VAL A HG12 4  
ATOM 6480  H HG13 . VAL A 1 78  ? -5.333  -10.578 -2.646  1.00 0.00 ? 78  VAL A HG13 4  
ATOM 6481  H HG21 . VAL A 1 78  ? -5.371  -6.366  -2.607  1.00 0.00 ? 78  VAL A HG21 4  
ATOM 6482  H HG22 . VAL A 1 78  ? -3.896  -7.327  -2.509  1.00 0.00 ? 78  VAL A HG22 4  
ATOM 6483  H HG23 . VAL A 1 78  ? -4.904  -7.109  -1.078  1.00 0.00 ? 78  VAL A HG23 4  
ATOM 6484  N N    . ASP A 1 79  ? -8.540  -7.867  -2.470  1.00 0.00 ? 79  ASP A N    4  
ATOM 6485  C CA   . ASP A 1 79  ? -9.695  -7.140  -1.963  1.00 0.00 ? 79  ASP A CA   4  
ATOM 6486  C C    . ASP A 1 79  ? -9.295  -6.354  -0.720  1.00 0.00 ? 79  ASP A C    4  
ATOM 6487  O O    . ASP A 1 79  ? -8.991  -6.937  0.319   1.00 0.00 ? 79  ASP A O    4  
ATOM 6488  C CB   . ASP A 1 79  ? -10.832 -8.107  -1.632  1.00 0.00 ? 79  ASP A CB   4  
ATOM 6489  C CG   . ASP A 1 79  ? -11.767 -8.321  -2.807  1.00 0.00 ? 79  ASP A CG   4  
ATOM 6490  O OD1  . ASP A 1 79  ? -12.635 -7.456  -3.042  1.00 0.00 ? 79  ASP A OD1  4  
ATOM 6491  O OD2  . ASP A 1 79  ? -11.630 -9.357  -3.491  1.00 0.00 ? 79  ASP A OD2  4  
ATOM 6492  H H    . ASP A 1 79  ? -8.345  -8.760  -2.115  1.00 0.00 ? 79  ASP A H    4  
ATOM 6493  H HA   . ASP A 1 79  ? -10.020 -6.450  -2.727  1.00 0.00 ? 79  ASP A HA   4  
ATOM 6494  H HB2  . ASP A 1 79  ? -10.413 -9.061  -1.350  1.00 0.00 ? 79  ASP A HB2  4  
ATOM 6495  H HB3  . ASP A 1 79  ? -11.405 -7.710  -0.807  1.00 0.00 ? 79  ASP A HB3  4  
ATOM 6496  N N    . ILE A 1 80  ? -9.283  -5.032  -0.835  1.00 0.00 ? 80  ILE A N    4  
ATOM 6497  C CA   . ILE A 1 80  ? -8.898  -4.175  0.279   1.00 0.00 ? 80  ILE A CA   4  
ATOM 6498  C C    . ILE A 1 80  ? -10.118 -3.581  0.978   1.00 0.00 ? 80  ILE A C    4  
ATOM 6499  O O    . ILE A 1 80  ? -11.240 -3.687  0.487   1.00 0.00 ? 80  ILE A O    4  
ATOM 6500  C CB   . ILE A 1 80  ? -7.978  -3.030  -0.191  1.00 0.00 ? 80  ILE A CB   4  
ATOM 6501  C CG1  . ILE A 1 80  ? -8.779  -1.949  -0.921  1.00 0.00 ? 80  ILE A CG1  4  
ATOM 6502  C CG2  . ILE A 1 80  ? -6.877  -3.574  -1.089  1.00 0.00 ? 80  ILE A CG2  4  
ATOM 6503  C CD1  . ILE A 1 80  ? -8.275  -0.546  -0.660  1.00 0.00 ? 80  ILE A CD1  4  
ATOM 6504  H H    . ILE A 1 80  ? -9.531  -4.622  -1.690  1.00 0.00 ? 80  ILE A H    4  
ATOM 6505  H HA   . ILE A 1 80  ? -8.347  -4.779  0.986   1.00 0.00 ? 80  ILE A HA   4  
ATOM 6506  H HB   . ILE A 1 80  ? -7.512  -2.595  0.681   1.00 0.00 ? 80  ILE A HB   4  
ATOM 6507  H HG12 . ILE A 1 80  ? -8.728  -2.127  -1.984  1.00 0.00 ? 80  ILE A HG12 4  
ATOM 6508  H HG13 . ILE A 1 80  ? -9.810  -1.995  -0.602  1.00 0.00 ? 80  ILE A HG13 4  
ATOM 6509  H HG21 . ILE A 1 80  ? -6.973  -4.646  -1.170  1.00 0.00 ? 80  ILE A HG21 4  
ATOM 6510  H HG22 . ILE A 1 80  ? -5.913  -3.331  -0.666  1.00 0.00 ? 80  ILE A HG22 4  
ATOM 6511  H HG23 . ILE A 1 80  ? -6.960  -3.130  -2.069  1.00 0.00 ? 80  ILE A HG23 4  
ATOM 6512  H HD11 . ILE A 1 80  ? -7.194  -0.540  -0.693  1.00 0.00 ? 80  ILE A HD11 4  
ATOM 6513  H HD12 . ILE A 1 80  ? -8.607  -0.219  0.313   1.00 0.00 ? 80  ILE A HD12 4  
ATOM 6514  H HD13 . ILE A 1 80  ? -8.660  0.122   -1.416  1.00 0.00 ? 80  ILE A HD13 4  
ATOM 6515  N N    . ILE A 1 81  ? -9.880  -2.949  2.123   1.00 0.00 ? 81  ILE A N    4  
ATOM 6516  C CA   . ILE A 1 81  ? -10.946 -2.321  2.897   1.00 0.00 ? 81  ILE A CA   4  
ATOM 6517  C C    . ILE A 1 81  ? -10.484 -0.969  3.431   1.00 0.00 ? 81  ILE A C    4  
ATOM 6518  O O    . ILE A 1 81  ? -9.416  -0.864  4.026   1.00 0.00 ? 81  ILE A O    4  
ATOM 6519  C CB   . ILE A 1 81  ? -11.389 -3.206  4.078   1.00 0.00 ? 81  ILE A CB   4  
ATOM 6520  C CG1  . ILE A 1 81  ? -10.199 -3.988  4.635   1.00 0.00 ? 81  ILE A CG1  4  
ATOM 6521  C CG2  . ILE A 1 81  ? -12.497 -4.153  3.644   1.00 0.00 ? 81  ILE A CG2  4  
ATOM 6522  C CD1  . ILE A 1 81  ? -9.914  -3.693  6.092   1.00 0.00 ? 81  ILE A CD1  4  
ATOM 6523  H H    . ILE A 1 81  ? -8.960  -2.899  2.455   1.00 0.00 ? 81  ILE A H    4  
ATOM 6524  H HA   . ILE A 1 81  ? -11.793 -2.171  2.243   1.00 0.00 ? 81  ILE A HA   4  
ATOM 6525  H HB   . ILE A 1 81  ? -11.783 -2.563  4.852   1.00 0.00 ? 81  ILE A HB   4  
ATOM 6526  H HG12 . ILE A 1 81  ? -10.396 -5.044  4.543   1.00 0.00 ? 81  ILE A HG12 4  
ATOM 6527  H HG13 . ILE A 1 81  ? -9.314  -3.737  4.065   1.00 0.00 ? 81  ILE A HG13 4  
ATOM 6528  H HG21 . ILE A 1 81  ? -12.847 -4.713  4.499   1.00 0.00 ? 81  ILE A HG21 4  
ATOM 6529  H HG22 . ILE A 1 81  ? -12.115 -4.836  2.898   1.00 0.00 ? 81  ILE A HG22 4  
ATOM 6530  H HG23 . ILE A 1 81  ? -13.314 -3.584  3.228   1.00 0.00 ? 81  ILE A HG23 4  
ATOM 6531  H HD11 . ILE A 1 81  ? -10.717 -3.097  6.502   1.00 0.00 ? 81  ILE A HD11 4  
ATOM 6532  H HD12 . ILE A 1 81  ? -8.984  -3.149  6.174   1.00 0.00 ? 81  ILE A HD12 4  
ATOM 6533  H HD13 . ILE A 1 81  ? -9.838  -4.621  6.640   1.00 0.00 ? 81  ILE A HD13 4  
ATOM 6534  N N    . SER A 1 82  ? -11.292 0.062   3.216   1.00 0.00 ? 82  SER A N    4  
ATOM 6535  C CA   . SER A 1 82  ? -10.948 1.403   3.677   1.00 0.00 ? 82  SER A CA   4  
ATOM 6536  C C    . SER A 1 82  ? -11.471 1.659   5.085   1.00 0.00 ? 82  SER A C    4  
ATOM 6537  O O    . SER A 1 82  ? -12.230 0.860   5.632   1.00 0.00 ? 82  SER A O    4  
ATOM 6538  C CB   . SER A 1 82  ? -11.502 2.456   2.715   1.00 0.00 ? 82  SER A CB   4  
ATOM 6539  O OG   . SER A 1 82  ? -12.695 3.032   3.216   1.00 0.00 ? 82  SER A OG   4  
ATOM 6540  H H    . SER A 1 82  ? -12.139 -0.082  2.743   1.00 0.00 ? 82  SER A H    4  
ATOM 6541  H HA   . SER A 1 82  ? -9.869  1.478   3.692   1.00 0.00 ? 82  SER A HA   4  
ATOM 6542  H HB2  . SER A 1 82  ? -10.769 3.238   2.579   1.00 0.00 ? 82  SER A HB2  4  
ATOM 6543  H HB3  . SER A 1 82  ? -11.712 1.993   1.761   1.00 0.00 ? 82  SER A HB3  4  
ATOM 6544  H HG   . SER A 1 82  ? -12.661 3.984   3.107   1.00 0.00 ? 82  SER A HG   4  
ATOM 6545  N N    . ARG A 1 83  ? -11.048 2.778   5.666   1.00 0.00 ? 83  ARG A N    4  
ATOM 6546  C CA   . ARG A 1 83  ? -11.460 3.153   7.019   1.00 0.00 ? 83  ARG A CA   4  
ATOM 6547  C C    . ARG A 1 83  ? -12.977 3.076   7.197   1.00 0.00 ? 83  ARG A C    4  
ATOM 6548  O O    . ARG A 1 83  ? -13.467 2.912   8.314   1.00 0.00 ? 83  ARG A O    4  
ATOM 6549  C CB   . ARG A 1 83  ? -10.976 4.568   7.349   1.00 0.00 ? 83  ARG A CB   4  
ATOM 6550  C CG   . ARG A 1 83  ? -11.825 5.667   6.726   1.00 0.00 ? 83  ARG A CG   4  
ATOM 6551  C CD   . ARG A 1 83  ? -11.000 6.903   6.412   1.00 0.00 ? 83  ARG A CD   4  
ATOM 6552  N NE   . ARG A 1 83  ? -11.453 8.070   7.164   1.00 0.00 ? 83  ARG A NE   4  
ATOM 6553  C CZ   . ARG A 1 83  ? -10.636 8.897   7.807   1.00 0.00 ? 83  ARG A CZ   4  
ATOM 6554  N NH1  . ARG A 1 83  ? -9.326  8.689   7.791   1.00 0.00 ? 83  ARG A NH1  4  
ATOM 6555  N NH2  . ARG A 1 83  ? -11.128 9.937   8.467   1.00 0.00 ? 83  ARG A NH2  4  
ATOM 6556  H H    . ARG A 1 83  ? -10.428 3.364   5.175   1.00 0.00 ? 83  ARG A H    4  
ATOM 6557  H HA   . ARG A 1 83  ? -10.997 2.461   7.705   1.00 0.00 ? 83  ARG A HA   4  
ATOM 6558  H HB2  . ARG A 1 83  ? -10.987 4.698   8.420   1.00 0.00 ? 83  ARG A HB2  4  
ATOM 6559  H HB3  . ARG A 1 83  ? -9.963  4.679   6.992   1.00 0.00 ? 83  ARG A HB3  4  
ATOM 6560  H HG2  . ARG A 1 83  ? -12.260 5.295   5.810   1.00 0.00 ? 83  ARG A HG2  4  
ATOM 6561  H HG3  . ARG A 1 83  ? -12.611 5.934   7.417   1.00 0.00 ? 83  ARG A HG3  4  
ATOM 6562  H HD2  . ARG A 1 83  ? -9.967  6.703   6.661   1.00 0.00 ? 83  ARG A HD2  4  
ATOM 6563  H HD3  . ARG A 1 83  ? -11.077 7.114   5.355   1.00 0.00 ? 83  ARG A HD3  4  
ATOM 6564  H HE   . ARG A 1 83  ? -12.417 8.244   7.192   1.00 0.00 ? 83  ARG A HE   4  
ATOM 6565  H HH11 . ARG A 1 83  ? -8.950  7.905   7.297   1.00 0.00 ? 83  ARG A HH11 4  
ATOM 6566  H HH12 . ARG A 1 83  ? -8.714  9.314   8.275   1.00 0.00 ? 83  ARG A HH12 4  
ATOM 6567  H HH21 . ARG A 1 83  ? -12.115 10.098  8.480   1.00 0.00 ? 83  ARG A HH21 4  
ATOM 6568  H HH22 . ARG A 1 83  ? -10.513 10.559  8.950   1.00 0.00 ? 83  ARG A HH22 4  
ATOM 6569  N N    . SER A 1 84  ? -13.719 3.206   6.099   1.00 0.00 ? 84  SER A N    4  
ATOM 6570  C CA   . SER A 1 84  ? -15.176 3.159   6.158   1.00 0.00 ? 84  SER A CA   4  
ATOM 6571  C C    . SER A 1 84  ? -15.702 1.767   5.826   1.00 0.00 ? 84  SER A C    4  
ATOM 6572  O O    . SER A 1 84  ? -16.826 1.414   6.186   1.00 0.00 ? 84  SER A O    4  
ATOM 6573  C CB   . SER A 1 84  ? -15.778 4.186   5.195   1.00 0.00 ? 84  SER A CB   4  
ATOM 6574  O OG   . SER A 1 84  ? -15.244 4.038   3.892   1.00 0.00 ? 84  SER A OG   4  
ATOM 6575  H H    . SER A 1 84  ? -13.278 3.341   5.234   1.00 0.00 ? 84  SER A H    4  
ATOM 6576  H HA   . SER A 1 84  ? -15.474 3.411   7.164   1.00 0.00 ? 84  SER A HA   4  
ATOM 6577  H HB2  . SER A 1 84  ? -16.849 4.049   5.150   1.00 0.00 ? 84  SER A HB2  4  
ATOM 6578  H HB3  . SER A 1 84  ? -15.558 5.182   5.551   1.00 0.00 ? 84  SER A HB3  4  
ATOM 6579  H HG   . SER A 1 84  ? -15.558 3.216   3.509   1.00 0.00 ? 84  SER A HG   4  
ATOM 6580  N N    . GLY A 1 85  ? -14.886 0.981   5.134   1.00 0.00 ? 85  GLY A N    4  
ATOM 6581  C CA   . GLY A 1 85  ? -15.291 -0.361  4.763   1.00 0.00 ? 85  GLY A CA   4  
ATOM 6582  C C    . GLY A 1 85  ? -15.704 -0.454  3.311   1.00 0.00 ? 85  GLY A C    4  
ATOM 6583  O O    . GLY A 1 85  ? -16.840 -0.133  2.960   1.00 0.00 ? 85  GLY A O    4  
ATOM 6584  H H    . GLY A 1 85  ? -14.004 1.317   4.871   1.00 0.00 ? 85  GLY A H    4  
ATOM 6585  H HA2  . GLY A 1 85  ? -14.467 -1.039  4.934   1.00 0.00 ? 85  GLY A HA2  4  
ATOM 6586  H HA3  . GLY A 1 85  ? -16.122 -0.659  5.379   1.00 0.00 ? 85  GLY A HA3  4  
ATOM 6587  N N    . GLU A 1 86  ? -14.783 -0.896  2.468   1.00 0.00 ? 86  GLU A N    4  
ATOM 6588  C CA   . GLU A 1 86  ? -15.053 -1.037  1.043   1.00 0.00 ? 86  GLU A CA   4  
ATOM 6589  C C    . GLU A 1 86  ? -14.355 -2.272  0.487   1.00 0.00 ? 86  GLU A C    4  
ATOM 6590  O O    . GLU A 1 86  ? -13.229 -2.190  -0.003  1.00 0.00 ? 86  GLU A O    4  
ATOM 6591  C CB   . GLU A 1 86  ? -14.590 0.211   0.284   1.00 0.00 ? 86  GLU A CB   4  
ATOM 6592  C CG   . GLU A 1 86  ? -14.913 1.520   0.989   1.00 0.00 ? 86  GLU A CG   4  
ATOM 6593  C CD   . GLU A 1 86  ? -14.745 2.725   0.086   1.00 0.00 ? 86  GLU A CD   4  
ATOM 6594  O OE1  . GLU A 1 86  ? -15.117 2.633   -1.104  1.00 0.00 ? 86  GLU A OE1  4  
ATOM 6595  O OE2  . GLU A 1 86  ? -14.244 3.762   0.567   1.00 0.00 ? 86  GLU A OE2  4  
ATOM 6596  H H    . GLU A 1 86  ? -13.899 -1.142  2.813   1.00 0.00 ? 86  GLU A H    4  
ATOM 6597  H HA   . GLU A 1 86  ? -16.118 -1.150  0.915   1.00 0.00 ? 86  GLU A HA   4  
ATOM 6598  H HB2  . GLU A 1 86  ? -13.520 0.158   0.146   1.00 0.00 ? 86  GLU A HB2  4  
ATOM 6599  H HB3  . GLU A 1 86  ? -15.069 0.223   -0.682  1.00 0.00 ? 86  GLU A HB3  4  
ATOM 6600  H HG2  . GLU A 1 86  ? -15.935 1.486   1.333   1.00 0.00 ? 86  GLU A HG2  4  
ATOM 6601  H HG3  . GLU A 1 86  ? -14.252 1.629   1.837   1.00 0.00 ? 86  GLU A HG3  4  
ATOM 6602  N N    . LYS A 1 87  ? -15.028 -3.414  0.576   1.00 0.00 ? 87  LYS A N    4  
ATOM 6603  C CA   . LYS A 1 87  ? -14.470 -4.675  0.088   1.00 0.00 ? 87  LYS A CA   4  
ATOM 6604  C C    . LYS A 1 87  ? -14.542 -4.757  -1.434  1.00 0.00 ? 87  LYS A C    4  
ATOM 6605  O O    . LYS A 1 87  ? -15.318 -5.535  -1.990  1.00 0.00 ? 87  LYS A O    4  
ATOM 6606  C CB   . LYS A 1 87  ? -15.198 -5.874  0.710   1.00 0.00 ? 87  LYS A CB   4  
ATOM 6607  C CG   . LYS A 1 87  ? -16.324 -5.499  1.662   1.00 0.00 ? 87  LYS A CG   4  
ATOM 6608  C CD   . LYS A 1 87  ? -15.800 -5.207  3.059   1.00 0.00 ? 87  LYS A CD   4  
ATOM 6609  C CE   . LYS A 1 87  ? -15.419 -6.483  3.791   1.00 0.00 ? 87  LYS A CE   4  
ATOM 6610  N NZ   . LYS A 1 87  ? -15.801 -6.435  5.228   1.00 0.00 ? 87  LYS A NZ   4  
ATOM 6611  H H    . LYS A 1 87  ? -15.919 -3.411  0.981   1.00 0.00 ? 87  LYS A H    4  
ATOM 6612  H HA   . LYS A 1 87  ? -13.433 -4.707  0.385   1.00 0.00 ? 87  LYS A HA   4  
ATOM 6613  H HB2  . LYS A 1 87  ? -15.616 -6.474  -0.084  1.00 0.00 ? 87  LYS A HB2  4  
ATOM 6614  H HB3  . LYS A 1 87  ? -14.481 -6.471  1.255   1.00 0.00 ? 87  LYS A HB3  4  
ATOM 6615  H HG2  . LYS A 1 87  ? -16.824 -4.620  1.284   1.00 0.00 ? 87  LYS A HG2  4  
ATOM 6616  H HG3  . LYS A 1 87  ? -17.025 -6.320  1.715   1.00 0.00 ? 87  LYS A HG3  4  
ATOM 6617  H HD2  . LYS A 1 87  ? -14.927 -4.575  2.980   1.00 0.00 ? 87  LYS A HD2  4  
ATOM 6618  H HD3  . LYS A 1 87  ? -16.568 -4.695  3.621   1.00 0.00 ? 87  LYS A HD3  4  
ATOM 6619  H HE2  . LYS A 1 87  ? -15.924 -7.315  3.322   1.00 0.00 ? 87  LYS A HE2  4  
ATOM 6620  H HE3  . LYS A 1 87  ? -14.351 -6.623  3.713   1.00 0.00 ? 87  LYS A HE3  4  
ATOM 6621  H HZ1  . LYS A 1 87  ? -15.948 -7.397  5.593   1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 6622  H HZ2  . LYS A 1 87  ? -16.680 -5.892  5.347   1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 6623  H HZ3  . LYS A 1 87  ? -15.048 -5.976  5.782   1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 6624  N N    . ILE A 1 88  ? -13.724 -3.950  -2.103  1.00 0.00 ? 88  ILE A N    4  
ATOM 6625  C CA   . ILE A 1 88  ? -13.692 -3.929  -3.562  1.00 0.00 ? 88  ILE A CA   4  
ATOM 6626  C C    . ILE A 1 88  ? -12.345 -4.423  -4.088  1.00 0.00 ? 88  ILE A C    4  
ATOM 6627  O O    . ILE A 1 88  ? -11.315 -4.255  -3.434  1.00 0.00 ? 88  ILE A O    4  
ATOM 6628  C CB   . ILE A 1 88  ? -13.956 -2.512  -4.108  1.00 0.00 ? 88  ILE A CB   4  
ATOM 6629  C CG1  . ILE A 1 88  ? -12.911 -1.530  -3.575  1.00 0.00 ? 88  ILE A CG1  4  
ATOM 6630  C CG2  . ILE A 1 88  ? -15.360 -2.055  -3.737  1.00 0.00 ? 88  ILE A CG2  4  
ATOM 6631  C CD1  . ILE A 1 88  ? -12.334 -0.623  -4.639  1.00 0.00 ? 88  ILE A CD1  4  
ATOM 6632  H H    . ILE A 1 88  ? -13.131 -3.352  -1.603  1.00 0.00 ? 88  ILE A H    4  
ATOM 6633  H HA   . ILE A 1 88  ? -14.473 -4.584  -3.921  1.00 0.00 ? 88  ILE A HA   4  
ATOM 6634  H HB   . ILE A 1 88  ? -13.889 -2.548  -5.186  1.00 0.00 ? 88  ILE A HB   4  
ATOM 6635  H HG12 . ILE A 1 88  ? -13.363 -0.907  -2.819  1.00 0.00 ? 88  ILE A HG12 4  
ATOM 6636  H HG13 . ILE A 1 88  ? -12.096 -2.087  -3.135  1.00 0.00 ? 88  ILE A HG13 4  
ATOM 6637  H HG21 . ILE A 1 88  ? -16.082 -2.753  -4.133  1.00 0.00 ? 88  ILE A HG21 4  
ATOM 6638  H HG22 . ILE A 1 88  ? -15.540 -1.074  -4.153  1.00 0.00 ? 88  ILE A HG22 4  
ATOM 6639  H HG23 . ILE A 1 88  ? -15.451 -2.011  -2.661  1.00 0.00 ? 88  ILE A HG23 4  
ATOM 6640  H HD11 . ILE A 1 88  ? -11.259 -0.601  -4.549  1.00 0.00 ? 88  ILE A HD11 4  
ATOM 6641  H HD12 . ILE A 1 88  ? -12.727 0.375   -4.514  1.00 0.00 ? 88  ILE A HD12 4  
ATOM 6642  H HD13 . ILE A 1 88  ? -12.604 -0.996  -5.615  1.00 0.00 ? 88  ILE A HD13 4  
ATOM 6643  N N    . PRO A 1 89  ? -12.332 -5.041  -5.284  1.00 0.00 ? 89  PRO A N    4  
ATOM 6644  C CA   . PRO A 1 89  ? -11.105 -5.555  -5.894  1.00 0.00 ? 89  PRO A CA   4  
ATOM 6645  C C    . PRO A 1 89  ? -10.166 -4.433  -6.314  1.00 0.00 ? 89  PRO A C    4  
ATOM 6646  O O    . PRO A 1 89  ? -10.579 -3.477  -6.973  1.00 0.00 ? 89  PRO A O    4  
ATOM 6647  C CB   . PRO A 1 89  ? -11.589 -6.330  -7.124  1.00 0.00 ? 89  PRO A CB   4  
ATOM 6648  C CG   . PRO A 1 89  ? -13.070 -6.454  -6.972  1.00 0.00 ? 89  PRO A CG   4  
ATOM 6649  C CD   . PRO A 1 89  ? -13.505 -5.287  -6.135  1.00 0.00 ? 89  PRO A CD   4  
ATOM 6650  H HA   . PRO A 1 89  ? -10.584 -6.225  -5.232  1.00 0.00 ? 89  PRO A HA   4  
ATOM 6651  H HB2  . PRO A 1 89  ? -11.329 -5.783  -8.012  1.00 0.00 ? 89  PRO A HB2  4  
ATOM 6652  H HB3  . PRO A 1 89  ? -11.115 -7.300  -7.147  1.00 0.00 ? 89  PRO A HB3  4  
ATOM 6653  H HG2  . PRO A 1 89  ? -13.542 -6.416  -7.942  1.00 0.00 ? 89  PRO A HG2  4  
ATOM 6654  H HG3  . PRO A 1 89  ? -13.311 -7.382  -6.473  1.00 0.00 ? 89  PRO A HG3  4  
ATOM 6655  H HD2  . PRO A 1 89  ? -13.717 -4.431  -6.759  1.00 0.00 ? 89  PRO A HD2  4  
ATOM 6656  H HD3  . PRO A 1 89  ? -14.367 -5.548  -5.539  1.00 0.00 ? 89  PRO A HD3  4  
ATOM 6657  N N    . VAL A 1 90  ? -8.899  -4.554  -5.933  1.00 0.00 ? 90  VAL A N    4  
ATOM 6658  C CA   . VAL A 1 90  ? -7.897  -3.550  -6.272  1.00 0.00 ? 90  VAL A CA   4  
ATOM 6659  C C    . VAL A 1 90  ? -6.564  -4.209  -6.602  1.00 0.00 ? 90  VAL A C    4  
ATOM 6660  O O    . VAL A 1 90  ? -6.226  -5.257  -6.056  1.00 0.00 ? 90  VAL A O    4  
ATOM 6661  C CB   . VAL A 1 90  ? -7.689  -2.542  -5.122  1.00 0.00 ? 90  VAL A CB   4  
ATOM 6662  C CG1  . VAL A 1 90  ? -6.783  -1.404  -5.564  1.00 0.00 ? 90  VAL A CG1  4  
ATOM 6663  C CG2  . VAL A 1 90  ? -9.023  -2.004  -4.627  1.00 0.00 ? 90  VAL A CG2  4  
ATOM 6664  H H    . VAL A 1 90  ? -8.628  -5.340  -5.417  1.00 0.00 ? 90  VAL A H    4  
ATOM 6665  H HA   . VAL A 1 90  ? -8.246  -3.010  -7.140  1.00 0.00 ? 90  VAL A HA   4  
ATOM 6666  H HB   . VAL A 1 90  ? -7.209  -3.056  -4.303  1.00 0.00 ? 90  VAL A HB   4  
ATOM 6667  H HG11 . VAL A 1 90  ? -7.386  -0.558  -5.862  1.00 0.00 ? 90  VAL A HG11 4  
ATOM 6668  H HG12 . VAL A 1 90  ? -6.179  -1.727  -6.399  1.00 0.00 ? 90  VAL A HG12 4  
ATOM 6669  H HG13 . VAL A 1 90  ? -6.140  -1.116  -4.746  1.00 0.00 ? 90  VAL A HG13 4  
ATOM 6670  H HG21 . VAL A 1 90  ? -8.878  -1.488  -3.690  1.00 0.00 ? 90  VAL A HG21 4  
ATOM 6671  H HG22 . VAL A 1 90  ? -9.713  -2.823  -4.486  1.00 0.00 ? 90  VAL A HG22 4  
ATOM 6672  H HG23 . VAL A 1 90  ? -9.428  -1.316  -5.357  1.00 0.00 ? 90  VAL A HG23 4  
ATOM 6673  N N    . SER A 1 91  ? -5.808  -3.578  -7.494  1.00 0.00 ? 91  SER A N    4  
ATOM 6674  C CA   . SER A 1 91  ? -4.504  -4.091  -7.896  1.00 0.00 ? 91  SER A CA   4  
ATOM 6675  C C    . SER A 1 91  ? -3.402  -3.447  -7.069  1.00 0.00 ? 91  SER A C    4  
ATOM 6676  O O    . SER A 1 91  ? -3.304  -2.222  -6.996  1.00 0.00 ? 91  SER A O    4  
ATOM 6677  C CB   . SER A 1 91  ? -4.265  -3.828  -9.382  1.00 0.00 ? 91  SER A CB   4  
ATOM 6678  O OG   . SER A 1 91  ? -5.351  -4.295  -10.166 1.00 0.00 ? 91  SER A OG   4  
ATOM 6679  H H    . SER A 1 91  ? -6.136  -2.742  -7.882  1.00 0.00 ? 91  SER A H    4  
ATOM 6680  H HA   . SER A 1 91  ? -4.498  -5.157  -7.721  1.00 0.00 ? 91  SER A HA   4  
ATOM 6681  H HB2  . SER A 1 91  ? -4.154  -2.767  -9.545  1.00 0.00 ? 91  SER A HB2  4  
ATOM 6682  H HB3  . SER A 1 91  ? -3.366  -4.337  -9.697  1.00 0.00 ? 91  SER A HB3  4  
ATOM 6683  H HG   . SER A 1 91  ? -6.078  -3.671  -10.108 1.00 0.00 ? 91  SER A HG   4  
ATOM 6684  N N    . VAL A 1 92  ? -2.573  -4.275  -6.436  1.00 0.00 ? 92  VAL A N    4  
ATOM 6685  C CA   . VAL A 1 92  ? -1.486  -3.770  -5.610  1.00 0.00 ? 92  VAL A CA   4  
ATOM 6686  C C    . VAL A 1 92  ? -0.136  -4.315  -6.063  1.00 0.00 ? 92  VAL A C    4  
ATOM 6687  O O    . VAL A 1 92  ? -0.008  -5.492  -6.387  1.00 0.00 ? 92  VAL A O    4  
ATOM 6688  C CB   . VAL A 1 92  ? -1.703  -4.140  -4.128  1.00 0.00 ? 92  VAL A CB   4  
ATOM 6689  C CG1  . VAL A 1 92  ? -0.539  -3.657  -3.275  1.00 0.00 ? 92  VAL A CG1  4  
ATOM 6690  C CG2  . VAL A 1 92  ? -3.018  -3.568  -3.623  1.00 0.00 ? 92  VAL A CG2  4  
ATOM 6691  H H    . VAL A 1 92  ? -2.697  -5.246  -6.525  1.00 0.00 ? 92  VAL A H    4  
ATOM 6692  H HA   . VAL A 1 92  ? -1.477  -2.694  -5.691  1.00 0.00 ? 92  VAL A HA   4  
ATOM 6693  H HB   . VAL A 1 92  ? -1.751  -5.217  -4.051  1.00 0.00 ? 92  VAL A HB   4  
ATOM 6694  H HG11 . VAL A 1 92  ? 0.384   -3.774  -3.824  1.00 0.00 ? 92  VAL A HG11 4  
ATOM 6695  H HG12 . VAL A 1 92  ? -0.494  -4.241  -2.366  1.00 0.00 ? 92  VAL A HG12 4  
ATOM 6696  H HG13 . VAL A 1 92  ? -0.682  -2.618  -3.024  1.00 0.00 ? 92  VAL A HG13 4  
ATOM 6697  H HG21 . VAL A 1 92  ? -3.034  -2.500  -3.789  1.00 0.00 ? 92  VAL A HG21 4  
ATOM 6698  H HG22 . VAL A 1 92  ? -3.117  -3.769  -2.566  1.00 0.00 ? 92  VAL A HG22 4  
ATOM 6699  H HG23 . VAL A 1 92  ? -3.839  -4.027  -4.156  1.00 0.00 ? 92  VAL A HG23 4  
ATOM 6700  N N    . TRP A 1 93  ? 0.869   -3.447  -6.069  1.00 0.00 ? 93  TRP A N    4  
ATOM 6701  C CA   . TRP A 1 93  ? 2.217   -3.843  -6.463  1.00 0.00 ? 93  TRP A CA   4  
ATOM 6702  C C    . TRP A 1 93  ? 3.261   -3.128  -5.614  1.00 0.00 ? 93  TRP A C    4  
ATOM 6703  O O    . TRP A 1 93  ? 3.436   -1.914  -5.717  1.00 0.00 ? 93  TRP A O    4  
ATOM 6704  C CB   . TRP A 1 93  ? 2.483   -3.586  -7.954  1.00 0.00 ? 93  TRP A CB   4  
ATOM 6705  C CG   . TRP A 1 93  ? 1.507   -2.663  -8.623  1.00 0.00 ? 93  TRP A CG   4  
ATOM 6706  C CD1  . TRP A 1 93  ? 0.183   -2.895  -8.870  1.00 0.00 ? 93  TRP A CD1  4  
ATOM 6707  C CD2  . TRP A 1 93  ? 1.791   -1.366  -9.162  1.00 0.00 ? 93  TRP A CD2  4  
ATOM 6708  N NE1  . TRP A 1 93  ? -0.374  -1.818  -9.513  1.00 0.00 ? 93  TRP A NE1  4  
ATOM 6709  C CE2  . TRP A 1 93  ? 0.592   -0.868  -9.706  1.00 0.00 ? 93  TRP A CE2  4  
ATOM 6710  C CE3  . TRP A 1 93  ? 2.942   -0.577  -9.232  1.00 0.00 ? 93  TRP A CE3  4  
ATOM 6711  C CZ2  . TRP A 1 93  ? 0.515   0.383   -10.311 1.00 0.00 ? 93  TRP A CZ2  4  
ATOM 6712  C CZ3  . TRP A 1 93  ? 2.862   0.664   -9.835  1.00 0.00 ? 93  TRP A CZ3  4  
ATOM 6713  C CH2  . TRP A 1 93  ? 1.658   1.134   -10.368 1.00 0.00 ? 93  TRP A CH2  4  
ATOM 6714  H H    . TRP A 1 93  ? 0.696   -2.522  -5.792  1.00 0.00 ? 93  TRP A H    4  
ATOM 6715  H HA   . TRP A 1 93  ? 2.303   -4.904  -6.277  1.00 0.00 ? 93  TRP A HA   4  
ATOM 6716  H HB2  . TRP A 1 93  ? 3.466   -3.153  -8.061  1.00 0.00 ? 93  TRP A HB2  4  
ATOM 6717  H HB3  . TRP A 1 93  ? 2.459   -4.530  -8.478  1.00 0.00 ? 93  TRP A HB3  4  
ATOM 6718  H HD1  . TRP A 1 93  ? -0.338  -3.798  -8.586  1.00 0.00 ? 93  TRP A HD1  4  
ATOM 6719  H HE1  . TRP A 1 93  ? -1.311  -1.743  -9.791  1.00 0.00 ? 93  TRP A HE1  4  
ATOM 6720  H HE3  . TRP A 1 93  ? 3.881   -0.919  -8.823  1.00 0.00 ? 93  TRP A HE3  4  
ATOM 6721  H HZ2  . TRP A 1 93  ? -0.408  0.760   -10.726 1.00 0.00 ? 93  TRP A HZ2  4  
ATOM 6722  H HZ3  . TRP A 1 93  ? 3.743   1.287   -9.899  1.00 0.00 ? 93  TRP A HZ3  4  
ATOM 6723  H HH2  . TRP A 1 93  ? 1.643   2.110   -10.828 1.00 0.00 ? 93  TRP A HH2  4  
ATOM 6724  N N    . MET A 1 94  ? 3.951   -3.894  -4.774  1.00 0.00 ? 94  MET A N    4  
ATOM 6725  C CA   . MET A 1 94  ? 4.980   -3.346  -3.900  1.00 0.00 ? 94  MET A CA   4  
ATOM 6726  C C    . MET A 1 94  ? 6.366   -3.562  -4.496  1.00 0.00 ? 94  MET A C    4  
ATOM 6727  O O    . MET A 1 94  ? 6.661   -4.629  -5.033  1.00 0.00 ? 94  MET A O    4  
ATOM 6728  C CB   . MET A 1 94  ? 4.898   -3.998  -2.517  1.00 0.00 ? 94  MET A CB   4  
ATOM 6729  C CG   . MET A 1 94  ? 5.139   -3.029  -1.370  1.00 0.00 ? 94  MET A CG   4  
ATOM 6730  S SD   . MET A 1 94  ? 4.909   -3.794  0.248   1.00 0.00 ? 94  MET A SD   4  
ATOM 6731  C CE   . MET A 1 94  ? 5.156   -2.389  1.332   1.00 0.00 ? 94  MET A CE   4  
ATOM 6732  H H    . MET A 1 94  ? 3.760   -4.855  -4.739  1.00 0.00 ? 94  MET A H    4  
ATOM 6733  H HA   . MET A 1 94  ? 4.803   -2.285  -3.800  1.00 0.00 ? 94  MET A HA   4  
ATOM 6734  H HB2  . MET A 1 94  ? 3.917   -4.431  -2.393  1.00 0.00 ? 94  MET A HB2  4  
ATOM 6735  H HB3  . MET A 1 94  ? 5.638   -4.783  -2.457  1.00 0.00 ? 94  MET A HB3  4  
ATOM 6736  H HG2  . MET A 1 94  ? 6.151   -2.661  -1.438  1.00 0.00 ? 94  MET A HG2  4  
ATOM 6737  H HG3  . MET A 1 94  ? 4.450   -2.204  -1.464  1.00 0.00 ? 94  MET A HG3  4  
ATOM 6738  H HE1  . MET A 1 94  ? 4.270   -2.235  1.930   1.00 0.00 ? 94  MET A HE1  4  
ATOM 6739  H HE2  . MET A 1 94  ? 5.349   -1.507  0.741   1.00 0.00 ? 94  MET A HE2  4  
ATOM 6740  H HE3  . MET A 1 94  ? 6.000   -2.579  1.981   1.00 0.00 ? 94  MET A HE3  4  
ATOM 6741  N N    . LYS A 1 95  ? 7.213   -2.543  -4.400  1.00 0.00 ? 95  LYS A N    4  
ATOM 6742  C CA   . LYS A 1 95  ? 8.569   -2.622  -4.932  1.00 0.00 ? 95  LYS A CA   4  
ATOM 6743  C C    . LYS A 1 95  ? 9.532   -1.788  -4.094  1.00 0.00 ? 95  LYS A C    4  
ATOM 6744  O O    . LYS A 1 95  ? 9.365   -0.574  -3.963  1.00 0.00 ? 95  LYS A O    4  
ATOM 6745  C CB   . LYS A 1 95  ? 8.599   -2.152  -6.387  1.00 0.00 ? 95  LYS A CB   4  
ATOM 6746  C CG   . LYS A 1 95  ? 7.662   -0.988  -6.672  1.00 0.00 ? 95  LYS A CG   4  
ATOM 6747  C CD   . LYS A 1 95  ? 6.909   -1.189  -7.977  1.00 0.00 ? 95  LYS A CD   4  
ATOM 6748  C CE   . LYS A 1 95  ? 6.508   0.138   -8.600  1.00 0.00 ? 95  LYS A CE   4  
ATOM 6749  N NZ   . LYS A 1 95  ? 7.345   0.471   -9.785  1.00 0.00 ? 95  LYS A NZ   4  
ATOM 6750  H H    . LYS A 1 95  ? 6.919   -1.716  -3.959  1.00 0.00 ? 95  LYS A H    4  
ATOM 6751  H HA   . LYS A 1 95  ? 8.880   -3.656  -4.891  1.00 0.00 ? 95  LYS A HA   4  
ATOM 6752  H HB2  . LYS A 1 95  ? 9.606   -1.844  -6.632  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 6753  H HB3  . LYS A 1 95  ? 8.318   -2.975  -7.025  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 6754  H HG2  . LYS A 1 95  ? 6.951   -0.906  -5.864  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 6755  H HG3  . LYS A 1 95  ? 8.244   -0.080  -6.737  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 6756  H HD2  . LYS A 1 95  ? 7.544   -1.722  -8.668  1.00 0.00 ? 95  LYS A HD2  4  
ATOM 6757  H HD3  . LYS A 1 95  ? 6.020   -1.769  -7.779  1.00 0.00 ? 95  LYS A HD3  4  
ATOM 6758  H HE2  . LYS A 1 95  ? 5.474   0.077   -8.907  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 6759  H HE3  . LYS A 1 95  ? 6.617   0.916   -7.861  1.00 0.00 ? 95  LYS A HE3  4  
ATOM 6760  H HZ1  . LYS A 1 95  ? 7.846   -0.378  -10.119 1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 6761  H HZ2  . LYS A 1 95  ? 8.047   1.196   -9.536  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 6762  H HZ3  . LYS A 1 95  ? 6.748   0.833   -10.555 1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 6763  N N    . ARG A 1 96  ? 10.537  -2.446  -3.527  1.00 0.00 ? 96  ARG A N    4  
ATOM 6764  C CA   . ARG A 1 96  ? 11.524  -1.765  -2.700  1.00 0.00 ? 96  ARG A CA   4  
ATOM 6765  C C    . ARG A 1 96  ? 12.460  -0.910  -3.551  1.00 0.00 ? 96  ARG A C    4  
ATOM 6766  O O    . ARG A 1 96  ? 13.438  -1.403  -4.111  1.00 0.00 ? 96  ARG A O    4  
ATOM 6767  C CB   . ARG A 1 96  ? 12.330  -2.780  -1.893  1.00 0.00 ? 96  ARG A CB   4  
ATOM 6768  C CG   . ARG A 1 96  ? 12.828  -3.957  -2.716  1.00 0.00 ? 96  ARG A CG   4  
ATOM 6769  C CD   . ARG A 1 96  ? 12.539  -5.281  -2.030  1.00 0.00 ? 96  ARG A CD   4  
ATOM 6770  N NE   . ARG A 1 96  ? 12.876  -6.423  -2.875  1.00 0.00 ? 96  ARG A NE   4  
ATOM 6771  C CZ   . ARG A 1 96  ? 12.825  -7.687  -2.467  1.00 0.00 ? 96  ARG A CZ   4  
ATOM 6772  N NH1  . ARG A 1 96  ? 12.454  -7.973  -1.226  1.00 0.00 ? 96  ARG A NH1  4  
ATOM 6773  N NH2  . ARG A 1 96  ? 13.145  -8.667  -3.301  1.00 0.00 ? 96  ARG A NH2  4  
ATOM 6774  H H    . ARG A 1 96  ? 10.616  -3.412  -3.665  1.00 0.00 ? 96  ARG A H    4  
ATOM 6775  H HA   . ARG A 1 96  ? 10.992  -1.120  -2.017  1.00 0.00 ? 96  ARG A HA   4  
ATOM 6776  H HB2  . ARG A 1 96  ? 13.185  -2.282  -1.462  1.00 0.00 ? 96  ARG A HB2  4  
ATOM 6777  H HB3  . ARG A 1 96  ? 11.710  -3.163  -1.096  1.00 0.00 ? 96  ARG A HB3  4  
ATOM 6778  H HG2  . ARG A 1 96  ? 12.334  -3.945  -3.676  1.00 0.00 ? 96  ARG A HG2  4  
ATOM 6779  H HG3  . ARG A 1 96  ? 13.895  -3.860  -2.857  1.00 0.00 ? 96  ARG A HG3  4  
ATOM 6780  H HD2  . ARG A 1 96  ? 13.120  -5.335  -1.121  1.00 0.00 ? 96  ARG A HD2  4  
ATOM 6781  H HD3  . ARG A 1 96  ? 11.488  -5.324  -1.785  1.00 0.00 ? 96  ARG A HD3  4  
ATOM 6782  H HE   . ARG A 1 96  ? 13.156  -6.236  -3.797  1.00 0.00 ? 96  ARG A HE   4  
ATOM 6783  H HH11 . ARG A 1 96  ? 12.212  -7.237  -0.593  1.00 0.00 ? 96  ARG A HH11 4  
ATOM 6784  H HH12 . ARG A 1 96  ? 12.415  -8.925  -0.922  1.00 0.00 ? 96  ARG A HH12 4  
ATOM 6785  H HH21 . ARG A 1 96  ? 13.424  -8.455  -4.237  1.00 0.00 ? 96  ARG A HH21 4  
ATOM 6786  H HH22 . ARG A 1 96  ? 13.106  -9.617  -2.992  1.00 0.00 ? 96  ARG A HH22 4  
ATOM 6787  N N    . MET A 1 97  ? 12.149  0.378   -3.634  1.00 0.00 ? 97  MET A N    4  
ATOM 6788  C CA   . MET A 1 97  ? 12.956  1.318   -4.404  1.00 0.00 ? 97  MET A CA   4  
ATOM 6789  C C    . MET A 1 97  ? 13.615  2.330   -3.474  1.00 0.00 ? 97  MET A C    4  
ATOM 6790  O O    . MET A 1 97  ? 13.471  2.242   -2.257  1.00 0.00 ? 97  MET A O    4  
ATOM 6791  C CB   . MET A 1 97  ? 12.092  2.039   -5.443  1.00 0.00 ? 97  MET A CB   4  
ATOM 6792  C CG   . MET A 1 97  ? 11.236  3.152   -4.861  1.00 0.00 ? 97  MET A CG   4  
ATOM 6793  S SD   . MET A 1 97  ? 10.562  4.245   -6.126  1.00 0.00 ? 97  MET A SD   4  
ATOM 6794  C CE   . MET A 1 97  ? 9.302   3.194   -6.846  1.00 0.00 ? 97  MET A CE   4  
ATOM 6795  H H    . MET A 1 97  ? 11.359  0.707   -3.159  1.00 0.00 ? 97  MET A H    4  
ATOM 6796  H HA   . MET A 1 97  ? 13.727  0.756   -4.912  1.00 0.00 ? 97  MET A HA   4  
ATOM 6797  H HB2  . MET A 1 97  ? 12.738  2.467   -6.195  1.00 0.00 ? 97  MET A HB2  4  
ATOM 6798  H HB3  . MET A 1 97  ? 11.438  1.319   -5.912  1.00 0.00 ? 97  MET A HB3  4  
ATOM 6799  H HG2  . MET A 1 97  ? 10.417  2.710   -4.314  1.00 0.00 ? 97  MET A HG2  4  
ATOM 6800  H HG3  . MET A 1 97  ? 11.844  3.737   -4.185  1.00 0.00 ? 97  MET A HG3  4  
ATOM 6801  H HE1  . MET A 1 97  ? 8.334   3.658   -6.721  1.00 0.00 ? 97  MET A HE1  4  
ATOM 6802  H HE2  . MET A 1 97  ? 9.309   2.234   -6.352  1.00 0.00 ? 97  MET A HE2  4  
ATOM 6803  H HE3  . MET A 1 97  ? 9.504   3.061   -7.899  1.00 0.00 ? 97  MET A HE3  4  
ATOM 6804  N N    . ARG A 1 98  ? 14.340  3.286   -4.045  1.00 0.00 ? 98  ARG A N    4  
ATOM 6805  C CA   . ARG A 1 98  ? 15.016  4.300   -3.244  1.00 0.00 ? 98  ARG A CA   4  
ATOM 6806  C C    . ARG A 1 98  ? 14.608  5.705   -3.674  1.00 0.00 ? 98  ARG A C    4  
ATOM 6807  O O    . ARG A 1 98  ? 14.533  6.005   -4.867  1.00 0.00 ? 98  ARG A O    4  
ATOM 6808  C CB   . ARG A 1 98  ? 16.532  4.142   -3.364  1.00 0.00 ? 98  ARG A CB   4  
ATOM 6809  C CG   . ARG A 1 98  ? 17.032  2.763   -2.971  1.00 0.00 ? 98  ARG A CG   4  
ATOM 6810  C CD   . ARG A 1 98  ? 18.226  2.850   -2.036  1.00 0.00 ? 98  ARG A CD   4  
ATOM 6811  N NE   . ARG A 1 98  ? 19.451  2.363   -2.666  1.00 0.00 ? 98  ARG A NE   4  
ATOM 6812  C CZ   . ARG A 1 98  ? 20.644  2.920   -2.485  1.00 0.00 ? 98  ARG A CZ   4  
ATOM 6813  N NH1  . ARG A 1 98  ? 20.773  3.985   -1.706  1.00 0.00 ? 98  ARG A NH1  4  
ATOM 6814  N NH2  . ARG A 1 98  ? 21.711  2.413   -3.088  1.00 0.00 ? 98  ARG A NH2  4  
ATOM 6815  H H    . ARG A 1 98  ? 14.434  3.313   -5.019  1.00 0.00 ? 98  ARG A H    4  
ATOM 6816  H HA   . ARG A 1 98  ? 14.730  4.153   -2.214  1.00 0.00 ? 98  ARG A HA   4  
ATOM 6817  H HB2  . ARG A 1 98  ? 16.821  4.329   -4.386  1.00 0.00 ? 98  ARG A HB2  4  
ATOM 6818  H HB3  . ARG A 1 98  ? 17.009  4.872   -2.725  1.00 0.00 ? 98  ARG A HB3  4  
ATOM 6819  H HG2  . ARG A 1 98  ? 16.236  2.230   -2.472  1.00 0.00 ? 98  ARG A HG2  4  
ATOM 6820  H HG3  . ARG A 1 98  ? 17.322  2.228   -3.863  1.00 0.00 ? 98  ARG A HG3  4  
ATOM 6821  H HD2  . ARG A 1 98  ? 18.367  3.882   -1.748  1.00 0.00 ? 98  ARG A HD2  4  
ATOM 6822  H HD3  . ARG A 1 98  ? 18.023  2.256   -1.157  1.00 0.00 ? 98  ARG A HD3  4  
ATOM 6823  H HE   . ARG A 1 98  ? 19.379  1.580   -3.250  1.00 0.00 ? 98  ARG A HE   4  
ATOM 6824  H HH11 . ARG A 1 98  ? 19.969  4.370   -1.251  1.00 0.00 ? 98  ARG A HH11 4  
ATOM 6825  H HH12 . ARG A 1 98  ? 21.671  4.402   -1.573  1.00 0.00 ? 98  ARG A HH12 4  
ATOM 6826  H HH21 . ARG A 1 98  ? 21.618  1.611   -3.678  1.00 0.00 ? 98  ARG A HH21 4  
ATOM 6827  H HH22 . ARG A 1 98  ? 22.608  2.832   -2.953  1.00 0.00 ? 98  ARG A HH22 4  
ATOM 6828  N N    . GLN A 1 99  ? 14.354  6.563   -2.693  1.00 0.00 ? 99  GLN A N    4  
ATOM 6829  C CA   . GLN A 1 99  ? 13.963  7.942   -2.960  1.00 0.00 ? 99  GLN A CA   4  
ATOM 6830  C C    . GLN A 1 99  ? 14.040  8.778   -1.685  1.00 0.00 ? 99  GLN A C    4  
ATOM 6831  O O    . GLN A 1 99  ? 13.254  9.706   -1.487  1.00 0.00 ? 99  GLN A O    4  
ATOM 6832  C CB   . GLN A 1 99  ? 12.551  7.998   -3.547  1.00 0.00 ? 99  GLN A CB   4  
ATOM 6833  C CG   . GLN A 1 99  ? 11.487  7.376   -2.658  1.00 0.00 ? 99  GLN A CG   4  
ATOM 6834  C CD   . GLN A 1 99  ? 10.111  7.408   -3.296  1.00 0.00 ? 99  GLN A CD   4  
ATOM 6835  O OE1  . GLN A 1 99  ? 9.960   7.129   -4.485  1.00 0.00 ? 99  GLN A OE1  4  
ATOM 6836  N NE2  . GLN A 1 99  ? 9.098   7.750   -2.509  1.00 0.00 ? 99  GLN A NE2  4  
ATOM 6837  H H    . GLN A 1 99  ? 14.438  6.263   -1.763  1.00 0.00 ? 99  GLN A H    4  
ATOM 6838  H HA   . GLN A 1 99  ? 14.658  8.348   -3.680  1.00 0.00 ? 99  GLN A HA   4  
ATOM 6839  H HB2  . GLN A 1 99  ? 12.285  9.032   -3.719  1.00 0.00 ? 99  GLN A HB2  4  
ATOM 6840  H HB3  . GLN A 1 99  ? 12.550  7.476   -4.493  1.00 0.00 ? 99  GLN A HB3  4  
ATOM 6841  H HG2  . GLN A 1 99  ? 11.752  6.347   -2.465  1.00 0.00 ? 99  GLN A HG2  4  
ATOM 6842  H HG3  . GLN A 1 99  ? 11.448  7.919   -1.726  1.00 0.00 ? 99  GLN A HG3  4  
ATOM 6843  H HE21 . GLN A 1 99  ? 9.289   7.958   -1.569  1.00 0.00 ? 99  GLN A HE21 4  
ATOM 6844  H HE22 . GLN A 1 99  ? 8.200   7.780   -2.898  1.00 0.00 ? 99  GLN A HE22 4  
ATOM 6845  N N    . GLU A 1 100 ? 14.996  8.437   -0.828  1.00 0.00 ? 100 GLU A N    4  
ATOM 6846  C CA   . GLU A 1 100 ? 15.193  9.144   0.430   1.00 0.00 ? 100 GLU A CA   4  
ATOM 6847  C C    . GLU A 1 100 ? 16.617  8.952   0.934   1.00 0.00 ? 100 GLU A C    4  
ATOM 6848  O O    . GLU A 1 100 ? 17.443  9.863   0.865   1.00 0.00 ? 100 GLU A O    4  
ATOM 6849  C CB   . GLU A 1 100 ? 14.195  8.650   1.478   1.00 0.00 ? 100 GLU A CB   4  
ATOM 6850  C CG   . GLU A 1 100 ? 13.109  9.661   1.809   1.00 0.00 ? 100 GLU A CG   4  
ATOM 6851  C CD   . GLU A 1 100 ? 13.340  10.351  3.138   1.00 0.00 ? 100 GLU A CD   4  
ATOM 6852  O OE1  . GLU A 1 100 ? 14.480  10.796  3.386   1.00 0.00 ? 100 GLU A OE1  4  
ATOM 6853  O OE2  . GLU A 1 100 ? 12.382  10.446  3.933   1.00 0.00 ? 100 GLU A OE2  4  
ATOM 6854  H H    . GLU A 1 100 ? 15.587  7.687   -1.050  1.00 0.00 ? 100 GLU A H    4  
ATOM 6855  H HA   . GLU A 1 100 ? 15.027  10.192  0.253   1.00 0.00 ? 100 GLU A HA   4  
ATOM 6856  H HB2  . GLU A 1 100 ? 13.720  7.752   1.112   1.00 0.00 ? 100 GLU A HB2  4  
ATOM 6857  H HB3  . GLU A 1 100 ? 14.731  8.418   2.386   1.00 0.00 ? 100 GLU A HB3  4  
ATOM 6858  H HG2  . GLU A 1 100 ? 13.087  10.412  1.033   1.00 0.00 ? 100 GLU A HG2  4  
ATOM 6859  H HG3  . GLU A 1 100 ? 12.158  9.151   1.844   1.00 0.00 ? 100 GLU A HG3  4  
ATOM 6860  N N    . ARG A 1 101 ? 16.892  7.756   1.438   1.00 0.00 ? 101 ARG A N    4  
ATOM 6861  C CA   . ARG A 1 101 ? 18.210  7.411   1.959   1.00 0.00 ? 101 ARG A CA   4  
ATOM 6862  C C    . ARG A 1 101 ? 18.223  5.959   2.415   1.00 0.00 ? 101 ARG A C    4  
ATOM 6863  O O    . ARG A 1 101 ? 19.274  5.395   2.714   1.00 0.00 ? 101 ARG A O    4  
ATOM 6864  C CB   . ARG A 1 101 ? 18.585  8.326   3.125   1.00 0.00 ? 101 ARG A CB   4  
ATOM 6865  C CG   . ARG A 1 101 ? 17.518  8.402   4.206   1.00 0.00 ? 101 ARG A CG   4  
ATOM 6866  C CD   . ARG A 1 101 ? 18.035  9.095   5.456   1.00 0.00 ? 101 ARG A CD   4  
ATOM 6867  N NE   . ARG A 1 101 ? 17.894  10.546  5.376   1.00 0.00 ? 101 ARG A NE   4  
ATOM 6868  C CZ   . ARG A 1 101 ? 18.040  11.361  6.417   1.00 0.00 ? 101 ARG A CZ   4  
ATOM 6869  N NH1  . ARG A 1 101 ? 18.322  10.870  7.616   1.00 0.00 ? 101 ARG A NH1  4  
ATOM 6870  N NH2  . ARG A 1 101 ? 17.900  12.670  6.259   1.00 0.00 ? 101 ARG A NH2  4  
ATOM 6871  H H    . ARG A 1 101 ? 16.184  7.078   1.457   1.00 0.00 ? 101 ARG A H    4  
ATOM 6872  H HA   . ARG A 1 101 ? 18.929  7.537   1.163   1.00 0.00 ? 101 ARG A HA   4  
ATOM 6873  H HB2  . ARG A 1 101 ? 19.496  7.963   3.577   1.00 0.00 ? 101 ARG A HB2  4  
ATOM 6874  H HB3  . ARG A 1 101 ? 18.754  9.325   2.749   1.00 0.00 ? 101 ARG A HB3  4  
ATOM 6875  H HG2  . ARG A 1 101 ? 16.671  8.955   3.825   1.00 0.00 ? 101 ARG A HG2  4  
ATOM 6876  H HG3  . ARG A 1 101 ? 17.207  7.400   4.463   1.00 0.00 ? 101 ARG A HG3  4  
ATOM 6877  H HD2  . ARG A 1 101 ? 17.479  8.736   6.308   1.00 0.00 ? 101 ARG A HD2  4  
ATOM 6878  H HD3  . ARG A 1 101 ? 19.079  8.851   5.580   1.00 0.00 ? 101 ARG A HD3  4  
ATOM 6879  H HE   . ARG A 1 101 ? 17.682  10.934  4.501   1.00 0.00 ? 101 ARG A HE   4  
ATOM 6880  H HH11 . ARG A 1 101 ? 18.426  9.884   7.741   1.00 0.00 ? 101 ARG A HH11 4  
ATOM 6881  H HH12 . ARG A 1 101 ? 18.431  11.486  8.396   1.00 0.00 ? 101 ARG A HH12 4  
ATOM 6882  H HH21 . ARG A 1 101 ? 17.686  13.045  5.357   1.00 0.00 ? 101 ARG A HH21 4  
ATOM 6883  H HH22 . ARG A 1 101 ? 18.010  13.283  7.042   1.00 0.00 ? 101 ARG A HH22 4  
ATOM 6884  N N    . ARG A 1 102 ? 17.034  5.367   2.467   1.00 0.00 ? 102 ARG A N    4  
ATOM 6885  C CA   . ARG A 1 102 ? 16.881  3.979   2.886   1.00 0.00 ? 102 ARG A CA   4  
ATOM 6886  C C    . ARG A 1 102 ? 15.893  3.250   1.976   1.00 0.00 ? 102 ARG A C    4  
ATOM 6887  O O    . ARG A 1 102 ? 14.979  3.865   1.426   1.00 0.00 ? 102 ARG A O    4  
ATOM 6888  C CB   . ARG A 1 102 ? 16.410  3.927   4.348   1.00 0.00 ? 102 ARG A CB   4  
ATOM 6889  C CG   . ARG A 1 102 ? 15.604  2.686   4.705   1.00 0.00 ? 102 ARG A CG   4  
ATOM 6890  C CD   . ARG A 1 102 ? 14.136  3.022   4.922   1.00 0.00 ? 102 ARG A CD   4  
ATOM 6891  N NE   . ARG A 1 102 ? 13.824  3.228   6.334   1.00 0.00 ? 102 ARG A NE   4  
ATOM 6892  C CZ   . ARG A 1 102 ? 13.919  4.404   6.947   1.00 0.00 ? 102 ARG A CZ   4  
ATOM 6893  N NH1  . ARG A 1 102 ? 14.313  5.479   6.275   1.00 0.00 ? 102 ARG A NH1  4  
ATOM 6894  N NH2  . ARG A 1 102 ? 13.617  4.508   8.233   1.00 0.00 ? 102 ARG A NH2  4  
ATOM 6895  H H    . ARG A 1 102 ? 16.235  5.881   2.214   1.00 0.00 ? 102 ARG A H    4  
ATOM 6896  H HA   . ARG A 1 102 ? 17.845  3.498   2.811   1.00 0.00 ? 102 ARG A HA   4  
ATOM 6897  H HB2  . ARG A 1 102 ? 17.275  3.961   4.992   1.00 0.00 ? 102 ARG A HB2  4  
ATOM 6898  H HB3  . ARG A 1 102 ? 15.796  4.795   4.543   1.00 0.00 ? 102 ARG A HB3  4  
ATOM 6899  H HG2  . ARG A 1 102 ? 15.683  1.971   3.900   1.00 0.00 ? 102 ARG A HG2  4  
ATOM 6900  H HG3  . ARG A 1 102 ? 16.004  2.257   5.611   1.00 0.00 ? 102 ARG A HG3  4  
ATOM 6901  H HD2  . ARG A 1 102 ? 13.901  3.924   4.377   1.00 0.00 ? 102 ARG A HD2  4  
ATOM 6902  H HD3  . ARG A 1 102 ? 13.533  2.208   4.545   1.00 0.00 ? 102 ARG A HD3  4  
ATOM 6903  H HE   . ARG A 1 102 ? 13.532  2.450   6.852   1.00 0.00 ? 102 ARG A HE   4  
ATOM 6904  H HH11 . ARG A 1 102 ? 14.540  5.405   5.305   1.00 0.00 ? 102 ARG A HH11 4  
ATOM 6905  H HH12 . ARG A 1 102 ? 14.381  6.361   6.740   1.00 0.00 ? 102 ARG A HH12 4  
ATOM 6906  H HH21 . ARG A 1 102 ? 13.321  3.702   8.745   1.00 0.00 ? 102 ARG A HH21 4  
ATOM 6907  H HH22 . ARG A 1 102 ? 13.690  5.392   8.695   1.00 0.00 ? 102 ARG A HH22 4  
ATOM 6908  N N    . LEU A 1 103 ? 16.081  1.939   1.825   1.00 0.00 ? 103 LEU A N    4  
ATOM 6909  C CA   . LEU A 1 103 ? 15.201  1.132   0.984   1.00 0.00 ? 103 LEU A CA   4  
ATOM 6910  C C    . LEU A 1 103 ? 13.744  1.389   1.339   1.00 0.00 ? 103 LEU A C    4  
ATOM 6911  O O    . LEU A 1 103 ? 13.264  0.958   2.388   1.00 0.00 ? 103 LEU A O    4  
ATOM 6912  C CB   . LEU A 1 103 ? 15.520  -0.356  1.143   1.00 0.00 ? 103 LEU A CB   4  
ATOM 6913  C CG   . LEU A 1 103 ? 15.949  -1.074  -0.141  1.00 0.00 ? 103 LEU A CG   4  
ATOM 6914  C CD1  . LEU A 1 103 ? 15.009  -0.735  -1.287  1.00 0.00 ? 103 LEU A CD1  4  
ATOM 6915  C CD2  . LEU A 1 103 ? 17.384  -0.709  -0.498  1.00 0.00 ? 103 LEU A CD2  4  
ATOM 6916  H H    . LEU A 1 103 ? 16.827  1.504   2.291   1.00 0.00 ? 103 LEU A H    4  
ATOM 6917  H HA   . LEU A 1 103 ? 15.367  1.422   -0.043  1.00 0.00 ? 103 LEU A HA   4  
ATOM 6918  H HB2  . LEU A 1 103 ? 16.315  -0.456  1.867   1.00 0.00 ? 103 LEU A HB2  4  
ATOM 6919  H HB3  . LEU A 1 103 ? 14.641  -0.851  1.526   1.00 0.00 ? 103 LEU A HB3  4  
ATOM 6920  H HG   . LEU A 1 103 ? 15.905  -2.140  0.020   1.00 0.00 ? 103 LEU A HG   4  
ATOM 6921  H HD11 . LEU A 1 103 ? 15.277  0.225   -1.702  1.00 0.00 ? 103 LEU A HD11 4  
ATOM 6922  H HD12 . LEU A 1 103 ? 13.994  -0.697  -0.919  1.00 0.00 ? 103 LEU A HD12 4  
ATOM 6923  H HD13 . LEU A 1 103 ? 15.086  -1.494  -2.053  1.00 0.00 ? 103 LEU A HD13 4  
ATOM 6924  H HD21 . LEU A 1 103 ? 17.557  0.332   -0.271  1.00 0.00 ? 103 LEU A HD21 4  
ATOM 6925  H HD22 . LEU A 1 103 ? 17.545  -0.881  -1.552  1.00 0.00 ? 103 LEU A HD22 4  
ATOM 6926  H HD23 . LEU A 1 103 ? 18.064  -1.322  0.076   1.00 0.00 ? 103 LEU A HD23 4  
ATOM 6927  N N    . CYS A 1 104 ? 13.045  2.109   0.467   1.00 0.00 ? 104 CYS A N    4  
ATOM 6928  C CA   . CYS A 1 104 ? 11.647  2.440   0.703   1.00 0.00 ? 104 CYS A CA   4  
ATOM 6929  C C    . CYS A 1 104 ? 10.712  1.656   -0.213  1.00 0.00 ? 104 CYS A C    4  
ATOM 6930  O O    . CYS A 1 104 ? 10.801  1.741   -1.438  1.00 0.00 ? 104 CYS A O    4  
ATOM 6931  C CB   . CYS A 1 104 ? 11.425  3.940   0.509   1.00 0.00 ? 104 CYS A CB   4  
ATOM 6932  S SG   . CYS A 1 104 ? 12.540  4.701   -0.693  1.00 0.00 ? 104 CYS A SG   4  
ATOM 6933  H H    . CYS A 1 104 ? 13.487  2.436   -0.343  1.00 0.00 ? 104 CYS A H    4  
ATOM 6934  H HA   . CYS A 1 104 ? 11.418  2.184   1.727   1.00 0.00 ? 104 CYS A HA   4  
ATOM 6935  H HB2  . CYS A 1 104 ? 10.413  4.107   0.168   1.00 0.00 ? 104 CYS A HB2  4  
ATOM 6936  H HB3  . CYS A 1 104 ? 11.568  4.443   1.455   1.00 0.00 ? 104 CYS A HB3  4  
ATOM 6937  H HG   . CYS A 1 104 ? 12.667  5.982   -0.379  1.00 0.00 ? 104 CYS A HG   4  
ATOM 6938  N N    . CYS A 1 105 ? 9.796   0.910   0.400   1.00 0.00 ? 105 CYS A N    4  
ATOM 6939  C CA   . CYS A 1 105 ? 8.812   0.123   -0.333  1.00 0.00 ? 105 CYS A CA   4  
ATOM 6940  C C    . CYS A 1 105 ? 7.653   1.009   -0.783  1.00 0.00 ? 105 CYS A C    4  
ATOM 6941  O O    . CYS A 1 105 ? 7.103   1.769   0.010   1.00 0.00 ? 105 CYS A O    4  
ATOM 6942  C CB   . CYS A 1 105 ? 8.285   -1.009  0.549   1.00 0.00 ? 105 CYS A CB   4  
ATOM 6943  S SG   . CYS A 1 105 ? 8.277   -2.629  -0.249  1.00 0.00 ? 105 CYS A SG   4  
ATOM 6944  H H    . CYS A 1 105 ? 9.773   0.904   1.380   1.00 0.00 ? 105 CYS A H    4  
ATOM 6945  H HA   . CYS A 1 105 ? 9.296   -0.298  -1.202  1.00 0.00 ? 105 CYS A HA   4  
ATOM 6946  H HB2  . CYS A 1 105 ? 8.904   -1.082  1.432   1.00 0.00 ? 105 CYS A HB2  4  
ATOM 6947  H HB3  . CYS A 1 105 ? 7.267   -0.778  0.847   1.00 0.00 ? 105 CYS A HB3  4  
ATOM 6948  H HG   . CYS A 1 105 ? 8.782   -2.489  -1.466  1.00 0.00 ? 105 CYS A HG   4  
ATOM 6949  N N    . VAL A 1 106 ? 7.283   0.907   -2.055  1.00 0.00 ? 106 VAL A N    4  
ATOM 6950  C CA   . VAL A 1 106 ? 6.185   1.706   -2.594  1.00 0.00 ? 106 VAL A CA   4  
ATOM 6951  C C    . VAL A 1 106 ? 4.999   0.825   -2.978  1.00 0.00 ? 106 VAL A C    4  
ATOM 6952  O O    . VAL A 1 106 ? 5.172   -0.253  -3.548  1.00 0.00 ? 106 VAL A O    4  
ATOM 6953  C CB   . VAL A 1 106 ? 6.638   2.518   -3.826  1.00 0.00 ? 106 VAL A CB   4  
ATOM 6954  C CG1  . VAL A 1 106 ? 5.454   3.229   -4.471  1.00 0.00 ? 106 VAL A CG1  4  
ATOM 6955  C CG2  . VAL A 1 106 ? 7.718   3.514   -3.436  1.00 0.00 ? 106 VAL A CG2  4  
ATOM 6956  H H    . VAL A 1 106 ? 7.753   0.281   -2.643  1.00 0.00 ? 106 VAL A H    4  
ATOM 6957  H HA   . VAL A 1 106 ? 5.872   2.399   -1.829  1.00 0.00 ? 106 VAL A HA   4  
ATOM 6958  H HB   . VAL A 1 106 ? 7.055   1.833   -4.550  1.00 0.00 ? 106 VAL A HB   4  
ATOM 6959  H HG11 . VAL A 1 106 ? 4.969   2.560   -5.166  1.00 0.00 ? 106 VAL A HG11 4  
ATOM 6960  H HG12 . VAL A 1 106 ? 5.805   4.104   -4.997  1.00 0.00 ? 106 VAL A HG12 4  
ATOM 6961  H HG13 . VAL A 1 106 ? 4.752   3.525   -3.706  1.00 0.00 ? 106 VAL A HG13 4  
ATOM 6962  H HG21 . VAL A 1 106 ? 8.332   3.736   -4.297  1.00 0.00 ? 106 VAL A HG21 4  
ATOM 6963  H HG22 . VAL A 1 106 ? 8.333   3.091   -2.655  1.00 0.00 ? 106 VAL A HG22 4  
ATOM 6964  H HG23 . VAL A 1 106 ? 7.257   4.423   -3.078  1.00 0.00 ? 106 VAL A HG23 4  
ATOM 6965  N N    . VAL A 1 107 ? 3.794   1.294   -2.664  1.00 0.00 ? 107 VAL A N    4  
ATOM 6966  C CA   . VAL A 1 107 ? 2.576   0.556   -2.974  1.00 0.00 ? 107 VAL A CA   4  
ATOM 6967  C C    . VAL A 1 107 ? 1.635   1.410   -3.823  1.00 0.00 ? 107 VAL A C    4  
ATOM 6968  O O    . VAL A 1 107 ? 1.435   2.592   -3.542  1.00 0.00 ? 107 VAL A O    4  
ATOM 6969  C CB   . VAL A 1 107 ? 1.855   0.099   -1.682  1.00 0.00 ? 107 VAL A CB   4  
ATOM 6970  C CG1  . VAL A 1 107 ? 0.350   0.321   -1.764  1.00 0.00 ? 107 VAL A CG1  4  
ATOM 6971  C CG2  . VAL A 1 107 ? 2.162   -1.360  -1.391  1.00 0.00 ? 107 VAL A CG2  4  
ATOM 6972  H H    . VAL A 1 107 ? 3.717   2.161   -2.213  1.00 0.00 ? 107 VAL A H    4  
ATOM 6973  H HA   . VAL A 1 107 ? 2.854   -0.323  -3.538  1.00 0.00 ? 107 VAL A HA   4  
ATOM 6974  H HB   . VAL A 1 107 ? 2.234   0.689   -0.860  1.00 0.00 ? 107 VAL A HB   4  
ATOM 6975  H HG11 . VAL A 1 107 ? 0.132   1.372   -1.637  1.00 0.00 ? 107 VAL A HG11 4  
ATOM 6976  H HG12 . VAL A 1 107 ? -0.141  -0.245  -0.987  1.00 0.00 ? 107 VAL A HG12 4  
ATOM 6977  H HG13 . VAL A 1 107 ? -0.010  -0.006  -2.730  1.00 0.00 ? 107 VAL A HG13 4  
ATOM 6978  H HG21 . VAL A 1 107 ? 3.216   -1.471  -1.177  1.00 0.00 ? 107 VAL A HG21 4  
ATOM 6979  H HG22 . VAL A 1 107 ? 1.905   -1.962  -2.251  1.00 0.00 ? 107 VAL A HG22 4  
ATOM 6980  H HG23 . VAL A 1 107 ? 1.587   -1.688  -0.539  1.00 0.00 ? 107 VAL A HG23 4  
ATOM 6981  N N    . VAL A 1 108 ? 1.063   0.807   -4.858  1.00 0.00 ? 108 VAL A N    4  
ATOM 6982  C CA   . VAL A 1 108 ? 0.145   1.518   -5.740  1.00 0.00 ? 108 VAL A CA   4  
ATOM 6983  C C    . VAL A 1 108 ? -1.153  0.745   -5.925  1.00 0.00 ? 108 VAL A C    4  
ATOM 6984  O O    . VAL A 1 108 ? -1.155  -0.372  -6.443  1.00 0.00 ? 108 VAL A O    4  
ATOM 6985  C CB   . VAL A 1 108 ? 0.774   1.779   -7.122  1.00 0.00 ? 108 VAL A CB   4  
ATOM 6986  C CG1  . VAL A 1 108 ? 0.051   2.912   -7.831  1.00 0.00 ? 108 VAL A CG1  4  
ATOM 6987  C CG2  . VAL A 1 108 ? 2.258   2.086   -6.991  1.00 0.00 ? 108 VAL A CG2  4  
ATOM 6988  H H    . VAL A 1 108 ? 1.261   -0.138  -5.033  1.00 0.00 ? 108 VAL A H    4  
ATOM 6989  H HA   . VAL A 1 108 ? -0.078  2.471   -5.284  1.00 0.00 ? 108 VAL A HA   4  
ATOM 6990  H HB   . VAL A 1 108 ? 0.665   0.885   -7.719  1.00 0.00 ? 108 VAL A HB   4  
ATOM 6991  H HG11 . VAL A 1 108 ? -0.568  3.445   -7.123  1.00 0.00 ? 108 VAL A HG11 4  
ATOM 6992  H HG12 . VAL A 1 108 ? -0.569  2.509   -8.617  1.00 0.00 ? 108 VAL A HG12 4  
ATOM 6993  H HG13 . VAL A 1 108 ? 0.776   3.592   -8.257  1.00 0.00 ? 108 VAL A HG13 4  
ATOM 6994  H HG21 . VAL A 1 108 ? 2.626   2.485   -7.926  1.00 0.00 ? 108 VAL A HG21 4  
ATOM 6995  H HG22 . VAL A 1 108 ? 2.794   1.177   -6.754  1.00 0.00 ? 108 VAL A HG22 4  
ATOM 6996  H HG23 . VAL A 1 108 ? 2.409   2.810   -6.204  1.00 0.00 ? 108 VAL A HG23 4  
ATOM 6997  N N    . LEU A 1 109 ? -2.259  1.347   -5.494  1.00 0.00 ? 109 LEU A N    4  
ATOM 6998  C CA   . LEU A 1 109 ? -3.566  0.716   -5.606  1.00 0.00 ? 109 LEU A CA   4  
ATOM 6999  C C    . LEU A 1 109 ? -4.322  1.231   -6.825  1.00 0.00 ? 109 LEU A C    4  
ATOM 7000  O O    . LEU A 1 109 ? -4.506  2.436   -6.991  1.00 0.00 ? 109 LEU A O    4  
ATOM 7001  C CB   . LEU A 1 109 ? -4.374  0.983   -4.341  1.00 0.00 ? 109 LEU A CB   4  
ATOM 7002  C CG   . LEU A 1 109 ? -3.535  1.109   -3.070  1.00 0.00 ? 109 LEU A CG   4  
ATOM 7003  C CD1  . LEU A 1 109 ? -4.247  1.973   -2.045  1.00 0.00 ? 109 LEU A CD1  4  
ATOM 7004  C CD2  . LEU A 1 109 ? -3.231  -0.269  -2.504  1.00 0.00 ? 109 LEU A CD2  4  
ATOM 7005  H H    . LEU A 1 109 ? -2.192  2.236   -5.085  1.00 0.00 ? 109 LEU A H    4  
ATOM 7006  H HA   . LEU A 1 109 ? -3.416  -0.349  -5.707  1.00 0.00 ? 109 LEU A HA   4  
ATOM 7007  H HB2  . LEU A 1 109 ? -4.930  1.900   -4.477  1.00 0.00 ? 109 LEU A HB2  4  
ATOM 7008  H HB3  . LEU A 1 109 ? -5.074  0.172   -4.205  1.00 0.00 ? 109 LEU A HB3  4  
ATOM 7009  H HG   . LEU A 1 109 ? -2.598  1.586   -3.313  1.00 0.00 ? 109 LEU A HG   4  
ATOM 7010  H HD11 . LEU A 1 109 ? -3.594  2.141   -1.201  1.00 0.00 ? 109 LEU A HD11 4  
ATOM 7011  H HD12 . LEU A 1 109 ? -5.144  1.472   -1.712  1.00 0.00 ? 109 LEU A HD12 4  
ATOM 7012  H HD13 . LEU A 1 109 ? -4.509  2.920   -2.493  1.00 0.00 ? 109 LEU A HD13 4  
ATOM 7013  H HD21 . LEU A 1 109 ? -4.047  -0.585  -1.871  1.00 0.00 ? 109 LEU A HD21 4  
ATOM 7014  H HD22 . LEU A 1 109 ? -2.320  -0.227  -1.926  1.00 0.00 ? 109 LEU A HD22 4  
ATOM 7015  H HD23 . LEU A 1 109 ? -3.111  -0.970  -3.316  1.00 0.00 ? 109 LEU A HD23 4  
ATOM 7016  N N    . GLU A 1 110 ? -4.761  0.309   -7.673  1.00 0.00 ? 110 GLU A N    4  
ATOM 7017  C CA   . GLU A 1 110 ? -5.502  0.668   -8.873  1.00 0.00 ? 110 GLU A CA   4  
ATOM 7018  C C    . GLU A 1 110 ? -6.831  -0.079  -8.931  1.00 0.00 ? 110 GLU A C    4  
ATOM 7019  O O    . GLU A 1 110 ? -6.856  -1.308  -9.014  1.00 0.00 ? 110 GLU A O    4  
ATOM 7020  C CB   . GLU A 1 110 ? -4.674  0.360   -10.124 1.00 0.00 ? 110 GLU A CB   4  
ATOM 7021  C CG   . GLU A 1 110 ? -4.885  1.358   -11.251 1.00 0.00 ? 110 GLU A CG   4  
ATOM 7022  C CD   . GLU A 1 110 ? -5.692  0.779   -12.398 1.00 0.00 ? 110 GLU A CD   4  
ATOM 7023  O OE1  . GLU A 1 110 ? -5.787  -0.463  -12.495 1.00 0.00 ? 110 GLU A OE1  4  
ATOM 7024  O OE2  . GLU A 1 110 ? -6.230  1.570   -13.202 1.00 0.00 ? 110 GLU A OE2  4  
ATOM 7025  H H    . GLU A 1 110 ? -4.586  -0.637  -7.483  1.00 0.00 ? 110 GLU A H    4  
ATOM 7026  H HA   . GLU A 1 110 ? -5.702  1.728   -8.835  1.00 0.00 ? 110 GLU A HA   4  
ATOM 7027  H HB2  . GLU A 1 110 ? -3.627  0.367   -9.857  1.00 0.00 ? 110 GLU A HB2  4  
ATOM 7028  H HB3  . GLU A 1 110 ? -4.939  -0.622  -10.483 1.00 0.00 ? 110 GLU A HB3  4  
ATOM 7029  H HG2  . GLU A 1 110 ? -5.407  2.217   -10.863 1.00 0.00 ? 110 GLU A HG2  4  
ATOM 7030  H HG3  . GLU A 1 110 ? -3.919  1.663   -11.629 1.00 0.00 ? 110 GLU A HG3  4  
ATOM 7031  N N    . PRO A 1 111 ? -7.959  0.652   -8.892  1.00 0.00 ? 111 PRO A N    4  
ATOM 7032  C CA   . PRO A 1 111 ? -9.291  0.043   -8.941  1.00 0.00 ? 111 PRO A CA   4  
ATOM 7033  C C    . PRO A 1 111 ? -9.500  -0.764  -10.217 1.00 0.00 ? 111 PRO A C    4  
ATOM 7034  O O    . PRO A 1 111 ? -9.173  -0.307  -11.311 1.00 0.00 ? 111 PRO A O    4  
ATOM 7035  C CB   . PRO A 1 111 ? -10.249 1.239   -8.897  1.00 0.00 ? 111 PRO A CB   4  
ATOM 7036  C CG   . PRO A 1 111 ? -9.422  2.424   -9.264  1.00 0.00 ? 111 PRO A CG   4  
ATOM 7037  C CD   . PRO A 1 111 ? -8.027  2.119   -8.799  1.00 0.00 ? 111 PRO A CD   4  
ATOM 7038  H HA   . PRO A 1 111 ? -9.464  -0.593  -8.085  1.00 0.00 ? 111 PRO A HA   4  
ATOM 7039  H HB2  . PRO A 1 111 ? -11.053 1.084   -9.603  1.00 0.00 ? 111 PRO A HB2  4  
ATOM 7040  H HB3  . PRO A 1 111 ? -10.656 1.337   -7.901  1.00 0.00 ? 111 PRO A HB3  4  
ATOM 7041  H HG2  . PRO A 1 111 ? -9.438  2.566   -10.335 1.00 0.00 ? 111 PRO A HG2  4  
ATOM 7042  H HG3  . PRO A 1 111 ? -9.798  3.304   -8.762  1.00 0.00 ? 111 PRO A HG3  4  
ATOM 7043  H HD2  . PRO A 1 111 ? -7.302  2.581   -9.454  1.00 0.00 ? 111 PRO A HD2  4  
ATOM 7044  H HD3  . PRO A 1 111 ? -7.883  2.449   -7.782  1.00 0.00 ? 111 PRO A HD3  4  
ATOM 7045  N N    . VAL A 1 112 ? -10.043 -1.968  -10.066 1.00 0.00 ? 112 VAL A N    4  
ATOM 7046  C CA   . VAL A 1 112 ? -10.294 -2.841  -11.206 1.00 0.00 ? 112 VAL A CA   4  
ATOM 7047  C C    . VAL A 1 112 ? -11.393 -2.276  -12.101 1.00 0.00 ? 112 VAL A C    4  
ATOM 7048  O O    . VAL A 1 112 ? -12.174 -1.422  -11.679 1.00 0.00 ? 112 VAL A O    4  
ATOM 7049  C CB   . VAL A 1 112 ? -10.694 -4.258  -10.748 1.00 0.00 ? 112 VAL A CB   4  
ATOM 7050  C CG1  . VAL A 1 112 ? -9.595  -4.874  -9.899  1.00 0.00 ? 112 VAL A CG1  4  
ATOM 7051  C CG2  . VAL A 1 112 ? -12.010 -4.220  -9.982  1.00 0.00 ? 112 VAL A CG2  4  
ATOM 7052  H H    . VAL A 1 112 ? -10.284 -2.277  -9.167  1.00 0.00 ? 112 VAL A H    4  
ATOM 7053  H HA   . VAL A 1 112 ? -9.380  -2.916  -11.778 1.00 0.00 ? 112 VAL A HA   4  
ATOM 7054  H HB   . VAL A 1 112 ? -10.830 -4.873  -11.625 1.00 0.00 ? 112 VAL A HB   4  
ATOM 7055  H HG11 . VAL A 1 112 ? -8.828  -4.135  -9.712  1.00 0.00 ? 112 VAL A HG11 4  
ATOM 7056  H HG12 . VAL A 1 112 ? -9.163  -5.713  -10.422 1.00 0.00 ? 112 VAL A HG12 4  
ATOM 7057  H HG13 . VAL A 1 112 ? -10.010 -5.208  -8.959  1.00 0.00 ? 112 VAL A HG13 4  
ATOM 7058  H HG21 . VAL A 1 112 ? -12.308 -3.193  -9.833  1.00 0.00 ? 112 VAL A HG21 4  
ATOM 7059  H HG22 . VAL A 1 112 ? -11.881 -4.702  -9.025  1.00 0.00 ? 112 VAL A HG22 4  
ATOM 7060  H HG23 . VAL A 1 112 ? -12.769 -4.736  -10.548 1.00 0.00 ? 112 VAL A HG23 4  
ATOM 7061  N N    . GLU A 1 113 ? -11.448 -2.759  -13.340 1.00 0.00 ? 113 GLU A N    4  
ATOM 7062  C CA   . GLU A 1 113 ? -12.452 -2.302  -14.291 1.00 0.00 ? 113 GLU A CA   4  
ATOM 7063  C C    . GLU A 1 113 ? -13.835 -2.823  -13.914 1.00 0.00 ? 113 GLU A C    4  
ATOM 7064  O O    . GLU A 1 113 ? -13.974 -3.938  -13.414 1.00 0.00 ? 113 GLU A O    4  
ATOM 7065  C CB   . GLU A 1 113 ? -12.092 -2.759  -15.706 1.00 0.00 ? 113 GLU A CB   4  
ATOM 7066  C CG   . GLU A 1 113 ? -12.874 -2.042  -16.796 1.00 0.00 ? 113 GLU A CG   4  
ATOM 7067  C CD   . GLU A 1 113 ? -13.076 -2.900  -18.030 1.00 0.00 ? 113 GLU A CD   4  
ATOM 7068  O OE1  . GLU A 1 113 ? -12.072 -3.419  -18.564 1.00 0.00 ? 113 GLU A OE1  4  
ATOM 7069  O OE2  . GLU A 1 113 ? -14.238 -3.054  -18.462 1.00 0.00 ? 113 GLU A OE2  4  
ATOM 7070  H H    . GLU A 1 113 ? -10.798 -3.438  -13.616 1.00 0.00 ? 113 GLU A H    4  
ATOM 7071  H HA   . GLU A 1 113 ? -12.468 -1.223  -14.266 1.00 0.00 ? 113 GLU A HA   4  
ATOM 7072  H HB2  . GLU A 1 113 ? -11.040 -2.581  -15.872 1.00 0.00 ? 113 GLU A HB2  4  
ATOM 7073  H HB3  . GLU A 1 113 ? -12.288 -3.818  -15.790 1.00 0.00 ? 113 GLU A HB3  4  
ATOM 7074  H HG2  . GLU A 1 113 ? -13.843 -1.768  -16.406 1.00 0.00 ? 113 GLU A HG2  4  
ATOM 7075  H HG3  . GLU A 1 113 ? -12.336 -1.149  -17.079 1.00 0.00 ? 113 GLU A HG3  4  
ATOM 7076  N N    . ARG A 1 114 ? -14.856 -2.006  -14.155 1.00 0.00 ? 114 ARG A N    4  
ATOM 7077  C CA   . ARG A 1 114 ? -16.229 -2.383  -13.839 1.00 0.00 ? 114 ARG A CA   4  
ATOM 7078  C C    . ARG A 1 114 ? -17.220 -1.595  -14.690 1.00 0.00 ? 114 ARG A C    4  
ATOM 7079  O O    . ARG A 1 114 ? -16.786 -0.644  -15.372 1.00 0.00 ? 114 ARG A O    4  
ATOM 7080  C CB   . ARG A 1 114 ? -16.517 -2.150  -12.353 1.00 0.00 ? 114 ARG A CB   4  
ATOM 7081  C CG   . ARG A 1 114 ? -15.729 -0.995  -11.754 1.00 0.00 ? 114 ARG A CG   4  
ATOM 7082  C CD   . ARG A 1 114 ? -16.255 -0.613  -10.380 1.00 0.00 ? 114 ARG A CD   4  
ATOM 7083  N NE   . ARG A 1 114 ? -17.128 0.557   -10.437 1.00 0.00 ? 114 ARG A NE   4  
ATOM 7084  C CZ   . ARG A 1 114 ? -16.707 1.803   -10.236 1.00 0.00 ? 114 ARG A CZ   4  
ATOM 7085  N NH1  . ARG A 1 114 ? -15.431 2.039   -9.964  1.00 0.00 ? 114 ARG A NH1  4  
ATOM 7086  N NH2  . ARG A 1 114 ? -17.563 2.813   -10.309 1.00 0.00 ? 114 ARG A NH2  4  
ATOM 7087  O OXT  . ARG A 1 114 ? -18.422 -1.935  -14.664 1.00 0.00 ? 114 ARG A OXT  4  
ATOM 7088  H H    . ARG A 1 114 ? -14.683 -1.128  -14.555 1.00 0.00 ? 114 ARG A H    4  
ATOM 7089  H HA   . ARG A 1 114 ? -16.343 -3.435  -14.058 1.00 0.00 ? 114 ARG A HA   4  
ATOM 7090  H HB2  . ARG A 1 114 ? -17.567 -1.942  -12.230 1.00 0.00 ? 114 ARG A HB2  4  
ATOM 7091  H HB3  . ARG A 1 114 ? -16.269 -3.048  -11.806 1.00 0.00 ? 114 ARG A HB3  4  
ATOM 7092  H HG2  . ARG A 1 114 ? -14.692 -1.286  -11.663 1.00 0.00 ? 114 ARG A HG2  4  
ATOM 7093  H HG3  . ARG A 1 114 ? -15.807 -0.142  -12.410 1.00 0.00 ? 114 ARG A HG3  4  
ATOM 7094  H HD2  . ARG A 1 114 ? -16.811 -1.444  -9.977  1.00 0.00 ? 114 ARG A HD2  4  
ATOM 7095  H HD3  . ARG A 1 114 ? -15.417 -0.393  -9.736  1.00 0.00 ? 114 ARG A HD3  4  
ATOM 7096  H HE   . ARG A 1 114 ? -18.076 0.406   -10.633 1.00 0.00 ? 114 ARG A HE   4  
ATOM 7097  H HH11 . ARG A 1 114 ? -14.782 1.280   -9.908  1.00 0.00 ? 114 ARG A HH11 4  
ATOM 7098  H HH12 . ARG A 1 114 ? -15.117 2.977   -9.816  1.00 0.00 ? 114 ARG A HH12 4  
ATOM 7099  H HH21 . ARG A 1 114 ? -18.526 2.639   -10.513 1.00 0.00 ? 114 ARG A HH21 4  
ATOM 7100  H HH22 . ARG A 1 114 ? -17.245 3.749   -10.159 1.00 0.00 ? 114 ARG A HH22 4  
ATOM 7101  N N    . GLY A 1 1   ? -6.198  17.135  -12.908 1.00 0.00 ? 1   GLY A N    5  
ATOM 7102  C CA   . GLY A 1 1   ? -6.670  16.312  -14.055 1.00 0.00 ? 1   GLY A CA   5  
ATOM 7103  C C    . GLY A 1 1   ? -5.617  16.169  -15.137 1.00 0.00 ? 1   GLY A C    5  
ATOM 7104  O O    . GLY A 1 1   ? -4.945  17.137  -15.489 1.00 0.00 ? 1   GLY A O    5  
ATOM 7105  H H1   . GLY A 1 1   ? -6.113  18.133  -13.194 1.00 0.00 ? 1   GLY A H1   5  
ATOM 7106  H H2   . GLY A 1 1   ? -5.270  16.801  -12.584 1.00 0.00 ? 1   GLY A H2   5  
ATOM 7107  H H3   . GLY A 1 1   ? -6.872  17.070  -12.119 1.00 0.00 ? 1   GLY A H3   5  
ATOM 7108  H HA2  . GLY A 1 1   ? -6.935  15.330  -13.693 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7109  H HA3  . GLY A 1 1   ? -7.547  16.777  -14.482 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7110  N N    . ALA A 1 2   ? -5.476  14.957  -15.663 1.00 0.00 ? 2   ALA A N    5  
ATOM 7111  C CA   . ALA A 1 2   ? -4.500  14.685  -16.712 1.00 0.00 ? 2   ALA A CA   5  
ATOM 7112  C C    . ALA A 1 2   ? -4.805  13.367  -17.417 1.00 0.00 ? 2   ALA A C    5  
ATOM 7113  O O    . ALA A 1 2   ? -5.139  13.349  -18.603 1.00 0.00 ? 2   ALA A O    5  
ATOM 7114  C CB   . ALA A 1 2   ? -3.094  14.661  -16.129 1.00 0.00 ? 2   ALA A CB   5  
ATOM 7115  H H    . ALA A 1 2   ? -6.044  14.227  -15.338 1.00 0.00 ? 2   ALA A H    5  
ATOM 7116  H HA   . ALA A 1 2   ? -4.553  15.489  -17.432 1.00 0.00 ? 2   ALA A HA   5  
ATOM 7117  H HB1  . ALA A 1 2   ? -3.145  14.428  -15.075 1.00 0.00 ? 2   ALA A HB1  5  
ATOM 7118  H HB2  . ALA A 1 2   ? -2.631  15.629  -16.263 1.00 0.00 ? 2   ALA A HB2  5  
ATOM 7119  H HB3  . ALA A 1 2   ? -2.507  13.909  -16.637 1.00 0.00 ? 2   ALA A HB3  5  
ATOM 7120  N N    . MET A 1 3   ? -4.689  12.268  -16.678 1.00 0.00 ? 3   MET A N    5  
ATOM 7121  C CA   . MET A 1 3   ? -4.953  10.942  -17.230 1.00 0.00 ? 3   MET A CA   5  
ATOM 7122  C C    . MET A 1 3   ? -5.095  9.910   -16.116 1.00 0.00 ? 3   MET A C    5  
ATOM 7123  O O    . MET A 1 3   ? -6.115  9.227   -16.014 1.00 0.00 ? 3   MET A O    5  
ATOM 7124  C CB   . MET A 1 3   ? -3.829  10.529  -18.183 1.00 0.00 ? 3   MET A CB   5  
ATOM 7125  C CG   . MET A 1 3   ? -4.317  9.793   -19.423 1.00 0.00 ? 3   MET A CG   5  
ATOM 7126  S SD   . MET A 1 3   ? -5.455  8.449   -19.035 1.00 0.00 ? 3   MET A SD   5  
ATOM 7127  C CE   . MET A 1 3   ? -4.303  7.126   -18.667 1.00 0.00 ? 3   MET A CE   5  
ATOM 7128  H H    . MET A 1 3   ? -4.420  12.349  -15.740 1.00 0.00 ? 3   MET A H    5  
ATOM 7129  H HA   . MET A 1 3   ? -5.880  10.992  -17.782 1.00 0.00 ? 3   MET A HA   5  
ATOM 7130  H HB2  . MET A 1 3   ? -3.299  11.413  -18.503 1.00 0.00 ? 3   MET A HB2  5  
ATOM 7131  H HB3  . MET A 1 3   ? -3.144  9.881   -17.654 1.00 0.00 ? 3   MET A HB3  5  
ATOM 7132  H HG2  . MET A 1 3   ? -4.822  10.498  -20.066 1.00 0.00 ? 3   MET A HG2  5  
ATOM 7133  H HG3  . MET A 1 3   ? -3.461  9.384   -19.940 1.00 0.00 ? 3   MET A HG3  5  
ATOM 7134  H HE1  . MET A 1 3   ? -3.666  6.957   -19.523 1.00 0.00 ? 3   MET A HE1  5  
ATOM 7135  H HE2  . MET A 1 3   ? -4.853  6.222   -18.443 1.00 0.00 ? 3   MET A HE2  5  
ATOM 7136  H HE3  . MET A 1 3   ? -3.700  7.401   -17.815 1.00 0.00 ? 3   MET A HE3  5  
ATOM 7137  N N    . ASP A 1 4   ? -4.065  9.803   -15.283 1.00 0.00 ? 4   ASP A N    5  
ATOM 7138  C CA   . ASP A 1 4   ? -4.071  8.854   -14.174 1.00 0.00 ? 4   ASP A CA   5  
ATOM 7139  C C    . ASP A 1 4   ? -2.966  9.168   -13.159 1.00 0.00 ? 4   ASP A C    5  
ATOM 7140  O O    . ASP A 1 4   ? -3.237  9.263   -11.963 1.00 0.00 ? 4   ASP A O    5  
ATOM 7141  C CB   . ASP A 1 4   ? -3.916  7.422   -14.688 1.00 0.00 ? 4   ASP A CB   5  
ATOM 7142  C CG   . ASP A 1 4   ? -4.951  6.481   -14.100 1.00 0.00 ? 4   ASP A CG   5  
ATOM 7143  O OD1  . ASP A 1 4   ? -5.158  6.521   -12.868 1.00 0.00 ? 4   ASP A OD1  5  
ATOM 7144  O OD2  . ASP A 1 4   ? -5.553  5.705   -14.872 1.00 0.00 ? 4   ASP A OD2  5  
ATOM 7145  H H    . ASP A 1 4   ? -3.282  10.375  -15.418 1.00 0.00 ? 4   ASP A H    5  
ATOM 7146  H HA   . ASP A 1 4   ? -5.026  8.941   -13.677 1.00 0.00 ? 4   ASP A HA   5  
ATOM 7147  H HB2  . ASP A 1 4   ? -4.022  7.417   -15.763 1.00 0.00 ? 4   ASP A HB2  5  
ATOM 7148  H HB3  . ASP A 1 4   ? -2.934  7.058   -14.423 1.00 0.00 ? 4   ASP A HB3  5  
ATOM 7149  N N    . PRO A 1 5   ? -1.700  9.335   -13.614 1.00 0.00 ? 5   PRO A N    5  
ATOM 7150  C CA   . PRO A 1 5   ? -0.579  9.639   -12.715 1.00 0.00 ? 5   PRO A CA   5  
ATOM 7151  C C    . PRO A 1 5   ? -0.896  10.788  -11.764 1.00 0.00 ? 5   PRO A C    5  
ATOM 7152  O O    . PRO A 1 5   ? -0.320  10.890  -10.681 1.00 0.00 ? 5   PRO A O    5  
ATOM 7153  C CB   . PRO A 1 5   ? 0.544   10.034  -13.674 1.00 0.00 ? 5   PRO A CB   5  
ATOM 7154  C CG   . PRO A 1 5   ? 0.241   9.294   -14.928 1.00 0.00 ? 5   PRO A CG   5  
ATOM 7155  C CD   . PRO A 1 5   ? -1.259  9.241   -15.023 1.00 0.00 ? 5   PRO A CD   5  
ATOM 7156  H HA   . PRO A 1 5   ? -0.282  8.772   -12.145 1.00 0.00 ? 5   PRO A HA   5  
ATOM 7157  H HB2  . PRO A 1 5   ? 0.528   11.103  -13.830 1.00 0.00 ? 5   PRO A HB2  5  
ATOM 7158  H HB3  . PRO A 1 5   ? 1.497   9.738   -13.261 1.00 0.00 ? 5   PRO A HB3  5  
ATOM 7159  H HG2  . PRO A 1 5   ? 0.654   9.823   -15.776 1.00 0.00 ? 5   PRO A HG2  5  
ATOM 7160  H HG3  . PRO A 1 5   ? 0.649   8.295   -14.873 1.00 0.00 ? 5   PRO A HG3  5  
ATOM 7161  H HD2  . PRO A 1 5   ? -1.630  10.075  -15.601 1.00 0.00 ? 5   PRO A HD2  5  
ATOM 7162  H HD3  . PRO A 1 5   ? -1.576  8.305   -15.463 1.00 0.00 ? 5   PRO A HD3  5  
ATOM 7163  N N    . GLU A 1 6   ? -1.823  11.644  -12.178 1.00 0.00 ? 6   GLU A N    5  
ATOM 7164  C CA   . GLU A 1 6   ? -2.231  12.787  -11.372 1.00 0.00 ? 6   GLU A CA   5  
ATOM 7165  C C    . GLU A 1 6   ? -3.730  12.726  -11.085 1.00 0.00 ? 6   GLU A C    5  
ATOM 7166  O O    . GLU A 1 6   ? -4.214  13.311  -10.115 1.00 0.00 ? 6   GLU A O    5  
ATOM 7167  C CB   . GLU A 1 6   ? -1.869  14.092  -12.095 1.00 0.00 ? 6   GLU A CB   5  
ATOM 7168  C CG   . GLU A 1 6   ? -2.791  15.260  -11.775 1.00 0.00 ? 6   GLU A CG   5  
ATOM 7169  C CD   . GLU A 1 6   ? -2.053  16.582  -11.704 1.00 0.00 ? 6   GLU A CD   5  
ATOM 7170  O OE1  . GLU A 1 6   ? -1.332  16.807  -10.709 1.00 0.00 ? 6   GLU A OE1  5  
ATOM 7171  O OE2  . GLU A 1 6   ? -2.195  17.393  -12.642 1.00 0.00 ? 6   GLU A OE2  5  
ATOM 7172  H H    . GLU A 1 6   ? -2.246  11.503  -13.050 1.00 0.00 ? 6   GLU A H    5  
ATOM 7173  H HA   . GLU A 1 6   ? -1.694  12.742  -10.436 1.00 0.00 ? 6   GLU A HA   5  
ATOM 7174  H HB2  . GLU A 1 6   ? -0.864  14.373  -11.818 1.00 0.00 ? 6   GLU A HB2  5  
ATOM 7175  H HB3  . GLU A 1 6   ? -1.903  13.918  -13.160 1.00 0.00 ? 6   GLU A HB3  5  
ATOM 7176  H HG2  . GLU A 1 6   ? -3.544  15.328  -12.545 1.00 0.00 ? 6   GLU A HG2  5  
ATOM 7177  H HG3  . GLU A 1 6   ? -3.266  15.077  -10.822 1.00 0.00 ? 6   GLU A HG3  5  
ATOM 7178  N N    . PHE A 1 7   ? -4.458  12.007  -11.934 1.00 0.00 ? 7   PHE A N    5  
ATOM 7179  C CA   . PHE A 1 7   ? -5.902  11.864  -11.772 1.00 0.00 ? 7   PHE A CA   5  
ATOM 7180  C C    . PHE A 1 7   ? -6.239  11.151  -10.467 1.00 0.00 ? 7   PHE A C    5  
ATOM 7181  O O    . PHE A 1 7   ? -6.797  11.751  -9.548  1.00 0.00 ? 7   PHE A O    5  
ATOM 7182  C CB   . PHE A 1 7   ? -6.496  11.096  -12.956 1.00 0.00 ? 7   PHE A CB   5  
ATOM 7183  C CG   . PHE A 1 7   ? -7.992  10.967  -12.898 1.00 0.00 ? 7   PHE A CG   5  
ATOM 7184  C CD1  . PHE A 1 7   ? -8.802  12.076  -13.075 1.00 0.00 ? 7   PHE A CD1  5  
ATOM 7185  C CD2  . PHE A 1 7   ? -8.586  9.737   -12.663 1.00 0.00 ? 7   PHE A CD2  5  
ATOM 7186  C CE1  . PHE A 1 7   ? -10.179 11.960  -13.021 1.00 0.00 ? 7   PHE A CE1  5  
ATOM 7187  C CE2  . PHE A 1 7   ? -9.962  9.615   -12.608 1.00 0.00 ? 7   PHE A CE2  5  
ATOM 7188  C CZ   . PHE A 1 7   ? -10.759 10.729  -12.787 1.00 0.00 ? 7   PHE A CZ   5  
ATOM 7189  H H    . PHE A 1 7   ? -4.015  11.560  -12.685 1.00 0.00 ? 7   PHE A H    5  
ATOM 7190  H HA   . PHE A 1 7   ? -6.331  12.855  -11.748 1.00 0.00 ? 7   PHE A HA   5  
ATOM 7191  H HB2  . PHE A 1 7   ? -6.242  11.609  -13.871 1.00 0.00 ? 7   PHE A HB2  5  
ATOM 7192  H HB3  . PHE A 1 7   ? -6.074  10.102  -12.977 1.00 0.00 ? 7   PHE A HB3  5  
ATOM 7193  H HD1  . PHE A 1 7   ? -8.350  13.039  -13.257 1.00 0.00 ? 7   PHE A HD1  5  
ATOM 7194  H HD2  . PHE A 1 7   ? -7.963  8.864   -12.523 1.00 0.00 ? 7   PHE A HD2  5  
ATOM 7195  H HE1  . PHE A 1 7   ? -10.800 12.833  -13.161 1.00 0.00 ? 7   PHE A HE1  5  
ATOM 7196  H HE2  . PHE A 1 7   ? -10.413 8.651   -12.426 1.00 0.00 ? 7   PHE A HE2  5  
ATOM 7197  H HZ   . PHE A 1 7   ? -11.834 10.636  -12.744 1.00 0.00 ? 7   PHE A HZ   5  
ATOM 7198  N N    . ASN A 1 8   ? -5.901  9.868   -10.394 1.00 0.00 ? 8   ASN A N    5  
ATOM 7199  C CA   . ASN A 1 8   ? -6.174  9.071   -9.202  1.00 0.00 ? 8   ASN A CA   5  
ATOM 7200  C C    . ASN A 1 8   ? -5.109  7.995   -9.006  1.00 0.00 ? 8   ASN A C    5  
ATOM 7201  O O    . ASN A 1 8   ? -5.419  6.806   -8.935  1.00 0.00 ? 8   ASN A O    5  
ATOM 7202  C CB   . ASN A 1 8   ? -7.556  8.427   -9.303  1.00 0.00 ? 8   ASN A CB   5  
ATOM 7203  C CG   . ASN A 1 8   ? -8.634  9.265   -8.646  1.00 0.00 ? 8   ASN A CG   5  
ATOM 7204  O OD1  . ASN A 1 8   ? -9.221  10.148  -9.273  1.00 0.00 ? 8   ASN A OD1  5  
ATOM 7205  N ND2  . ASN A 1 8   ? -8.901  8.994   -7.373  1.00 0.00 ? 8   ASN A ND2  5  
ATOM 7206  H H    . ASN A 1 8   ? -5.462  9.446   -11.161 1.00 0.00 ? 8   ASN A H    5  
ATOM 7207  H HA   . ASN A 1 8   ? -6.158  9.736   -8.351  1.00 0.00 ? 8   ASN A HA   5  
ATOM 7208  H HB2  . ASN A 1 8   ? -7.812  8.298   -10.345 1.00 0.00 ? 8   ASN A HB2  5  
ATOM 7209  H HB3  . ASN A 1 8   ? -7.532  7.461   -8.821  1.00 0.00 ? 8   ASN A HB3  5  
ATOM 7210  H HD21 . ASN A 1 8   ? -8.394  8.277   -6.938  1.00 0.00 ? 8   ASN A HD21 5  
ATOM 7211  H HD22 . ASN A 1 8   ? -9.594  9.519   -6.924  1.00 0.00 ? 8   ASN A HD22 5  
ATOM 7212  N N    . LYS A 1 9   ? -3.853  8.420   -8.921  1.00 0.00 ? 9   LYS A N    5  
ATOM 7213  C CA   . LYS A 1 9   ? -2.743  7.491   -8.734  1.00 0.00 ? 9   LYS A CA   5  
ATOM 7214  C C    . LYS A 1 9   ? -2.533  7.171   -7.256  1.00 0.00 ? 9   LYS A C    5  
ATOM 7215  O O    . LYS A 1 9   ? -2.039  8.000   -6.486  1.00 0.00 ? 9   LYS A O    5  
ATOM 7216  C CB   . LYS A 1 9   ? -1.458  8.069   -9.328  1.00 0.00 ? 9   LYS A CB   5  
ATOM 7217  C CG   . LYS A 1 9   ? -0.787  7.148   -10.335 1.00 0.00 ? 9   LYS A CG   5  
ATOM 7218  C CD   . LYS A 1 9   ? 0.058   6.087   -9.647  1.00 0.00 ? 9   LYS A CD   5  
ATOM 7219  C CE   . LYS A 1 9   ? 0.520   5.022   -10.629 1.00 0.00 ? 9   LYS A CE   5  
ATOM 7220  N NZ   . LYS A 1 9   ? 1.994   5.061   -10.842 1.00 0.00 ? 9   LYS A NZ   5  
ATOM 7221  H H    . LYS A 1 9   ? -3.666  9.379   -8.985  1.00 0.00 ? 9   LYS A H    5  
ATOM 7222  H HA   . LYS A 1 9   ? -2.988  6.577   -9.254  1.00 0.00 ? 9   LYS A HA   5  
ATOM 7223  H HB2  . LYS A 1 9   ? -1.691  8.999   -9.824  1.00 0.00 ? 9   LYS A HB2  5  
ATOM 7224  H HB3  . LYS A 1 9   ? -0.760  8.262   -8.528  1.00 0.00 ? 9   LYS A HB3  5  
ATOM 7225  H HG2  . LYS A 1 9   ? -1.547  6.661   -10.924 1.00 0.00 ? 9   LYS A HG2  5  
ATOM 7226  H HG3  . LYS A 1 9   ? -0.150  7.738   -10.979 1.00 0.00 ? 9   LYS A HG3  5  
ATOM 7227  H HD2  . LYS A 1 9   ? 0.923   6.557   -9.208  1.00 0.00 ? 9   LYS A HD2  5  
ATOM 7228  H HD3  . LYS A 1 9   ? -0.531  5.618   -8.872  1.00 0.00 ? 9   LYS A HD3  5  
ATOM 7229  H HE2  . LYS A 1 9   ? 0.246   4.050   -10.243 1.00 0.00 ? 9   LYS A HE2  5  
ATOM 7230  H HE3  . LYS A 1 9   ? 0.022   5.183   -11.576 1.00 0.00 ? 9   LYS A HE3  5  
ATOM 7231  H HZ1  . LYS A 1 9   ? 2.256   4.448   -11.639 1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 7232  H HZ2  . LYS A 1 9   ? 2.486   4.732   -9.987  1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 7233  H HZ3  . LYS A 1 9   ? 2.298   6.034   -11.050 1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 7234  N N    . ALA A 1 10  ? -2.918  5.966   -6.860  1.00 0.00 ? 10  ALA A N    5  
ATOM 7235  C CA   . ALA A 1 10  ? -2.772  5.545   -5.478  1.00 0.00 ? 10  ALA A CA   5  
ATOM 7236  C C    . ALA A 1 10  ? -1.319  5.219   -5.156  1.00 0.00 ? 10  ALA A C    5  
ATOM 7237  O O    . ALA A 1 10  ? -0.863  4.097   -5.373  1.00 0.00 ? 10  ALA A O    5  
ATOM 7238  C CB   . ALA A 1 10  ? -3.668  4.352   -5.185  1.00 0.00 ? 10  ALA A CB   5  
ATOM 7239  H H    . ALA A 1 10  ? -3.321  5.350   -7.508  1.00 0.00 ? 10  ALA A H    5  
ATOM 7240  H HA   . ALA A 1 10  ? -3.089  6.364   -4.852  1.00 0.00 ? 10  ALA A HA   5  
ATOM 7241  H HB1  . ALA A 1 10  ? -4.452  4.651   -4.502  1.00 0.00 ? 10  ALA A HB1  5  
ATOM 7242  H HB2  . ALA A 1 10  ? -3.084  3.562   -4.741  1.00 0.00 ? 10  ALA A HB2  5  
ATOM 7243  H HB3  . ALA A 1 10  ? -4.110  3.999   -6.105  1.00 0.00 ? 10  ALA A HB3  5  
ATOM 7244  N N    . ILE A 1 11  ? -0.591  6.211   -4.646  1.00 0.00 ? 11  ILE A N    5  
ATOM 7245  C CA   . ILE A 1 11  ? 0.815   6.029   -4.307  1.00 0.00 ? 11  ILE A CA   5  
ATOM 7246  C C    . ILE A 1 11  ? 1.048   6.094   -2.800  1.00 0.00 ? 11  ILE A C    5  
ATOM 7247  O O    . ILE A 1 11  ? 0.829   7.130   -2.170  1.00 0.00 ? 11  ILE A O    5  
ATOM 7248  C CB   . ILE A 1 11  ? 1.694   7.096   -4.991  1.00 0.00 ? 11  ILE A CB   5  
ATOM 7249  C CG1  . ILE A 1 11  ? 1.497   7.054   -6.507  1.00 0.00 ? 11  ILE A CG1  5  
ATOM 7250  C CG2  . ILE A 1 11  ? 3.160   6.893   -4.633  1.00 0.00 ? 11  ILE A CG2  5  
ATOM 7251  C CD1  . ILE A 1 11  ? 1.623   8.409   -7.170  1.00 0.00 ? 11  ILE A CD1  5  
ATOM 7252  H H    . ILE A 1 11  ? -1.004  7.089   -4.505  1.00 0.00 ? 11  ILE A H    5  
ATOM 7253  H HA   . ILE A 1 11  ? 1.122   5.059   -4.667  1.00 0.00 ? 11  ILE A HA   5  
ATOM 7254  H HB   . ILE A 1 11  ? 1.393   8.066   -4.625  1.00 0.00 ? 11  ILE A HB   5  
ATOM 7255  H HG12 . ILE A 1 11  ? 2.240   6.403   -6.943  1.00 0.00 ? 11  ILE A HG12 5  
ATOM 7256  H HG13 . ILE A 1 11  ? 0.513   6.667   -6.725  1.00 0.00 ? 11  ILE A HG13 5  
ATOM 7257  H HG21 . ILE A 1 11  ? 3.304   7.089   -3.581  1.00 0.00 ? 11  ILE A HG21 5  
ATOM 7258  H HG22 . ILE A 1 11  ? 3.771   7.570   -5.212  1.00 0.00 ? 11  ILE A HG22 5  
ATOM 7259  H HG23 . ILE A 1 11  ? 3.446   5.874   -4.852  1.00 0.00 ? 11  ILE A HG23 5  
ATOM 7260  H HD11 . ILE A 1 11  ? 2.443   8.392   -7.870  1.00 0.00 ? 11  ILE A HD11 5  
ATOM 7261  H HD12 . ILE A 1 11  ? 1.808   9.162   -6.416  1.00 0.00 ? 11  ILE A HD12 5  
ATOM 7262  H HD13 . ILE A 1 11  ? 0.706   8.641   -7.693  1.00 0.00 ? 11  ILE A HD13 5  
ATOM 7263  N N    . PHE A 1 12  ? 1.519   4.986   -2.237  1.00 0.00 ? 12  PHE A N    5  
ATOM 7264  C CA   . PHE A 1 12  ? 1.814   4.909   -0.810  1.00 0.00 ? 12  PHE A CA   5  
ATOM 7265  C C    . PHE A 1 12  ? 3.306   4.648   -0.613  1.00 0.00 ? 12  PHE A C    5  
ATOM 7266  O O    . PHE A 1 12  ? 3.793   3.558   -0.910  1.00 0.00 ? 12  PHE A O    5  
ATOM 7267  C CB   . PHE A 1 12  ? 0.998   3.790   -0.152  1.00 0.00 ? 12  PHE A CB   5  
ATOM 7268  C CG   . PHE A 1 12  ? -0.344  4.235   0.365   1.00 0.00 ? 12  PHE A CG   5  
ATOM 7269  C CD1  . PHE A 1 12  ? -1.436  4.311   -0.483  1.00 0.00 ? 12  PHE A CD1  5  
ATOM 7270  C CD2  . PHE A 1 12  ? -0.512  4.571   1.699   1.00 0.00 ? 12  PHE A CD2  5  
ATOM 7271  C CE1  . PHE A 1 12  ? -2.670  4.715   -0.010  1.00 0.00 ? 12  PHE A CE1  5  
ATOM 7272  C CE2  . PHE A 1 12  ? -1.743  4.978   2.178   1.00 0.00 ? 12  PHE A CE2  5  
ATOM 7273  C CZ   . PHE A 1 12  ? -2.824  5.049   1.321   1.00 0.00 ? 12  PHE A CZ   5  
ATOM 7274  H H    . PHE A 1 12  ? 1.688   4.203   -2.796  1.00 0.00 ? 12  PHE A H    5  
ATOM 7275  H HA   . PHE A 1 12  ? 1.555   5.856   -0.360  1.00 0.00 ? 12  PHE A HA   5  
ATOM 7276  H HB2  . PHE A 1 12  ? 0.831   3.007   -0.875  1.00 0.00 ? 12  PHE A HB2  5  
ATOM 7277  H HB3  . PHE A 1 12  ? 1.559   3.389   0.680   1.00 0.00 ? 12  PHE A HB3  5  
ATOM 7278  H HD1  . PHE A 1 12  ? -1.316  4.048   -1.524  1.00 0.00 ? 12  PHE A HD1  5  
ATOM 7279  H HD2  . PHE A 1 12  ? 0.333   4.515   2.369   1.00 0.00 ? 12  PHE A HD2  5  
ATOM 7280  H HE1  . PHE A 1 12  ? -3.514  4.772   -0.682  1.00 0.00 ? 12  PHE A HE1  5  
ATOM 7281  H HE2  . PHE A 1 12  ? -1.862  5.241   3.224   1.00 0.00 ? 12  PHE A HE2  5  
ATOM 7282  H HZ   . PHE A 1 12  ? -3.790  5.366   1.690   1.00 0.00 ? 12  PHE A HZ   5  
ATOM 7283  N N    . THR A 1 13  ? 4.028   5.654   -0.132  1.00 0.00 ? 13  THR A N    5  
ATOM 7284  C CA   . THR A 1 13  ? 5.466   5.517   0.076   1.00 0.00 ? 13  THR A CA   5  
ATOM 7285  C C    . THR A 1 13  ? 5.799   5.121   1.508   1.00 0.00 ? 13  THR A C    5  
ATOM 7286  O O    . THR A 1 13  ? 5.407   5.795   2.458   1.00 0.00 ? 13  THR A O    5  
ATOM 7287  C CB   . THR A 1 13  ? 6.215   6.815   -0.267  1.00 0.00 ? 13  THR A CB   5  
ATOM 7288  O OG1  . THR A 1 13  ? 5.750   7.336   -1.519  1.00 0.00 ? 13  THR A OG1  5  
ATOM 7289  C CG2  . THR A 1 13  ? 7.712   6.560   -0.341  1.00 0.00 ? 13  THR A CG2  5  
ATOM 7290  H H    . THR A 1 13  ? 3.590   6.505   0.077   1.00 0.00 ? 13  THR A H    5  
ATOM 7291  H HA   . THR A 1 13  ? 5.820   4.740   -0.586  1.00 0.00 ? 13  THR A HA   5  
ATOM 7292  H HB   . THR A 1 13  ? 6.026   7.540   0.510   1.00 0.00 ? 13  THR A HB   5  
ATOM 7293  H HG1  . THR A 1 13  ? 4.826   7.109   -1.637  1.00 0.00 ? 13  THR A HG1  5  
ATOM 7294  H HG21 . THR A 1 13  ? 8.203   7.420   -0.772  1.00 0.00 ? 13  THR A HG21 5  
ATOM 7295  H HG22 . THR A 1 13  ? 7.899   5.692   -0.958  1.00 0.00 ? 13  THR A HG22 5  
ATOM 7296  H HG23 . THR A 1 13  ? 8.097   6.385   0.652   1.00 0.00 ? 13  THR A HG23 5  
ATOM 7297  N N    . VAL A 1 14  ? 6.526   4.015   1.645   1.00 0.00 ? 14  VAL A N    5  
ATOM 7298  C CA   . VAL A 1 14  ? 6.927   3.502   2.951   1.00 0.00 ? 14  VAL A CA   5  
ATOM 7299  C C    . VAL A 1 14  ? 8.346   2.940   2.889   1.00 0.00 ? 14  VAL A C    5  
ATOM 7300  O O    . VAL A 1 14  ? 8.939   2.869   1.816   1.00 0.00 ? 14  VAL A O    5  
ATOM 7301  C CB   . VAL A 1 14  ? 5.960   2.389   3.438   1.00 0.00 ? 14  VAL A CB   5  
ATOM 7302  C CG1  . VAL A 1 14  ? 4.566   2.596   2.867   1.00 0.00 ? 14  VAL A CG1  5  
ATOM 7303  C CG2  . VAL A 1 14  ? 6.476   1.006   3.063   1.00 0.00 ? 14  VAL A CG2  5  
ATOM 7304  H H    . VAL A 1 14  ? 6.796   3.526   0.843   1.00 0.00 ? 14  VAL A H    5  
ATOM 7305  H HA   . VAL A 1 14  ? 6.898   4.317   3.658   1.00 0.00 ? 14  VAL A HA   5  
ATOM 7306  H HB   . VAL A 1 14  ? 5.894   2.446   4.515   1.00 0.00 ? 14  VAL A HB   5  
ATOM 7307  H HG11 . VAL A 1 14  ? 4.173   1.648   2.534   1.00 0.00 ? 14  VAL A HG11 5  
ATOM 7308  H HG12 . VAL A 1 14  ? 4.617   3.278   2.031   1.00 0.00 ? 14  VAL A HG12 5  
ATOM 7309  H HG13 . VAL A 1 14  ? 3.921   3.005   3.629   1.00 0.00 ? 14  VAL A HG13 5  
ATOM 7310  H HG21 . VAL A 1 14  ? 6.805   1.008   2.034   1.00 0.00 ? 14  VAL A HG21 5  
ATOM 7311  H HG22 . VAL A 1 14  ? 5.685   0.281   3.186   1.00 0.00 ? 14  VAL A HG22 5  
ATOM 7312  H HG23 . VAL A 1 14  ? 7.305   0.745   3.704   1.00 0.00 ? 14  VAL A HG23 5  
ATOM 7313  N N    . ASP A 1 15  ? 8.876   2.523   4.036   1.00 0.00 ? 15  ASP A N    5  
ATOM 7314  C CA   . ASP A 1 15  ? 10.213  1.938   4.090   1.00 0.00 ? 15  ASP A CA   5  
ATOM 7315  C C    . ASP A 1 15  ? 10.091  0.413   4.071   1.00 0.00 ? 15  ASP A C    5  
ATOM 7316  O O    . ASP A 1 15  ? 9.029   -0.124  4.371   1.00 0.00 ? 15  ASP A O    5  
ATOM 7317  C CB   . ASP A 1 15  ? 10.969  2.435   5.329   1.00 0.00 ? 15  ASP A CB   5  
ATOM 7318  C CG   . ASP A 1 15  ? 10.953  1.447   6.476   1.00 0.00 ? 15  ASP A CG   5  
ATOM 7319  O OD1  . ASP A 1 15  ? 9.955   1.419   7.223   1.00 0.00 ? 15  ASP A OD1  5  
ATOM 7320  O OD2  . ASP A 1 15  ? 11.946  0.711   6.637   1.00 0.00 ? 15  ASP A OD2  5  
ATOM 7321  H H    . ASP A 1 15  ? 8.350   2.591   4.859   1.00 0.00 ? 15  ASP A H    5  
ATOM 7322  H HA   . ASP A 1 15  ? 10.743  2.253   3.201   1.00 0.00 ? 15  ASP A HA   5  
ATOM 7323  H HB2  . ASP A 1 15  ? 11.998  2.622   5.061   1.00 0.00 ? 15  ASP A HB2  5  
ATOM 7324  H HB3  . ASP A 1 15  ? 10.520  3.356   5.669   1.00 0.00 ? 15  ASP A HB3  5  
ATOM 7325  N N    . ALA A 1 16  ? 11.150  -0.288  3.684   1.00 0.00 ? 16  ALA A N    5  
ATOM 7326  C CA   . ALA A 1 16  ? 11.089  -1.749  3.600   1.00 0.00 ? 16  ALA A CA   5  
ATOM 7327  C C    . ALA A 1 16  ? 11.436  -2.437  4.909   1.00 0.00 ? 16  ALA A C    5  
ATOM 7328  O O    . ALA A 1 16  ? 11.025  -3.575  5.137   1.00 0.00 ? 16  ALA A O    5  
ATOM 7329  C CB   . ALA A 1 16  ? 11.992  -2.249  2.482   1.00 0.00 ? 16  ALA A CB   5  
ATOM 7330  H H    . ALA A 1 16  ? 11.974  0.171   3.421   1.00 0.00 ? 16  ALA A H    5  
ATOM 7331  H HA   . ALA A 1 16  ? 10.075  -2.013  3.348   1.00 0.00 ? 16  ALA A HA   5  
ATOM 7332  H HB1  . ALA A 1 16  ? 11.869  -1.623  1.610   1.00 0.00 ? 16  ALA A HB1  5  
ATOM 7333  H HB2  . ALA A 1 16  ? 11.726  -3.266  2.231   1.00 0.00 ? 16  ALA A HB2  5  
ATOM 7334  H HB3  . ALA A 1 16  ? 13.022  -2.217  2.807   1.00 0.00 ? 16  ALA A HB3  5  
ATOM 7335  N N    . LYS A 1 17  ? 12.177  -1.763  5.773   1.00 0.00 ? 17  LYS A N    5  
ATOM 7336  C CA   . LYS A 1 17  ? 12.540  -2.356  7.052   1.00 0.00 ? 17  LYS A CA   5  
ATOM 7337  C C    . LYS A 1 17  ? 11.298  -2.550  7.918   1.00 0.00 ? 17  LYS A C    5  
ATOM 7338  O O    . LYS A 1 17  ? 10.912  -3.677  8.228   1.00 0.00 ? 17  LYS A O    5  
ATOM 7339  C CB   . LYS A 1 17  ? 13.559  -1.479  7.786   1.00 0.00 ? 17  LYS A CB   5  
ATOM 7340  C CG   . LYS A 1 17  ? 14.655  -2.268  8.486   1.00 0.00 ? 17  LYS A CG   5  
ATOM 7341  C CD   . LYS A 1 17  ? 14.090  -3.209  9.540   1.00 0.00 ? 17  LYS A CD   5  
ATOM 7342  C CE   . LYS A 1 17  ? 14.020  -2.545  10.905  1.00 0.00 ? 17  LYS A CE   5  
ATOM 7343  N NZ   . LYS A 1 17  ? 15.220  -2.848  11.734  1.00 0.00 ? 17  LYS A NZ   5  
ATOM 7344  H H    . LYS A 1 17  ? 12.474  -0.854  5.553   1.00 0.00 ? 17  LYS A H    5  
ATOM 7345  H HA   . LYS A 1 17  ? 12.981  -3.321  6.857   1.00 0.00 ? 17  LYS A HA   5  
ATOM 7346  H HB2  . LYS A 1 17  ? 14.024  -0.816  7.073   1.00 0.00 ? 17  LYS A HB2  5  
ATOM 7347  H HB3  . LYS A 1 17  ? 13.039  -0.890  8.528   1.00 0.00 ? 17  LYS A HB3  5  
ATOM 7348  H HG2  . LYS A 1 17  ? 15.194  -2.847  7.754   1.00 0.00 ? 17  LYS A HG2  5  
ATOM 7349  H HG3  . LYS A 1 17  ? 15.331  -1.574  8.966   1.00 0.00 ? 17  LYS A HG3  5  
ATOM 7350  H HD2  . LYS A 1 17  ? 13.096  -3.509  9.245   1.00 0.00 ? 17  LYS A HD2  5  
ATOM 7351  H HD3  . LYS A 1 17  ? 14.724  -4.082  9.606   1.00 0.00 ? 17  LYS A HD3  5  
ATOM 7352  H HE2  . LYS A 1 17  ? 13.948  -1.476  10.769  1.00 0.00 ? 17  LYS A HE2  5  
ATOM 7353  H HE3  . LYS A 1 17  ? 13.139  -2.902  11.420  1.00 0.00 ? 17  LYS A HE3  5  
ATOM 7354  H HZ1  . LYS A 1 17  ? 15.121  -3.782  12.178  1.00 0.00 ? 17  LYS A HZ1  5  
ATOM 7355  H HZ2  . LYS A 1 17  ? 15.328  -2.132  12.480  1.00 0.00 ? 17  LYS A HZ2  5  
ATOM 7356  H HZ3  . LYS A 1 17  ? 16.074  -2.846  11.139  1.00 0.00 ? 17  LYS A HZ3  5  
ATOM 7357  N N    . THR A 1 18  ? 10.700  -1.439  8.331   1.00 0.00 ? 18  THR A N    5  
ATOM 7358  C CA   . THR A 1 18  ? 9.524   -1.499  9.194   1.00 0.00 ? 18  THR A CA   5  
ATOM 7359  C C    . THR A 1 18  ? 8.237   -1.044  8.515   1.00 0.00 ? 18  THR A C    5  
ATOM 7360  O O    . THR A 1 18  ? 7.170   -1.078  9.131   1.00 0.00 ? 18  THR A O    5  
ATOM 7361  C CB   . THR A 1 18  ? 9.731   -0.698  10.493  1.00 0.00 ? 18  THR A CB   5  
ATOM 7362  O OG1  . THR A 1 18  ? 8.666   -0.974  11.413  1.00 0.00 ? 18  THR A OG1  5  
ATOM 7363  C CG2  . THR A 1 18  ? 9.786   0.796   10.213  1.00 0.00 ? 18  THR A CG2  5  
ATOM 7364  H H    . THR A 1 18  ? 11.099  -0.583  8.071   1.00 0.00 ? 18  THR A H    5  
ATOM 7365  H HA   . THR A 1 18  ? 9.401   -2.530  9.456   1.00 0.00 ? 18  THR A HA   5  
ATOM 7366  H HB   . THR A 1 18  ? 10.666  -1.000  10.940  1.00 0.00 ? 18  THR A HB   5  
ATOM 7367  H HG1  . THR A 1 18  ? 8.936   -0.722  12.299  1.00 0.00 ? 18  THR A HG1  5  
ATOM 7368  H HG21 . THR A 1 18  ? 10.395  1.281   10.962  1.00 0.00 ? 18  THR A HG21 5  
ATOM 7369  H HG22 . THR A 1 18  ? 8.787   1.206   10.239  1.00 0.00 ? 18  THR A HG22 5  
ATOM 7370  H HG23 . THR A 1 18  ? 10.218  0.963   9.237   1.00 0.00 ? 18  THR A HG23 5  
ATOM 7371  N N    . THR A 1 19  ? 8.342   -0.602  7.270   1.00 0.00 ? 19  THR A N    5  
ATOM 7372  C CA   . THR A 1 19  ? 7.184   -0.119  6.516   1.00 0.00 ? 19  THR A CA   5  
ATOM 7373  C C    . THR A 1 19  ? 6.837   1.315   6.919   1.00 0.00 ? 19  THR A C    5  
ATOM 7374  O O    . THR A 1 19  ? 7.602   2.236   6.637   1.00 0.00 ? 19  THR A O    5  
ATOM 7375  C CB   . THR A 1 19  ? 5.946   -1.028  6.691   1.00 0.00 ? 19  THR A CB   5  
ATOM 7376  O OG1  . THR A 1 19  ? 6.346   -2.402  6.727   1.00 0.00 ? 19  THR A OG1  5  
ATOM 7377  C CG2  . THR A 1 19  ? 4.952   -0.816  5.559   1.00 0.00 ? 19  THR A CG2  5  
ATOM 7378  H H    . THR A 1 19  ? 9.227   -0.569  6.856   1.00 0.00 ? 19  THR A H    5  
ATOM 7379  H HA   . THR A 1 19  ? 7.452   -0.124  5.469   1.00 0.00 ? 19  THR A HA   5  
ATOM 7380  H HB   . THR A 1 19  ? 5.463   -0.777  7.623   1.00 0.00 ? 19  THR A HB   5  
ATOM 7381  H HG1  . THR A 1 19  ? 5.645   -2.930  7.118   1.00 0.00 ? 19  THR A HG1  5  
ATOM 7382  H HG21 . THR A 1 19  ? 4.718   0.234   5.478   1.00 0.00 ? 19  THR A HG21 5  
ATOM 7383  H HG22 . THR A 1 19  ? 4.050   -1.373  5.762   1.00 0.00 ? 19  THR A HG22 5  
ATOM 7384  H HG23 . THR A 1 19  ? 5.387   -1.159  4.632   1.00 0.00 ? 19  THR A HG23 5  
ATOM 7385  N N    . GLU A 1 20  ? 5.693   1.504   7.579   1.00 0.00 ? 20  GLU A N    5  
ATOM 7386  C CA   . GLU A 1 20  ? 5.270   2.836   8.012   1.00 0.00 ? 20  GLU A CA   5  
ATOM 7387  C C    . GLU A 1 20  ? 5.238   3.808   6.836   1.00 0.00 ? 20  GLU A C    5  
ATOM 7388  O O    . GLU A 1 20  ? 6.279   4.283   6.382   1.00 0.00 ? 20  GLU A O    5  
ATOM 7389  C CB   . GLU A 1 20  ? 6.207   3.363   9.102   1.00 0.00 ? 20  GLU A CB   5  
ATOM 7390  C CG   . GLU A 1 20  ? 6.058   2.645   10.433  1.00 0.00 ? 20  GLU A CG   5  
ATOM 7391  C CD   . GLU A 1 20  ? 6.351   3.545   11.617  1.00 0.00 ? 20  GLU A CD   5  
ATOM 7392  O OE1  . GLU A 1 20  ? 6.109   4.766   11.511  1.00 0.00 ? 20  GLU A OE1  5  
ATOM 7393  O OE2  . GLU A 1 20  ? 6.826   3.030   12.652  1.00 0.00 ? 20  GLU A OE2  5  
ATOM 7394  H H    . GLU A 1 20  ? 5.123   0.735   7.782   1.00 0.00 ? 20  GLU A H    5  
ATOM 7395  H HA   . GLU A 1 20  ? 4.274   2.750   8.420   1.00 0.00 ? 20  GLU A HA   5  
ATOM 7396  H HB2  . GLU A 1 20  ? 7.228   3.249   8.768   1.00 0.00 ? 20  GLU A HB2  5  
ATOM 7397  H HB3  . GLU A 1 20  ? 6.003   4.412   9.258   1.00 0.00 ? 20  GLU A HB3  5  
ATOM 7398  H HG2  . GLU A 1 20  ? 5.045   2.281   10.521  1.00 0.00 ? 20  GLU A HG2  5  
ATOM 7399  H HG3  . GLU A 1 20  ? 6.743   1.811   10.455  1.00 0.00 ? 20  GLU A HG3  5  
ATOM 7400  N N    . ILE A 1 21  ? 4.041   4.095   6.338   1.00 0.00 ? 21  ILE A N    5  
ATOM 7401  C CA   . ILE A 1 21  ? 3.885   5.000   5.206   1.00 0.00 ? 21  ILE A CA   5  
ATOM 7402  C C    . ILE A 1 21  ? 4.490   6.372   5.494   1.00 0.00 ? 21  ILE A C    5  
ATOM 7403  O O    . ILE A 1 21  ? 3.915   7.178   6.227   1.00 0.00 ? 21  ILE A O    5  
ATOM 7404  C CB   . ILE A 1 21  ? 2.408   5.182   4.803   1.00 0.00 ? 21  ILE A CB   5  
ATOM 7405  C CG1  . ILE A 1 21  ? 1.570   3.968   5.220   1.00 0.00 ? 21  ILE A CG1  5  
ATOM 7406  C CG2  . ILE A 1 21  ? 2.305   5.401   3.303   1.00 0.00 ? 21  ILE A CG2  5  
ATOM 7407  C CD1  . ILE A 1 21  ? 0.477   4.301   6.213   1.00 0.00 ? 21  ILE A CD1  5  
ATOM 7408  H H    . ILE A 1 21  ? 3.247   3.683   6.738   1.00 0.00 ? 21  ILE A H    5  
ATOM 7409  H HA   . ILE A 1 21  ? 4.408   4.565   4.366   1.00 0.00 ? 21  ILE A HA   5  
ATOM 7410  H HB   . ILE A 1 21  ? 2.027   6.063   5.298   1.00 0.00 ? 21  ILE A HB   5  
ATOM 7411  H HG12 . ILE A 1 21  ? 1.103   3.546   4.345   1.00 0.00 ? 21  ILE A HG12 5  
ATOM 7412  H HG13 . ILE A 1 21  ? 2.217   3.231   5.671   1.00 0.00 ? 21  ILE A HG13 5  
ATOM 7413  H HG21 . ILE A 1 21  ? 1.837   4.540   2.846   1.00 0.00 ? 21  ILE A HG21 5  
ATOM 7414  H HG22 . ILE A 1 21  ? 3.293   5.534   2.890   1.00 0.00 ? 21  ILE A HG22 5  
ATOM 7415  H HG23 . ILE A 1 21  ? 1.710   6.280   3.106   1.00 0.00 ? 21  ILE A HG23 5  
ATOM 7416  H HD11 . ILE A 1 21  ? 0.917   4.717   7.106   1.00 0.00 ? 21  ILE A HD11 5  
ATOM 7417  H HD12 . ILE A 1 21  ? -0.067  3.403   6.462   1.00 0.00 ? 21  ILE A HD12 5  
ATOM 7418  H HD13 . ILE A 1 21  ? -0.199  5.021   5.775   1.00 0.00 ? 21  ILE A HD13 5  
ATOM 7419  N N    . LEU A 1 22  ? 5.655   6.625   4.903   1.00 0.00 ? 22  LEU A N    5  
ATOM 7420  C CA   . LEU A 1 22  ? 6.349   7.895   5.080   1.00 0.00 ? 22  LEU A CA   5  
ATOM 7421  C C    . LEU A 1 22  ? 5.471   9.064   4.648   1.00 0.00 ? 22  LEU A C    5  
ATOM 7422  O O    . LEU A 1 22  ? 5.531   10.144  5.235   1.00 0.00 ? 22  LEU A O    5  
ATOM 7423  C CB   . LEU A 1 22  ? 7.658   7.908   4.281   1.00 0.00 ? 22  LEU A CB   5  
ATOM 7424  C CG   . LEU A 1 22  ? 8.403   6.571   4.223   1.00 0.00 ? 22  LEU A CG   5  
ATOM 7425  C CD1  . LEU A 1 22  ? 9.694   6.712   3.432   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 7426  C CD2  . LEU A 1 22  ? 8.691   6.060   5.627   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 7427  H H    . LEU A 1 22  ? 6.053   5.937   4.331   1.00 0.00 ? 22  LEU A H    5  
ATOM 7428  H HA   . LEU A 1 22  ? 6.580   8.002   6.130   1.00 0.00 ? 22  LEU A HA   5  
ATOM 7429  H HB2  . LEU A 1 22  ? 7.431   8.213   3.268   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7430  H HB3  . LEU A 1 22  ? 8.317   8.642   4.721   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 7431  H HG   . LEU A 1 22  ? 7.784   5.843   3.719   1.00 0.00 ? 22  LEU A HG   5  
ATOM 7432  H HD11 . LEU A 1 22  ? 10.356  5.893   3.673   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 7433  H HD12 . LEU A 1 22  ? 10.171  7.648   3.688   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 7434  H HD13 . LEU A 1 22  ? 9.473   6.699   2.375   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 7435  H HD21 . LEU A 1 22  ? 7.926   5.356   5.916   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 7436  H HD22 . LEU A 1 22  ? 8.697   6.889   6.317   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 7437  H HD23 . LEU A 1 22  ? 9.654   5.571   5.642   1.00 0.00 ? 22  LEU A HD23 5  
ATOM 7438  N N    . VAL A 1 23  ? 4.651   8.841   3.622   1.00 0.00 ? 23  VAL A N    5  
ATOM 7439  C CA   . VAL A 1 23  ? 3.755   9.880   3.114   1.00 0.00 ? 23  VAL A CA   5  
ATOM 7440  C C    . VAL A 1 23  ? 2.904   9.365   1.950   1.00 0.00 ? 23  VAL A C    5  
ATOM 7441  O O    . VAL A 1 23  ? 3.268   8.396   1.282   1.00 0.00 ? 23  VAL A O    5  
ATOM 7442  C CB   . VAL A 1 23  ? 4.547   11.135  2.669   1.00 0.00 ? 23  VAL A CB   5  
ATOM 7443  C CG1  . VAL A 1 23  ? 4.551   11.294  1.152   1.00 0.00 ? 23  VAL A CG1  5  
ATOM 7444  C CG2  . VAL A 1 23  ? 3.988   12.380  3.339   1.00 0.00 ? 23  VAL A CG2  5  
ATOM 7445  H H    . VAL A 1 23  ? 4.645   7.956   3.197   1.00 0.00 ? 23  VAL A H    5  
ATOM 7446  H HA   . VAL A 1 23  ? 3.097   10.168  3.921   1.00 0.00 ? 23  VAL A HA   5  
ATOM 7447  H HB   . VAL A 1 23  ? 5.571   11.016  2.991   1.00 0.00 ? 23  VAL A HB   5  
ATOM 7448  H HG11 . VAL A 1 23  ? 5.083   10.469  0.704   1.00 0.00 ? 23  VAL A HG11 5  
ATOM 7449  H HG12 . VAL A 1 23  ? 5.034   12.223  0.888   1.00 0.00 ? 23  VAL A HG12 5  
ATOM 7450  H HG13 . VAL A 1 23  ? 3.533   11.305  0.789   1.00 0.00 ? 23  VAL A HG13 5  
ATOM 7451  H HG21 . VAL A 1 23  ? 4.790   13.074  3.540   1.00 0.00 ? 23  VAL A HG21 5  
ATOM 7452  H HG22 . VAL A 1 23  ? 3.510   12.105  4.268   1.00 0.00 ? 23  VAL A HG22 5  
ATOM 7453  H HG23 . VAL A 1 23  ? 3.263   12.845  2.686   1.00 0.00 ? 23  VAL A HG23 5  
ATOM 7454  N N    . ALA A 1 24  ? 1.780   10.036  1.707   1.00 0.00 ? 24  ALA A N    5  
ATOM 7455  C CA   . ALA A 1 24  ? 0.880   9.669   0.618   1.00 0.00 ? 24  ALA A CA   5  
ATOM 7456  C C    . ALA A 1 24  ? 0.376   10.917  -0.099  1.00 0.00 ? 24  ALA A C    5  
ATOM 7457  O O    . ALA A 1 24  ? 0.509   12.028  0.413   1.00 0.00 ? 24  ALA A O    5  
ATOM 7458  C CB   . ALA A 1 24  ? -0.283  8.843   1.138   1.00 0.00 ? 24  ALA A CB   5  
ATOM 7459  H H    . ALA A 1 24  ? 1.555   10.806  2.268   1.00 0.00 ? 24  ALA A H    5  
ATOM 7460  H HA   . ALA A 1 24  ? 1.437   9.062   -0.084  1.00 0.00 ? 24  ALA A HA   5  
ATOM 7461  H HB1  . ALA A 1 24  ? -1.193  9.148   0.641   1.00 0.00 ? 24  ALA A HB1  5  
ATOM 7462  H HB2  . ALA A 1 24  ? -0.386  8.998   2.202   1.00 0.00 ? 24  ALA A HB2  5  
ATOM 7463  H HB3  . ALA A 1 24  ? -0.101  7.797   0.942   1.00 0.00 ? 24  ALA A HB3  5  
ATOM 7464  N N    . ASN A 1 25  ? -0.170  10.738  -1.299  1.00 0.00 ? 25  ASN A N    5  
ATOM 7465  C CA   . ASN A 1 25  ? -0.647  11.874  -2.083  1.00 0.00 ? 25  ASN A CA   5  
ATOM 7466  C C    . ASN A 1 25  ? -2.167  12.041  -2.043  1.00 0.00 ? 25  ASN A C    5  
ATOM 7467  O O    . ASN A 1 25  ? -2.886  11.277  -1.396  1.00 0.00 ? 25  ASN A O    5  
ATOM 7468  C CB   . ASN A 1 25  ? -0.176  11.745  -3.534  1.00 0.00 ? 25  ASN A CB   5  
ATOM 7469  C CG   . ASN A 1 25  ? -0.709  10.497  -4.214  1.00 0.00 ? 25  ASN A CG   5  
ATOM 7470  O OD1  . ASN A 1 25  ? -0.850  9.444   -3.591  1.00 0.00 ? 25  ASN A OD1  5  
ATOM 7471  N ND2  . ASN A 1 25  ? -1.005  10.609  -5.503  1.00 0.00 ? 25  ASN A ND2  5  
ATOM 7472  H H    . ASN A 1 25  ? -0.218  9.835   -1.674  1.00 0.00 ? 25  ASN A H    5  
ATOM 7473  H HA   . ASN A 1 25  ? -0.204  12.762  -1.658  1.00 0.00 ? 25  ASN A HA   5  
ATOM 7474  H HB2  . ASN A 1 25  ? -0.512  12.605  -4.092  1.00 0.00 ? 25  ASN A HB2  5  
ATOM 7475  H HB3  . ASN A 1 25  ? 0.903   11.710  -3.553  1.00 0.00 ? 25  ASN A HB3  5  
ATOM 7476  H HD21 . ASN A 1 25  ? -0.865  11.477  -5.936  1.00 0.00 ? 25  ASN A HD21 5  
ATOM 7477  H HD22 . ASN A 1 25  ? -1.359  9.822   -5.967  1.00 0.00 ? 25  ASN A HD22 5  
ATOM 7478  N N    . ASP A 1 26  ? -2.625  13.077  -2.745  1.00 0.00 ? 26  ASP A N    5  
ATOM 7479  C CA   . ASP A 1 26  ? -4.043  13.428  -2.828  1.00 0.00 ? 26  ASP A CA   5  
ATOM 7480  C C    . ASP A 1 26  ? -4.827  12.457  -3.703  1.00 0.00 ? 26  ASP A C    5  
ATOM 7481  O O    . ASP A 1 26  ? -6.052  12.541  -3.785  1.00 0.00 ? 26  ASP A O    5  
ATOM 7482  C CB   . ASP A 1 26  ? -4.205  14.851  -3.362  1.00 0.00 ? 26  ASP A CB   5  
ATOM 7483  C CG   . ASP A 1 26  ? -5.606  15.390  -3.165  1.00 0.00 ? 26  ASP A CG   5  
ATOM 7484  O OD1  . ASP A 1 26  ? -6.196  15.133  -2.094  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 7485  O OD2  . ASP A 1 26  ? -6.117  16.069  -4.080  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 7486  H H    . ASP A 1 26  ? -1.970  13.632  -3.217  1.00 0.00 ? 26  ASP A H    5  
ATOM 7487  H HA   . ASP A 1 26  ? -4.451  13.385  -1.827  1.00 0.00 ? 26  ASP A HA   5  
ATOM 7488  H HB2  . ASP A 1 26  ? -3.512  15.503  -2.848  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 7489  H HB3  . ASP A 1 26  ? -3.980  14.858  -4.417  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 7490  N N    . LYS A 1 27  ? -4.129  11.525  -4.336  1.00 0.00 ? 27  LYS A N    5  
ATOM 7491  C CA   . LYS A 1 27  ? -4.788  10.535  -5.175  1.00 0.00 ? 27  LYS A CA   5  
ATOM 7492  C C    . LYS A 1 27  ? -5.077  9.292   -4.348  1.00 0.00 ? 27  LYS A C    5  
ATOM 7493  O O    . LYS A 1 27  ? -6.231  8.990   -4.048  1.00 0.00 ? 27  LYS A O    5  
ATOM 7494  C CB   . LYS A 1 27  ? -3.920  10.198  -6.384  1.00 0.00 ? 27  LYS A CB   5  
ATOM 7495  C CG   . LYS A 1 27  ? -4.028  11.219  -7.503  1.00 0.00 ? 27  LYS A CG   5  
ATOM 7496  C CD   . LYS A 1 27  ? -2.675  11.828  -7.834  1.00 0.00 ? 27  LYS A CD   5  
ATOM 7497  C CE   . LYS A 1 27  ? -2.426  13.097  -7.036  1.00 0.00 ? 27  LYS A CE   5  
ATOM 7498  N NZ   . LYS A 1 27  ? -3.448  14.142  -7.322  1.00 0.00 ? 27  LYS A NZ   5  
ATOM 7499  H H    . LYS A 1 27  ? -3.160  11.474  -4.209  1.00 0.00 ? 27  LYS A H    5  
ATOM 7500  H HA   . LYS A 1 27  ? -5.722  10.955  -5.513  1.00 0.00 ? 27  LYS A HA   5  
ATOM 7501  H HB2  . LYS A 1 27  ? -2.888  10.146  -6.070  1.00 0.00 ? 27  LYS A HB2  5  
ATOM 7502  H HB3  . LYS A 1 27  ? -4.218  9.236   -6.771  1.00 0.00 ? 27  LYS A HB3  5  
ATOM 7503  H HG2  . LYS A 1 27  ? -4.417  10.732  -8.385  1.00 0.00 ? 27  LYS A HG2  5  
ATOM 7504  H HG3  . LYS A 1 27  ? -4.701  12.004  -7.196  1.00 0.00 ? 27  LYS A HG3  5  
ATOM 7505  H HD2  . LYS A 1 27  ? -1.902  11.110  -7.601  1.00 0.00 ? 27  LYS A HD2  5  
ATOM 7506  H HD3  . LYS A 1 27  ? -2.643  12.063  -8.887  1.00 0.00 ? 27  LYS A HD3  5  
ATOM 7507  H HE2  . LYS A 1 27  ? -2.455  12.857  -5.983  1.00 0.00 ? 27  LYS A HE2  5  
ATOM 7508  H HE3  . LYS A 1 27  ? -1.449  13.481  -7.290  1.00 0.00 ? 27  LYS A HE3  5  
ATOM 7509  H HZ1  . LYS A 1 27  ? -4.195  13.754  -7.931  1.00 0.00 ? 27  LYS A HZ1  5  
ATOM 7510  H HZ2  . LYS A 1 27  ? -3.007  14.949  -7.806  1.00 0.00 ? 27  LYS A HZ2  5  
ATOM 7511  H HZ3  . LYS A 1 27  ? -3.876  14.475  -6.434  1.00 0.00 ? 27  LYS A HZ3  5  
ATOM 7512  N N    . ALA A 1 28  ? -4.013  8.591   -3.959  1.00 0.00 ? 28  ALA A N    5  
ATOM 7513  C CA   . ALA A 1 28  ? -4.142  7.397   -3.129  1.00 0.00 ? 28  ALA A CA   5  
ATOM 7514  C C    . ALA A 1 28  ? -5.105  7.643   -1.976  1.00 0.00 ? 28  ALA A C    5  
ATOM 7515  O O    . ALA A 1 28  ? -6.026  6.861   -1.733  1.00 0.00 ? 28  ALA A O    5  
ATOM 7516  C CB   . ALA A 1 28  ? -2.783  6.995   -2.580  1.00 0.00 ? 28  ALA A CB   5  
ATOM 7517  H H    . ALA A 1 28  ? -3.118  8.898   -4.226  1.00 0.00 ? 28  ALA A H    5  
ATOM 7518  H HA   . ALA A 1 28  ? -4.516  6.591   -3.743  1.00 0.00 ? 28  ALA A HA   5  
ATOM 7519  H HB1  . ALA A 1 28  ? -2.034  7.685   -2.937  1.00 0.00 ? 28  ALA A HB1  5  
ATOM 7520  H HB2  . ALA A 1 28  ? -2.541  5.997   -2.911  1.00 0.00 ? 28  ALA A HB2  5  
ATOM 7521  H HB3  . ALA A 1 28  ? -2.812  7.022   -1.501  1.00 0.00 ? 28  ALA A HB3  5  
ATOM 7522  N N    . CYS A 1 29  ? -4.877  8.744   -1.267  1.00 0.00 ? 29  CYS A N    5  
ATOM 7523  C CA   . CYS A 1 29  ? -5.711  9.117   -0.135  1.00 0.00 ? 29  CYS A CA   5  
ATOM 7524  C C    . CYS A 1 29  ? -7.168  9.226   -0.561  1.00 0.00 ? 29  CYS A C    5  
ATOM 7525  O O    . CYS A 1 29  ? -8.069  8.804   0.164   1.00 0.00 ? 29  CYS A O    5  
ATOM 7526  C CB   . CYS A 1 29  ? -5.219  10.441  0.455   1.00 0.00 ? 29  CYS A CB   5  
ATOM 7527  S SG   . CYS A 1 29  ? -6.198  11.885  -0.025  1.00 0.00 ? 29  CYS A SG   5  
ATOM 7528  H H    . CYS A 1 29  ? -4.126  9.322   -1.516  1.00 0.00 ? 29  CYS A H    5  
ATOM 7529  H HA   . CYS A 1 29  ? -5.630  8.339   0.610   1.00 0.00 ? 29  CYS A HA   5  
ATOM 7530  H HB2  . CYS A 1 29  ? -5.237  10.377  1.533   1.00 0.00 ? 29  CYS A HB2  5  
ATOM 7531  H HB3  . CYS A 1 29  ? -4.203  10.612  0.130   1.00 0.00 ? 29  CYS A HB3  5  
ATOM 7532  H HG   . CYS A 1 29  ? -5.581  12.966  0.431   1.00 0.00 ? 29  CYS A HG   5  
ATOM 7533  N N    . GLY A 1 30  ? -7.388  9.779   -1.749  1.00 0.00 ? 30  GLY A N    5  
ATOM 7534  C CA   . GLY A 1 30  ? -8.740  9.912   -2.259  1.00 0.00 ? 30  GLY A CA   5  
ATOM 7535  C C    . GLY A 1 30  ? -9.424  8.563   -2.373  1.00 0.00 ? 30  GLY A C    5  
ATOM 7536  O O    . GLY A 1 30  ? -10.604 8.425   -2.060  1.00 0.00 ? 30  GLY A O    5  
ATOM 7537  H H    . GLY A 1 30  ? -6.624  10.087  -2.287  1.00 0.00 ? 30  GLY A H    5  
ATOM 7538  H HA2  . GLY A 1 30  ? -9.310  10.541  -1.591  1.00 0.00 ? 30  GLY A HA2  5  
ATOM 7539  H HA3  . GLY A 1 30  ? -8.706  10.373  -3.236  1.00 0.00 ? 30  GLY A HA3  5  
ATOM 7540  N N    . LEU A 1 31  ? -8.662  7.569   -2.823  1.00 0.00 ? 31  LEU A N    5  
ATOM 7541  C CA   . LEU A 1 31  ? -9.171  6.211   -2.984  1.00 0.00 ? 31  LEU A CA   5  
ATOM 7542  C C    . LEU A 1 31  ? -9.872  5.746   -1.711  1.00 0.00 ? 31  LEU A C    5  
ATOM 7543  O O    . LEU A 1 31  ? -11.072 5.465   -1.719  1.00 0.00 ? 31  LEU A O    5  
ATOM 7544  C CB   . LEU A 1 31  ? -8.023  5.260   -3.328  1.00 0.00 ? 31  LEU A CB   5  
ATOM 7545  C CG   . LEU A 1 31  ? -8.229  3.806   -2.913  1.00 0.00 ? 31  LEU A CG   5  
ATOM 7546  C CD1  . LEU A 1 31  ? -8.409  2.939   -4.135  1.00 0.00 ? 31  LEU A CD1  5  
ATOM 7547  C CD2  . LEU A 1 31  ? -7.056  3.317   -2.078  1.00 0.00 ? 31  LEU A CD2  5  
ATOM 7548  H H    . LEU A 1 31  ? -7.729  7.763   -3.056  1.00 0.00 ? 31  LEU A H    5  
ATOM 7549  H HA   . LEU A 1 31  ? -9.884  6.213   -3.796  1.00 0.00 ? 31  LEU A HA   5  
ATOM 7550  H HB2  . LEU A 1 31  ? -7.870  5.289   -4.397  1.00 0.00 ? 31  LEU A HB2  5  
ATOM 7551  H HB3  . LEU A 1 31  ? -7.128  5.625   -2.844  1.00 0.00 ? 31  LEU A HB3  5  
ATOM 7552  H HG   . LEU A 1 31  ? -9.125  3.723   -2.318  1.00 0.00 ? 31  LEU A HG   5  
ATOM 7553  H HD11 . LEU A 1 31  ? -7.818  3.338   -4.944  1.00 0.00 ? 31  LEU A HD11 5  
ATOM 7554  H HD12 . LEU A 1 31  ? -9.450  2.934   -4.415  1.00 0.00 ? 31  LEU A HD12 5  
ATOM 7555  H HD13 . LEU A 1 31  ? -8.089  1.934   -3.912  1.00 0.00 ? 31  LEU A HD13 5  
ATOM 7556  H HD21 . LEU A 1 31  ? -6.683  4.130   -1.472  1.00 0.00 ? 31  LEU A HD21 5  
ATOM 7557  H HD22 . LEU A 1 31  ? -6.270  2.965   -2.732  1.00 0.00 ? 31  LEU A HD22 5  
ATOM 7558  H HD23 . LEU A 1 31  ? -7.381  2.510   -1.437  1.00 0.00 ? 31  LEU A HD23 5  
ATOM 7559  N N    . LEU A 1 32  ? -9.122  5.690   -0.616  1.00 0.00 ? 32  LEU A N    5  
ATOM 7560  C CA   . LEU A 1 32  ? -9.705  5.282   0.666   1.00 0.00 ? 32  LEU A CA   5  
ATOM 7561  C C    . LEU A 1 32  ? -10.379 6.464   1.351   1.00 0.00 ? 32  LEU A C    5  
ATOM 7562  O O    . LEU A 1 32  ? -11.607 6.567   1.368   1.00 0.00 ? 32  LEU A O    5  
ATOM 7563  C CB   . LEU A 1 32  ? -8.677  4.664   1.625   1.00 0.00 ? 32  LEU A CB   5  
ATOM 7564  C CG   . LEU A 1 32  ? -7.225  4.623   1.157   1.00 0.00 ? 32  LEU A CG   5  
ATOM 7565  C CD1  . LEU A 1 32  ? -6.620  6.019   1.152   1.00 0.00 ? 32  LEU A CD1  5  
ATOM 7566  C CD2  . LEU A 1 32  ? -6.426  3.697   2.063   1.00 0.00 ? 32  LEU A CD2  5  
ATOM 7567  H H    . LEU A 1 32  ? -8.173  5.948   -0.683  1.00 0.00 ? 32  LEU A H    5  
ATOM 7568  H HA   . LEU A 1 32  ? -10.462 4.541   0.450   1.00 0.00 ? 32  LEU A HA   5  
ATOM 7569  H HB2  . LEU A 1 32  ? -8.710  5.220   2.549   1.00 0.00 ? 32  LEU A HB2  5  
ATOM 7570  H HB3  . LEU A 1 32  ? -8.988  3.649   1.832   1.00 0.00 ? 32  LEU A HB3  5  
ATOM 7571  H HG   . LEU A 1 32  ? -7.181  4.232   0.152   1.00 0.00 ? 32  LEU A HG   5  
ATOM 7572  H HD11 . LEU A 1 32  ? -5.655  5.990   0.672   1.00 0.00 ? 32  LEU A HD11 5  
ATOM 7573  H HD12 . LEU A 1 32  ? -6.505  6.365   2.170   1.00 0.00 ? 32  LEU A HD12 5  
ATOM 7574  H HD13 . LEU A 1 32  ? -7.272  6.691   0.615   1.00 0.00 ? 32  LEU A HD13 5  
ATOM 7575  H HD21 . LEU A 1 32  ? -6.117  2.824   1.507   1.00 0.00 ? 32  LEU A HD21 5  
ATOM 7576  H HD22 . LEU A 1 32  ? -7.047  3.391   2.899   1.00 0.00 ? 32  LEU A HD22 5  
ATOM 7577  H HD23 . LEU A 1 32  ? -5.556  4.216   2.434   1.00 0.00 ? 32  LEU A HD23 5  
ATOM 7578  N N    . GLY A 1 33  ? -9.571  7.353   1.919   1.00 0.00 ? 33  GLY A N    5  
ATOM 7579  C CA   . GLY A 1 33  ? -10.105 8.516   2.605   1.00 0.00 ? 33  GLY A CA   5  
ATOM 7580  C C    . GLY A 1 33  ? -9.121  9.095   3.602   1.00 0.00 ? 33  GLY A C    5  
ATOM 7581  O O    . GLY A 1 33  ? -9.515  9.768   4.556   1.00 0.00 ? 33  GLY A O    5  
ATOM 7582  H H    . GLY A 1 33  ? -8.600  7.218   1.876   1.00 0.00 ? 33  GLY A H    5  
ATOM 7583  H HA2  . GLY A 1 33  ? -10.348 9.272   1.871   1.00 0.00 ? 33  GLY A HA2  5  
ATOM 7584  H HA3  . GLY A 1 33  ? -11.006 8.233   3.126   1.00 0.00 ? 33  GLY A HA3  5  
ATOM 7585  N N    . TYR A 1 34  ? -7.839  8.832   3.375   1.00 0.00 ? 34  TYR A N    5  
ATOM 7586  C CA   . TYR A 1 34  ? -6.785  9.326   4.255   1.00 0.00 ? 34  TYR A CA   5  
ATOM 7587  C C    . TYR A 1 34  ? -6.056  10.502  3.609   1.00 0.00 ? 34  TYR A C    5  
ATOM 7588  O O    . TYR A 1 34  ? -6.654  11.283  2.869   1.00 0.00 ? 34  TYR A O    5  
ATOM 7589  C CB   . TYR A 1 34  ? -5.783  8.206   4.557   1.00 0.00 ? 34  TYR A CB   5  
ATOM 7590  C CG   . TYR A 1 34  ? -6.290  7.163   5.523   1.00 0.00 ? 34  TYR A CG   5  
ATOM 7591  C CD1  . TYR A 1 34  ? -7.261  6.250   5.140   1.00 0.00 ? 34  TYR A CD1  5  
ATOM 7592  C CD2  . TYR A 1 34  ? -5.790  7.088   6.818   1.00 0.00 ? 34  TYR A CD2  5  
ATOM 7593  C CE1  . TYR A 1 34  ? -7.723  5.292   6.021   1.00 0.00 ? 34  TYR A CE1  5  
ATOM 7594  C CE2  . TYR A 1 34  ? -6.247  6.133   7.704   1.00 0.00 ? 34  TYR A CE2  5  
ATOM 7595  C CZ   . TYR A 1 34  ? -7.214  5.237   7.301   1.00 0.00 ? 34  TYR A CZ   5  
ATOM 7596  O OH   . TYR A 1 34  ? -7.672  4.284   8.179   1.00 0.00 ? 34  TYR A OH   5  
ATOM 7597  H H    . TYR A 1 34  ? -7.595  8.292   2.594   1.00 0.00 ? 34  TYR A H    5  
ATOM 7598  H HA   . TYR A 1 34  ? -7.239  9.655   5.176   1.00 0.00 ? 34  TYR A HA   5  
ATOM 7599  H HB2  . TYR A 1 34  ? -5.528  7.706   3.636   1.00 0.00 ? 34  TYR A HB2  5  
ATOM 7600  H HB3  . TYR A 1 34  ? -4.888  8.643   4.979   1.00 0.00 ? 34  TYR A HB3  5  
ATOM 7601  H HD1  . TYR A 1 34  ? -7.657  6.293   4.136   1.00 0.00 ? 34  TYR A HD1  5  
ATOM 7602  H HD2  . TYR A 1 34  ? -5.032  7.793   7.128   1.00 0.00 ? 34  TYR A HD2  5  
ATOM 7603  H HE1  . TYR A 1 34  ? -8.479  4.590   5.703   1.00 0.00 ? 34  TYR A HE1  5  
ATOM 7604  H HE2  . TYR A 1 34  ? -5.845  6.090   8.705   1.00 0.00 ? 34  TYR A HE2  5  
ATOM 7605  H HH   . TYR A 1 34  ? -8.480  4.593   8.596   1.00 0.00 ? 34  TYR A HH   5  
ATOM 7606  N N    . SER A 1 35  ? -4.756  10.602  3.886   1.00 0.00 ? 35  SER A N    5  
ATOM 7607  C CA   . SER A 1 35  ? -3.909  11.653  3.334   1.00 0.00 ? 35  SER A CA   5  
ATOM 7608  C C    . SER A 1 35  ? -2.528  11.603  3.969   1.00 0.00 ? 35  SER A C    5  
ATOM 7609  O O    . SER A 1 35  ? -2.323  10.920  4.969   1.00 0.00 ? 35  SER A O    5  
ATOM 7610  C CB   . SER A 1 35  ? -4.519  13.037  3.535   1.00 0.00 ? 35  SER A CB   5  
ATOM 7611  O OG   . SER A 1 35  ? -4.727  13.317  4.907   1.00 0.00 ? 35  SER A OG   5  
ATOM 7612  H H    . SER A 1 35  ? -4.347  9.934   4.475   1.00 0.00 ? 35  SER A H    5  
ATOM 7613  H HA   . SER A 1 35  ? -3.812  11.472  2.275   1.00 0.00 ? 35  SER A HA   5  
ATOM 7614  H HB2  . SER A 1 35  ? -3.850  13.782  3.122   1.00 0.00 ? 35  SER A HB2  5  
ATOM 7615  H HB3  . SER A 1 35  ? -5.462  13.079  3.018   1.00 0.00 ? 35  SER A HB3  5  
ATOM 7616  H HG   . SER A 1 35  ? -4.197  14.072  5.165   1.00 0.00 ? 35  SER A HG   5  
ATOM 7617  N N    . SER A 1 36  ? -1.584  12.320  3.379   1.00 0.00 ? 36  SER A N    5  
ATOM 7618  C CA   . SER A 1 36  ? -0.216  12.349  3.885   1.00 0.00 ? 36  SER A CA   5  
ATOM 7619  C C    . SER A 1 36  ? -0.173  12.665  5.380   1.00 0.00 ? 36  SER A C    5  
ATOM 7620  O O    . SER A 1 36  ? 0.724   12.211  6.089   1.00 0.00 ? 36  SER A O    5  
ATOM 7621  C CB   . SER A 1 36  ? 0.607   13.382  3.115   1.00 0.00 ? 36  SER A CB   5  
ATOM 7622  O OG   . SER A 1 36  ? 0.469   14.671  3.684   1.00 0.00 ? 36  SER A OG   5  
ATOM 7623  H H    . SER A 1 36  ? -1.810  12.840  2.579   1.00 0.00 ? 36  SER A H    5  
ATOM 7624  H HA   . SER A 1 36  ? 0.213   11.371  3.725   1.00 0.00 ? 36  SER A HA   5  
ATOM 7625  H HB2  . SER A 1 36  ? 1.649   13.101  3.141   1.00 0.00 ? 36  SER A HB2  5  
ATOM 7626  H HB3  . SER A 1 36  ? 0.271   13.415  2.089   1.00 0.00 ? 36  SER A HB3  5  
ATOM 7627  H HG   . SER A 1 36  ? 0.926   15.314  3.136   1.00 0.00 ? 36  SER A HG   5  
ATOM 7628  N N    . GLN A 1 37  ? -1.132  13.453  5.851   1.00 0.00 ? 37  GLN A N    5  
ATOM 7629  C CA   . GLN A 1 37  ? -1.182  13.837  7.262   1.00 0.00 ? 37  GLN A CA   5  
ATOM 7630  C C    . GLN A 1 37  ? -2.185  13.002  8.058   1.00 0.00 ? 37  GLN A C    5  
ATOM 7631  O O    . GLN A 1 37  ? -2.295  13.155  9.275   1.00 0.00 ? 37  GLN A O    5  
ATOM 7632  C CB   . GLN A 1 37  ? -1.533  15.321  7.391   1.00 0.00 ? 37  GLN A CB   5  
ATOM 7633  C CG   . GLN A 1 37  ? -2.635  15.775  6.448   1.00 0.00 ? 37  GLN A CG   5  
ATOM 7634  C CD   . GLN A 1 37  ? -3.326  17.039  6.921   1.00 0.00 ? 37  GLN A CD   5  
ATOM 7635  O OE1  . GLN A 1 37  ? -4.555  17.132  6.905   1.00 0.00 ? 37  GLN A OE1  5  
ATOM 7636  N NE2  . GLN A 1 37  ? -2.540  18.024  7.343   1.00 0.00 ? 37  GLN A NE2  5  
ATOM 7637  H H    . GLN A 1 37  ? -1.814  13.794  5.238   1.00 0.00 ? 37  GLN A H    5  
ATOM 7638  H HA   . GLN A 1 37  ? -0.198  13.678  7.677   1.00 0.00 ? 37  GLN A HA   5  
ATOM 7639  H HB2  . GLN A 1 37  ? -1.854  15.514  8.404   1.00 0.00 ? 37  GLN A HB2  5  
ATOM 7640  H HB3  . GLN A 1 37  ? -0.649  15.906  7.187   1.00 0.00 ? 37  GLN A HB3  5  
ATOM 7641  H HG2  . GLN A 1 37  ? -2.204  15.963  5.476   1.00 0.00 ? 37  GLN A HG2  5  
ATOM 7642  H HG3  . GLN A 1 37  ? -3.370  14.988  6.370   1.00 0.00 ? 37  GLN A HG3  5  
ATOM 7643  H HE21 . GLN A 1 37  ? -1.571  17.881  7.326   1.00 0.00 ? 37  GLN A HE21 5  
ATOM 7644  H HE22 . GLN A 1 37  ? -2.962  18.852  7.653   1.00 0.00 ? 37  GLN A HE22 5  
ATOM 7645  N N    . ASP A 1 38  ? -2.933  12.137  7.377   1.00 0.00 ? 38  ASP A N    5  
ATOM 7646  C CA   . ASP A 1 38  ? -3.939  11.316  8.053   1.00 0.00 ? 38  ASP A CA   5  
ATOM 7647  C C    . ASP A 1 38  ? -3.590  9.827   8.041   1.00 0.00 ? 38  ASP A C    5  
ATOM 7648  O O    . ASP A 1 38  ? -4.261  9.029   8.696   1.00 0.00 ? 38  ASP A O    5  
ATOM 7649  C CB   . ASP A 1 38  ? -5.308  11.524  7.404   1.00 0.00 ? 38  ASP A CB   5  
ATOM 7650  C CG   . ASP A 1 38  ? -6.054  12.703  7.995   1.00 0.00 ? 38  ASP A CG   5  
ATOM 7651  O OD1  . ASP A 1 38  ? -5.464  13.801  8.073   1.00 0.00 ? 38  ASP A OD1  5  
ATOM 7652  O OD2  . ASP A 1 38  ? -7.229  12.530  8.381   1.00 0.00 ? 38  ASP A OD2  5  
ATOM 7653  H H    . ASP A 1 38  ? -2.823  12.063  6.409   1.00 0.00 ? 38  ASP A H    5  
ATOM 7654  H HA   . ASP A 1 38  ? -3.993  11.646  9.078   1.00 0.00 ? 38  ASP A HA   5  
ATOM 7655  H HB2  . ASP A 1 38  ? -5.176  11.698  6.347   1.00 0.00 ? 38  ASP A HB2  5  
ATOM 7656  H HB3  . ASP A 1 38  ? -5.905  10.636  7.547   1.00 0.00 ? 38  ASP A HB3  5  
ATOM 7657  N N    . LEU A 1 39  ? -2.554  9.447   7.300   1.00 0.00 ? 39  LEU A N    5  
ATOM 7658  C CA   . LEU A 1 39  ? -2.158  8.042   7.227   1.00 0.00 ? 39  LEU A CA   5  
ATOM 7659  C C    . LEU A 1 39  ? -0.689  7.852   7.595   1.00 0.00 ? 39  LEU A C    5  
ATOM 7660  O O    . LEU A 1 39  ? -0.249  6.732   7.860   1.00 0.00 ? 39  LEU A O    5  
ATOM 7661  C CB   . LEU A 1 39  ? -2.435  7.481   5.827   1.00 0.00 ? 39  LEU A CB   5  
ATOM 7662  C CG   . LEU A 1 39  ? -1.627  8.114   4.697   1.00 0.00 ? 39  LEU A CG   5  
ATOM 7663  C CD1  . LEU A 1 39  ? -0.398  7.274   4.386   1.00 0.00 ? 39  LEU A CD1  5  
ATOM 7664  C CD2  . LEU A 1 39  ? -2.497  8.267   3.461   1.00 0.00 ? 39  LEU A CD2  5  
ATOM 7665  H H    . LEU A 1 39  ? -2.050  10.118  6.793   1.00 0.00 ? 39  LEU A H    5  
ATOM 7666  H HA   . LEU A 1 39  ? -2.761  7.499   7.940   1.00 0.00 ? 39  LEU A HA   5  
ATOM 7667  H HB2  . LEU A 1 39  ? -2.231  6.421   5.835   1.00 0.00 ? 39  LEU A HB2  5  
ATOM 7668  H HB3  . LEU A 1 39  ? -3.483  7.625   5.611   1.00 0.00 ? 39  LEU A HB3  5  
ATOM 7669  H HG   . LEU A 1 39  ? -1.298  9.097   5.002   1.00 0.00 ? 39  LEU A HG   5  
ATOM 7670  H HD11 . LEU A 1 39  ? -0.567  6.254   4.701   1.00 0.00 ? 39  LEU A HD11 5  
ATOM 7671  H HD12 . LEU A 1 39  ? 0.455   7.677   4.911   1.00 0.00 ? 39  LEU A HD12 5  
ATOM 7672  H HD13 . LEU A 1 39  ? -0.208  7.295   3.323   1.00 0.00 ? 39  LEU A HD13 5  
ATOM 7673  H HD21 . LEU A 1 39  ? -3.532  8.327   3.756   1.00 0.00 ? 39  LEU A HD21 5  
ATOM 7674  H HD22 . LEU A 1 39  ? -2.355  7.414   2.814   1.00 0.00 ? 39  LEU A HD22 5  
ATOM 7675  H HD23 . LEU A 1 39  ? -2.218  9.169   2.937   1.00 0.00 ? 39  LEU A HD23 5  
ATOM 7676  N N    . ILE A 1 40  ? 0.067   8.945   7.616   1.00 0.00 ? 40  ILE A N    5  
ATOM 7677  C CA   . ILE A 1 40  ? 1.484   8.879   7.957   1.00 0.00 ? 40  ILE A CA   5  
ATOM 7678  C C    . ILE A 1 40  ? 1.674   8.378   9.387   1.00 0.00 ? 40  ILE A C    5  
ATOM 7679  O O    . ILE A 1 40  ? 0.895   8.709   10.283  1.00 0.00 ? 40  ILE A O    5  
ATOM 7680  C CB   . ILE A 1 40  ? 2.168   10.256  7.787   1.00 0.00 ? 40  ILE A CB   5  
ATOM 7681  C CG1  . ILE A 1 40  ? 3.691   10.088  7.671   1.00 0.00 ? 40  ILE A CG1  5  
ATOM 7682  C CG2  . ILE A 1 40  ? 1.797   11.195  8.930   1.00 0.00 ? 40  ILE A CG2  5  
ATOM 7683  C CD1  . ILE A 1 40  ? 4.415   10.003  9.001   1.00 0.00 ? 40  ILE A CD1  5  
ATOM 7684  H H    . ILE A 1 40  ? -0.333  9.811   7.401   1.00 0.00 ? 40  ILE A H    5  
ATOM 7685  H HA   . ILE A 1 40  ? 1.954   8.181   7.279   1.00 0.00 ? 40  ILE A HA   5  
ATOM 7686  H HB   . ILE A 1 40  ? 1.799   10.694  6.872   1.00 0.00 ? 40  ILE A HB   5  
ATOM 7687  H HG12 . ILE A 1 40  ? 3.905   9.182   7.127   1.00 0.00 ? 40  ILE A HG12 5  
ATOM 7688  H HG13 . ILE A 1 40  ? 4.095   10.931  7.128   1.00 0.00 ? 40  ILE A HG13 5  
ATOM 7689  H HG21 . ILE A 1 40  ? 2.468   12.041  8.933   1.00 0.00 ? 40  ILE A HG21 5  
ATOM 7690  H HG22 . ILE A 1 40  ? 1.878   10.668  9.870   1.00 0.00 ? 40  ILE A HG22 5  
ATOM 7691  H HG23 . ILE A 1 40  ? 0.783   11.540  8.797   1.00 0.00 ? 40  ILE A HG23 5  
ATOM 7692  H HD11 . ILE A 1 40  ? 5.266   9.345   8.905   1.00 0.00 ? 40  ILE A HD11 5  
ATOM 7693  H HD12 . ILE A 1 40  ? 3.742   9.617   9.751   1.00 0.00 ? 40  ILE A HD12 5  
ATOM 7694  H HD13 . ILE A 1 40  ? 4.751   10.987  9.291   1.00 0.00 ? 40  ILE A HD13 5  
ATOM 7695  N N    . GLY A 1 41  ? 2.713   7.575   9.592   1.00 0.00 ? 41  GLY A N    5  
ATOM 7696  C CA   . GLY A 1 41  ? 2.987   7.038   10.911  1.00 0.00 ? 41  GLY A CA   5  
ATOM 7697  C C    . GLY A 1 41  ? 2.571   5.586   11.043  1.00 0.00 ? 41  GLY A C    5  
ATOM 7698  O O    . GLY A 1 41  ? 3.250   4.796   11.700  1.00 0.00 ? 41  GLY A O    5  
ATOM 7699  H H    . GLY A 1 41  ? 3.297   7.343   8.839   1.00 0.00 ? 41  GLY A H    5  
ATOM 7700  H HA2  . GLY A 1 41  ? 4.046   7.116   11.106  1.00 0.00 ? 41  GLY A HA2  5  
ATOM 7701  H HA3  . GLY A 1 41  ? 2.452   7.622   11.645  1.00 0.00 ? 41  GLY A HA3  5  
ATOM 7702  N N    . GLN A 1 42  ? 1.454   5.233   10.416  1.00 0.00 ? 42  GLN A N    5  
ATOM 7703  C CA   . GLN A 1 42  ? 0.949   3.867   10.465  1.00 0.00 ? 42  GLN A CA   5  
ATOM 7704  C C    . GLN A 1 42  ? 1.425   3.076   9.250   1.00 0.00 ? 42  GLN A C    5  
ATOM 7705  O O    . GLN A 1 42  ? 2.305   3.522   8.517   1.00 0.00 ? 42  GLN A O    5  
ATOM 7706  C CB   . GLN A 1 42  ? -0.581  3.863   10.527  1.00 0.00 ? 42  GLN A CB   5  
ATOM 7707  C CG   . GLN A 1 42  ? -1.162  5.013   11.334  1.00 0.00 ? 42  GLN A CG   5  
ATOM 7708  C CD   . GLN A 1 42  ? -2.639  5.225   11.069  1.00 0.00 ? 42  GLN A CD   5  
ATOM 7709  O OE1  . GLN A 1 42  ? -3.479  4.432   11.496  1.00 0.00 ? 42  GLN A OE1  5  
ATOM 7710  N NE2  . GLN A 1 42  ? -2.966  6.300   10.360  1.00 0.00 ? 42  GLN A NE2  5  
ATOM 7711  H H    . GLN A 1 42  ? 0.958   5.908   9.906   1.00 0.00 ? 42  GLN A H    5  
ATOM 7712  H HA   . GLN A 1 42  ? 1.338   3.401   11.358  1.00 0.00 ? 42  GLN A HA   5  
ATOM 7713  H HB2  . GLN A 1 42  ? -0.973  3.923   9.522   1.00 0.00 ? 42  GLN A HB2  5  
ATOM 7714  H HB3  . GLN A 1 42  ? -0.910  2.935   10.974  1.00 0.00 ? 42  GLN A HB3  5  
ATOM 7715  H HG2  . GLN A 1 42  ? -1.026  4.802   12.385  1.00 0.00 ? 42  GLN A HG2  5  
ATOM 7716  H HG3  . GLN A 1 42  ? -0.631  5.918   11.077  1.00 0.00 ? 42  GLN A HG3  5  
ATOM 7717  H HE21 . GLN A 1 42  ? -2.242  6.888   10.052  1.00 0.00 ? 42  GLN A HE21 5  
ATOM 7718  H HE22 . GLN A 1 42  ? -3.914  6.462   10.174  1.00 0.00 ? 42  GLN A HE22 5  
ATOM 7719  N N    . LYS A 1 43  ? 0.833   1.904   9.043   1.00 0.00 ? 43  LYS A N    5  
ATOM 7720  C CA   . LYS A 1 43  ? 1.193   1.056   7.913   1.00 0.00 ? 43  LYS A CA   5  
ATOM 7721  C C    . LYS A 1 43  ? 0.024   0.943   6.942   1.00 0.00 ? 43  LYS A C    5  
ATOM 7722  O O    . LYS A 1 43  ? -1.106  0.700   7.356   1.00 0.00 ? 43  LYS A O    5  
ATOM 7723  C CB   . LYS A 1 43  ? 1.609   -0.332  8.402   1.00 0.00 ? 43  LYS A CB   5  
ATOM 7724  C CG   . LYS A 1 43  ? 2.755   -0.305  9.399   1.00 0.00 ? 43  LYS A CG   5  
ATOM 7725  C CD   . LYS A 1 43  ? 2.309   -0.764  10.777  1.00 0.00 ? 43  LYS A CD   5  
ATOM 7726  C CE   . LYS A 1 43  ? 3.347   -1.665  11.425  1.00 0.00 ? 43  LYS A CE   5  
ATOM 7727  N NZ   . LYS A 1 43  ? 4.553   -0.903  11.856  1.00 0.00 ? 43  LYS A NZ   5  
ATOM 7728  H H    . LYS A 1 43  ? 0.135   1.606   9.663   1.00 0.00 ? 43  LYS A H    5  
ATOM 7729  H HA   . LYS A 1 43  ? 2.027   1.515   7.404   1.00 0.00 ? 43  LYS A HA   5  
ATOM 7730  H HB2  . LYS A 1 43  ? 0.760   -0.805  8.876   1.00 0.00 ? 43  LYS A HB2  5  
ATOM 7731  H HB3  . LYS A 1 43  ? 1.912   -0.925  7.553   1.00 0.00 ? 43  LYS A HB3  5  
ATOM 7732  H HG2  . LYS A 1 43  ? 3.540   -0.960  9.049   1.00 0.00 ? 43  LYS A HG2  5  
ATOM 7733  H HG3  . LYS A 1 43  ? 3.134   0.705   9.470   1.00 0.00 ? 43  LYS A HG3  5  
ATOM 7734  H HD2  . LYS A 1 43  ? 2.158   0.104   11.402  1.00 0.00 ? 43  LYS A HD2  5  
ATOM 7735  H HD3  . LYS A 1 43  ? 1.381   -1.309  10.680  1.00 0.00 ? 43  LYS A HD3  5  
ATOM 7736  H HE2  . LYS A 1 43  ? 2.905   -2.138  12.287  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 7737  H HE3  . LYS A 1 43  ? 3.645   -2.420  10.713  1.00 0.00 ? 43  LYS A HE3  5  
ATOM 7738  H HZ1  . LYS A 1 43  ? 4.389   0.117   11.743  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 7739  H HZ2  . LYS A 1 43  ? 5.372   -1.177  11.280  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 7740  H HZ3  . LYS A 1 43  ? 4.763   -1.103  12.855  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 7741  N N    . LEU A 1 44  ? 0.299   1.151   5.656   1.00 0.00 ? 44  LEU A N    5  
ATOM 7742  C CA   . LEU A 1 44  ? -0.738  1.098   4.626   1.00 0.00 ? 44  LEU A CA   5  
ATOM 7743  C C    . LEU A 1 44  ? -1.651  -0.115  4.789   1.00 0.00 ? 44  LEU A C    5  
ATOM 7744  O O    . LEU A 1 44  ? -2.865  0.000   4.656   1.00 0.00 ? 44  LEU A O    5  
ATOM 7745  C CB   . LEU A 1 44  ? -0.118  1.082   3.223   1.00 0.00 ? 44  LEU A CB   5  
ATOM 7746  C CG   . LEU A 1 44  ? 1.341   0.621   3.137   1.00 0.00 ? 44  LEU A CG   5  
ATOM 7747  C CD1  . LEU A 1 44  ? 1.467   -0.866  3.441   1.00 0.00 ? 44  LEU A CD1  5  
ATOM 7748  C CD2  . LEU A 1 44  ? 1.903   0.927   1.758   1.00 0.00 ? 44  LEU A CD2  5  
ATOM 7749  H H    . LEU A 1 44  ? 1.217   1.376   5.396   1.00 0.00 ? 44  LEU A H    5  
ATOM 7750  H HA   . LEU A 1 44  ? -1.338  1.989   4.725   1.00 0.00 ? 44  LEU A HA   5  
ATOM 7751  H HB2  . LEU A 1 44  ? -0.714  0.429   2.602   1.00 0.00 ? 44  LEU A HB2  5  
ATOM 7752  H HB3  . LEU A 1 44  ? -0.177  2.081   2.819   1.00 0.00 ? 44  LEU A HB3  5  
ATOM 7753  H HG   . LEU A 1 44  ? 1.927   1.162   3.866   1.00 0.00 ? 44  LEU A HG   5  
ATOM 7754  H HD11 . LEU A 1 44  ? 0.944   -1.094  4.357   1.00 0.00 ? 44  LEU A HD11 5  
ATOM 7755  H HD12 . LEU A 1 44  ? 2.511   -1.123  3.550   1.00 0.00 ? 44  LEU A HD12 5  
ATOM 7756  H HD13 . LEU A 1 44  ? 1.040   -1.441  2.629   1.00 0.00 ? 44  LEU A HD13 5  
ATOM 7757  H HD21 . LEU A 1 44  ? 1.375   0.347   1.016   1.00 0.00 ? 44  LEU A HD21 5  
ATOM 7758  H HD22 . LEU A 1 44  ? 2.953   0.675   1.733   1.00 0.00 ? 44  LEU A HD22 5  
ATOM 7759  H HD23 . LEU A 1 44  ? 1.782   1.979   1.546   1.00 0.00 ? 44  LEU A HD23 5  
ATOM 7760  N N    . THR A 1 45  ? -1.057  -1.273  5.057   1.00 0.00 ? 45  THR A N    5  
ATOM 7761  C CA   . THR A 1 45  ? -1.808  -2.519  5.212   1.00 0.00 ? 45  THR A CA   5  
ATOM 7762  C C    . THR A 1 45  ? -2.934  -2.402  6.233   1.00 0.00 ? 45  THR A C    5  
ATOM 7763  O O    . THR A 1 45  ? -3.821  -3.254  6.288   1.00 0.00 ? 45  THR A O    5  
ATOM 7764  C CB   . THR A 1 45  ? -0.876  -3.670  5.614   1.00 0.00 ? 45  THR A CB   5  
ATOM 7765  O OG1  . THR A 1 45  ? -0.341  -3.440  6.922   1.00 0.00 ? 45  THR A OG1  5  
ATOM 7766  C CG2  . THR A 1 45  ? 0.252   -3.791  4.611   1.00 0.00 ? 45  THR A CG2  5  
ATOM 7767  H H    . THR A 1 45  ? -0.082  -1.296  5.137   1.00 0.00 ? 45  THR A H    5  
ATOM 7768  H HA   . THR A 1 45  ? -2.239  -2.763  4.252   1.00 0.00 ? 45  THR A HA   5  
ATOM 7769  H HB   . THR A 1 45  ? -1.437  -4.591  5.612   1.00 0.00 ? 45  THR A HB   5  
ATOM 7770  H HG1  . THR A 1 45  ? 0.607   -3.593  6.912   1.00 0.00 ? 45  THR A HG1  5  
ATOM 7771  H HG21 . THR A 1 45  ? 0.058   -3.128  3.779   1.00 0.00 ? 45  THR A HG21 5  
ATOM 7772  H HG22 . THR A 1 45  ? 0.313   -4.807  4.256   1.00 0.00 ? 45  THR A HG22 5  
ATOM 7773  H HG23 . THR A 1 45  ? 1.182   -3.514  5.082   1.00 0.00 ? 45  THR A HG23 5  
ATOM 7774  N N    . GLN A 1 46  ? -2.903  -1.343  7.026   1.00 0.00 ? 46  GLN A N    5  
ATOM 7775  C CA   . GLN A 1 46  ? -3.934  -1.117  8.029   1.00 0.00 ? 46  GLN A CA   5  
ATOM 7776  C C    . GLN A 1 46  ? -5.262  -0.829  7.346   1.00 0.00 ? 46  GLN A C    5  
ATOM 7777  O O    . GLN A 1 46  ? -6.331  -0.994  7.932   1.00 0.00 ? 46  GLN A O    5  
ATOM 7778  C CB   . GLN A 1 46  ? -3.547  0.049   8.940   1.00 0.00 ? 46  GLN A CB   5  
ATOM 7779  C CG   . GLN A 1 46  ? -4.231  0.015   10.296  1.00 0.00 ? 46  GLN A CG   5  
ATOM 7780  C CD   . GLN A 1 46  ? -3.246  0.066   11.450  1.00 0.00 ? 46  GLN A CD   5  
ATOM 7781  O OE1  . GLN A 1 46  ? -3.470  -0.539  12.498  1.00 0.00 ? 46  GLN A OE1  5  
ATOM 7782  N NE2  . GLN A 1 46  ? -2.147  0.791   11.264  1.00 0.00 ? 46  GLN A NE2  5  
ATOM 7783  H H    . GLN A 1 46  ? -2.180  -0.695  6.923   1.00 0.00 ? 46  GLN A H    5  
ATOM 7784  H HA   . GLN A 1 46  ? -4.030  -2.015  8.621   1.00 0.00 ? 46  GLN A HA   5  
ATOM 7785  H HB2  . GLN A 1 46  ? -2.481  0.027   9.099   1.00 0.00 ? 46  GLN A HB2  5  
ATOM 7786  H HB3  . GLN A 1 46  ? -3.810  0.974   8.451   1.00 0.00 ? 46  GLN A HB3  5  
ATOM 7787  H HG2  . GLN A 1 46  ? -4.894  0.864   10.372  1.00 0.00 ? 46  GLN A HG2  5  
ATOM 7788  H HG3  . GLN A 1 46  ? -4.805  -0.898  10.370  1.00 0.00 ? 46  GLN A HG3  5  
ATOM 7789  H HE21 . GLN A 1 46  ? -2.032  1.245   10.404  1.00 0.00 ? 46  GLN A HE21 5  
ATOM 7790  H HE22 . GLN A 1 46  ? -1.497  0.839   11.994  1.00 0.00 ? 46  GLN A HE22 5  
ATOM 7791  N N    . PHE A 1 47  ? -5.178  -0.372  6.104   1.00 0.00 ? 47  PHE A N    5  
ATOM 7792  C CA   . PHE A 1 47  ? -6.365  -0.035  5.332   1.00 0.00 ? 47  PHE A CA   5  
ATOM 7793  C C    . PHE A 1 47  ? -6.533  -0.972  4.139   1.00 0.00 ? 47  PHE A C    5  
ATOM 7794  O O    . PHE A 1 47  ? -6.909  -0.542  3.049   1.00 0.00 ? 47  PHE A O    5  
ATOM 7795  C CB   . PHE A 1 47  ? -6.287  1.419   4.851   1.00 0.00 ? 47  PHE A CB   5  
ATOM 7796  C CG   . PHE A 1 47  ? -5.239  2.240   5.553   1.00 0.00 ? 47  PHE A CG   5  
ATOM 7797  C CD1  . PHE A 1 47  ? -5.321  2.479   6.916   1.00 0.00 ? 47  PHE A CD1  5  
ATOM 7798  C CD2  . PHE A 1 47  ? -4.171  2.774   4.846   1.00 0.00 ? 47  PHE A CD2  5  
ATOM 7799  C CE1  . PHE A 1 47  ? -4.357  3.234   7.559   1.00 0.00 ? 47  PHE A CE1  5  
ATOM 7800  C CE2  . PHE A 1 47  ? -3.207  3.529   5.486   1.00 0.00 ? 47  PHE A CE2  5  
ATOM 7801  C CZ   . PHE A 1 47  ? -3.300  3.759   6.845   1.00 0.00 ? 47  PHE A CZ   5  
ATOM 7802  H H    . PHE A 1 47  ? -4.293  -0.234  5.707   1.00 0.00 ? 47  PHE A H    5  
ATOM 7803  H HA   . PHE A 1 47  ? -7.222  -0.145  5.980   1.00 0.00 ? 47  PHE A HA   5  
ATOM 7804  H HB2  . PHE A 1 47  ? -6.064  1.428   3.798   1.00 0.00 ? 47  PHE A HB2  5  
ATOM 7805  H HB3  . PHE A 1 47  ? -7.244  1.894   5.013   1.00 0.00 ? 47  PHE A HB3  5  
ATOM 7806  H HD1  . PHE A 1 47  ? -6.147  2.069   7.477   1.00 0.00 ? 47  PHE A HD1  5  
ATOM 7807  H HD2  . PHE A 1 47  ? -4.099  2.593   3.784   1.00 0.00 ? 47  PHE A HD2  5  
ATOM 7808  H HE1  . PHE A 1 47  ? -4.432  3.413   8.623   1.00 0.00 ? 47  PHE A HE1  5  
ATOM 7809  H HE2  . PHE A 1 47  ? -2.378  3.938   4.923   1.00 0.00 ? 47  PHE A HE2  5  
ATOM 7810  H HZ   . PHE A 1 47  ? -2.550  4.350   7.345   1.00 0.00 ? 47  PHE A HZ   5  
ATOM 7811  N N    . PHE A 1 48  ? -6.262  -2.256  4.358   1.00 0.00 ? 48  PHE A N    5  
ATOM 7812  C CA   . PHE A 1 48  ? -6.390  -3.260  3.306   1.00 0.00 ? 48  PHE A CA   5  
ATOM 7813  C C    . PHE A 1 48  ? -6.880  -4.581  3.888   1.00 0.00 ? 48  PHE A C    5  
ATOM 7814  O O    . PHE A 1 48  ? -6.891  -4.758  5.106   1.00 0.00 ? 48  PHE A O    5  
ATOM 7815  C CB   . PHE A 1 48  ? -5.057  -3.455  2.575   1.00 0.00 ? 48  PHE A CB   5  
ATOM 7816  C CG   . PHE A 1 48  ? -4.574  -2.207  1.888   1.00 0.00 ? 48  PHE A CG   5  
ATOM 7817  C CD1  . PHE A 1 48  ? -5.250  -1.698  0.793   1.00 0.00 ? 48  PHE A CD1  5  
ATOM 7818  C CD2  . PHE A 1 48  ? -3.453  -1.536  2.345   1.00 0.00 ? 48  PHE A CD2  5  
ATOM 7819  C CE1  . PHE A 1 48  ? -4.816  -0.547  0.165   1.00 0.00 ? 48  PHE A CE1  5  
ATOM 7820  C CE2  . PHE A 1 48  ? -3.014  -0.383  1.722   1.00 0.00 ? 48  PHE A CE2  5  
ATOM 7821  C CZ   . PHE A 1 48  ? -3.697  0.112   0.631   1.00 0.00 ? 48  PHE A CZ   5  
ATOM 7822  H H    . PHE A 1 48  ? -5.975  -2.536  5.252   1.00 0.00 ? 48  PHE A H    5  
ATOM 7823  H HA   . PHE A 1 48  ? -7.126  -2.902  2.601   1.00 0.00 ? 48  PHE A HA   5  
ATOM 7824  H HB2  . PHE A 1 48  ? -4.305  -3.756  3.289   1.00 0.00 ? 48  PHE A HB2  5  
ATOM 7825  H HB3  . PHE A 1 48  ? -5.170  -4.230  1.826   1.00 0.00 ? 48  PHE A HB3  5  
ATOM 7826  H HD1  . PHE A 1 48  ? -6.124  -2.210  0.427   1.00 0.00 ? 48  PHE A HD1  5  
ATOM 7827  H HD2  . PHE A 1 48  ? -2.917  -1.923  3.197   1.00 0.00 ? 48  PHE A HD2  5  
ATOM 7828  H HE1  . PHE A 1 48  ? -5.354  -0.162  -0.690  1.00 0.00 ? 48  PHE A HE1  5  
ATOM 7829  H HE2  . PHE A 1 48  ? -2.139  0.132   2.089   1.00 0.00 ? 48  PHE A HE2  5  
ATOM 7830  H HZ   . PHE A 1 48  ? -3.357  1.013   0.142   1.00 0.00 ? 48  PHE A HZ   5  
ATOM 7831  N N    . LEU A 1 49  ? -7.293  -5.491  3.002   1.00 0.00 ? 49  LEU A N    5  
ATOM 7832  C CA   . LEU A 1 49  ? -7.808  -6.812  3.384   1.00 0.00 ? 49  LEU A CA   5  
ATOM 7833  C C    . LEU A 1 49  ? -7.375  -7.231  4.791   1.00 0.00 ? 49  LEU A C    5  
ATOM 7834  O O    . LEU A 1 49  ? -6.282  -7.758  4.985   1.00 0.00 ? 49  LEU A O    5  
ATOM 7835  C CB   . LEU A 1 49  ? -7.370  -7.883  2.368   1.00 0.00 ? 49  LEU A CB   5  
ATOM 7836  C CG   . LEU A 1 49  ? -6.054  -7.625  1.612   1.00 0.00 ? 49  LEU A CG   5  
ATOM 7837  C CD1  . LEU A 1 49  ? -6.260  -6.611  0.499   1.00 0.00 ? 49  LEU A CD1  5  
ATOM 7838  C CD2  . LEU A 1 49  ? -4.945  -7.168  2.553   1.00 0.00 ? 49  LEU A CD2  5  
ATOM 7839  H H    . LEU A 1 49  ? -7.262  -5.260  2.052   1.00 0.00 ? 49  LEU A H    5  
ATOM 7840  H HA   . LEU A 1 49  ? -8.885  -6.752  3.368   1.00 0.00 ? 49  LEU A HA   5  
ATOM 7841  H HB2  . LEU A 1 49  ? -7.274  -8.821  2.895   1.00 0.00 ? 49  LEU A HB2  5  
ATOM 7842  H HB3  . LEU A 1 49  ? -8.160  -7.987  1.636   1.00 0.00 ? 49  LEU A HB3  5  
ATOM 7843  H HG   . LEU A 1 49  ? -5.734  -8.551  1.151   1.00 0.00 ? 49  LEU A HG   5  
ATOM 7844  H HD11 . LEU A 1 49  ? -5.308  -6.186  0.218   1.00 0.00 ? 49  LEU A HD11 5  
ATOM 7845  H HD12 . LEU A 1 49  ? -6.916  -5.826  0.844   1.00 0.00 ? 49  LEU A HD12 5  
ATOM 7846  H HD13 . LEU A 1 49  ? -6.703  -7.100  -0.356  1.00 0.00 ? 49  LEU A HD13 5  
ATOM 7847  H HD21 . LEU A 1 49  ? -4.021  -7.073  2.003   1.00 0.00 ? 49  LEU A HD21 5  
ATOM 7848  H HD22 . LEU A 1 49  ? -4.821  -7.896  3.343   1.00 0.00 ? 49  LEU A HD22 5  
ATOM 7849  H HD23 . LEU A 1 49  ? -5.209  -6.214  2.985   1.00 0.00 ? 49  LEU A HD23 5  
ATOM 7850  N N    . ARG A 1 50  ? -8.255  -6.999  5.765   1.00 0.00 ? 50  ARG A N    5  
ATOM 7851  C CA   . ARG A 1 50  ? -7.982  -7.352  7.157   1.00 0.00 ? 50  ARG A CA   5  
ATOM 7852  C C    . ARG A 1 50  ? -6.765  -6.601  7.691   1.00 0.00 ? 50  ARG A C    5  
ATOM 7853  O O    . ARG A 1 50  ? -5.627  -6.900  7.330   1.00 0.00 ? 50  ARG A O    5  
ATOM 7854  C CB   . ARG A 1 50  ? -7.768  -8.861  7.295   1.00 0.00 ? 50  ARG A CB   5  
ATOM 7855  C CG   . ARG A 1 50  ? -7.250  -9.280  8.661   1.00 0.00 ? 50  ARG A CG   5  
ATOM 7856  C CD   . ARG A 1 50  ? -7.803  -10.633 9.077   1.00 0.00 ? 50  ARG A CD   5  
ATOM 7857  N NE   . ARG A 1 50  ? -7.530  -11.664 8.083   1.00 0.00 ? 50  ARG A NE   5  
ATOM 7858  C CZ   . ARG A 1 50  ? -8.202  -12.809 8.002   1.00 0.00 ? 50  ARG A CZ   5  
ATOM 7859  N NH1  . ARG A 1 50  ? -9.181  -13.068 8.858   1.00 0.00 ? 50  ARG A NH1  5  
ATOM 7860  N NH2  . ARG A 1 50  ? -7.895  -13.695 7.064   1.00 0.00 ? 50  ARG A NH2  5  
ATOM 7861  H H    . ARG A 1 50  ? -9.112  -6.582  5.541   1.00 0.00 ? 50  ARG A H    5  
ATOM 7862  H HA   . ARG A 1 50  ? -8.845  -7.067  7.741   1.00 0.00 ? 50  ARG A HA   5  
ATOM 7863  H HB2  . ARG A 1 50  ? -8.709  -9.364  7.123   1.00 0.00 ? 50  ARG A HB2  5  
ATOM 7864  H HB3  . ARG A 1 50  ? -7.056  -9.182  6.550   1.00 0.00 ? 50  ARG A HB3  5  
ATOM 7865  H HG2  . ARG A 1 50  ? -6.173  -9.341  8.624   1.00 0.00 ? 50  ARG A HG2  5  
ATOM 7866  H HG3  . ARG A 1 50  ? -7.545  -8.541  9.390   1.00 0.00 ? 50  ARG A HG3  5  
ATOM 7867  H HD2  . ARG A 1 50  ? -7.349  -10.920 10.014  1.00 0.00 ? 50  ARG A HD2  5  
ATOM 7868  H HD3  . ARG A 1 50  ? -8.872  -10.545 9.207   1.00 0.00 ? 50  ARG A HD3  5  
ATOM 7869  H HE   . ARG A 1 50  ? -6.808  -11.497 7.441   1.00 0.00 ? 50  ARG A HE   5  
ATOM 7870  H HH11 . ARG A 1 50  ? -9.416  -12.402 9.566   1.00 0.00 ? 50  ARG A HH11 5  
ATOM 7871  H HH12 . ARG A 1 50  ? -9.685  -13.929 8.795   1.00 0.00 ? 50  ARG A HH12 5  
ATOM 7872  H HH21 . ARG A 1 50  ? -7.156  -13.503 6.418   1.00 0.00 ? 50  ARG A HH21 5  
ATOM 7873  H HH22 . ARG A 1 50  ? -8.401  -14.556 7.006   1.00 0.00 ? 50  ARG A HH22 5  
ATOM 7874  N N    . SER A 1 51  ? -7.017  -5.623  8.554   1.00 0.00 ? 51  SER A N    5  
ATOM 7875  C CA   . SER A 1 51  ? -5.952  -4.819  9.142   1.00 0.00 ? 51  SER A CA   5  
ATOM 7876  C C    . SER A 1 51  ? -5.408  -5.451  10.420  1.00 0.00 ? 51  SER A C    5  
ATOM 7877  O O    . SER A 1 51  ? -4.470  -4.931  11.024  1.00 0.00 ? 51  SER A O    5  
ATOM 7878  C CB   . SER A 1 51  ? -6.465  -3.415  9.447   1.00 0.00 ? 51  SER A CB   5  
ATOM 7879  O OG   . SER A 1 51  ? -7.627  -3.461  10.256  1.00 0.00 ? 51  SER A OG   5  
ATOM 7880  H H    . SER A 1 51  ? -7.947  -5.432  8.798   1.00 0.00 ? 51  SER A H    5  
ATOM 7881  H HA   . SER A 1 51  ? -5.154  -4.749  8.420   1.00 0.00 ? 51  SER A HA   5  
ATOM 7882  H HB2  . SER A 1 51  ? -5.700  -2.860  9.970   1.00 0.00 ? 51  SER A HB2  5  
ATOM 7883  H HB3  . SER A 1 51  ? -6.703  -2.914  8.521   1.00 0.00 ? 51  SER A HB3  5  
ATOM 7884  H HG   . SER A 1 51  ? -8.304  -3.978  9.814   1.00 0.00 ? 51  SER A HG   5  
ATOM 7885  N N    . ASP A 1 52  ? -6.013  -6.554  10.846  1.00 0.00 ? 52  ASP A N    5  
ATOM 7886  C CA   . ASP A 1 52  ? -5.593  -7.221  12.076  1.00 0.00 ? 52  ASP A CA   5  
ATOM 7887  C C    . ASP A 1 52  ? -4.408  -8.162  11.862  1.00 0.00 ? 52  ASP A C    5  
ATOM 7888  O O    . ASP A 1 52  ? -3.301  -7.890  12.328  1.00 0.00 ? 52  ASP A O    5  
ATOM 7889  C CB   . ASP A 1 52  ? -6.766  -7.999  12.673  1.00 0.00 ? 52  ASP A CB   5  
ATOM 7890  C CG   . ASP A 1 52  ? -7.454  -7.242  13.792  1.00 0.00 ? 52  ASP A CG   5  
ATOM 7891  O OD1  . ASP A 1 52  ? -7.816  -6.066  13.579  1.00 0.00 ? 52  ASP A OD1  5  
ATOM 7892  O OD2  . ASP A 1 52  ? -7.633  -7.826  14.882  1.00 0.00 ? 52  ASP A OD2  5  
ATOM 7893  H H    . ASP A 1 52  ? -6.768  -6.914  10.337  1.00 0.00 ? 52  ASP A H    5  
ATOM 7894  H HA   . ASP A 1 52  ? -5.300  -6.454  12.776  1.00 0.00 ? 52  ASP A HA   5  
ATOM 7895  H HB2  . ASP A 1 52  ? -7.491  -8.196  11.898  1.00 0.00 ? 52  ASP A HB2  5  
ATOM 7896  H HB3  . ASP A 1 52  ? -6.403  -8.938  13.067  1.00 0.00 ? 52  ASP A HB3  5  
ATOM 7897  N N    . SER A 1 53  ? -4.651  -9.286  11.193  1.00 0.00 ? 53  SER A N    5  
ATOM 7898  C CA   . SER A 1 53  ? -3.603  -10.281 10.965  1.00 0.00 ? 53  SER A CA   5  
ATOM 7899  C C    . SER A 1 53  ? -2.876  -10.092 9.634   1.00 0.00 ? 53  SER A C    5  
ATOM 7900  O O    . SER A 1 53  ? -1.654  -10.177 9.574   1.00 0.00 ? 53  SER A O    5  
ATOM 7901  C CB   . SER A 1 53  ? -4.200  -11.688 11.029  1.00 0.00 ? 53  SER A CB   5  
ATOM 7902  O OG   . SER A 1 53  ? -5.018  -11.949 9.902   1.00 0.00 ? 53  SER A OG   5  
ATOM 7903  H H    . SER A 1 53  ? -5.558  -9.463  10.868  1.00 0.00 ? 53  SER A H    5  
ATOM 7904  H HA   . SER A 1 53  ? -2.882  -10.182 11.762  1.00 0.00 ? 53  SER A HA   5  
ATOM 7905  H HB2  . SER A 1 53  ? -3.400  -12.415 11.051  1.00 0.00 ? 53  SER A HB2  5  
ATOM 7906  H HB3  . SER A 1 53  ? -4.797  -11.784 11.922  1.00 0.00 ? 53  SER A HB3  5  
ATOM 7907  H HG   . SER A 1 53  ? -5.375  -11.122 9.567   1.00 0.00 ? 53  SER A HG   5  
ATOM 7908  N N    . ASP A 1 54  ? -3.632  -9.877  8.565   1.00 0.00 ? 54  ASP A N    5  
ATOM 7909  C CA   . ASP A 1 54  ? -3.048  -9.722  7.230   1.00 0.00 ? 54  ASP A CA   5  
ATOM 7910  C C    . ASP A 1 54  ? -1.949  -8.661  7.181   1.00 0.00 ? 54  ASP A C    5  
ATOM 7911  O O    . ASP A 1 54  ? -1.186  -8.608  6.217   1.00 0.00 ? 54  ASP A O    5  
ATOM 7912  C CB   . ASP A 1 54  ? -4.137  -9.384  6.214   1.00 0.00 ? 54  ASP A CB   5  
ATOM 7913  C CG   . ASP A 1 54  ? -4.721  -10.619 5.556   1.00 0.00 ? 54  ASP A CG   5  
ATOM 7914  O OD1  . ASP A 1 54  ? -4.928  -11.627 6.264   1.00 0.00 ? 54  ASP A OD1  5  
ATOM 7915  O OD2  . ASP A 1 54  ? -4.973  -10.578 4.333   1.00 0.00 ? 54  ASP A OD2  5  
ATOM 7916  H H    . ASP A 1 54  ? -4.606  -9.847  8.666   1.00 0.00 ? 54  ASP A H    5  
ATOM 7917  H HA   . ASP A 1 54  ? -2.607  -10.670 6.959   1.00 0.00 ? 54  ASP A HA   5  
ATOM 7918  H HB2  . ASP A 1 54  ? -4.936  -8.853  6.713   1.00 0.00 ? 54  ASP A HB2  5  
ATOM 7919  H HB3  . ASP A 1 54  ? -3.718  -8.752  5.443   1.00 0.00 ? 54  ASP A HB3  5  
ATOM 7920  N N    . VAL A 1 55  ? -1.860  -7.823  8.206   1.00 0.00 ? 55  VAL A N    5  
ATOM 7921  C CA   . VAL A 1 55  ? -0.835  -6.785  8.234   1.00 0.00 ? 55  VAL A CA   5  
ATOM 7922  C C    . VAL A 1 55  ? 0.414   -7.262  8.969   1.00 0.00 ? 55  VAL A C    5  
ATOM 7923  O O    . VAL A 1 55  ? 1.510   -6.759  8.734   1.00 0.00 ? 55  VAL A O    5  
ATOM 7924  C CB   . VAL A 1 55  ? -1.353  -5.481  8.873   1.00 0.00 ? 55  VAL A CB   5  
ATOM 7925  C CG1  . VAL A 1 55  ? -2.756  -5.178  8.380   1.00 0.00 ? 55  VAL A CG1  5  
ATOM 7926  C CG2  . VAL A 1 55  ? -1.319  -5.557  10.392  1.00 0.00 ? 55  VAL A CG2  5  
ATOM 7927  H H    . VAL A 1 55  ? -2.490  -7.902  8.954   1.00 0.00 ? 55  VAL A H    5  
ATOM 7928  H HA   . VAL A 1 55  ? -0.566  -6.570  7.210   1.00 0.00 ? 55  VAL A HA   5  
ATOM 7929  H HB   . VAL A 1 55  ? -0.708  -4.673  8.560   1.00 0.00 ? 55  VAL A HB   5  
ATOM 7930  H HG11 . VAL A 1 55  ? -2.942  -4.116  8.455   1.00 0.00 ? 55  VAL A HG11 5  
ATOM 7931  H HG12 . VAL A 1 55  ? -3.473  -5.714  8.986   1.00 0.00 ? 55  VAL A HG12 5  
ATOM 7932  H HG13 . VAL A 1 55  ? -2.852  -5.489  7.350   1.00 0.00 ? 55  VAL A HG13 5  
ATOM 7933  H HG21 . VAL A 1 55  ? -1.211  -4.561  10.796  1.00 0.00 ? 55  VAL A HG21 5  
ATOM 7934  H HG22 . VAL A 1 55  ? -0.482  -6.164  10.703  1.00 0.00 ? 55  VAL A HG22 5  
ATOM 7935  H HG23 . VAL A 1 55  ? -2.238  -5.995  10.750  1.00 0.00 ? 55  VAL A HG23 5  
ATOM 7936  N N    . VAL A 1 56  ? 0.244   -8.239  9.853   1.00 0.00 ? 56  VAL A N    5  
ATOM 7937  C CA   . VAL A 1 56  ? 1.365   -8.781  10.606  1.00 0.00 ? 56  VAL A CA   5  
ATOM 7938  C C    . VAL A 1 56  ? 2.119   -9.825  9.785   1.00 0.00 ? 56  VAL A C    5  
ATOM 7939  O O    . VAL A 1 56  ? 3.310   -10.049 9.994   1.00 0.00 ? 56  VAL A O    5  
ATOM 7940  C CB   . VAL A 1 56  ? 0.914   -9.403  11.947  1.00 0.00 ? 56  VAL A CB   5  
ATOM 7941  C CG1  . VAL A 1 56  ? 0.017   -8.438  12.707  1.00 0.00 ? 56  VAL A CG1  5  
ATOM 7942  C CG2  . VAL A 1 56  ? 0.207   -10.732 11.723  1.00 0.00 ? 56  VAL A CG2  5  
ATOM 7943  H H    . VAL A 1 56  ? -0.652  -8.607  9.997   1.00 0.00 ? 56  VAL A H    5  
ATOM 7944  H HA   . VAL A 1 56  ? 2.039   -7.964  10.824  1.00 0.00 ? 56  VAL A HA   5  
ATOM 7945  H HB   . VAL A 1 56  ? 1.794   -9.586  12.546  1.00 0.00 ? 56  VAL A HB   5  
ATOM 7946  H HG11 . VAL A 1 56  ? -0.046  -7.505  12.169  1.00 0.00 ? 56  VAL A HG11 5  
ATOM 7947  H HG12 . VAL A 1 56  ? 0.430   -8.261  13.688  1.00 0.00 ? 56  VAL A HG12 5  
ATOM 7948  H HG13 . VAL A 1 56  ? -0.969  -8.865  12.805  1.00 0.00 ? 56  VAL A HG13 5  
ATOM 7949  H HG21 . VAL A 1 56  ? -0.846  -10.557 11.561  1.00 0.00 ? 56  VAL A HG21 5  
ATOM 7950  H HG22 . VAL A 1 56  ? 0.338   -11.361 12.591  1.00 0.00 ? 56  VAL A HG22 5  
ATOM 7951  H HG23 . VAL A 1 56  ? 0.627   -11.223 10.857  1.00 0.00 ? 56  VAL A HG23 5  
ATOM 7952  N N    . GLU A 1 57  ? 1.418   -10.452 8.839   1.00 0.00 ? 57  GLU A N    5  
ATOM 7953  C CA   . GLU A 1 57  ? 2.034   -11.462 7.979   1.00 0.00 ? 57  GLU A CA   5  
ATOM 7954  C C    . GLU A 1 57  ? 2.619   -10.811 6.730   1.00 0.00 ? 57  GLU A C    5  
ATOM 7955  O O    . GLU A 1 57  ? 3.688   -11.199 6.259   1.00 0.00 ? 57  GLU A O    5  
ATOM 7956  C CB   . GLU A 1 57  ? 1.020   -12.538 7.576   1.00 0.00 ? 57  GLU A CB   5  
ATOM 7957  C CG   . GLU A 1 57  ? -0.303  -12.454 8.322   1.00 0.00 ? 57  GLU A CG   5  
ATOM 7958  C CD   . GLU A 1 57  ? -0.605  -13.710 9.118   1.00 0.00 ? 57  GLU A CD   5  
ATOM 7959  O OE1  . GLU A 1 57  ? 0.310   -14.214 9.803   1.00 0.00 ? 57  GLU A OE1  5  
ATOM 7960  O OE2  . GLU A 1 57  ? -1.759  -14.186 9.057   1.00 0.00 ? 57  GLU A OE2  5  
ATOM 7961  H H    . GLU A 1 57  ? 0.472   -10.223 8.708   1.00 0.00 ? 57  GLU A H    5  
ATOM 7962  H HA   . GLU A 1 57  ? 2.835   -11.924 8.536   1.00 0.00 ? 57  GLU A HA   5  
ATOM 7963  H HB2  . GLU A 1 57  ? 0.816   -12.444 6.520   1.00 0.00 ? 57  GLU A HB2  5  
ATOM 7964  H HB3  . GLU A 1 57  ? 1.452   -13.510 7.765   1.00 0.00 ? 57  GLU A HB3  5  
ATOM 7965  H HG2  . GLU A 1 57  ? -0.265  -11.617 9.001   1.00 0.00 ? 57  GLU A HG2  5  
ATOM 7966  H HG3  . GLU A 1 57  ? -1.095  -12.301 7.603   1.00 0.00 ? 57  GLU A HG3  5  
ATOM 7967  N N    . ALA A 1 58  ? 1.903   -9.826  6.197   1.00 0.00 ? 58  ALA A N    5  
ATOM 7968  C CA   . ALA A 1 58  ? 2.340   -9.118  4.998   1.00 0.00 ? 58  ALA A CA   5  
ATOM 7969  C C    . ALA A 1 58  ? 3.698   -8.453  5.197   1.00 0.00 ? 58  ALA A C    5  
ATOM 7970  O O    . ALA A 1 58  ? 4.593   -8.596  4.364   1.00 0.00 ? 58  ALA A O    5  
ATOM 7971  C CB   . ALA A 1 58  ? 1.301   -8.086  4.588   1.00 0.00 ? 58  ALA A CB   5  
ATOM 7972  H H    . ALA A 1 58  ? 1.055   -9.571  6.621   1.00 0.00 ? 58  ALA A H    5  
ATOM 7973  H HA   . ALA A 1 58  ? 2.423   -9.841  4.199   1.00 0.00 ? 58  ALA A HA   5  
ATOM 7974  H HB1  . ALA A 1 58  ? 0.359   -8.577  4.398   1.00 0.00 ? 58  ALA A HB1  5  
ATOM 7975  H HB2  . ALA A 1 58  ? 1.631   -7.579  3.694   1.00 0.00 ? 58  ALA A HB2  5  
ATOM 7976  H HB3  . ALA A 1 58  ? 1.177   -7.365  5.385   1.00 0.00 ? 58  ALA A HB3  5  
ATOM 7977  N N    . LEU A 1 59  ? 3.843   -7.724  6.298   1.00 0.00 ? 59  LEU A N    5  
ATOM 7978  C CA   . LEU A 1 59  ? 5.096   -7.036  6.593   1.00 0.00 ? 59  LEU A CA   5  
ATOM 7979  C C    . LEU A 1 59  ? 6.088   -7.967  7.283   1.00 0.00 ? 59  LEU A C    5  
ATOM 7980  O O    . LEU A 1 59  ? 7.227   -7.584  7.551   1.00 0.00 ? 59  LEU A O    5  
ATOM 7981  C CB   . LEU A 1 59  ? 4.839   -5.806  7.468   1.00 0.00 ? 59  LEU A CB   5  
ATOM 7982  C CG   . LEU A 1 59  ? 3.494   -5.109  7.239   1.00 0.00 ? 59  LEU A CG   5  
ATOM 7983  C CD1  . LEU A 1 59  ? 3.329   -3.940  8.199   1.00 0.00 ? 59  LEU A CD1  5  
ATOM 7984  C CD2  . LEU A 1 59  ? 3.371   -4.636  5.798   1.00 0.00 ? 59  LEU A CD2  5  
ATOM 7985  H H    . LEU A 1 59  ? 3.092   -7.647  6.923   1.00 0.00 ? 59  LEU A H    5  
ATOM 7986  H HA   . LEU A 1 59  ? 5.521   -6.712  5.656   1.00 0.00 ? 59  LEU A HA   5  
ATOM 7987  H HB2  . LEU A 1 59  ? 4.889   -6.109  8.503   1.00 0.00 ? 59  LEU A HB2  5  
ATOM 7988  H HB3  . LEU A 1 59  ? 5.624   -5.088  7.284   1.00 0.00 ? 59  LEU A HB3  5  
ATOM 7989  H HG   . LEU A 1 59  ? 2.696   -5.810  7.431   1.00 0.00 ? 59  LEU A HG   5  
ATOM 7990  H HD11 . LEU A 1 59  ? 3.066   -3.053  7.644   1.00 0.00 ? 59  LEU A HD11 5  
ATOM 7991  H HD12 . LEU A 1 59  ? 4.258   -3.773  8.723   1.00 0.00 ? 59  LEU A HD12 5  
ATOM 7992  H HD13 . LEU A 1 59  ? 2.549   -4.166  8.910   1.00 0.00 ? 59  LEU A HD13 5  
ATOM 7993  H HD21 . LEU A 1 59  ? 3.971   -3.751  5.657   1.00 0.00 ? 59  LEU A HD21 5  
ATOM 7994  H HD22 . LEU A 1 59  ? 2.336   -4.409  5.581   1.00 0.00 ? 59  LEU A HD22 5  
ATOM 7995  H HD23 . LEU A 1 59  ? 3.714   -5.414  5.134   1.00 0.00 ? 59  LEU A HD23 5  
ATOM 7996  N N    . SER A 1 60  ? 5.648   -9.190  7.571   1.00 0.00 ? 60  SER A N    5  
ATOM 7997  C CA   . SER A 1 60  ? 6.505   -10.170 8.234   1.00 0.00 ? 60  SER A CA   5  
ATOM 7998  C C    . SER A 1 60  ? 7.684   -10.550 7.345   1.00 0.00 ? 60  SER A C    5  
ATOM 7999  O O    . SER A 1 60  ? 8.741   -10.948 7.835   1.00 0.00 ? 60  SER A O    5  
ATOM 8000  C CB   . SER A 1 60  ? 5.702   -11.422 8.599   1.00 0.00 ? 60  SER A CB   5  
ATOM 8001  O OG   . SER A 1 60  ? 6.562   -12.502 8.922   1.00 0.00 ? 60  SER A OG   5  
ATOM 8002  H H    . SER A 1 60  ? 4.730   -9.439  7.336   1.00 0.00 ? 60  SER A H    5  
ATOM 8003  H HA   . SER A 1 60  ? 6.885   -9.718  9.136   1.00 0.00 ? 60  SER A HA   5  
ATOM 8004  H HB2  . SER A 1 60  ? 5.073   -11.212 9.451   1.00 0.00 ? 60  SER A HB2  5  
ATOM 8005  H HB3  . SER A 1 60  ? 5.085   -11.709 7.759   1.00 0.00 ? 60  SER A HB3  5  
ATOM 8006  H HG   . SER A 1 60  ? 6.910   -12.887 8.116   1.00 0.00 ? 60  SER A HG   5  
ATOM 8007  N N    . GLU A 1 61  ? 7.494   -10.419 6.038   1.00 0.00 ? 61  GLU A N    5  
ATOM 8008  C CA   . GLU A 1 61  ? 8.536   -10.740 5.071   1.00 0.00 ? 61  GLU A CA   5  
ATOM 8009  C C    . GLU A 1 61  ? 8.309   -9.968  3.778   1.00 0.00 ? 61  GLU A C    5  
ATOM 8010  O O    . GLU A 1 61  ? 8.954   -10.225 2.762   1.00 0.00 ? 61  GLU A O    5  
ATOM 8011  C CB   . GLU A 1 61  ? 8.561   -12.243 4.791   1.00 0.00 ? 61  GLU A CB   5  
ATOM 8012  C CG   . GLU A 1 61  ? 9.442   -13.031 5.747   1.00 0.00 ? 61  GLU A CG   5  
ATOM 8013  C CD   . GLU A 1 61  ? 10.882  -12.554 5.744   1.00 0.00 ? 61  GLU A CD   5  
ATOM 8014  O OE1  . GLU A 1 61  ? 11.388  -12.196 4.659   1.00 0.00 ? 61  GLU A OE1  5  
ATOM 8015  O OE2  . GLU A 1 61  ? 11.507  -12.541 6.826   1.00 0.00 ? 61  GLU A OE2  5  
ATOM 8016  H H    . GLU A 1 61  ? 6.630   -10.091 5.712   1.00 0.00 ? 61  GLU A H    5  
ATOM 8017  H HA   . GLU A 1 61  ? 9.485   -10.443 5.496   1.00 0.00 ? 61  GLU A HA   5  
ATOM 8018  H HB2  . GLU A 1 61  ? 7.555   -12.627 4.863   1.00 0.00 ? 61  GLU A HB2  5  
ATOM 8019  H HB3  . GLU A 1 61  ? 8.926   -12.402 3.787   1.00 0.00 ? 61  GLU A HB3  5  
ATOM 8020  H HG2  . GLU A 1 61  ? 9.049   -12.927 6.748   1.00 0.00 ? 61  GLU A HG2  5  
ATOM 8021  H HG3  . GLU A 1 61  ? 9.423   -14.071 5.460   1.00 0.00 ? 61  GLU A HG3  5  
ATOM 8022  N N    . GLU A 1 62  ? 7.390   -9.010  3.838   1.00 0.00 ? 62  GLU A N    5  
ATOM 8023  C CA   . GLU A 1 62  ? 7.060   -8.172  2.690   1.00 0.00 ? 62  GLU A CA   5  
ATOM 8024  C C    . GLU A 1 62  ? 6.624   -8.997  1.486   1.00 0.00 ? 62  GLU A C    5  
ATOM 8025  O O    . GLU A 1 62  ? 6.824   -8.600  0.337   1.00 0.00 ? 62  GLU A O    5  
ATOM 8026  C CB   . GLU A 1 62  ? 8.246   -7.295  2.310   1.00 0.00 ? 62  GLU A CB   5  
ATOM 8027  C CG   . GLU A 1 62  ? 7.952   -5.808  2.401   1.00 0.00 ? 62  GLU A CG   5  
ATOM 8028  C CD   . GLU A 1 62  ? 8.986   -5.058  3.216   1.00 0.00 ? 62  GLU A CD   5  
ATOM 8029  O OE1  . GLU A 1 62  ? 10.052  -4.719  2.658   1.00 0.00 ? 62  GLU A OE1  5  
ATOM 8030  O OE2  . GLU A 1 62  ? 8.731   -4.809  4.414   1.00 0.00 ? 62  GLU A OE2  5  
ATOM 8031  H H    . GLU A 1 62  ? 6.926   -8.854  4.687   1.00 0.00 ? 62  GLU A H    5  
ATOM 8032  H HA   . GLU A 1 62  ? 6.238   -7.544  2.979   1.00 0.00 ? 62  GLU A HA   5  
ATOM 8033  H HB2  . GLU A 1 62  ? 9.072   -7.521  2.969   1.00 0.00 ? 62  GLU A HB2  5  
ATOM 8034  H HB3  . GLU A 1 62  ? 8.530   -7.528  1.298   1.00 0.00 ? 62  GLU A HB3  5  
ATOM 8035  H HG2  . GLU A 1 62  ? 7.934   -5.396  1.403   1.00 0.00 ? 62  GLU A HG2  5  
ATOM 8036  H HG3  . GLU A 1 62  ? 6.985   -5.675  2.863   1.00 0.00 ? 62  GLU A HG3  5  
ATOM 8037  N N    . HIS A 1 63  ? 6.009   -10.129 1.766   1.00 0.00 ? 63  HIS A N    5  
ATOM 8038  C CA   . HIS A 1 63  ? 5.511   -11.020 0.721   1.00 0.00 ? 63  HIS A CA   5  
ATOM 8039  C C    . HIS A 1 63  ? 4.761   -12.209 1.324   1.00 0.00 ? 63  HIS A C    5  
ATOM 8040  O O    . HIS A 1 63  ? 4.064   -12.064 2.326   1.00 0.00 ? 63  HIS A O    5  
ATOM 8041  C CB   . HIS A 1 63  ? 6.652   -11.502 -0.187  1.00 0.00 ? 63  HIS A CB   5  
ATOM 8042  C CG   . HIS A 1 63  ? 7.827   -12.082 0.540   1.00 0.00 ? 63  HIS A CG   5  
ATOM 8043  N ND1  . HIS A 1 63  ? 9.132   -11.757 0.232   1.00 0.00 ? 63  HIS A ND1  5  
ATOM 8044  C CD2  . HIS A 1 63  ? 7.893   -12.982 1.549   1.00 0.00 ? 63  HIS A CD2  5  
ATOM 8045  C CE1  . HIS A 1 63  ? 9.949   -12.435 1.020   1.00 0.00 ? 63  HIS A CE1  5  
ATOM 8046  N NE2  . HIS A 1 63  ? 9.223   -13.184 1.827   1.00 0.00 ? 63  HIS A NE2  5  
ATOM 8047  H H    . HIS A 1 63  ? 5.877   -10.362 2.703   1.00 0.00 ? 63  HIS A H    5  
ATOM 8048  H HA   . HIS A 1 63  ? 4.813   -10.452 0.123   1.00 0.00 ? 63  HIS A HA   5  
ATOM 8049  H HB2  . HIS A 1 63  ? 6.272   -12.261 -0.853  1.00 0.00 ? 63  HIS A HB2  5  
ATOM 8050  H HB3  . HIS A 1 63  ? 7.005   -10.666 -0.775  1.00 0.00 ? 63  HIS A HB3  5  
ATOM 8051  H HD1  . HIS A 1 63  ? 9.417   -11.125 -0.460  1.00 0.00 ? 63  HIS A HD1  5  
ATOM 8052  H HD2  . HIS A 1 63  ? 7.056   -13.452 2.042   1.00 0.00 ? 63  HIS A HD2  5  
ATOM 8053  H HE1  . HIS A 1 63  ? 11.029  -12.383 1.005   1.00 0.00 ? 63  HIS A HE1  5  
ATOM 8054  H HE2  . HIS A 1 63  ? 9.580   -13.856 2.446   1.00 0.00 ? 63  HIS A HE2  5  
ATOM 8055  N N    . MET A 1 64  ? 4.900   -13.381 0.706   1.00 0.00 ? 64  MET A N    5  
ATOM 8056  C CA   . MET A 1 64  ? 4.224   -14.588 1.184   1.00 0.00 ? 64  MET A CA   5  
ATOM 8057  C C    . MET A 1 64  ? 4.959   -15.207 2.371   1.00 0.00 ? 64  MET A C    5  
ATOM 8058  O O    . MET A 1 64  ? 4.930   -16.424 2.558   1.00 0.00 ? 64  MET A O    5  
ATOM 8059  C CB   . MET A 1 64  ? 4.096   -15.620 0.056   1.00 0.00 ? 64  MET A CB   5  
ATOM 8060  C CG   . MET A 1 64  ? 4.527   -15.110 -1.309  1.00 0.00 ? 64  MET A CG   5  
ATOM 8061  S SD   . MET A 1 64  ? 3.177   -14.343 -2.227  1.00 0.00 ? 64  MET A SD   5  
ATOM 8062  C CE   . MET A 1 64  ? 3.811   -14.424 -3.899  1.00 0.00 ? 64  MET A CE   5  
ATOM 8063  H H    . MET A 1 64  ? 5.464   -13.436 -0.091  1.00 0.00 ? 64  MET A H    5  
ATOM 8064  H HA   . MET A 1 64  ? 3.236   -14.301 1.506   1.00 0.00 ? 64  MET A HA   5  
ATOM 8065  H HB2  . MET A 1 64  ? 4.705   -16.477 0.302   1.00 0.00 ? 64  MET A HB2  5  
ATOM 8066  H HB3  . MET A 1 64  ? 3.064   -15.934 -0.010  1.00 0.00 ? 64  MET A HB3  5  
ATOM 8067  H HG2  . MET A 1 64  ? 5.310   -14.379 -1.176  1.00 0.00 ? 64  MET A HG2  5  
ATOM 8068  H HG3  . MET A 1 64  ? 4.908   -15.940 -1.885  1.00 0.00 ? 64  MET A HG3  5  
ATOM 8069  H HE1  . MET A 1 64  ? 3.904   -15.456 -4.201  1.00 0.00 ? 64  MET A HE1  5  
ATOM 8070  H HE2  . MET A 1 64  ? 4.782   -13.949 -3.941  1.00 0.00 ? 64  MET A HE2  5  
ATOM 8071  H HE3  . MET A 1 64  ? 3.134   -13.914 -4.567  1.00 0.00 ? 64  MET A HE3  5  
ATOM 8072  N N    . GLU A 1 65  ? 5.616   -14.365 3.165   1.00 0.00 ? 65  GLU A N    5  
ATOM 8073  C CA   . GLU A 1 65  ? 6.363   -14.826 4.334   1.00 0.00 ? 65  GLU A CA   5  
ATOM 8074  C C    . GLU A 1 65  ? 7.479   -15.786 3.934   1.00 0.00 ? 65  GLU A C    5  
ATOM 8075  O O    . GLU A 1 65  ? 8.180   -16.329 4.789   1.00 0.00 ? 65  GLU A O    5  
ATOM 8076  C CB   . GLU A 1 65  ? 5.426   -15.507 5.333   1.00 0.00 ? 65  GLU A CB   5  
ATOM 8077  C CG   . GLU A 1 65  ? 4.312   -14.603 5.830   1.00 0.00 ? 65  GLU A CG   5  
ATOM 8078  C CD   . GLU A 1 65  ? 3.610   -15.159 7.053   1.00 0.00 ? 65  GLU A CD   5  
ATOM 8079  O OE1  . GLU A 1 65  ? 4.206   -15.113 8.151   1.00 0.00 ? 65  GLU A OE1  5  
ATOM 8080  O OE2  . GLU A 1 65  ? 2.466   -15.641 6.913   1.00 0.00 ? 65  GLU A OE2  5  
ATOM 8081  H H    . GLU A 1 65  ? 5.601   -13.408 2.960   1.00 0.00 ? 65  GLU A H    5  
ATOM 8082  H HA   . GLU A 1 65  ? 6.804   -13.961 4.805   1.00 0.00 ? 65  GLU A HA   5  
ATOM 8083  H HB2  . GLU A 1 65  ? 4.977   -16.368 4.862   1.00 0.00 ? 65  GLU A HB2  5  
ATOM 8084  H HB3  . GLU A 1 65  ? 6.002   -15.833 6.187   1.00 0.00 ? 65  GLU A HB3  5  
ATOM 8085  H HG2  . GLU A 1 65  ? 4.731   -13.640 6.081   1.00 0.00 ? 65  GLU A HG2  5  
ATOM 8086  H HG3  . GLU A 1 65  ? 3.586   -14.483 5.039   1.00 0.00 ? 65  GLU A HG3  5  
ATOM 8087  N N    . ALA A 1 66  ? 7.638   -15.989 2.630   1.00 0.00 ? 66  ALA A N    5  
ATOM 8088  C CA   . ALA A 1 66  ? 8.668   -16.884 2.117   1.00 0.00 ? 66  ALA A CA   5  
ATOM 8089  C C    . ALA A 1 66  ? 8.891   -16.668 0.619   1.00 0.00 ? 66  ALA A C    5  
ATOM 8090  O O    . ALA A 1 66  ? 9.646   -15.781 0.219   1.00 0.00 ? 66  ALA A O    5  
ATOM 8091  C CB   . ALA A 1 66  ? 8.302   -18.333 2.402   1.00 0.00 ? 66  ALA A CB   5  
ATOM 8092  H H    . ALA A 1 66  ? 7.046   -15.527 1.999   1.00 0.00 ? 66  ALA A H    5  
ATOM 8093  H HA   . ALA A 1 66  ? 9.589   -16.663 2.638   1.00 0.00 ? 66  ALA A HA   5  
ATOM 8094  H HB1  . ALA A 1 66  ? 8.926   -18.713 3.195   1.00 0.00 ? 66  ALA A HB1  5  
ATOM 8095  H HB2  . ALA A 1 66  ? 8.452   -18.924 1.510   1.00 0.00 ? 66  ALA A HB2  5  
ATOM 8096  H HB3  . ALA A 1 66  ? 7.265   -18.389 2.701   1.00 0.00 ? 66  ALA A HB3  5  
ATOM 8097  N N    . ASP A 1 67  ? 8.229   -17.482 -0.203  1.00 0.00 ? 67  ASP A N    5  
ATOM 8098  C CA   . ASP A 1 67  ? 8.359   -17.376 -1.653  1.00 0.00 ? 67  ASP A CA   5  
ATOM 8099  C C    . ASP A 1 67  ? 7.368   -18.294 -2.361  1.00 0.00 ? 67  ASP A C    5  
ATOM 8100  O O    . ASP A 1 67  ? 7.727   -19.003 -3.302  1.00 0.00 ? 67  ASP A O    5  
ATOM 8101  C CB   . ASP A 1 67  ? 9.787   -17.722 -2.085  1.00 0.00 ? 67  ASP A CB   5  
ATOM 8102  C CG   . ASP A 1 67  ? 10.402  -16.647 -2.961  1.00 0.00 ? 67  ASP A CG   5  
ATOM 8103  O OD1  . ASP A 1 67  ? 9.910   -16.450 -4.091  1.00 0.00 ? 67  ASP A OD1  5  
ATOM 8104  O OD2  . ASP A 1 67  ? 11.376  -16.003 -2.516  1.00 0.00 ? 67  ASP A OD2  5  
ATOM 8105  H H    . ASP A 1 67  ? 7.639   -18.169 0.174   1.00 0.00 ? 67  ASP A H    5  
ATOM 8106  H HA   . ASP A 1 67  ? 8.147   -16.353 -1.930  1.00 0.00 ? 67  ASP A HA   5  
ATOM 8107  H HB2  . ASP A 1 67  ? 10.404  -17.840 -1.208  1.00 0.00 ? 67  ASP A HB2  5  
ATOM 8108  H HB3  . ASP A 1 67  ? 9.774   -18.648 -2.638  1.00 0.00 ? 67  ASP A HB3  5  
ATOM 8109  N N    . GLY A 1 68  ? 6.117   -18.275 -1.908  1.00 0.00 ? 68  GLY A N    5  
ATOM 8110  C CA   . GLY A 1 68  ? 5.097   -19.111 -2.513  1.00 0.00 ? 68  GLY A CA   5  
ATOM 8111  C C    . GLY A 1 68  ? 4.153   -19.709 -1.490  1.00 0.00 ? 68  GLY A C    5  
ATOM 8112  O O    . GLY A 1 68  ? 4.207   -20.908 -1.211  1.00 0.00 ? 68  GLY A O    5  
ATOM 8113  H H    . GLY A 1 68  ? 5.888   -17.689 -1.157  1.00 0.00 ? 68  GLY A H    5  
ATOM 8114  H HA2  . GLY A 1 68  ? 4.527   -18.515 -3.209  1.00 0.00 ? 68  GLY A HA2  5  
ATOM 8115  H HA3  . GLY A 1 68  ? 5.579   -19.912 -3.054  1.00 0.00 ? 68  GLY A HA3  5  
ATOM 8116  N N    . HIS A 1 69  ? 3.283   -18.875 -0.930  1.00 0.00 ? 69  HIS A N    5  
ATOM 8117  C CA   . HIS A 1 69  ? 2.322   -19.329 0.068   1.00 0.00 ? 69  HIS A CA   5  
ATOM 8118  C C    . HIS A 1 69  ? 0.918   -18.834 -0.265  1.00 0.00 ? 69  HIS A C    5  
ATOM 8119  O O    . HIS A 1 69  ? 0.685   -18.282 -1.341  1.00 0.00 ? 69  HIS A O    5  
ATOM 8120  C CB   . HIS A 1 69  ? 2.733   -18.842 1.459   1.00 0.00 ? 69  HIS A CB   5  
ATOM 8121  C CG   . HIS A 1 69  ? 3.591   -19.817 2.203   1.00 0.00 ? 69  HIS A CG   5  
ATOM 8122  N ND1  . HIS A 1 69  ? 3.077   -20.810 3.011   1.00 0.00 ? 69  HIS A ND1  5  
ATOM 8123  C CD2  . HIS A 1 69  ? 4.939   -19.953 2.255   1.00 0.00 ? 69  HIS A CD2  5  
ATOM 8124  C CE1  . HIS A 1 69  ? 4.068   -21.512 3.530   1.00 0.00 ? 69  HIS A CE1  5  
ATOM 8125  N NE2  . HIS A 1 69  ? 5.208   -21.013 3.086   1.00 0.00 ? 69  HIS A NE2  5  
ATOM 8126  H H    . HIS A 1 69  ? 3.289   -17.930 -1.195  1.00 0.00 ? 69  HIS A H    5  
ATOM 8127  H HA   . HIS A 1 69  ? 2.321   -20.409 0.060   1.00 0.00 ? 69  HIS A HA   5  
ATOM 8128  H HB2  . HIS A 1 69  ? 3.287   -17.921 1.363   1.00 0.00 ? 69  HIS A HB2  5  
ATOM 8129  H HB3  . HIS A 1 69  ? 1.844   -18.662 2.048   1.00 0.00 ? 69  HIS A HB3  5  
ATOM 8130  H HD1  . HIS A 1 69  ? 2.125   -20.974 3.182   1.00 0.00 ? 69  HIS A HD1  5  
ATOM 8131  H HD2  . HIS A 1 69  ? 5.665   -19.341 1.740   1.00 0.00 ? 69  HIS A HD2  5  
ATOM 8132  H HE1  . HIS A 1 69  ? 3.966   -22.352 4.200   1.00 0.00 ? 69  HIS A HE1  5  
ATOM 8133  H HE2  . HIS A 1 69  ? 6.100   -21.307 3.363   1.00 0.00 ? 69  HIS A HE2  5  
ATOM 8134  N N    . ALA A 1 70  ? -0.013  -19.036 0.661   1.00 0.00 ? 70  ALA A N    5  
ATOM 8135  C CA   . ALA A 1 70  ? -1.394  -18.611 0.462   1.00 0.00 ? 70  ALA A CA   5  
ATOM 8136  C C    . ALA A 1 70  ? -2.000  -18.084 1.758   1.00 0.00 ? 70  ALA A C    5  
ATOM 8137  O O    . ALA A 1 70  ? -3.173  -18.318 2.049   1.00 0.00 ? 70  ALA A O    5  
ATOM 8138  C CB   . ALA A 1 70  ? -2.226  -19.762 -0.086  1.00 0.00 ? 70  ALA A CB   5  
ATOM 8139  H H    . ALA A 1 70  ? 0.233   -19.482 1.498   1.00 0.00 ? 70  ALA A H    5  
ATOM 8140  H HA   . ALA A 1 70  ? -1.393  -17.818 -0.272  1.00 0.00 ? 70  ALA A HA   5  
ATOM 8141  H HB1  . ALA A 1 70  ? -2.282  -19.686 -1.162  1.00 0.00 ? 70  ALA A HB1  5  
ATOM 8142  H HB2  . ALA A 1 70  ? -3.221  -19.717 0.331   1.00 0.00 ? 70  ALA A HB2  5  
ATOM 8143  H HB3  . ALA A 1 70  ? -1.765  -20.700 0.185   1.00 0.00 ? 70  ALA A HB3  5  
ATOM 8144  N N    . ALA A 1 71  ? -1.191  -17.367 2.533   1.00 0.00 ? 71  ALA A N    5  
ATOM 8145  C CA   . ALA A 1 71  ? -1.644  -16.803 3.798   1.00 0.00 ? 71  ALA A CA   5  
ATOM 8146  C C    . ALA A 1 71  ? -1.614  -15.280 3.760   1.00 0.00 ? 71  ALA A C    5  
ATOM 8147  O O    . ALA A 1 71  ? -2.389  -14.615 4.449   1.00 0.00 ? 71  ALA A O    5  
ATOM 8148  C CB   . ALA A 1 71  ? -0.786  -17.319 4.944   1.00 0.00 ? 71  ALA A CB   5  
ATOM 8149  H H    . ALA A 1 71  ? -0.267  -17.214 2.247   1.00 0.00 ? 71  ALA A H    5  
ATOM 8150  H HA   . ALA A 1 71  ? -2.660  -17.130 3.965   1.00 0.00 ? 71  ALA A HA   5  
ATOM 8151  H HB1  . ALA A 1 71  ? 0.246   -17.050 4.771   1.00 0.00 ? 71  ALA A HB1  5  
ATOM 8152  H HB2  . ALA A 1 71  ? -0.873  -18.393 5.003   1.00 0.00 ? 71  ALA A HB2  5  
ATOM 8153  H HB3  . ALA A 1 71  ? -1.122  -16.879 5.873   1.00 0.00 ? 71  ALA A HB3  5  
ATOM 8154  N N    . VAL A 1 72  ? -0.713  -14.732 2.949   1.00 0.00 ? 72  VAL A N    5  
ATOM 8155  C CA   . VAL A 1 72  ? -0.576  -13.287 2.818   1.00 0.00 ? 72  VAL A CA   5  
ATOM 8156  C C    . VAL A 1 72  ? -0.483  -12.877 1.350   1.00 0.00 ? 72  VAL A C    5  
ATOM 8157  O O    . VAL A 1 72  ? 0.398   -13.335 0.623   1.00 0.00 ? 72  VAL A O    5  
ATOM 8158  C CB   . VAL A 1 72  ? 0.667   -12.768 3.572   1.00 0.00 ? 72  VAL A CB   5  
ATOM 8159  C CG1  . VAL A 1 72  ? 1.792   -13.791 3.520   1.00 0.00 ? 72  VAL A CG1  5  
ATOM 8160  C CG2  . VAL A 1 72  ? 1.128   -11.433 3.003   1.00 0.00 ? 72  VAL A CG2  5  
ATOM 8161  H H    . VAL A 1 72  ? -0.124  -15.316 2.429   1.00 0.00 ? 72  VAL A H    5  
ATOM 8162  H HA   . VAL A 1 72  ? -1.452  -12.829 3.254   1.00 0.00 ? 72  VAL A HA   5  
ATOM 8163  H HB   . VAL A 1 72  ? 0.401   -12.618 4.609   1.00 0.00 ? 72  VAL A HB   5  
ATOM 8164  H HG11 . VAL A 1 72  ? 1.828   -14.238 2.536   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 8165  H HG12 . VAL A 1 72  ? 1.616   -14.560 4.257   1.00 0.00 ? 72  VAL A HG12 5  
ATOM 8166  H HG13 . VAL A 1 72  ? 2.734   -13.304 3.726   1.00 0.00 ? 72  VAL A HG13 5  
ATOM 8167  H HG21 . VAL A 1 72  ? 0.352   -10.697 3.142   1.00 0.00 ? 72  VAL A HG21 5  
ATOM 8168  H HG22 . VAL A 1 72  ? 1.336   -11.544 1.948   1.00 0.00 ? 72  VAL A HG22 5  
ATOM 8169  H HG23 . VAL A 1 72  ? 2.024   -11.114 3.514   1.00 0.00 ? 72  VAL A HG23 5  
ATOM 8170  N N    . VAL A 1 73  ? -1.395  -12.010 0.926   1.00 0.00 ? 73  VAL A N    5  
ATOM 8171  C CA   . VAL A 1 73  ? -1.413  -11.534 -0.453  1.00 0.00 ? 73  VAL A CA   5  
ATOM 8172  C C    . VAL A 1 73  ? -1.715  -10.039 -0.522  1.00 0.00 ? 73  VAL A C    5  
ATOM 8173  O O    . VAL A 1 73  ? -2.873  -9.629  -0.452  1.00 0.00 ? 73  VAL A O    5  
ATOM 8174  C CB   . VAL A 1 73  ? -2.451  -12.293 -1.304  1.00 0.00 ? 73  VAL A CB   5  
ATOM 8175  C CG1  . VAL A 1 73  ? -1.775  -13.381 -2.124  1.00 0.00 ? 73  VAL A CG1  5  
ATOM 8176  C CG2  . VAL A 1 73  ? -3.545  -12.882 -0.426  1.00 0.00 ? 73  VAL A CG2  5  
ATOM 8177  H H    . VAL A 1 73  ? -2.071  -11.680 1.553   1.00 0.00 ? 73  VAL A H    5  
ATOM 8178  H HA   . VAL A 1 73  ? -0.436  -11.711 -0.877  1.00 0.00 ? 73  VAL A HA   5  
ATOM 8179  H HB   . VAL A 1 73  ? -2.908  -11.592 -1.988  1.00 0.00 ? 73  VAL A HB   5  
ATOM 8180  H HG11 . VAL A 1 73  ? -1.646  -14.264 -1.516  1.00 0.00 ? 73  VAL A HG11 5  
ATOM 8181  H HG12 . VAL A 1 73  ? -0.811  -13.030 -2.462  1.00 0.00 ? 73  VAL A HG12 5  
ATOM 8182  H HG13 . VAL A 1 73  ? -2.389  -13.621 -2.981  1.00 0.00 ? 73  VAL A HG13 5  
ATOM 8183  H HG21 . VAL A 1 73  ? -4.275  -13.380 -1.044  1.00 0.00 ? 73  VAL A HG21 5  
ATOM 8184  H HG22 . VAL A 1 73  ? -4.023  -12.090 0.133   1.00 0.00 ? 73  VAL A HG22 5  
ATOM 8185  H HG23 . VAL A 1 73  ? -3.110  -13.593 0.262   1.00 0.00 ? 73  VAL A HG23 5  
ATOM 8186  N N    . PHE A 1 74  ? -0.670  -9.227  -0.670  1.00 0.00 ? 74  PHE A N    5  
ATOM 8187  C CA   . PHE A 1 74  ? -0.839  -7.781  -0.760  1.00 0.00 ? 74  PHE A CA   5  
ATOM 8188  C C    . PHE A 1 74  ? -0.219  -7.241  -2.047  1.00 0.00 ? 74  PHE A C    5  
ATOM 8189  O O    . PHE A 1 74  ? -0.760  -6.330  -2.663  1.00 0.00 ? 74  PHE A O    5  
ATOM 8190  C CB   . PHE A 1 74  ? -0.227  -7.074  0.456   1.00 0.00 ? 74  PHE A CB   5  
ATOM 8191  C CG   . PHE A 1 74  ? -0.500  -5.590  0.495   1.00 0.00 ? 74  PHE A CG   5  
ATOM 8192  C CD1  . PHE A 1 74  ? -1.728  -5.081  0.089   1.00 0.00 ? 74  PHE A CD1  5  
ATOM 8193  C CD2  . PHE A 1 74  ? 0.474   -4.702  0.930   1.00 0.00 ? 74  PHE A CD2  5  
ATOM 8194  C CE1  . PHE A 1 74  ? -1.974  -3.724  0.118   1.00 0.00 ? 74  PHE A CE1  5  
ATOM 8195  C CE2  . PHE A 1 74  ? 0.231   -3.342  0.958   1.00 0.00 ? 74  PHE A CE2  5  
ATOM 8196  C CZ   . PHE A 1 74  ? -0.993  -2.853  0.551   1.00 0.00 ? 74  PHE A CZ   5  
ATOM 8197  H H    . PHE A 1 74  ? 0.231   -9.610  -0.727  1.00 0.00 ? 74  PHE A H    5  
ATOM 8198  H HA   . PHE A 1 74  ? -1.900  -7.578  -0.782  1.00 0.00 ? 74  PHE A HA   5  
ATOM 8199  H HB2  . PHE A 1 74  ? -0.632  -7.509  1.357   1.00 0.00 ? 74  PHE A HB2  5  
ATOM 8200  H HB3  . PHE A 1 74  ? 0.844   -7.216  0.444   1.00 0.00 ? 74  PHE A HB3  5  
ATOM 8201  H HD1  . PHE A 1 74  ? -2.497  -5.757  -0.250  1.00 0.00 ? 74  PHE A HD1  5  
ATOM 8202  H HD2  . PHE A 1 74  ? 1.432   -5.078  1.253   1.00 0.00 ? 74  PHE A HD2  5  
ATOM 8203  H HE1  . PHE A 1 74  ? -2.934  -3.341  -0.201  1.00 0.00 ? 74  PHE A HE1  5  
ATOM 8204  H HE2  . PHE A 1 74  ? 0.998   -2.663  1.299   1.00 0.00 ? 74  PHE A HE2  5  
ATOM 8205  H HZ   . PHE A 1 74  ? -1.184  -1.791  0.573   1.00 0.00 ? 74  PHE A HZ   5  
ATOM 8206  N N    . GLY A 1 75  ? 0.913   -7.812  -2.450  1.00 0.00 ? 75  GLY A N    5  
ATOM 8207  C CA   . GLY A 1 75  ? 1.577   -7.369  -3.668  1.00 0.00 ? 75  GLY A CA   5  
ATOM 8208  C C    . GLY A 1 75  ? 0.898   -7.893  -4.923  1.00 0.00 ? 75  GLY A C    5  
ATOM 8209  O O    . GLY A 1 75  ? 1.555   -8.165  -5.928  1.00 0.00 ? 75  GLY A O    5  
ATOM 8210  H H    . GLY A 1 75  ? 1.300   -8.541  -1.920  1.00 0.00 ? 75  GLY A H    5  
ATOM 8211  H HA2  . GLY A 1 75  ? 1.574   -6.289  -3.695  1.00 0.00 ? 75  GLY A HA2  5  
ATOM 8212  H HA3  . GLY A 1 75  ? 2.600   -7.717  -3.654  1.00 0.00 ? 75  GLY A HA3  5  
ATOM 8213  N N    . THR A 1 76  ? -0.421  -8.036  -4.853  1.00 0.00 ? 76  THR A N    5  
ATOM 8214  C CA   . THR A 1 76  ? -1.214  -8.529  -5.972  1.00 0.00 ? 76  THR A CA   5  
ATOM 8215  C C    . THR A 1 76  ? -2.607  -7.908  -5.961  1.00 0.00 ? 76  THR A C    5  
ATOM 8216  O O    . THR A 1 76  ? -3.014  -7.307  -4.968  1.00 0.00 ? 76  THR A O    5  
ATOM 8217  C CB   . THR A 1 76  ? -1.347  -10.063 -5.936  1.00 0.00 ? 76  THR A CB   5  
ATOM 8218  O OG1  . THR A 1 76  ? -0.390  -10.617 -5.026  1.00 0.00 ? 76  THR A OG1  5  
ATOM 8219  C CG2  . THR A 1 76  ? -1.140  -10.658 -7.321  1.00 0.00 ? 76  THR A CG2  5  
ATOM 8220  H H    . THR A 1 76  ? -0.874  -7.796  -4.019  1.00 0.00 ? 76  THR A H    5  
ATOM 8221  H HA   . THR A 1 76  ? -0.712  -8.251  -6.888  1.00 0.00 ? 76  THR A HA   5  
ATOM 8222  H HB   . THR A 1 76  ? -2.343  -10.314 -5.599  1.00 0.00 ? 76  THR A HB   5  
ATOM 8223  H HG1  . THR A 1 76  ? 0.447   -10.740 -5.476  1.00 0.00 ? 76  THR A HG1  5  
ATOM 8224  H HG21 . THR A 1 76  ? -1.348  -11.717 -7.292  1.00 0.00 ? 76  THR A HG21 5  
ATOM 8225  H HG22 . THR A 1 76  ? -0.117  -10.500 -7.630  1.00 0.00 ? 76  THR A HG22 5  
ATOM 8226  H HG23 . THR A 1 76  ? -1.806  -10.179 -8.022  1.00 0.00 ? 76  THR A HG23 5  
ATOM 8227  N N    . VAL A 1 77  ? -3.340  -8.059  -7.059  1.00 0.00 ? 77  VAL A N    5  
ATOM 8228  C CA   . VAL A 1 77  ? -4.692  -7.519  -7.135  1.00 0.00 ? 77  VAL A CA   5  
ATOM 8229  C C    . VAL A 1 77  ? -5.586  -8.239  -6.124  1.00 0.00 ? 77  VAL A C    5  
ATOM 8230  O O    . VAL A 1 77  ? -6.031  -9.363  -6.363  1.00 0.00 ? 77  VAL A O    5  
ATOM 8231  C CB   . VAL A 1 77  ? -5.287  -7.658  -8.554  1.00 0.00 ? 77  VAL A CB   5  
ATOM 8232  C CG1  . VAL A 1 77  ? -5.044  -9.056  -9.105  1.00 0.00 ? 77  VAL A CG1  5  
ATOM 8233  C CG2  . VAL A 1 77  ? -6.775  -7.326  -8.555  1.00 0.00 ? 77  VAL A CG2  5  
ATOM 8234  H H    . VAL A 1 77  ? -2.972  -8.551  -7.823  1.00 0.00 ? 77  VAL A H    5  
ATOM 8235  H HA   . VAL A 1 77  ? -4.649  -6.469  -6.880  1.00 0.00 ? 77  VAL A HA   5  
ATOM 8236  H HB   . VAL A 1 77  ? -4.785  -6.953  -9.201  1.00 0.00 ? 77  VAL A HB   5  
ATOM 8237  H HG11 . VAL A 1 77  ? -4.040  -9.369  -8.863  1.00 0.00 ? 77  VAL A HG11 5  
ATOM 8238  H HG12 . VAL A 1 77  ? -5.170  -9.047  -10.178 1.00 0.00 ? 77  VAL A HG12 5  
ATOM 8239  H HG13 . VAL A 1 77  ? -5.752  -9.743  -8.666  1.00 0.00 ? 77  VAL A HG13 5  
ATOM 8240  H HG21 . VAL A 1 77  ? -7.291  -7.985  -9.238  1.00 0.00 ? 77  VAL A HG21 5  
ATOM 8241  H HG22 . VAL A 1 77  ? -6.914  -6.301  -8.870  1.00 0.00 ? 77  VAL A HG22 5  
ATOM 8242  H HG23 . VAL A 1 77  ? -7.174  -7.453  -7.559  1.00 0.00 ? 77  VAL A HG23 5  
ATOM 8243  N N    . VAL A 1 78  ? -5.812  -7.599  -4.980  1.00 0.00 ? 78  VAL A N    5  
ATOM 8244  C CA   . VAL A 1 78  ? -6.616  -8.194  -3.918  1.00 0.00 ? 78  VAL A CA   5  
ATOM 8245  C C    . VAL A 1 78  ? -7.790  -7.311  -3.513  1.00 0.00 ? 78  VAL A C    5  
ATOM 8246  O O    . VAL A 1 78  ? -7.851  -6.133  -3.867  1.00 0.00 ? 78  VAL A O    5  
ATOM 8247  C CB   . VAL A 1 78  ? -5.764  -8.437  -2.659  1.00 0.00 ? 78  VAL A CB   5  
ATOM 8248  C CG1  . VAL A 1 78  ? -4.986  -9.736  -2.765  1.00 0.00 ? 78  VAL A CG1  5  
ATOM 8249  C CG2  . VAL A 1 78  ? -4.820  -7.267  -2.423  1.00 0.00 ? 78  VAL A CG2  5  
ATOM 8250  H H    . VAL A 1 78  ? -5.411  -6.718  -4.838  1.00 0.00 ? 78  VAL A H    5  
ATOM 8251  H HA   . VAL A 1 78  ? -6.990  -9.144  -4.266  1.00 0.00 ? 78  VAL A HA   5  
ATOM 8252  H HB   . VAL A 1 78  ? -6.426  -8.510  -1.808  1.00 0.00 ? 78  VAL A HB   5  
ATOM 8253  H HG11 . VAL A 1 78  ? -4.325  -9.824  -1.914  1.00 0.00 ? 78  VAL A HG11 5  
ATOM 8254  H HG12 . VAL A 1 78  ? -4.406  -9.734  -3.675  1.00 0.00 ? 78  VAL A HG12 5  
ATOM 8255  H HG13 . VAL A 1 78  ? -5.673  -10.567 -2.776  1.00 0.00 ? 78  VAL A HG13 5  
ATOM 8256  H HG21 . VAL A 1 78  ? -4.055  -7.263  -3.186  1.00 0.00 ? 78  VAL A HG21 5  
ATOM 8257  H HG22 . VAL A 1 78  ? -4.358  -7.365  -1.452  1.00 0.00 ? 78  VAL A HG22 5  
ATOM 8258  H HG23 . VAL A 1 78  ? -5.377  -6.342  -2.465  1.00 0.00 ? 78  VAL A HG23 5  
ATOM 8259  N N    . ASP A 1 79  ? -8.699  -7.888  -2.732  1.00 0.00 ? 79  ASP A N    5  
ATOM 8260  C CA   . ASP A 1 79  ? -9.857  -7.162  -2.230  1.00 0.00 ? 79  ASP A CA   5  
ATOM 8261  C C    . ASP A 1 79  ? -9.455  -6.397  -0.978  1.00 0.00 ? 79  ASP A C    5  
ATOM 8262  O O    . ASP A 1 79  ? -9.192  -6.994  0.067   1.00 0.00 ? 79  ASP A O    5  
ATOM 8263  C CB   . ASP A 1 79  ? -11.002 -8.127  -1.914  1.00 0.00 ? 79  ASP A CB   5  
ATOM 8264  C CG   . ASP A 1 79  ? -11.886 -8.391  -3.116  1.00 0.00 ? 79  ASP A CG   5  
ATOM 8265  O OD1  . ASP A 1 79  ? -11.546 -9.287  -3.919  1.00 0.00 ? 79  ASP A OD1  5  
ATOM 8266  O OD2  . ASP A 1 79  ? -12.919 -7.703  -3.258  1.00 0.00 ? 79  ASP A OD2  5  
ATOM 8267  H H    . ASP A 1 79  ? -8.569  -8.822  -2.466  1.00 0.00 ? 79  ASP A H    5  
ATOM 8268  H HA   . ASP A 1 79  ? -10.174 -6.461  -2.988  1.00 0.00 ? 79  ASP A HA   5  
ATOM 8269  H HB2  . ASP A 1 79  ? -10.590 -9.067  -1.580  1.00 0.00 ? 79  ASP A HB2  5  
ATOM 8270  H HB3  . ASP A 1 79  ? -11.611 -7.707  -1.127  1.00 0.00 ? 79  ASP A HB3  5  
ATOM 8271  N N    . ILE A 1 80  ? -9.388  -5.078  -1.090  1.00 0.00 ? 80  ILE A N    5  
ATOM 8272  C CA   . ILE A 1 80  ? -8.988  -4.241  0.030   1.00 0.00 ? 80  ILE A CA   5  
ATOM 8273  C C    . ILE A 1 80  ? -10.190 -3.635  0.743   1.00 0.00 ? 80  ILE A C    5  
ATOM 8274  O O    . ILE A 1 80  ? -11.318 -3.700  0.254   1.00 0.00 ? 80  ILE A O    5  
ATOM 8275  C CB   . ILE A 1 80  ? -8.051  -3.110  -0.433  1.00 0.00 ? 80  ILE A CB   5  
ATOM 8276  C CG1  . ILE A 1 80  ? -8.829  -2.047  -1.213  1.00 0.00 ? 80  ILE A CG1  5  
ATOM 8277  C CG2  . ILE A 1 80  ? -6.921  -3.679  -1.282  1.00 0.00 ? 80  ILE A CG2  5  
ATOM 8278  C CD1  . ILE A 1 80  ? -8.087  -0.734  -1.346  1.00 0.00 ? 80  ILE A CD1  5  
ATOM 8279  H H    . ILE A 1 80  ? -9.600  -4.659  -1.947  1.00 0.00 ? 80  ILE A H    5  
ATOM 8280  H HA   . ILE A 1 80  ? -8.443  -4.860  0.729   1.00 0.00 ? 80  ILE A HA   5  
ATOM 8281  H HB   . ILE A 1 80  ? -7.613  -2.656  0.443   1.00 0.00 ? 80  ILE A HB   5  
ATOM 8282  H HG12 . ILE A 1 80  ? -9.033  -2.416  -2.206  1.00 0.00 ? 80  ILE A HG12 5  
ATOM 8283  H HG13 . ILE A 1 80  ? -9.764  -1.852  -0.706  1.00 0.00 ? 80  ILE A HG13 5  
ATOM 8284  H HG21 . ILE A 1 80  ? -6.750  -3.033  -2.129  1.00 0.00 ? 80  ILE A HG21 5  
ATOM 8285  H HG22 . ILE A 1 80  ? -7.193  -4.665  -1.628  1.00 0.00 ? 80  ILE A HG22 5  
ATOM 8286  H HG23 . ILE A 1 80  ? -6.021  -3.741  -0.689  1.00 0.00 ? 80  ILE A HG23 5  
ATOM 8287  H HD11 . ILE A 1 80  ? -7.570  -0.708  -2.294  1.00 0.00 ? 80  ILE A HD11 5  
ATOM 8288  H HD12 . ILE A 1 80  ? -7.373  -0.641  -0.542  1.00 0.00 ? 80  ILE A HD12 5  
ATOM 8289  H HD13 . ILE A 1 80  ? -8.792  0.083   -1.297  1.00 0.00 ? 80  ILE A HD13 5  
ATOM 8290  N N    . ILE A 1 81  ? -9.931  -3.044  1.904   1.00 0.00 ? 81  ILE A N    5  
ATOM 8291  C CA   . ILE A 1 81  ? -10.978 -2.417  2.700   1.00 0.00 ? 81  ILE A CA   5  
ATOM 8292  C C    . ILE A 1 81  ? -10.524 -1.050  3.201   1.00 0.00 ? 81  ILE A C    5  
ATOM 8293  O O    . ILE A 1 81  ? -9.415  -0.904  3.711   1.00 0.00 ? 81  ILE A O    5  
ATOM 8294  C CB   . ILE A 1 81  ? -11.364 -3.291  3.907   1.00 0.00 ? 81  ILE A CB   5  
ATOM 8295  C CG1  . ILE A 1 81  ? -10.143 -4.055  4.425   1.00 0.00 ? 81  ILE A CG1  5  
ATOM 8296  C CG2  . ILE A 1 81  ? -12.474 -4.257  3.525   1.00 0.00 ? 81  ILE A CG2  5  
ATOM 8297  C CD1  . ILE A 1 81  ? -9.835  -3.788  5.883   1.00 0.00 ? 81  ILE A CD1  5  
ATOM 8298  H H    . ILE A 1 81  ? -9.009  -3.027  2.233   1.00 0.00 ? 81  ILE A H    5  
ATOM 8299  H HA   . ILE A 1 81  ? -11.848 -2.292  2.074   1.00 0.00 ? 81  ILE A HA   5  
ATOM 8300  H HB   . ILE A 1 81  ? -11.735 -2.644  4.689   1.00 0.00 ? 81  ILE A HB   5  
ATOM 8301  H HG12 . ILE A 1 81  ? -10.315 -5.113  4.311   1.00 0.00 ? 81  ILE A HG12 5  
ATOM 8302  H HG13 . ILE A 1 81  ? -9.278  -3.770  3.844   1.00 0.00 ? 81  ILE A HG13 5  
ATOM 8303  H HG21 . ILE A 1 81  ? -13.115 -3.794  2.788   1.00 0.00 ? 81  ILE A HG21 5  
ATOM 8304  H HG22 . ILE A 1 81  ? -13.054 -4.504  4.401   1.00 0.00 ? 81  ILE A HG22 5  
ATOM 8305  H HG23 . ILE A 1 81  ? -12.042 -5.156  3.113   1.00 0.00 ? 81  ILE A HG23 5  
ATOM 8306  H HD11 . ILE A 1 81  ? -10.664 -3.265  6.336   1.00 0.00 ? 81  ILE A HD11 5  
ATOM 8307  H HD12 . ILE A 1 81  ? -8.945  -3.181  5.958   1.00 0.00 ? 81  ILE A HD12 5  
ATOM 8308  H HD13 . ILE A 1 81  ? -9.678  -4.725  6.394   1.00 0.00 ? 81  ILE A HD13 5  
ATOM 8309  N N    . SER A 1 82  ? -11.386 -0.053  3.052   1.00 0.00 ? 82  SER A N    5  
ATOM 8310  C CA   . SER A 1 82  ? -11.065 1.299   3.490   1.00 0.00 ? 82  SER A CA   5  
ATOM 8311  C C    . SER A 1 82  ? -11.477 1.512   4.944   1.00 0.00 ? 82  SER A C    5  
ATOM 8312  O O    . SER A 1 82  ? -12.216 0.711   5.514   1.00 0.00 ? 82  SER A O    5  
ATOM 8313  C CB   . SER A 1 82  ? -11.756 2.328   2.592   1.00 0.00 ? 82  SER A CB   5  
ATOM 8314  O OG   . SER A 1 82  ? -12.690 3.102   3.324   1.00 0.00 ? 82  SER A OG   5  
ATOM 8315  H H    . SER A 1 82  ? -12.257 -0.230  2.641   1.00 0.00 ? 82  SER A H    5  
ATOM 8316  H HA   . SER A 1 82  ? -9.997  1.427   3.412   1.00 0.00 ? 82  SER A HA   5  
ATOM 8317  H HB2  . SER A 1 82  ? -11.013 2.988   2.171   1.00 0.00 ? 82  SER A HB2  5  
ATOM 8318  H HB3  . SER A 1 82  ? -12.275 1.816   1.796   1.00 0.00 ? 82  SER A HB3  5  
ATOM 8319  H HG   . SER A 1 82  ? -13.554 2.684   3.282   1.00 0.00 ? 82  SER A HG   5  
ATOM 8320  N N    . ARG A 1 83  ? -10.975 2.588   5.536   1.00 0.00 ? 83  ARG A N    5  
ATOM 8321  C CA   . ARG A 1 83  ? -11.271 2.915   6.933   1.00 0.00 ? 83  ARG A CA   5  
ATOM 8322  C C    . ARG A 1 83  ? -12.772 2.863   7.228   1.00 0.00 ? 83  ARG A C    5  
ATOM 8323  O O    . ARG A 1 83  ? -13.174 2.654   8.373   1.00 0.00 ? 83  ARG A O    5  
ATOM 8324  C CB   . ARG A 1 83  ? -10.732 4.305   7.276   1.00 0.00 ? 83  ARG A CB   5  
ATOM 8325  C CG   . ARG A 1 83  ? -11.621 5.444   6.797   1.00 0.00 ? 83  ARG A CG   5  
ATOM 8326  C CD   . ARG A 1 83  ? -10.810 6.688   6.469   1.00 0.00 ? 83  ARG A CD   5  
ATOM 8327  N NE   . ARG A 1 83  ? -11.218 7.833   7.280   1.00 0.00 ? 83  ARG A NE   5  
ATOM 8328  C CZ   . ARG A 1 83  ? -10.389 8.509   8.072   1.00 0.00 ? 83  ARG A CZ   5  
ATOM 8329  N NH1  . ARG A 1 83  ? -9.114  8.157   8.161   1.00 0.00 ? 83  ARG A NH1  5  
ATOM 8330  N NH2  . ARG A 1 83  ? -10.838 9.539   8.776   1.00 0.00 ? 83  ARG A NH2  5  
ATOM 8331  H H    . ARG A 1 83  ? -10.370 3.172   5.027   1.00 0.00 ? 83  ARG A H    5  
ATOM 8332  H HA   . ARG A 1 83  ? -10.772 2.186   7.552   1.00 0.00 ? 83  ARG A HA   5  
ATOM 8333  H HB2  . ARG A 1 83  ? -10.631 4.384   8.348   1.00 0.00 ? 83  ARG A HB2  5  
ATOM 8334  H HB3  . ARG A 1 83  ? -9.760  4.422   6.824   1.00 0.00 ? 83  ARG A HB3  5  
ATOM 8335  H HG2  . ARG A 1 83  ? -12.146 5.127   5.909   1.00 0.00 ? 83  ARG A HG2  5  
ATOM 8336  H HG3  . ARG A 1 83  ? -12.333 5.682   7.573   1.00 0.00 ? 83  ARG A HG3  5  
ATOM 8337  H HD2  . ARG A 1 83  ? -9.767  6.480   6.655   1.00 0.00 ? 83  ARG A HD2  5  
ATOM 8338  H HD3  . ARG A 1 83  ? -10.950 6.929   5.428   1.00 0.00 ? 83  ARG A HD3  5  
ATOM 8339  H HE   . ARG A 1 83  ? -12.155 8.113   7.232   1.00 0.00 ? 83  ARG A HE   5  
ATOM 8340  H HH11 . ARG A 1 83  ? -8.771  7.381   7.632   1.00 0.00 ? 83  ARG A HH11 5  
ATOM 8341  H HH12 . ARG A 1 83  ? -8.495  8.668   8.756   1.00 0.00 ? 83  ARG A HH12 5  
ATOM 8342  H HH21 . ARG A 1 83  ? -11.799 9.808   8.712   1.00 0.00 ? 83  ARG A HH21 5  
ATOM 8343  H HH22 . ARG A 1 83  ? -10.216 10.048  9.371   1.00 0.00 ? 83  ARG A HH22 5  
ATOM 8344  N N    . SER A 1 84  ? -13.596 3.065   6.202   1.00 0.00 ? 84  SER A N    5  
ATOM 8345  C CA   . SER A 1 84  ? -15.045 3.050   6.376   1.00 0.00 ? 84  SER A CA   5  
ATOM 8346  C C    . SER A 1 84  ? -15.626 1.675   6.065   1.00 0.00 ? 84  SER A C    5  
ATOM 8347  O O    . SER A 1 84  ? -16.739 1.351   6.481   1.00 0.00 ? 84  SER A O    5  
ATOM 8348  C CB   . SER A 1 84  ? -15.698 4.106   5.481   1.00 0.00 ? 84  SER A CB   5  
ATOM 8349  O OG   . SER A 1 84  ? -15.321 5.413   5.876   1.00 0.00 ? 84  SER A OG   5  
ATOM 8350  H H    . SER A 1 84  ? -13.223 3.233   5.310   1.00 0.00 ? 84  SER A H    5  
ATOM 8351  H HA   . SER A 1 84  ? -15.257 3.289   7.407   1.00 0.00 ? 84  SER A HA   5  
ATOM 8352  H HB2  . SER A 1 84  ? -15.388 3.948   4.460   1.00 0.00 ? 84  SER A HB2  5  
ATOM 8353  H HB3  . SER A 1 84  ? -16.772 4.017   5.550   1.00 0.00 ? 84  SER A HB3  5  
ATOM 8354  H HG   . SER A 1 84  ? -14.420 5.400   6.208   1.00 0.00 ? 84  SER A HG   5  
ATOM 8355  N N    . GLY A 1 85  ? -14.869 0.876   5.325   1.00 0.00 ? 85  GLY A N    5  
ATOM 8356  C CA   . GLY A 1 85  ? -15.326 -0.450  4.960   1.00 0.00 ? 85  GLY A CA   5  
ATOM 8357  C C    . GLY A 1 85  ? -16.116 -0.438  3.677   1.00 0.00 ? 85  GLY A C    5  
ATOM 8358  O O    . GLY A 1 85  ? -17.245 0.051   3.639   1.00 0.00 ? 85  GLY A O    5  
ATOM 8359  H H    . GLY A 1 85  ? -13.996 1.194   5.019   1.00 0.00 ? 85  GLY A H    5  
ATOM 8360  H HA2  . GLY A 1 85  ? -14.470 -1.099  4.842   1.00 0.00 ? 85  GLY A HA2  5  
ATOM 8361  H HA3  . GLY A 1 85  ? -15.951 -0.836  5.748   1.00 0.00 ? 85  GLY A HA3  5  
ATOM 8362  N N    . GLU A 1 86  ? -15.522 -0.967  2.618   1.00 0.00 ? 86  GLU A N    5  
ATOM 8363  C CA   . GLU A 1 86  ? -16.182 -1.002  1.325   1.00 0.00 ? 86  GLU A CA   5  
ATOM 8364  C C    . GLU A 1 86  ? -15.845 -2.281  0.566   1.00 0.00 ? 86  GLU A C    5  
ATOM 8365  O O    . GLU A 1 86  ? -16.481 -2.596  -0.441  1.00 0.00 ? 86  GLU A O    5  
ATOM 8366  C CB   . GLU A 1 86  ? -15.780 0.220   0.501   1.00 0.00 ? 86  GLU A CB   5  
ATOM 8367  C CG   . GLU A 1 86  ? -16.092 1.547   1.176   1.00 0.00 ? 86  GLU A CG   5  
ATOM 8368  C CD   . GLU A 1 86  ? -17.350 2.197   0.632   1.00 0.00 ? 86  GLU A CD   5  
ATOM 8369  O OE1  . GLU A 1 86  ? -17.689 1.947   -0.545  1.00 0.00 ? 86  GLU A OE1  5  
ATOM 8370  O OE2  . GLU A 1 86  ? -17.996 2.960   1.382   1.00 0.00 ? 86  GLU A OE2  5  
ATOM 8371  H H    . GLU A 1 86  ? -14.619 -1.339  2.708   1.00 0.00 ? 86  GLU A H    5  
ATOM 8372  H HA   . GLU A 1 86  ? -17.248 -0.971  1.497   1.00 0.00 ? 86  GLU A HA   5  
ATOM 8373  H HB2  . GLU A 1 86  ? -14.716 0.181   0.313   1.00 0.00 ? 86  GLU A HB2  5  
ATOM 8374  H HB3  . GLU A 1 86  ? -16.304 0.188   -0.436  1.00 0.00 ? 86  GLU A HB3  5  
ATOM 8375  H HG2  . GLU A 1 86  ? -16.226 1.376   2.232   1.00 0.00 ? 86  GLU A HG2  5  
ATOM 8376  H HG3  . GLU A 1 86  ? -15.263 2.219   1.022   1.00 0.00 ? 86  GLU A HG3  5  
ATOM 8377  N N    . LYS A 1 87  ? -14.842 -3.012  1.056   1.00 0.00 ? 87  LYS A N    5  
ATOM 8378  C CA   . LYS A 1 87  ? -14.407 -4.259  0.427   1.00 0.00 ? 87  LYS A CA   5  
ATOM 8379  C C    . LYS A 1 87  ? -14.389 -4.121  -1.093  1.00 0.00 ? 87  LYS A C    5  
ATOM 8380  O O    . LYS A 1 87  ? -15.182 -4.750  -1.794  1.00 0.00 ? 87  LYS A O    5  
ATOM 8381  C CB   . LYS A 1 87  ? -15.317 -5.428  0.834   1.00 0.00 ? 87  LYS A CB   5  
ATOM 8382  C CG   . LYS A 1 87  ? -16.285 -5.103  1.963   1.00 0.00 ? 87  LYS A CG   5  
ATOM 8383  C CD   . LYS A 1 87  ? -15.705 -5.455  3.324   1.00 0.00 ? 87  LYS A CD   5  
ATOM 8384  C CE   . LYS A 1 87  ? -15.492 -6.955  3.475   1.00 0.00 ? 87  LYS A CE   5  
ATOM 8385  N NZ   . LYS A 1 87  ? -16.632 -7.610  4.171   1.00 0.00 ? 87  LYS A NZ   5  
ATOM 8386  H H    . LYS A 1 87  ? -14.378 -2.700  1.861   1.00 0.00 ? 87  LYS A H    5  
ATOM 8387  H HA   . LYS A 1 87  ? -13.402 -4.464  0.767   1.00 0.00 ? 87  LYS A HA   5  
ATOM 8388  H HB2  . LYS A 1 87  ? -15.893 -5.733  -0.026  1.00 0.00 ? 87  LYS A HB2  5  
ATOM 8389  H HB3  . LYS A 1 87  ? -14.696 -6.255  1.150   1.00 0.00 ? 87  LYS A HB3  5  
ATOM 8390  H HG2  . LYS A 1 87  ? -16.506 -4.047  1.942   1.00 0.00 ? 87  LYS A HG2  5  
ATOM 8391  H HG3  . LYS A 1 87  ? -17.196 -5.665  1.814   1.00 0.00 ? 87  LYS A HG3  5  
ATOM 8392  H HD2  . LYS A 1 87  ? -14.756 -4.955  3.439   1.00 0.00 ? 87  LYS A HD2  5  
ATOM 8393  H HD3  . LYS A 1 87  ? -16.384 -5.119  4.093   1.00 0.00 ? 87  LYS A HD3  5  
ATOM 8394  H HE2  . LYS A 1 87  ? -15.383 -7.390  2.493   1.00 0.00 ? 87  LYS A HE2  5  
ATOM 8395  H HE3  . LYS A 1 87  ? -14.589 -7.122  4.042   1.00 0.00 ? 87  LYS A HE3  5  
ATOM 8396  H HZ1  . LYS A 1 87  ? -16.634 -8.631  3.973   1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 8397  H HZ2  . LYS A 1 87  ? -17.532 -7.204  3.844   1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 8398  H HZ3  . LYS A 1 87  ? -16.554 -7.467  5.199   1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 8399  N N    . ILE A 1 88  ? -13.486 -3.285  -1.592  1.00 0.00 ? 88  ILE A N    5  
ATOM 8400  C CA   . ILE A 1 88  ? -13.369 -3.052  -3.022  1.00 0.00 ? 88  ILE A CA   5  
ATOM 8401  C C    . ILE A 1 88  ? -12.083 -3.665  -3.575  1.00 0.00 ? 88  ILE A C    5  
ATOM 8402  O O    . ILE A 1 88  ? -10.991 -3.385  -3.083  1.00 0.00 ? 88  ILE A O    5  
ATOM 8403  C CB   . ILE A 1 88  ? -13.391 -1.541  -3.329  1.00 0.00 ? 88  ILE A CB   5  
ATOM 8404  C CG1  . ILE A 1 88  ? -14.809 -0.984  -3.159  1.00 0.00 ? 88  ILE A CG1  5  
ATOM 8405  C CG2  . ILE A 1 88  ? -12.864 -1.268  -4.730  1.00 0.00 ? 88  ILE A CG2  5  
ATOM 8406  C CD1  . ILE A 1 88  ? -15.795 -1.489  -4.194  1.00 0.00 ? 88  ILE A CD1  5  
ATOM 8407  H H    . ILE A 1 88  ? -12.883 -2.807  -0.987  1.00 0.00 ? 88  ILE A H    5  
ATOM 8408  H HA   . ILE A 1 88  ? -14.218 -3.510  -3.507  1.00 0.00 ? 88  ILE A HA   5  
ATOM 8409  H HB   . ILE A 1 88  ? -12.735 -1.048  -2.626  1.00 0.00 ? 88  ILE A HB   5  
ATOM 8410  H HG12 . ILE A 1 88  ? -15.182 -1.261  -2.186  1.00 0.00 ? 88  ILE A HG12 5  
ATOM 8411  H HG13 . ILE A 1 88  ? -14.775 0.095   -3.231  1.00 0.00 ? 88  ILE A HG13 5  
ATOM 8412  H HG21 . ILE A 1 88  ? -11.786 -1.209  -4.699  1.00 0.00 ? 88  ILE A HG21 5  
ATOM 8413  H HG22 . ILE A 1 88  ? -13.264 -0.333  -5.090  1.00 0.00 ? 88  ILE A HG22 5  
ATOM 8414  H HG23 . ILE A 1 88  ? -13.163 -2.067  -5.387  1.00 0.00 ? 88  ILE A HG23 5  
ATOM 8415  H HD11 . ILE A 1 88  ? -15.376 -2.344  -4.703  1.00 0.00 ? 88  ILE A HD11 5  
ATOM 8416  H HD12 . ILE A 1 88  ? -15.997 -0.707  -4.911  1.00 0.00 ? 88  ILE A HD12 5  
ATOM 8417  H HD13 . ILE A 1 88  ? -16.714 -1.775  -3.705  1.00 0.00 ? 88  ILE A HD13 5  
ATOM 8418  N N    . PRO A 1 89  ? -12.193 -4.511  -4.619  1.00 0.00 ? 89  PRO A N    5  
ATOM 8419  C CA   . PRO A 1 89  ? -11.033 -5.153  -5.238  1.00 0.00 ? 89  PRO A CA   5  
ATOM 8420  C C    . PRO A 1 89  ? -10.186 -4.163  -6.030  1.00 0.00 ? 89  PRO A C    5  
ATOM 8421  O O    . PRO A 1 89  ? -10.714 -3.347  -6.786  1.00 0.00 ? 89  PRO A O    5  
ATOM 8422  C CB   . PRO A 1 89  ? -11.654 -6.191  -6.171  1.00 0.00 ? 89  PRO A CB   5  
ATOM 8423  C CG   . PRO A 1 89  ? -12.998 -5.639  -6.504  1.00 0.00 ? 89  PRO A CG   5  
ATOM 8424  C CD   . PRO A 1 89  ? -13.457 -4.899  -5.279  1.00 0.00 ? 89  PRO A CD   5  
ATOM 8425  H HA   . PRO A 1 89  ? -10.412 -5.648  -4.504  1.00 0.00 ? 89  PRO A HA   5  
ATOM 8426  H HB2  . PRO A 1 89  ? -11.041 -6.300  -7.055  1.00 0.00 ? 89  PRO A HB2  5  
ATOM 8427  H HB3  . PRO A 1 89  ? -11.734 -7.137  -5.660  1.00 0.00 ? 89  PRO A HB3  5  
ATOM 8428  H HG2  . PRO A 1 89  ? -12.920 -4.964  -7.344  1.00 0.00 ? 89  PRO A HG2  5  
ATOM 8429  H HG3  . PRO A 1 89  ? -13.679 -6.446  -6.734  1.00 0.00 ? 89  PRO A HG3  5  
ATOM 8430  H HD2  . PRO A 1 89  ? -14.031 -4.028  -5.557  1.00 0.00 ? 89  PRO A HD2  5  
ATOM 8431  H HD3  . PRO A 1 89  ? -14.039 -5.550  -4.641  1.00 0.00 ? 89  PRO A HD3  5  
ATOM 8432  N N    . VAL A 1 90  ? -8.872  -4.245  -5.857  1.00 0.00 ? 90  VAL A N    5  
ATOM 8433  C CA   . VAL A 1 90  ? -7.948  -3.363  -6.557  1.00 0.00 ? 90  VAL A CA   5  
ATOM 8434  C C    . VAL A 1 90  ? -6.630  -4.077  -6.838  1.00 0.00 ? 90  VAL A C    5  
ATOM 8435  O O    . VAL A 1 90  ? -6.443  -5.227  -6.445  1.00 0.00 ? 90  VAL A O    5  
ATOM 8436  C CB   . VAL A 1 90  ? -7.655  -2.076  -5.757  1.00 0.00 ? 90  VAL A CB   5  
ATOM 8437  C CG1  . VAL A 1 90  ? -8.934  -1.291  -5.506  1.00 0.00 ? 90  VAL A CG1  5  
ATOM 8438  C CG2  . VAL A 1 90  ? -6.964  -2.406  -4.445  1.00 0.00 ? 90  VAL A CG2  5  
ATOM 8439  H H    . VAL A 1 90  ? -8.513  -4.922  -5.246  1.00 0.00 ? 90  VAL A H    5  
ATOM 8440  H HA   . VAL A 1 90  ? -8.402  -3.084  -7.497  1.00 0.00 ? 90  VAL A HA   5  
ATOM 8441  H HB   . VAL A 1 90  ? -6.991  -1.457  -6.342  1.00 0.00 ? 90  VAL A HB   5  
ATOM 8442  H HG11 . VAL A 1 90  ? -8.738  -0.236  -5.629  1.00 0.00 ? 90  VAL A HG11 5  
ATOM 8443  H HG12 . VAL A 1 90  ? -9.281  -1.478  -4.499  1.00 0.00 ? 90  VAL A HG12 5  
ATOM 8444  H HG13 . VAL A 1 90  ? -9.692  -1.601  -6.212  1.00 0.00 ? 90  VAL A HG13 5  
ATOM 8445  H HG21 . VAL A 1 90  ? -7.571  -3.098  -3.882  1.00 0.00 ? 90  VAL A HG21 5  
ATOM 8446  H HG22 . VAL A 1 90  ? -6.826  -1.500  -3.874  1.00 0.00 ? 90  VAL A HG22 5  
ATOM 8447  H HG23 . VAL A 1 90  ? -6.001  -2.853  -4.648  1.00 0.00 ? 90  VAL A HG23 5  
ATOM 8448  N N    . SER A 1 91  ? -5.723  -3.384  -7.513  1.00 0.00 ? 91  SER A N    5  
ATOM 8449  C CA   . SER A 1 91  ? -4.417  -3.946  -7.841  1.00 0.00 ? 91  SER A CA   5  
ATOM 8450  C C    . SER A 1 91  ? -3.334  -3.315  -6.976  1.00 0.00 ? 91  SER A C    5  
ATOM 8451  O O    . SER A 1 91  ? -3.182  -2.093  -6.953  1.00 0.00 ? 91  SER A O    5  
ATOM 8452  C CB   . SER A 1 91  ? -4.100  -3.726  -9.320  1.00 0.00 ? 91  SER A CB   5  
ATOM 8453  O OG   . SER A 1 91  ? -5.131  -4.238  -10.146 1.00 0.00 ? 91  SER A OG   5  
ATOM 8454  H H    . SER A 1 91  ? -5.938  -2.470  -7.786  1.00 0.00 ? 91  SER A H    5  
ATOM 8455  H HA   . SER A 1 91  ? -4.454  -5.005  -7.640  1.00 0.00 ? 91  SER A HA   5  
ATOM 8456  H HB2  . SER A 1 91  ? -3.994  -2.669  -9.512  1.00 0.00 ? 91  SER A HB2  5  
ATOM 8457  H HB3  . SER A 1 91  ? -3.177  -4.228  -9.567  1.00 0.00 ? 91  SER A HB3  5  
ATOM 8458  H HG   . SER A 1 91  ? -5.173  -3.726  -10.959 1.00 0.00 ? 91  SER A HG   5  
ATOM 8459  N N    . VAL A 1 92  ? -2.576  -4.150  -6.267  1.00 0.00 ? 92  VAL A N    5  
ATOM 8460  C CA   . VAL A 1 92  ? -1.509  -3.652  -5.409  1.00 0.00 ? 92  VAL A CA   5  
ATOM 8461  C C    . VAL A 1 92  ? -0.168  -4.273  -5.775  1.00 0.00 ? 92  VAL A C    5  
ATOM 8462  O O    . VAL A 1 92  ? -0.070  -5.478  -6.002  1.00 0.00 ? 92  VAL A O    5  
ATOM 8463  C CB   . VAL A 1 92  ? -1.801  -3.937  -3.926  1.00 0.00 ? 92  VAL A CB   5  
ATOM 8464  C CG1  . VAL A 1 92  ? -0.655  -3.446  -3.050  1.00 0.00 ? 92  VAL A CG1  5  
ATOM 8465  C CG2  . VAL A 1 92  ? -3.118  -3.304  -3.504  1.00 0.00 ? 92  VAL A CG2  5  
ATOM 8466  H H    . VAL A 1 92  ? -2.732  -5.118  -6.324  1.00 0.00 ? 92  VAL A H    5  
ATOM 8467  H HA   . VAL A 1 92  ? -1.447  -2.581  -5.542  1.00 0.00 ? 92  VAL A HA   5  
ATOM 8468  H HB   . VAL A 1 92  ? -1.885  -5.008  -3.798  1.00 0.00 ? 92  VAL A HB   5  
ATOM 8469  H HG11 . VAL A 1 92  ? 0.288   -3.738  -3.495  1.00 0.00 ? 92  VAL A HG11 5  
ATOM 8470  H HG12 . VAL A 1 92  ? -0.741  -3.889  -2.066  1.00 0.00 ? 92  VAL A HG12 5  
ATOM 8471  H HG13 . VAL A 1 92  ? -0.698  -2.372  -2.967  1.00 0.00 ? 92  VAL A HG13 5  
ATOM 8472  H HG21 . VAL A 1 92  ? -3.936  -3.823  -3.981  1.00 0.00 ? 92  VAL A HG21 5  
ATOM 8473  H HG22 . VAL A 1 92  ? -3.129  -2.265  -3.801  1.00 0.00 ? 92  VAL A HG22 5  
ATOM 8474  H HG23 . VAL A 1 92  ? -3.224  -3.372  -2.432  1.00 0.00 ? 92  VAL A HG23 5  
ATOM 8475  N N    . TRP A 1 93  ? 0.867   -3.442  -5.819  1.00 0.00 ? 93  TRP A N    5  
ATOM 8476  C CA   . TRP A 1 93  ? 2.206   -3.913  -6.142  1.00 0.00 ? 93  TRP A CA   5  
ATOM 8477  C C    . TRP A 1 93  ? 3.259   -3.179  -5.320  1.00 0.00 ? 93  TRP A C    5  
ATOM 8478  O O    . TRP A 1 93  ? 3.467   -1.978  -5.483  1.00 0.00 ? 93  TRP A O    5  
ATOM 8479  C CB   . TRP A 1 93  ? 2.514   -3.770  -7.639  1.00 0.00 ? 93  TRP A CB   5  
ATOM 8480  C CG   . TRP A 1 93  ? 1.598   -2.848  -8.391  1.00 0.00 ? 93  TRP A CG   5  
ATOM 8481  C CD1  . TRP A 1 93  ? 0.277   -3.048  -8.674  1.00 0.00 ? 93  TRP A CD1  5  
ATOM 8482  C CD2  . TRP A 1 93  ? 1.946   -1.588  -8.976  1.00 0.00 ? 93  TRP A CD2  5  
ATOM 8483  N NE1  . TRP A 1 93  ? -0.220  -1.985  -9.389  1.00 0.00 ? 93  TRP A NE1  5  
ATOM 8484  C CE2  . TRP A 1 93  ? 0.786   -1.076  -9.588  1.00 0.00 ? 93  TRP A CE2  5  
ATOM 8485  C CE3  . TRP A 1 93  ? 3.125   -0.840  -9.038  1.00 0.00 ? 93  TRP A CE3  5  
ATOM 8486  C CZ2  . TRP A 1 93  ? 0.774   0.146   -10.256 1.00 0.00 ? 93  TRP A CZ2  5  
ATOM 8487  C CZ3  . TRP A 1 93  ? 3.111   0.373   -9.700  1.00 0.00 ? 93  TRP A CZ3  5  
ATOM 8488  C CH2  . TRP A 1 93  ? 1.943   0.855   -10.301 1.00 0.00 ? 93  TRP A CH2  5  
ATOM 8489  H H    . TRP A 1 93  ? 0.717   -2.494  -5.618  1.00 0.00 ? 93  TRP A H    5  
ATOM 8490  H HA   . TRP A 1 93  ? 2.246   -4.960  -5.880  1.00 0.00 ? 93  TRP A HA   5  
ATOM 8491  H HB2  . TRP A 1 93  ? 3.520   -3.396  -7.753  1.00 0.00 ? 93  TRP A HB2  5  
ATOM 8492  H HB3  . TRP A 1 93  ? 2.452   -4.747  -8.101  1.00 0.00 ? 93  TRP A HB3  5  
ATOM 8493  H HD1  . TRP A 1 93  ? -0.286  -3.918  -8.369  1.00 0.00 ? 93  TRP A HD1  5  
ATOM 8494  H HE1  . TRP A 1 93  ? -1.143  -1.894  -9.706  1.00 0.00 ? 93  TRP A HE1  5  
ATOM 8495  H HE3  . TRP A 1 93  ? 4.037   -1.195  -8.580  1.00 0.00 ? 93  TRP A HE3  5  
ATOM 8496  H HZ2  . TRP A 1 93  ? -0.119  0.532   -10.724 1.00 0.00 ? 93  TRP A HZ2  5  
ATOM 8497  H HZ3  . TRP A 1 93  ? 4.011   0.963   -9.757  1.00 0.00 ? 93  TRP A HZ3  5  
ATOM 8498  H HH2  . TRP A 1 93  ? 1.978   1.808   -10.807 1.00 0.00 ? 93  TRP A HH2  5  
ATOM 8499  N N    . MET A 1 94  ? 3.921   -3.921  -4.437  1.00 0.00 ? 94  MET A N    5  
ATOM 8500  C CA   . MET A 1 94  ? 4.959   -3.357  -3.584  1.00 0.00 ? 94  MET A CA   5  
ATOM 8501  C C    . MET A 1 94  ? 6.340   -3.630  -4.171  1.00 0.00 ? 94  MET A C    5  
ATOM 8502  O O    . MET A 1 94  ? 6.609   -4.725  -4.665  1.00 0.00 ? 94  MET A O    5  
ATOM 8503  C CB   . MET A 1 94  ? 4.868   -3.952  -2.176  1.00 0.00 ? 94  MET A CB   5  
ATOM 8504  C CG   . MET A 1 94  ? 5.443   -3.055  -1.092  1.00 0.00 ? 94  MET A CG   5  
ATOM 8505  S SD   . MET A 1 94  ? 5.228   -3.738  0.563   1.00 0.00 ? 94  MET A SD   5  
ATOM 8506  C CE   . MET A 1 94  ? 5.199   -2.244  1.550   1.00 0.00 ? 94  MET A CE   5  
ATOM 8507  H H    . MET A 1 94  ? 3.704   -4.873  -4.359  1.00 0.00 ? 94  MET A H    5  
ATOM 8508  H HA   . MET A 1 94  ? 4.805   -2.291  -3.527  1.00 0.00 ? 94  MET A HA   5  
ATOM 8509  H HB2  . MET A 1 94  ? 3.829   -4.140  -1.944  1.00 0.00 ? 94  MET A HB2  5  
ATOM 8510  H HB3  . MET A 1 94  ? 5.404   -4.889  -2.159  1.00 0.00 ? 94  MET A HB3  5  
ATOM 8511  H HG2  . MET A 1 94  ? 6.499   -2.921  -1.278  1.00 0.00 ? 94  MET A HG2  5  
ATOM 8512  H HG3  . MET A 1 94  ? 4.946   -2.095  -1.139  1.00 0.00 ? 94  MET A HG3  5  
ATOM 8513  H HE1  . MET A 1 94  ? 4.199   -2.077  1.925   1.00 0.00 ? 94  MET A HE1  5  
ATOM 8514  H HE2  . MET A 1 94  ? 5.500   -1.404  0.941   1.00 0.00 ? 94  MET A HE2  5  
ATOM 8515  H HE3  . MET A 1 94  ? 5.881   -2.347  2.382   1.00 0.00 ? 94  MET A HE3  5  
ATOM 8516  N N    . LYS A 1 95  ? 7.210   -2.627  -4.118  1.00 0.00 ? 95  LYS A N    5  
ATOM 8517  C CA   . LYS A 1 95  ? 8.562   -2.764  -4.652  1.00 0.00 ? 95  LYS A CA   5  
ATOM 8518  C C    . LYS A 1 95  ? 9.558   -1.934  -3.846  1.00 0.00 ? 95  LYS A C    5  
ATOM 8519  O O    . LYS A 1 95  ? 9.416   -0.717  -3.726  1.00 0.00 ? 95  LYS A O    5  
ATOM 8520  C CB   . LYS A 1 95  ? 8.607   -2.343  -6.124  1.00 0.00 ? 95  LYS A CB   5  
ATOM 8521  C CG   . LYS A 1 95  ? 7.357   -1.613  -6.595  1.00 0.00 ? 95  LYS A CG   5  
ATOM 8522  C CD   . LYS A 1 95  ? 7.319   -1.497  -8.110  1.00 0.00 ? 95  LYS A CD   5  
ATOM 8523  C CE   . LYS A 1 95  ? 6.805   -0.136  -8.552  1.00 0.00 ? 95  LYS A CE   5  
ATOM 8524  N NZ   . LYS A 1 95  ? 7.910   0.845   -8.727  1.00 0.00 ? 95  LYS A NZ   5  
ATOM 8525  H H    . LYS A 1 95  ? 6.938   -1.776  -3.712  1.00 0.00 ? 95  LYS A H    5  
ATOM 8526  H HA   . LYS A 1 95  ? 8.841   -3.803  -4.577  1.00 0.00 ? 95  LYS A HA   5  
ATOM 8527  H HB2  . LYS A 1 95  ? 9.454   -1.690  -6.275  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 8528  H HB3  . LYS A 1 95  ? 8.732   -3.226  -6.733  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 8529  H HG2  . LYS A 1 95  ? 6.487   -2.160  -6.265  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 8530  H HG3  . LYS A 1 95  ? 7.347   -0.623  -6.165  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 8531  H HD2  . LYS A 1 95  ? 8.316   -1.635  -8.498  1.00 0.00 ? 95  LYS A HD2  5  
ATOM 8532  H HD3  . LYS A 1 95  ? 6.666   -2.264  -8.505  1.00 0.00 ? 95  LYS A HD3  5  
ATOM 8533  H HE2  . LYS A 1 95  ? 6.285   -0.250  -9.491  1.00 0.00 ? 95  LYS A HE2  5  
ATOM 8534  H HE3  . LYS A 1 95  ? 6.119   0.236   -7.806  1.00 0.00 ? 95  LYS A HE3  5  
ATOM 8535  H HZ1  . LYS A 1 95  ? 8.135   0.955   -9.737  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 8536  H HZ2  . LYS A 1 95  ? 8.762   0.518   -8.229  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 8537  H HZ3  . LYS A 1 95  ? 7.631   1.771   -8.344  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 8538  N N    . ARG A 1 96  ? 10.563  -2.605  -3.293  1.00 0.00 ? 96  ARG A N    5  
ATOM 8539  C CA   . ARG A 1 96  ? 11.584  -1.937  -2.494  1.00 0.00 ? 96  ARG A CA   5  
ATOM 8540  C C    . ARG A 1 96  ? 12.543  -1.143  -3.376  1.00 0.00 ? 96  ARG A C    5  
ATOM 8541  O O    . ARG A 1 96  ? 13.464  -1.699  -3.971  1.00 0.00 ? 96  ARG A O    5  
ATOM 8542  C CB   . ARG A 1 96  ? 12.367  -2.958  -1.669  1.00 0.00 ? 96  ARG A CB   5  
ATOM 8543  C CG   . ARG A 1 96  ? 11.492  -3.814  -0.770  1.00 0.00 ? 96  ARG A CG   5  
ATOM 8544  C CD   . ARG A 1 96  ? 11.809  -5.292  -0.927  1.00 0.00 ? 96  ARG A CD   5  
ATOM 8545  N NE   . ARG A 1 96  ? 12.455  -5.843  0.260   1.00 0.00 ? 96  ARG A NE   5  
ATOM 8546  C CZ   . ARG A 1 96  ? 13.548  -6.599  0.223   1.00 0.00 ? 96  ARG A CZ   5  
ATOM 8547  N NH1  . ARG A 1 96  ? 14.121  -6.887  -0.938  1.00 0.00 ? 96  ARG A NH1  5  
ATOM 8548  N NH2  . ARG A 1 96  ? 14.071  -7.066  1.348   1.00 0.00 ? 96  ARG A NH2  5  
ATOM 8549  H H    . ARG A 1 96  ? 10.617  -3.574  -3.423  1.00 0.00 ? 96  ARG A H    5  
ATOM 8550  H HA   . ARG A 1 96  ? 11.084  -1.256  -1.823  1.00 0.00 ? 96  ARG A HA   5  
ATOM 8551  H HB2  . ARG A 1 96  ? 12.902  -3.612  -2.342  1.00 0.00 ? 96  ARG A HB2  5  
ATOM 8552  H HB3  . ARG A 1 96  ? 13.079  -2.433  -1.051  1.00 0.00 ? 96  ARG A HB3  5  
ATOM 8553  H HG2  . ARG A 1 96  ? 11.660  -3.529  0.258   1.00 0.00 ? 96  ARG A HG2  5  
ATOM 8554  H HG3  . ARG A 1 96  ? 10.456  -3.649  -1.028  1.00 0.00 ? 96  ARG A HG3  5  
ATOM 8555  H HD2  . ARG A 1 96  ? 10.890  -5.828  -1.107  1.00 0.00 ? 96  ARG A HD2  5  
ATOM 8556  H HD3  . ARG A 1 96  ? 12.469  -5.416  -1.773  1.00 0.00 ? 96  ARG A HD3  5  
ATOM 8557  H HE   . ARG A 1 96  ? 12.052  -5.642  1.130   1.00 0.00 ? 96  ARG A HE   5  
ATOM 8558  H HH11 . ARG A 1 96  ? 13.731  -6.536  -1.789  1.00 0.00 ? 96  ARG A HH11 5  
ATOM 8559  H HH12 . ARG A 1 96  ? 14.943  -7.456  -0.963  1.00 0.00 ? 96  ARG A HH12 5  
ATOM 8560  H HH21 . ARG A 1 96  ? 13.642  -6.850  2.226   1.00 0.00 ? 96  ARG A HH21 5  
ATOM 8561  H HH22 . ARG A 1 96  ? 14.891  -7.637  1.319   1.00 0.00 ? 96  ARG A HH22 5  
ATOM 8562  N N    . MET A 1 97  ? 12.320  0.165   -3.439  1.00 0.00 ? 97  MET A N    5  
ATOM 8563  C CA   . MET A 1 97  ? 13.163  1.052   -4.231  1.00 0.00 ? 97  MET A CA   5  
ATOM 8564  C C    . MET A 1 97  ? 13.760  2.141   -3.347  1.00 0.00 ? 97  MET A C    5  
ATOM 8565  O O    . MET A 1 97  ? 13.292  2.364   -2.233  1.00 0.00 ? 97  MET A O    5  
ATOM 8566  C CB   . MET A 1 97  ? 12.359  1.680   -5.373  1.00 0.00 ? 97  MET A CB   5  
ATOM 8567  C CG   . MET A 1 97  ? 11.778  3.044   -5.039  1.00 0.00 ? 97  MET A CG   5  
ATOM 8568  S SD   . MET A 1 97  ? 11.076  3.874   -6.478  1.00 0.00 ? 97  MET A SD   5  
ATOM 8569  C CE   . MET A 1 97  ? 9.476   3.077   -6.584  1.00 0.00 ? 97  MET A CE   5  
ATOM 8570  H H    . MET A 1 97  ? 11.573  0.543   -2.932  1.00 0.00 ? 97  MET A H    5  
ATOM 8571  H HA   . MET A 1 97  ? 13.963  0.463   -4.650  1.00 0.00 ? 97  MET A HA   5  
ATOM 8572  H HB2  . MET A 1 97  ? 13.003  1.788   -6.234  1.00 0.00 ? 97  MET A HB2  5  
ATOM 8573  H HB3  . MET A 1 97  ? 11.547  1.015   -5.626  1.00 0.00 ? 97  MET A HB3  5  
ATOM 8574  H HG2  . MET A 1 97  ? 11.000  2.918   -4.299  1.00 0.00 ? 97  MET A HG2  5  
ATOM 8575  H HG3  . MET A 1 97  ? 12.565  3.661   -4.630  1.00 0.00 ? 97  MET A HG3  5  
ATOM 8576  H HE1  . MET A 1 97  ? 9.293   2.770   -7.602  1.00 0.00 ? 97  MET A HE1  5  
ATOM 8577  H HE2  . MET A 1 97  ? 8.708   3.770   -6.274  1.00 0.00 ? 97  MET A HE2  5  
ATOM 8578  H HE3  . MET A 1 97  ? 9.461   2.211   -5.938  1.00 0.00 ? 97  MET A HE3  5  
ATOM 8579  N N    . ARG A 1 98  ? 14.792  2.813   -3.841  1.00 0.00 ? 98  ARG A N    5  
ATOM 8580  C CA   . ARG A 1 98  ? 15.446  3.868   -3.084  1.00 0.00 ? 98  ARG A CA   5  
ATOM 8581  C C    . ARG A 1 98  ? 14.794  5.221   -3.352  1.00 0.00 ? 98  ARG A C    5  
ATOM 8582  O O    . ARG A 1 98  ? 14.997  5.821   -4.408  1.00 0.00 ? 98  ARG A O    5  
ATOM 8583  C CB   . ARG A 1 98  ? 16.929  3.924   -3.448  1.00 0.00 ? 98  ARG A CB   5  
ATOM 8584  C CG   . ARG A 1 98  ? 17.741  2.764   -2.893  1.00 0.00 ? 98  ARG A CG   5  
ATOM 8585  C CD   . ARG A 1 98  ? 17.345  1.437   -3.524  1.00 0.00 ? 98  ARG A CD   5  
ATOM 8586  N NE   . ARG A 1 98  ? 18.217  1.079   -4.641  1.00 0.00 ? 98  ARG A NE   5  
ATOM 8587  C CZ   . ARG A 1 98  ? 17.825  1.081   -5.911  1.00 0.00 ? 98  ARG A CZ   5  
ATOM 8588  N NH1  . ARG A 1 98  ? 16.585  1.425   -6.228  1.00 0.00 ? 98  ARG A NH1  5  
ATOM 8589  N NH2  . ARG A 1 98  ? 18.678  0.737   -6.868  1.00 0.00 ? 98  ARG A NH2  5  
ATOM 8590  H H    . ARG A 1 98  ? 15.135  2.599   -4.732  1.00 0.00 ? 98  ARG A H    5  
ATOM 8591  H HA   . ARG A 1 98  ? 15.349  3.635   -2.035  1.00 0.00 ? 98  ARG A HA   5  
ATOM 8592  H HB2  . ARG A 1 98  ? 17.024  3.919   -4.523  1.00 0.00 ? 98  ARG A HB2  5  
ATOM 8593  H HB3  . ARG A 1 98  ? 17.347  4.843   -3.063  1.00 0.00 ? 98  ARG A HB3  5  
ATOM 8594  H HG2  . ARG A 1 98  ? 18.780  2.943   -3.099  1.00 0.00 ? 98  ARG A HG2  5  
ATOM 8595  H HG3  . ARG A 1 98  ? 17.588  2.704   -1.826  1.00 0.00 ? 98  ARG A HG3  5  
ATOM 8596  H HD2  . ARG A 1 98  ? 17.405  0.665   -2.773  1.00 0.00 ? 98  ARG A HD2  5  
ATOM 8597  H HD3  . ARG A 1 98  ? 16.330  1.512   -3.883  1.00 0.00 ? 98  ARG A HD3  5  
ATOM 8598  H HE   . ARG A 1 98  ? 19.139  0.822   -4.431  1.00 0.00 ? 98  ARG A HE   5  
ATOM 8599  H HH11 . ARG A 1 98  ? 15.940  1.685   -5.511  1.00 0.00 ? 98  ARG A HH11 5  
ATOM 8600  H HH12 . ARG A 1 98  ? 16.294  1.425   -7.186  1.00 0.00 ? 98  ARG A HH12 5  
ATOM 8601  H HH21 . ARG A 1 98  ? 19.615  0.477   -6.635  1.00 0.00 ? 98  ARG A HH21 5  
ATOM 8602  H HH22 . ARG A 1 98  ? 18.383  0.739   -7.825  1.00 0.00 ? 98  ARG A HH22 5  
ATOM 8603  N N    . GLN A 1 99  ? 14.014  5.699   -2.388  1.00 0.00 ? 99  GLN A N    5  
ATOM 8604  C CA   . GLN A 1 99  ? 13.337  6.983   -2.517  1.00 0.00 ? 99  GLN A CA   5  
ATOM 8605  C C    . GLN A 1 99  ? 14.262  8.121   -2.092  1.00 0.00 ? 99  GLN A C    5  
ATOM 8606  O O    . GLN A 1 99  ? 14.070  9.271   -2.486  1.00 0.00 ? 99  GLN A O    5  
ATOM 8607  C CB   . GLN A 1 99  ? 12.060  7.003   -1.673  1.00 0.00 ? 99  GLN A CB   5  
ATOM 8608  C CG   . GLN A 1 99  ? 11.209  8.246   -1.880  1.00 0.00 ? 99  GLN A CG   5  
ATOM 8609  C CD   . GLN A 1 99  ? 10.158  8.066   -2.957  1.00 0.00 ? 99  GLN A CD   5  
ATOM 8610  O OE1  . GLN A 1 99  ? 10.478  7.791   -4.115  1.00 0.00 ? 99  GLN A OE1  5  
ATOM 8611  N NE2  . GLN A 1 99  ? 8.893   8.220   -2.583  1.00 0.00 ? 99  GLN A NE2  5  
ATOM 8612  H H    . GLN A 1 99  ? 13.895  5.175   -1.568  1.00 0.00 ? 99  GLN A H    5  
ATOM 8613  H HA   . GLN A 1 99  ? 13.076  7.116   -3.555  1.00 0.00 ? 99  GLN A HA   5  
ATOM 8614  H HB2  . GLN A 1 99  ? 11.461  6.139   -1.927  1.00 0.00 ? 99  GLN A HB2  5  
ATOM 8615  H HB3  . GLN A 1 99  ? 12.330  6.946   -0.630  1.00 0.00 ? 99  GLN A HB3  5  
ATOM 8616  H HG2  . GLN A 1 99  ? 10.712  8.486   -0.950  1.00 0.00 ? 99  GLN A HG2  5  
ATOM 8617  H HG3  . GLN A 1 99  ? 11.855  9.066   -2.163  1.00 0.00 ? 99  GLN A HG3  5  
ATOM 8618  H HE21 . GLN A 1 99  ? 8.712   8.440   -1.643  1.00 0.00 ? 99  GLN A HE21 5  
ATOM 8619  H HE22 . GLN A 1 99  ? 8.191   8.107   -3.258  1.00 0.00 ? 99  GLN A HE22 5  
ATOM 8620  N N    . GLU A 1 100 ? 15.267  7.785   -1.287  1.00 0.00 ? 100 GLU A N    5  
ATOM 8621  C CA   . GLU A 1 100 ? 16.226  8.772   -0.807  1.00 0.00 ? 100 GLU A CA   5  
ATOM 8622  C C    . GLU A 1 100 ? 17.587  8.129   -0.558  1.00 0.00 ? 100 GLU A C    5  
ATOM 8623  O O    . GLU A 1 100 ? 18.472  8.173   -1.414  1.00 0.00 ? 100 GLU A O    5  
ATOM 8624  C CB   . GLU A 1 100 ? 15.713  9.431   0.474   1.00 0.00 ? 100 GLU A CB   5  
ATOM 8625  C CG   . GLU A 1 100 ? 15.425  10.915  0.318   1.00 0.00 ? 100 GLU A CG   5  
ATOM 8626  C CD   . GLU A 1 100 ? 13.955  11.245  0.501   1.00 0.00 ? 100 GLU A CD   5  
ATOM 8627  O OE1  . GLU A 1 100 ? 13.492  11.276  1.659   1.00 0.00 ? 100 GLU A OE1  5  
ATOM 8628  O OE2  . GLU A 1 100 ? 13.268  11.472  -0.518  1.00 0.00 ? 100 GLU A OE2  5  
ATOM 8629  H H    . GLU A 1 100 ? 15.365  6.852   -1.012  1.00 0.00 ? 100 GLU A H    5  
ATOM 8630  H HA   . GLU A 1 100 ? 16.334  9.527   -1.571  1.00 0.00 ? 100 GLU A HA   5  
ATOM 8631  H HB2  . GLU A 1 100 ? 14.802  8.939   0.780   1.00 0.00 ? 100 GLU A HB2  5  
ATOM 8632  H HB3  . GLU A 1 100 ? 16.455  9.309   1.249   1.00 0.00 ? 100 GLU A HB3  5  
ATOM 8633  H HG2  . GLU A 1 100 ? 15.993  11.460  1.057   1.00 0.00 ? 100 GLU A HG2  5  
ATOM 8634  H HG3  . GLU A 1 100 ? 15.729  11.226  -0.670  1.00 0.00 ? 100 GLU A HG3  5  
ATOM 8635  N N    . ARG A 1 101 ? 17.749  7.530   0.618   1.00 0.00 ? 101 ARG A N    5  
ATOM 8636  C CA   . ARG A 1 101 ? 19.002  6.874   0.978   1.00 0.00 ? 101 ARG A CA   5  
ATOM 8637  C C    . ARG A 1 101 ? 18.732  5.540   1.664   1.00 0.00 ? 101 ARG A C    5  
ATOM 8638  O O    . ARG A 1 101 ? 19.661  4.823   2.039   1.00 0.00 ? 101 ARG A O    5  
ATOM 8639  C CB   . ARG A 1 101 ? 19.827  7.773   1.902   1.00 0.00 ? 101 ARG A CB   5  
ATOM 8640  C CG   . ARG A 1 101 ? 20.420  8.984   1.199   1.00 0.00 ? 101 ARG A CG   5  
ATOM 8641  C CD   . ARG A 1 101 ? 21.315  9.784   2.131   1.00 0.00 ? 101 ARG A CD   5  
ATOM 8642  N NE   . ARG A 1 101 ? 20.542  10.589  3.074   1.00 0.00 ? 101 ARG A NE   5  
ATOM 8643  C CZ   . ARG A 1 101 ? 21.080  11.496  3.887   1.00 0.00 ? 101 ARG A CZ   5  
ATOM 8644  N NH1  . ARG A 1 101 ? 22.390  11.714  3.872   1.00 0.00 ? 101 ARG A NH1  5  
ATOM 8645  N NH2  . ARG A 1 101 ? 20.308  12.186  4.715   1.00 0.00 ? 101 ARG A NH2  5  
ATOM 8646  H H    . ARG A 1 101 ? 17.007  7.525   1.259   1.00 0.00 ? 101 ARG A H    5  
ATOM 8647  H HA   . ARG A 1 101 ? 19.557  6.694   0.071   1.00 0.00 ? 101 ARG A HA   5  
ATOM 8648  H HB2  . ARG A 1 101 ? 19.195  8.123   2.705   1.00 0.00 ? 101 ARG A HB2  5  
ATOM 8649  H HB3  . ARG A 1 101 ? 20.637  7.195   2.319   1.00 0.00 ? 101 ARG A HB3  5  
ATOM 8650  H HG2  . ARG A 1 101 ? 21.006  8.648   0.356   1.00 0.00 ? 101 ARG A HG2  5  
ATOM 8651  H HG3  . ARG A 1 101 ? 19.617  9.616   0.853   1.00 0.00 ? 101 ARG A HG3  5  
ATOM 8652  H HD2  . ARG A 1 101 ? 21.940  9.099   2.686   1.00 0.00 ? 101 ARG A HD2  5  
ATOM 8653  H HD3  . ARG A 1 101 ? 21.937  10.438  1.540   1.00 0.00 ? 101 ARG A HD3  5  
ATOM 8654  H HE   . ARG A 1 101 ? 19.573  10.447  3.104   1.00 0.00 ? 101 ARG A HE   5  
ATOM 8655  H HH11 . ARG A 1 101 ? 22.975  11.197  3.249   1.00 0.00 ? 101 ARG A HH11 5  
ATOM 8656  H HH12 . ARG A 1 101 ? 22.789  12.396  4.484   1.00 0.00 ? 101 ARG A HH12 5  
ATOM 8657  H HH21 . ARG A 1 101 ? 19.322  12.025  4.730   1.00 0.00 ? 101 ARG A HH21 5  
ATOM 8658  H HH22 . ARG A 1 101 ? 20.713  12.866  5.325   1.00 0.00 ? 101 ARG A HH22 5  
ATOM 8659  N N    . ARG A 1 102 ? 17.453  5.215   1.823   1.00 0.00 ? 102 ARG A N    5  
ATOM 8660  C CA   . ARG A 1 102 ? 17.051  3.967   2.466   1.00 0.00 ? 102 ARG A CA   5  
ATOM 8661  C C    . ARG A 1 102 ? 16.068  3.202   1.587   1.00 0.00 ? 102 ARG A C    5  
ATOM 8662  O O    . ARG A 1 102 ? 15.206  3.800   0.943   1.00 0.00 ? 102 ARG A O    5  
ATOM 8663  C CB   . ARG A 1 102 ? 16.418  4.258   3.831   1.00 0.00 ? 102 ARG A CB   5  
ATOM 8664  C CG   . ARG A 1 102 ? 15.629  3.090   4.409   1.00 0.00 ? 102 ARG A CG   5  
ATOM 8665  C CD   . ARG A 1 102 ? 14.310  3.546   5.026   1.00 0.00 ? 102 ARG A CD   5  
ATOM 8666  N NE   . ARG A 1 102 ? 14.225  5.000   5.143   1.00 0.00 ? 102 ARG A NE   5  
ATOM 8667  C CZ   . ARG A 1 102 ? 14.286  5.651   6.302   1.00 0.00 ? 102 ARG A CZ   5  
ATOM 8668  N NH1  . ARG A 1 102 ? 14.422  4.980   7.438   1.00 0.00 ? 102 ARG A NH1  5  
ATOM 8669  N NH2  . ARG A 1 102 ? 14.207  6.974   6.324   1.00 0.00 ? 102 ARG A NH2  5  
ATOM 8670  H H    . ARG A 1 102 ? 16.762  5.831   1.503   1.00 0.00 ? 102 ARG A H    5  
ATOM 8671  H HA   . ARG A 1 102 ? 17.936  3.366   2.608   1.00 0.00 ? 102 ARG A HA   5  
ATOM 8672  H HB2  . ARG A 1 102 ? 17.202  4.512   4.530   1.00 0.00 ? 102 ARG A HB2  5  
ATOM 8673  H HB3  . ARG A 1 102 ? 15.750  5.100   3.732   1.00 0.00 ? 102 ARG A HB3  5  
ATOM 8674  H HG2  . ARG A 1 102 ? 15.418  2.385   3.620   1.00 0.00 ? 102 ARG A HG2  5  
ATOM 8675  H HG3  . ARG A 1 102 ? 16.223  2.610   5.173   1.00 0.00 ? 102 ARG A HG3  5  
ATOM 8676  H HD2  . ARG A 1 102 ? 13.498  3.198   4.404   1.00 0.00 ? 102 ARG A HD2  5  
ATOM 8677  H HD3  . ARG A 1 102 ? 14.219  3.110   6.010   1.00 0.00 ? 102 ARG A HD3  5  
ATOM 8678  H HE   . ARG A 1 102 ? 14.121  5.517   4.318   1.00 0.00 ? 102 ARG A HE   5  
ATOM 8679  H HH11 . ARG A 1 102 ? 14.481  3.981   7.427   1.00 0.00 ? 102 ARG A HH11 5  
ATOM 8680  H HH12 . ARG A 1 102 ? 14.465  5.474   8.307   1.00 0.00 ? 102 ARG A HH12 5  
ATOM 8681  H HH21 . ARG A 1 102 ? 14.102  7.483   5.471   1.00 0.00 ? 102 ARG A HH21 5  
ATOM 8682  H HH22 . ARG A 1 102 ? 14.250  7.463   7.195   1.00 0.00 ? 102 ARG A HH22 5  
ATOM 8683  N N    . LEU A 1 103 ? 16.198  1.877   1.573   1.00 0.00 ? 103 LEU A N    5  
ATOM 8684  C CA   . LEU A 1 103 ? 15.309  1.034   0.781   1.00 0.00 ? 103 LEU A CA   5  
ATOM 8685  C C    . LEU A 1 103 ? 13.861  1.282   1.178   1.00 0.00 ? 103 LEU A C    5  
ATOM 8686  O O    . LEU A 1 103 ? 13.375  0.731   2.165   1.00 0.00 ? 103 LEU A O    5  
ATOM 8687  C CB   . LEU A 1 103 ? 15.654  -0.441  0.977   1.00 0.00 ? 103 LEU A CB   5  
ATOM 8688  C CG   . LEU A 1 103 ? 16.127  -1.169  -0.280  1.00 0.00 ? 103 LEU A CG   5  
ATOM 8689  C CD1  . LEU A 1 103 ? 17.638  -1.069  -0.418  1.00 0.00 ? 103 LEU A CD1  5  
ATOM 8690  C CD2  . LEU A 1 103 ? 15.688  -2.625  -0.247  1.00 0.00 ? 103 LEU A CD2  5  
ATOM 8691  H H    . LEU A 1 103 ? 16.899  1.457   2.112   1.00 0.00 ? 103 LEU A H    5  
ATOM 8692  H HA   . LEU A 1 103 ? 15.438  1.295   -0.259  1.00 0.00 ? 103 LEU A HA   5  
ATOM 8693  H HB2  . LEU A 1 103 ? 16.431  -0.508  1.723   1.00 0.00 ? 103 LEU A HB2  5  
ATOM 8694  H HB3  . LEU A 1 103 ? 14.776  -0.947  1.350   1.00 0.00 ? 103 LEU A HB3  5  
ATOM 8695  H HG   . LEU A 1 103 ? 15.682  -0.704  -1.147  1.00 0.00 ? 103 LEU A HG   5  
ATOM 8696  H HD11 . LEU A 1 103 ? 17.932  -0.030  -0.389  1.00 0.00 ? 103 LEU A HD11 5  
ATOM 8697  H HD12 . LEU A 1 103 ? 17.942  -1.503  -1.358  1.00 0.00 ? 103 LEU A HD12 5  
ATOM 8698  H HD13 . LEU A 1 103 ? 18.110  -1.600  0.394   1.00 0.00 ? 103 LEU A HD13 5  
ATOM 8699  H HD21 . LEU A 1 103 ? 16.436  -3.215  0.262   1.00 0.00 ? 103 LEU A HD21 5  
ATOM 8700  H HD22 . LEU A 1 103 ? 15.568  -2.988  -1.256  1.00 0.00 ? 103 LEU A HD22 5  
ATOM 8701  H HD23 . LEU A 1 103 ? 14.748  -2.704  0.280   1.00 0.00 ? 103 LEU A HD23 5  
ATOM 8702  N N    . CYS A 1 104 ? 13.182  2.127   0.414   1.00 0.00 ? 104 CYS A N    5  
ATOM 8703  C CA   . CYS A 1 104 ? 11.794  2.463   0.695   1.00 0.00 ? 104 CYS A CA   5  
ATOM 8704  C C    . CYS A 1 104 ? 10.835  1.605   -0.121  1.00 0.00 ? 104 CYS A C    5  
ATOM 8705  O O    . CYS A 1 104 ? 10.913  1.557   -1.348  1.00 0.00 ? 104 CYS A O    5  
ATOM 8706  C CB   . CYS A 1 104 ? 11.540  3.943   0.402   1.00 0.00 ? 104 CYS A CB   5  
ATOM 8707  S SG   . CYS A 1 104 ? 12.282  5.070   1.605   1.00 0.00 ? 104 CYS A SG   5  
ATOM 8708  H H    . CYS A 1 104 ? 13.628  2.542   -0.353  1.00 0.00 ? 104 CYS A H    5  
ATOM 8709  H HA   . CYS A 1 104 ? 11.616  2.281   1.744   1.00 0.00 ? 104 CYS A HA   5  
ATOM 8710  H HB2  . CYS A 1 104 ? 11.946  4.185   -0.568  1.00 0.00 ? 104 CYS A HB2  5  
ATOM 8711  H HB3  . CYS A 1 104 ? 10.475  4.123   0.394   1.00 0.00 ? 104 CYS A HB3  5  
ATOM 8712  H HG   . CYS A 1 104 ? 13.493  5.390   1.171   1.00 0.00 ? 104 CYS A HG   5  
ATOM 8713  N N    . CYS A 1 105 ? 9.916   0.945   0.574   1.00 0.00 ? 105 CYS A N    5  
ATOM 8714  C CA   . CYS A 1 105 ? 8.921   0.103   -0.072  1.00 0.00 ? 105 CYS A CA   5  
ATOM 8715  C C    . CYS A 1 105 ? 7.786   0.965   -0.619  1.00 0.00 ? 105 CYS A C    5  
ATOM 8716  O O    . CYS A 1 105 ? 7.187   1.752   0.114   1.00 0.00 ? 105 CYS A O    5  
ATOM 8717  C CB   . CYS A 1 105 ? 8.367   -0.916  0.926   1.00 0.00 ? 105 CYS A CB   5  
ATOM 8718  S SG   . CYS A 1 105 ? 8.424   -2.628  0.346   1.00 0.00 ? 105 CYS A SG   5  
ATOM 8719  H H    . CYS A 1 105 ? 9.898   1.039   1.550   1.00 0.00 ? 105 CYS A H    5  
ATOM 8720  H HA   . CYS A 1 105 ? 9.396   -0.419  -0.889  1.00 0.00 ? 105 CYS A HA   5  
ATOM 8721  H HB2  . CYS A 1 105 ? 8.943   -0.862  1.839   1.00 0.00 ? 105 CYS A HB2  5  
ATOM 8722  H HB3  . CYS A 1 105 ? 7.335   -0.673  1.144   1.00 0.00 ? 105 CYS A HB3  5  
ATOM 8723  H HG   . CYS A 1 105 ? 9.114   -2.655  -0.784  1.00 0.00 ? 105 CYS A HG   5  
ATOM 8724  N N    . VAL A 1 106 ? 7.497   0.818   -1.905  1.00 0.00 ? 106 VAL A N    5  
ATOM 8725  C CA   . VAL A 1 106 ? 6.435   1.593   -2.537  1.00 0.00 ? 106 VAL A CA   5  
ATOM 8726  C C    . VAL A 1 106 ? 5.256   0.707   -2.916  1.00 0.00 ? 106 VAL A C    5  
ATOM 8727  O O    . VAL A 1 106 ? 5.426   -0.341  -3.538  1.00 0.00 ? 106 VAL A O    5  
ATOM 8728  C CB   . VAL A 1 106 ? 6.945   2.328   -3.793  1.00 0.00 ? 106 VAL A CB   5  
ATOM 8729  C CG1  . VAL A 1 106 ? 5.795   3.011   -4.523  1.00 0.00 ? 106 VAL A CG1  5  
ATOM 8730  C CG2  . VAL A 1 106 ? 8.019   3.337   -3.419  1.00 0.00 ? 106 VAL A CG2  5  
ATOM 8731  H H    . VAL A 1 106 ? 8.002   0.175   -2.442  1.00 0.00 ? 106 VAL A H    5  
ATOM 8732  H HA   . VAL A 1 106 ? 6.100   2.334   -1.826  1.00 0.00 ? 106 VAL A HA   5  
ATOM 8733  H HB   . VAL A 1 106 ? 7.382   1.599   -4.459  1.00 0.00 ? 106 VAL A HB   5  
ATOM 8734  H HG11 . VAL A 1 106 ? 5.464   3.866   -3.951  1.00 0.00 ? 106 VAL A HG11 5  
ATOM 8735  H HG12 . VAL A 1 106 ? 4.976   2.316   -4.634  1.00 0.00 ? 106 VAL A HG12 5  
ATOM 8736  H HG13 . VAL A 1 106 ? 6.128   3.335   -5.497  1.00 0.00 ? 106 VAL A HG13 5  
ATOM 8737  H HG21 . VAL A 1 106 ? 8.849   2.824   -2.957  1.00 0.00 ? 106 VAL A HG21 5  
ATOM 8738  H HG22 . VAL A 1 106 ? 7.610   4.058   -2.724  1.00 0.00 ? 106 VAL A HG22 5  
ATOM 8739  H HG23 . VAL A 1 106 ? 8.360   3.847   -4.307  1.00 0.00 ? 106 VAL A HG23 5  
ATOM 8740  N N    . VAL A 1 107 ? 4.058   1.144   -2.542  1.00 0.00 ? 107 VAL A N    5  
ATOM 8741  C CA   . VAL A 1 107 ? 2.839   0.408   -2.842  1.00 0.00 ? 107 VAL A CA   5  
ATOM 8742  C C    . VAL A 1 107 ? 1.901   1.267   -3.687  1.00 0.00 ? 107 VAL A C    5  
ATOM 8743  O O    . VAL A 1 107 ? 1.475   2.340   -3.261  1.00 0.00 ? 107 VAL A O    5  
ATOM 8744  C CB   . VAL A 1 107 ? 2.127   -0.043  -1.539  1.00 0.00 ? 107 VAL A CB   5  
ATOM 8745  C CG1  . VAL A 1 107 ? 0.619   0.151   -1.619  1.00 0.00 ? 107 VAL A CG1  5  
ATOM 8746  C CG2  . VAL A 1 107 ? 2.460   -1.492  -1.228  1.00 0.00 ? 107 VAL A CG2  5  
ATOM 8747  H H    . VAL A 1 107 ? 3.989   1.992   -2.057  1.00 0.00 ? 107 VAL A H    5  
ATOM 8748  H HA   . VAL A 1 107 ? 3.110   -0.475  -3.406  1.00 0.00 ? 107 VAL A HA   5  
ATOM 8749  H HB   . VAL A 1 107 ? 2.498   0.565   -0.727  1.00 0.00 ? 107 VAL A HB   5  
ATOM 8750  H HG11 . VAL A 1 107 ? 0.255   -0.240  -2.558  1.00 0.00 ? 107 VAL A HG11 5  
ATOM 8751  H HG12 . VAL A 1 107 ? 0.386   1.203   -1.552  1.00 0.00 ? 107 VAL A HG12 5  
ATOM 8752  H HG13 . VAL A 1 107 ? 0.146   -0.375  -0.802  1.00 0.00 ? 107 VAL A HG13 5  
ATOM 8753  H HG21 . VAL A 1 107 ? 2.662   -1.597  -0.173  1.00 0.00 ? 107 VAL A HG21 5  
ATOM 8754  H HG22 . VAL A 1 107 ? 3.331   -1.791  -1.793  1.00 0.00 ? 107 VAL A HG22 5  
ATOM 8755  H HG23 . VAL A 1 107 ? 1.624   -2.119  -1.498  1.00 0.00 ? 107 VAL A HG23 5  
ATOM 8756  N N    . VAL A 1 108 ? 1.591   0.795   -4.888  1.00 0.00 ? 108 VAL A N    5  
ATOM 8757  C CA   . VAL A 1 108 ? 0.710   1.531   -5.785  1.00 0.00 ? 108 VAL A CA   5  
ATOM 8758  C C    . VAL A 1 108 ? -0.587  0.771   -6.026  1.00 0.00 ? 108 VAL A C    5  
ATOM 8759  O O    . VAL A 1 108 ? -0.592  -0.289  -6.655  1.00 0.00 ? 108 VAL A O    5  
ATOM 8760  C CB   . VAL A 1 108 ? 1.387   1.822   -7.136  1.00 0.00 ? 108 VAL A CB   5  
ATOM 8761  C CG1  . VAL A 1 108 ? 0.632   2.910   -7.885  1.00 0.00 ? 108 VAL A CG1  5  
ATOM 8762  C CG2  . VAL A 1 108 ? 2.842   2.216   -6.932  1.00 0.00 ? 108 VAL A CG2  5  
ATOM 8763  H H    . VAL A 1 108 ? 1.965   -0.063  -5.179  1.00 0.00 ? 108 VAL A H    5  
ATOM 8764  H HA   . VAL A 1 108 ? 0.475   2.476   -5.315  1.00 0.00 ? 108 VAL A HA   5  
ATOM 8765  H HB   . VAL A 1 108 ? 1.361   0.922   -7.733  1.00 0.00 ? 108 VAL A HB   5  
ATOM 8766  H HG11 . VAL A 1 108 ? 0.398   2.566   -8.881  1.00 0.00 ? 108 VAL A HG11 5  
ATOM 8767  H HG12 . VAL A 1 108 ? 1.246   3.797   -7.946  1.00 0.00 ? 108 VAL A HG12 5  
ATOM 8768  H HG13 . VAL A 1 108 ? -0.283  3.142   -7.360  1.00 0.00 ? 108 VAL A HG13 5  
ATOM 8769  H HG21 . VAL A 1 108 ? 3.007   2.458   -5.894  1.00 0.00 ? 108 VAL A HG21 5  
ATOM 8770  H HG22 . VAL A 1 108 ? 3.071   3.075   -7.545  1.00 0.00 ? 108 VAL A HG22 5  
ATOM 8771  H HG23 . VAL A 1 108 ? 3.480   1.391   -7.215  1.00 0.00 ? 108 VAL A HG23 5  
ATOM 8772  N N    . LEU A 1 109 ? -1.683  1.321   -5.518  1.00 0.00 ? 109 LEU A N    5  
ATOM 8773  C CA   . LEU A 1 109 ? -2.992  0.700   -5.670  1.00 0.00 ? 109 LEU A CA   5  
ATOM 8774  C C    . LEU A 1 109 ? -3.680  1.185   -6.938  1.00 0.00 ? 109 LEU A C    5  
ATOM 8775  O O    . LEU A 1 109 ? -3.369  2.258   -7.454  1.00 0.00 ? 109 LEU A O    5  
ATOM 8776  C CB   . LEU A 1 109 ? -3.866  1.012   -4.455  1.00 0.00 ? 109 LEU A CB   5  
ATOM 8777  C CG   . LEU A 1 109 ? -3.099  1.250   -3.157  1.00 0.00 ? 109 LEU A CG   5  
ATOM 8778  C CD1  . LEU A 1 109 ? -3.960  1.999   -2.157  1.00 0.00 ? 109 LEU A CD1  5  
ATOM 8779  C CD2  . LEU A 1 109 ? -2.625  -0.072  -2.575  1.00 0.00 ? 109 LEU A CD2  5  
ATOM 8780  H H    . LEU A 1 109 ? -1.609  2.166   -5.026  1.00 0.00 ? 109 LEU A H    5  
ATOM 8781  H HA   . LEU A 1 109 ? -2.849  -0.368  -5.734  1.00 0.00 ? 109 LEU A HA   5  
ATOM 8782  H HB2  . LEU A 1 109 ? -4.447  1.896   -4.674  1.00 0.00 ? 109 LEU A HB2  5  
ATOM 8783  H HB3  . LEU A 1 109 ? -4.543  0.185   -4.302  1.00 0.00 ? 109 LEU A HB3  5  
ATOM 8784  H HG   . LEU A 1 109 ? -2.227  1.855   -3.367  1.00 0.00 ? 109 LEU A HG   5  
ATOM 8785  H HD11 . LEU A 1 109 ? -4.331  2.907   -2.608  1.00 0.00 ? 109 LEU A HD11 5  
ATOM 8786  H HD12 . LEU A 1 109 ? -3.370  2.243   -1.286  1.00 0.00 ? 109 LEU A HD12 5  
ATOM 8787  H HD13 . LEU A 1 109 ? -4.793  1.377   -1.863  1.00 0.00 ? 109 LEU A HD13 5  
ATOM 8788  H HD21 . LEU A 1 109 ? -1.865  0.114   -1.831  1.00 0.00 ? 109 LEU A HD21 5  
ATOM 8789  H HD22 . LEU A 1 109 ? -2.214  -0.686  -3.364  1.00 0.00 ? 109 LEU A HD22 5  
ATOM 8790  H HD23 . LEU A 1 109 ? -3.459  -0.583  -2.119  1.00 0.00 ? 109 LEU A HD23 5  
ATOM 8791  N N    . GLU A 1 110 ? -4.615  0.385   -7.435  1.00 0.00 ? 110 GLU A N    5  
ATOM 8792  C CA   . GLU A 1 110 ? -5.352  0.733   -8.643  1.00 0.00 ? 110 GLU A CA   5  
ATOM 8793  C C    . GLU A 1 110 ? -6.758  0.143   -8.606  1.00 0.00 ? 110 GLU A C    5  
ATOM 8794  O O    . GLU A 1 110 ? -6.928  -1.075  -8.621  1.00 0.00 ? 110 GLU A O    5  
ATOM 8795  C CB   . GLU A 1 110 ? -4.605  0.232   -9.881  1.00 0.00 ? 110 GLU A CB   5  
ATOM 8796  C CG   . GLU A 1 110 ? -4.785  1.120   -11.101 1.00 0.00 ? 110 GLU A CG   5  
ATOM 8797  C CD   . GLU A 1 110 ? -5.959  0.695   -11.964 1.00 0.00 ? 110 GLU A CD   5  
ATOM 8798  O OE1  . GLU A 1 110 ? -6.445  -0.442  -11.791 1.00 0.00 ? 110 GLU A OE1  5  
ATOM 8799  O OE2  . GLU A 1 110 ? -6.393  1.503   -12.814 1.00 0.00 ? 110 GLU A OE2  5  
ATOM 8800  H H    . GLU A 1 110 ? -4.818  -0.458  -6.978  1.00 0.00 ? 110 GLU A H    5  
ATOM 8801  H HA   . GLU A 1 110 ? -5.427  1.808   -8.687  1.00 0.00 ? 110 GLU A HA   5  
ATOM 8802  H HB2  . GLU A 1 110 ? -3.549  0.181   -9.654  1.00 0.00 ? 110 GLU A HB2  5  
ATOM 8803  H HB3  . GLU A 1 110 ? -4.960  -0.758  -10.126 1.00 0.00 ? 110 GLU A HB3  5  
ATOM 8804  H HG2  . GLU A 1 110 ? -4.951  2.135   -10.772 1.00 0.00 ? 110 GLU A HG2  5  
ATOM 8805  H HG3  . GLU A 1 110 ? -3.886  1.078   -11.696 1.00 0.00 ? 110 GLU A HG3  5  
ATOM 8806  N N    . PRO A 1 111 ? -7.789  1.004   -8.568  1.00 0.00 ? 111 PRO A N    5  
ATOM 8807  C CA   . PRO A 1 111 ? -9.182  0.555   -8.536  1.00 0.00 ? 111 PRO A CA   5  
ATOM 8808  C C    . PRO A 1 111 ? -9.536  -0.252  -9.781  1.00 0.00 ? 111 PRO A C    5  
ATOM 8809  O O    . PRO A 1 111 ? -9.275  0.184   -10.904 1.00 0.00 ? 111 PRO A O    5  
ATOM 8810  C CB   . PRO A 1 111 ? -9.988  1.858   -8.493  1.00 0.00 ? 111 PRO A CB   5  
ATOM 8811  C CG   . PRO A 1 111 ? -9.054  2.914   -8.977  1.00 0.00 ? 111 PRO A CG   5  
ATOM 8812  C CD   . PRO A 1 111 ? -7.680  2.471   -8.559  1.00 0.00 ? 111 PRO A CD   5  
ATOM 8813  H HA   . PRO A 1 111 ? -9.388  -0.031  -7.649  1.00 0.00 ? 111 PRO A HA   5  
ATOM 8814  H HB2  . PRO A 1 111 ? -10.851 1.772   -9.139  1.00 0.00 ? 111 PRO A HB2  5  
ATOM 8815  H HB3  . PRO A 1 111 ? -10.310 2.051   -7.481  1.00 0.00 ? 111 PRO A HB3  5  
ATOM 8816  H HG2  . PRO A 1 111 ? -9.110  2.993   -10.052 1.00 0.00 ? 111 PRO A HG2  5  
ATOM 8817  H HG3  . PRO A 1 111 ? -9.297  3.860   -8.516  1.00 0.00 ? 111 PRO A HG3  5  
ATOM 8818  H HD2  . PRO A 1 111 ? -6.940  2.809   -9.272  1.00 0.00 ? 111 PRO A HD2  5  
ATOM 8819  H HD3  . PRO A 1 111 ? -7.446  2.836   -7.570  1.00 0.00 ? 111 PRO A HD3  5  
ATOM 8820  N N    . VAL A 1 112 ? -10.130 -1.426  -9.587  1.00 0.00 ? 112 VAL A N    5  
ATOM 8821  C CA   . VAL A 1 112 ? -10.509 -2.277  -10.710 1.00 0.00 ? 112 VAL A CA   5  
ATOM 8822  C C    . VAL A 1 112 ? -11.658 -1.656  -11.500 1.00 0.00 ? 112 VAL A C    5  
ATOM 8823  O O    . VAL A 1 112 ? -12.469 -0.910  -10.951 1.00 0.00 ? 112 VAL A O    5  
ATOM 8824  C CB   . VAL A 1 112 ? -10.922 -3.687  -10.244 1.00 0.00 ? 112 VAL A CB   5  
ATOM 8825  C CG1  . VAL A 1 112 ? -9.778  -4.361  -9.502  1.00 0.00 ? 112 VAL A CG1  5  
ATOM 8826  C CG2  . VAL A 1 112 ? -12.169 -3.623  -9.374  1.00 0.00 ? 112 VAL A CG2  5  
ATOM 8827  H H    . VAL A 1 112 ? -10.320 -1.725  -8.673  1.00 0.00 ? 112 VAL A H    5  
ATOM 8828  H HA   . VAL A 1 112 ? -9.652  -2.372  -11.359 1.00 0.00 ? 112 VAL A HA   5  
ATOM 8829  H HB   . VAL A 1 112 ? -11.151 -4.279  -11.117 1.00 0.00 ? 112 VAL A HB   5  
ATOM 8830  H HG11 . VAL A 1 112 ? -9.675  -5.379  -9.846  1.00 0.00 ? 112 VAL A HG11 5  
ATOM 8831  H HG12 . VAL A 1 112 ? -9.985  -4.361  -8.442  1.00 0.00 ? 112 VAL A HG12 5  
ATOM 8832  H HG13 . VAL A 1 112 ? -8.860  -3.822  -9.689  1.00 0.00 ? 112 VAL A HG13 5  
ATOM 8833  H HG21 . VAL A 1 112 ? -13.044 -3.550  -10.002 1.00 0.00 ? 112 VAL A HG21 5  
ATOM 8834  H HG22 . VAL A 1 112 ? -12.115 -2.758  -8.730  1.00 0.00 ? 112 VAL A HG22 5  
ATOM 8835  H HG23 . VAL A 1 112 ? -12.234 -4.517  -8.770  1.00 0.00 ? 112 VAL A HG23 5  
ATOM 8836  N N    . GLU A 1 113 ? -11.722 -1.970  -12.792 1.00 0.00 ? 113 GLU A N    5  
ATOM 8837  C CA   . GLU A 1 113 ? -12.772 -1.440  -13.656 1.00 0.00 ? 113 GLU A CA   5  
ATOM 8838  C C    . GLU A 1 113 ? -13.581 -2.567  -14.289 1.00 0.00 ? 113 GLU A C    5  
ATOM 8839  O O    . GLU A 1 113 ? -14.252 -2.372  -15.303 1.00 0.00 ? 113 GLU A O    5  
ATOM 8840  C CB   . GLU A 1 113 ? -12.170 -0.553  -14.753 1.00 0.00 ? 113 GLU A CB   5  
ATOM 8841  C CG   . GLU A 1 113 ? -10.667 -0.360  -14.634 1.00 0.00 ? 113 GLU A CG   5  
ATOM 8842  C CD   . GLU A 1 113 ? -10.229 1.046   -14.996 1.00 0.00 ? 113 GLU A CD   5  
ATOM 8843  O OE1  . GLU A 1 113 ? -10.490 1.474   -16.140 1.00 0.00 ? 113 GLU A OE1  5  
ATOM 8844  O OE2  . GLU A 1 113 ? -9.624  1.720   -14.136 1.00 0.00 ? 113 GLU A OE2  5  
ATOM 8845  H H    . GLU A 1 113 ? -11.046 -2.569  -13.172 1.00 0.00 ? 113 GLU A H    5  
ATOM 8846  H HA   . GLU A 1 113 ? -13.431 -0.840  -13.045 1.00 0.00 ? 113 GLU A HA   5  
ATOM 8847  H HB2  . GLU A 1 113 ? -12.377 -1.003  -15.714 1.00 0.00 ? 113 GLU A HB2  5  
ATOM 8848  H HB3  . GLU A 1 113 ? -12.641 0.418   -14.712 1.00 0.00 ? 113 GLU A HB3  5  
ATOM 8849  H HG2  . GLU A 1 113 ? -10.369 -0.561  -13.616 1.00 0.00 ? 113 GLU A HG2  5  
ATOM 8850  H HG3  . GLU A 1 113 ? -10.173 -1.056  -15.297 1.00 0.00 ? 113 GLU A HG3  5  
ATOM 8851  N N    . ARG A 1 114 ? -13.517 -3.750  -13.684 1.00 0.00 ? 114 ARG A N    5  
ATOM 8852  C CA   . ARG A 1 114 ? -14.243 -4.909  -14.190 1.00 0.00 ? 114 ARG A CA   5  
ATOM 8853  C C    . ARG A 1 114 ? -15.511 -5.152  -13.379 1.00 0.00 ? 114 ARG A C    5  
ATOM 8854  O O    . ARG A 1 114 ? -15.402 -5.311  -12.145 1.00 0.00 ? 114 ARG A O    5  
ATOM 8855  C CB   . ARG A 1 114 ? -13.354 -6.152  -14.156 1.00 0.00 ? 114 ARG A CB   5  
ATOM 8856  C CG   . ARG A 1 114 ? -11.945 -5.909  -14.669 1.00 0.00 ? 114 ARG A CG   5  
ATOM 8857  C CD   . ARG A 1 114 ? -11.043 -7.105  -14.416 1.00 0.00 ? 114 ARG A CD   5  
ATOM 8858  N NE   . ARG A 1 114 ? -9.646  -6.812  -14.726 1.00 0.00 ? 114 ARG A NE   5  
ATOM 8859  C CZ   . ARG A 1 114 ? -8.660  -6.902  -13.839 1.00 0.00 ? 114 ARG A CZ   5  
ATOM 8860  N NH1  . ARG A 1 114 ? -8.913  -7.283  -12.594 1.00 0.00 ? 114 ARG A NH1  5  
ATOM 8861  N NH2  . ARG A 1 114 ? -7.417  -6.610  -14.199 1.00 0.00 ? 114 ARG A NH2  5  
ATOM 8862  O OXT  . ARG A 1 114 ? -16.604 -5.180  -13.983 1.00 0.00 ? 114 ARG A OXT  5  
ATOM 8863  H H    . ARG A 1 114 ? -12.965 -3.845  -12.878 1.00 0.00 ? 114 ARG A H    5  
ATOM 8864  H HA   . ARG A 1 114 ? -14.520 -4.703  -15.213 1.00 0.00 ? 114 ARG A HA   5  
ATOM 8865  H HB2  . ARG A 1 114 ? -13.285 -6.504  -13.136 1.00 0.00 ? 114 ARG A HB2  5  
ATOM 8866  H HB3  . ARG A 1 114 ? -13.807 -6.922  -14.761 1.00 0.00 ? 114 ARG A HB3  5  
ATOM 8867  H HG2  . ARG A 1 114 ? -11.988 -5.722  -15.733 1.00 0.00 ? 114 ARG A HG2  5  
ATOM 8868  H HG3  . ARG A 1 114 ? -11.533 -5.046  -14.168 1.00 0.00 ? 114 ARG A HG3  5  
ATOM 8869  H HD2  . ARG A 1 114 ? -11.121 -7.384  -13.376 1.00 0.00 ? 114 ARG A HD2  5  
ATOM 8870  H HD3  . ARG A 1 114 ? -11.375 -7.928  -15.033 1.00 0.00 ? 114 ARG A HD3  5  
ATOM 8871  H HE   . ARG A 1 114 ? -9.435  -6.534  -15.641 1.00 0.00 ? 114 ARG A HE   5  
ATOM 8872  H HH11 . ARG A 1 114 ? -9.849  -7.506  -12.319 1.00 0.00 ? 114 ARG A HH11 5  
ATOM 8873  H HH12 . ARG A 1 114 ? -8.169  -7.348  -11.930 1.00 0.00 ? 114 ARG A HH12 5  
ATOM 8874  H HH21 . ARG A 1 114 ? -7.222  -6.326  -15.136 1.00 0.00 ? 114 ARG A HH21 5  
ATOM 8875  H HH22 . ARG A 1 114 ? -6.675  -6.677  -13.532 1.00 0.00 ? 114 ARG A HH22 5  
ATOM 8876  N N    . GLY A 1 1   ? -1.454  17.859  -17.162 1.00 0.00 ? 1   GLY A N    6  
ATOM 8877  C CA   . GLY A 1 1   ? -2.129  17.589  -15.863 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8878  C C    . GLY A 1 1   ? -3.419  16.810  -16.031 1.00 0.00 ? 1   GLY A C    6  
ATOM 8879  O O    . GLY A 1 1   ? -4.465  17.385  -16.332 1.00 0.00 ? 1   GLY A O    6  
ATOM 8880  H H1   . GLY A 1 1   ? -1.585  18.857  -17.431 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8881  H H2   . GLY A 1 1   ? -1.858  17.255  -17.906 1.00 0.00 ? 1   GLY A H2   6  
ATOM 8882  H H3   . GLY A 1 1   ? -0.436  17.664  -17.083 1.00 0.00 ? 1   GLY A H3   6  
ATOM 8883  H HA2  . GLY A 1 1   ? -1.458  17.022  -15.233 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8884  H HA3  . GLY A 1 1   ? -2.350  18.529  -15.380 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8885  N N    . ALA A 1 2   ? -3.345  15.497  -15.835 1.00 0.00 ? 2   ALA A N    6  
ATOM 8886  C CA   . ALA A 1 2   ? -4.514  14.635  -15.969 1.00 0.00 ? 2   ALA A CA   6  
ATOM 8887  C C    . ALA A 1 2   ? -5.068  14.248  -14.600 1.00 0.00 ? 2   ALA A C    6  
ATOM 8888  O O    . ALA A 1 2   ? -4.716  14.847  -13.585 1.00 0.00 ? 2   ALA A O    6  
ATOM 8889  C CB   . ALA A 1 2   ? -4.163  13.392  -16.773 1.00 0.00 ? 2   ALA A CB   6  
ATOM 8890  H H    . ALA A 1 2   ? -2.483  15.097  -15.598 1.00 0.00 ? 2   ALA A H    6  
ATOM 8891  H HA   . ALA A 1 2   ? -5.273  15.184  -16.509 1.00 0.00 ? 2   ALA A HA   6  
ATOM 8892  H HB1  . ALA A 1 2   ? -3.299  12.914  -16.337 1.00 0.00 ? 2   ALA A HB1  6  
ATOM 8893  H HB2  . ALA A 1 2   ? -3.945  13.674  -17.792 1.00 0.00 ? 2   ALA A HB2  6  
ATOM 8894  H HB3  . ALA A 1 2   ? -4.998  12.707  -16.759 1.00 0.00 ? 2   ALA A HB3  6  
ATOM 8895  N N    . MET A 1 3   ? -5.937  13.240  -14.583 1.00 0.00 ? 3   MET A N    6  
ATOM 8896  C CA   . MET A 1 3   ? -6.540  12.773  -13.339 1.00 0.00 ? 3   MET A CA   6  
ATOM 8897  C C    . MET A 1 3   ? -5.683  11.689  -12.692 1.00 0.00 ? 3   MET A C    6  
ATOM 8898  O O    . MET A 1 3   ? -6.141  10.975  -11.798 1.00 0.00 ? 3   MET A O    6  
ATOM 8899  C CB   . MET A 1 3   ? -7.949  12.240  -13.601 1.00 0.00 ? 3   MET A CB   6  
ATOM 8900  C CG   . MET A 1 3   ? -7.988  11.080  -14.582 1.00 0.00 ? 3   MET A CG   6  
ATOM 8901  S SD   . MET A 1 3   ? -8.405  11.603  -16.256 1.00 0.00 ? 3   MET A SD   6  
ATOM 8902  C CE   . MET A 1 3   ? -10.130 11.122  -16.341 1.00 0.00 ? 3   MET A CE   6  
ATOM 8903  H H    . MET A 1 3   ? -6.178  12.803  -15.424 1.00 0.00 ? 3   MET A H    6  
ATOM 8904  H HA   . MET A 1 3   ? -6.603  13.614  -12.664 1.00 0.00 ? 3   MET A HA   6  
ATOM 8905  H HB2  . MET A 1 3   ? -8.375  11.907  -12.666 1.00 0.00 ? 3   MET A HB2  6  
ATOM 8906  H HB3  . MET A 1 3   ? -8.557  13.039  -13.996 1.00 0.00 ? 3   MET A HB3  6  
ATOM 8907  H HG2  . MET A 1 3   ? -7.017  10.608  -14.601 1.00 0.00 ? 3   MET A HG2  6  
ATOM 8908  H HG3  . MET A 1 3   ? -8.727  10.368  -14.246 1.00 0.00 ? 3   MET A HG3  6  
ATOM 8909  H HE1  . MET A 1 3   ? -10.428 10.685  -15.399 1.00 0.00 ? 3   MET A HE1  6  
ATOM 8910  H HE2  . MET A 1 3   ? -10.264 10.399  -17.133 1.00 0.00 ? 3   MET A HE2  6  
ATOM 8911  H HE3  . MET A 1 3   ? -10.737 11.992  -16.542 1.00 0.00 ? 3   MET A HE3  6  
ATOM 8912  N N    . ASP A 1 4   ? -4.439  11.571  -13.149 1.00 0.00 ? 4   ASP A N    6  
ATOM 8913  C CA   . ASP A 1 4   ? -3.512  10.575  -12.618 1.00 0.00 ? 4   ASP A CA   6  
ATOM 8914  C C    . ASP A 1 4   ? -4.089  9.165   -12.742 1.00 0.00 ? 4   ASP A C    6  
ATOM 8915  O O    . ASP A 1 4   ? -4.562  8.591   -11.760 1.00 0.00 ? 4   ASP A O    6  
ATOM 8916  C CB   . ASP A 1 4   ? -3.181  10.880  -11.155 1.00 0.00 ? 4   ASP A CB   6  
ATOM 8917  C CG   . ASP A 1 4   ? -1.903  11.685  -11.007 1.00 0.00 ? 4   ASP A CG   6  
ATOM 8918  O OD1  . ASP A 1 4   ? -1.059  11.636  -11.928 1.00 0.00 ? 4   ASP A OD1  6  
ATOM 8919  O OD2  . ASP A 1 4   ? -1.747  12.366  -9.971  1.00 0.00 ? 4   ASP A OD2  6  
ATOM 8920  H H    . ASP A 1 4   ? -4.136  12.171  -13.863 1.00 0.00 ? 4   ASP A H    6  
ATOM 8921  H HA   . ASP A 1 4   ? -2.604  10.628  -13.199 1.00 0.00 ? 4   ASP A HA   6  
ATOM 8922  H HB2  . ASP A 1 4   ? -3.992  11.445  -10.719 1.00 0.00 ? 4   ASP A HB2  6  
ATOM 8923  H HB3  . ASP A 1 4   ? -3.064  9.952   -10.618 1.00 0.00 ? 4   ASP A HB3  6  
ATOM 8924  N N    . PRO A 1 5   ? -4.052  8.583   -13.954 1.00 0.00 ? 5   PRO A N    6  
ATOM 8925  C CA   . PRO A 1 5   ? -4.567  7.232   -14.197 1.00 0.00 ? 5   PRO A CA   6  
ATOM 8926  C C    . PRO A 1 5   ? -3.606  6.160   -13.699 1.00 0.00 ? 5   PRO A C    6  
ATOM 8927  O O    . PRO A 1 5   ? -4.024  5.135   -13.160 1.00 0.00 ? 5   PRO A O    6  
ATOM 8928  C CB   . PRO A 1 5   ? -4.683  7.175   -15.719 1.00 0.00 ? 5   PRO A CB   6  
ATOM 8929  C CG   . PRO A 1 5   ? -3.619  8.095   -16.209 1.00 0.00 ? 5   PRO A CG   6  
ATOM 8930  C CD   . PRO A 1 5   ? -3.503  9.192   -15.182 1.00 0.00 ? 5   PRO A CD   6  
ATOM 8931  H HA   . PRO A 1 5   ? -5.537  7.087   -13.749 1.00 0.00 ? 5   PRO A HA   6  
ATOM 8932  H HB2  . PRO A 1 5   ? -4.519  6.163   -16.057 1.00 0.00 ? 5   PRO A HB2  6  
ATOM 8933  H HB3  . PRO A 1 5   ? -5.665  7.509   -16.021 1.00 0.00 ? 5   PRO A HB3  6  
ATOM 8934  H HG2  . PRO A 1 5   ? -2.684  7.563   -16.295 1.00 0.00 ? 5   PRO A HG2  6  
ATOM 8935  H HG3  . PRO A 1 5   ? -3.904  8.509   -17.165 1.00 0.00 ? 5   PRO A HG3  6  
ATOM 8936  H HD2  . PRO A 1 5   ? -2.468  9.467   -15.043 1.00 0.00 ? 5   PRO A HD2  6  
ATOM 8937  H HD3  . PRO A 1 5   ? -4.086  10.050  -15.480 1.00 0.00 ? 5   PRO A HD3  6  
ATOM 8938  N N    . GLU A 1 6   ? -2.315  6.411   -13.884 1.00 0.00 ? 6   GLU A N    6  
ATOM 8939  C CA   . GLU A 1 6   ? -1.277  5.482   -13.461 1.00 0.00 ? 6   GLU A CA   6  
ATOM 8940  C C    . GLU A 1 6   ? 0.011   6.232   -13.147 1.00 0.00 ? 6   GLU A C    6  
ATOM 8941  O O    . GLU A 1 6   ? 0.998   5.639   -12.712 1.00 0.00 ? 6   GLU A O    6  
ATOM 8942  C CB   . GLU A 1 6   ? -1.022  4.436   -14.548 1.00 0.00 ? 6   GLU A CB   6  
ATOM 8943  C CG   . GLU A 1 6   ? -1.355  3.018   -14.118 1.00 0.00 ? 6   GLU A CG   6  
ATOM 8944  C CD   . GLU A 1 6   ? -0.398  1.995   -14.700 1.00 0.00 ? 6   GLU A CD   6  
ATOM 8945  O OE1  . GLU A 1 6   ? 0.807   2.060   -14.380 1.00 0.00 ? 6   GLU A OE1  6  
ATOM 8946  O OE2  . GLU A 1 6   ? -0.854  1.128   -15.474 1.00 0.00 ? 6   GLU A OE2  6  
ATOM 8947  H H    . GLU A 1 6   ? -2.053  7.249   -14.321 1.00 0.00 ? 6   GLU A H    6  
ATOM 8948  H HA   . GLU A 1 6   ? -1.622  4.985   -12.565 1.00 0.00 ? 6   GLU A HA   6  
ATOM 8949  H HB2  . GLU A 1 6   ? -1.622  4.679   -15.413 1.00 0.00 ? 6   GLU A HB2  6  
ATOM 8950  H HB3  . GLU A 1 6   ? 0.021   4.471   -14.823 1.00 0.00 ? 6   GLU A HB3  6  
ATOM 8951  H HG2  . GLU A 1 6   ? -1.309  2.961   -13.042 1.00 0.00 ? 6   GLU A HG2  6  
ATOM 8952  H HG3  . GLU A 1 6   ? -2.356  2.781   -14.449 1.00 0.00 ? 6   GLU A HG3  6  
ATOM 8953  N N    . PHE A 1 7   ? -0.010  7.540   -13.374 1.00 0.00 ? 7   PHE A N    6  
ATOM 8954  C CA   . PHE A 1 7   ? 1.153   8.382   -13.121 1.00 0.00 ? 7   PHE A CA   6  
ATOM 8955  C C    . PHE A 1 7   ? 1.456   8.467   -11.630 1.00 0.00 ? 7   PHE A C    6  
ATOM 8956  O O    . PHE A 1 7   ? 2.369   7.802   -11.134 1.00 0.00 ? 7   PHE A O    6  
ATOM 8957  C CB   . PHE A 1 7   ? 0.926   9.784   -13.689 1.00 0.00 ? 7   PHE A CB   6  
ATOM 8958  C CG   . PHE A 1 7   ? 1.859   10.138  -14.812 1.00 0.00 ? 7   PHE A CG   6  
ATOM 8959  C CD1  . PHE A 1 7   ? 3.230   10.179  -14.610 1.00 0.00 ? 7   PHE A CD1  6  
ATOM 8960  C CD2  . PHE A 1 7   ? 1.363   10.431  -16.074 1.00 0.00 ? 7   PHE A CD2  6  
ATOM 8961  C CE1  . PHE A 1 7   ? 4.088   10.505  -15.641 1.00 0.00 ? 7   PHE A CE1  6  
ATOM 8962  C CE2  . PHE A 1 7   ? 2.218   10.756  -17.110 1.00 0.00 ? 7   PHE A CE2  6  
ATOM 8963  C CZ   . PHE A 1 7   ? 3.582   10.795  -16.894 1.00 0.00 ? 7   PHE A CZ   6  
ATOM 8964  H H    . PHE A 1 7   ? -0.830  7.951   -13.724 1.00 0.00 ? 7   PHE A H    6  
ATOM 8965  H HA   . PHE A 1 7   ? 1.998   7.936   -13.623 1.00 0.00 ? 7   PHE A HA   6  
ATOM 8966  H HB2  . PHE A 1 7   ? -0.085  9.854   -14.062 1.00 0.00 ? 7   PHE A HB2  6  
ATOM 8967  H HB3  . PHE A 1 7   ? 1.064   10.509  -12.900 1.00 0.00 ? 7   PHE A HB3  6  
ATOM 8968  H HD1  . PHE A 1 7   ? 3.627   9.954   -13.630 1.00 0.00 ? 7   PHE A HD1  6  
ATOM 8969  H HD2  . PHE A 1 7   ? 0.298   10.401  -16.244 1.00 0.00 ? 7   PHE A HD2  6  
ATOM 8970  H HE1  . PHE A 1 7   ? 5.154   10.534  -15.469 1.00 0.00 ? 7   PHE A HE1  6  
ATOM 8971  H HE2  . PHE A 1 7   ? 1.820   10.984  -18.088 1.00 0.00 ? 7   PHE A HE2  6  
ATOM 8972  H HZ   . PHE A 1 7   ? 4.251   11.050  -17.701 1.00 0.00 ? 7   PHE A HZ   6  
ATOM 8973  N N    . ASN A 1 8   ? 0.691   9.289   -10.915 1.00 0.00 ? 8   ASN A N    6  
ATOM 8974  C CA   . ASN A 1 8   ? 0.888   9.459   -9.480  1.00 0.00 ? 8   ASN A CA   6  
ATOM 8975  C C    . ASN A 1 8   ? -0.447  9.479   -8.738  1.00 0.00 ? 8   ASN A C    6  
ATOM 8976  O O    . ASN A 1 8   ? -0.782  10.459  -8.072  1.00 0.00 ? 8   ASN A O    6  
ATOM 8977  C CB   . ASN A 1 8   ? 1.659   10.751  -9.202  1.00 0.00 ? 8   ASN A CB   6  
ATOM 8978  C CG   . ASN A 1 8   ? 2.888   10.891  -10.080 1.00 0.00 ? 8   ASN A CG   6  
ATOM 8979  O OD1  . ASN A 1 8   ? 2.836   11.500  -11.149 1.00 0.00 ? 8   ASN A OD1  6  
ATOM 8980  N ND2  . ASN A 1 8   ? 4.001   10.327  -9.630  1.00 0.00 ? 8   ASN A ND2  6  
ATOM 8981  H H    . ASN A 1 8   ? -0.018  9.793   -11.366 1.00 0.00 ? 8   ASN A H    6  
ATOM 8982  H HA   . ASN A 1 8   ? 1.469   8.623   -9.125  1.00 0.00 ? 8   ASN A HA   6  
ATOM 8983  H HB2  . ASN A 1 8   ? 1.011   11.596  -9.386  1.00 0.00 ? 8   ASN A HB2  6  
ATOM 8984  H HB3  . ASN A 1 8   ? 1.973   10.761  -8.169  1.00 0.00 ? 8   ASN A HB3  6  
ATOM 8985  H HD21 . ASN A 1 8   ? 3.969   9.859   -8.769  1.00 0.00 ? 8   ASN A HD21 6  
ATOM 8986  H HD22 . ASN A 1 8   ? 4.813   10.403  -10.176 1.00 0.00 ? 8   ASN A HD22 6  
ATOM 8987  N N    . LYS A 1 9   ? -1.202  8.390   -8.852  1.00 0.00 ? 9   LYS A N    6  
ATOM 8988  C CA   . LYS A 1 9   ? -2.497  8.284   -8.186  1.00 0.00 ? 9   LYS A CA   6  
ATOM 8989  C C    . LYS A 1 9   ? -2.353  7.643   -6.806  1.00 0.00 ? 9   LYS A C    6  
ATOM 8990  O O    . LYS A 1 9   ? -1.782  8.245   -5.896  1.00 0.00 ? 9   LYS A O    6  
ATOM 8991  C CB   . LYS A 1 9   ? -3.487  7.496   -9.046  1.00 0.00 ? 9   LYS A CB   6  
ATOM 8992  C CG   . LYS A 1 9   ? -2.833  6.669   -10.144 1.00 0.00 ? 9   LYS A CG   6  
ATOM 8993  C CD   . LYS A 1 9   ? -2.201  5.403   -9.586  1.00 0.00 ? 9   LYS A CD   6  
ATOM 8994  C CE   . LYS A 1 9   ? -2.680  4.167   -10.330 1.00 0.00 ? 9   LYS A CE   6  
ATOM 8995  N NZ   . LYS A 1 9   ? -3.095  3.084   -9.397  1.00 0.00 ? 9   LYS A NZ   6  
ATOM 8996  H H    . LYS A 1 9   ? -0.879  7.642   -9.396  1.00 0.00 ? 9   LYS A H    6  
ATOM 8997  H HA   . LYS A 1 9   ? -2.878  9.286   -8.055  1.00 0.00 ? 9   LYS A HA   6  
ATOM 8998  H HB2  . LYS A 1 9   ? -4.047  6.828   -8.409  1.00 0.00 ? 9   LYS A HB2  6  
ATOM 8999  H HB3  . LYS A 1 9   ? -4.168  8.193   -9.509  1.00 0.00 ? 9   LYS A HB3  6  
ATOM 9000  H HG2  . LYS A 1 9   ? -3.584  6.394   -10.869 1.00 0.00 ? 9   LYS A HG2  6  
ATOM 9001  H HG3  . LYS A 1 9   ? -2.067  7.264   -10.620 1.00 0.00 ? 9   LYS A HG3  6  
ATOM 9002  H HD2  . LYS A 1 9   ? -1.129  5.475   -9.683  1.00 0.00 ? 9   LYS A HD2  6  
ATOM 9003  H HD3  . LYS A 1 9   ? -2.466  5.310   -8.543  1.00 0.00 ? 9   LYS A HD3  6  
ATOM 9004  H HE2  . LYS A 1 9   ? -3.523  4.439   -10.949 1.00 0.00 ? 9   LYS A HE2  6  
ATOM 9005  H HE3  . LYS A 1 9   ? -1.877  3.805   -10.956 1.00 0.00 ? 9   LYS A HE3  6  
ATOM 9006  H HZ1  . LYS A 1 9   ? -2.617  3.198   -8.482  1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 9007  H HZ2  . LYS A 1 9   ? -2.845  2.156   -9.793  1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 9008  H HZ3  . LYS A 1 9   ? -4.124  3.119   -9.246  1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 9009  N N    . ALA A 1 10  ? -2.875  6.434   -6.639  1.00 0.00 ? 10  ALA A N    6  
ATOM 9010  C CA   . ALA A 1 10  ? -2.788  5.756   -5.356  1.00 0.00 ? 10  ALA A CA   6  
ATOM 9011  C C    . ALA A 1 10  ? -1.365  5.293   -5.074  1.00 0.00 ? 10  ALA A C    6  
ATOM 9012  O O    . ALA A 1 10  ? -0.996  4.161   -5.388  1.00 0.00 ? 10  ALA A O    6  
ATOM 9013  C CB   . ALA A 1 10  ? -3.756  4.583   -5.301  1.00 0.00 ? 10  ALA A CB   6  
ATOM 9014  H H    . ALA A 1 10  ? -3.330  5.992   -7.386  1.00 0.00 ? 10  ALA A H    6  
ATOM 9015  H HA   . ALA A 1 10  ? -3.078  6.462   -4.594  1.00 0.00 ? 10  ALA A HA   6  
ATOM 9016  H HB1  . ALA A 1 10  ? -4.293  4.602   -4.362  1.00 0.00 ? 10  ALA A HB1  6  
ATOM 9017  H HB2  . ALA A 1 10  ? -3.206  3.658   -5.381  1.00 0.00 ? 10  ALA A HB2  6  
ATOM 9018  H HB3  . ALA A 1 10  ? -4.459  4.659   -6.117  1.00 0.00 ? 10  ALA A HB3  6  
ATOM 9019  N N    . ILE A 1 11  ? -0.566  6.178   -4.481  1.00 0.00 ? 11  ILE A N    6  
ATOM 9020  C CA   . ILE A 1 11  ? 0.818   5.858   -4.157  1.00 0.00 ? 11  ILE A CA   6  
ATOM 9021  C C    . ILE A 1 11  ? 1.078   5.993   -2.659  1.00 0.00 ? 11  ILE A C    6  
ATOM 9022  O O    . ILE A 1 11  ? 0.869   7.056   -2.076  1.00 0.00 ? 11  ILE A O    6  
ATOM 9023  C CB   . ILE A 1 11  ? 1.803   6.761   -4.934  1.00 0.00 ? 11  ILE A CB   6  
ATOM 9024  C CG1  . ILE A 1 11  ? 1.952   6.270   -6.374  1.00 0.00 ? 11  ILE A CG1  6  
ATOM 9025  C CG2  . ILE A 1 11  ? 3.163   6.800   -4.247  1.00 0.00 ? 11  ILE A CG2  6  
ATOM 9026  C CD1  . ILE A 1 11  ? 0.812   6.686   -7.275  1.00 0.00 ? 11  ILE A CD1  6  
ATOM 9027  H H    . ILE A 1 11  ? -0.916  7.068   -4.254  1.00 0.00 ? 11  ILE A H    6  
ATOM 9028  H HA   . ILE A 1 11  ? 0.997   4.833   -4.450  1.00 0.00 ? 11  ILE A HA   6  
ATOM 9029  H HB   . ILE A 1 11  ? 1.403   7.764   -4.945  1.00 0.00 ? 11  ILE A HB   6  
ATOM 9030  H HG12 . ILE A 1 11  ? 2.864   6.667   -6.791  1.00 0.00 ? 11  ILE A HG12 6  
ATOM 9031  H HG13 . ILE A 1 11  ? 2.000   5.191   -6.376  1.00 0.00 ? 11  ILE A HG13 6  
ATOM 9032  H HG21 . ILE A 1 11  ? 3.158   7.563   -3.483  1.00 0.00 ? 11  ILE A HG21 6  
ATOM 9033  H HG22 . ILE A 1 11  ? 3.928   7.023   -4.976  1.00 0.00 ? 11  ILE A HG22 6  
ATOM 9034  H HG23 . ILE A 1 11  ? 3.364   5.840   -3.795  1.00 0.00 ? 11  ILE A HG23 6  
ATOM 9035  H HD11 . ILE A 1 11  ? 1.130   7.504   -7.905  1.00 0.00 ? 11  ILE A HD11 6  
ATOM 9036  H HD12 . ILE A 1 11  ? -0.028  7.002   -6.672  1.00 0.00 ? 11  ILE A HD12 6  
ATOM 9037  H HD13 . ILE A 1 11  ? 0.518   5.852   -7.894  1.00 0.00 ? 11  ILE A HD13 6  
ATOM 9038  N N    . PHE A 1 12  ? 1.552   4.912   -2.053  1.00 0.00 ? 12  PHE A N    6  
ATOM 9039  C CA   . PHE A 1 12  ? 1.864   4.901   -0.630  1.00 0.00 ? 12  PHE A CA   6  
ATOM 9040  C C    . PHE A 1 12  ? 3.349   4.620   -0.432  1.00 0.00 ? 12  PHE A C    6  
ATOM 9041  O O    . PHE A 1 12  ? 3.814   3.506   -0.670  1.00 0.00 ? 12  PHE A O    6  
ATOM 9042  C CB   . PHE A 1 12  ? 1.034   3.834   0.093   1.00 0.00 ? 12  PHE A CB   6  
ATOM 9043  C CG   . PHE A 1 12  ? -0.343  4.289   0.492   1.00 0.00 ? 12  PHE A CG   6  
ATOM 9044  C CD1  . PHE A 1 12  ? -1.359  4.374   -0.448  1.00 0.00 ? 12  PHE A CD1  6  
ATOM 9045  C CD2  . PHE A 1 12  ? -0.623  4.624   1.806   1.00 0.00 ? 12  PHE A CD2  6  
ATOM 9046  C CE1  . PHE A 1 12  ? -2.629  4.782   -0.081  1.00 0.00 ? 12  PHE A CE1  6  
ATOM 9047  C CE2  . PHE A 1 12  ? -1.891  5.035   2.180   1.00 0.00 ? 12  PHE A CE2  6  
ATOM 9048  C CZ   . PHE A 1 12  ? -2.894  5.113   1.234   1.00 0.00 ? 12  PHE A CZ   6  
ATOM 9049  H H    . PHE A 1 12  ? 1.710   4.102   -2.577  1.00 0.00 ? 12  PHE A H    6  
ATOM 9050  H HA   . PHE A 1 12  ? 1.629   5.874   -0.224  1.00 0.00 ? 12  PHE A HA   6  
ATOM 9051  H HB2  . PHE A 1 12  ? 0.923   2.978   -0.555  1.00 0.00 ? 12  PHE A HB2  6  
ATOM 9052  H HB3  . PHE A 1 12  ? 1.557   3.532   0.990   1.00 0.00 ? 12  PHE A HB3  6  
ATOM 9053  H HD1  . PHE A 1 12  ? -1.153  4.115   -1.477  1.00 0.00 ? 12  PHE A HD1  6  
ATOM 9054  H HD2  . PHE A 1 12  ? 0.161   4.563   2.546   1.00 0.00 ? 12  PHE A HD2  6  
ATOM 9055  H HE1  . PHE A 1 12  ? -3.411  4.842   -0.822  1.00 0.00 ? 12  PHE A HE1  6  
ATOM 9056  H HE2  . PHE A 1 12  ? -2.094  5.295   3.209   1.00 0.00 ? 12  PHE A HE2  6  
ATOM 9057  H HZ   . PHE A 1 12  ? -3.887  5.432   1.520   1.00 0.00 ? 12  PHE A HZ   6  
ATOM 9058  N N    . THR A 1 13  ? 4.095   5.634   -0.003  1.00 0.00 ? 13  THR A N    6  
ATOM 9059  C CA   . THR A 1 13  ? 5.527   5.481   0.213   1.00 0.00 ? 13  THR A CA   6  
ATOM 9060  C C    . THR A 1 13  ? 5.823   5.025   1.633   1.00 0.00 ? 13  THR A C    6  
ATOM 9061  O O    . THR A 1 13  ? 5.426   5.673   2.599   1.00 0.00 ? 13  THR A O    6  
ATOM 9062  C CB   . THR A 1 13  ? 6.289   6.788   -0.062  1.00 0.00 ? 13  THR A CB   6  
ATOM 9063  O OG1  . THR A 1 13  ? 5.744   7.443   -1.212  1.00 0.00 ? 13  THR A OG1  6  
ATOM 9064  C CG2  . THR A 1 13  ? 7.768   6.507   -0.286  1.00 0.00 ? 13  THR A CG2  6  
ATOM 9065  H H    . THR A 1 13  ? 3.672   6.502   0.166   1.00 0.00 ? 13  THR A H    6  
ATOM 9066  H HA   . THR A 1 13  ? 5.887   4.728   -0.473  1.00 0.00 ? 13  THR A HA   6  
ATOM 9067  H HB   . THR A 1 13  ? 6.189   7.435   0.795   1.00 0.00 ? 13  THR A HB   6  
ATOM 9068  H HG1  . THR A 1 13  ? 4.945   7.914   -0.964  1.00 0.00 ? 13  THR A HG1  6  
ATOM 9069  H HG21 . THR A 1 13  ? 8.163   5.960   0.557   1.00 0.00 ? 13  THR A HG21 6  
ATOM 9070  H HG22 . THR A 1 13  ? 8.300   7.441   -0.389  1.00 0.00 ? 13  THR A HG22 6  
ATOM 9071  H HG23 . THR A 1 13  ? 7.892   5.921   -1.185  1.00 0.00 ? 13  THR A HG23 6  
ATOM 9072  N N    . VAL A 1 14  ? 6.513   3.893   1.749   1.00 0.00 ? 14  VAL A N    6  
ATOM 9073  C CA   . VAL A 1 14  ? 6.857   3.331   3.049   1.00 0.00 ? 14  VAL A CA   6  
ATOM 9074  C C    . VAL A 1 14  ? 8.268   2.745   3.040   1.00 0.00 ? 14  VAL A C    6  
ATOM 9075  O O    . VAL A 1 14  ? 8.921   2.696   2.000   1.00 0.00 ? 14  VAL A O    6  
ATOM 9076  C CB   . VAL A 1 14  ? 5.851   2.234   3.471   1.00 0.00 ? 14  VAL A CB   6  
ATOM 9077  C CG1  . VAL A 1 14  ? 4.469   2.535   2.923   1.00 0.00 ? 14  VAL A CG1  6  
ATOM 9078  C CG2  . VAL A 1 14  ? 6.306   0.857   3.009   1.00 0.00 ? 14  VAL A CG2  6  
ATOM 9079  H H    . VAL A 1 14  ? 6.788   3.421   0.939   1.00 0.00 ? 14  VAL A H    6  
ATOM 9080  H HA   . VAL A 1 14  ? 6.812   4.128   3.775   1.00 0.00 ? 14  VAL A HA   6  
ATOM 9081  H HB   . VAL A 1 14  ? 5.792   2.226   4.551   1.00 0.00 ? 14  VAL A HB   6  
ATOM 9082  H HG11 . VAL A 1 14  ? 3.933   3.165   3.619   1.00 0.00 ? 14  VAL A HG11 6  
ATOM 9083  H HG12 . VAL A 1 14  ? 3.931   1.609   2.785   1.00 0.00 ? 14  VAL A HG12 6  
ATOM 9084  H HG13 . VAL A 1 14  ? 4.562   3.044   1.975   1.00 0.00 ? 14  VAL A HG13 6  
ATOM 9085  H HG21 . VAL A 1 14  ? 6.378   0.844   1.931   1.00 0.00 ? 14  VAL A HG21 6  
ATOM 9086  H HG22 . VAL A 1 14  ? 5.591   0.115   3.331   1.00 0.00 ? 14  VAL A HG22 6  
ATOM 9087  H HG23 . VAL A 1 14  ? 7.274   0.635   3.438   1.00 0.00 ? 14  VAL A HG23 6  
ATOM 9088  N N    . ASP A 1 15  ? 8.720   2.285   4.202   1.00 0.00 ? 15  ASP A N    6  
ATOM 9089  C CA   . ASP A 1 15  ? 10.041  1.677   4.332   1.00 0.00 ? 15  ASP A CA   6  
ATOM 9090  C C    . ASP A 1 15  ? 9.925   0.162   4.171   1.00 0.00 ? 15  ASP A C    6  
ATOM 9091  O O    . ASP A 1 15  ? 8.865   -0.407  4.418   1.00 0.00 ? 15  ASP A O    6  
ATOM 9092  C CB   . ASP A 1 15  ? 10.651  2.030   5.693   1.00 0.00 ? 15  ASP A CB   6  
ATOM 9093  C CG   . ASP A 1 15  ? 11.842  1.162   6.048   1.00 0.00 ? 15  ASP A CG   6  
ATOM 9094  O OD1  . ASP A 1 15  ? 12.707  0.950   5.174   1.00 0.00 ? 15  ASP A OD1  6  
ATOM 9095  O OD2  . ASP A 1 15  ? 11.912  0.699   7.207   1.00 0.00 ? 15  ASP A OD2  6  
ATOM 9096  H H    . ASP A 1 15  ? 8.145   2.344   4.992   1.00 0.00 ? 15  ASP A H    6  
ATOM 9097  H HA   . ASP A 1 15  ? 10.670  2.068   3.545   1.00 0.00 ? 15  ASP A HA   6  
ATOM 9098  H HB2  . ASP A 1 15  ? 10.974  3.059   5.677   1.00 0.00 ? 15  ASP A HB2  6  
ATOM 9099  H HB3  . ASP A 1 15  ? 9.898   1.906   6.457   1.00 0.00 ? 15  ASP A HB3  6  
ATOM 9100  N N    . ALA A 1 16  ? 10.995  -0.495  3.739   1.00 0.00 ? 16  ALA A N    6  
ATOM 9101  C CA   . ALA A 1 16  ? 10.951  -1.940  3.541   1.00 0.00 ? 16  ALA A CA   6  
ATOM 9102  C C    . ALA A 1 16  ? 11.318  -2.703  4.804   1.00 0.00 ? 16  ALA A C    6  
ATOM 9103  O O    . ALA A 1 16  ? 10.950  -3.869  4.957   1.00 0.00 ? 16  ALA A O    6  
ATOM 9104  C CB   . ALA A 1 16  ? 11.853  -2.349  2.389   1.00 0.00 ? 16  ALA A CB   6  
ATOM 9105  H H    . ALA A 1 16  ? 11.820  -0.009  3.536   1.00 0.00 ? 16  ALA A H    6  
ATOM 9106  H HA   . ALA A 1 16  ? 9.936   -2.200  3.282   1.00 0.00 ? 16  ALA A HA   6  
ATOM 9107  H HB1  . ALA A 1 16  ? 12.880  -2.352  2.719   1.00 0.00 ? 16  ALA A HB1  6  
ATOM 9108  H HB2  . ALA A 1 16  ? 11.739  -1.645  1.576   1.00 0.00 ? 16  ALA A HB2  6  
ATOM 9109  H HB3  . ALA A 1 16  ? 11.579  -3.337  2.050   1.00 0.00 ? 16  ALA A HB3  6  
ATOM 9110  N N    . LYS A 1 17  ? 12.030  -2.053  5.712   1.00 0.00 ? 17  LYS A N    6  
ATOM 9111  C CA   . LYS A 1 17  ? 12.414  -2.703  6.955   1.00 0.00 ? 17  LYS A CA   6  
ATOM 9112  C C    . LYS A 1 17  ? 11.187  -2.926  7.830   1.00 0.00 ? 17  LYS A C    6  
ATOM 9113  O O    . LYS A 1 17  ? 10.793  -4.064  8.090   1.00 0.00 ? 17  LYS A O    6  
ATOM 9114  C CB   . LYS A 1 17  ? 13.452  -1.861  7.704   1.00 0.00 ? 17  LYS A CB   6  
ATOM 9115  C CG   . LYS A 1 17  ? 14.007  -2.541  8.947   1.00 0.00 ? 17  LYS A CG   6  
ATOM 9116  C CD   . LYS A 1 17  ? 15.283  -1.867  9.425   1.00 0.00 ? 17  LYS A CD   6  
ATOM 9117  C CE   . LYS A 1 17  ? 14.987  -0.745  10.409  1.00 0.00 ? 17  LYS A CE   6  
ATOM 9118  N NZ   . LYS A 1 17  ? 15.769  -0.889  11.669  1.00 0.00 ? 17  LYS A NZ   6  
ATOM 9119  H H    . LYS A 1 17  ? 12.292  -1.122  5.549   1.00 0.00 ? 17  LYS A H    6  
ATOM 9120  H HA   . LYS A 1 17  ? 12.847  -3.662  6.709   1.00 0.00 ? 17  LYS A HA   6  
ATOM 9121  H HB2  . LYS A 1 17  ? 14.276  -1.650  7.037   1.00 0.00 ? 17  LYS A HB2  6  
ATOM 9122  H HB3  . LYS A 1 17  ? 12.996  -0.929  8.003   1.00 0.00 ? 17  LYS A HB3  6  
ATOM 9123  H HG2  . LYS A 1 17  ? 13.268  -2.489  9.732   1.00 0.00 ? 17  LYS A HG2  6  
ATOM 9124  H HG3  . LYS A 1 17  ? 14.221  -3.574  8.715   1.00 0.00 ? 17  LYS A HG3  6  
ATOM 9125  H HD2  . LYS A 1 17  ? 15.907  -2.602  9.911   1.00 0.00 ? 17  LYS A HD2  6  
ATOM 9126  H HD3  . LYS A 1 17  ? 15.805  -1.459  8.573   1.00 0.00 ? 17  LYS A HD3  6  
ATOM 9127  H HE2  . LYS A 1 17  ? 15.237  0.198   9.946   1.00 0.00 ? 17  LYS A HE2  6  
ATOM 9128  H HE3  . LYS A 1 17  ? 13.933  -0.760  10.644  1.00 0.00 ? 17  LYS A HE3  6  
ATOM 9129  H HZ1  . LYS A 1 17  ? 15.204  -1.393  12.383  1.00 0.00 ? 17  LYS A HZ1  6  
ATOM 9130  H HZ2  . LYS A 1 17  ? 16.021  0.048   12.040  1.00 0.00 ? 17  LYS A HZ2  6  
ATOM 9131  H HZ3  . LYS A 1 17  ? 16.641  -1.426  11.489  1.00 0.00 ? 17  LYS A HZ3  6  
ATOM 9132  N N    . THR A 1 18  ? 10.601  -1.830  8.299   1.00 0.00 ? 18  THR A N    6  
ATOM 9133  C CA   . THR A 1 18  ? 9.433   -1.920  9.168   1.00 0.00 ? 18  THR A CA   6  
ATOM 9134  C C    . THR A 1 18  ? 8.154   -1.396  8.527   1.00 0.00 ? 18  THR A C    6  
ATOM 9135  O O    . THR A 1 18  ? 7.084   -1.480  9.131   1.00 0.00 ? 18  THR A O    6  
ATOM 9136  C CB   . THR A 1 18  ? 9.664   -1.197  10.509  1.00 0.00 ? 18  THR A CB   6  
ATOM 9137  O OG1  . THR A 1 18  ? 8.567   -1.444  11.396  1.00 0.00 ? 18  THR A OG1  6  
ATOM 9138  C CG2  . THR A 1 18  ? 9.826   0.301   10.297  1.00 0.00 ? 18  THR A CG2  6  
ATOM 9139  H H    . THR A 1 18  ? 11.001  -0.965  8.072   1.00 0.00 ? 18  THR A H    6  
ATOM 9140  H HA   . THR A 1 18  ? 9.288   -2.960  9.371   1.00 0.00 ? 18  THR A HA   6  
ATOM 9141  H HB   . THR A 1 18  ? 10.570  -1.583  10.955  1.00 0.00 ? 18  THR A HB   6  
ATOM 9142  H HG1  . THR A 1 18  ? 7.783   -0.999  11.069  1.00 0.00 ? 18  THR A HG1  6  
ATOM 9143  H HG21 . THR A 1 18  ? 9.378   0.831   11.124  1.00 0.00 ? 18  THR A HG21 6  
ATOM 9144  H HG22 . THR A 1 18  ? 9.338   0.589   9.378   1.00 0.00 ? 18  THR A HG22 6  
ATOM 9145  H HG23 . THR A 1 18  ? 10.876  0.545   10.239  1.00 0.00 ? 18  THR A HG23 6  
ATOM 9146  N N    . THR A 1 19  ? 8.274   -0.843  7.328   1.00 0.00 ? 19  THR A N    6  
ATOM 9147  C CA   . THR A 1 19  ? 7.130   -0.279  6.605   1.00 0.00 ? 19  THR A CA   6  
ATOM 9148  C C    . THR A 1 19  ? 6.864   1.157   7.054   1.00 0.00 ? 19  THR A C    6  
ATOM 9149  O O    . THR A 1 19  ? 7.685   2.040   6.812   1.00 0.00 ? 19  THR A O    6  
ATOM 9150  C CB   . THR A 1 19  ? 5.847   -1.129  6.760   1.00 0.00 ? 19  THR A CB   6  
ATOM 9151  O OG1  . THR A 1 19  ? 6.178   -2.523  6.773   1.00 0.00 ? 19  THR A OG1  6  
ATOM 9152  C CG2  . THR A 1 19  ? 4.872   -0.848  5.627   1.00 0.00 ? 19  THR A CG2  6  
ATOM 9153  H H    . THR A 1 19  ? 9.165   -0.777  6.930   1.00 0.00 ? 19  THR A H    6  
ATOM 9154  H HA   . THR A 1 19  ? 7.389   -0.263  5.555   1.00 0.00 ? 19  THR A HA   6  
ATOM 9155  H HB   . THR A 1 19  ? 5.373   -0.870  7.696   1.00 0.00 ? 19  THR A HB   6  
ATOM 9156  H HG1  . THR A 1 19  ? 5.616   -2.991  6.151   1.00 0.00 ? 19  THR A HG1  6  
ATOM 9157  H HG21 . THR A 1 19  ? 4.064   -1.565  5.661   1.00 0.00 ? 19  THR A HG21 6  
ATOM 9158  H HG22 . THR A 1 19  ? 5.384   -0.930  4.682   1.00 0.00 ? 19  THR A HG22 6  
ATOM 9159  H HG23 . THR A 1 19  ? 4.471   0.149   5.737   1.00 0.00 ? 19  THR A HG23 6  
ATOM 9160  N N    . GLU A 1 20  ? 5.726   1.391   7.707   1.00 0.00 ? 20  GLU A N    6  
ATOM 9161  C CA   . GLU A 1 20  ? 5.380   2.732   8.174   1.00 0.00 ? 20  GLU A CA   6  
ATOM 9162  C C    . GLU A 1 20  ? 5.337   3.709   7.003   1.00 0.00 ? 20  GLU A C    6  
ATOM 9163  O O    . GLU A 1 20  ? 6.372   4.211   6.562   1.00 0.00 ? 20  GLU A O    6  
ATOM 9164  C CB   . GLU A 1 20  ? 6.387   3.211   9.222   1.00 0.00 ? 20  GLU A CB   6  
ATOM 9165  C CG   . GLU A 1 20  ? 5.744   3.877   10.425  1.00 0.00 ? 20  GLU A CG   6  
ATOM 9166  C CD   . GLU A 1 20  ? 6.108   3.199   11.733  1.00 0.00 ? 20  GLU A CD   6  
ATOM 9167  O OE1  . GLU A 1 20  ? 5.455   2.192   12.080  1.00 0.00 ? 20  GLU A OE1  6  
ATOM 9168  O OE2  . GLU A 1 20  ? 7.042   3.677   12.409  1.00 0.00 ? 20  GLU A OE2  6  
ATOM 9169  H H    . GLU A 1 20  ? 5.105   0.654   7.876   1.00 0.00 ? 20  GLU A H    6  
ATOM 9170  H HA   . GLU A 1 20  ? 4.398   2.684   8.623   1.00 0.00 ? 20  GLU A HA   6  
ATOM 9171  H HB2  . GLU A 1 20  ? 6.957   2.360   9.571   1.00 0.00 ? 20  GLU A HB2  6  
ATOM 9172  H HB3  . GLU A 1 20  ? 7.061   3.917   8.761   1.00 0.00 ? 20  GLU A HB3  6  
ATOM 9173  H HG2  . GLU A 1 20  ? 6.070   4.906   10.469  1.00 0.00 ? 20  GLU A HG2  6  
ATOM 9174  H HG3  . GLU A 1 20  ? 4.670   3.847   10.307  1.00 0.00 ? 20  GLU A HG3  6  
ATOM 9175  N N    . ILE A 1 21  ? 4.136   3.966   6.496   1.00 0.00 ? 21  ILE A N    6  
ATOM 9176  C CA   . ILE A 1 21  ? 3.958   4.870   5.364   1.00 0.00 ? 21  ILE A CA   6  
ATOM 9177  C C    . ILE A 1 21  ? 4.573   6.238   5.639   1.00 0.00 ? 21  ILE A C    6  
ATOM 9178  O O    . ILE A 1 21  ? 4.011   7.047   6.376   1.00 0.00 ? 21  ILE A O    6  
ATOM 9179  C CB   . ILE A 1 21  ? 2.471   5.052   4.993   1.00 0.00 ? 21  ILE A CB   6  
ATOM 9180  C CG1  . ILE A 1 21  ? 1.640   3.847   5.442   1.00 0.00 ? 21  ILE A CG1  6  
ATOM 9181  C CG2  . ILE A 1 21  ? 2.330   5.256   3.493   1.00 0.00 ? 21  ILE A CG2  6  
ATOM 9182  C CD1  . ILE A 1 21  ? 0.383   4.226   6.194   1.00 0.00 ? 21  ILE A CD1  6  
ATOM 9183  H H    . ILE A 1 21  ? 3.353   3.528   6.887   1.00 0.00 ? 21  ILE A H    6  
ATOM 9184  H HA   . ILE A 1 21  ? 4.462   4.432   4.515   1.00 0.00 ? 21  ILE A HA   6  
ATOM 9185  H HB   . ILE A 1 21  ? 2.105   5.940   5.488   1.00 0.00 ? 21  ILE A HB   6  
ATOM 9186  H HG12 . ILE A 1 21  ? 1.346   3.280   4.573   1.00 0.00 ? 21  ILE A HG12 6  
ATOM 9187  H HG13 . ILE A 1 21  ? 2.240   3.224   6.088   1.00 0.00 ? 21  ILE A HG13 6  
ATOM 9188  H HG21 . ILE A 1 21  ? 2.189   4.298   3.012   1.00 0.00 ? 21  ILE A HG21 6  
ATOM 9189  H HG22 . ILE A 1 21  ? 3.223   5.725   3.108   1.00 0.00 ? 21  ILE A HG22 6  
ATOM 9190  H HG23 . ILE A 1 21  ? 1.478   5.889   3.293   1.00 0.00 ? 21  ILE A HG23 6  
ATOM 9191  H HD11 . ILE A 1 21  ? -0.004  5.156   5.801   1.00 0.00 ? 21  ILE A HD11 6  
ATOM 9192  H HD12 . ILE A 1 21  ? 0.614   4.348   7.242   1.00 0.00 ? 21  ILE A HD12 6  
ATOM 9193  H HD13 . ILE A 1 21  ? -0.355  3.450   6.075   1.00 0.00 ? 21  ILE A HD13 6  
ATOM 9194  N N    . LEU A 1 22  ? 5.730   6.486   5.033   1.00 0.00 ? 22  LEU A N    6  
ATOM 9195  C CA   . LEU A 1 22  ? 6.433   7.752   5.198   1.00 0.00 ? 22  LEU A CA   6  
ATOM 9196  C C    . LEU A 1 22  ? 5.531   8.926   4.821   1.00 0.00 ? 22  LEU A C    6  
ATOM 9197  O O    . LEU A 1 22  ? 5.548   9.965   5.480   1.00 0.00 ? 22  LEU A O    6  
ATOM 9198  C CB   . LEU A 1 22  ? 7.708   7.776   4.346   1.00 0.00 ? 22  LEU A CB   6  
ATOM 9199  C CG   . LEU A 1 22  ? 8.361   6.412   4.096   1.00 0.00 ? 22  LEU A CG   6  
ATOM 9200  C CD1  . LEU A 1 22  ? 9.566   6.557   3.178   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 9201  C CD2  . LEU A 1 22  ? 8.770   5.764   5.411   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 9202  H H    . LEU A 1 22  ? 6.121   5.793   4.458   1.00 0.00 ? 22  LEU A H    6  
ATOM 9203  H HA   . LEU A 1 22  ? 6.707   7.843   6.239   1.00 0.00 ? 22  LEU A HA   6  
ATOM 9204  H HB2  . LEU A 1 22  ? 7.465   8.214   3.388   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 9205  H HB3  . LEU A 1 22  ? 8.431   8.410   4.838   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 9206  H HG   . LEU A 1 22  ? 7.649   5.763   3.609   1.00 0.00 ? 22  LEU A HG   6  
ATOM 9207  H HD11 . LEU A 1 22  ? 10.027  7.520   3.340   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 9208  H HD12 . LEU A 1 22  ? 9.247   6.479   2.151   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 9209  H HD13 . LEU A 1 22  ? 10.280  5.774   3.394   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 9210  H HD21 . LEU A 1 22  ? 9.581   6.325   5.851   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 9211  H HD22 . LEU A 1 22  ? 9.090   4.748   5.229   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 9212  H HD23 . LEU A 1 22  ? 7.926   5.760   6.088   1.00 0.00 ? 22  LEU A HD23 6  
ATOM 9213  N N    . VAL A 1 23  ? 4.740   8.747   3.762   1.00 0.00 ? 23  VAL A N    6  
ATOM 9214  C CA   . VAL A 1 23  ? 3.826   9.788   3.302   1.00 0.00 ? 23  VAL A CA   6  
ATOM 9215  C C    . VAL A 1 23  ? 2.997   9.312   2.107   1.00 0.00 ? 23  VAL A C    6  
ATOM 9216  O O    . VAL A 1 23  ? 3.356   8.342   1.437   1.00 0.00 ? 23  VAL A O    6  
ATOM 9217  C CB   . VAL A 1 23  ? 4.585   11.084  2.923   1.00 0.00 ? 23  VAL A CB   6  
ATOM 9218  C CG1  . VAL A 1 23  ? 4.718   11.239  1.412   1.00 0.00 ? 23  VAL A CG1  6  
ATOM 9219  C CG2  . VAL A 1 23  ? 3.897   12.298  3.529   1.00 0.00 ? 23  VAL A CG2  6  
ATOM 9220  H H    . VAL A 1 23  ? 4.766   7.892   3.283   1.00 0.00 ? 23  VAL A H    6  
ATOM 9221  H HA   . VAL A 1 23  ? 3.153   10.020  4.116   1.00 0.00 ? 23  VAL A HA   6  
ATOM 9222  H HB   . VAL A 1 23  ? 5.582   11.023  3.340   1.00 0.00 ? 23  VAL A HB   6  
ATOM 9223  H HG11 . VAL A 1 23  ? 5.125   10.331  0.991   1.00 0.00 ? 23  VAL A HG11 6  
ATOM 9224  H HG12 . VAL A 1 23  ? 5.376   12.067  1.190   1.00 0.00 ? 23  VAL A HG12 6  
ATOM 9225  H HG13 . VAL A 1 23  ? 3.744   11.429  0.983   1.00 0.00 ? 23  VAL A HG13 6  
ATOM 9226  H HG21 . VAL A 1 23  ? 4.318   12.503  4.502   1.00 0.00 ? 23  VAL A HG21 6  
ATOM 9227  H HG22 . VAL A 1 23  ? 2.840   12.101  3.627   1.00 0.00 ? 23  VAL A HG22 6  
ATOM 9228  H HG23 . VAL A 1 23  ? 4.046   13.153  2.885   1.00 0.00 ? 23  VAL A HG23 6  
ATOM 9229  N N    . ALA A 1 24  ? 1.896   10.008  1.843   1.00 0.00 ? 24  ALA A N    6  
ATOM 9230  C CA   . ALA A 1 24  ? 1.020   9.671   0.726   1.00 0.00 ? 24  ALA A CA   6  
ATOM 9231  C C    . ALA A 1 24  ? 0.504   10.937  0.050   1.00 0.00 ? 24  ALA A C    6  
ATOM 9232  O O    . ALA A 1 24  ? 0.560   12.023  0.629   1.00 0.00 ? 24  ALA A O    6  
ATOM 9233  C CB   . ALA A 1 24  ? -0.135  8.807   1.192   1.00 0.00 ? 24  ALA A CB   6  
ATOM 9234  H H    . ALA A 1 24  ? 1.670   10.777  2.409   1.00 0.00 ? 24  ALA A H    6  
ATOM 9235  H HA   . ALA A 1 24  ? 1.598   9.104   0.010   1.00 0.00 ? 24  ALA A HA   6  
ATOM 9236  H HB1  . ALA A 1 24  ? -0.086  8.688   2.265   1.00 0.00 ? 24  ALA A HB1  6  
ATOM 9237  H HB2  . ALA A 1 24  ? -0.078  7.838   0.719   1.00 0.00 ? 24  ALA A HB2  6  
ATOM 9238  H HB3  . ALA A 1 24  ? -1.070  9.282   0.929   1.00 0.00 ? 24  ALA A HB3  6  
ATOM 9239  N N    . ASN A 1 25  ? 0.028   10.801  -1.185  1.00 0.00 ? 25  ASN A N    6  
ATOM 9240  C CA   . ASN A 1 25  ? -0.458  11.954  -1.933  1.00 0.00 ? 25  ASN A CA   6  
ATOM 9241  C C    . ASN A 1 25  ? -1.976  12.121  -1.854  1.00 0.00 ? 25  ASN A C    6  
ATOM 9242  O O    . ASN A 1 25  ? -2.688  11.294  -1.285  1.00 0.00 ? 25  ASN A O    6  
ATOM 9243  C CB   . ASN A 1 25  ? -0.016  11.866  -3.397  1.00 0.00 ? 25  ASN A CB   6  
ATOM 9244  C CG   . ASN A 1 25  ? -0.539  10.626  -4.103  1.00 0.00 ? 25  ASN A CG   6  
ATOM 9245  O OD1  . ASN A 1 25  ? -0.532  9.524   -3.549  1.00 0.00 ? 25  ASN A OD1  6  
ATOM 9246  N ND2  . ASN A 1 25  ? -0.994  10.800  -5.339  1.00 0.00 ? 25  ASN A ND2  6  
ATOM 9247  H H    . ASN A 1 25  ? 0.037   9.919   -1.608  1.00 0.00 ? 25  ASN A H    6  
ATOM 9248  H HA   . ASN A 1 25  ? -0.006  12.831  -1.491  1.00 0.00 ? 25  ASN A HA   6  
ATOM 9249  H HB2  . ASN A 1 25  ? -0.378  12.733  -3.927  1.00 0.00 ? 25  ASN A HB2  6  
ATOM 9250  H HB3  . ASN A 1 25  ? 1.063   11.851  -3.436  1.00 0.00 ? 25  ASN A HB3  6  
ATOM 9251  H HD21 . ASN A 1 25  ? -0.970  11.702  -5.722  1.00 0.00 ? 25  ASN A HD21 6  
ATOM 9252  H HD22 . ASN A 1 25  ? -1.333  10.019  -5.820  1.00 0.00 ? 25  ASN A HD22 6  
ATOM 9253  N N    . ASP A 1 26  ? -2.441  13.227  -2.430  1.00 0.00 ? 26  ASP A N    6  
ATOM 9254  C CA   . ASP A 1 26  ? -3.860  13.582  -2.453  1.00 0.00 ? 26  ASP A CA   6  
ATOM 9255  C C    . ASP A 1 26  ? -4.666  12.653  -3.350  1.00 0.00 ? 26  ASP A C    6  
ATOM 9256  O O    . ASP A 1 26  ? -5.894  12.729  -3.386  1.00 0.00 ? 26  ASP A O    6  
ATOM 9257  C CB   . ASP A 1 26  ? -4.038  15.031  -2.907  1.00 0.00 ? 26  ASP A CB   6  
ATOM 9258  C CG   . ASP A 1 26  ? -5.426  15.564  -2.616  1.00 0.00 ? 26  ASP A CG   6  
ATOM 9259  O OD1  . ASP A 1 26  ? -6.005  15.179  -1.578  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 9260  O OD2  . ASP A 1 26  ? -5.936  16.366  -3.427  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 9261  H H    . ASP A 1 26  ? -1.792  13.831  -2.848  1.00 0.00 ? 26  ASP A H    6  
ATOM 9262  H HA   . ASP A 1 26  ? -4.238  13.484  -1.446  1.00 0.00 ? 26  ASP A HA   6  
ATOM 9263  H HB2  . ASP A 1 26  ? -3.320  15.654  -2.393  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 9264  H HB3  . ASP A 1 26  ? -3.864  15.091  -3.972  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 9265  N N    . LYS A 1 27  ? -3.985  11.757  -4.050  1.00 0.00 ? 27  LYS A N    6  
ATOM 9266  C CA   . LYS A 1 27  ? -4.664  10.803  -4.909  1.00 0.00 ? 27  LYS A CA   6  
ATOM 9267  C C    . LYS A 1 27  ? -4.898  9.517   -4.133  1.00 0.00 ? 27  LYS A C    6  
ATOM 9268  O O    . LYS A 1 27  ? -6.039  9.103   -3.926  1.00 0.00 ? 27  LYS A O    6  
ATOM 9269  C CB   . LYS A 1 27  ? -3.849  10.531  -6.171  1.00 0.00 ? 27  LYS A CB   6  
ATOM 9270  C CG   . LYS A 1 27  ? -3.619  11.770  -7.023  1.00 0.00 ? 27  LYS A CG   6  
ATOM 9271  C CD   . LYS A 1 27  ? -4.670  11.899  -8.114  1.00 0.00 ? 27  LYS A CD   6  
ATOM 9272  C CE   . LYS A 1 27  ? -5.943  12.542  -7.591  1.00 0.00 ? 27  LYS A CE   6  
ATOM 9273  N NZ   . LYS A 1 27  ? -6.010  13.992  -7.917  1.00 0.00 ? 27  LYS A NZ   6  
ATOM 9274  H H    . LYS A 1 27  ? -3.011  11.702  -3.956  1.00 0.00 ? 27  LYS A H    6  
ATOM 9275  H HA   . LYS A 1 27  ? -5.620  11.226  -5.184  1.00 0.00 ? 27  LYS A HA   6  
ATOM 9276  H HB2  . LYS A 1 27  ? -2.888  10.134  -5.886  1.00 0.00 ? 27  LYS A HB2  6  
ATOM 9277  H HB3  . LYS A 1 27  ? -4.369  9.801   -6.772  1.00 0.00 ? 27  LYS A HB3  6  
ATOM 9278  H HG2  . LYS A 1 27  ? -3.663  12.644  -6.389  1.00 0.00 ? 27  LYS A HG2  6  
ATOM 9279  H HG3  . LYS A 1 27  ? -2.643  11.705  -7.480  1.00 0.00 ? 27  LYS A HG3  6  
ATOM 9280  H HD2  . LYS A 1 27  ? -4.273  12.509  -8.912  1.00 0.00 ? 27  LYS A HD2  6  
ATOM 9281  H HD3  . LYS A 1 27  ? -4.903  10.915  -8.494  1.00 0.00 ? 27  LYS A HD3  6  
ATOM 9282  H HE2  . LYS A 1 27  ? -6.791  12.042  -8.034  1.00 0.00 ? 27  LYS A HE2  6  
ATOM 9283  H HE3  . LYS A 1 27  ? -5.977  12.421  -6.517  1.00 0.00 ? 27  LYS A HE3  6  
ATOM 9284  H HZ1  . LYS A 1 27  ? -6.241  14.542  -7.066  1.00 0.00 ? 27  LYS A HZ1  6  
ATOM 9285  H HZ2  . LYS A 1 27  ? -6.741  14.164  -8.635  1.00 0.00 ? 27  LYS A HZ2  6  
ATOM 9286  H HZ3  . LYS A 1 27  ? -5.093  14.317  -8.288  1.00 0.00 ? 27  LYS A HZ3  6  
ATOM 9287  N N    . ALA A 1 28  ? -3.806  8.905   -3.677  1.00 0.00 ? 28  ALA A N    6  
ATOM 9288  C CA   . ALA A 1 28  ? -3.887  7.684   -2.885  1.00 0.00 ? 28  ALA A CA   6  
ATOM 9289  C C    . ALA A 1 28  ? -4.848  7.883   -1.726  1.00 0.00 ? 28  ALA A C    6  
ATOM 9290  O O    . ALA A 1 28  ? -5.688  7.032   -1.438  1.00 0.00 ? 28  ALA A O    6  
ATOM 9291  C CB   . ALA A 1 28  ? -2.511  7.302   -2.364  1.00 0.00 ? 28  ALA A CB   6  
ATOM 9292  H H    . ALA A 1 28  ? -2.926  9.296   -3.864  1.00 0.00 ? 28  ALA A H    6  
ATOM 9293  H HA   . ALA A 1 28  ? -4.249  6.889   -3.520  1.00 0.00 ? 28  ALA A HA   6  
ATOM 9294  H HB1  . ALA A 1 28  ? -2.387  6.232   -2.426  1.00 0.00 ? 28  ALA A HB1  6  
ATOM 9295  H HB2  . ALA A 1 28  ? -2.416  7.617   -1.335  1.00 0.00 ? 28  ALA A HB2  6  
ATOM 9296  H HB3  . ALA A 1 28  ? -1.752  7.788   -2.960  1.00 0.00 ? 28  ALA A HB3  6  
ATOM 9297  N N    . CYS A 1 29  ? -4.718  9.032   -1.078  1.00 0.00 ? 29  CYS A N    6  
ATOM 9298  C CA   . CYS A 1 29  ? -5.574  9.382   0.042   1.00 0.00 ? 29  CYS A CA   6  
ATOM 9299  C C    . CYS A 1 29  ? -7.026  9.396   -0.406  1.00 0.00 ? 29  CYS A C    6  
ATOM 9300  O O    . CYS A 1 29  ? -7.917  8.945   0.314   1.00 0.00 ? 29  CYS A O    6  
ATOM 9301  C CB   . CYS A 1 29  ? -5.169  10.747  0.595   1.00 0.00 ? 29  CYS A CB   6  
ATOM 9302  S SG   . CYS A 1 29  ? -6.238  12.112  0.081   1.00 0.00 ? 29  CYS A SG   6  
ATOM 9303  H H    . CYS A 1 29  ? -4.032  9.668   -1.369  1.00 0.00 ? 29  CYS A H    6  
ATOM 9304  H HA   . CYS A 1 29  ? -5.450  8.631   0.811   1.00 0.00 ? 29  CYS A HA   6  
ATOM 9305  H HB2  . CYS A 1 29  ? -5.183  10.708  1.672   1.00 0.00 ? 29  CYS A HB2  6  
ATOM 9306  H HB3  . CYS A 1 29  ? -4.167  10.972  0.262   1.00 0.00 ? 29  CYS A HB3  6  
ATOM 9307  H HG   . CYS A 1 29  ? -5.543  12.894  -0.733  1.00 0.00 ? 29  CYS A HG   6  
ATOM 9308  N N    . GLY A 1 30  ? -7.249  9.900   -1.615  1.00 0.00 ? 30  GLY A N    6  
ATOM 9309  C CA   . GLY A 1 30  ? -8.592  9.947   -2.161  1.00 0.00 ? 30  GLY A CA   6  
ATOM 9310  C C    . GLY A 1 30  ? -9.162  8.553   -2.306  1.00 0.00 ? 30  GLY A C    6  
ATOM 9311  O O    . GLY A 1 30  ? -10.342 8.319   -2.038  1.00 0.00 ? 30  GLY A O    6  
ATOM 9312  H H    . GLY A 1 30  ? -6.488  10.231  -2.144  1.00 0.00 ? 30  GLY A H    6  
ATOM 9313  H HA2  . GLY A 1 30  ? -9.225  10.522  -1.501  1.00 0.00 ? 30  GLY A HA2  6  
ATOM 9314  H HA3  . GLY A 1 30  ? -8.565  10.419  -3.132  1.00 0.00 ? 30  GLY A HA3  6  
ATOM 9315  N N    . LEU A 1 31  ? -8.303  7.627   -2.723  1.00 0.00 ? 31  LEU A N    6  
ATOM 9316  C CA   . LEU A 1 31  ? -8.687  6.233   -2.898  1.00 0.00 ? 31  LEU A CA   6  
ATOM 9317  C C    . LEU A 1 31  ? -9.428  5.737   -1.652  1.00 0.00 ? 31  LEU A C    6  
ATOM 9318  O O    . LEU A 1 31  ? -10.569 5.281   -1.744  1.00 0.00 ? 31  LEU A O    6  
ATOM 9319  C CB   . LEU A 1 31  ? -7.435  5.389   -3.184  1.00 0.00 ? 31  LEU A CB   6  
ATOM 9320  C CG   . LEU A 1 31  ? -7.631  3.872   -3.324  1.00 0.00 ? 31  LEU A CG   6  
ATOM 9321  C CD1  . LEU A 1 31  ? -7.272  3.183   -2.018  1.00 0.00 ? 31  LEU A CD1  6  
ATOM 9322  C CD2  . LEU A 1 31  ? -9.050  3.519   -3.753  1.00 0.00 ? 31  LEU A CD2  6  
ATOM 9323  H H    . LEU A 1 31  ? -7.380  7.895   -2.911  1.00 0.00 ? 31  LEU A H    6  
ATOM 9324  H HA   . LEU A 1 31  ? -9.354  6.176   -3.746  1.00 0.00 ? 31  LEU A HA   6  
ATOM 9325  H HB2  . LEU A 1 31  ? -6.990  5.752   -4.100  1.00 0.00 ? 31  LEU A HB2  6  
ATOM 9326  H HB3  . LEU A 1 31  ? -6.733  5.560   -2.380  1.00 0.00 ? 31  LEU A HB3  6  
ATOM 9327  H HG   . LEU A 1 31  ? -6.954  3.503   -4.083  1.00 0.00 ? 31  LEU A HG   6  
ATOM 9328  H HD11 . LEU A 1 31  ? -6.929  3.922   -1.307  1.00 0.00 ? 31  LEU A HD11 6  
ATOM 9329  H HD12 . LEU A 1 31  ? -6.485  2.464   -2.198  1.00 0.00 ? 31  LEU A HD12 6  
ATOM 9330  H HD13 . LEU A 1 31  ? -8.140  2.678   -1.624  1.00 0.00 ? 31  LEU A HD13 6  
ATOM 9331  H HD21 . LEU A 1 31  ? -9.437  4.300   -4.390  1.00 0.00 ? 31  LEU A HD21 6  
ATOM 9332  H HD22 . LEU A 1 31  ? -9.678  3.423   -2.879  1.00 0.00 ? 31  LEU A HD22 6  
ATOM 9333  H HD23 . LEU A 1 31  ? -9.040  2.584   -4.295  1.00 0.00 ? 31  LEU A HD23 6  
ATOM 9334  N N    . LEU A 1 32  ? -8.788  5.851   -0.490  1.00 0.00 ? 32  LEU A N    6  
ATOM 9335  C CA   . LEU A 1 32  ? -9.431  5.428   0.757   1.00 0.00 ? 32  LEU A CA   6  
ATOM 9336  C C    . LEU A 1 32  ? -10.145 6.599   1.428   1.00 0.00 ? 32  LEU A C    6  
ATOM 9337  O O    . LEU A 1 32  ? -11.374 6.677   1.420   1.00 0.00 ? 32  LEU A O    6  
ATOM 9338  C CB   . LEU A 1 32  ? -8.447  4.797   1.748   1.00 0.00 ? 32  LEU A CB   6  
ATOM 9339  C CG   . LEU A 1 32  ? -6.964  4.843   1.379   1.00 0.00 ? 32  LEU A CG   6  
ATOM 9340  C CD1  . LEU A 1 32  ? -6.427  6.263   1.471   1.00 0.00 ? 32  LEU A CD1  6  
ATOM 9341  C CD2  . LEU A 1 32  ? -6.191  3.916   2.303   1.00 0.00 ? 32  LEU A CD2  6  
ATOM 9342  H H    . LEU A 1 32  ? -7.885  6.238   -0.483  1.00 0.00 ? 32  LEU A H    6  
ATOM 9343  H HA   . LEU A 1 32  ? -10.175 4.689   0.496   1.00 0.00 ? 32  LEU A HA   6  
ATOM 9344  H HB2  . LEU A 1 32  ? -8.565  5.298   2.698   1.00 0.00 ? 32  LEU A HB2  6  
ATOM 9345  H HB3  . LEU A 1 32  ? -8.726  3.762   1.878   1.00 0.00 ? 32  LEU A HB3  6  
ATOM 9346  H HG   . LEU A 1 32  ? -6.834  4.495   0.367   1.00 0.00 ? 32  LEU A HG   6  
ATOM 9347  H HD11 . LEU A 1 32  ? -6.404  6.572   2.505   1.00 0.00 ? 32  LEU A HD11 6  
ATOM 9348  H HD12 . LEU A 1 32  ? -7.064  6.926   0.908   1.00 0.00 ? 32  LEU A HD12 6  
ATOM 9349  H HD13 . LEU A 1 32  ? -5.425  6.296   1.065   1.00 0.00 ? 32  LEU A HD13 6  
ATOM 9350  H HD21 . LEU A 1 32  ? -5.378  4.459   2.761   1.00 0.00 ? 32  LEU A HD21 6  
ATOM 9351  H HD22 . LEU A 1 32  ? -5.796  3.086   1.737   1.00 0.00 ? 32  LEU A HD22 6  
ATOM 9352  H HD23 . LEU A 1 32  ? -6.857  3.544   3.075   1.00 0.00 ? 32  LEU A HD23 6  
ATOM 9353  N N    . GLY A 1 33  ? -9.365  7.504   2.013   1.00 0.00 ? 33  GLY A N    6  
ATOM 9354  C CA   . GLY A 1 33  ? -9.933  8.657   2.687   1.00 0.00 ? 33  GLY A CA   6  
ATOM 9355  C C    . GLY A 1 33  ? -8.970  9.259   3.693   1.00 0.00 ? 33  GLY A C    6  
ATOM 9356  O O    . GLY A 1 33  ? -9.381  9.948   4.626   1.00 0.00 ? 33  GLY A O    6  
ATOM 9357  H H    . GLY A 1 33  ? -8.393  7.388   1.987   1.00 0.00 ? 33  GLY A H    6  
ATOM 9358  H HA2  . GLY A 1 33  ? -10.182 9.408   1.950   1.00 0.00 ? 33  GLY A HA2  6  
ATOM 9359  H HA3  . GLY A 1 33  ? -10.834 8.357   3.200   1.00 0.00 ? 33  GLY A HA3  6  
ATOM 9360  N N    . TYR A 1 34  ? -7.685  8.988   3.498   1.00 0.00 ? 34  TYR A N    6  
ATOM 9361  C CA   . TYR A 1 34  ? -6.641  9.495   4.385   1.00 0.00 ? 34  TYR A CA   6  
ATOM 9362  C C    . TYR A 1 34  ? -5.925  10.682  3.746   1.00 0.00 ? 34  TYR A C    6  
ATOM 9363  O O    . TYR A 1 34  ? -6.543  11.486  3.049   1.00 0.00 ? 34  TYR A O    6  
ATOM 9364  C CB   . TYR A 1 34  ? -5.632  8.382   4.685   1.00 0.00 ? 34  TYR A CB   6  
ATOM 9365  C CG   . TYR A 1 34  ? -6.139  7.317   5.628   1.00 0.00 ? 34  TYR A CG   6  
ATOM 9366  C CD1  . TYR A 1 34  ? -7.149  6.443   5.245   1.00 0.00 ? 34  TYR A CD1  6  
ATOM 9367  C CD2  . TYR A 1 34  ? -5.599  7.179   6.899   1.00 0.00 ? 34  TYR A CD2  6  
ATOM 9368  C CE1  . TYR A 1 34  ? -7.607  5.463   6.104   1.00 0.00 ? 34  TYR A CE1  6  
ATOM 9369  C CE2  . TYR A 1 34  ? -6.052  6.202   7.765   1.00 0.00 ? 34  TYR A CE2  6  
ATOM 9370  C CZ   . TYR A 1 34  ? -7.056  5.347   7.363   1.00 0.00 ? 34  TYR A CZ   6  
ATOM 9371  O OH   . TYR A 1 34  ? -7.506  4.372   8.222   1.00 0.00 ? 34  TYR A OH   6  
ATOM 9372  H H    . TYR A 1 34  ? -7.427  8.430   2.734   1.00 0.00 ? 34  TYR A H    6  
ATOM 9373  H HA   . TYR A 1 34  ? -7.106  9.812   5.307   1.00 0.00 ? 34  TYR A HA   6  
ATOM 9374  H HB2  . TYR A 1 34  ? -5.359  7.898   3.759   1.00 0.00 ? 34  TYR A HB2  6  
ATOM 9375  H HB3  . TYR A 1 34  ? -4.746  8.821   5.125   1.00 0.00 ? 34  TYR A HB3  6  
ATOM 9376  H HD1  . TYR A 1 34  ? -7.579  6.539   4.258   1.00 0.00 ? 34  TYR A HD1  6  
ATOM 9377  H HD2  . TYR A 1 34  ? -4.810  7.850   7.210   1.00 0.00 ? 34  TYR A HD2  6  
ATOM 9378  H HE1  . TYR A 1 34  ? -8.392  4.793   5.789   1.00 0.00 ? 34  TYR A HE1  6  
ATOM 9379  H HE2  . TYR A 1 34  ? -5.621  6.112   8.751   1.00 0.00 ? 34  TYR A HE2  6  
ATOM 9380  H HH   . TYR A 1 34  ? -6.927  4.326   8.987   1.00 0.00 ? 34  TYR A HH   6  
ATOM 9381  N N    . SER A 1 35  ? -4.611  10.768  3.975   1.00 0.00 ? 35  SER A N    6  
ATOM 9382  C CA   . SER A 1 35  ? -3.778  11.829  3.414   1.00 0.00 ? 35  SER A CA   6  
ATOM 9383  C C    . SER A 1 35  ? -2.360  11.734  3.957   1.00 0.00 ? 35  SER A C    6  
ATOM 9384  O O    . SER A 1 35  ? -2.092  10.968  4.880   1.00 0.00 ? 35  SER A O    6  
ATOM 9385  C CB   . SER A 1 35  ? -4.348  13.213  3.696   1.00 0.00 ? 35  SER A CB   6  
ATOM 9386  O OG   . SER A 1 35  ? -4.382  13.488  5.085   1.00 0.00 ? 35  SER A OG   6  
ATOM 9387  H H    . SER A 1 35  ? -4.184  10.081  4.529   1.00 0.00 ? 35  SER A H    6  
ATOM 9388  H HA   . SER A 1 35  ? -3.750  11.682  2.347   1.00 0.00 ? 35  SER A HA   6  
ATOM 9389  H HB2  . SER A 1 35  ? -3.729  13.953  3.207   1.00 0.00 ? 35  SER A HB2  6  
ATOM 9390  H HB3  . SER A 1 35  ? -5.349  13.263  3.301   1.00 0.00 ? 35  SER A HB3  6  
ATOM 9391  H HG   . SER A 1 35  ? -5.279  13.705  5.347   1.00 0.00 ? 35  SER A HG   6  
ATOM 9392  N N    . SER A 1 36  ? -1.457  12.509  3.372   1.00 0.00 ? 36  SER A N    6  
ATOM 9393  C CA   . SER A 1 36  ? -0.059  12.514  3.785   1.00 0.00 ? 36  SER A CA   6  
ATOM 9394  C C    . SER A 1 36  ? 0.088   12.537  5.306   1.00 0.00 ? 36  SER A C    6  
ATOM 9395  O O    . SER A 1 36  ? 0.981   11.898  5.857   1.00 0.00 ? 36  SER A O    6  
ATOM 9396  C CB   . SER A 1 36  ? 0.666   13.717  3.179   1.00 0.00 ? 36  SER A CB   6  
ATOM 9397  O OG   . SER A 1 36  ? -0.241  14.769  2.898   1.00 0.00 ? 36  SER A OG   6  
ATOM 9398  H H    . SER A 1 36  ? -1.737  13.095  2.636   1.00 0.00 ? 36  SER A H    6  
ATOM 9399  H HA   . SER A 1 36  ? 0.398   11.610  3.409   1.00 0.00 ? 36  SER A HA   6  
ATOM 9400  H HB2  . SER A 1 36  ? 1.409   14.078  3.875   1.00 0.00 ? 36  SER A HB2  6  
ATOM 9401  H HB3  . SER A 1 36  ? 1.149   13.418  2.261   1.00 0.00 ? 36  SER A HB3  6  
ATOM 9402  H HG   . SER A 1 36  ? 0.094   15.295  2.168   1.00 0.00 ? 36  SER A HG   6  
ATOM 9403  N N    . GLN A 1 37  ? -0.777  13.291  5.977   1.00 0.00 ? 37  GLN A N    6  
ATOM 9404  C CA   . GLN A 1 37  ? -0.723  13.407  7.434   1.00 0.00 ? 37  GLN A CA   6  
ATOM 9405  C C    . GLN A 1 37  ? -1.753  12.516  8.133   1.00 0.00 ? 37  GLN A C    6  
ATOM 9406  O O    . GLN A 1 37  ? -1.629  12.235  9.325   1.00 0.00 ? 37  GLN A O    6  
ATOM 9407  C CB   . GLN A 1 37  ? -0.937  14.863  7.852   1.00 0.00 ? 37  GLN A CB   6  
ATOM 9408  C CG   . GLN A 1 37  ? -2.270  15.438  7.401   1.00 0.00 ? 37  GLN A CG   6  
ATOM 9409  C CD   . GLN A 1 37  ? -2.139  16.833  6.824   1.00 0.00 ? 37  GLN A CD   6  
ATOM 9410  O OE1  . GLN A 1 37  ? -2.372  17.048  5.633   1.00 0.00 ? 37  GLN A OE1  6  
ATOM 9411  N NE2  . GLN A 1 37  ? -1.760  17.789  7.664   1.00 0.00 ? 37  GLN A NE2  6  
ATOM 9412  H H    . GLN A 1 37  ? -1.461  13.790  5.482   1.00 0.00 ? 37  GLN A H    6  
ATOM 9413  H HA   . GLN A 1 37  ? 0.262   13.102  7.748   1.00 0.00 ? 37  GLN A HA   6  
ATOM 9414  H HB2  . GLN A 1 37  ? -0.887  14.928  8.929   1.00 0.00 ? 37  GLN A HB2  6  
ATOM 9415  H HB3  . GLN A 1 37  ? -0.149  15.467  7.427   1.00 0.00 ? 37  GLN A HB3  6  
ATOM 9416  H HG2  . GLN A 1 37  ? -2.692  14.789  6.648   1.00 0.00 ? 37  GLN A HG2  6  
ATOM 9417  H HG3  . GLN A 1 37  ? -2.936  15.477  8.252   1.00 0.00 ? 37  GLN A HG3  6  
ATOM 9418  H HE21 . GLN A 1 37  ? -1.590  17.543  8.597   1.00 0.00 ? 37  GLN A HE21 6  
ATOM 9419  H HE22 . GLN A 1 37  ? -1.664  18.700  7.315   1.00 0.00 ? 37  GLN A HE22 6  
ATOM 9420  N N    . ASP A 1 38  ? -2.782  12.099  7.402   1.00 0.00 ? 38  ASP A N    6  
ATOM 9421  C CA   . ASP A 1 38  ? -3.843  11.272  7.978   1.00 0.00 ? 38  ASP A CA   6  
ATOM 9422  C C    . ASP A 1 38  ? -3.473  9.790   8.030   1.00 0.00 ? 38  ASP A C    6  
ATOM 9423  O O    . ASP A 1 38  ? -4.065  9.030   8.796   1.00 0.00 ? 38  ASP A O    6  
ATOM 9424  C CB   . ASP A 1 38  ? -5.136  11.445  7.182   1.00 0.00 ? 38  ASP A CB   6  
ATOM 9425  C CG   . ASP A 1 38  ? -6.202  12.188  7.963   1.00 0.00 ? 38  ASP A CG   6  
ATOM 9426  O OD1  . ASP A 1 38  ? -6.804  11.580  8.874   1.00 0.00 ? 38  ASP A OD1  6  
ATOM 9427  O OD2  . ASP A 1 38  ? -6.438  13.378  7.665   1.00 0.00 ? 38  ASP A OD2  6  
ATOM 9428  H H    . ASP A 1 38  ? -2.845  12.370  6.463   1.00 0.00 ? 38  ASP A H    6  
ATOM 9429  H HA   . ASP A 1 38  ? -4.012  11.617  8.986   1.00 0.00 ? 38  ASP A HA   6  
ATOM 9430  H HB2  . ASP A 1 38  ? -4.926  12.001  6.281   1.00 0.00 ? 38  ASP A HB2  6  
ATOM 9431  H HB3  . ASP A 1 38  ? -5.521  10.473  6.917   1.00 0.00 ? 38  ASP A HB3  6  
ATOM 9432  N N    . LEU A 1 39  ? -2.514  9.372   7.210   1.00 0.00 ? 39  LEU A N    6  
ATOM 9433  C CA   . LEU A 1 39  ? -2.115  7.967   7.179   1.00 0.00 ? 39  LEU A CA   6  
ATOM 9434  C C    . LEU A 1 39  ? -0.659  7.775   7.600   1.00 0.00 ? 39  LEU A C    6  
ATOM 9435  O O    . LEU A 1 39  ? -0.238  6.657   7.899   1.00 0.00 ? 39  LEU A O    6  
ATOM 9436  C CB   . LEU A 1 39  ? -2.342  7.391   5.779   1.00 0.00 ? 39  LEU A CB   6  
ATOM 9437  C CG   . LEU A 1 39  ? -1.593  8.100   4.656   1.00 0.00 ? 39  LEU A CG   6  
ATOM 9438  C CD1  . LEU A 1 39  ? -0.309  7.358   4.318   1.00 0.00 ? 39  LEU A CD1  6  
ATOM 9439  C CD2  . LEU A 1 39  ? -2.481  8.225   3.429   1.00 0.00 ? 39  LEU A CD2  6  
ATOM 9440  H H    . LEU A 1 39  ? -2.082  10.011  6.608   1.00 0.00 ? 39  LEU A H    6  
ATOM 9441  H HA   . LEU A 1 39  ? -2.743  7.436   7.875   1.00 0.00 ? 39  LEU A HA   6  
ATOM 9442  H HB2  . LEU A 1 39  ? -2.045  6.353   5.782   1.00 0.00 ? 39  LEU A HB2  6  
ATOM 9443  H HB3  . LEU A 1 39  ? -3.398  7.441   5.561   1.00 0.00 ? 39  LEU A HB3  6  
ATOM 9444  H HG   . LEU A 1 39  ? -1.326  9.096   4.981   1.00 0.00 ? 39  LEU A HG   6  
ATOM 9445  H HD11 . LEU A 1 39  ? -0.027  6.730   5.151   1.00 0.00 ? 39  LEU A HD11 6  
ATOM 9446  H HD12 . LEU A 1 39  ? 0.478   8.069   4.122   1.00 0.00 ? 39  LEU A HD12 6  
ATOM 9447  H HD13 . LEU A 1 39  ? -0.468  6.745   3.442   1.00 0.00 ? 39  LEU A HD13 6  
ATOM 9448  H HD21 . LEU A 1 39  ? -3.410  8.700   3.705   1.00 0.00 ? 39  LEU A HD21 6  
ATOM 9449  H HD22 . LEU A 1 39  ? -2.683  7.241   3.032   1.00 0.00 ? 39  LEU A HD22 6  
ATOM 9450  H HD23 . LEU A 1 39  ? -1.979  8.820   2.680   1.00 0.00 ? 39  LEU A HD23 6  
ATOM 9451  N N    . ILE A 1 40  ? 0.107   8.861   7.629   1.00 0.00 ? 40  ILE A N    6  
ATOM 9452  C CA   . ILE A 1 40  ? 1.511   8.786   8.023   1.00 0.00 ? 40  ILE A CA   6  
ATOM 9453  C C    . ILE A 1 40  ? 1.650   8.286   9.458   1.00 0.00 ? 40  ILE A C    6  
ATOM 9454  O O    . ILE A 1 40  ? 0.855   8.639   10.329  1.00 0.00 ? 40  ILE A O    6  
ATOM 9455  C CB   . ILE A 1 40  ? 2.209   10.155  7.884   1.00 0.00 ? 40  ILE A CB   6  
ATOM 9456  C CG1  . ILE A 1 40  ? 3.728   10.010  8.088   1.00 0.00 ? 40  ILE A CG1  6  
ATOM 9457  C CG2  . ILE A 1 40  ? 1.608   11.167  8.854   1.00 0.00 ? 40  ILE A CG2  6  
ATOM 9458  C CD1  . ILE A 1 40  ? 4.188   10.189  9.522   1.00 0.00 ? 40  ILE A CD1  6  
ATOM 9459  H H    . ILE A 1 40  ? -0.278  9.729   7.387   1.00 0.00 ? 40  ILE A H    6  
ATOM 9460  H HA   . ILE A 1 40  ? 2.004   8.087   7.363   1.00 0.00 ? 40  ILE A HA   6  
ATOM 9461  H HB   . ILE A 1 40  ? 2.028   10.517  6.883   1.00 0.00 ? 40  ILE A HB   6  
ATOM 9462  H HG12 . ILE A 1 40  ? 4.029   9.026   7.769   1.00 0.00 ? 40  ILE A HG12 6  
ATOM 9463  H HG13 . ILE A 1 40  ? 4.233   10.748  7.483   1.00 0.00 ? 40  ILE A HG13 6  
ATOM 9464  H HG21 . ILE A 1 40  ? 2.330   11.944  9.058   1.00 0.00 ? 40  ILE A HG21 6  
ATOM 9465  H HG22 . ILE A 1 40  ? 1.347   10.669  9.776   1.00 0.00 ? 40  ILE A HG22 6  
ATOM 9466  H HG23 . ILE A 1 40  ? 0.722   11.603  8.416   1.00 0.00 ? 40  ILE A HG23 6  
ATOM 9467  H HD11 . ILE A 1 40  ? 3.708   9.453   10.148  1.00 0.00 ? 40  ILE A HD11 6  
ATOM 9468  H HD12 . ILE A 1 40  ? 3.928   11.181  9.863   1.00 0.00 ? 40  ILE A HD12 6  
ATOM 9469  H HD13 . ILE A 1 40  ? 5.260   10.059  9.574   1.00 0.00 ? 40  ILE A HD13 6  
ATOM 9470  N N    . GLY A 1 41  ? 2.664   7.460   9.697   1.00 0.00 ? 41  GLY A N    6  
ATOM 9471  C CA   . GLY A 1 41  ? 2.890   6.922   11.025  1.00 0.00 ? 41  GLY A CA   6  
ATOM 9472  C C    . GLY A 1 41  ? 2.494   5.463   11.136  1.00 0.00 ? 41  GLY A C    6  
ATOM 9473  O O    . GLY A 1 41  ? 3.145   4.686   11.833  1.00 0.00 ? 41  GLY A O    6  
ATOM 9474  H H    . GLY A 1 41  ? 3.264   7.212   8.960   1.00 0.00 ? 41  GLY A H    6  
ATOM 9475  H HA2  . GLY A 1 41  ? 3.939   7.015   11.263  1.00 0.00 ? 41  GLY A HA2  6  
ATOM 9476  H HA3  . GLY A 1 41  ? 2.316   7.495   11.737  1.00 0.00 ? 41  GLY A HA3  6  
ATOM 9477  N N    . GLN A 1 42  ? 1.425   5.091   10.440  1.00 0.00 ? 42  GLN A N    6  
ATOM 9478  C CA   . GLN A 1 42  ? 0.945   3.713   10.457  1.00 0.00 ? 42  GLN A CA   6  
ATOM 9479  C C    . GLN A 1 42  ? 1.440   2.960   9.226   1.00 0.00 ? 42  GLN A C    6  
ATOM 9480  O O    . GLN A 1 42  ? 2.326   3.433   8.516   1.00 0.00 ? 42  GLN A O    6  
ATOM 9481  C CB   . GLN A 1 42  ? -0.586  3.678   10.511  1.00 0.00 ? 42  GLN A CB   6  
ATOM 9482  C CG   . GLN A 1 42  ? -1.207  4.915   11.139  1.00 0.00 ? 42  GLN A CG   6  
ATOM 9483  C CD   . GLN A 1 42  ? -2.691  5.033   10.850  1.00 0.00 ? 42  GLN A CD   6  
ATOM 9484  O OE1  . GLN A 1 42  ? -3.516  4.405   11.511  1.00 0.00 ? 42  GLN A OE1  6  
ATOM 9485  N NE2  . GLN A 1 42  ? -3.037  5.839   9.852   1.00 0.00 ? 42  GLN A NE2  6  
ATOM 9486  H H    . GLN A 1 42  ? 0.949   5.755   9.899   1.00 0.00 ? 42  GLN A H    6  
ATOM 9487  H HA   . GLN A 1 42  ? 1.340   3.235   11.340  1.00 0.00 ? 42  GLN A HA   6  
ATOM 9488  H HB2  . GLN A 1 42  ? -0.968  3.581   9.506   1.00 0.00 ? 42  GLN A HB2  6  
ATOM 9489  H HB3  . GLN A 1 42  ? -0.894  2.816   11.086  1.00 0.00 ? 42  GLN A HB3  6  
ATOM 9490  H HG2  . GLN A 1 42  ? -1.067  4.870   12.208  1.00 0.00 ? 42  GLN A HG2  6  
ATOM 9491  H HG3  . GLN A 1 42  ? -0.708  5.791   10.749  1.00 0.00 ? 42  GLN A HG3  6  
ATOM 9492  H HE21 . GLN A 1 42  ? -2.328  6.308   9.368   1.00 0.00 ? 42  GLN A HE21 6  
ATOM 9493  H HE22 . GLN A 1 42  ? -3.992  5.933   9.643   1.00 0.00 ? 42  GLN A HE22 6  
ATOM 9494  N N    . LYS A 1 43  ? 0.857   1.794   8.976   1.00 0.00 ? 43  LYS A N    6  
ATOM 9495  C CA   . LYS A 1 43  ? 1.235   0.982   7.824   1.00 0.00 ? 43  LYS A CA   6  
ATOM 9496  C C    . LYS A 1 43  ? 0.063   0.853   6.859   1.00 0.00 ? 43  LYS A C    6  
ATOM 9497  O O    . LYS A 1 43  ? -1.060  0.587   7.279   1.00 0.00 ? 43  LYS A O    6  
ATOM 9498  C CB   . LYS A 1 43  ? 1.698   -0.403  8.280   1.00 0.00 ? 43  LYS A CB   6  
ATOM 9499  C CG   . LYS A 1 43  ? 2.792   -0.362  9.336   1.00 0.00 ? 43  LYS A CG   6  
ATOM 9500  C CD   . LYS A 1 43  ? 2.315   -0.949  10.654  1.00 0.00 ? 43  LYS A CD   6  
ATOM 9501  C CE   . LYS A 1 43  ? 3.483   -1.325  11.552  1.00 0.00 ? 43  LYS A CE   6  
ATOM 9502  N NZ   . LYS A 1 43  ? 3.038   -1.653  12.936  1.00 0.00 ? 43  LYS A NZ   6  
ATOM 9503  H H    . LYS A 1 43  ? 0.152   1.472   9.574   1.00 0.00 ? 43  LYS A H    6  
ATOM 9504  H HA   . LYS A 1 43  ? 2.050   1.479   7.319   1.00 0.00 ? 43  LYS A HA   6  
ATOM 9505  H HB2  . LYS A 1 43  ? 0.854   -0.938  8.688   1.00 0.00 ? 43  LYS A HB2  6  
ATOM 9506  H HB3  . LYS A 1 43  ? 2.075   -0.944  7.424   1.00 0.00 ? 43  LYS A HB3  6  
ATOM 9507  H HG2  . LYS A 1 43  ? 3.639   -0.933  8.985   1.00 0.00 ? 43  LYS A HG2  6  
ATOM 9508  H HG3  . LYS A 1 43  ? 3.087   0.664   9.494   1.00 0.00 ? 43  LYS A HG3  6  
ATOM 9509  H HD2  . LYS A 1 43  ? 1.706   -0.218  11.164  1.00 0.00 ? 43  LYS A HD2  6  
ATOM 9510  H HD3  . LYS A 1 43  ? 1.728   -1.834  10.453  1.00 0.00 ? 43  LYS A HD3  6  
ATOM 9511  H HE2  . LYS A 1 43  ? 3.981   -2.186  11.131  1.00 0.00 ? 43  LYS A HE2  6  
ATOM 9512  H HE3  . LYS A 1 43  ? 4.173   -0.495  11.592  1.00 0.00 ? 43  LYS A HE3  6  
ATOM 9513  H HZ1  . LYS A 1 43  ? 2.727   -2.645  12.986  1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 9514  H HZ2  . LYS A 1 43  ? 2.245   -1.038  13.210  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 9515  H HZ3  . LYS A 1 43  ? 3.820   -1.510  13.606  1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 9516  N N    . LEU A 1 44  ? 0.328   1.076   5.573   1.00 0.00 ? 44  LEU A N    6  
ATOM 9517  C CA   . LEU A 1 44  ? -0.712  1.013   4.547   1.00 0.00 ? 44  LEU A CA   6  
ATOM 9518  C C    . LEU A 1 44  ? -1.629  -0.196  4.726   1.00 0.00 ? 44  LEU A C    6  
ATOM 9519  O O    . LEU A 1 44  ? -2.841  -0.086  4.568   1.00 0.00 ? 44  LEU A O    6  
ATOM 9520  C CB   . LEU A 1 44  ? -0.098  0.986   3.141   1.00 0.00 ? 44  LEU A CB   6  
ATOM 9521  C CG   . LEU A 1 44  ? 1.339   0.460   3.040   1.00 0.00 ? 44  LEU A CG   6  
ATOM 9522  C CD1  . LEU A 1 44  ? 1.382   -1.049  3.224   1.00 0.00 ? 44  LEU A CD1  6  
ATOM 9523  C CD2  . LEU A 1 44  ? 1.943   0.843   1.699   1.00 0.00 ? 44  LEU A CD2  6  
ATOM 9524  H H    . LEU A 1 44  ? 1.239   1.322   5.312   1.00 0.00 ? 44  LEU A H    6  
ATOM 9525  H HA   . LEU A 1 44  ? -1.311  1.907   4.640   1.00 0.00 ? 44  LEU A HA   6  
ATOM 9526  H HB2  . LEU A 1 44  ? -0.724  0.368   2.514   1.00 0.00 ? 44  LEU A HB2  6  
ATOM 9527  H HB3  . LEU A 1 44  ? -0.114  1.992   2.749   1.00 0.00 ? 44  LEU A HB3  6  
ATOM 9528  H HG   . LEU A 1 44  ? 1.937   0.911   3.819   1.00 0.00 ? 44  LEU A HG   6  
ATOM 9529  H HD11 . LEU A 1 44  ? 0.705   -1.334  4.013   1.00 0.00 ? 44  LEU A HD11 6  
ATOM 9530  H HD12 . LEU A 1 44  ? 2.387   -1.351  3.485   1.00 0.00 ? 44  LEU A HD12 6  
ATOM 9531  H HD13 . LEU A 1 44  ? 1.089   -1.535  2.303   1.00 0.00 ? 44  LEU A HD13 6  
ATOM 9532  H HD21 . LEU A 1 44  ? 3.020   0.816   1.771   1.00 0.00 ? 44  LEU A HD21 6  
ATOM 9533  H HD22 . LEU A 1 44  ? 1.623   1.837   1.431   1.00 0.00 ? 44  LEU A HD22 6  
ATOM 9534  H HD23 . LEU A 1 44  ? 1.616   0.143   0.944   1.00 0.00 ? 44  LEU A HD23 6  
ATOM 9535  N N    . THR A 1 45  ? -1.042  -1.345  5.037   1.00 0.00 ? 45  THR A N    6  
ATOM 9536  C CA   . THR A 1 45  ? -1.796  -2.587  5.211   1.00 0.00 ? 45  THR A CA   6  
ATOM 9537  C C    . THR A 1 45  ? -2.950  -2.446  6.198   1.00 0.00 ? 45  THR A C    6  
ATOM 9538  O O    . THR A 1 45  ? -3.877  -3.254  6.190   1.00 0.00 ? 45  THR A O    6  
ATOM 9539  C CB   . THR A 1 45  ? -0.878  -3.724  5.671   1.00 0.00 ? 45  THR A CB   6  
ATOM 9540  O OG1  . THR A 1 45  ? -0.328  -3.428  6.960   1.00 0.00 ? 45  THR A OG1  6  
ATOM 9541  C CG2  . THR A 1 45  ? 0.239   -3.916  4.668   1.00 0.00 ? 45  THR A CG2  6  
ATOM 9542  H H    . THR A 1 45  ? -0.066  -1.364  5.132   1.00 0.00 ? 45  THR A H    6  
ATOM 9543  H HA   . THR A 1 45  ? -2.201  -2.861  4.249   1.00 0.00 ? 45  THR A HA   6  
ATOM 9544  H HB   . THR A 1 45  ? -1.451  -4.636  5.727   1.00 0.00 ? 45  THR A HB   6  
ATOM 9545  H HG1  . THR A 1 45  ? -1.035  -3.170  7.558   1.00 0.00 ? 45  THR A HG1  6  
ATOM 9546  H HG21 . THR A 1 45  ? 0.308   -4.957  4.399   1.00 0.00 ? 45  THR A HG21 6  
ATOM 9547  H HG22 . THR A 1 45  ? 1.173   -3.591  5.103   1.00 0.00 ? 45  THR A HG22 6  
ATOM 9548  H HG23 . THR A 1 45  ? 0.028   -3.327  3.787   1.00 0.00 ? 45  THR A HG23 6  
ATOM 9549  N N    . GLN A 1 46  ? -2.904  -1.416  7.030   1.00 0.00 ? 46  GLN A N    6  
ATOM 9550  C CA   . GLN A 1 46  ? -3.963  -1.184  8.000   1.00 0.00 ? 46  GLN A CA   6  
ATOM 9551  C C    . GLN A 1 46  ? -5.259  -0.875  7.269   1.00 0.00 ? 46  GLN A C    6  
ATOM 9552  O O    . GLN A 1 46  ? -6.354  -1.074  7.796   1.00 0.00 ? 46  GLN A O    6  
ATOM 9553  C CB   . GLN A 1 46  ? -3.595  -0.031  8.936   1.00 0.00 ? 46  GLN A CB   6  
ATOM 9554  C CG   . GLN A 1 46  ? -3.534  -0.435  10.400  1.00 0.00 ? 46  GLN A CG   6  
ATOM 9555  C CD   . GLN A 1 46  ? -2.113  -0.507  10.926  1.00 0.00 ? 46  GLN A CD   6  
ATOM 9556  O OE1  . GLN A 1 46  ? -1.619  -1.583  11.266  1.00 0.00 ? 46  GLN A OE1  6  
ATOM 9557  N NE2  . GLN A 1 46  ? -1.447  0.640   10.995  1.00 0.00 ? 46  GLN A NE2  6  
ATOM 9558  H H    . GLN A 1 46  ? -2.151  -0.797  6.981   1.00 0.00 ? 46  GLN A H    6  
ATOM 9559  H HA   . GLN A 1 46  ? -4.093  -2.087  8.579   1.00 0.00 ? 46  GLN A HA   6  
ATOM 9560  H HB2  . GLN A 1 46  ? -2.628  0.355   8.649   1.00 0.00 ? 46  GLN A HB2  6  
ATOM 9561  H HB3  . GLN A 1 46  ? -4.331  0.752   8.831   1.00 0.00 ? 46  GLN A HB3  6  
ATOM 9562  H HG2  . GLN A 1 46  ? -4.079  0.290   10.983  1.00 0.00 ? 46  GLN A HG2  6  
ATOM 9563  H HG3  . GLN A 1 46  ? -3.993  -1.406  10.511  1.00 0.00 ? 46  GLN A HG3  6  
ATOM 9564  H HE21 . GLN A 1 46  ? -1.905  1.457   10.704  1.00 0.00 ? 46  GLN A HE21 6  
ATOM 9565  H HE22 . GLN A 1 46  ? -0.529  0.623   11.332  1.00 0.00 ? 46  GLN A HE22 6  
ATOM 9566  N N    . PHE A 1 47  ? -5.119  -0.364  6.055   1.00 0.00 ? 47  PHE A N    6  
ATOM 9567  C CA   . PHE A 1 47  ? -6.270  -0.001  5.240   1.00 0.00 ? 47  PHE A CA   6  
ATOM 9568  C C    . PHE A 1 47  ? -6.432  -0.957  4.064   1.00 0.00 ? 47  PHE A C    6  
ATOM 9569  O O    . PHE A 1 47  ? -6.933  -0.571  3.009   1.00 0.00 ? 47  PHE A O    6  
ATOM 9570  C CB   . PHE A 1 47  ? -6.130  1.438   4.733   1.00 0.00 ? 47  PHE A CB   6  
ATOM 9571  C CG   . PHE A 1 47  ? -5.094  2.251   5.464   1.00 0.00 ? 47  PHE A CG   6  
ATOM 9572  C CD1  . PHE A 1 47  ? -5.216  2.494   6.825   1.00 0.00 ? 47  PHE A CD1  6  
ATOM 9573  C CD2  . PHE A 1 47  ? -3.999  2.769   4.792   1.00 0.00 ? 47  PHE A CD2  6  
ATOM 9574  C CE1  . PHE A 1 47  ? -4.265  3.238   7.497   1.00 0.00 ? 47  PHE A CE1  6  
ATOM 9575  C CE2  . PHE A 1 47  ? -3.045  3.515   5.460   1.00 0.00 ? 47  PHE A CE2  6  
ATOM 9576  C CZ   . PHE A 1 47  ? -3.178  3.748   6.814   1.00 0.00 ? 47  PHE A CZ   6  
ATOM 9577  H H    . PHE A 1 47  ? -4.214  -0.204  5.708   1.00 0.00 ? 47  PHE A H    6  
ATOM 9578  H HA   . PHE A 1 47  ? -7.148  -0.067  5.864   1.00 0.00 ? 47  PHE A HA   6  
ATOM 9579  H HB2  . PHE A 1 47  ? -5.852  1.416   3.690   1.00 0.00 ? 47  PHE A HB2  6  
ATOM 9580  H HB3  . PHE A 1 47  ? -7.080  1.942   4.837   1.00 0.00 ? 47  PHE A HB3  6  
ATOM 9581  H HD1  . PHE A 1 47  ? -6.064  2.095   7.359   1.00 0.00 ? 47  PHE A HD1  6  
ATOM 9582  H HD2  . PHE A 1 47  ? -3.895  2.589   3.732   1.00 0.00 ? 47  PHE A HD2  6  
ATOM 9583  H HE1  . PHE A 1 47  ? -4.371  3.421   8.556   1.00 0.00 ? 47  PHE A HE1  6  
ATOM 9584  H HE2  . PHE A 1 47  ? -2.197  3.913   4.922   1.00 0.00 ? 47  PHE A HE2  6  
ATOM 9585  H HZ   . PHE A 1 47  ? -2.434  4.331   7.338   1.00 0.00 ? 47  PHE A HZ   6  
ATOM 9586  N N    . PHE A 1 48  ? -6.016  -2.210  4.253   1.00 0.00 ? 48  PHE A N    6  
ATOM 9587  C CA   . PHE A 1 48  ? -6.127  -3.222  3.204   1.00 0.00 ? 48  PHE A CA   6  
ATOM 9588  C C    . PHE A 1 48  ? -6.425  -4.596  3.798   1.00 0.00 ? 48  PHE A C    6  
ATOM 9589  O O    . PHE A 1 48  ? -5.875  -4.967  4.835   1.00 0.00 ? 48  PHE A O    6  
ATOM 9590  C CB   . PHE A 1 48  ? -4.844  -3.285  2.365   1.00 0.00 ? 48  PHE A CB   6  
ATOM 9591  C CG   . PHE A 1 48  ? -4.452  -1.968  1.754   1.00 0.00 ? 48  PHE A CG   6  
ATOM 9592  C CD1  . PHE A 1 48  ? -5.280  -1.337  0.842   1.00 0.00 ? 48  PHE A CD1  6  
ATOM 9593  C CD2  . PHE A 1 48  ? -3.260  -1.361  2.099   1.00 0.00 ? 48  PHE A CD2  6  
ATOM 9594  C CE1  . PHE A 1 48  ? -4.926  -0.124  0.286   1.00 0.00 ? 48  PHE A CE1  6  
ATOM 9595  C CE2  . PHE A 1 48  ? -2.898  -0.148  1.546   1.00 0.00 ? 48  PHE A CE2  6  
ATOM 9596  C CZ   . PHE A 1 48  ? -3.732  0.471   0.639   1.00 0.00 ? 48  PHE A CZ   6  
ATOM 9597  H H    . PHE A 1 48  ? -5.633  -2.457  5.119   1.00 0.00 ? 48  PHE A H    6  
ATOM 9598  H HA   . PHE A 1 48  ? -6.947  -2.940  2.563   1.00 0.00 ? 48  PHE A HA   6  
ATOM 9599  H HB2  . PHE A 1 48  ? -4.028  -3.615  2.990   1.00 0.00 ? 48  PHE A HB2  6  
ATOM 9600  H HB3  . PHE A 1 48  ? -4.984  -3.996  1.558   1.00 0.00 ? 48  PHE A HB3  6  
ATOM 9601  H HD1  . PHE A 1 48  ? -6.214  -1.800  0.567   1.00 0.00 ? 48  PHE A HD1  6  
ATOM 9602  H HD2  . PHE A 1 48  ? -2.605  -1.843  2.808   1.00 0.00 ? 48  PHE A HD2  6  
ATOM 9603  H HE1  . PHE A 1 48  ? -5.581  0.357   -0.426  1.00 0.00 ? 48  PHE A HE1  6  
ATOM 9604  H HE2  . PHE A 1 48  ? -1.963  0.315   1.822   1.00 0.00 ? 48  PHE A HE2  6  
ATOM 9605  H HZ   . PHE A 1 48  ? -3.452  1.420   0.206   1.00 0.00 ? 48  PHE A HZ   6  
ATOM 9606  N N    . LEU A 1 49  ? -7.298  -5.337  3.111   1.00 0.00 ? 49  LEU A N    6  
ATOM 9607  C CA   . LEU A 1 49  ? -7.717  -6.690  3.499   1.00 0.00 ? 49  LEU A CA   6  
ATOM 9608  C C    . LEU A 1 49  ? -7.388  -7.043  4.952   1.00 0.00 ? 49  LEU A C    6  
ATOM 9609  O O    . LEU A 1 49  ? -6.339  -7.615  5.240   1.00 0.00 ? 49  LEU A O    6  
ATOM 9610  C CB   . LEU A 1 49  ? -7.111  -7.751  2.558   1.00 0.00 ? 49  LEU A CB   6  
ATOM 9611  C CG   . LEU A 1 49  ? -5.748  -7.426  1.920   1.00 0.00 ? 49  LEU A CG   6  
ATOM 9612  C CD1  . LEU A 1 49  ? -5.863  -6.267  0.942   1.00 0.00 ? 49  LEU A CD1  6  
ATOM 9613  C CD2  . LEU A 1 49  ? -4.695  -7.132  2.983   1.00 0.00 ? 49  LEU A CD2  6  
ATOM 9614  H H    . LEU A 1 49  ? -7.677  -4.955  2.292   1.00 0.00 ? 49  LEU A H    6  
ATOM 9615  H HA   . LEU A 1 49  ? -8.790  -6.722  3.389   1.00 0.00 ? 49  LEU A HA   6  
ATOM 9616  H HB2  . LEU A 1 49  ? -7.005  -8.667  3.118   1.00 0.00 ? 49  LEU A HB2  6  
ATOM 9617  H HB3  . LEU A 1 49  ? -7.818  -7.925  1.760   1.00 0.00 ? 49  LEU A HB3  6  
ATOM 9618  H HG   . LEU A 1 49  ? -5.416  -8.289  1.361   1.00 0.00 ? 49  LEU A HG   6  
ATOM 9619  H HD11 . LEU A 1 49  ? -6.776  -6.367  0.374   1.00 0.00 ? 49  LEU A HD11 6  
ATOM 9620  H HD12 . LEU A 1 49  ? -5.017  -6.275  0.271   1.00 0.00 ? 49  LEU A HD12 6  
ATOM 9621  H HD13 . LEU A 1 49  ? -5.880  -5.336  1.489   1.00 0.00 ? 49  LEU A HD13 6  
ATOM 9622  H HD21 . LEU A 1 49  ? -3.821  -6.701  2.515   1.00 0.00 ? 49  LEU A HD21 6  
ATOM 9623  H HD22 . LEU A 1 49  ? -4.419  -8.050  3.480   1.00 0.00 ? 49  LEU A HD22 6  
ATOM 9624  H HD23 . LEU A 1 49  ? -5.094  -6.437  3.707   1.00 0.00 ? 49  LEU A HD23 6  
ATOM 9625  N N    . ARG A 1 50  ? -8.313  -6.726  5.856   1.00 0.00 ? 50  ARG A N    6  
ATOM 9626  C CA   . ARG A 1 50  ? -8.150  -7.029  7.278   1.00 0.00 ? 50  ARG A CA   6  
ATOM 9627  C C    . ARG A 1 50  ? -6.875  -6.415  7.854   1.00 0.00 ? 50  ARG A C    6  
ATOM 9628  O O    . ARG A 1 50  ? -5.763  -6.822  7.518   1.00 0.00 ? 50  ARG A O    6  
ATOM 9629  C CB   . ARG A 1 50  ? -8.141  -8.543  7.500   1.00 0.00 ? 50  ARG A CB   6  
ATOM 9630  C CG   . ARG A 1 50  ? -8.654  -8.959  8.868   1.00 0.00 ? 50  ARG A CG   6  
ATOM 9631  C CD   . ARG A 1 50  ? -7.861  -10.127 9.428   1.00 0.00 ? 50  ARG A CD   6  
ATOM 9632  N NE   . ARG A 1 50  ? -8.424  -10.621 10.680  1.00 0.00 ? 50  ARG A NE   6  
ATOM 9633  C CZ   . ARG A 1 50  ? -8.899  -11.853 10.843  1.00 0.00 ? 50  ARG A CZ   6  
ATOM 9634  N NH1  . ARG A 1 50  ? -8.880  -12.712 9.833   1.00 0.00 ? 50  ARG A NH1  6  
ATOM 9635  N NH2  . ARG A 1 50  ? -9.397  -12.225 12.014  1.00 0.00 ? 50  ARG A NH2  6  
ATOM 9636  H H    . ARG A 1 50  ? -9.139  -6.293  5.556   1.00 0.00 ? 50  ARG A H    6  
ATOM 9637  H HA   . ARG A 1 50  ? -8.996  -6.609  7.796   1.00 0.00 ? 50  ARG A HA   6  
ATOM 9638  H HB2  . ARG A 1 50  ? -8.763  -9.008  6.749   1.00 0.00 ? 50  ARG A HB2  6  
ATOM 9639  H HB3  . ARG A 1 50  ? -7.130  -8.906  7.393   1.00 0.00 ? 50  ARG A HB3  6  
ATOM 9640  H HG2  . ARG A 1 50  ? -8.567  -8.122  9.544   1.00 0.00 ? 50  ARG A HG2  6  
ATOM 9641  H HG3  . ARG A 1 50  ? -9.691  -9.248  8.780   1.00 0.00 ? 50  ARG A HG3  6  
ATOM 9642  H HD2  . ARG A 1 50  ? -7.864  -10.929 8.703   1.00 0.00 ? 50  ARG A HD2  6  
ATOM 9643  H HD3  . ARG A 1 50  ? -6.844  -9.807  9.604   1.00 0.00 ? 50  ARG A HD3  6  
ATOM 9644  H HE   . ARG A 1 50  ? -8.449  -10.003 11.443  1.00 0.00 ? 50  ARG A HE   6  
ATOM 9645  H HH11 . ARG A 1 50  ? -8.506  -12.435 8.947   1.00 0.00 ? 50  ARG A HH11 6  
ATOM 9646  H HH12 . ARG A 1 50  ? -9.239  -13.637 9.956   1.00 0.00 ? 50  ARG A HH12 6  
ATOM 9647  H HH21 . ARG A 1 50  ? -9.413  -11.581 12.778  1.00 0.00 ? 50  ARG A HH21 6  
ATOM 9648  H HH22 . ARG A 1 50  ? -9.753  -13.151 12.134  1.00 0.00 ? 50  ARG A HH22 6  
ATOM 9649  N N    . SER A 1 51  ? -7.049  -5.434  8.733   1.00 0.00 ? 51  SER A N    6  
ATOM 9650  C CA   . SER A 1 51  ? -5.921  -4.760  9.367   1.00 0.00 ? 51  SER A CA   6  
ATOM 9651  C C    . SER A 1 51  ? -5.490  -5.457  10.654  1.00 0.00 ? 51  SER A C    6  
ATOM 9652  O O    . SER A 1 51  ? -4.518  -5.046  11.289  1.00 0.00 ? 51  SER A O    6  
ATOM 9653  C CB   . SER A 1 51  ? -6.281  -3.308  9.672   1.00 0.00 ? 51  SER A CB   6  
ATOM 9654  O OG   . SER A 1 51  ? -7.635  -3.191  10.076  1.00 0.00 ? 51  SER A OG   6  
ATOM 9655  H H    . SER A 1 51  ? -7.961  -5.157  8.963   1.00 0.00 ? 51  SER A H    6  
ATOM 9656  H HA   . SER A 1 51  ? -5.097  -4.774  8.670   1.00 0.00 ? 51  SER A HA   6  
ATOM 9657  H HB2  . SER A 1 51  ? -5.648  -2.944  10.468  1.00 0.00 ? 51  SER A HB2  6  
ATOM 9658  H HB3  . SER A 1 51  ? -6.129  -2.708  8.789   1.00 0.00 ? 51  SER A HB3  6  
ATOM 9659  H HG   . SER A 1 51  ? -8.180  -3.778  9.548   1.00 0.00 ? 51  SER A HG   6  
ATOM 9660  N N    . ASP A 1 52  ? -6.226  -6.486  11.056  1.00 0.00 ? 52  ASP A N    6  
ATOM 9661  C CA   . ASP A 1 52  ? -5.916  -7.197  12.294  1.00 0.00 ? 52  ASP A CA   6  
ATOM 9662  C C    . ASP A 1 52  ? -4.736  -8.159  12.143  1.00 0.00 ? 52  ASP A C    6  
ATOM 9663  O O    . ASP A 1 52  ? -3.656  -7.912  12.679  1.00 0.00 ? 52  ASP A O    6  
ATOM 9664  C CB   . ASP A 1 52  ? -7.147  -7.965  12.780  1.00 0.00 ? 52  ASP A CB   6  
ATOM 9665  C CG   . ASP A 1 52  ? -7.536  -7.592  14.197  1.00 0.00 ? 52  ASP A CG   6  
ATOM 9666  O OD1  . ASP A 1 52  ? -7.958  -6.436  14.412  1.00 0.00 ? 52  ASP A OD1  6  
ATOM 9667  O OD2  . ASP A 1 52  ? -7.421  -8.456  15.092  1.00 0.00 ? 52  ASP A OD2  6  
ATOM 9668  H H    . ASP A 1 52  ? -7.005  -6.759  10.527  1.00 0.00 ? 52  ASP A H    6  
ATOM 9669  H HA   . ASP A 1 52  ? -5.659  -6.457  13.036  1.00 0.00 ? 52  ASP A HA   6  
ATOM 9670  H HB2  . ASP A 1 52  ? -7.979  -7.747  12.129  1.00 0.00 ? 52  ASP A HB2  6  
ATOM 9671  H HB3  . ASP A 1 52  ? -6.937  -9.024  12.750  1.00 0.00 ? 52  ASP A HB3  6  
ATOM 9672  N N    . SER A 1 53  ? -4.952  -9.266  11.439  1.00 0.00 ? 53  SER A N    6  
ATOM 9673  C CA   . SER A 1 53  ? -3.904  -10.271 11.256  1.00 0.00 ? 53  SER A CA   6  
ATOM 9674  C C    . SER A 1 53  ? -3.116  -10.077 9.964   1.00 0.00 ? 53  SER A C    6  
ATOM 9675  O O    . SER A 1 53  ? -1.888  -10.159 9.960   1.00 0.00 ? 53  SER A O    6  
ATOM 9676  C CB   . SER A 1 53  ? -4.513  -11.674 11.282  1.00 0.00 ? 53  SER A CB   6  
ATOM 9677  O OG   . SER A 1 53  ? -5.461  -11.840 10.243  1.00 0.00 ? 53  SER A OG   6  
ATOM 9678  H H    . SER A 1 53  ? -5.838  -9.423  11.051  1.00 0.00 ? 53  SER A H    6  
ATOM 9679  H HA   . SER A 1 53  ? -3.223  -10.182 12.087  1.00 0.00 ? 53  SER A HA   6  
ATOM 9680  H HB2  . SER A 1 53  ? -3.729  -12.406 11.153  1.00 0.00 ? 53  SER A HB2  6  
ATOM 9681  H HB3  . SER A 1 53  ? -5.001  -11.832 12.230  1.00 0.00 ? 53  SER A HB3  6  
ATOM 9682  H HG   . SER A 1 53  ? -5.153  -12.510 9.630   1.00 0.00 ? 53  SER A HG   6  
ATOM 9683  N N    . ASP A 1 54  ? -3.827  -9.859  8.862   1.00 0.00 ? 54  ASP A N    6  
ATOM 9684  C CA   . ASP A 1 54  ? -3.195  -9.695  7.553   1.00 0.00 ? 54  ASP A CA   6  
ATOM 9685  C C    . ASP A 1 54  ? -2.116  -8.616  7.549   1.00 0.00 ? 54  ASP A C    6  
ATOM 9686  O O    . ASP A 1 54  ? -1.314  -8.543  6.618   1.00 0.00 ? 54  ASP A O    6  
ATOM 9687  C CB   . ASP A 1 54  ? -4.251  -9.379  6.492   1.00 0.00 ? 54  ASP A CB   6  
ATOM 9688  C CG   . ASP A 1 54  ? -5.176  -10.551 6.230   1.00 0.00 ? 54  ASP A CG   6  
ATOM 9689  O OD1  . ASP A 1 54  ? -5.811  -11.034 7.192   1.00 0.00 ? 54  ASP A OD1  6  
ATOM 9690  O OD2  . ASP A 1 54  ? -5.268  -10.984 5.062   1.00 0.00 ? 54  ASP A OD2  6  
ATOM 9691  H H    . ASP A 1 54  ? -4.805  -9.832  8.926   1.00 0.00 ? 54  ASP A H    6  
ATOM 9692  H HA   . ASP A 1 54  ? -2.730  -10.636 7.304   1.00 0.00 ? 54  ASP A HA   6  
ATOM 9693  H HB2  . ASP A 1 54  ? -4.846  -8.540  6.824   1.00 0.00 ? 54  ASP A HB2  6  
ATOM 9694  H HB3  . ASP A 1 54  ? -3.757  -9.120  5.568   1.00 0.00 ? 54  ASP A HB3  6  
ATOM 9695  N N    . VAL A 1 55  ? -2.090  -7.782  8.581   1.00 0.00 ? 55  VAL A N    6  
ATOM 9696  C CA   . VAL A 1 55  ? -1.095  -6.718  8.667   1.00 0.00 ? 55  VAL A CA   6  
ATOM 9697  C C    . VAL A 1 55  ? 0.181   -7.213  9.342   1.00 0.00 ? 55  VAL A C    6  
ATOM 9698  O O    . VAL A 1 55  ? 1.277   -6.744  9.037   1.00 0.00 ? 55  VAL A O    6  
ATOM 9699  C CB   . VAL A 1 55  ? -1.650  -5.500  9.433   1.00 0.00 ? 55  VAL A CB   6  
ATOM 9700  C CG1  . VAL A 1 55  ? -0.533  -4.555  9.854   1.00 0.00 ? 55  VAL A CG1  6  
ATOM 9701  C CG2  . VAL A 1 55  ? -2.674  -4.772  8.579   1.00 0.00 ? 55  VAL A CG2  6  
ATOM 9702  H H    . VAL A 1 55  ? -2.751  -7.882  9.298   1.00 0.00 ? 55  VAL A H    6  
ATOM 9703  H HA   . VAL A 1 55  ? -0.857  -6.405  7.661   1.00 0.00 ? 55  VAL A HA   6  
ATOM 9704  H HB   . VAL A 1 55  ? -2.146  -5.856  10.323  1.00 0.00 ? 55  VAL A HB   6  
ATOM 9705  H HG11 . VAL A 1 55  ? 0.243   -4.557  9.102   1.00 0.00 ? 55  VAL A HG11 6  
ATOM 9706  H HG12 . VAL A 1 55  ? -0.121  -4.884  10.797  1.00 0.00 ? 55  VAL A HG12 6  
ATOM 9707  H HG13 . VAL A 1 55  ? -0.927  -3.556  9.962   1.00 0.00 ? 55  VAL A HG13 6  
ATOM 9708  H HG21 . VAL A 1 55  ? -2.932  -5.383  7.724   1.00 0.00 ? 55  VAL A HG21 6  
ATOM 9709  H HG22 . VAL A 1 55  ? -2.259  -3.836  8.240   1.00 0.00 ? 55  VAL A HG22 6  
ATOM 9710  H HG23 . VAL A 1 55  ? -3.560  -4.582  9.164   1.00 0.00 ? 55  VAL A HG23 6  
ATOM 9711  N N    . VAL A 1 56  ? 0.033   -8.160  10.257  1.00 0.00 ? 56  VAL A N    6  
ATOM 9712  C CA   . VAL A 1 56  ? 1.174   -8.711  10.975  1.00 0.00 ? 56  VAL A CA   6  
ATOM 9713  C C    . VAL A 1 56  ? 1.934   -9.727  10.124  1.00 0.00 ? 56  VAL A C    6  
ATOM 9714  O O    . VAL A 1 56  ? 3.128   -9.952  10.328  1.00 0.00 ? 56  VAL A O    6  
ATOM 9715  C CB   . VAL A 1 56  ? 0.727   -9.377  12.294  1.00 0.00 ? 56  VAL A CB   6  
ATOM 9716  C CG1  . VAL A 1 56  ? 0.337   -10.832 12.076  1.00 0.00 ? 56  VAL A CG1  6  
ATOM 9717  C CG2  . VAL A 1 56  ? 1.821   -9.264  13.346  1.00 0.00 ? 56  VAL A CG2  6  
ATOM 9718  H H    . VAL A 1 56  ? -0.865  -8.495  10.458  1.00 0.00 ? 56  VAL A H    6  
ATOM 9719  H HA   . VAL A 1 56  ? 1.838   -7.895  11.218  1.00 0.00 ? 56  VAL A HA   6  
ATOM 9720  H HB   . VAL A 1 56  ? -0.144  -8.851  12.657  1.00 0.00 ? 56  VAL A HB   6  
ATOM 9721  H HG11 . VAL A 1 56  ? -0.323  -11.152 12.868  1.00 0.00 ? 56  VAL A HG11 6  
ATOM 9722  H HG12 . VAL A 1 56  ? 1.225   -11.446 12.074  1.00 0.00 ? 56  VAL A HG12 6  
ATOM 9723  H HG13 . VAL A 1 56  ? -0.169  -10.928 11.125  1.00 0.00 ? 56  VAL A HG13 6  
ATOM 9724  H HG21 . VAL A 1 56  ? 2.596   -8.603  12.988  1.00 0.00 ? 56  VAL A HG21 6  
ATOM 9725  H HG22 . VAL A 1 56  ? 2.239   -10.240 13.537  1.00 0.00 ? 56  VAL A HG22 6  
ATOM 9726  H HG23 . VAL A 1 56  ? 1.404   -8.867  14.260  1.00 0.00 ? 56  VAL A HG23 6  
ATOM 9727  N N    . GLU A 1 57  ? 1.236   -10.349 9.178   1.00 0.00 ? 57  GLU A N    6  
ATOM 9728  C CA   . GLU A 1 57  ? 1.846   -11.351 8.310   1.00 0.00 ? 57  GLU A CA   6  
ATOM 9729  C C    . GLU A 1 57  ? 2.424   -10.734 7.038   1.00 0.00 ? 57  GLU A C    6  
ATOM 9730  O O    . GLU A 1 57  ? 3.533   -11.071 6.623   1.00 0.00 ? 57  GLU A O    6  
ATOM 9731  C CB   . GLU A 1 57  ? 0.825   -12.428 7.942   1.00 0.00 ? 57  GLU A CB   6  
ATOM 9732  C CG   . GLU A 1 57  ? -0.572  -11.891 7.686   1.00 0.00 ? 57  GLU A CG   6  
ATOM 9733  C CD   . GLU A 1 57  ? -1.642  -12.948 7.873   1.00 0.00 ? 57  GLU A CD   6  
ATOM 9734  O OE1  . GLU A 1 57  ? -1.435  -14.090 7.412   1.00 0.00 ? 57  GLU A OE1  6  
ATOM 9735  O OE2  . GLU A 1 57  ? -2.686  -12.636 8.483   1.00 0.00 ? 57  GLU A OE2  6  
ATOM 9736  H H    . GLU A 1 57  ? 0.285   -10.133 9.065   1.00 0.00 ? 57  GLU A H    6  
ATOM 9737  H HA   . GLU A 1 57  ? 2.651   -11.813 8.861   1.00 0.00 ? 57  GLU A HA   6  
ATOM 9738  H HB2  . GLU A 1 57  ? 1.160   -12.936 7.050   1.00 0.00 ? 57  GLU A HB2  6  
ATOM 9739  H HB3  . GLU A 1 57  ? 0.770   -13.142 8.751   1.00 0.00 ? 57  GLU A HB3  6  
ATOM 9740  H HG2  . GLU A 1 57  ? -0.765  -11.081 8.374   1.00 0.00 ? 57  GLU A HG2  6  
ATOM 9741  H HG3  . GLU A 1 57  ? -0.622  -11.523 6.672   1.00 0.00 ? 57  GLU A HG3  6  
ATOM 9742  N N    . ALA A 1 58  ? 1.658   -9.848  6.411   1.00 0.00 ? 58  ALA A N    6  
ATOM 9743  C CA   . ALA A 1 58  ? 2.084   -9.203  5.174   1.00 0.00 ? 58  ALA A CA   6  
ATOM 9744  C C    . ALA A 1 58  ? 3.360   -8.390  5.366   1.00 0.00 ? 58  ALA A C    6  
ATOM 9745  O O    . ALA A 1 58  ? 4.197   -8.317  4.466   1.00 0.00 ? 58  ALA A O    6  
ATOM 9746  C CB   . ALA A 1 58  ? 0.970   -8.324  4.630   1.00 0.00 ? 58  ALA A CB   6  
ATOM 9747  H H    . ALA A 1 58  ? 0.778   -9.632  6.784   1.00 0.00 ? 58  ALA A H    6  
ATOM 9748  H HA   . ALA A 1 58  ? 2.275   -9.981  4.449   1.00 0.00 ? 58  ALA A HA   6  
ATOM 9749  H HB1  . ALA A 1 58  ? 1.262   -7.926  3.668   1.00 0.00 ? 58  ALA A HB1  6  
ATOM 9750  H HB2  . ALA A 1 58  ? 0.782   -7.513  5.317   1.00 0.00 ? 58  ALA A HB2  6  
ATOM 9751  H HB3  . ALA A 1 58  ? 0.071   -8.914  4.517   1.00 0.00 ? 58  ALA A HB3  6  
ATOM 9752  N N    . LEU A 1 59  ? 3.504   -7.776  6.535   1.00 0.00 ? 59  LEU A N    6  
ATOM 9753  C CA   . LEU A 1 59  ? 4.681   -6.967  6.826   1.00 0.00 ? 59  LEU A CA   6  
ATOM 9754  C C    . LEU A 1 59  ? 5.838   -7.835  7.310   1.00 0.00 ? 59  LEU A C    6  
ATOM 9755  O O    . LEU A 1 59  ? 6.944   -7.342  7.538   1.00 0.00 ? 59  LEU A O    6  
ATOM 9756  C CB   . LEU A 1 59  ? 4.349   -5.895  7.869   1.00 0.00 ? 59  LEU A CB   6  
ATOM 9757  C CG   . LEU A 1 59  ? 3.131   -5.026  7.542   1.00 0.00 ? 59  LEU A CG   6  
ATOM 9758  C CD1  . LEU A 1 59  ? 2.965   -3.930  8.582   1.00 0.00 ? 59  LEU A CD1  6  
ATOM 9759  C CD2  . LEU A 1 59  ? 3.255   -4.424  6.148   1.00 0.00 ? 59  LEU A CD2  6  
ATOM 9760  H H    . LEU A 1 59  ? 2.804   -7.866  7.214   1.00 0.00 ? 59  LEU A H    6  
ATOM 9761  H HA   . LEU A 1 59  ? 4.978   -6.478  5.909   1.00 0.00 ? 59  LEU A HA   6  
ATOM 9762  H HB2  . LEU A 1 59  ? 4.172   -6.387  8.814   1.00 0.00 ? 59  LEU A HB2  6  
ATOM 9763  H HB3  . LEU A 1 59  ? 5.207   -5.249  7.975   1.00 0.00 ? 59  LEU A HB3  6  
ATOM 9764  H HG   . LEU A 1 59  ? 2.244   -5.641  7.563   1.00 0.00 ? 59  LEU A HG   6  
ATOM 9765  H HD11 . LEU A 1 59  ? 3.918   -3.460  8.770   1.00 0.00 ? 59  LEU A HD11 6  
ATOM 9766  H HD12 . LEU A 1 59  ? 2.588   -4.359  9.499   1.00 0.00 ? 59  LEU A HD12 6  
ATOM 9767  H HD13 . LEU A 1 59  ? 2.265   -3.192  8.217   1.00 0.00 ? 59  LEU A HD13 6  
ATOM 9768  H HD21 . LEU A 1 59  ? 4.088   -4.878  5.631   1.00 0.00 ? 59  LEU A HD21 6  
ATOM 9769  H HD22 . LEU A 1 59  ? 3.417   -3.360  6.229   1.00 0.00 ? 59  LEU A HD22 6  
ATOM 9770  H HD23 . LEU A 1 59  ? 2.344   -4.609  5.595   1.00 0.00 ? 59  LEU A HD23 6  
ATOM 9771  N N    . SER A 1 60  ? 5.581   -9.131  7.458   1.00 0.00 ? 60  SER A N    6  
ATOM 9772  C CA   . SER A 1 60  ? 6.608   -10.067 7.903   1.00 0.00 ? 60  SER A CA   6  
ATOM 9773  C C    . SER A 1 60  ? 7.514   -10.455 6.736   1.00 0.00 ? 60  SER A C    6  
ATOM 9774  O O    . SER A 1 60  ? 7.607   -9.727  5.748   1.00 0.00 ? 60  SER A O    6  
ATOM 9775  C CB   . SER A 1 60  ? 5.961   -11.316 8.506   1.00 0.00 ? 60  SER A CB   6  
ATOM 9776  O OG   . SER A 1 60  ? 6.864   -11.996 9.362   1.00 0.00 ? 60  SER A OG   6  
ATOM 9777  H H    . SER A 1 60  ? 4.683   -9.468  7.253   1.00 0.00 ? 60  SER A H    6  
ATOM 9778  H HA   . SER A 1 60  ? 7.201   -9.577  8.658   1.00 0.00 ? 60  SER A HA   6  
ATOM 9779  H HB2  . SER A 1 60  ? 5.092   -11.028 9.077   1.00 0.00 ? 60  SER A HB2  6  
ATOM 9780  H HB3  . SER A 1 60  ? 5.665   -11.984 7.711   1.00 0.00 ? 60  SER A HB3  6  
ATOM 9781  H HG   . SER A 1 60  ? 7.478   -11.367 9.747   1.00 0.00 ? 60  SER A HG   6  
ATOM 9782  N N    . GLU A 1 61  ? 8.177   -11.606 6.850   1.00 0.00 ? 61  GLU A N    6  
ATOM 9783  C CA   . GLU A 1 61  ? 9.068   -12.079 5.794   1.00 0.00 ? 61  GLU A CA   6  
ATOM 9784  C C    . GLU A 1 61  ? 8.323   -12.172 4.464   1.00 0.00 ? 61  GLU A C    6  
ATOM 9785  O O    . GLU A 1 61  ? 8.939   -12.166 3.396   1.00 0.00 ? 61  GLU A O    6  
ATOM 9786  C CB   . GLU A 1 61  ? 9.663   -13.440 6.161   1.00 0.00 ? 61  GLU A CB   6  
ATOM 9787  C CG   . GLU A 1 61  ? 11.157  -13.395 6.435   1.00 0.00 ? 61  GLU A CG   6  
ATOM 9788  C CD   . GLU A 1 61  ? 11.515  -13.920 7.813   1.00 0.00 ? 61  GLU A CD   6  
ATOM 9789  O OE1  . GLU A 1 61  ? 10.589  -14.250 8.585   1.00 0.00 ? 61  GLU A OE1  6  
ATOM 9790  O OE2  . GLU A 1 61  ? 12.722  -14.003 8.122   1.00 0.00 ? 61  GLU A OE2  6  
ATOM 9791  H H    . GLU A 1 61  ? 8.064   -12.147 7.658   1.00 0.00 ? 61  GLU A H    6  
ATOM 9792  H HA   . GLU A 1 61  ? 9.868   -11.362 5.692   1.00 0.00 ? 61  GLU A HA   6  
ATOM 9793  H HB2  . GLU A 1 61  ? 9.166   -13.809 7.045   1.00 0.00 ? 61  GLU A HB2  6  
ATOM 9794  H HB3  . GLU A 1 61  ? 9.488   -14.127 5.347   1.00 0.00 ? 61  GLU A HB3  6  
ATOM 9795  H HG2  . GLU A 1 61  ? 11.664  -13.996 5.696   1.00 0.00 ? 61  GLU A HG2  6  
ATOM 9796  H HG3  . GLU A 1 61  ? 11.494  -12.373 6.359   1.00 0.00 ? 61  GLU A HG3  6  
ATOM 9797  N N    . GLU A 1 62  ? 6.993   -12.238 4.544   1.00 0.00 ? 62  GLU A N    6  
ATOM 9798  C CA   . GLU A 1 62  ? 6.142   -12.312 3.359   1.00 0.00 ? 62  GLU A CA   6  
ATOM 9799  C C    . GLU A 1 62  ? 6.280   -13.650 2.644   1.00 0.00 ? 62  GLU A C    6  
ATOM 9800  O O    . GLU A 1 62  ? 7.332   -13.973 2.092   1.00 0.00 ? 62  GLU A O    6  
ATOM 9801  C CB   . GLU A 1 62  ? 6.458   -11.165 2.393   1.00 0.00 ? 62  GLU A CB   6  
ATOM 9802  C CG   . GLU A 1 62  ? 5.275   -10.245 2.135   1.00 0.00 ? 62  GLU A CG   6  
ATOM 9803  C CD   . GLU A 1 62  ? 5.671   -8.981  1.399   1.00 0.00 ? 62  GLU A CD   6  
ATOM 9804  O OE1  . GLU A 1 62  ? 5.774   -9.024  0.155   1.00 0.00 ? 62  GLU A OE1  6  
ATOM 9805  O OE2  . GLU A 1 62  ? 5.876   -7.945  2.068   1.00 0.00 ? 62  GLU A OE2  6  
ATOM 9806  H H    . GLU A 1 62  ? 6.572   -12.229 5.432   1.00 0.00 ? 62  GLU A H    6  
ATOM 9807  H HA   . GLU A 1 62  ? 5.119   -12.212 3.690   1.00 0.00 ? 62  GLU A HA   6  
ATOM 9808  H HB2  . GLU A 1 62  ? 7.261   -10.573 2.806   1.00 0.00 ? 62  GLU A HB2  6  
ATOM 9809  H HB3  . GLU A 1 62  ? 6.775   -11.582 1.449   1.00 0.00 ? 62  GLU A HB3  6  
ATOM 9810  H HG2  . GLU A 1 62  ? 4.547   -10.776 1.538   1.00 0.00 ? 62  GLU A HG2  6  
ATOM 9811  H HG3  . GLU A 1 62  ? 4.834   -9.972  3.082   1.00 0.00 ? 62  GLU A HG3  6  
ATOM 9812  N N    . HIS A 1 63  ? 5.189   -14.408 2.664   1.00 0.00 ? 63  HIS A N    6  
ATOM 9813  C CA   . HIS A 1 63  ? 5.123   -15.721 2.026   1.00 0.00 ? 63  HIS A CA   6  
ATOM 9814  C C    . HIS A 1 63  ? 3.800   -16.400 2.378   1.00 0.00 ? 63  HIS A C    6  
ATOM 9815  O O    . HIS A 1 63  ? 2.731   -15.818 2.188   1.00 0.00 ? 63  HIS A O    6  
ATOM 9816  C CB   . HIS A 1 63  ? 6.310   -16.597 2.457   1.00 0.00 ? 63  HIS A CB   6  
ATOM 9817  C CG   . HIS A 1 63  ? 6.576   -16.584 3.932   1.00 0.00 ? 63  HIS A CG   6  
ATOM 9818  N ND1  . HIS A 1 63  ? 7.319   -15.607 4.558   1.00 0.00 ? 63  HIS A ND1  6  
ATOM 9819  C CD2  . HIS A 1 63  ? 6.195   -17.443 4.905   1.00 0.00 ? 63  HIS A CD2  6  
ATOM 9820  C CE1  . HIS A 1 63  ? 7.383   -15.868 5.853   1.00 0.00 ? 63  HIS A CE1  6  
ATOM 9821  N NE2  . HIS A 1 63  ? 6.709   -16.976 6.088   1.00 0.00 ? 63  HIS A NE2  6  
ATOM 9822  H H    . HIS A 1 63  ? 4.394   -14.061 3.120   1.00 0.00 ? 63  HIS A H    6  
ATOM 9823  H HA   . HIS A 1 63  ? 5.163   -15.571 0.958   1.00 0.00 ? 63  HIS A HA   6  
ATOM 9824  H HB2  . HIS A 1 63  ? 6.116   -17.619 2.165   1.00 0.00 ? 63  HIS A HB2  6  
ATOM 9825  H HB3  . HIS A 1 63  ? 7.201   -16.251 1.955   1.00 0.00 ? 63  HIS A HB3  6  
ATOM 9826  H HD1  . HIS A 1 63  ? 7.738   -14.837 4.121   1.00 0.00 ? 63  HIS A HD1  6  
ATOM 9827  H HD2  . HIS A 1 63  ? 5.590   -18.329 4.775   1.00 0.00 ? 63  HIS A HD2  6  
ATOM 9828  H HE1  . HIS A 1 63  ? 7.900   -15.273 6.593   1.00 0.00 ? 63  HIS A HE1  6  
ATOM 9829  H HE2  . HIS A 1 63  ? 6.657   -17.433 6.952   1.00 0.00 ? 63  HIS A HE2  6  
ATOM 9830  N N    . MET A 1 64  ? 3.871   -17.618 2.905   1.00 0.00 ? 64  MET A N    6  
ATOM 9831  C CA   . MET A 1 64  ? 2.676   -18.350 3.297   1.00 0.00 ? 64  MET A CA   6  
ATOM 9832  C C    . MET A 1 64  ? 2.514   -18.306 4.808   1.00 0.00 ? 64  MET A C    6  
ATOM 9833  O O    . MET A 1 64  ? 1.746   -19.080 5.381   1.00 0.00 ? 64  MET A O    6  
ATOM 9834  C CB   . MET A 1 64  ? 2.758   -19.802 2.819   1.00 0.00 ? 64  MET A CB   6  
ATOM 9835  C CG   . MET A 1 64  ? 3.503   -19.967 1.504   1.00 0.00 ? 64  MET A CG   6  
ATOM 9836  S SD   . MET A 1 64  ? 4.154   -21.634 1.278   1.00 0.00 ? 64  MET A SD   6  
ATOM 9837  C CE   . MET A 1 64  ? 4.001   -21.820 -0.495  1.00 0.00 ? 64  MET A CE   6  
ATOM 9838  H H    . MET A 1 64  ? 4.746   -18.028 3.047   1.00 0.00 ? 64  MET A H    6  
ATOM 9839  H HA   . MET A 1 64  ? 1.824   -17.875 2.844   1.00 0.00 ? 64  MET A HA   6  
ATOM 9840  H HB2  . MET A 1 64  ? 3.265   -20.388 3.571   1.00 0.00 ? 64  MET A HB2  6  
ATOM 9841  H HB3  . MET A 1 64  ? 1.757   -20.184 2.693   1.00 0.00 ? 64  MET A HB3  6  
ATOM 9842  H HG2  . MET A 1 64  ? 2.824   -19.750 0.694   1.00 0.00 ? 64  MET A HG2  6  
ATOM 9843  H HG3  . MET A 1 64  ? 4.324   -19.268 1.482   1.00 0.00 ? 64  MET A HG3  6  
ATOM 9844  H HE1  . MET A 1 64  ? 4.745   -22.514 -0.853  1.00 0.00 ? 64  MET A HE1  6  
ATOM 9845  H HE2  . MET A 1 64  ? 4.144   -20.861 -0.973  1.00 0.00 ? 64  MET A HE2  6  
ATOM 9846  H HE3  . MET A 1 64  ? 3.015   -22.196 -0.734  1.00 0.00 ? 64  MET A HE3  6  
ATOM 9847  N N    . GLU A 1 65  ? 3.256   -17.390 5.438   1.00 0.00 ? 65  GLU A N    6  
ATOM 9848  C CA   . GLU A 1 65  ? 3.235   -17.215 6.888   1.00 0.00 ? 65  GLU A CA   6  
ATOM 9849  C C    . GLU A 1 65  ? 3.962   -18.359 7.582   1.00 0.00 ? 65  GLU A C    6  
ATOM 9850  O O    . GLU A 1 65  ? 4.695   -18.150 8.550   1.00 0.00 ? 65  GLU A O    6  
ATOM 9851  C CB   . GLU A 1 65  ? 1.801   -17.131 7.404   1.00 0.00 ? 65  GLU A CB   6  
ATOM 9852  C CG   . GLU A 1 65  ? 1.350   -15.713 7.667   1.00 0.00 ? 65  GLU A CG   6  
ATOM 9853  C CD   . GLU A 1 65  ? 1.337   -15.373 9.146   1.00 0.00 ? 65  GLU A CD   6  
ATOM 9854  O OE1  . GLU A 1 65  ? 0.292   -15.585 9.794   1.00 0.00 ? 65  GLU A OE1  6  
ATOM 9855  O OE2  . GLU A 1 65  ? 2.372   -14.896 9.652   1.00 0.00 ? 65  GLU A OE2  6  
ATOM 9856  H H    . GLU A 1 65  ? 3.840   -16.813 4.907   1.00 0.00 ? 65  GLU A H    6  
ATOM 9857  H HA   . GLU A 1 65  ? 3.747   -16.285 7.113   1.00 0.00 ? 65  GLU A HA   6  
ATOM 9858  H HB2  . GLU A 1 65  ? 1.138   -17.568 6.671   1.00 0.00 ? 65  GLU A HB2  6  
ATOM 9859  H HB3  . GLU A 1 65  ? 1.725   -17.688 8.325   1.00 0.00 ? 65  GLU A HB3  6  
ATOM 9860  H HG2  . GLU A 1 65  ? 2.026   -15.043 7.160   1.00 0.00 ? 65  GLU A HG2  6  
ATOM 9861  H HG3  . GLU A 1 65  ? 0.353   -15.589 7.273   1.00 0.00 ? 65  GLU A HG3  6  
ATOM 9862  N N    . ALA A 1 66  ? 3.751   -19.565 7.075   1.00 0.00 ? 66  ALA A N    6  
ATOM 9863  C CA   . ALA A 1 66  ? 4.377   -20.759 7.633   1.00 0.00 ? 66  ALA A CA   6  
ATOM 9864  C C    . ALA A 1 66  ? 4.111   -21.977 6.753   1.00 0.00 ? 66  ALA A C    6  
ATOM 9865  O O    . ALA A 1 66  ? 4.111   -23.112 7.235   1.00 0.00 ? 66  ALA A O    6  
ATOM 9866  C CB   . ALA A 1 66  ? 3.876   -21.009 9.048   1.00 0.00 ? 66  ALA A CB   6  
ATOM 9867  H H    . ALA A 1 66  ? 3.154   -19.652 6.300   1.00 0.00 ? 66  ALA A H    6  
ATOM 9868  H HA   . ALA A 1 66  ? 5.443   -20.586 7.678   1.00 0.00 ? 66  ALA A HA   6  
ATOM 9869  H HB1  . ALA A 1 66  ? 2.843   -20.702 9.124   1.00 0.00 ? 66  ALA A HB1  6  
ATOM 9870  H HB2  . ALA A 1 66  ? 4.473   -20.439 9.746   1.00 0.00 ? 66  ALA A HB2  6  
ATOM 9871  H HB3  . ALA A 1 66  ? 3.957   -22.059 9.278   1.00 0.00 ? 66  ALA A HB3  6  
ATOM 9872  N N    . ASP A 1 67  ? 3.885   -21.727 5.465   1.00 0.00 ? 67  ASP A N    6  
ATOM 9873  C CA   . ASP A 1 67  ? 3.613   -22.793 4.499   1.00 0.00 ? 67  ASP A CA   6  
ATOM 9874  C C    . ASP A 1 67  ? 2.281   -23.477 4.792   1.00 0.00 ? 67  ASP A C    6  
ATOM 9875  O O    . ASP A 1 67  ? 1.996   -23.850 5.932   1.00 0.00 ? 67  ASP A O    6  
ATOM 9876  C CB   . ASP A 1 67  ? 4.744   -23.825 4.499   1.00 0.00 ? 67  ASP A CB   6  
ATOM 9877  C CG   . ASP A 1 67  ? 6.116   -23.180 4.445   1.00 0.00 ? 67  ASP A CG   6  
ATOM 9878  O OD1  . ASP A 1 67  ? 6.580   -22.862 3.330   1.00 0.00 ? 67  ASP A OD1  6  
ATOM 9879  O OD2  . ASP A 1 67  ? 6.726   -22.992 5.518   1.00 0.00 ? 67  ASP A OD2  6  
ATOM 9880  H H    . ASP A 1 67  ? 3.898   -20.799 5.152   1.00 0.00 ? 67  ASP A H    6  
ATOM 9881  H HA   . ASP A 1 67  ? 3.558   -22.339 3.521   1.00 0.00 ? 67  ASP A HA   6  
ATOM 9882  H HB2  . ASP A 1 67  ? 4.682   -24.420 5.398   1.00 0.00 ? 67  ASP A HB2  6  
ATOM 9883  H HB3  . ASP A 1 67  ? 4.636   -24.469 3.639   1.00 0.00 ? 67  ASP A HB3  6  
ATOM 9884  N N    . GLY A 1 68  ? 1.467   -23.640 3.754   1.00 0.00 ? 68  GLY A N    6  
ATOM 9885  C CA   . GLY A 1 68  ? 0.172   -24.278 3.914   1.00 0.00 ? 68  GLY A CA   6  
ATOM 9886  C C    . GLY A 1 68  ? -0.784  -23.451 4.751   1.00 0.00 ? 68  GLY A C    6  
ATOM 9887  O O    . GLY A 1 68  ? -1.504  -23.987 5.596   1.00 0.00 ? 68  GLY A O    6  
ATOM 9888  H H    . GLY A 1 68  ? 1.747   -23.323 2.870   1.00 0.00 ? 68  GLY A H    6  
ATOM 9889  H HA2  . GLY A 1 68  ? -0.262  -24.434 2.939   1.00 0.00 ? 68  GLY A HA2  6  
ATOM 9890  H HA3  . GLY A 1 68  ? 0.315   -25.237 4.392   1.00 0.00 ? 68  GLY A HA3  6  
ATOM 9891  N N    . HIS A 1 69  ? -0.792  -22.142 4.517   1.00 0.00 ? 69  HIS A N    6  
ATOM 9892  C CA   . HIS A 1 69  ? -1.667  -21.237 5.255   1.00 0.00 ? 69  HIS A CA   6  
ATOM 9893  C C    . HIS A 1 69  ? -2.423  -20.318 4.302   1.00 0.00 ? 69  HIS A C    6  
ATOM 9894  O O    . HIS A 1 69  ? -3.654  -20.327 4.260   1.00 0.00 ? 69  HIS A O    6  
ATOM 9895  C CB   . HIS A 1 69  ? -0.851  -20.401 6.243   1.00 0.00 ? 69  HIS A CB   6  
ATOM 9896  C CG   . HIS A 1 69  ? -1.123  -20.737 7.676   1.00 0.00 ? 69  HIS A CG   6  
ATOM 9897  N ND1  . HIS A 1 69  ? -2.361  -20.587 8.263   1.00 0.00 ? 69  HIS A ND1  6  
ATOM 9898  C CD2  . HIS A 1 69  ? -0.307  -21.222 8.643   1.00 0.00 ? 69  HIS A CD2  6  
ATOM 9899  C CE1  . HIS A 1 69  ? -2.296  -20.964 9.528   1.00 0.00 ? 69  HIS A CE1  6  
ATOM 9900  N NE2  . HIS A 1 69  ? -1.062  -21.353 9.783   1.00 0.00 ? 69  HIS A NE2  6  
ATOM 9901  H H    . HIS A 1 69  ? -0.194  -21.776 3.831   1.00 0.00 ? 69  HIS A H    6  
ATOM 9902  H HA   . HIS A 1 69  ? -2.380  -21.835 5.803   1.00 0.00 ? 69  HIS A HA   6  
ATOM 9903  H HB2  . HIS A 1 69  ? 0.201   -20.562 6.058   1.00 0.00 ? 69  HIS A HB2  6  
ATOM 9904  H HB3  . HIS A 1 69  ? -1.083  -19.356 6.096   1.00 0.00 ? 69  HIS A HB3  6  
ATOM 9905  H HD1  . HIS A 1 69  ? -3.168  -20.253 7.820   1.00 0.00 ? 69  HIS A HD1  6  
ATOM 9906  H HD2  . HIS A 1 69  ? 0.743   -21.459 8.538   1.00 0.00 ? 69  HIS A HD2  6  
ATOM 9907  H HE1  . HIS A 1 69  ? -3.114  -20.955 10.233  1.00 0.00 ? 69  HIS A HE1  6  
ATOM 9908  H HE2  . HIS A 1 69  ? -0.717  -21.595 10.668  1.00 0.00 ? 69  HIS A HE2  6  
ATOM 9909  N N    . ALA A 1 70  ? -1.674  -19.526 3.537   1.00 0.00 ? 70  ALA A N    6  
ATOM 9910  C CA   . ALA A 1 70  ? -2.261  -18.596 2.578   1.00 0.00 ? 70  ALA A CA   6  
ATOM 9911  C C    . ALA A 1 70  ? -3.166  -17.579 3.271   1.00 0.00 ? 70  ALA A C    6  
ATOM 9912  O O    . ALA A 1 70  ? -4.254  -17.270 2.788   1.00 0.00 ? 70  ALA A O    6  
ATOM 9913  C CB   . ALA A 1 70  ? -3.034  -19.356 1.509   1.00 0.00 ? 70  ALA A CB   6  
ATOM 9914  H H    . ALA A 1 70  ? -0.699  -19.568 3.622   1.00 0.00 ? 70  ALA A H    6  
ATOM 9915  H HA   . ALA A 1 70  ? -1.454  -18.067 2.094   1.00 0.00 ? 70  ALA A HA   6  
ATOM 9916  H HB1  . ALA A 1 70  ? -3.734  -18.689 1.028   1.00 0.00 ? 70  ALA A HB1  6  
ATOM 9917  H HB2  . ALA A 1 70  ? -3.570  -20.174 1.965   1.00 0.00 ? 70  ALA A HB2  6  
ATOM 9918  H HB3  . ALA A 1 70  ? -2.343  -19.743 0.774   1.00 0.00 ? 70  ALA A HB3  6  
ATOM 9919  N N    . ALA A 1 71  ? -2.700  -17.058 4.403   1.00 0.00 ? 71  ALA A N    6  
ATOM 9920  C CA   . ALA A 1 71  ? -3.461  -16.071 5.159   1.00 0.00 ? 71  ALA A CA   6  
ATOM 9921  C C    . ALA A 1 71  ? -2.957  -14.660 4.869   1.00 0.00 ? 71  ALA A C    6  
ATOM 9922  O O    . ALA A 1 71  ? -3.672  -13.679 5.074   1.00 0.00 ? 71  ALA A O    6  
ATOM 9923  C CB   . ALA A 1 71  ? -3.377  -16.368 6.650   1.00 0.00 ? 71  ALA A CB   6  
ATOM 9924  H H    . ALA A 1 71  ? -1.822  -17.341 4.734   1.00 0.00 ? 71  ALA A H    6  
ATOM 9925  H HA   . ALA A 1 71  ? -4.495  -16.143 4.859   1.00 0.00 ? 71  ALA A HA   6  
ATOM 9926  H HB1  . ALA A 1 71  ? -2.601  -17.097 6.828   1.00 0.00 ? 71  ALA A HB1  6  
ATOM 9927  H HB2  . ALA A 1 71  ? -4.322  -16.760 6.993   1.00 0.00 ? 71  ALA A HB2  6  
ATOM 9928  H HB3  . ALA A 1 71  ? -3.147  -15.459 7.188   1.00 0.00 ? 71  ALA A HB3  6  
ATOM 9929  N N    . VAL A 1 72  ? -1.724  -14.573 4.383   1.00 0.00 ? 72  VAL A N    6  
ATOM 9930  C CA   . VAL A 1 72  ? -1.115  -13.288 4.054   1.00 0.00 ? 72  VAL A CA   6  
ATOM 9931  C C    . VAL A 1 72  ? -1.183  -13.027 2.552   1.00 0.00 ? 72  VAL A C    6  
ATOM 9932  O O    . VAL A 1 72  ? -0.619  -13.778 1.756   1.00 0.00 ? 72  VAL A O    6  
ATOM 9933  C CB   . VAL A 1 72  ? 0.358   -13.225 4.522   1.00 0.00 ? 72  VAL A CB   6  
ATOM 9934  C CG1  . VAL A 1 72  ? 1.023   -14.588 4.392   1.00 0.00 ? 72  VAL A CG1  6  
ATOM 9935  C CG2  . VAL A 1 72  ? 1.134   -12.171 3.743   1.00 0.00 ? 72  VAL A CG2  6  
ATOM 9936  H H    . VAL A 1 72  ? -1.209  -15.393 4.239   1.00 0.00 ? 72  VAL A H    6  
ATOM 9937  H HA   . VAL A 1 72  ? -1.668  -12.516 4.568   1.00 0.00 ? 72  VAL A HA   6  
ATOM 9938  H HB   . VAL A 1 72  ? 0.367   -12.944 5.565   1.00 0.00 ? 72  VAL A HB   6  
ATOM 9939  H HG11 . VAL A 1 72  ? 0.267   -15.346 4.244   1.00 0.00 ? 72  VAL A HG11 6  
ATOM 9940  H HG12 . VAL A 1 72  ? 1.579   -14.807 5.291   1.00 0.00 ? 72  VAL A HG12 6  
ATOM 9941  H HG13 . VAL A 1 72  ? 1.693   -14.582 3.547   1.00 0.00 ? 72  VAL A HG13 6  
ATOM 9942  H HG21 . VAL A 1 72  ? 0.442   -11.469 3.299   1.00 0.00 ? 72  VAL A HG21 6  
ATOM 9943  H HG22 . VAL A 1 72  ? 1.709   -12.650 2.965   1.00 0.00 ? 72  VAL A HG22 6  
ATOM 9944  H HG23 . VAL A 1 72  ? 1.798   -11.646 4.412   1.00 0.00 ? 72  VAL A HG23 6  
ATOM 9945  N N    . VAL A 1 73  ? -1.887  -11.965 2.169   1.00 0.00 ? 73  VAL A N    6  
ATOM 9946  C CA   . VAL A 1 73  ? -2.033  -11.618 0.760   1.00 0.00 ? 73  VAL A CA   6  
ATOM 9947  C C    . VAL A 1 73  ? -1.909  -10.114 0.523   1.00 0.00 ? 73  VAL A C    6  
ATOM 9948  O O    . VAL A 1 73  ? -2.823  -9.349  0.827   1.00 0.00 ? 73  VAL A O    6  
ATOM 9949  C CB   . VAL A 1 73  ? -3.386  -12.100 0.202   1.00 0.00 ? 73  VAL A CB   6  
ATOM 9950  C CG1  . VAL A 1 73  ? -3.275  -13.527 -0.309  1.00 0.00 ? 73  VAL A CG1  6  
ATOM 9951  C CG2  . VAL A 1 73  ? -4.474  -11.988 1.262   1.00 0.00 ? 73  VAL A CG2  6  
ATOM 9952  H H    . VAL A 1 73  ? -2.320  -11.409 2.848   1.00 0.00 ? 73  VAL A H    6  
ATOM 9953  H HA   . VAL A 1 73  ? -1.248  -12.122 0.213   1.00 0.00 ? 73  VAL A HA   6  
ATOM 9954  H HB   . VAL A 1 73  ? -3.657  -11.465 -0.628  1.00 0.00 ? 73  VAL A HB   6  
ATOM 9955  H HG11 . VAL A 1 73  ? -3.366  -14.215 0.518   1.00 0.00 ? 73  VAL A HG11 6  
ATOM 9956  H HG12 . VAL A 1 73  ? -2.316  -13.665 -0.789  1.00 0.00 ? 73  VAL A HG12 6  
ATOM 9957  H HG13 . VAL A 1 73  ? -4.064  -13.717 -1.022  1.00 0.00 ? 73  VAL A HG13 6  
ATOM 9958  H HG21 . VAL A 1 73  ? -5.339  -11.500 0.840   1.00 0.00 ? 73  VAL A HG21 6  
ATOM 9959  H HG22 . VAL A 1 73  ? -4.103  -11.412 2.097   1.00 0.00 ? 73  VAL A HG22 6  
ATOM 9960  H HG23 . VAL A 1 73  ? -4.748  -12.977 1.599   1.00 0.00 ? 73  VAL A HG23 6  
ATOM 9961  N N    . PHE A 1 74  ? -0.778  -9.703  -0.047  1.00 0.00 ? 74  PHE A N    6  
ATOM 9962  C CA   . PHE A 1 74  ? -0.530  -8.298  -0.358  1.00 0.00 ? 74  PHE A CA   6  
ATOM 9963  C C    . PHE A 1 74  ? 0.499   -8.188  -1.479  1.00 0.00 ? 74  PHE A C    6  
ATOM 9964  O O    . PHE A 1 74  ? 1.292   -9.105  -1.696  1.00 0.00 ? 74  PHE A O    6  
ATOM 9965  C CB   . PHE A 1 74  ? -0.064  -7.527  0.884   1.00 0.00 ? 74  PHE A CB   6  
ATOM 9966  C CG   . PHE A 1 74  ? -0.407  -6.058  0.844   1.00 0.00 ? 74  PHE A CG   6  
ATOM 9967  C CD1  . PHE A 1 74  ? -1.682  -5.636  0.484   1.00 0.00 ? 74  PHE A CD1  6  
ATOM 9968  C CD2  . PHE A 1 74  ? 0.547   -5.098  1.158   1.00 0.00 ? 74  PHE A CD2  6  
ATOM 9969  C CE1  . PHE A 1 74  ? -1.994  -4.290  0.439   1.00 0.00 ? 74  PHE A CE1  6  
ATOM 9970  C CE2  . PHE A 1 74  ? 0.236   -3.753  1.112   1.00 0.00 ? 74  PHE A CE2  6  
ATOM 9971  C CZ   . PHE A 1 74  ? -1.033  -3.350  0.752   1.00 0.00 ? 74  PHE A CZ   6  
ATOM 9972  H H    . PHE A 1 74  ? -0.098  -10.369 -0.281  1.00 0.00 ? 74  PHE A H    6  
ATOM 9973  H HA   . PHE A 1 74  ? -1.461  -7.874  -0.705  1.00 0.00 ? 74  PHE A HA   6  
ATOM 9974  H HB2  . PHE A 1 74  ? -0.528  -7.954  1.760   1.00 0.00 ? 74  PHE A HB2  6  
ATOM 9975  H HB3  . PHE A 1 74  ? 1.009   -7.616  0.971   1.00 0.00 ? 74  PHE A HB3  6  
ATOM 9976  H HD1  . PHE A 1 74  ? -2.438  -6.367  0.240   1.00 0.00 ? 74  PHE A HD1  6  
ATOM 9977  H HD2  . PHE A 1 74  ? 1.541   -5.407  1.441   1.00 0.00 ? 74  PHE A HD2  6  
ATOM 9978  H HE1  . PHE A 1 74  ? -2.989  -3.974  0.158   1.00 0.00 ? 74  PHE A HE1  6  
ATOM 9979  H HE2  . PHE A 1 74  ? 0.988   -3.017  1.359   1.00 0.00 ? 74  PHE A HE2  6  
ATOM 9980  H HZ   . PHE A 1 74  ? -1.274  -2.298  0.717   1.00 0.00 ? 74  PHE A HZ   6  
ATOM 9981  N N    . GLY A 1 75  ? 0.470   -7.075  -2.205  1.00 0.00 ? 75  GLY A N    6  
ATOM 9982  C CA   . GLY A 1 75  ? 1.392   -6.890  -3.311  1.00 0.00 ? 75  GLY A CA   6  
ATOM 9983  C C    . GLY A 1 75  ? 0.848   -7.505  -4.585  1.00 0.00 ? 75  GLY A C    6  
ATOM 9984  O O    . GLY A 1 75  ? 1.580   -7.738  -5.546  1.00 0.00 ? 75  GLY A O    6  
ATOM 9985  H H    . GLY A 1 75  ? -0.196  -6.384  -2.002  1.00 0.00 ? 75  GLY A H    6  
ATOM 9986  H HA2  . GLY A 1 75  ? 1.548   -5.832  -3.469  1.00 0.00 ? 75  GLY A HA2  6  
ATOM 9987  H HA3  . GLY A 1 75  ? 2.334   -7.357  -3.071  1.00 0.00 ? 75  GLY A HA3  6  
ATOM 9988  N N    . THR A 1 76  ? -0.456  -7.763  -4.573  1.00 0.00 ? 76  THR A N    6  
ATOM 9989  C CA   . THR A 1 76  ? -1.154  -8.355  -5.707  1.00 0.00 ? 76  THR A CA   6  
ATOM 9990  C C    . THR A 1 76  ? -2.587  -7.840  -5.765  1.00 0.00 ? 76  THR A C    6  
ATOM 9991  O O    . THR A 1 76  ? -3.071  -7.235  -4.808  1.00 0.00 ? 76  THR A O    6  
ATOM 9992  C CB   . THR A 1 76  ? -1.173  -9.892  -5.629  1.00 0.00 ? 76  THR A CB   6  
ATOM 9993  O OG1  . THR A 1 76  ? -0.248  -10.343 -4.632  1.00 0.00 ? 76  THR A OG1  6  
ATOM 9994  C CG2  . THR A 1 76  ? -0.817  -10.509 -6.972  1.00 0.00 ? 76  THR A CG2  6  
ATOM 9995  H H    . THR A 1 76  ? -0.966  -7.541  -3.767  1.00 0.00 ? 76  THR A H    6  
ATOM 9996  H HA   . THR A 1 76  ? -0.637  -8.063  -6.610  1.00 0.00 ? 76  THR A HA   6  
ATOM 9997  H HB   . THR A 1 76  ? -2.168  -10.212 -5.353  1.00 0.00 ? 76  THR A HB   6  
ATOM 9998  H HG1  . THR A 1 76  ? -0.725  -10.583 -3.834  1.00 0.00 ? 76  THR A HG1  6  
ATOM 9999  H HG21 . THR A 1 76  ? -1.623  -10.338 -7.672  1.00 0.00 ? 76  THR A HG21 6  
ATOM 10000 H HG22 . THR A 1 76  ? -0.666  -11.571 -6.853  1.00 0.00 ? 76  THR A HG22 6  
ATOM 10001 H HG23 . THR A 1 76  ? 0.088   -10.057 -7.348  1.00 0.00 ? 76  THR A HG23 6  
ATOM 10002 N N    . VAL A 1 77  ? -3.272  -8.073  -6.880  1.00 0.00 ? 77  VAL A N    6  
ATOM 10003 C CA   . VAL A 1 77  ? -4.651  -7.625  -7.011  1.00 0.00 ? 77  VAL A CA   6  
ATOM 10004 C C    . VAL A 1 77  ? -5.526  -8.354  -5.997  1.00 0.00 ? 77  VAL A C    6  
ATOM 10005 O O    . VAL A 1 77  ? -5.906  -9.505  -6.206  1.00 0.00 ? 77  VAL A O    6  
ATOM 10006 C CB   . VAL A 1 77  ? -5.206  -7.872  -8.429  1.00 0.00 ? 77  VAL A CB   6  
ATOM 10007 C CG1  . VAL A 1 77  ? -6.458  -7.038  -8.664  1.00 0.00 ? 77  VAL A CG1  6  
ATOM 10008 C CG2  . VAL A 1 77  ? -4.148  -7.568  -9.480  1.00 0.00 ? 77  VAL A CG2  6  
ATOM 10009 H H    . VAL A 1 77  ? -2.847  -8.560  -7.618  1.00 0.00 ? 77  VAL A H    6  
ATOM 10010 H HA   . VAL A 1 77  ? -4.682  -6.562  -6.808  1.00 0.00 ? 77  VAL A HA   6  
ATOM 10011 H HB   . VAL A 1 77  ? -5.475  -8.913  -8.510  1.00 0.00 ? 77  VAL A HB   6  
ATOM 10012 H HG11 . VAL A 1 77  ? -6.175  -6.019  -8.883  1.00 0.00 ? 77  VAL A HG11 6  
ATOM 10013 H HG12 . VAL A 1 77  ? -7.075  -7.059  -7.778  1.00 0.00 ? 77  VAL A HG12 6  
ATOM 10014 H HG13 . VAL A 1 77  ? -7.010  -7.447  -9.498  1.00 0.00 ? 77  VAL A HG13 6  
ATOM 10015 H HG21 . VAL A 1 77  ? -3.560  -6.718  -9.164  1.00 0.00 ? 77  VAL A HG21 6  
ATOM 10016 H HG22 . VAL A 1 77  ? -4.628  -7.344  -10.421 1.00 0.00 ? 77  VAL A HG22 6  
ATOM 10017 H HG23 . VAL A 1 77  ? -3.504  -8.427  -9.600  1.00 0.00 ? 77  VAL A HG23 6  
ATOM 10018 N N    . VAL A 1 78  ? -5.812  -7.682  -4.887  1.00 0.00 ? 78  VAL A N    6  
ATOM 10019 C CA   . VAL A 1 78  ? -6.614  -8.271  -3.821  1.00 0.00 ? 78  VAL A CA   6  
ATOM 10020 C C    . VAL A 1 78  ? -7.771  -7.368  -3.413  1.00 0.00 ? 78  VAL A C    6  
ATOM 10021 O O    . VAL A 1 78  ? -7.918  -6.258  -3.921  1.00 0.00 ? 78  VAL A O    6  
ATOM 10022 C CB   . VAL A 1 78  ? -5.752  -8.533  -2.572  1.00 0.00 ? 78  VAL A CB   6  
ATOM 10023 C CG1  . VAL A 1 78  ? -4.732  -9.621  -2.839  1.00 0.00 ? 78  VAL A CG1  6  
ATOM 10024 C CG2  . VAL A 1 78  ? -5.065  -7.252  -2.127  1.00 0.00 ? 78  VAL A CG2  6  
ATOM 10025 H H    . VAL A 1 78  ? -5.464  -6.773  -4.773  1.00 0.00 ? 78  VAL A H    6  
ATOM 10026 H HA   . VAL A 1 78  ? -7.004  -9.215  -4.169  1.00 0.00 ? 78  VAL A HA   6  
ATOM 10027 H HB   . VAL A 1 78  ? -6.400  -8.864  -1.773  1.00 0.00 ? 78  VAL A HB   6  
ATOM 10028 H HG11 . VAL A 1 78  ? -4.086  -9.722  -1.979  1.00 0.00 ? 78  VAL A HG11 6  
ATOM 10029 H HG12 . VAL A 1 78  ? -4.143  -9.358  -3.703  1.00 0.00 ? 78  VAL A HG12 6  
ATOM 10030 H HG13 . VAL A 1 78  ? -5.241  -10.556 -3.019  1.00 0.00 ? 78  VAL A HG13 6  
ATOM 10031 H HG21 . VAL A 1 78  ? -4.774  -7.340  -1.091  1.00 0.00 ? 78  VAL A HG21 6  
ATOM 10032 H HG22 . VAL A 1 78  ? -5.745  -6.420  -2.242  1.00 0.00 ? 78  VAL A HG22 6  
ATOM 10033 H HG23 . VAL A 1 78  ? -4.186  -7.086  -2.734  1.00 0.00 ? 78  VAL A HG23 6  
ATOM 10034 N N    . ASP A 1 79  ? -8.570  -7.851  -2.469  1.00 0.00 ? 79  ASP A N    6  
ATOM 10035 C CA   . ASP A 1 79  ? -9.702  -7.093  -1.955  1.00 0.00 ? 79  ASP A CA   6  
ATOM 10036 C C    . ASP A 1 79  ? -9.258  -6.241  -0.773  1.00 0.00 ? 79  ASP A C    6  
ATOM 10037 O O    . ASP A 1 79  ? -8.913  -6.766  0.286   1.00 0.00 ? 79  ASP A O    6  
ATOM 10038 C CB   . ASP A 1 79  ? -10.829 -8.036  -1.530  1.00 0.00 ? 79  ASP A CB   6  
ATOM 10039 C CG   . ASP A 1 79  ? -11.888 -8.197  -2.602  1.00 0.00 ? 79  ASP A CG   6  
ATOM 10040 O OD1  . ASP A 1 79  ? -12.301 -7.172  -3.187  1.00 0.00 ? 79  ASP A OD1  6  
ATOM 10041 O OD2  . ASP A 1 79  ? -12.305 -9.346  -2.858  1.00 0.00 ? 79  ASP A OD2  6  
ATOM 10042 H H    . ASP A 1 79  ? -8.379  -8.736  -2.095  1.00 0.00 ? 79  ASP A H    6  
ATOM 10043 H HA   . ASP A 1 79  ? -10.057 -6.444  -2.744  1.00 0.00 ? 79  ASP A HA   6  
ATOM 10044 H HB2  . ASP A 1 79  ? -10.412 -9.010  -1.314  1.00 0.00 ? 79  ASP A HB2  6  
ATOM 10045 H HB3  . ASP A 1 79  ? -11.300 -7.647  -0.639  1.00 0.00 ? 79  ASP A HB3  6  
ATOM 10046 N N    . ILE A 1 80  ? -9.256  -4.928  -0.962  1.00 0.00 ? 80  ILE A N    6  
ATOM 10047 C CA   . ILE A 1 80  ? -8.841  -4.009  0.087   1.00 0.00 ? 80  ILE A CA   6  
ATOM 10048 C C    . ILE A 1 80  ? -10.042 -3.388  0.790   1.00 0.00 ? 80  ILE A C    6  
ATOM 10049 O O    . ILE A 1 80  ? -11.170 -3.469  0.302   1.00 0.00 ? 80  ILE A O    6  
ATOM 10050 C CB   . ILE A 1 80  ? -7.948  -2.886  -0.474  1.00 0.00 ? 80  ILE A CB   6  
ATOM 10051 C CG1  . ILE A 1 80  ? -8.782  -1.866  -1.258  1.00 0.00 ? 80  ILE A CG1  6  
ATOM 10052 C CG2  . ILE A 1 80  ? -6.851  -3.469  -1.353  1.00 0.00 ? 80  ILE A CG2  6  
ATOM 10053 C CD1  . ILE A 1 80  ? -8.158  -0.488  -1.310  1.00 0.00 ? 80  ILE A CD1  6  
ATOM 10054 H H    . ILE A 1 80  ? -9.539  -4.566  -1.826  1.00 0.00 ? 80  ILE A H    6  
ATOM 10055 H HA   . ILE A 1 80  ? -8.260  -4.569  0.808   1.00 0.00 ? 80  ILE A HA   6  
ATOM 10056 H HB   . ILE A 1 80  ? -7.476  -2.385  0.358   1.00 0.00 ? 80  ILE A HB   6  
ATOM 10057 H HG12 . ILE A 1 80  ? -8.903  -2.215  -2.273  1.00 0.00 ? 80  ILE A HG12 6  
ATOM 10058 H HG13 . ILE A 1 80  ? -9.754  -1.775  -0.796  1.00 0.00 ? 80  ILE A HG13 6  
ATOM 10059 H HG21 . ILE A 1 80  ? -6.568  -2.747  -2.103  1.00 0.00 ? 80  ILE A HG21 6  
ATOM 10060 H HG22 . ILE A 1 80  ? -7.214  -4.366  -1.833  1.00 0.00 ? 80  ILE A HG22 6  
ATOM 10061 H HG23 . ILE A 1 80  ? -5.991  -3.711  -0.742  1.00 0.00 ? 80  ILE A HG23 6  
ATOM 10062 H HD11 . ILE A 1 80  ? -8.903  0.252   -1.056  1.00 0.00 ? 80  ILE A HD11 6  
ATOM 10063 H HD12 . ILE A 1 80  ? -7.787  -0.299  -2.304  1.00 0.00 ? 80  ILE A HD12 6  
ATOM 10064 H HD13 . ILE A 1 80  ? -7.344  -0.436  -0.603  1.00 0.00 ? 80  ILE A HD13 6  
ATOM 10065 N N    . ILE A 1 81  ? -9.791  -2.767  1.937   1.00 0.00 ? 81  ILE A N    6  
ATOM 10066 C CA   . ILE A 1 81  ? -10.846 -2.128  2.714   1.00 0.00 ? 81  ILE A CA   6  
ATOM 10067 C C    . ILE A 1 81  ? -10.364 -0.803  3.295   1.00 0.00 ? 81  ILE A C    6  
ATOM 10068 O O    . ILE A 1 81  ? -9.268  -0.724  3.843   1.00 0.00 ? 81  ILE A O    6  
ATOM 10069 C CB   . ILE A 1 81  ? -11.316 -3.038  3.861   1.00 0.00 ? 81  ILE A CB   6  
ATOM 10070 C CG1  . ILE A 1 81  ? -10.108 -3.569  4.634   1.00 0.00 ? 81  ILE A CG1  6  
ATOM 10071 C CG2  . ILE A 1 81  ? -12.153 -4.186  3.316   1.00 0.00 ? 81  ILE A CG2  6  
ATOM 10072 C CD1  . ILE A 1 81  ? -10.463 -4.186  5.969   1.00 0.00 ? 81  ILE A CD1  6  
ATOM 10073 H H    . ILE A 1 81  ? -8.871  -2.741  2.272   1.00 0.00 ? 81  ILE A H    6  
ATOM 10074 H HA   . ILE A 1 81  ? -11.685 -1.942  2.057   1.00 0.00 ? 81  ILE A HA   6  
ATOM 10075 H HB   . ILE A 1 81  ? -11.934 -2.456  4.527   1.00 0.00 ? 81  ILE A HB   6  
ATOM 10076 H HG12 . ILE A 1 81  ? -9.611  -4.324  4.038   1.00 0.00 ? 81  ILE A HG12 6  
ATOM 10077 H HG13 . ILE A 1 81  ? -9.421  -2.755  4.816   1.00 0.00 ? 81  ILE A HG13 6  
ATOM 10078 H HG21 . ILE A 1 81  ? -12.761 -3.830  2.497   1.00 0.00 ? 81  ILE A HG21 6  
ATOM 10079 H HG22 . ILE A 1 81  ? -12.791 -4.570  4.097   1.00 0.00 ? 81  ILE A HG22 6  
ATOM 10080 H HG23 . ILE A 1 81  ? -11.500 -4.972  2.965   1.00 0.00 ? 81  ILE A HG23 6  
ATOM 10081 H HD11 . ILE A 1 81  ? -10.979 -5.121  5.809   1.00 0.00 ? 81  ILE A HD11 6  
ATOM 10082 H HD12 . ILE A 1 81  ? -11.104 -3.510  6.517   1.00 0.00 ? 81  ILE A HD12 6  
ATOM 10083 H HD13 . ILE A 1 81  ? -9.560  -4.364  6.535   1.00 0.00 ? 81  ILE A HD13 6  
ATOM 10084 N N    . SER A 1 82  ? -11.187 0.233   3.186   1.00 0.00 ? 82  SER A N    6  
ATOM 10085 C CA   . SER A 1 82  ? -10.826 1.543   3.713   1.00 0.00 ? 82  SER A CA   6  
ATOM 10086 C C    . SER A 1 82  ? -11.199 1.655   5.187   1.00 0.00 ? 82  SER A C    6  
ATOM 10087 O O    . SER A 1 82  ? -11.922 0.813   5.718   1.00 0.00 ? 82  SER A O    6  
ATOM 10088 C CB   . SER A 1 82  ? -11.505 2.655   2.912   1.00 0.00 ? 82  SER A CB   6  
ATOM 10089 O OG   . SER A 1 82  ? -11.665 2.281   1.554   1.00 0.00 ? 82  SER A OG   6  
ATOM 10090 H H    . SER A 1 82  ? -12.058 0.110   2.750   1.00 0.00 ? 82  SER A H    6  
ATOM 10091 H HA   . SER A 1 82  ? -9.757  1.650   3.619   1.00 0.00 ? 82  SER A HA   6  
ATOM 10092 H HB2  . SER A 1 82  ? -12.477 2.859   3.334   1.00 0.00 ? 82  SER A HB2  6  
ATOM 10093 H HB3  . SER A 1 82  ? -10.896 3.546   2.956   1.00 0.00 ? 82  SER A HB3  6  
ATOM 10094 H HG   . SER A 1 82  ? -11.107 2.831   1.002   1.00 0.00 ? 82  SER A HG   6  
ATOM 10095 N N    . ARG A 1 83  ? -10.684 2.689   5.845   1.00 0.00 ? 83  ARG A N    6  
ATOM 10096 C CA   . ARG A 1 83  ? -10.942 2.913   7.270   1.00 0.00 ? 83  ARG A CA   6  
ATOM 10097 C C    . ARG A 1 83  ? -12.423 2.756   7.622   1.00 0.00 ? 83  ARG A C    6  
ATOM 10098 O O    . ARG A 1 83  ? -12.759 2.253   8.695   1.00 0.00 ? 83  ARG A O    6  
ATOM 10099 C CB   . ARG A 1 83  ? -10.458 4.306   7.685   1.00 0.00 ? 83  ARG A CB   6  
ATOM 10100 C CG   . ARG A 1 83  ? -11.396 5.430   7.270   1.00 0.00 ? 83  ARG A CG   6  
ATOM 10101 C CD   . ARG A 1 83  ? -10.639 6.723   7.017   1.00 0.00 ? 83  ARG A CD   6  
ATOM 10102 N NE   . ARG A 1 83  ? -11.019 7.775   7.957   1.00 0.00 ? 83  ARG A NE   6  
ATOM 10103 C CZ   . ARG A 1 83  ? -11.785 8.813   7.636   1.00 0.00 ? 83  ARG A CZ   6  
ATOM 10104 N NH1  . ARG A 1 83  ? -12.249 8.942   6.400   1.00 0.00 ? 83  ARG A NH1  6  
ATOM 10105 N NH2  . ARG A 1 83  ? -12.089 9.724   8.551   1.00 0.00 ? 83  ARG A NH2  6  
ATOM 10106 H H    . ARG A 1 83  ? -10.089 3.311   5.365   1.00 0.00 ? 83  ARG A H    6  
ATOM 10107 H HA   . ARG A 1 83  ? -10.378 2.176   7.821   1.00 0.00 ? 83  ARG A HA   6  
ATOM 10108 H HB2  . ARG A 1 83  ? -10.357 4.332   8.759   1.00 0.00 ? 83  ARG A HB2  6  
ATOM 10109 H HB3  . ARG A 1 83  ? -9.494  4.488   7.235   1.00 0.00 ? 83  ARG A HB3  6  
ATOM 10110 H HG2  . ARG A 1 83  ? -11.910 5.144   6.364   1.00 0.00 ? 83  ARG A HG2  6  
ATOM 10111 H HG3  . ARG A 1 83  ? -12.115 5.596   8.058   1.00 0.00 ? 83  ARG A HG3  6  
ATOM 10112 H HD2  . ARG A 1 83  ? -9.581  6.532   7.116   1.00 0.00 ? 83  ARG A HD2  6  
ATOM 10113 H HD3  . ARG A 1 83  ? -10.848 7.058   6.011   1.00 0.00 ? 83  ARG A HD3  6  
ATOM 10114 H HE   . ARG A 1 83  ? -10.687 7.702   8.877   1.00 0.00 ? 83  ARG A HE   6  
ATOM 10115 H HH11 . ARG A 1 83  ? -12.023 8.259   5.706   1.00 0.00 ? 83  ARG A HH11 6  
ATOM 10116 H HH12 . ARG A 1 83  ? -12.825 9.726   6.161   1.00 0.00 ? 83  ARG A HH12 6  
ATOM 10117 H HH21 . ARG A 1 83  ? -11.740 9.629   9.485   1.00 0.00 ? 83  ARG A HH21 6  
ATOM 10118 H HH22 . ARG A 1 83  ? -12.664 10.504  8.309   1.00 0.00 ? 83  ARG A HH22 6  
ATOM 10119 N N    . SER A 1 84  ? -13.306 3.201   6.729   1.00 0.00 ? 84  SER A N    6  
ATOM 10120 C CA   . SER A 1 84  ? -14.744 3.116   6.971   1.00 0.00 ? 84  SER A CA   6  
ATOM 10121 C C    . SER A 1 84  ? -15.312 1.778   6.513   1.00 0.00 ? 84  SER A C    6  
ATOM 10122 O O    . SER A 1 84  ? -16.414 1.394   6.901   1.00 0.00 ? 84  SER A O    6  
ATOM 10123 C CB   . SER A 1 84  ? -15.469 4.262   6.255   1.00 0.00 ? 84  SER A CB   6  
ATOM 10124 O OG   . SER A 1 84  ? -16.118 3.803   5.081   1.00 0.00 ? 84  SER A OG   6  
ATOM 10125 H H    . SER A 1 84  ? -12.984 3.602   5.895   1.00 0.00 ? 84  SER A H    6  
ATOM 10126 H HA   . SER A 1 84  ? -14.904 3.213   8.035   1.00 0.00 ? 84  SER A HA   6  
ATOM 10127 H HB2  . SER A 1 84  ? -16.209 4.689   6.916   1.00 0.00 ? 84  SER A HB2  6  
ATOM 10128 H HB3  . SER A 1 84  ? -14.752 5.021   5.980   1.00 0.00 ? 84  SER A HB3  6  
ATOM 10129 H HG   . SER A 1 84  ? -16.857 4.379   4.878   1.00 0.00 ? 84  SER A HG   6  
ATOM 10130 N N    . GLY A 1 85  ? -14.553 1.072   5.684   1.00 0.00 ? 85  GLY A N    6  
ATOM 10131 C CA   . GLY A 1 85  ? -14.997 -0.214  5.182   1.00 0.00 ? 85  GLY A CA   6  
ATOM 10132 C C    . GLY A 1 85  ? -15.444 -0.141  3.738   1.00 0.00 ? 85  GLY A C    6  
ATOM 10133 O O    . GLY A 1 85  ? -16.573 0.256   3.449   1.00 0.00 ? 85  GLY A O    6  
ATOM 10134 H H    . GLY A 1 85  ? -13.685 1.432   5.408   1.00 0.00 ? 85  GLY A H    6  
ATOM 10135 H HA2  . GLY A 1 85  ? -14.184 -0.920  5.263   1.00 0.00 ? 85  GLY A HA2  6  
ATOM 10136 H HA3  . GLY A 1 85  ? -15.822 -0.559  5.787   1.00 0.00 ? 85  GLY A HA3  6  
ATOM 10137 N N    . GLU A 1 86  ? -14.552 -0.517  2.827   1.00 0.00 ? 86  GLU A N    6  
ATOM 10138 C CA   . GLU A 1 86  ? -14.856 -0.485  1.404   1.00 0.00 ? 86  GLU A CA   6  
ATOM 10139 C C    . GLU A 1 86  ? -14.402 -1.772  0.722   1.00 0.00 ? 86  GLU A C    6  
ATOM 10140 O O    . GLU A 1 86  ? -13.256 -1.888  0.289   1.00 0.00 ? 86  GLU A O    6  
ATOM 10141 C CB   . GLU A 1 86  ? -14.178 0.725   0.756   1.00 0.00 ? 86  GLU A CB   6  
ATOM 10142 C CG   . GLU A 1 86  ? -14.311 0.772   -0.756  1.00 0.00 ? 86  GLU A CG   6  
ATOM 10143 C CD   . GLU A 1 86  ? -15.529 1.553   -1.213  1.00 0.00 ? 86  GLU A CD   6  
ATOM 10144 O OE1  . GLU A 1 86  ? -16.546 1.541   -0.489  1.00 0.00 ? 86  GLU A OE1  6  
ATOM 10145 O OE2  . GLU A 1 86  ? -15.463 2.176   -2.292  1.00 0.00 ? 86  GLU A OE2  6  
ATOM 10146 H H    . GLU A 1 86  ? -13.667 -0.817  3.121   1.00 0.00 ? 86  GLU A H    6  
ATOM 10147 H HA   . GLU A 1 86  ? -15.925 -0.389  1.293   1.00 0.00 ? 86  GLU A HA   6  
ATOM 10148 H HB2  . GLU A 1 86  ? -14.616 1.626   1.160   1.00 0.00 ? 86  GLU A HB2  6  
ATOM 10149 H HB3  . GLU A 1 86  ? -13.126 0.707   1.002   1.00 0.00 ? 86  GLU A HB3  6  
ATOM 10150 H HG2  . GLU A 1 86  ? -13.428 1.239   -1.165  1.00 0.00 ? 86  GLU A HG2  6  
ATOM 10151 H HG3  . GLU A 1 86  ? -14.388 -0.239  -1.129  1.00 0.00 ? 86  GLU A HG3  6  
ATOM 10152 N N    . LYS A 1 87  ? -15.311 -2.738  0.629   1.00 0.00 ? 87  LYS A N    6  
ATOM 10153 C CA   . LYS A 1 87  ? -15.009 -4.019  -0.001  1.00 0.00 ? 87  LYS A CA   6  
ATOM 10154 C C    . LYS A 1 87  ? -15.024 -3.888  -1.520  1.00 0.00 ? 87  LYS A C    6  
ATOM 10155 O O    . LYS A 1 87  ? -16.082 -3.917  -2.145  1.00 0.00 ? 87  LYS A O    6  
ATOM 10156 C CB   . LYS A 1 87  ? -16.015 -5.084  0.442   1.00 0.00 ? 87  LYS A CB   6  
ATOM 10157 C CG   . LYS A 1 87  ? -16.534 -4.884  1.859   1.00 0.00 ? 87  LYS A CG   6  
ATOM 10158 C CD   . LYS A 1 87  ? -15.474 -5.226  2.895   1.00 0.00 ? 87  LYS A CD   6  
ATOM 10159 C CE   . LYS A 1 87  ? -15.329 -6.729  3.069   1.00 0.00 ? 87  LYS A CE   6  
ATOM 10160 N NZ   . LYS A 1 87  ? -16.598 -7.362  3.528   1.00 0.00 ? 87  LYS A NZ   6  
ATOM 10161 H H    . LYS A 1 87  ? -16.209 -2.586  0.994   1.00 0.00 ? 87  LYS A H    6  
ATOM 10162 H HA   . LYS A 1 87  ? -14.020 -4.317  0.314   1.00 0.00 ? 87  LYS A HA   6  
ATOM 10163 H HB2  . LYS A 1 87  ? -16.858 -5.067  -0.232  1.00 0.00 ? 87  LYS A HB2  6  
ATOM 10164 H HB3  . LYS A 1 87  ? -15.541 -6.054  0.390   1.00 0.00 ? 87  LYS A HB3  6  
ATOM 10165 H HG2  . LYS A 1 87  ? -16.824 -3.853  1.982   1.00 0.00 ? 87  LYS A HG2  6  
ATOM 10166 H HG3  . LYS A 1 87  ? -17.391 -5.523  2.010   1.00 0.00 ? 87  LYS A HG3  6  
ATOM 10167 H HD2  . LYS A 1 87  ? -14.527 -4.819  2.573   1.00 0.00 ? 87  LYS A HD2  6  
ATOM 10168 H HD3  . LYS A 1 87  ? -15.755 -4.788  3.842   1.00 0.00 ? 87  LYS A HD3  6  
ATOM 10169 H HE2  . LYS A 1 87  ? -15.042 -7.163  2.123   1.00 0.00 ? 87  LYS A HE2  6  
ATOM 10170 H HE3  . LYS A 1 87  ? -14.557 -6.922  3.801   1.00 0.00 ? 87  LYS A HE3  6  
ATOM 10171 H HZ1  . LYS A 1 87  ? -16.608 -8.368  3.270   1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 10172 H HZ2  . LYS A 1 87  ? -17.412 -6.893  3.080   1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 10173 H HZ3  . LYS A 1 87  ? -16.687 -7.277  4.559   1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 10174 N N    . ILE A 1 88  ? -13.839 -3.741  -2.105  1.00 0.00 ? 88  ILE A N    6  
ATOM 10175 C CA   . ILE A 1 88  ? -13.712 -3.602  -3.553  1.00 0.00 ? 88  ILE A CA   6  
ATOM 10176 C C    . ILE A 1 88  ? -12.400 -4.193  -4.062  1.00 0.00 ? 88  ILE A C    6  
ATOM 10177 O O    . ILE A 1 88  ? -11.343 -3.972  -3.470  1.00 0.00 ? 88  ILE A O    6  
ATOM 10178 C CB   . ILE A 1 88  ? -13.785 -2.122  -3.984  1.00 0.00 ? 88  ILE A CB   6  
ATOM 10179 C CG1  . ILE A 1 88  ? -12.850 -1.271  -3.121  1.00 0.00 ? 88  ILE A CG1  6  
ATOM 10180 C CG2  . ILE A 1 88  ? -15.213 -1.607  -3.895  1.00 0.00 ? 88  ILE A CG2  6  
ATOM 10181 C CD1  . ILE A 1 88  ? -12.453 0.037   -3.768  1.00 0.00 ? 88  ILE A CD1  6  
ATOM 10182 H H    . ILE A 1 88  ? -13.031 -3.727  -1.551  1.00 0.00 ? 88  ILE A H    6  
ATOM 10183 H HA   . ILE A 1 88  ? -14.537 -4.129  -4.011  1.00 0.00 ? 88  ILE A HA   6  
ATOM 10184 H HB   . ILE A 1 88  ? -13.470 -2.057  -5.016  1.00 0.00 ? 88  ILE A HB   6  
ATOM 10185 H HG12 . ILE A 1 88  ? -13.340 -1.044  -2.188  1.00 0.00 ? 88  ILE A HG12 6  
ATOM 10186 H HG13 . ILE A 1 88  ? -11.948 -1.832  -2.923  1.00 0.00 ? 88  ILE A HG13 6  
ATOM 10187 H HG21 . ILE A 1 88  ? -15.814 -2.078  -4.660  1.00 0.00 ? 88  ILE A HG21 6  
ATOM 10188 H HG22 . ILE A 1 88  ? -15.220 -0.537  -4.038  1.00 0.00 ? 88  ILE A HG22 6  
ATOM 10189 H HG23 . ILE A 1 88  ? -15.621 -1.842  -2.923  1.00 0.00 ? 88  ILE A HG23 6  
ATOM 10190 H HD11 . ILE A 1 88  ? -12.985 0.153   -4.702  1.00 0.00 ? 88  ILE A HD11 6  
ATOM 10191 H HD12 . ILE A 1 88  ? -11.389 0.038   -3.958  1.00 0.00 ? 88  ILE A HD12 6  
ATOM 10192 H HD13 . ILE A 1 88  ? -12.703 0.856   -3.109  1.00 0.00 ? 88  ILE A HD13 6  
ATOM 10193 N N    . PRO A 1 89  ? -12.447 -4.946  -5.175  1.00 0.00 ? 89  PRO A N    6  
ATOM 10194 C CA   . PRO A 1 89  ? -11.248 -5.553  -5.764  1.00 0.00 ? 89  PRO A CA   6  
ATOM 10195 C C    . PRO A 1 89  ? -10.313 -4.496  -6.340  1.00 0.00 ? 89  PRO A C    6  
ATOM 10196 O O    . PRO A 1 89  ? -10.727 -3.655  -7.139  1.00 0.00 ? 89  PRO A O    6  
ATOM 10197 C CB   . PRO A 1 89  ? -11.804 -6.446  -6.876  1.00 0.00 ? 89  PRO A CB   6  
ATOM 10198 C CG   . PRO A 1 89  ? -13.122 -5.846  -7.225  1.00 0.00 ? 89  PRO A CG   6  
ATOM 10199 C CD   . PRO A 1 89  ? -13.663 -5.255  -5.954  1.00 0.00 ? 89  PRO A CD   6  
ATOM 10200 H HA   . PRO A 1 89  ? -10.714 -6.154  -5.043  1.00 0.00 ? 89  PRO A HA   6  
ATOM 10201 H HB2  . PRO A 1 89  ? -11.128 -6.437  -7.718  1.00 0.00 ? 89  PRO A HB2  6  
ATOM 10202 H HB3  . PRO A 1 89  ? -11.915 -7.454  -6.507  1.00 0.00 ? 89  PRO A HB3  6  
ATOM 10203 H HG2  . PRO A 1 89  ? -12.988 -5.075  -7.970  1.00 0.00 ? 89  PRO A HG2  6  
ATOM 10204 H HG3  . PRO A 1 89  ? -13.788 -6.613  -7.595  1.00 0.00 ? 89  PRO A HG3  6  
ATOM 10205 H HD2  . PRO A 1 89  ? -14.223 -4.355  -6.164  1.00 0.00 ? 89  PRO A HD2  6  
ATOM 10206 H HD3  . PRO A 1 89  ? -14.279 -5.972  -5.435  1.00 0.00 ? 89  PRO A HD3  6  
ATOM 10207 N N    . VAL A 1 90  ? -9.050  -4.539  -5.924  1.00 0.00 ? 90  VAL A N    6  
ATOM 10208 C CA   . VAL A 1 90  ? -8.059  -3.577  -6.395  1.00 0.00 ? 90  VAL A CA   6  
ATOM 10209 C C    . VAL A 1 90  ? -6.722  -4.255  -6.675  1.00 0.00 ? 90  VAL A C    6  
ATOM 10210 O O    . VAL A 1 90  ? -6.403  -5.289  -6.091  1.00 0.00 ? 90  VAL A O    6  
ATOM 10211 C CB   . VAL A 1 90  ? -7.842  -2.446  -5.366  1.00 0.00 ? 90  VAL A CB   6  
ATOM 10212 C CG1  . VAL A 1 90  ? -6.987  -1.334  -5.958  1.00 0.00 ? 90  VAL A CG1  6  
ATOM 10213 C CG2  . VAL A 1 90  ? -9.175  -1.896  -4.879  1.00 0.00 ? 90  VAL A CG2  6  
ATOM 10214 H H    . VAL A 1 90  ? -8.775  -5.228  -5.288  1.00 0.00 ? 90  VAL A H    6  
ATOM 10215 H HA   . VAL A 1 90  ? -8.428  -3.138  -7.311  1.00 0.00 ? 90  VAL A HA   6  
ATOM 10216 H HB   . VAL A 1 90  ? -7.315  -2.858  -4.518  1.00 0.00 ? 90  VAL A HB   6  
ATOM 10217 H HG11 . VAL A 1 90  ? -6.698  -0.648  -5.177  1.00 0.00 ? 90  VAL A HG11 6  
ATOM 10218 H HG12 . VAL A 1 90  ? -7.556  -0.805  -6.710  1.00 0.00 ? 90  VAL A HG12 6  
ATOM 10219 H HG13 . VAL A 1 90  ? -6.103  -1.761  -6.408  1.00 0.00 ? 90  VAL A HG13 6  
ATOM 10220 H HG21 . VAL A 1 90  ? -9.608  -1.269  -5.644  1.00 0.00 ? 90  VAL A HG21 6  
ATOM 10221 H HG22 . VAL A 1 90  ? -9.018  -1.313  -3.983  1.00 0.00 ? 90  VAL A HG22 6  
ATOM 10222 H HG23 . VAL A 1 90  ? -9.845  -2.715  -4.662  1.00 0.00 ? 90  VAL A HG23 6  
ATOM 10223 N N    . SER A 1 91  ? -5.942  -3.649  -7.564  1.00 0.00 ? 91  SER A N    6  
ATOM 10224 C CA   . SER A 1 91  ? -4.630  -4.172  -7.921  1.00 0.00 ? 91  SER A CA   6  
ATOM 10225 C C    . SER A 1 91  ? -3.549  -3.500  -7.083  1.00 0.00 ? 91  SER A C    6  
ATOM 10226 O O    . SER A 1 91  ? -3.459  -2.273  -7.047  1.00 0.00 ? 91  SER A O    6  
ATOM 10227 C CB   . SER A 1 91  ? -4.354  -3.947  -9.407  1.00 0.00 ? 91  SER A CB   6  
ATOM 10228 O OG   . SER A 1 91  ? -5.460  -4.346  -10.199 1.00 0.00 ? 91  SER A OG   6  
ATOM 10229 H H    . SER A 1 91  ? -6.257  -2.820  -7.977  1.00 0.00 ? 91  SER A H    6  
ATOM 10230 H HA   . SER A 1 91  ? -4.626  -5.233  -7.716  1.00 0.00 ? 91  SER A HA   6  
ATOM 10231 H HB2  . SER A 1 91  ? -4.166  -2.898  -9.581  1.00 0.00 ? 91  SER A HB2  6  
ATOM 10232 H HB3  . SER A 1 91  ? -3.489  -4.521  -9.702  1.00 0.00 ? 91  SER A HB3  6  
ATOM 10233 H HG   . SER A 1 91  ? -5.227  -5.132  -10.700 1.00 0.00 ? 91  SER A HG   6  
ATOM 10234 N N    . VAL A 1 92  ? -2.731  -4.301  -6.406  1.00 0.00 ? 92  VAL A N    6  
ATOM 10235 C CA   . VAL A 1 92  ? -1.668  -3.758  -5.572  1.00 0.00 ? 92  VAL A CA   6  
ATOM 10236 C C    . VAL A 1 92  ? -0.314  -4.358  -5.931  1.00 0.00 ? 92  VAL A C    6  
ATOM 10237 O O    . VAL A 1 92  ? -0.207  -5.551  -6.202  1.00 0.00 ? 92  VAL A O    6  
ATOM 10238 C CB   . VAL A 1 92  ? -1.946  -4.009  -4.076  1.00 0.00 ? 92  VAL A CB   6  
ATOM 10239 C CG1  . VAL A 1 92  ? -0.819  -3.453  -3.218  1.00 0.00 ? 92  VAL A CG1  6  
ATOM 10240 C CG2  . VAL A 1 92  ? -3.282  -3.403  -3.674  1.00 0.00 ? 92  VAL A CG2  6  
ATOM 10241 H H    . VAL A 1 92  ? -2.844  -5.275  -6.466  1.00 0.00 ? 92  VAL A H    6  
ATOM 10242 H HA   . VAL A 1 92  ? -1.630  -2.690  -5.733  1.00 0.00 ? 92  VAL A HA   6  
ATOM 10243 H HB   . VAL A 1 92  ? -1.997  -5.075  -3.916  1.00 0.00 ? 92  VAL A HB   6  
ATOM 10244 H HG11 . VAL A 1 92  ? -0.900  -2.377  -3.170  1.00 0.00 ? 92  VAL A HG11 6  
ATOM 10245 H HG12 . VAL A 1 92  ? 0.132   -3.723  -3.654  1.00 0.00 ? 92  VAL A HG12 6  
ATOM 10246 H HG13 . VAL A 1 92  ? -0.889  -3.865  -2.221  1.00 0.00 ? 92  VAL A HG13 6  
ATOM 10247 H HG21 . VAL A 1 92  ? -4.032  -4.181  -3.630  1.00 0.00 ? 92  VAL A HG21 6  
ATOM 10248 H HG22 . VAL A 1 92  ? -3.574  -2.661  -4.401  1.00 0.00 ? 92  VAL A HG22 6  
ATOM 10249 H HG23 . VAL A 1 92  ? -3.188  -2.937  -2.703  1.00 0.00 ? 92  VAL A HG23 6  
ATOM 10250 N N    . TRP A 1 93  ? 0.718   -3.521  -5.918  1.00 0.00 ? 93  TRP A N    6  
ATOM 10251 C CA   . TRP A 1 93  ? 2.070   -3.974  -6.225  1.00 0.00 ? 93  TRP A CA   6  
ATOM 10252 C C    . TRP A 1 93  ? 3.098   -3.240  -5.374  1.00 0.00 ? 93  TRP A C    6  
ATOM 10253 O O    . TRP A 1 93  ? 3.371   -2.058  -5.586  1.00 0.00 ? 93  TRP A O    6  
ATOM 10254 C CB   . TRP A 1 93  ? 2.403   -3.813  -7.716  1.00 0.00 ? 93  TRP A CB   6  
ATOM 10255 C CG   . TRP A 1 93  ? 1.546   -2.828  -8.453  1.00 0.00 ? 93  TRP A CG   6  
ATOM 10256 C CD1  . TRP A 1 93  ? 0.217   -2.946  -8.748  1.00 0.00 ? 93  TRP A CD1  6  
ATOM 10257 C CD2  . TRP A 1 93  ? 1.970   -1.577  -9.014  1.00 0.00 ? 93  TRP A CD2  6  
ATOM 10258 N NE1  . TRP A 1 93  ? -0.212  -1.844  -9.446  1.00 0.00 ? 93  TRP A NE1  6  
ATOM 10259 C CE2  . TRP A 1 93  ? 0.845   -0.991  -9.622  1.00 0.00 ? 93  TRP A CE2  6  
ATOM 10260 C CE3  . TRP A 1 93  ? 3.190   -0.896  -9.054  1.00 0.00 ? 93  TRP A CE3  6  
ATOM 10261 C CZ2  . TRP A 1 93  ? 0.905   0.242   -10.264 1.00 0.00 ? 93  TRP A CZ2  6  
ATOM 10262 C CZ3  . TRP A 1 93  ? 3.249   0.326   -9.691  1.00 0.00 ? 93  TRP A CZ3  6  
ATOM 10263 C CH2  . TRP A 1 93  ? 2.113   0.886   -10.288 1.00 0.00 ? 93  TRP A CH2  6  
ATOM 10264 H H    . TRP A 1 93  ? 0.557   -2.582  -5.685  1.00 0.00 ? 93  TRP A H    6  
ATOM 10265 H HA   . TRP A 1 93  ? 2.116   -5.024  -5.974  1.00 0.00 ? 93  TRP A HA   6  
ATOM 10266 H HB2  . TRP A 1 93  ? 3.428   -3.489  -7.809  1.00 0.00 ? 93  TRP A HB2  6  
ATOM 10267 H HB3  . TRP A 1 93  ? 2.295   -4.773  -8.200  1.00 0.00 ? 93  TRP A HB3  6  
ATOM 10268 H HD1  . TRP A 1 93  ? -0.395  -3.789  -8.463  1.00 0.00 ? 93  TRP A HD1  6  
ATOM 10269 H HE1  . TRP A 1 93  ? -1.127  -1.694  -9.765  1.00 0.00 ? 93  TRP A HE1  6  
ATOM 10270 H HE3  . TRP A 1 93  ? 4.074   -1.309  -8.595  1.00 0.00 ? 93  TRP A HE3  6  
ATOM 10271 H HZ2  . TRP A 1 93  ? 0.038   0.686   -10.728 1.00 0.00 ? 93  TRP A HZ2  6  
ATOM 10272 H HZ3  . TRP A 1 93  ? 4.183   0.867   -9.732  1.00 0.00 ? 93  TRP A HZ3  6  
ATOM 10273 H HH2  . TRP A 1 93  ? 2.206   1.846   -10.774 1.00 0.00 ? 93  TRP A HH2  6  
ATOM 10274 N N    . MET A 1 94  ? 3.668   -3.957  -4.409  1.00 0.00 ? 94  MET A N    6  
ATOM 10275 C CA   . MET A 1 94  ? 4.670   -3.393  -3.515  1.00 0.00 ? 94  MET A CA   6  
ATOM 10276 C C    . MET A 1 94  ? 6.073   -3.775  -3.976  1.00 0.00 ? 94  MET A C    6  
ATOM 10277 O O    . MET A 1 94  ? 6.346   -4.940  -4.264  1.00 0.00 ? 94  MET A O    6  
ATOM 10278 C CB   . MET A 1 94  ? 4.440   -3.884  -2.083  1.00 0.00 ? 94  MET A CB   6  
ATOM 10279 C CG   . MET A 1 94  ? 4.860   -2.884  -1.018  1.00 0.00 ? 94  MET A CG   6  
ATOM 10280 S SD   . MET A 1 94  ? 4.662   -3.527  0.656   1.00 0.00 ? 94  MET A SD   6  
ATOM 10281 C CE   . MET A 1 94  ? 4.801   -2.021  1.621   1.00 0.00 ? 94  MET A CE   6  
ATOM 10282 H H    . MET A 1 94  ? 3.404   -4.895  -4.296  1.00 0.00 ? 94  MET A H    6  
ATOM 10283 H HA   . MET A 1 94  ? 4.573   -2.318  -3.541  1.00 0.00 ? 94  MET A HA   6  
ATOM 10284 H HB2  . MET A 1 94  ? 3.388   -4.095  -1.953  1.00 0.00 ? 94  MET A HB2  6  
ATOM 10285 H HB3  . MET A 1 94  ? 5.001   -4.794  -1.932  1.00 0.00 ? 94  MET A HB3  6  
ATOM 10286 H HG2  . MET A 1 94  ? 5.899   -2.634  -1.170  1.00 0.00 ? 94  MET A HG2  6  
ATOM 10287 H HG3  . MET A 1 94  ? 4.256   -1.994  -1.121  1.00 0.00 ? 94  MET A HG3  6  
ATOM 10288 H HE1  . MET A 1 94  ? 5.123   -1.214  0.982   1.00 0.00 ? 94  MET A HE1  6  
ATOM 10289 H HE2  . MET A 1 94  ? 5.521   -2.165  2.413   1.00 0.00 ? 94  MET A HE2  6  
ATOM 10290 H HE3  . MET A 1 94  ? 3.839   -1.779  2.049   1.00 0.00 ? 94  MET A HE3  6  
ATOM 10291 N N    . LYS A 1 95  ? 6.959   -2.787  -4.049  1.00 0.00 ? 95  LYS A N    6  
ATOM 10292 C CA   . LYS A 1 95  ? 8.334   -3.026  -4.480  1.00 0.00 ? 95  LYS A CA   6  
ATOM 10293 C C    . LYS A 1 95  ? 9.305   -2.148  -3.699  1.00 0.00 ? 95  LYS A C    6  
ATOM 10294 O O    . LYS A 1 95  ? 9.114   -0.937  -3.592  1.00 0.00 ? 95  LYS A O    6  
ATOM 10295 C CB   . LYS A 1 95  ? 8.482   -2.762  -5.982  1.00 0.00 ? 95  LYS A CB   6  
ATOM 10296 C CG   . LYS A 1 95  ? 7.311   -2.010  -6.593  1.00 0.00 ? 95  LYS A CG   6  
ATOM 10297 C CD   . LYS A 1 95  ? 7.221   -2.247  -8.092  1.00 0.00 ? 95  LYS A CD   6  
ATOM 10298 C CE   . LYS A 1 95  ? 6.342   -3.445  -8.416  1.00 0.00 ? 95  LYS A CE   6  
ATOM 10299 N NZ   . LYS A 1 95  ? 6.145   -3.610  -9.881  1.00 0.00 ? 95  LYS A NZ   6  
ATOM 10300 H H    . LYS A 1 95  ? 6.686   -1.876  -3.807  1.00 0.00 ? 95  LYS A H    6  
ATOM 10301 H HA   . LYS A 1 95  ? 8.566   -4.061  -4.282  1.00 0.00 ? 95  LYS A HA   6  
ATOM 10302 H HB2  . LYS A 1 95  ? 9.377   -2.179  -6.144  1.00 0.00 ? 95  LYS A HB2  6  
ATOM 10303 H HB3  . LYS A 1 95  ? 8.582   -3.708  -6.492  1.00 0.00 ? 95  LYS A HB3  6  
ATOM 10304 H HG2  . LYS A 1 95  ? 6.395   -2.351  -6.131  1.00 0.00 ? 95  LYS A HG2  6  
ATOM 10305 H HG3  . LYS A 1 95  ? 7.438   -0.954  -6.412  1.00 0.00 ? 95  LYS A HG3  6  
ATOM 10306 H HD2  . LYS A 1 95  ? 6.802   -1.369  -8.562  1.00 0.00 ? 95  LYS A HD2  6  
ATOM 10307 H HD3  . LYS A 1 95  ? 8.214   -2.425  -8.479  1.00 0.00 ? 95  LYS A HD3  6  
ATOM 10308 H HE2  . LYS A 1 95  ? 6.809   -4.334  -8.022  1.00 0.00 ? 95  LYS A HE2  6  
ATOM 10309 H HE3  . LYS A 1 95  ? 5.381   -3.305  -7.944  1.00 0.00 ? 95  LYS A HE3  6  
ATOM 10310 H HZ1  . LYS A 1 95  ? 5.131   -3.678  -10.100 1.00 0.00 ? 95  LYS A HZ1  6  
ATOM 10311 H HZ2  . LYS A 1 95  ? 6.618   -4.476  -10.212 1.00 0.00 ? 95  LYS A HZ2  6  
ATOM 10312 H HZ3  . LYS A 1 95  ? 6.544   -2.795  -10.391 1.00 0.00 ? 95  LYS A HZ3  6  
ATOM 10313 N N    . ARG A 1 96  ? 10.345  -2.768  -3.152  1.00 0.00 ? 96  ARG A N    6  
ATOM 10314 C CA   . ARG A 1 96  ? 11.343  -2.047  -2.373  1.00 0.00 ? 96  ARG A CA   6  
ATOM 10315 C C    . ARG A 1 96  ? 12.351  -1.342  -3.274  1.00 0.00 ? 96  ARG A C    6  
ATOM 10316 O O    . ARG A 1 96  ? 13.410  -1.886  -3.589  1.00 0.00 ? 96  ARG A O    6  
ATOM 10317 C CB   . ARG A 1 96  ? 12.072  -2.997  -1.426  1.00 0.00 ? 96  ARG A CB   6  
ATOM 10318 C CG   . ARG A 1 96  ? 11.149  -3.974  -0.717  1.00 0.00 ? 96  ARG A CG   6  
ATOM 10319 C CD   . ARG A 1 96  ? 11.434  -5.409  -1.129  1.00 0.00 ? 96  ARG A CD   6  
ATOM 10320 N NE   . ARG A 1 96  ? 10.226  -6.229  -1.131  1.00 0.00 ? 96  ARG A NE   6  
ATOM 10321 C CZ   . ARG A 1 96  ? 10.055  -7.291  -1.913  1.00 0.00 ? 96  ARG A CZ   6  
ATOM 10322 N NH1  . ARG A 1 96  ? 11.013  -7.664  -2.752  1.00 0.00 ? 96  ARG A NH1  6  
ATOM 10323 N NH2  . ARG A 1 96  ? 8.925   -7.984  -1.856  1.00 0.00 ? 96  ARG A NH2  6  
ATOM 10324 H H    . ARG A 1 96  ? 10.440  -3.737  -3.269  1.00 0.00 ? 96  ARG A H    6  
ATOM 10325 H HA   . ARG A 1 96  ? 10.825  -1.301  -1.787  1.00 0.00 ? 96  ARG A HA   6  
ATOM 10326 H HB2  . ARG A 1 96  ? 12.796  -3.564  -1.992  1.00 0.00 ? 96  ARG A HB2  6  
ATOM 10327 H HB3  . ARG A 1 96  ? 12.587  -2.414  -0.678  1.00 0.00 ? 96  ARG A HB3  6  
ATOM 10328 H HG2  . ARG A 1 96  ? 11.292  -3.881  0.349   1.00 0.00 ? 96  ARG A HG2  6  
ATOM 10329 H HG3  . ARG A 1 96  ? 10.126  -3.734  -0.967  1.00 0.00 ? 96  ARG A HG3  6  
ATOM 10330 H HD2  . ARG A 1 96  ? 11.857  -5.408  -2.123  1.00 0.00 ? 96  ARG A HD2  6  
ATOM 10331 H HD3  . ARG A 1 96  ? 12.147  -5.835  -0.436  1.00 0.00 ? 96  ARG A HD3  6  
ATOM 10332 H HE   . ARG A 1 96  ? 9.504   -5.974  -0.519  1.00 0.00 ? 96  ARG A HE   6  
ATOM 10333 H HH11 . ARG A 1 96  ? 11.867  -7.145  -2.796  1.00 0.00 ? 96  ARG A HH11 6  
ATOM 10334 H HH12 . ARG A 1 96  ? 10.884  -8.462  -3.337  1.00 0.00 ? 96  ARG A HH12 6  
ATOM 10335 H HH21 . ARG A 1 96  ? 8.201   -7.708  -1.225  1.00 0.00 ? 96  ARG A HH21 6  
ATOM 10336 H HH22 . ARG A 1 96  ? 8.799   -8.782  -2.445  1.00 0.00 ? 96  ARG A HH22 6  
ATOM 10337 N N    . MET A 1 97  ? 12.017  -0.122  -3.670  1.00 0.00 ? 97  MET A N    6  
ATOM 10338 C CA   . MET A 1 97  ? 12.891  0.678   -4.521  1.00 0.00 ? 97  MET A CA   6  
ATOM 10339 C C    . MET A 1 97  ? 13.660  1.685   -3.672  1.00 0.00 ? 97  MET A C    6  
ATOM 10340 O O    . MET A 1 97  ? 13.629  1.613   -2.447  1.00 0.00 ? 97  MET A O    6  
ATOM 10341 C CB   . MET A 1 97  ? 12.076  1.400   -5.598  1.00 0.00 ? 97  MET A CB   6  
ATOM 10342 C CG   . MET A 1 97  ? 11.236  2.547   -5.061  1.00 0.00 ? 97  MET A CG   6  
ATOM 10343 S SD   . MET A 1 97  ? 10.719  3.693   -6.352  1.00 0.00 ? 97  MET A SD   6  
ATOM 10344 C CE   . MET A 1 97  ? 9.356   2.788   -7.082  1.00 0.00 ? 97  MET A CE   6  
ATOM 10345 H H    . MET A 1 97  ? 11.162  0.254   -3.373  1.00 0.00 ? 97  MET A H    6  
ATOM 10346 H HA   . MET A 1 97  ? 13.595  0.010   -4.996  1.00 0.00 ? 97  MET A HA   6  
ATOM 10347 H HB2  . MET A 1 97  ? 12.751  1.796   -6.340  1.00 0.00 ? 97  MET A HB2  6  
ATOM 10348 H HB3  . MET A 1 97  ? 11.415  0.688   -6.069  1.00 0.00 ? 97  MET A HB3  6  
ATOM 10349 H HG2  . MET A 1 97  ? 10.354  2.139   -4.587  1.00 0.00 ? 97  MET A HG2  6  
ATOM 10350 H HG3  . MET A 1 97  ? 11.817  3.089   -4.329  1.00 0.00 ? 97  MET A HG3  6  
ATOM 10351 H HE1  . MET A 1 97  ? 9.444   2.811   -8.156  1.00 0.00 ? 97  MET A HE1  6  
ATOM 10352 H HE2  . MET A 1 97  ? 8.423   3.243   -6.785  1.00 0.00 ? 97  MET A HE2  6  
ATOM 10353 H HE3  . MET A 1 97  ? 9.381   1.764   -6.739  1.00 0.00 ? 97  MET A HE3  6  
ATOM 10354 N N    . ARG A 1 98  ? 14.348  2.621   -4.319  1.00 0.00 ? 98  ARG A N    6  
ATOM 10355 C CA   . ARG A 1 98  ? 15.115  3.629   -3.594  1.00 0.00 ? 98  ARG A CA   6  
ATOM 10356 C C    . ARG A 1 98  ? 14.528  5.019   -3.811  1.00 0.00 ? 98  ARG A C    6  
ATOM 10357 O O    . ARG A 1 98  ? 14.349  5.456   -4.949  1.00 0.00 ? 98  ARG A O    6  
ATOM 10358 C CB   . ARG A 1 98  ? 16.579  3.604   -4.036  1.00 0.00 ? 98  ARG A CB   6  
ATOM 10359 C CG   . ARG A 1 98  ? 17.272  2.279   -3.759  1.00 0.00 ? 98  ARG A CG   6  
ATOM 10360 C CD   . ARG A 1 98  ? 18.380  2.435   -2.728  1.00 0.00 ? 98  ARG A CD   6  
ATOM 10361 N NE   . ARG A 1 98  ? 19.670  2.723   -3.350  1.00 0.00 ? 98  ARG A NE   6  
ATOM 10362 C CZ   . ARG A 1 98  ? 20.185  3.945   -3.451  1.00 0.00 ? 98  ARG A CZ   6  
ATOM 10363 N NH1  . ARG A 1 98  ? 19.523  4.990   -2.971  1.00 0.00 ? 98  ARG A NH1  6  
ATOM 10364 N NH2  . ARG A 1 98  ? 21.363  4.122   -4.030  1.00 0.00 ? 98  ARG A NH2  6  
ATOM 10365 H H    . ARG A 1 98  ? 14.349  2.639   -5.297  1.00 0.00 ? 98  ARG A H    6  
ATOM 10366 H HA   . ARG A 1 98  ? 15.062  3.391   -2.542  1.00 0.00 ? 98  ARG A HA   6  
ATOM 10367 H HB2  . ARG A 1 98  ? 16.625  3.795   -5.098  1.00 0.00 ? 98  ARG A HB2  6  
ATOM 10368 H HB3  . ARG A 1 98  ? 17.114  4.382   -3.515  1.00 0.00 ? 98  ARG A HB3  6  
ATOM 10369 H HG2  . ARG A 1 98  ? 16.546  1.574   -3.387  1.00 0.00 ? 98  ARG A HG2  6  
ATOM 10370 H HG3  . ARG A 1 98  ? 17.699  1.909   -4.679  1.00 0.00 ? 98  ARG A HG3  6  
ATOM 10371 H HD2  . ARG A 1 98  ? 18.123  3.247   -2.064  1.00 0.00 ? 98  ARG A HD2  6  
ATOM 10372 H HD3  . ARG A 1 98  ? 18.460  1.519   -2.164  1.00 0.00 ? 98  ARG A HD3  6  
ATOM 10373 H HE   . ARG A 1 98  ? 20.177  1.967   -3.712  1.00 0.00 ? 98  ARG A HE   6  
ATOM 10374 H HH11 . ARG A 1 98  ? 18.634  4.862   -2.534  1.00 0.00 ? 98  ARG A HH11 6  
ATOM 10375 H HH12 . ARG A 1 98  ? 19.914  5.907   -3.051  1.00 0.00 ? 98  ARG A HH12 6  
ATOM 10376 H HH21 . ARG A 1 98  ? 21.866  3.337   -4.393  1.00 0.00 ? 98  ARG A HH21 6  
ATOM 10377 H HH22 . ARG A 1 98  ? 21.751  5.041   -4.106  1.00 0.00 ? 98  ARG A HH22 6  
ATOM 10378 N N    . GLN A 1 99  ? 14.225  5.707   -2.714  1.00 0.00 ? 99  GLN A N    6  
ATOM 10379 C CA   . GLN A 1 99  ? 13.655  7.047   -2.786  1.00 0.00 ? 99  GLN A CA   6  
ATOM 10380 C C    . GLN A 1 99  ? 14.546  8.062   -2.077  1.00 0.00 ? 99  GLN A C    6  
ATOM 10381 O O    . GLN A 1 99  ? 14.550  9.244   -2.423  1.00 0.00 ? 99  GLN A O    6  
ATOM 10382 C CB   . GLN A 1 99  ? 12.256  7.059   -2.170  1.00 0.00 ? 99  GLN A CB   6  
ATOM 10383 C CG   . GLN A 1 99  ? 11.465  8.320   -2.484  1.00 0.00 ? 99  GLN A CG   6  
ATOM 10384 C CD   . GLN A 1 99  ? 10.203  8.035   -3.276  1.00 0.00 ? 99  GLN A CD   6  
ATOM 10385 O OE1  . GLN A 1 99  ? 10.257  7.773   -4.478  1.00 0.00 ? 99  GLN A OE1  6  
ATOM 10386 N NE2  . GLN A 1 99  ? 9.059   8.087   -2.605  1.00 0.00 ? 99  GLN A NE2  6  
ATOM 10387 H H    . GLN A 1 99  ? 14.390  5.303   -1.836  1.00 0.00 ? 99  GLN A H    6  
ATOM 10388 H HA   . GLN A 1 99  ? 13.581  7.319   -3.828  1.00 0.00 ? 99  GLN A HA   6  
ATOM 10389 H HB2  . GLN A 1 99  ? 11.701  6.211   -2.544  1.00 0.00 ? 99  GLN A HB2  6  
ATOM 10390 H HB3  . GLN A 1 99  ? 12.345  6.976   -1.097  1.00 0.00 ? 99  GLN A HB3  6  
ATOM 10391 H HG2  . GLN A 1 99  ? 11.188  8.795   -1.555  1.00 0.00 ? 99  GLN A HG2  6  
ATOM 10392 H HG3  . GLN A 1 99  ? 12.089  8.989   -3.056  1.00 0.00 ? 99  GLN A HG3  6  
ATOM 10393 H HE21 . GLN A 1 99  ? 9.092   8.302   -1.650  1.00 0.00 ? 99  GLN A HE21 6  
ATOM 10394 H HE22 . GLN A 1 99  ? 8.228   7.909   -3.094  1.00 0.00 ? 99  GLN A HE22 6  
ATOM 10395 N N    . GLU A 1 100 ? 15.300  7.597   -1.084  1.00 0.00 ? 100 GLU A N    6  
ATOM 10396 C CA   . GLU A 1 100 ? 16.195  8.470   -0.331  1.00 0.00 ? 100 GLU A CA   6  
ATOM 10397 C C    . GLU A 1 100 ? 17.584  7.851   -0.194  1.00 0.00 ? 100 GLU A C    6  
ATOM 10398 O O    . GLU A 1 100 ? 18.444  8.044   -1.052  1.00 0.00 ? 100 GLU A O    6  
ATOM 10399 C CB   . GLU A 1 100 ? 15.611  8.763   1.056   1.00 0.00 ? 100 GLU A CB   6  
ATOM 10400 C CG   . GLU A 1 100 ? 14.905  10.105  1.147   1.00 0.00 ? 100 GLU A CG   6  
ATOM 10401 C CD   . GLU A 1 100 ? 13.741  10.088  2.118   1.00 0.00 ? 100 GLU A CD   6  
ATOM 10402 O OE1  . GLU A 1 100 ? 12.709  9.461   1.796   1.00 0.00 ? 100 GLU A OE1  6  
ATOM 10403 O OE2  . GLU A 1 100 ? 13.859  10.700  3.200   1.00 0.00 ? 100 GLU A OE2  6  
ATOM 10404 H H    . GLU A 1 100 ? 15.256  6.645   -0.854  1.00 0.00 ? 100 GLU A H    6  
ATOM 10405 H HA   . GLU A 1 100 ? 16.283  9.398   -0.874  1.00 0.00 ? 100 GLU A HA   6  
ATOM 10406 H HB2  . GLU A 1 100 ? 14.900  7.989   1.304   1.00 0.00 ? 100 GLU A HB2  6  
ATOM 10407 H HB3  . GLU A 1 100 ? 16.411  8.751   1.780   1.00 0.00 ? 100 GLU A HB3  6  
ATOM 10408 H HG2  . GLU A 1 100 ? 15.616  10.850  1.475   1.00 0.00 ? 100 GLU A HG2  6  
ATOM 10409 H HG3  . GLU A 1 100 ? 14.535  10.370  0.167   1.00 0.00 ? 100 GLU A HG3  6  
ATOM 10410 N N    . ARG A 1 101 ? 17.794  7.106   0.888   1.00 0.00 ? 101 ARG A N    6  
ATOM 10411 C CA   . ARG A 1 101 ? 19.076  6.458   1.136   1.00 0.00 ? 101 ARG A CA   6  
ATOM 10412 C C    . ARG A 1 101 ? 18.870  5.015   1.586   1.00 0.00 ? 101 ARG A C    6  
ATOM 10413 O O    . ARG A 1 101 ? 19.830  4.279   1.807   1.00 0.00 ? 101 ARG A O    6  
ATOM 10414 C CB   . ARG A 1 101 ? 19.860  7.227   2.200   1.00 0.00 ? 101 ARG A CB   6  
ATOM 10415 C CG   . ARG A 1 101 ? 19.111  7.379   3.514   1.00 0.00 ? 101 ARG A CG   6  
ATOM 10416 C CD   . ARG A 1 101 ? 19.733  8.452   4.394   1.00 0.00 ? 101 ARG A CD   6  
ATOM 10417 N NE   . ARG A 1 101 ? 18.723  9.231   5.102   1.00 0.00 ? 101 ARG A NE   6  
ATOM 10418 C CZ   . ARG A 1 101 ? 18.020  8.768   6.134   1.00 0.00 ? 101 ARG A CZ   6  
ATOM 10419 N NH1  . ARG A 1 101 ? 18.218  7.531   6.573   1.00 0.00 ? 101 ARG A NH1  6  
ATOM 10420 N NH2  . ARG A 1 101 ? 17.119  9.540   6.725   1.00 0.00 ? 101 ARG A NH2  6  
ATOM 10421 H H    . ARG A 1 101 ? 17.069  6.990   1.535   1.00 0.00 ? 101 ARG A H    6  
ATOM 10422 H HA   . ARG A 1 101 ? 19.637  6.459   0.212   1.00 0.00 ? 101 ARG A HA   6  
ATOM 10423 H HB2  . ARG A 1 101 ? 20.786  6.704   2.396   1.00 0.00 ? 101 ARG A HB2  6  
ATOM 10424 H HB3  . ARG A 1 101 ? 20.086  8.213   1.823   1.00 0.00 ? 101 ARG A HB3  6  
ATOM 10425 H HG2  . ARG A 1 101 ? 18.088  7.651   3.302   1.00 0.00 ? 101 ARG A HG2  6  
ATOM 10426 H HG3  . ARG A 1 101 ? 19.133  6.436   4.041   1.00 0.00 ? 101 ARG A HG3  6  
ATOM 10427 H HD2  . ARG A 1 101 ? 20.379  7.976   5.116   1.00 0.00 ? 101 ARG A HD2  6  
ATOM 10428 H HD3  . ARG A 1 101 ? 20.316  9.115   3.771   1.00 0.00 ? 101 ARG A HD3  6  
ATOM 10429 H HE   . ARG A 1 101 ? 18.557  10.147  4.794   1.00 0.00 ? 101 ARG A HE   6  
ATOM 10430 H HH11 . ARG A 1 101 ? 18.896  6.944   6.129   1.00 0.00 ? 101 ARG A HH11 6  
ATOM 10431 H HH12 . ARG A 1 101 ? 17.688  7.186   7.348   1.00 0.00 ? 101 ARG A HH12 6  
ATOM 10432 H HH21 . ARG A 1 101 ? 16.965  10.472  6.395   1.00 0.00 ? 101 ARG A HH21 6  
ATOM 10433 H HH22 . ARG A 1 101 ? 16.593  9.190   7.501   1.00 0.00 ? 101 ARG A HH22 6  
ATOM 10434 N N    . ARG A 1 102 ? 17.609  4.625   1.721   1.00 0.00 ? 102 ARG A N    6  
ATOM 10435 C CA   . ARG A 1 102 ? 17.262  3.275   2.148   1.00 0.00 ? 102 ARG A CA   6  
ATOM 10436 C C    . ARG A 1 102 ? 16.193  2.680   1.234   1.00 0.00 ? 102 ARG A C    6  
ATOM 10437 O O    . ARG A 1 102 ? 15.377  3.408   0.668   1.00 0.00 ? 102 ARG A O    6  
ATOM 10438 C CB   . ARG A 1 102 ? 16.780  3.294   3.607   1.00 0.00 ? 102 ARG A CB   6  
ATOM 10439 C CG   . ARG A 1 102 ? 15.575  2.403   3.888   1.00 0.00 ? 102 ARG A CG   6  
ATOM 10440 C CD   . ARG A 1 102 ? 14.269  3.183   3.827   1.00 0.00 ? 102 ARG A CD   6  
ATOM 10441 N NE   . ARG A 1 102 ? 14.441  4.577   4.229   1.00 0.00 ? 102 ARG A NE   6  
ATOM 10442 C CZ   . ARG A 1 102 ? 14.170  5.033   5.448   1.00 0.00 ? 102 ARG A CZ   6  
ATOM 10443 N NH1  . ARG A 1 102 ? 13.717  4.207   6.382   1.00 0.00 ? 102 ARG A NH1  6  
ATOM 10444 N NH2  . ARG A 1 102 ? 14.355  6.313   5.734   1.00 0.00 ? 102 ARG A NH2  6  
ATOM 10445 H H    . ARG A 1 102 ? 16.888  5.265   1.531   1.00 0.00 ? 102 ARG A H    6  
ATOM 10446 H HA   . ARG A 1 102 ? 18.155  2.668   2.080   1.00 0.00 ? 102 ARG A HA   6  
ATOM 10447 H HB2  . ARG A 1 102 ? 17.590  2.972   4.243   1.00 0.00 ? 102 ARG A HB2  6  
ATOM 10448 H HB3  . ARG A 1 102 ? 16.515  4.309   3.868   1.00 0.00 ? 102 ARG A HB3  6  
ATOM 10449 H HG2  . ARG A 1 102 ? 15.545  1.613   3.154   1.00 0.00 ? 102 ARG A HG2  6  
ATOM 10450 H HG3  . ARG A 1 102 ? 15.682  1.974   4.874   1.00 0.00 ? 102 ARG A HG3  6  
ATOM 10451 H HD2  . ARG A 1 102 ? 13.895  3.156   2.813   1.00 0.00 ? 102 ARG A HD2  6  
ATOM 10452 H HD3  . ARG A 1 102 ? 13.554  2.714   4.486   1.00 0.00 ? 102 ARG A HD3  6  
ATOM 10453 H HE   . ARG A 1 102 ? 14.776  5.205   3.554   1.00 0.00 ? 102 ARG A HE   6  
ATOM 10454 H HH11 . ARG A 1 102 ? 13.579  3.240   6.171   1.00 0.00 ? 102 ARG A HH11 6  
ATOM 10455 H HH12 . ARG A 1 102 ? 13.514  4.553   7.299   1.00 0.00 ? 102 ARG A HH12 6  
ATOM 10456 H HH21 . ARG A 1 102 ? 14.699  6.939   5.032   1.00 0.00 ? 102 ARG A HH21 6  
ATOM 10457 H HH22 . ARG A 1 102 ? 14.151  6.657   6.651   1.00 0.00 ? 102 ARG A HH22 6  
ATOM 10458 N N    . LEU A 1 103 ? 16.205  1.356   1.097   1.00 0.00 ? 103 LEU A N    6  
ATOM 10459 C CA   . LEU A 1 103 ? 15.228  0.669   0.256   1.00 0.00 ? 103 LEU A CA   6  
ATOM 10460 C C    . LEU A 1 103 ? 13.810  0.996   0.716   1.00 0.00 ? 103 LEU A C    6  
ATOM 10461 O O    . LEU A 1 103 ? 13.284  0.365   1.631   1.00 0.00 ? 103 LEU A O    6  
ATOM 10462 C CB   . LEU A 1 103 ? 15.445  -0.850  0.282   1.00 0.00 ? 103 LEU A CB   6  
ATOM 10463 C CG   . LEU A 1 103 ? 16.561  -1.342  1.205   1.00 0.00 ? 103 LEU A CG   6  
ATOM 10464 C CD1  . LEU A 1 103 ? 16.189  -2.680  1.827   1.00 0.00 ? 103 LEU A CD1  6  
ATOM 10465 C CD2  . LEU A 1 103 ? 17.870  -1.454  0.438   1.00 0.00 ? 103 LEU A CD2  6  
ATOM 10466 H H    . LEU A 1 103 ? 16.879  0.833   1.577   1.00 0.00 ? 103 LEU A H    6  
ATOM 10467 H HA   . LEU A 1 103 ? 15.355  1.026   -0.754  1.00 0.00 ? 103 LEU A HA   6  
ATOM 10468 H HB2  . LEU A 1 103 ? 14.521  -1.317  0.590   1.00 0.00 ? 103 LEU A HB2  6  
ATOM 10469 H HB3  . LEU A 1 103 ? 15.671  -1.174  -0.723  1.00 0.00 ? 103 LEU A HB3  6  
ATOM 10470 H HG   . LEU A 1 103 ? 16.699  -0.629  2.004   1.00 0.00 ? 103 LEU A HG   6  
ATOM 10471 H HD11 . LEU A 1 103 ? 17.014  -3.368  1.721   1.00 0.00 ? 103 LEU A HD11 6  
ATOM 10472 H HD12 . LEU A 1 103 ? 15.319  -3.080  1.327   1.00 0.00 ? 103 LEU A HD12 6  
ATOM 10473 H HD13 . LEU A 1 103 ? 15.969  -2.540  2.874   1.00 0.00 ? 103 LEU A HD13 6  
ATOM 10474 H HD21 . LEU A 1 103 ? 17.779  -0.941  -0.507  1.00 0.00 ? 103 LEU A HD21 6  
ATOM 10475 H HD22 . LEU A 1 103 ? 18.097  -2.495  0.263   1.00 0.00 ? 103 LEU A HD22 6  
ATOM 10476 H HD23 . LEU A 1 103 ? 18.665  -1.006  1.016   1.00 0.00 ? 103 LEU A HD23 6  
ATOM 10477 N N    . CYS A 1 104 ? 13.202  1.989   0.076   1.00 0.00 ? 104 CYS A N    6  
ATOM 10478 C CA   . CYS A 1 104 ? 11.850  2.404   0.421   1.00 0.00 ? 104 CYS A CA   6  
ATOM 10479 C C    . CYS A 1 104 ? 10.813  1.573   -0.326  1.00 0.00 ? 104 CYS A C    6  
ATOM 10480 O O    . CYS A 1 104 ? 10.831  1.492   -1.555  1.00 0.00 ? 104 CYS A O    6  
ATOM 10481 C CB   . CYS A 1 104 ? 11.653  3.888   0.103   1.00 0.00 ? 104 CYS A CB   6  
ATOM 10482 S SG   . CYS A 1 104 ? 12.252  5.003   1.395   1.00 0.00 ? 104 CYS A SG   6  
ATOM 10483 H H    . CYS A 1 104 ? 13.673  2.455   -0.644  1.00 0.00 ? 104 CYS A H    6  
ATOM 10484 H HA   . CYS A 1 104 ? 11.716  2.251   1.481   1.00 0.00 ? 104 CYS A HA   6  
ATOM 10485 H HB2  . CYS A 1 104 ? 12.185  4.126   -0.806  1.00 0.00 ? 104 CYS A HB2  6  
ATOM 10486 H HB3  . CYS A 1 104 ? 10.601  4.082   -0.039  1.00 0.00 ? 104 CYS A HB3  6  
ATOM 10487 H HG   . CYS A 1 104 ? 12.246  6.234   0.905   1.00 0.00 ? 104 CYS A HG   6  
ATOM 10488 N N    . CYS A 1 105 ? 9.911   0.962   0.429   1.00 0.00 ? 105 CYS A N    6  
ATOM 10489 C CA   . CYS A 1 105 ? 8.855   0.136   -0.141  1.00 0.00 ? 105 CYS A CA   6  
ATOM 10490 C C    . CYS A 1 105 ? 7.708   1.005   -0.652  1.00 0.00 ? 105 CYS A C    6  
ATOM 10491 O O    . CYS A 1 105 ? 7.130   1.788   0.098   1.00 0.00 ? 105 CYS A O    6  
ATOM 10492 C CB   . CYS A 1 105 ? 8.340   -0.839  0.916   1.00 0.00 ? 105 CYS A CB   6  
ATOM 10493 S SG   . CYS A 1 105 ? 7.886   -2.462  0.266   1.00 0.00 ? 105 CYS A SG   6  
ATOM 10494 H H    . CYS A 1 105 ? 9.953   1.072   1.402   1.00 0.00 ? 105 CYS A H    6  
ATOM 10495 H HA   . CYS A 1 105 ? 9.272   -0.420  -0.966  1.00 0.00 ? 105 CYS A HA   6  
ATOM 10496 H HB2  . CYS A 1 105 ? 9.107   -0.987  1.660   1.00 0.00 ? 105 CYS A HB2  6  
ATOM 10497 H HB3  . CYS A 1 105 ? 7.464   -0.413  1.391   1.00 0.00 ? 105 CYS A HB3  6  
ATOM 10498 H HG   . CYS A 1 105 ? 8.766   -3.343  0.718   1.00 0.00 ? 105 CYS A HG   6  
ATOM 10499 N N    . VAL A 1 106 ? 7.385   0.864   -1.935  1.00 0.00 ? 106 VAL A N    6  
ATOM 10500 C CA   . VAL A 1 106 ? 6.308   1.639   -2.545  1.00 0.00 ? 106 VAL A CA   6  
ATOM 10501 C C    . VAL A 1 106 ? 5.136   0.745   -2.938  1.00 0.00 ? 106 VAL A C    6  
ATOM 10502 O O    . VAL A 1 106 ? 5.329   -0.358  -3.449  1.00 0.00 ? 106 VAL A O    6  
ATOM 10503 C CB   . VAL A 1 106 ? 6.807   2.399   -3.791  1.00 0.00 ? 106 VAL A CB   6  
ATOM 10504 C CG1  . VAL A 1 106 ? 5.671   3.173   -4.447  1.00 0.00 ? 106 VAL A CG1  6  
ATOM 10505 C CG2  . VAL A 1 106 ? 7.952   3.331   -3.424  1.00 0.00 ? 106 VAL A CG2  6  
ATOM 10506 H H    . VAL A 1 106 ? 7.881   0.224   -2.484  1.00 0.00 ? 106 VAL A H    6  
ATOM 10507 H HA   . VAL A 1 106 ? 5.967   2.365   -1.820  1.00 0.00 ? 106 VAL A HA   6  
ATOM 10508 H HB   . VAL A 1 106 ? 7.176   1.676   -4.504  1.00 0.00 ? 106 VAL A HB   6  
ATOM 10509 H HG11 . VAL A 1 106 ? 5.907   3.346   -5.488  1.00 0.00 ? 106 VAL A HG11 6  
ATOM 10510 H HG12 . VAL A 1 106 ? 5.544   4.121   -3.946  1.00 0.00 ? 106 VAL A HG12 6  
ATOM 10511 H HG13 . VAL A 1 106 ? 4.758   2.602   -4.375  1.00 0.00 ? 106 VAL A HG13 6  
ATOM 10512 H HG21 . VAL A 1 106 ? 8.845   2.751   -3.246  1.00 0.00 ? 106 VAL A HG21 6  
ATOM 10513 H HG22 . VAL A 1 106 ? 7.694   3.880   -2.530  1.00 0.00 ? 106 VAL A HG22 6  
ATOM 10514 H HG23 . VAL A 1 106 ? 8.128   4.024   -4.234  1.00 0.00 ? 106 VAL A HG23 6  
ATOM 10515 N N    . VAL A 1 107 ? 3.918   1.229   -2.701  1.00 0.00 ? 107 VAL A N    6  
ATOM 10516 C CA   . VAL A 1 107 ? 2.713   0.478   -3.033  1.00 0.00 ? 107 VAL A CA   6  
ATOM 10517 C C    . VAL A 1 107 ? 1.777   1.319   -3.900  1.00 0.00 ? 107 VAL A C    6  
ATOM 10518 O O    . VAL A 1 107 ? 1.642   2.526   -3.693  1.00 0.00 ? 107 VAL A O    6  
ATOM 10519 C CB   . VAL A 1 107 ? 1.975   0.012   -1.749  1.00 0.00 ? 107 VAL A CB   6  
ATOM 10520 C CG1  . VAL A 1 107 ? 0.625   0.702   -1.590  1.00 0.00 ? 107 VAL A CG1  6  
ATOM 10521 C CG2  . VAL A 1 107 ? 1.802   -1.499  -1.752  1.00 0.00 ? 107 VAL A CG2  6  
ATOM 10522 H H    . VAL A 1 107 ? 3.822   2.117   -2.295  1.00 0.00 ? 107 VAL A H    6  
ATOM 10523 H HA   . VAL A 1 107 ? 3.011   -0.399  -3.589  1.00 0.00 ? 107 VAL A HA   6  
ATOM 10524 H HB   . VAL A 1 107 ? 2.585   0.276   -0.897  1.00 0.00 ? 107 VAL A HB   6  
ATOM 10525 H HG11 . VAL A 1 107 ? -0.045  0.364   -2.365  1.00 0.00 ? 107 VAL A HG11 6  
ATOM 10526 H HG12 . VAL A 1 107 ? 0.756   1.772   -1.664  1.00 0.00 ? 107 VAL A HG12 6  
ATOM 10527 H HG13 . VAL A 1 107 ? 0.208   0.458   -0.622  1.00 0.00 ? 107 VAL A HG13 6  
ATOM 10528 H HG21 . VAL A 1 107 ? 1.683   -1.849  -0.736  1.00 0.00 ? 107 VAL A HG21 6  
ATOM 10529 H HG22 . VAL A 1 107 ? 2.672   -1.960  -2.192  1.00 0.00 ? 107 VAL A HG22 6  
ATOM 10530 H HG23 . VAL A 1 107 ? 0.926   -1.760  -2.325  1.00 0.00 ? 107 VAL A HG23 6  
ATOM 10531 N N    . VAL A 1 108 ? 1.136   0.682   -4.875  1.00 0.00 ? 108 VAL A N    6  
ATOM 10532 C CA   . VAL A 1 108 ? 0.219   1.383   -5.769  1.00 0.00 ? 108 VAL A CA   6  
ATOM 10533 C C    . VAL A 1 108 ? -1.092  0.618   -5.922  1.00 0.00 ? 108 VAL A C    6  
ATOM 10534 O O    . VAL A 1 108 ? -1.098  -0.559  -6.284  1.00 0.00 ? 108 VAL A O    6  
ATOM 10535 C CB   . VAL A 1 108 ? 0.835   1.599   -7.164  1.00 0.00 ? 108 VAL A CB   6  
ATOM 10536 C CG1  . VAL A 1 108 ? 0.090   2.692   -7.913  1.00 0.00 ? 108 VAL A CG1  6  
ATOM 10537 C CG2  . VAL A 1 108 ? 2.316   1.934   -7.053  1.00 0.00 ? 108 VAL A CG2  6  
ATOM 10538 H H    . VAL A 1 108 ? 1.286   -0.279  -4.999  1.00 0.00 ? 108 VAL A H    6  
ATOM 10539 H HA   . VAL A 1 108 ? 0.010   2.350   -5.338  1.00 0.00 ? 108 VAL A HA   6  
ATOM 10540 H HB   . VAL A 1 108 ? 0.739   0.680   -7.722  1.00 0.00 ? 108 VAL A HB   6  
ATOM 10541 H HG11 . VAL A 1 108 ? -0.075  2.379   -8.932  1.00 0.00 ? 108 VAL A HG11 6  
ATOM 10542 H HG12 . VAL A 1 108 ? 0.677   3.598   -7.904  1.00 0.00 ? 108 VAL A HG12 6  
ATOM 10543 H HG13 . VAL A 1 108 ? -0.861  2.874   -7.434  1.00 0.00 ? 108 VAL A HG13 6  
ATOM 10544 H HG21 . VAL A 1 108 ? 2.615   2.516   -7.914  1.00 0.00 ? 108 VAL A HG21 6  
ATOM 10545 H HG22 . VAL A 1 108 ? 2.891   1.017   -7.022  1.00 0.00 ? 108 VAL A HG22 6  
ATOM 10546 H HG23 . VAL A 1 108 ? 2.493   2.501   -6.152  1.00 0.00 ? 108 VAL A HG23 6  
ATOM 10547 N N    . LEU A 1 109 ? -2.203  1.291   -5.632  1.00 0.00 ? 109 LEU A N    6  
ATOM 10548 C CA   . LEU A 1 109 ? -3.520  0.675   -5.723  1.00 0.00 ? 109 LEU A CA   6  
ATOM 10549 C C    . LEU A 1 109 ? -4.286  1.182   -6.942  1.00 0.00 ? 109 LEU A C    6  
ATOM 10550 O O    . LEU A 1 109 ? -4.517  2.381   -7.090  1.00 0.00 ? 109 LEU A O    6  
ATOM 10551 C CB   . LEU A 1 109 ? -4.305  0.973   -4.450  1.00 0.00 ? 109 LEU A CB   6  
ATOM 10552 C CG   . LEU A 1 109 ? -3.430  1.227   -3.224  1.00 0.00 ? 109 LEU A CG   6  
ATOM 10553 C CD1  . LEU A 1 109 ? -4.164  2.079   -2.205  1.00 0.00 ? 109 LEU A CD1  6  
ATOM 10554 C CD2  . LEU A 1 109 ? -2.989  -0.094  -2.615  1.00 0.00 ? 109 LEU A CD2  6  
ATOM 10555 H H    . LEU A 1 109 ? -2.139  2.224   -5.335  1.00 0.00 ? 109 LEU A H    6  
ATOM 10556 H HA   . LEU A 1 109 ? -3.386  -0.392  -5.808  1.00 0.00 ? 109 LEU A HA   6  
ATOM 10557 H HB2  . LEU A 1 109 ? -4.919  1.845   -4.622  1.00 0.00 ? 109 LEU A HB2  6  
ATOM 10558 H HB3  . LEU A 1 109 ? -4.949  0.132   -4.239  1.00 0.00 ? 109 LEU A HB3  6  
ATOM 10559 H HG   . LEU A 1 109 ? -2.546  1.765   -3.529  1.00 0.00 ? 109 LEU A HG   6  
ATOM 10560 H HD11 . LEU A 1 109 ? -4.320  3.069   -2.608  1.00 0.00 ? 109 LEU A HD11 6  
ATOM 10561 H HD12 . LEU A 1 109 ? -3.576  2.146   -1.301  1.00 0.00 ? 109 LEU A HD12 6  
ATOM 10562 H HD13 . LEU A 1 109 ? -5.120  1.628   -1.980  1.00 0.00 ? 109 LEU A HD13 6  
ATOM 10563 H HD21 . LEU A 1 109 ? -3.728  -0.429  -1.904  1.00 0.00 ? 109 LEU A HD21 6  
ATOM 10564 H HD22 . LEU A 1 109 ? -2.041  0.040   -2.113  1.00 0.00 ? 109 LEU A HD22 6  
ATOM 10565 H HD23 . LEU A 1 109 ? -2.882  -0.831  -3.399  1.00 0.00 ? 109 LEU A HD23 6  
ATOM 10566 N N    . GLU A 1 110 ? -4.685  0.259   -7.811  1.00 0.00 ? 110 GLU A N    6  
ATOM 10567 C CA   . GLU A 1 110 ? -5.430  0.611   -9.012  1.00 0.00 ? 110 GLU A CA   6  
ATOM 10568 C C    . GLU A 1 110 ? -6.765  -0.128  -9.049  1.00 0.00 ? 110 GLU A C    6  
ATOM 10569 O O    . GLU A 1 110 ? -6.800  -1.356  -9.124  1.00 0.00 ? 110 GLU A O    6  
ATOM 10570 C CB   . GLU A 1 110 ? -4.608  0.293   -10.257 1.00 0.00 ? 110 GLU A CB   6  
ATOM 10571 C CG   . GLU A 1 110 ? -5.434  0.164   -11.530 1.00 0.00 ? 110 GLU A CG   6  
ATOM 10572 C CD   . GLU A 1 110 ? -4.583  -0.109  -12.753 1.00 0.00 ? 110 GLU A CD   6  
ATOM 10573 O OE1  . GLU A 1 110 ? -3.496  -0.706  -12.601 1.00 0.00 ? 110 GLU A OE1  6  
ATOM 10574 O OE2  . GLU A 1 110 ? -5.002  0.275   -13.865 1.00 0.00 ? 110 GLU A OE2  6  
ATOM 10575 H H    . GLU A 1 110 ? -4.475  -0.683  -7.638  1.00 0.00 ? 110 GLU A H    6  
ATOM 10576 H HA   . GLU A 1 110 ? -5.620  1.666   -8.983  1.00 0.00 ? 110 GLU A HA   6  
ATOM 10577 H HB2  . GLU A 1 110 ? -3.881  1.077   -10.406 1.00 0.00 ? 110 GLU A HB2  6  
ATOM 10578 H HB3  . GLU A 1 110 ? -4.092  -0.634  -10.094 1.00 0.00 ? 110 GLU A HB3  6  
ATOM 10579 H HG2  . GLU A 1 110 ? -6.134  -0.649  -11.407 1.00 0.00 ? 110 GLU A HG2  6  
ATOM 10580 H HG3  . GLU A 1 110 ? -5.978  1.084   -11.685 1.00 0.00 ? 110 GLU A HG3  6  
ATOM 10581 N N    . PRO A 1 111 ? -7.887  0.611   -9.000  1.00 0.00 ? 111 PRO A N    6  
ATOM 10582 C CA   . PRO A 1 111 ? -9.222  0.013   -9.027  1.00 0.00 ? 111 PRO A CA   6  
ATOM 10583 C C    . PRO A 1 111 ? -9.451  -0.809  -10.290 1.00 0.00 ? 111 PRO A C    6  
ATOM 10584 O O    . PRO A 1 111 ? -9.108  -0.376  -11.391 1.00 0.00 ? 111 PRO A O    6  
ATOM 10585 C CB   . PRO A 1 111 ? -10.173 1.218   -8.990  1.00 0.00 ? 111 PRO A CB   6  
ATOM 10586 C CG   . PRO A 1 111 ? -9.336  2.394   -9.373  1.00 0.00 ? 111 PRO A CG   6  
ATOM 10587 C CD   . PRO A 1 111 ? -7.941  2.079   -8.915  1.00 0.00 ? 111 PRO A CD   6  
ATOM 10588 H HA   . PRO A 1 111 ? -9.392  -0.608  -8.160  1.00 0.00 ? 111 PRO A HA   6  
ATOM 10589 H HB2  . PRO A 1 111 ? -10.979 1.063   -9.692  1.00 0.00 ? 111 PRO A HB2  6  
ATOM 10590 H HB3  . PRO A 1 111 ? -10.574 1.330   -7.993  1.00 0.00 ? 111 PRO A HB3  6  
ATOM 10591 H HG2  . PRO A 1 111 ? -9.358  2.523   -10.445 1.00 0.00 ? 111 PRO A HG2  6  
ATOM 10592 H HG3  . PRO A 1 111 ? -9.704  3.280   -8.879  1.00 0.00 ? 111 PRO A HG3  6  
ATOM 10593 H HD2  . PRO A 1 111 ? -7.216  2.533   -9.576  1.00 0.00 ? 111 PRO A HD2  6  
ATOM 10594 H HD3  . PRO A 1 111 ? -7.789  2.413   -7.900  1.00 0.00 ? 111 PRO A HD3  6  
ATOM 10595 N N    . VAL A 1 112 ? -10.030 -1.994  -10.130 1.00 0.00 ? 112 VAL A N    6  
ATOM 10596 C CA   . VAL A 1 112 ? -10.299 -2.870  -11.264 1.00 0.00 ? 112 VAL A CA   6  
ATOM 10597 C C    . VAL A 1 112 ? -11.430 -2.317  -12.126 1.00 0.00 ? 112 VAL A C    6  
ATOM 10598 O O    . VAL A 1 112 ? -12.280 -1.566  -11.646 1.00 0.00 ? 112 VAL A O    6  
ATOM 10599 C CB   . VAL A 1 112 ? -10.662 -4.296  -10.805 1.00 0.00 ? 112 VAL A CB   6  
ATOM 10600 C CG1  . VAL A 1 112 ? -9.589  -4.850  -9.881  1.00 0.00 ? 112 VAL A CG1  6  
ATOM 10601 C CG2  . VAL A 1 112 ? -12.021 -4.312  -10.122 1.00 0.00 ? 112 VAL A CG2  6  
ATOM 10602 H H    . VAL A 1 112 ? -10.285 -2.289  -9.229  1.00 0.00 ? 112 VAL A H    6  
ATOM 10603 H HA   . VAL A 1 112 ? -9.401  -2.924  -11.861 1.00 0.00 ? 112 VAL A HA   6  
ATOM 10604 H HB   . VAL A 1 112 ? -10.714 -4.931  -11.678 1.00 0.00 ? 112 VAL A HB   6  
ATOM 10605 H HG11 . VAL A 1 112 ? -9.160  -5.740  -10.318 1.00 0.00 ? 112 VAL A HG11 6  
ATOM 10606 H HG12 . VAL A 1 112 ? -10.027 -5.094  -8.925  1.00 0.00 ? 112 VAL A HG12 6  
ATOM 10607 H HG13 . VAL A 1 112 ? -8.814  -4.108  -9.744  1.00 0.00 ? 112 VAL A HG13 6  
ATOM 10608 H HG21 . VAL A 1 112 ? -11.953 -4.866  -9.197  1.00 0.00 ? 112 VAL A HG21 6  
ATOM 10609 H HG22 . VAL A 1 112 ? -12.745 -4.784  -10.772 1.00 0.00 ? 112 VAL A HG22 6  
ATOM 10610 H HG23 . VAL A 1 112 ? -12.331 -3.300  -9.913  1.00 0.00 ? 112 VAL A HG23 6  
ATOM 10611 N N    . GLU A 1 113 ? -11.435 -2.694  -13.400 1.00 0.00 ? 113 GLU A N    6  
ATOM 10612 C CA   . GLU A 1 113 ? -12.465 -2.238  -14.328 1.00 0.00 ? 113 GLU A CA   6  
ATOM 10613 C C    . GLU A 1 113 ? -13.510 -3.326  -14.555 1.00 0.00 ? 113 GLU A C    6  
ATOM 10614 O O    . GLU A 1 113 ? -13.171 -4.488  -14.777 1.00 0.00 ? 113 GLU A O    6  
ATOM 10615 C CB   . GLU A 1 113 ? -11.835 -1.830  -15.661 1.00 0.00 ? 113 GLU A CB   6  
ATOM 10616 C CG   . GLU A 1 113 ? -10.796 -0.728  -15.531 1.00 0.00 ? 113 GLU A CG   6  
ATOM 10617 C CD   . GLU A 1 113 ? -10.610 0.052   -16.817 1.00 0.00 ? 113 GLU A CD   6  
ATOM 10618 O OE1  . GLU A 1 113 ? -10.360 -0.579  -17.865 1.00 0.00 ? 113 GLU A OE1  6  
ATOM 10619 O OE2  . GLU A 1 113 ? -10.711 1.297   -16.777 1.00 0.00 ? 113 GLU A OE2  6  
ATOM 10620 H H    . GLU A 1 113 ? -10.732 -3.295  -13.724 1.00 0.00 ? 113 GLU A H    6  
ATOM 10621 H HA   . GLU A 1 113 ? -12.947 -1.376  -13.891 1.00 0.00 ? 113 GLU A HA   6  
ATOM 10622 H HB2  . GLU A 1 113 ? -11.357 -2.694  -16.101 1.00 0.00 ? 113 GLU A HB2  6  
ATOM 10623 H HB3  . GLU A 1 113 ? -12.614 -1.485  -16.323 1.00 0.00 ? 113 GLU A HB3  6  
ATOM 10624 H HG2  . GLU A 1 113 ? -11.110 -0.045  -14.756 1.00 0.00 ? 113 GLU A HG2  6  
ATOM 10625 H HG3  . GLU A 1 113 ? -9.850  -1.172  -15.256 1.00 0.00 ? 113 GLU A HG3  6  
ATOM 10626 N N    . ARG A 1 114 ? -14.780 -2.940  -14.495 1.00 0.00 ? 114 ARG A N    6  
ATOM 10627 C CA   . ARG A 1 114 ? -15.876 -3.882  -14.691 1.00 0.00 ? 114 ARG A CA   6  
ATOM 10628 C C    . ARG A 1 114 ? -16.667 -3.546  -15.950 1.00 0.00 ? 114 ARG A C    6  
ATOM 10629 O O    . ARG A 1 114 ? -16.267 -2.602  -16.665 1.00 0.00 ? 114 ARG A O    6  
ATOM 10630 C CB   . ARG A 1 114 ? -16.804 -3.877  -13.476 1.00 0.00 ? 114 ARG A CB   6  
ATOM 10631 C CG   . ARG A 1 114 ? -17.102 -2.485  -12.942 1.00 0.00 ? 114 ARG A CG   6  
ATOM 10632 C CD   . ARG A 1 114 ? -18.586 -2.296  -12.680 1.00 0.00 ? 114 ARG A CD   6  
ATOM 10633 N NE   . ARG A 1 114 ? -19.241 -1.541  -13.745 1.00 0.00 ? 114 ARG A NE   6  
ATOM 10634 C CZ   . ARG A 1 114 ? -19.503 -0.238  -13.673 1.00 0.00 ? 114 ARG A CZ   6  
ATOM 10635 N NH1  . ARG A 1 114 ? -19.163 0.452   -12.592 1.00 0.00 ? 114 ARG A NH1  6  
ATOM 10636 N NH2  . ARG A 1 114 ? -20.103 0.375   -14.684 1.00 0.00 ? 114 ARG A NH2  6  
ATOM 10637 O OXT  . ARG A 1 114 ? -17.679 -4.228  -16.212 1.00 0.00 ? 114 ARG A OXT  6  
ATOM 10638 H H    . ARG A 1 114 ? -14.985 -1.999  -14.312 1.00 0.00 ? 114 ARG A H    6  
ATOM 10639 H HA   . ARG A 1 114 ? -15.449 -4.868  -14.802 1.00 0.00 ? 114 ARG A HA   6  
ATOM 10640 H HB2  . ARG A 1 114 ? -17.741 -4.342  -13.750 1.00 0.00 ? 114 ARG A HB2  6  
ATOM 10641 H HB3  . ARG A 1 114 ? -16.347 -4.452  -12.685 1.00 0.00 ? 114 ARG A HB3  6  
ATOM 10642 H HG2  . ARG A 1 114 ? -16.562 -2.341  -12.018 1.00 0.00 ? 114 ARG A HG2  6  
ATOM 10643 H HG3  . ARG A 1 114 ? -16.777 -1.756  -13.669 1.00 0.00 ? 114 ARG A HG3  6  
ATOM 10644 H HD2  . ARG A 1 114 ? -19.054 -3.267  -12.602 1.00 0.00 ? 114 ARG A HD2  6  
ATOM 10645 H HD3  . ARG A 1 114 ? -18.708 -1.764  -11.747 1.00 0.00 ? 114 ARG A HD3  6  
ATOM 10646 H HE   . ARG A 1 114 ? -19.502 -2.029  -14.554 1.00 0.00 ? 114 ARG A HE   6  
ATOM 10647 H HH11 . ARG A 1 114 ? -18.710 -0.006  -11.829 1.00 0.00 ? 114 ARG A HH11 6  
ATOM 10648 H HH12 . ARG A 1 114 ? -19.360 1.431   -12.543 1.00 0.00 ? 114 ARG A HH12 6  
ATOM 10649 H HH21 . ARG A 1 114 ? -20.361 -0.142  -15.501 1.00 0.00 ? 114 ARG A HH21 6  
ATOM 10650 H HH22 . ARG A 1 114 ? -20.300 1.355   -14.629 1.00 0.00 ? 114 ARG A HH22 6  
ATOM 10651 N N    . GLY A 1 1   ? -11.096 10.028  -16.686 1.00 0.00 ? 1   GLY A N    7  
ATOM 10652 C CA   . GLY A 1 1   ? -10.952 9.881   -18.160 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10653 C C    . GLY A 1 1   ? -10.531 8.482   -18.566 1.00 0.00 ? 1   GLY A C    7  
ATOM 10654 O O    . GLY A 1 1   ? -11.303 7.752   -19.187 1.00 0.00 ? 1   GLY A O    7  
ATOM 10655 H H1   . GLY A 1 1   ? -10.704 10.940  -16.377 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10656 H H2   . GLY A 1 1   ? -10.591 9.262   -16.199 1.00 0.00 ? 1   GLY A H2   7  
ATOM 10657 H H3   . GLY A 1 1   ? -12.102 9.987   -16.422 1.00 0.00 ? 1   GLY A H3   7  
ATOM 10658 H HA2  . GLY A 1 1   ? -11.896 10.112  -18.629 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10659 H HA3  . GLY A 1 1   ? -10.207 10.582  -18.510 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10660 N N    . ALA A 1 2   ? -9.305  8.109   -18.213 1.00 0.00 ? 2   ALA A N    7  
ATOM 10661 C CA   . ALA A 1 2   ? -8.781  6.788   -18.544 1.00 0.00 ? 2   ALA A CA   7  
ATOM 10662 C C    . ALA A 1 2   ? -7.629  6.410   -17.622 1.00 0.00 ? 2   ALA A C    7  
ATOM 10663 O O    . ALA A 1 2   ? -7.781  5.570   -16.733 1.00 0.00 ? 2   ALA A O    7  
ATOM 10664 C CB   . ALA A 1 2   ? -8.333  6.748   -19.997 1.00 0.00 ? 2   ALA A CB   7  
ATOM 10665 H H    . ALA A 1 2   ? -8.737  8.737   -17.719 1.00 0.00 ? 2   ALA A H    7  
ATOM 10666 H HA   . ALA A 1 2   ? -9.581  6.072   -18.416 1.00 0.00 ? 2   ALA A HA   7  
ATOM 10667 H HB1  . ALA A 1 2   ? -8.825  7.534   -20.548 1.00 0.00 ? 2   ALA A HB1  7  
ATOM 10668 H HB2  . ALA A 1 2   ? -8.591  5.790   -20.426 1.00 0.00 ? 2   ALA A HB2  7  
ATOM 10669 H HB3  . ALA A 1 2   ? -7.263  6.888   -20.048 1.00 0.00 ? 2   ALA A HB3  7  
ATOM 10670 N N    . MET A 1 3   ? -6.477  7.038   -17.837 1.00 0.00 ? 3   MET A N    7  
ATOM 10671 C CA   . MET A 1 3   ? -5.297  6.770   -17.024 1.00 0.00 ? 3   MET A CA   7  
ATOM 10672 C C    . MET A 1 3   ? -5.226  7.729   -15.842 1.00 0.00 ? 3   MET A C    7  
ATOM 10673 O O    . MET A 1 3   ? -5.914  8.749   -15.816 1.00 0.00 ? 3   MET A O    7  
ATOM 10674 C CB   . MET A 1 3   ? -4.028  6.892   -17.871 1.00 0.00 ? 3   MET A CB   7  
ATOM 10675 C CG   . MET A 1 3   ? -4.011  8.118   -18.771 1.00 0.00 ? 3   MET A CG   7  
ATOM 10676 S SD   . MET A 1 3   ? -2.875  7.945   -20.159 1.00 0.00 ? 3   MET A SD   7  
ATOM 10677 C CE   . MET A 1 3   ? -3.988  8.194   -21.543 1.00 0.00 ? 3   MET A CE   7  
ATOM 10678 H H    . MET A 1 3   ? -6.421  7.697   -18.559 1.00 0.00 ? 3   MET A H    7  
ATOM 10679 H HA   . MET A 1 3   ? -5.373  5.759   -16.651 1.00 0.00 ? 3   MET A HA   7  
ATOM 10680 H HB2  . MET A 1 3   ? -3.174  6.943   -17.213 1.00 0.00 ? 3   MET A HB2  7  
ATOM 10681 H HB3  . MET A 1 3   ? -3.939  6.014   -18.495 1.00 0.00 ? 3   MET A HB3  7  
ATOM 10682 H HG2  . MET A 1 3   ? -5.006  8.278   -19.157 1.00 0.00 ? 3   MET A HG2  7  
ATOM 10683 H HG3  . MET A 1 3   ? -3.714  8.974   -18.183 1.00 0.00 ? 3   MET A HG3  7  
ATOM 10684 H HE1  . MET A 1 3   ? -5.001  8.279   -21.178 1.00 0.00 ? 3   MET A HE1  7  
ATOM 10685 H HE2  . MET A 1 3   ? -3.917  7.355   -22.217 1.00 0.00 ? 3   MET A HE2  7  
ATOM 10686 H HE3  . MET A 1 3   ? -3.715  9.099   -22.065 1.00 0.00 ? 3   MET A HE3  7  
ATOM 10687 N N    . ASP A 1 4   ? -4.391  7.395   -14.864 1.00 0.00 ? 4   ASP A N    7  
ATOM 10688 C CA   . ASP A 1 4   ? -4.233  8.229   -13.678 1.00 0.00 ? 4   ASP A CA   7  
ATOM 10689 C C    . ASP A 1 4   ? -2.756  8.501   -13.390 1.00 0.00 ? 4   ASP A C    7  
ATOM 10690 O O    . ASP A 1 4   ? -2.231  8.081   -12.360 1.00 0.00 ? 4   ASP A O    7  
ATOM 10691 C CB   . ASP A 1 4   ? -4.886  7.558   -12.468 1.00 0.00 ? 4   ASP A CB   7  
ATOM 10692 C CG   . ASP A 1 4   ? -6.301  7.097   -12.758 1.00 0.00 ? 4   ASP A CG   7  
ATOM 10693 O OD1  . ASP A 1 4   ? -6.461  6.055   -13.429 1.00 0.00 ? 4   ASP A OD1  7  
ATOM 10694 O OD2  . ASP A 1 4   ? -7.250  7.779   -12.317 1.00 0.00 ? 4   ASP A OD2  7  
ATOM 10695 H H    . ASP A 1 4   ? -3.869  6.569   -14.941 1.00 0.00 ? 4   ASP A H    7  
ATOM 10696 H HA   . ASP A 1 4   ? -4.727  9.170   -13.866 1.00 0.00 ? 4   ASP A HA   7  
ATOM 10697 H HB2  . ASP A 1 4   ? -4.301  6.700   -12.179 1.00 0.00 ? 4   ASP A HB2  7  
ATOM 10698 H HB3  . ASP A 1 4   ? -4.917  8.261   -11.648 1.00 0.00 ? 4   ASP A HB3  7  
ATOM 10699 N N    . PRO A 1 5   ? -2.065  9.218   -14.297 1.00 0.00 ? 5   PRO A N    7  
ATOM 10700 C CA   . PRO A 1 5   ? -0.646  9.547   -14.126 1.00 0.00 ? 5   PRO A CA   7  
ATOM 10701 C C    . PRO A 1 5   ? -0.411  10.433  -12.909 1.00 0.00 ? 5   PRO A C    7  
ATOM 10702 O O    . PRO A 1 5   ? 0.552   10.245  -12.165 1.00 0.00 ? 5   PRO A O    7  
ATOM 10703 C CB   . PRO A 1 5   ? -0.291  10.305  -15.410 1.00 0.00 ? 5   PRO A CB   7  
ATOM 10704 C CG   . PRO A 1 5   ? -1.592  10.797  -15.944 1.00 0.00 ? 5   PRO A CG   7  
ATOM 10705 C CD   . PRO A 1 5   ? -2.611  9.765   -15.552 1.00 0.00 ? 5   PRO A CD   7  
ATOM 10706 H HA   . PRO A 1 5   ? -0.040  8.659   -14.047 1.00 0.00 ? 5   PRO A HA   7  
ATOM 10707 H HB2  . PRO A 1 5   ? 0.372   11.126  -15.172 1.00 0.00 ? 5   PRO A HB2  7  
ATOM 10708 H HB3  . PRO A 1 5   ? 0.192   9.636   -16.104 1.00 0.00 ? 5   PRO A HB3  7  
ATOM 10709 H HG2  . PRO A 1 5   ? -1.834  11.751  -15.498 1.00 0.00 ? 5   PRO A HG2  7  
ATOM 10710 H HG3  . PRO A 1 5   ? -1.538  10.884  -17.017 1.00 0.00 ? 5   PRO A HG3  7  
ATOM 10711 H HD2  . PRO A 1 5   ? -3.573  10.228  -15.389 1.00 0.00 ? 5   PRO A HD2  7  
ATOM 10712 H HD3  . PRO A 1 5   ? -2.681  8.998   -16.309 1.00 0.00 ? 5   PRO A HD3  7  
ATOM 10713 N N    . GLU A 1 6   ? -1.305  11.397  -12.714 1.00 0.00 ? 6   GLU A N    7  
ATOM 10714 C CA   . GLU A 1 6   ? -1.209  12.317  -11.589 1.00 0.00 ? 6   GLU A CA   7  
ATOM 10715 C C    . GLU A 1 6   ? -2.593  12.818  -11.191 1.00 0.00 ? 6   GLU A C    7  
ATOM 10716 O O    . GLU A 1 6   ? -2.723  13.731  -10.374 1.00 0.00 ? 6   GLU A O    7  
ATOM 10717 C CB   . GLU A 1 6   ? -0.304  13.499  -11.939 1.00 0.00 ? 6   GLU A CB   7  
ATOM 10718 C CG   . GLU A 1 6   ? 0.618   13.915  -10.805 1.00 0.00 ? 6   GLU A CG   7  
ATOM 10719 C CD   . GLU A 1 6   ? 1.737   14.826  -11.266 1.00 0.00 ? 6   GLU A CD   7  
ATOM 10720 O OE1  . GLU A 1 6   ? 1.458   15.771  -12.033 1.00 0.00 ? 6   GLU A OE1  7  
ATOM 10721 O OE2  . GLU A 1 6   ? 2.896   14.597  -10.857 1.00 0.00 ? 6   GLU A OE2  7  
ATOM 10722 H H    . GLU A 1 6   ? -2.049  11.490  -13.342 1.00 0.00 ? 6   GLU A H    7  
ATOM 10723 H HA   . GLU A 1 6   ? -0.780  11.781  -10.755 1.00 0.00 ? 6   GLU A HA   7  
ATOM 10724 H HB2  . GLU A 1 6   ? 0.304   13.233  -12.790 1.00 0.00 ? 6   GLU A HB2  7  
ATOM 10725 H HB3  . GLU A 1 6   ? -0.921  14.346  -12.200 1.00 0.00 ? 6   GLU A HB3  7  
ATOM 10726 H HG2  . GLU A 1 6   ? 0.035   14.434  -10.058 1.00 0.00 ? 6   GLU A HG2  7  
ATOM 10727 H HG3  . GLU A 1 6   ? 1.052   13.027  -10.369 1.00 0.00 ? 6   GLU A HG3  7  
ATOM 10728 N N    . PHE A 1 7   ? -3.622  12.217  -11.777 1.00 0.00 ? 7   PHE A N    7  
ATOM 10729 C CA   . PHE A 1 7   ? -4.998  12.601  -11.485 1.00 0.00 ? 7   PHE A CA   7  
ATOM 10730 C C    . PHE A 1 7   ? -5.538  11.826  -10.287 1.00 0.00 ? 7   PHE A C    7  
ATOM 10731 O O    . PHE A 1 7   ? -6.170  12.399  -9.400  1.00 0.00 ? 7   PHE A O    7  
ATOM 10732 C CB   . PHE A 1 7   ? -5.889  12.358  -12.707 1.00 0.00 ? 7   PHE A CB   7  
ATOM 10733 C CG   . PHE A 1 7   ? -7.021  13.338  -12.826 1.00 0.00 ? 7   PHE A CG   7  
ATOM 10734 C CD1  . PHE A 1 7   ? -6.793  14.631  -13.267 1.00 0.00 ? 7   PHE A CD1  7  
ATOM 10735 C CD2  . PHE A 1 7   ? -8.315  12.963  -12.495 1.00 0.00 ? 7   PHE A CD2  7  
ATOM 10736 C CE1  . PHE A 1 7   ? -7.834  15.533  -13.376 1.00 0.00 ? 7   PHE A CE1  7  
ATOM 10737 C CE2  . PHE A 1 7   ? -9.358  13.863  -12.602 1.00 0.00 ? 7   PHE A CE2  7  
ATOM 10738 C CZ   . PHE A 1 7   ? -9.118  15.150  -13.042 1.00 0.00 ? 7   PHE A CZ   7  
ATOM 10739 H H    . PHE A 1 7   ? -3.451  11.497  -12.422 1.00 0.00 ? 7   PHE A H    7  
ATOM 10740 H HA   . PHE A 1 7   ? -5.006  13.653  -11.251 1.00 0.00 ? 7   PHE A HA   7  
ATOM 10741 H HB2  . PHE A 1 7   ? -5.289  12.434  -13.603 1.00 0.00 ? 7   PHE A HB2  7  
ATOM 10742 H HB3  . PHE A 1 7   ? -6.310  11.365  -12.646 1.00 0.00 ? 7   PHE A HB3  7  
ATOM 10743 H HD1  . PHE A 1 7   ? -5.790  14.932  -13.529 1.00 0.00 ? 7   PHE A HD1  7  
ATOM 10744 H HD2  . PHE A 1 7   ? -8.503  11.957  -12.150 1.00 0.00 ? 7   PHE A HD2  7  
ATOM 10745 H HE1  . PHE A 1 7   ? -7.643  16.539  -13.721 1.00 0.00 ? 7   PHE A HE1  7  
ATOM 10746 H HE2  . PHE A 1 7   ? -10.361 13.559  -12.340 1.00 0.00 ? 7   PHE A HE2  7  
ATOM 10747 H HZ   . PHE A 1 7   ? -9.932  15.853  -13.127 1.00 0.00 ? 7   PHE A HZ   7  
ATOM 10748 N N    . ASN A 1 8   ? -5.285  10.519  -10.269 1.00 0.00 ? 8   ASN A N    7  
ATOM 10749 C CA   . ASN A 1 8   ? -5.744  9.666   -9.179  1.00 0.00 ? 8   ASN A CA   7  
ATOM 10750 C C    . ASN A 1 8   ? -4.804  8.479   -8.984  1.00 0.00 ? 8   ASN A C    7  
ATOM 10751 O O    . ASN A 1 8   ? -5.245  7.333   -8.894  1.00 0.00 ? 8   ASN A O    7  
ATOM 10752 C CB   . ASN A 1 8   ? -7.166  9.168   -9.457  1.00 0.00 ? 8   ASN A CB   7  
ATOM 10753 C CG   . ASN A 1 8   ? -8.075  9.314   -8.253  1.00 0.00 ? 8   ASN A CG   7  
ATOM 10754 O OD1  . ASN A 1 8   ? -8.122  8.438   -7.387  1.00 0.00 ? 8   ASN A OD1  7  
ATOM 10755 N ND2  . ASN A 1 8   ? -8.803  10.421  -8.192  1.00 0.00 ? 8   ASN A ND2  7  
ATOM 10756 H H    . ASN A 1 8   ? -4.777  10.122  -11.005 1.00 0.00 ? 8   ASN A H    7  
ATOM 10757 H HA   . ASN A 1 8   ? -5.751  10.257  -8.274  1.00 0.00 ? 8   ASN A HA   7  
ATOM 10758 H HB2  . ASN A 1 8   ? -7.586  9.738   -10.272 1.00 0.00 ? 8   ASN A HB2  7  
ATOM 10759 H HB3  . ASN A 1 8   ? -7.128  8.125   -9.734  1.00 0.00 ? 8   ASN A HB3  7  
ATOM 10760 H HD21 . ASN A 1 8   ? -8.712  11.075  -8.916  1.00 0.00 ? 8   ASN A HD21 7  
ATOM 10761 H HD22 . ASN A 1 8   ? -9.399  10.542  -7.423  1.00 0.00 ? 8   ASN A HD22 7  
ATOM 10762 N N    . LYS A 1 9   ? -3.505  8.761   -8.924  1.00 0.00 ? 9   LYS A N    7  
ATOM 10763 C CA   . LYS A 1 9   ? -2.503  7.716   -8.746  1.00 0.00 ? 9   LYS A CA   7  
ATOM 10764 C C    . LYS A 1 9   ? -2.302  7.378   -7.272  1.00 0.00 ? 9   LYS A C    7  
ATOM 10765 O O    . LYS A 1 9   ? -1.873  8.216   -6.474  1.00 0.00 ? 9   LYS A O    7  
ATOM 10766 C CB   . LYS A 1 9   ? -1.172  8.149   -9.363  1.00 0.00 ? 9   LYS A CB   7  
ATOM 10767 C CG   . LYS A 1 9   ? -0.172  7.014   -9.511  1.00 0.00 ? 9   LYS A CG   7  
ATOM 10768 C CD   . LYS A 1 9   ? 0.213   6.803   -10.965 1.00 0.00 ? 9   LYS A CD   7  
ATOM 10769 C CE   . LYS A 1 9   ? 0.067   5.345   -11.375 1.00 0.00 ? 9   LYS A CE   7  
ATOM 10770 N NZ   . LYS A 1 9   ? -1.265  5.069   -11.979 1.00 0.00 ? 9   LYS A NZ   7  
ATOM 10771 H H    . LYS A 1 9   ? -3.216  9.694   -9.005  1.00 0.00 ? 9   LYS A H    7  
ATOM 10772 H HA   . LYS A 1 9   ? -2.852  6.835   -9.259  1.00 0.00 ? 9   LYS A HA   7  
ATOM 10773 H HB2  . LYS A 1 9   ? -1.360  8.565   -10.342 1.00 0.00 ? 9   LYS A HB2  7  
ATOM 10774 H HB3  . LYS A 1 9   ? -0.728  8.909   -8.736  1.00 0.00 ? 9   LYS A HB3  7  
ATOM 10775 H HG2  . LYS A 1 9   ? 0.715   7.249   -8.945  1.00 0.00 ? 9   LYS A HG2  7  
ATOM 10776 H HG3  . LYS A 1 9   ? -0.616  6.105   -9.131  1.00 0.00 ? 9   LYS A HG3  7  
ATOM 10777 H HD2  . LYS A 1 9   ? -0.428  7.406   -11.587 1.00 0.00 ? 9   LYS A HD2  7  
ATOM 10778 H HD3  . LYS A 1 9   ? 1.241   7.104   -11.103 1.00 0.00 ? 9   LYS A HD3  7  
ATOM 10779 H HE2  . LYS A 1 9   ? 0.834   5.108   -12.094 1.00 0.00 ? 9   LYS A HE2  7  
ATOM 10780 H HE3  . LYS A 1 9   ? 0.192   4.725   -10.498 1.00 0.00 ? 9   LYS A HE3  7  
ATOM 10781 H HZ1  . LYS A 1 9   ? -1.175  4.969   -13.010 1.00 0.00 ? 9   LYS A HZ1  7  
ATOM 10782 H HZ2  . LYS A 1 9   ? -1.920  5.852   -11.774 1.00 0.00 ? 9   LYS A HZ2  7  
ATOM 10783 H HZ3  . LYS A 1 9   ? -1.661  4.190   -11.588 1.00 0.00 ? 9   LYS A HZ3  7  
ATOM 10784 N N    . ALA A 1 10  ? -2.624  6.142   -6.912  1.00 0.00 ? 10  ALA A N    7  
ATOM 10785 C CA   . ALA A 1 10  ? -2.481  5.700   -5.536  1.00 0.00 ? 10  ALA A CA   7  
ATOM 10786 C C    . ALA A 1 10  ? -1.027  5.401   -5.204  1.00 0.00 ? 10  ALA A C    7  
ATOM 10787 O O    . ALA A 1 10  ? -0.561  4.276   -5.373  1.00 0.00 ? 10  ALA A O    7  
ATOM 10788 C CB   . ALA A 1 10  ? -3.354  4.482   -5.275  1.00 0.00 ? 10  ALA A CB   7  
ATOM 10789 H H    . ALA A 1 10  ? -2.976  5.519   -7.582  1.00 0.00 ? 10  ALA A H    7  
ATOM 10790 H HA   . ALA A 1 10  ? -2.824  6.500   -4.899  1.00 0.00 ? 10  ALA A HA   7  
ATOM 10791 H HB1  . ALA A 1 10  ? -4.191  4.765   -4.653  1.00 0.00 ? 10  ALA A HB1  7  
ATOM 10792 H HB2  . ALA A 1 10  ? -2.773  3.723   -4.771  1.00 0.00 ? 10  ALA A HB2  7  
ATOM 10793 H HB3  . ALA A 1 10  ? -3.720  4.092   -6.214  1.00 0.00 ? 10  ALA A HB3  7  
ATOM 10794 N N    . ILE A 1 11  ? -0.309  6.419   -4.733  1.00 0.00 ? 11  ILE A N    7  
ATOM 10795 C CA   . ILE A 1 11  ? 1.099   6.265   -4.382  1.00 0.00 ? 11  ILE A CA   7  
ATOM 10796 C C    . ILE A 1 11  ? 1.299   6.254   -2.870  1.00 0.00 ? 11  ILE A C    7  
ATOM 10797 O O    . ILE A 1 11  ? 1.082   7.263   -2.196  1.00 0.00 ? 11  ILE A O    7  
ATOM 10798 C CB   . ILE A 1 11  ? 1.956   7.392   -4.995  1.00 0.00 ? 11  ILE A CB   7  
ATOM 10799 C CG1  . ILE A 1 11  ? 1.838   7.379   -6.520  1.00 0.00 ? 11  ILE A CG1  7  
ATOM 10800 C CG2  . ILE A 1 11  ? 3.411   7.249   -4.567  1.00 0.00 ? 11  ILE A CG2  7  
ATOM 10801 C CD1  . ILE A 1 11  ? 1.620   8.752   -7.119  1.00 0.00 ? 11  ILE A CD1  7  
ATOM 10802 H H    . ILE A 1 11  ? -0.733  7.295   -4.622  1.00 0.00 ? 11  ILE A H    7  
ATOM 10803 H HA   . ILE A 1 11  ? 1.440   5.323   -4.786  1.00 0.00 ? 11  ILE A HA   7  
ATOM 10804 H HB   . ILE A 1 11  ? 1.589   8.335   -4.620  1.00 0.00 ? 11  ILE A HB   7  
ATOM 10805 H HG12 . ILE A 1 11  ? 2.746   6.976   -6.942  1.00 0.00 ? 11  ILE A HG12 7  
ATOM 10806 H HG13 . ILE A 1 11  ? 1.004   6.754   -6.806  1.00 0.00 ? 11  ILE A HG13 7  
ATOM 10807 H HG21 . ILE A 1 11  ? 3.741   6.237   -4.744  1.00 0.00 ? 11  ILE A HG21 7  
ATOM 10808 H HG22 . ILE A 1 11  ? 3.502   7.481   -3.515  1.00 0.00 ? 11  ILE A HG22 7  
ATOM 10809 H HG23 . ILE A 1 11  ? 4.022   7.932   -5.139  1.00 0.00 ? 11  ILE A HG23 7  
ATOM 10810 H HD11 . ILE A 1 11  ? 2.569   9.255   -7.222  1.00 0.00 ? 11  ILE A HD11 7  
ATOM 10811 H HD12 . ILE A 1 11  ? 0.974   9.328   -6.474  1.00 0.00 ? 11  ILE A HD12 7  
ATOM 10812 H HD13 . ILE A 1 11  ? 1.160   8.651   -8.091  1.00 0.00 ? 11  ILE A HD13 7  
ATOM 10813 N N    . PHE A 1 12  ? 1.730   5.112   -2.348  1.00 0.00 ? 12  PHE A N    7  
ATOM 10814 C CA   . PHE A 1 12  ? 1.982   4.962   -0.920  1.00 0.00 ? 12  PHE A CA   7  
ATOM 10815 C C    . PHE A 1 12  ? 3.464   4.693   -0.683  1.00 0.00 ? 12  PHE A C    7  
ATOM 10816 O O    . PHE A 1 12  ? 3.968   3.622   -1.021  1.00 0.00 ? 12  PHE A O    7  
ATOM 10817 C CB   . PHE A 1 12  ? 1.147   3.812   -0.350  1.00 0.00 ? 12  PHE A CB   7  
ATOM 10818 C CG   . PHE A 1 12  ? -0.179  4.240   0.208   1.00 0.00 ? 12  PHE A CG   7  
ATOM 10819 C CD1  . PHE A 1 12  ? -1.273  4.413   -0.624  1.00 0.00 ? 12  PHE A CD1  7  
ATOM 10820 C CD2  . PHE A 1 12  ? -0.334  4.467   1.566   1.00 0.00 ? 12  PHE A CD2  7  
ATOM 10821 C CE1  . PHE A 1 12  ? -2.496  4.806   -0.112  1.00 0.00 ? 12  PHE A CE1  7  
ATOM 10822 C CE2  . PHE A 1 12  ? -1.553  4.861   2.085   1.00 0.00 ? 12  PHE A CE2  7  
ATOM 10823 C CZ   . PHE A 1 12  ? -2.637  5.029   1.244   1.00 0.00 ? 12  PHE A CZ   7  
ATOM 10824 H H    . PHE A 1 12  ? 1.895   4.349   -2.940  1.00 0.00 ? 12  PHE A H    7  
ATOM 10825 H HA   . PHE A 1 12  ? 1.705   5.885   -0.429  1.00 0.00 ? 12  PHE A HA   7  
ATOM 10826 H HB2  . PHE A 1 12  ? 0.960   3.093   -1.133  1.00 0.00 ? 12  PHE A HB2  7  
ATOM 10827 H HB3  . PHE A 1 12  ? 1.703   3.334   0.443   1.00 0.00 ? 12  PHE A HB3  7  
ATOM 10828 H HD1  . PHE A 1 12  ? -1.164  4.237   -1.684  1.00 0.00 ? 12  PHE A HD1  7  
ATOM 10829 H HD2  . PHE A 1 12  ? 0.512   4.335   2.225   1.00 0.00 ? 12  PHE A HD2  7  
ATOM 10830 H HE1  . PHE A 1 12  ? -3.341  4.937   -0.770  1.00 0.00 ? 12  PHE A HE1  7  
ATOM 10831 H HE2  . PHE A 1 12  ? -1.661  5.033   3.147   1.00 0.00 ? 12  PHE A HE2  7  
ATOM 10832 H HZ   . PHE A 1 12  ? -3.590  5.335   1.645   1.00 0.00 ? 12  PHE A HZ   7  
ATOM 10833 N N    . THR A 1 13  ? 4.166   5.668   -0.113  1.00 0.00 ? 13  THR A N    7  
ATOM 10834 C CA   . THR A 1 13  ? 5.594   5.515   0.146   1.00 0.00 ? 13  THR A CA   7  
ATOM 10835 C C    . THR A 1 13  ? 5.865   5.108   1.587   1.00 0.00 ? 13  THR A C    7  
ATOM 10836 O O    . THR A 1 13  ? 5.509   5.817   2.527   1.00 0.00 ? 13  THR A O    7  
ATOM 10837 C CB   . THR A 1 13  ? 6.372   6.806   -0.165  1.00 0.00 ? 13  THR A CB   7  
ATOM 10838 O OG1  . THR A 1 13  ? 5.943   7.347   -1.422  1.00 0.00 ? 13  THR A OG1  7  
ATOM 10839 C CG2  . THR A 1 13  ? 7.868   6.533   -0.209  1.00 0.00 ? 13  THR A CG2  7  
ATOM 10840 H H    . THR A 1 13  ? 3.718   6.505   0.131   1.00 0.00 ? 13  THR A H    7  
ATOM 10841 H HA   . THR A 1 13  ? 5.960   4.736   -0.505  1.00 0.00 ? 13  THR A HA   7  
ATOM 10842 H HB   . THR A 1 13  ? 6.174   7.527   0.615   1.00 0.00 ? 13  THR A HB   7  
ATOM 10843 H HG1  . THR A 1 13  ? 5.003   7.534   -1.386  1.00 0.00 ? 13  THR A HG1  7  
ATOM 10844 H HG21 . THR A 1 13  ? 8.275   6.596   0.791   1.00 0.00 ? 13  THR A HG21 7  
ATOM 10845 H HG22 . THR A 1 13  ? 8.350   7.265   -0.840  1.00 0.00 ? 13  THR A HG22 7  
ATOM 10846 H HG23 . THR A 1 13  ? 8.042   5.542   -0.607  1.00 0.00 ? 13  THR A HG23 7  
ATOM 10847 N N    . VAL A 1 14  ? 6.501   3.950   1.746   1.00 0.00 ? 14  VAL A N    7  
ATOM 10848 C CA   . VAL A 1 14  ? 6.835   3.415   3.060   1.00 0.00 ? 14  VAL A CA   7  
ATOM 10849 C C    . VAL A 1 14  ? 8.220   2.775   3.040   1.00 0.00 ? 14  VAL A C    7  
ATOM 10850 O O    . VAL A 1 14  ? 8.851   2.685   1.991   1.00 0.00 ? 14  VAL A O    7  
ATOM 10851 C CB   . VAL A 1 14  ? 5.794   2.367   3.525   1.00 0.00 ? 14  VAL A CB   7  
ATOM 10852 C CG1  . VAL A 1 14  ? 4.425   2.678   2.949   1.00 0.00 ? 14  VAL A CG1  7  
ATOM 10853 C CG2  . VAL A 1 14  ? 6.216   0.956   3.131   1.00 0.00 ? 14  VAL A CG2  7  
ATOM 10854 H H    . VAL A 1 14  ? 6.750   3.436   0.951   1.00 0.00 ? 14  VAL A H    7  
ATOM 10855 H HA   . VAL A 1 14  ? 6.834   4.234   3.765   1.00 0.00 ? 14  VAL A HA   7  
ATOM 10856 H HB   . VAL A 1 14  ? 5.724   2.411   4.603   1.00 0.00 ? 14  VAL A HB   7  
ATOM 10857 H HG11 . VAL A 1 14  ? 3.789   3.080   3.724   1.00 0.00 ? 14  VAL A HG11 7  
ATOM 10858 H HG12 . VAL A 1 14  ? 3.988   1.772   2.556   1.00 0.00 ? 14  VAL A HG12 7  
ATOM 10859 H HG13 . VAL A 1 14  ? 4.526   3.403   2.153   1.00 0.00 ? 14  VAL A HG13 7  
ATOM 10860 H HG21 . VAL A 1 14  ? 5.337   0.353   2.958   1.00 0.00 ? 14  VAL A HG21 7  
ATOM 10861 H HG22 . VAL A 1 14  ? 6.801   0.520   3.927   1.00 0.00 ? 14  VAL A HG22 7  
ATOM 10862 H HG23 . VAL A 1 14  ? 6.808   0.997   2.229   1.00 0.00 ? 14  VAL A HG23 7  
ATOM 10863 N N    . ASP A 1 15  ? 8.678   2.316   4.202   1.00 0.00 ? 15  ASP A N    7  
ATOM 10864 C CA   . ASP A 1 15  ? 9.977   1.659   4.304   1.00 0.00 ? 15  ASP A CA   7  
ATOM 10865 C C    . ASP A 1 15  ? 9.808   0.154   4.119   1.00 0.00 ? 15  ASP A C    7  
ATOM 10866 O O    . ASP A 1 15  ? 8.729   -0.382  4.348   1.00 0.00 ? 15  ASP A O    7  
ATOM 10867 C CB   . ASP A 1 15  ? 10.621  1.952   5.661   1.00 0.00 ? 15  ASP A CB   7  
ATOM 10868 C CG   . ASP A 1 15  ? 10.522  3.417   6.044   1.00 0.00 ? 15  ASP A CG   7  
ATOM 10869 O OD1  . ASP A 1 15  ? 10.965  4.269   5.244   1.00 0.00 ? 15  ASP A OD1  7  
ATOM 10870 O OD2  . ASP A 1 15  ? 10.002  3.711   7.139   1.00 0.00 ? 15  ASP A OD2  7  
ATOM 10871 H H    . ASP A 1 15  ? 8.122   2.404   5.003   1.00 0.00 ? 15  ASP A H    7  
ATOM 10872 H HA   . ASP A 1 15  ? 10.610  2.043   3.519   1.00 0.00 ? 15  ASP A HA   7  
ATOM 10873 H HB2  . ASP A 1 15  ? 10.124  1.369   6.422   1.00 0.00 ? 15  ASP A HB2  7  
ATOM 10874 H HB3  . ASP A 1 15  ? 11.664  1.678   5.627   1.00 0.00 ? 15  ASP A HB3  7  
ATOM 10875 N N    . ALA A 1 16  ? 10.860  -0.533  3.695   1.00 0.00 ? 16  ALA A N    7  
ATOM 10876 C CA   . ALA A 1 16  ? 10.774  -1.972  3.485   1.00 0.00 ? 16  ALA A CA   7  
ATOM 10877 C C    . ALA A 1 16  ? 11.155  -2.738  4.737   1.00 0.00 ? 16  ALA A C    7  
ATOM 10878 O O    . ALA A 1 16  ? 10.788  -3.902  4.899   1.00 0.00 ? 16  ALA A O    7  
ATOM 10879 C CB   . ALA A 1 16  ? 11.641  -2.395  2.309   1.00 0.00 ? 16  ALA A CB   7  
ATOM 10880 H H    . ALA A 1 16  ? 11.705  -0.068  3.513   1.00 0.00 ? 16  ALA A H    7  
ATOM 10881 H HA   . ALA A 1 16  ? 9.748   -2.209  3.252   1.00 0.00 ? 16  ALA A HA   7  
ATOM 10882 H HB1  . ALA A 1 16  ? 12.247  -1.559  1.991   1.00 0.00 ? 16  ALA A HB1  7  
ATOM 10883 H HB2  . ALA A 1 16  ? 11.011  -2.716  1.493   1.00 0.00 ? 16  ALA A HB2  7  
ATOM 10884 H HB3  . ALA A 1 16  ? 12.283  -3.209  2.610   1.00 0.00 ? 16  ALA A HB3  7  
ATOM 10885 N N    . LYS A 1 17  ? 11.876  -2.081  5.629   1.00 0.00 ? 17  LYS A N    7  
ATOM 10886 C CA   . LYS A 1 17  ? 12.276  -2.709  6.872   1.00 0.00 ? 17  LYS A CA   7  
ATOM 10887 C C    . LYS A 1 17  ? 11.067  -2.865  7.782   1.00 0.00 ? 17  LYS A C    7  
ATOM 10888 O O    . LYS A 1 17  ? 10.657  -3.980  8.107   1.00 0.00 ? 17  LYS A O    7  
ATOM 10889 C CB   . LYS A 1 17  ? 13.355  -1.878  7.568   1.00 0.00 ? 17  LYS A CB   7  
ATOM 10890 C CG   . LYS A 1 17  ? 14.533  -2.702  8.064   1.00 0.00 ? 17  LYS A CG   7  
ATOM 10891 C CD   . LYS A 1 17  ? 15.751  -1.831  8.327   1.00 0.00 ? 17  LYS A CD   7  
ATOM 10892 C CE   . LYS A 1 17  ? 15.579  -0.995  9.585   1.00 0.00 ? 17  LYS A CE   7  
ATOM 10893 N NZ   . LYS A 1 17  ? 16.217  0.345   9.458   1.00 0.00 ? 17  LYS A NZ   7  
ATOM 10894 H H    . LYS A 1 17  ? 12.130  -1.149  5.453   1.00 0.00 ? 17  LYS A H    7  
ATOM 10895 H HA   . LYS A 1 17  ? 12.674  -3.687  6.640   1.00 0.00 ? 17  LYS A HA   7  
ATOM 10896 H HB2  . LYS A 1 17  ? 13.726  -1.136  6.877   1.00 0.00 ? 17  LYS A HB2  7  
ATOM 10897 H HB3  . LYS A 1 17  ? 12.911  -1.377  8.417   1.00 0.00 ? 17  LYS A HB3  7  
ATOM 10898 H HG2  . LYS A 1 17  ? 14.251  -3.195  8.981   1.00 0.00 ? 17  LYS A HG2  7  
ATOM 10899 H HG3  . LYS A 1 17  ? 14.782  -3.439  7.316   1.00 0.00 ? 17  LYS A HG3  7  
ATOM 10900 H HD2  . LYS A 1 17  ? 16.615  -2.466  8.447   1.00 0.00 ? 17  LYS A HD2  7  
ATOM 10901 H HD3  . LYS A 1 17  ? 15.901  -1.172  7.484   1.00 0.00 ? 17  LYS A HD3  7  
ATOM 10902 H HE2  . LYS A 1 17  ? 14.522  -0.863  9.771   1.00 0.00 ? 17  LYS A HE2  7  
ATOM 10903 H HE3  . LYS A 1 17  ? 16.025  -1.520  10.415  1.00 0.00 ? 17  LYS A HE3  7  
ATOM 10904 H HZ1  . LYS A 1 17  ? 15.772  1.018   10.113  1.00 0.00 ? 17  LYS A HZ1  7  
ATOM 10905 H HZ2  . LYS A 1 17  ? 16.110  0.701   8.486   1.00 0.00 ? 17  LYS A HZ2  7  
ATOM 10906 H HZ3  . LYS A 1 17  ? 17.231  0.278   9.682   1.00 0.00 ? 17  LYS A HZ3  7  
ATOM 10907 N N    . THR A 1 18  ? 10.522  -1.734  8.213   1.00 0.00 ? 18  THR A N    7  
ATOM 10908 C CA   . THR A 1 18  ? 9.378   -1.752  9.117   1.00 0.00 ? 18  THR A CA   7  
ATOM 10909 C C    . THR A 1 18  ? 8.082   -1.273  8.477   1.00 0.00 ? 18  THR A C    7  
ATOM 10910 O O    . THR A 1 18  ? 7.021   -1.368  9.094   1.00 0.00 ? 18  THR A O    7  
ATOM 10911 C CB   . THR A 1 18  ? 9.647   -0.933  10.397  1.00 0.00 ? 18  THR A CB   7  
ATOM 10912 O OG1  . THR A 1 18  ? 8.846   0.255   10.399  1.00 0.00 ? 18  THR A OG1  7  
ATOM 10913 C CG2  . THR A 1 18  ? 11.119  -0.554  10.508  1.00 0.00 ? 18  THR A CG2  7  
ATOM 10914 H H    . THR A 1 18  ? 10.936  -0.889  7.936   1.00 0.00 ? 18  THR A H    7  
ATOM 10915 H HA   . THR A 1 18  ? 9.238   -2.773  9.398   1.00 0.00 ? 18  THR A HA   7  
ATOM 10916 H HB   . THR A 1 18  ? 9.383   -1.536  11.252  1.00 0.00 ? 18  THR A HB   7  
ATOM 10917 H HG1  . THR A 1 18  ? 9.256   0.917   10.959  1.00 0.00 ? 18  THR A HG1  7  
ATOM 10918 H HG21 . THR A 1 18  ? 11.244  0.483   10.235  1.00 0.00 ? 18  THR A HG21 7  
ATOM 10919 H HG22 . THR A 1 18  ? 11.702  -1.174  9.843   1.00 0.00 ? 18  THR A HG22 7  
ATOM 10920 H HG23 . THR A 1 18  ? 11.452  -0.702  11.525  1.00 0.00 ? 18  THR A HG23 7  
ATOM 10921 N N    . THR A 1 19  ? 8.175   -0.746  7.266   1.00 0.00 ? 19  THR A N    7  
ATOM 10922 C CA   . THR A 1 19  ? 7.008   -0.228  6.547   1.00 0.00 ? 19  THR A CA   7  
ATOM 10923 C C    . THR A 1 19  ? 6.685   1.195   7.002   1.00 0.00 ? 19  THR A C    7  
ATOM 10924 O O    . THR A 1 19  ? 7.518   2.090   6.856   1.00 0.00 ? 19  THR A O    7  
ATOM 10925 C CB   . THR A 1 19  ? 5.762   -1.132  6.712   1.00 0.00 ? 19  THR A CB   7  
ATOM 10926 O OG1  . THR A 1 19  ? 6.158   -2.508  6.769   1.00 0.00 ? 19  THR A OG1  7  
ATOM 10927 C CG2  . THR A 1 19  ? 4.789   -0.931  5.559   1.00 0.00 ? 19  THR A CG2  7  
ATOM 10928 H H    . THR A 1 19  ? 9.059   -0.669  6.857   1.00 0.00 ? 19  THR A H    7  
ATOM 10929 H HA   . THR A 1 19  ? 7.260   -0.199  5.496   1.00 0.00 ? 19  THR A HA   7  
ATOM 10930 H HB   . THR A 1 19  ? 5.265   -0.870  7.633   1.00 0.00 ? 19  THR A HB   7  
ATOM 10931 H HG1  . THR A 1 19  ? 5.908   -2.948  5.954   1.00 0.00 ? 19  THR A HG1  7  
ATOM 10932 H HG21 . THR A 1 19  ? 3.815   -1.303  5.843   1.00 0.00 ? 19  THR A HG21 7  
ATOM 10933 H HG22 . THR A 1 19  ? 5.140   -1.469  4.693   1.00 0.00 ? 19  THR A HG22 7  
ATOM 10934 H HG23 . THR A 1 19  ? 4.719   0.121   5.326   1.00 0.00 ? 19  THR A HG23 7  
ATOM 10935 N N    . GLU A 1 20  ? 5.487   1.407   7.549   1.00 0.00 ? 20  GLU A N    7  
ATOM 10936 C CA   . GLU A 1 20  ? 5.079   2.731   8.012   1.00 0.00 ? 20  GLU A CA   7  
ATOM 10937 C C    . GLU A 1 20  ? 5.069   3.727   6.854   1.00 0.00 ? 20  GLU A C    7  
ATOM 10938 O O    . GLU A 1 20  ? 6.120   4.103   6.337   1.00 0.00 ? 20  GLU A O    7  
ATOM 10939 C CB   . GLU A 1 20  ? 6.010   3.224   9.122   1.00 0.00 ? 20  GLU A CB   7  
ATOM 10940 C CG   . GLU A 1 20  ? 5.379   4.270   10.026  1.00 0.00 ? 20  GLU A CG   7  
ATOM 10941 C CD   . GLU A 1 20  ? 6.307   5.437   10.302  1.00 0.00 ? 20  GLU A CD   7  
ATOM 10942 O OE1  . GLU A 1 20  ? 6.849   6.005   9.331   1.00 0.00 ? 20  GLU A OE1  7  
ATOM 10943 O OE2  . GLU A 1 20  ? 6.489   5.783   11.488  1.00 0.00 ? 20  GLU A OE2  7  
ATOM 10944 H H    . GLU A 1 20  ? 4.862   0.658   7.641   1.00 0.00 ? 20  GLU A H    7  
ATOM 10945 H HA   . GLU A 1 20  ? 4.077   2.649   8.406   1.00 0.00 ? 20  GLU A HA   7  
ATOM 10946 H HB2  . GLU A 1 20  ? 6.303   2.383   9.732   1.00 0.00 ? 20  GLU A HB2  7  
ATOM 10947 H HB3  . GLU A 1 20  ? 6.892   3.655   8.671   1.00 0.00 ? 20  GLU A HB3  7  
ATOM 10948 H HG2  . GLU A 1 20  ? 4.484   4.645   9.553   1.00 0.00 ? 20  GLU A HG2  7  
ATOM 10949 H HG3  . GLU A 1 20  ? 5.119   3.806   10.966  1.00 0.00 ? 20  GLU A HG3  7  
ATOM 10950 N N    . ILE A 1 21  ? 3.877   4.140   6.446   1.00 0.00 ? 21  ILE A N    7  
ATOM 10951 C CA   . ILE A 1 21  ? 3.732   5.079   5.339   1.00 0.00 ? 21  ILE A CA   7  
ATOM 10952 C C    . ILE A 1 21  ? 4.351   6.432   5.665   1.00 0.00 ? 21  ILE A C    7  
ATOM 10953 O O    . ILE A 1 21  ? 3.788   7.216   6.430   1.00 0.00 ? 21  ILE A O    7  
ATOM 10954 C CB   . ILE A 1 21  ? 2.256   5.295   4.956   1.00 0.00 ? 21  ILE A CB   7  
ATOM 10955 C CG1  . ILE A 1 21  ? 1.422   4.051   5.270   1.00 0.00 ? 21  ILE A CG1  7  
ATOM 10956 C CG2  . ILE A 1 21  ? 2.149   5.650   3.482   1.00 0.00 ? 21  ILE A CG2  7  
ATOM 10957 C CD1  . ILE A 1 21  ? 0.315   4.305   6.269   1.00 0.00 ? 21  ILE A CD1  7  
ATOM 10958 H H    . ILE A 1 21  ? 3.074   3.799   6.892   1.00 0.00 ? 21  ILE A H    7  
ATOM 10959 H HA   . ILE A 1 21  ? 4.243   4.661   4.485   1.00 0.00 ? 21  ILE A HA   7  
ATOM 10960 H HB   . ILE A 1 21  ? 1.878   6.127   5.529   1.00 0.00 ? 21  ILE A HB   7  
ATOM 10961 H HG12 . ILE A 1 21  ? 0.970   3.688   4.359   1.00 0.00 ? 21  ILE A HG12 7  
ATOM 10962 H HG13 . ILE A 1 21  ? 2.069   3.286   5.676   1.00 0.00 ? 21  ILE A HG13 7  
ATOM 10963 H HG21 . ILE A 1 21  ? 1.439   6.455   3.357   1.00 0.00 ? 21  ILE A HG21 7  
ATOM 10964 H HG22 . ILE A 1 21  ? 1.813   4.785   2.927   1.00 0.00 ? 21  ILE A HG22 7  
ATOM 10965 H HG23 . ILE A 1 21  ? 3.115   5.962   3.115   1.00 0.00 ? 21  ILE A HG23 7  
ATOM 10966 H HD11 . ILE A 1 21  ? 0.518   5.219   6.808   1.00 0.00 ? 21  ILE A HD11 7  
ATOM 10967 H HD12 . ILE A 1 21  ? 0.263   3.481   6.966   1.00 0.00 ? 21  ILE A HD12 7  
ATOM 10968 H HD13 . ILE A 1 21  ? -0.626  4.396   5.748   1.00 0.00 ? 21  ILE A HD13 7  
ATOM 10969 N N    . LEU A 1 22  ? 5.507   6.704   5.067   1.00 0.00 ? 22  LEU A N    7  
ATOM 10970 C CA   . LEU A 1 22  ? 6.196   7.971   5.282   1.00 0.00 ? 22  LEU A CA   7  
ATOM 10971 C C    . LEU A 1 22  ? 5.305   9.132   4.862   1.00 0.00 ? 22  LEU A C    7  
ATOM 10972 O O    . LEU A 1 22  ? 5.325   10.199  5.475   1.00 0.00 ? 22  LEU A O    7  
ATOM 10973 C CB   . LEU A 1 22  ? 7.510   8.015   4.492   1.00 0.00 ? 22  LEU A CB   7  
ATOM 10974 C CG   . LEU A 1 22  ? 8.274   6.691   4.398   1.00 0.00 ? 22  LEU A CG   7  
ATOM 10975 C CD1  . LEU A 1 22  ? 9.645   6.915   3.787   1.00 0.00 ? 22  LEU A CD1  7  
ATOM 10976 C CD2  . LEU A 1 22  ? 8.402   6.043   5.771   1.00 0.00 ? 22  LEU A CD2  7  
ATOM 10977 H H    . LEU A 1 22  ? 5.897   6.039   4.464   1.00 0.00 ? 22  LEU A H    7  
ATOM 10978 H HA   . LEU A 1 22  ? 6.414   8.060   6.335   1.00 0.00 ? 22  LEU A HA   7  
ATOM 10979 H HB2  . LEU A 1 22  ? 7.288   8.346   3.487   1.00 0.00 ? 22  LEU A HB2  7  
ATOM 10980 H HB3  . LEU A 1 22  ? 8.157   8.744   4.955   1.00 0.00 ? 22  LEU A HB3  7  
ATOM 10981 H HG   . LEU A 1 22  ? 7.730   6.012   3.756   1.00 0.00 ? 22  LEU A HG   7  
ATOM 10982 H HD11 . LEU A 1 22  ? 9.537   7.203   2.752   1.00 0.00 ? 22  LEU A HD11 7  
ATOM 10983 H HD12 . LEU A 1 22  ? 10.221  6.003   3.849   1.00 0.00 ? 22  LEU A HD12 7  
ATOM 10984 H HD13 . LEU A 1 22  ? 10.156  7.701   4.327   1.00 0.00 ? 22  LEU A HD13 7  
ATOM 10985 H HD21 . LEU A 1 22  ? 8.928   5.105   5.678   1.00 0.00 ? 22  LEU A HD21 7  
ATOM 10986 H HD22 . LEU A 1 22  ? 7.418   5.866   6.178   1.00 0.00 ? 22  LEU A HD22 7  
ATOM 10987 H HD23 . LEU A 1 22  ? 8.951   6.702   6.428   1.00 0.00 ? 22  LEU A HD23 7  
ATOM 10988 N N    . VAL A 1 23  ? 4.517   8.907   3.811   1.00 0.00 ? 23  VAL A N    7  
ATOM 10989 C CA   . VAL A 1 23  ? 3.603   9.923   3.301   1.00 0.00 ? 23  VAL A CA   7  
ATOM 10990 C C    . VAL A 1 23  ? 2.803   9.399   2.109   1.00 0.00 ? 23  VAL A C    7  
ATOM 10991 O O    . VAL A 1 23  ? 3.225   8.468   1.422   1.00 0.00 ? 23  VAL A O    7  
ATOM 10992 C CB   . VAL A 1 23  ? 4.357   11.212  2.892   1.00 0.00 ? 23  VAL A CB   7  
ATOM 10993 C CG1  . VAL A 1 23  ? 4.545   11.295  1.381   1.00 0.00 ? 23  VAL A CG1  7  
ATOM 10994 C CG2  . VAL A 1 23  ? 3.627   12.441  3.410   1.00 0.00 ? 23  VAL A CG2  7  
ATOM 10995 H H    . VAL A 1 23  ? 4.545   8.032   3.371   1.00 0.00 ? 23  VAL A H    7  
ATOM 10996 H HA   . VAL A 1 23  ? 2.915   10.175  4.096   1.00 0.00 ? 23  VAL A HA   7  
ATOM 10997 H HB   . VAL A 1 23  ? 5.336   11.189  3.348   1.00 0.00 ? 23  VAL A HB   7  
ATOM 10998 H HG11 . VAL A 1 23  ? 3.595   11.516  0.911   1.00 0.00 ? 23  VAL A HG11 7  
ATOM 10999 H HG12 . VAL A 1 23  ? 4.918   10.351  1.013   1.00 0.00 ? 23  VAL A HG12 7  
ATOM 11000 H HG13 . VAL A 1 23  ? 5.252   12.079  1.147   1.00 0.00 ? 23  VAL A HG13 7  
ATOM 11001 H HG21 . VAL A 1 23  ? 2.721   12.135  3.913   1.00 0.00 ? 23  VAL A HG21 7  
ATOM 11002 H HG22 . VAL A 1 23  ? 3.376   13.088  2.582   1.00 0.00 ? 23  VAL A HG22 7  
ATOM 11003 H HG23 . VAL A 1 23  ? 4.261   12.972  4.104   1.00 0.00 ? 23  VAL A HG23 7  
ATOM 11004 N N    . ALA A 1 24  ? 1.657   10.024  1.862   1.00 0.00 ? 24  ALA A N    7  
ATOM 11005 C CA   . ALA A 1 24  ? 0.799   9.651   0.745   1.00 0.00 ? 24  ALA A CA   7  
ATOM 11006 C C    . ALA A 1 24  ? 0.265   10.909  0.068   1.00 0.00 ? 24  ALA A C    7  
ATOM 11007 O O    . ALA A 1 24  ? 0.277   11.986  0.660   1.00 0.00 ? 24  ALA A O    7  
ATOM 11008 C CB   . ALA A 1 24  ? -0.337  8.753   1.214   1.00 0.00 ? 24  ALA A CB   7  
ATOM 11009 H H    . ALA A 1 24  ? 1.389   10.769  2.439   1.00 0.00 ? 24  ALA A H    7  
ATOM 11010 H HA   . ALA A 1 24  ? 1.399   9.098   0.033   1.00 0.00 ? 24  ALA A HA   7  
ATOM 11011 H HB1  . ALA A 1 24  ? -1.162  8.822   0.520   1.00 0.00 ? 24  ALA A HB1  7  
ATOM 11012 H HB2  . ALA A 1 24  ? -0.663  9.066   2.194   1.00 0.00 ? 24  ALA A HB2  7  
ATOM 11013 H HB3  . ALA A 1 24  ? 0.011   7.729   1.258   1.00 0.00 ? 24  ALA A HB3  7  
ATOM 11014 N N    . ASN A 1 25  ? -0.160  10.787  -1.183  1.00 0.00 ? 25  ASN A N    7  
ATOM 11015 C CA   . ASN A 1 25  ? -0.639  11.951  -1.925  1.00 0.00 ? 25  ASN A CA   7  
ATOM 11016 C C    . ASN A 1 25  ? -2.161  12.057  -1.981  1.00 0.00 ? 25  ASN A C    7  
ATOM 11017 O O    . ASN A 1 25  ? -2.888  11.136  -1.619  1.00 0.00 ? 25  ASN A O    7  
ATOM 11018 C CB   . ASN A 1 25  ? -0.067  11.934  -3.345  1.00 0.00 ? 25  ASN A CB   7  
ATOM 11019 C CG   . ASN A 1 25  ? -0.435  10.674  -4.107  1.00 0.00 ? 25  ASN A CG   7  
ATOM 11020 O OD1  . ASN A 1 25  ? -0.425  9.572   -3.560  1.00 0.00 ? 25  ASN A OD1  7  
ATOM 11021 N ND2  . ASN A 1 25  ? -0.764  10.834  -5.382  1.00 0.00 ? 25  ASN A ND2  7  
ATOM 11022 H H    . ASN A 1 25  ? -0.114  9.914   -1.626  1.00 0.00 ? 25  ASN A H    7  
ATOM 11023 H HA   . ASN A 1 25  ? -0.265  12.826  -1.414  1.00 0.00 ? 25  ASN A HA   7  
ATOM 11024 H HB2  . ASN A 1 25  ? -0.451  12.786  -3.888  1.00 0.00 ? 25  ASN A HB2  7  
ATOM 11025 H HB3  . ASN A 1 25  ? 1.010   12.000  -3.292  1.00 0.00 ? 25  ASN A HB3  7  
ATOM 11026 H HD21 . ASN A 1 25  ? -0.748  11.738  -5.755  1.00 0.00 ? 25  ASN A HD21 7  
ATOM 11027 H HD22 . ASN A 1 25  ? -1.018  10.039  -5.899  1.00 0.00 ? 25  ASN A HD22 7  
ATOM 11028 N N    . ASP A 1 26  ? -2.613  13.213  -2.456  1.00 0.00 ? 26  ASP A N    7  
ATOM 11029 C CA   . ASP A 1 26  ? -4.035  13.519  -2.589  1.00 0.00 ? 26  ASP A CA   7  
ATOM 11030 C C    . ASP A 1 26  ? -4.737  12.560  -3.544  1.00 0.00 ? 26  ASP A C    7  
ATOM 11031 O O    . ASP A 1 26  ? -5.962  12.590  -3.672  1.00 0.00 ? 26  ASP A O    7  
ATOM 11032 C CB   . ASP A 1 26  ? -4.232  14.960  -3.062  1.00 0.00 ? 26  ASP A CB   7  
ATOM 11033 C CG   . ASP A 1 26  ? -3.112  15.434  -3.968  1.00 0.00 ? 26  ASP A CG   7  
ATOM 11034 O OD1  . ASP A 1 26  ? -2.043  15.811  -3.444  1.00 0.00 ? 26  ASP A OD1  7  
ATOM 11035 O OD2  . ASP A 1 26  ? -3.303  15.429  -5.201  1.00 0.00 ? 26  ASP A OD2  7  
ATOM 11036 H H    . ASP A 1 26  ? -1.951  13.881  -2.731  1.00 0.00 ? 26  ASP A H    7  
ATOM 11037 H HA   . ASP A 1 26  ? -4.482  13.410  -1.613  1.00 0.00 ? 26  ASP A HA   7  
ATOM 11038 H HB2  . ASP A 1 26  ? -5.160  15.029  -3.607  1.00 0.00 ? 26  ASP A HB2  7  
ATOM 11039 H HB3  . ASP A 1 26  ? -4.274  15.613  -2.201  1.00 0.00 ? 26  ASP A HB3  7  
ATOM 11040 N N    . LYS A 1 27  ? -3.971  11.691  -4.186  1.00 0.00 ? 27  LYS A N    7  
ATOM 11041 C CA   . LYS A 1 27  ? -4.540  10.709  -5.093  1.00 0.00 ? 27  LYS A CA   7  
ATOM 11042 C C    . LYS A 1 27  ? -4.778  9.414   -4.330  1.00 0.00 ? 27  LYS A C    7  
ATOM 11043 O O    . LYS A 1 27  ? -5.921  9.032   -4.078  1.00 0.00 ? 27  LYS A O    7  
ATOM 11044 C CB   . LYS A 1 27  ? -3.607  10.482  -6.284  1.00 0.00 ? 27  LYS A CB   7  
ATOM 11045 C CG   . LYS A 1 27  ? -3.639  11.613  -7.298  1.00 0.00 ? 27  LYS A CG   7  
ATOM 11046 C CD   . LYS A 1 27  ? -2.266  11.867  -7.899  1.00 0.00 ? 27  LYS A CD   7  
ATOM 11047 C CE   . LYS A 1 27  ? -1.681  13.185  -7.417  1.00 0.00 ? 27  LYS A CE   7  
ATOM 11048 N NZ   . LYS A 1 27  ? -2.588  14.335  -7.693  1.00 0.00 ? 27  LYS A NZ   7  
ATOM 11049 H H    . LYS A 1 27  ? -3.006  11.679  -4.016  1.00 0.00 ? 27  LYS A H    7  
ATOM 11050 H HA   . LYS A 1 27  ? -5.486  11.090  -5.447  1.00 0.00 ? 27  LYS A HA   7  
ATOM 11051 H HB2  . LYS A 1 27  ? -2.597  10.384  -5.919  1.00 0.00 ? 27  LYS A HB2  7  
ATOM 11052 H HB3  . LYS A 1 27  ? -3.889  9.568   -6.784  1.00 0.00 ? 27  LYS A HB3  7  
ATOM 11053 H HG2  . LYS A 1 27  ? -4.326  11.355  -8.089  1.00 0.00 ? 27  LYS A HG2  7  
ATOM 11054 H HG3  . LYS A 1 27  ? -3.977  12.512  -6.805  1.00 0.00 ? 27  LYS A HG3  7  
ATOM 11055 H HD2  . LYS A 1 27  ? -1.603  11.064  -7.612  1.00 0.00 ? 27  LYS A HD2  7  
ATOM 11056 H HD3  . LYS A 1 27  ? -2.354  11.895  -8.976  1.00 0.00 ? 27  LYS A HD3  7  
ATOM 11057 H HE2  . LYS A 1 27  ? -1.512  13.121  -6.352  1.00 0.00 ? 27  LYS A HE2  7  
ATOM 11058 H HE3  . LYS A 1 27  ? -0.739  13.352  -7.919  1.00 0.00 ? 27  LYS A HE3  7  
ATOM 11059 H HZ1  . LYS A 1 27  ? -3.579  14.027  -7.642  1.00 0.00 ? 27  LYS A HZ1  7  
ATOM 11060 H HZ2  . LYS A 1 27  ? -2.403  14.716  -8.643  1.00 0.00 ? 27  LYS A HZ2  7  
ATOM 11061 H HZ3  . LYS A 1 27  ? -2.432  15.087  -6.994  1.00 0.00 ? 27  LYS A HZ3  7  
ATOM 11062 N N    . ALA A 1 28  ? -3.685  8.761   -3.937  1.00 0.00 ? 28  ALA A N    7  
ATOM 11063 C CA   . ALA A 1 28  ? -3.760  7.524   -3.165  1.00 0.00 ? 28  ALA A CA   7  
ATOM 11064 C C    . ALA A 1 28  ? -4.750  7.655   -2.013  1.00 0.00 ? 28  ALA A C    7  
ATOM 11065 O O    . ALA A 1 28  ? -5.670  6.847   -1.870  1.00 0.00 ? 28  ALA A O    7  
ATOM 11066 C CB   . ALA A 1 28  ? -2.385  7.167   -2.621  1.00 0.00 ? 28  ALA A CB   7  
ATOM 11067 H H    . ALA A 1 28  ? -2.806  9.130   -4.167  1.00 0.00 ? 28  ALA A H    7  
ATOM 11068 H HA   . ALA A 1 28  ? -4.082  6.732   -3.823  1.00 0.00 ? 28  ALA A HA   7  
ATOM 11069 H HB1  . ALA A 1 28  ? -2.455  6.981   -1.559  1.00 0.00 ? 28  ALA A HB1  7  
ATOM 11070 H HB2  . ALA A 1 28  ? -1.703  7.987   -2.798  1.00 0.00 ? 28  ALA A HB2  7  
ATOM 11071 H HB3  . ALA A 1 28  ? -2.021  6.281   -3.119  1.00 0.00 ? 28  ALA A HB3  7  
ATOM 11072 N N    . CYS A 1 29  ? -4.552  8.683   -1.197  1.00 0.00 ? 29  CYS A N    7  
ATOM 11073 C CA   . CYS A 1 29  ? -5.420  8.938   -0.055  1.00 0.00 ? 29  CYS A CA   7  
ATOM 11074 C C    . CYS A 1 29  ? -6.871  9.050   -0.501  1.00 0.00 ? 29  CYS A C    7  
ATOM 11075 O O    . CYS A 1 29  ? -7.780  8.591   0.192   1.00 0.00 ? 29  CYS A O    7  
ATOM 11076 C CB   . CYS A 1 29  ? -4.965  10.214  0.651   1.00 0.00 ? 29  CYS A CB   7  
ATOM 11077 S SG   . CYS A 1 29  ? -3.184  10.269  0.958   1.00 0.00 ? 29  CYS A SG   7  
ATOM 11078 H H    . CYS A 1 29  ? -3.803  9.292   -1.370  1.00 0.00 ? 29  CYS A H    7  
ATOM 11079 H HA   . CYS A 1 29  ? -5.333  8.102   0.630   1.00 0.00 ? 29  CYS A HA   7  
ATOM 11080 H HB2  . CYS A 1 29  ? -5.221  11.065  0.039   1.00 0.00 ? 29  CYS A HB2  7  
ATOM 11081 H HB3  . CYS A 1 29  ? -5.463  10.295  1.604   1.00 0.00 ? 29  CYS A HB3  7  
ATOM 11082 H HG   . CYS A 1 29  ? -2.870  11.502  1.326   1.00 0.00 ? 29  CYS A HG   7  
ATOM 11083 N N    . GLY A 1 30  ? -7.082  9.638   -1.677  1.00 0.00 ? 30  GLY A N    7  
ATOM 11084 C CA   . GLY A 1 30  ? -8.429  9.762   -2.205  1.00 0.00 ? 30  GLY A CA   7  
ATOM 11085 C C    . GLY A 1 30  ? -9.062  8.399   -2.393  1.00 0.00 ? 30  GLY A C    7  
ATOM 11086 O O    . GLY A 1 30  ? -10.230 8.192   -2.057  1.00 0.00 ? 30  GLY A O    7  
ATOM 11087 H H    . GLY A 1 30  ? -6.319  9.968   -2.195  1.00 0.00 ? 30  GLY A H    7  
ATOM 11088 H HA2  . GLY A 1 30  ? -9.027  10.342  -1.516  1.00 0.00 ? 30  GLY A HA2  7  
ATOM 11089 H HA3  . GLY A 1 30  ? -8.392  10.268  -3.157  1.00 0.00 ? 30  GLY A HA3  7  
ATOM 11090 N N    . LEU A 1 31  ? -8.269  7.466   -2.919  1.00 0.00 ? 31  LEU A N    7  
ATOM 11091 C CA   . LEU A 1 31  ? -8.720  6.096   -3.144  1.00 0.00 ? 31  LEU A CA   7  
ATOM 11092 C C    . LEU A 1 31  ? -9.417  5.573   -1.888  1.00 0.00 ? 31  LEU A C    7  
ATOM 11093 O O    . LEU A 1 31  ? -10.558 5.112   -1.943  1.00 0.00 ? 31  LEU A O    7  
ATOM 11094 C CB   . LEU A 1 31  ? -7.515  5.216   -3.526  1.00 0.00 ? 31  LEU A CB   7  
ATOM 11095 C CG   . LEU A 1 31  ? -7.758  3.703   -3.642  1.00 0.00 ? 31  LEU A CG   7  
ATOM 11096 C CD1  . LEU A 1 31  ? -7.447  3.016   -2.323  1.00 0.00 ? 31  LEU A CD1  7  
ATOM 11097 C CD2  . LEU A 1 31  ? -9.181  3.392   -4.095  1.00 0.00 ? 31  LEU A CD2  7  
ATOM 11098 H H    . LEU A 1 31  ? -7.348  7.712   -3.150  1.00 0.00 ? 31  LEU A H    7  
ATOM 11099 H HA   . LEU A 1 31  ? -9.428  6.106   -3.960  1.00 0.00 ? 31  LEU A HA   7  
ATOM 11100 H HB2  . LEU A 1 31  ? -7.142  5.565   -4.478  1.00 0.00 ? 31  LEU A HB2  7  
ATOM 11101 H HB3  . LEU A 1 31  ? -6.744  5.373   -2.787  1.00 0.00 ? 31  LEU A HB3  7  
ATOM 11102 H HG   . LEU A 1 31  ? -7.081  3.303   -4.384  1.00 0.00 ? 31  LEU A HG   7  
ATOM 11103 H HD11 . LEU A 1 31  ? -6.641  2.309   -2.468  1.00 0.00 ? 31  LEU A HD11 7  
ATOM 11104 H HD12 . LEU A 1 31  ? -8.324  2.495   -1.967  1.00 0.00 ? 31  LEU A HD12 7  
ATOM 11105 H HD13 . LEU A 1 31  ? -7.144  3.755   -1.594  1.00 0.00 ? 31  LEU A HD13 7  
ATOM 11106 H HD21 . LEU A 1 31  ? -9.302  2.323   -4.184  1.00 0.00 ? 31  LEU A HD21 7  
ATOM 11107 H HD22 . LEU A 1 31  ? -9.361  3.856   -5.054  1.00 0.00 ? 31  LEU A HD22 7  
ATOM 11108 H HD23 . LEU A 1 31  ? -9.881  3.777   -3.371  1.00 0.00 ? 31  LEU A HD23 7  
ATOM 11109 N N    . LEU A 1 32  ? -8.732  5.676   -0.752  1.00 0.00 ? 32  LEU A N    7  
ATOM 11110 C CA   . LEU A 1 32  ? -9.307  5.242   0.518   1.00 0.00 ? 32  LEU A CA   7  
ATOM 11111 C C    . LEU A 1 32  ? -10.133 6.360   1.137   1.00 0.00 ? 32  LEU A C    7  
ATOM 11112 O O    . LEU A 1 32  ? -11.355 6.402   1.001   1.00 0.00 ? 32  LEU A O    7  
ATOM 11113 C CB   . LEU A 1 32  ? -8.239  4.832   1.529   1.00 0.00 ? 32  LEU A CB   7  
ATOM 11114 C CG   . LEU A 1 32  ? -7.068  4.015   1.009   1.00 0.00 ? 32  LEU A CG   7  
ATOM 11115 C CD1  . LEU A 1 32  ? -6.029  4.914   0.354   1.00 0.00 ? 32  LEU A CD1  7  
ATOM 11116 C CD2  . LEU A 1 32  ? -6.460  3.253   2.166   1.00 0.00 ? 32  LEU A CD2  7  
ATOM 11117 H H    . LEU A 1 32  ? -7.835  6.072   -0.782  1.00 0.00 ? 32  LEU A H    7  
ATOM 11118 H HA   . LEU A 1 32  ? -9.952  4.398   0.321   1.00 0.00 ? 32  LEU A HA   7  
ATOM 11119 H HB2  . LEU A 1 32  ? -7.845  5.729   1.980   1.00 0.00 ? 32  LEU A HB2  7  
ATOM 11120 H HB3  . LEU A 1 32  ? -8.726  4.252   2.301   1.00 0.00 ? 32  LEU A HB3  7  
ATOM 11121 H HG   . LEU A 1 32  ? -7.417  3.304   0.275   1.00 0.00 ? 32  LEU A HG   7  
ATOM 11122 H HD11 . LEU A 1 32  ? -5.434  4.335   -0.337  1.00 0.00 ? 32  LEU A HD11 7  
ATOM 11123 H HD12 . LEU A 1 32  ? -5.388  5.336   1.115   1.00 0.00 ? 32  LEU A HD12 7  
ATOM 11124 H HD13 . LEU A 1 32  ? -6.526  5.712   -0.179  1.00 0.00 ? 32  LEU A HD13 7  
ATOM 11125 H HD21 . LEU A 1 32  ? -6.274  2.233   1.871   1.00 0.00 ? 32  LEU A HD21 7  
ATOM 11126 H HD22 . LEU A 1 32  ? -7.149  3.271   3.004   1.00 0.00 ? 32  LEU A HD22 7  
ATOM 11127 H HD23 . LEU A 1 32  ? -5.531  3.723   2.454   1.00 0.00 ? 32  LEU A HD23 7  
ATOM 11128 N N    . GLY A 1 33  ? -9.441  7.266   1.824   1.00 0.00 ? 33  GLY A N    7  
ATOM 11129 C CA   . GLY A 1 33  ? -10.106 8.384   2.469   1.00 0.00 ? 33  GLY A CA   7  
ATOM 11130 C C    . GLY A 1 33  ? -9.219  9.061   3.498   1.00 0.00 ? 33  GLY A C    7  
ATOM 11131 O O    . GLY A 1 33  ? -9.702  9.783   4.371   1.00 0.00 ? 33  GLY A O    7  
ATOM 11132 H H    . GLY A 1 33  ? -8.460  7.174   1.894   1.00 0.00 ? 33  GLY A H    7  
ATOM 11133 H HA2  . GLY A 1 33  ? -10.384 9.108   1.718   1.00 0.00 ? 33  GLY A HA2  7  
ATOM 11134 H HA3  . GLY A 1 33  ? -11.000 8.026   2.960   1.00 0.00 ? 33  GLY A HA3  7  
ATOM 11135 N N    . TYR A 1 34  ? -7.918  8.822   3.389   1.00 0.00 ? 34  TYR A N    7  
ATOM 11136 C CA   . TYR A 1 34  ? -6.941  9.403   4.305   1.00 0.00 ? 34  TYR A CA   7  
ATOM 11137 C C    . TYR A 1 34  ? -6.232  10.583  3.646   1.00 0.00 ? 34  TYR A C    7  
ATOM 11138 O O    . TYR A 1 34  ? -6.792  11.252  2.778   1.00 0.00 ? 34  TYR A O    7  
ATOM 11139 C CB   . TYR A 1 34  ? -5.900  8.350   4.699   1.00 0.00 ? 34  TYR A CB   7  
ATOM 11140 C CG   . TYR A 1 34  ? -6.419  7.243   5.584   1.00 0.00 ? 34  TYR A CG   7  
ATOM 11141 C CD1  . TYR A 1 34  ? -7.437  6.402   5.161   1.00 0.00 ? 34  TYR A CD1  7  
ATOM 11142 C CD2  . TYR A 1 34  ? -5.878  7.035   6.845   1.00 0.00 ? 34  TYR A CD2  7  
ATOM 11143 C CE1  . TYR A 1 34  ? -7.905  5.385   5.971   1.00 0.00 ? 34  TYR A CE1  7  
ATOM 11144 C CE2  . TYR A 1 34  ? -6.337  6.022   7.661   1.00 0.00 ? 34  TYR A CE2  7  
ATOM 11145 C CZ   . TYR A 1 34  ? -7.351  5.199   7.220   1.00 0.00 ? 34  TYR A CZ   7  
ATOM 11146 O OH   . TYR A 1 34  ? -7.812  4.188   8.029   1.00 0.00 ? 34  TYR A OH   7  
ATOM 11147 H H    . TYR A 1 34  ? -7.602  8.236   2.669   1.00 0.00 ? 34  TYR A H    7  
ATOM 11148 H HA   . TYR A 1 34  ? -7.460  9.742   5.188   1.00 0.00 ? 34  TYR A HA   7  
ATOM 11149 H HB2  . TYR A 1 34  ? -5.510  7.894   3.801   1.00 0.00 ? 34  TYR A HB2  7  
ATOM 11150 H HB3  . TYR A 1 34  ? -5.091  8.841   5.221   1.00 0.00 ? 34  TYR A HB3  7  
ATOM 11151 H HD1  . TYR A 1 34  ? -7.868  6.550   4.181   1.00 0.00 ? 34  TYR A HD1  7  
ATOM 11152 H HD2  . TYR A 1 34  ? -5.078  7.679   7.185   1.00 0.00 ? 34  TYR A HD2  7  
ATOM 11153 H HE1  . TYR A 1 34  ? -8.698  4.741   5.624   1.00 0.00 ? 34  TYR A HE1  7  
ATOM 11154 H HE2  . TYR A 1 34  ? -5.903  5.877   8.640   1.00 0.00 ? 34  TYR A HE2  7  
ATOM 11155 H HH   . TYR A 1 34  ? -7.479  4.313   8.921   1.00 0.00 ? 34  TYR A HH   7  
ATOM 11156 N N    . SER A 1 35  ? -4.983  10.807  4.049   1.00 0.00 ? 35  SER A N    7  
ATOM 11157 C CA   . SER A 1 35  ? -4.161  11.870  3.489   1.00 0.00 ? 35  SER A CA   7  
ATOM 11158 C C    . SER A 1 35  ? -2.743  11.790  4.031   1.00 0.00 ? 35  SER A C    7  
ATOM 11159 O O    . SER A 1 35  ? -2.491  11.129  5.038   1.00 0.00 ? 35  SER A O    7  
ATOM 11160 C CB   . SER A 1 35  ? -4.742  13.250  3.752   1.00 0.00 ? 35  SER A CB   7  
ATOM 11161 O OG   . SER A 1 35  ? -4.732  13.562  5.131   1.00 0.00 ? 35  SER A OG   7  
ATOM 11162 H H    . SER A 1 35  ? -4.593  10.219  4.729   1.00 0.00 ? 35  SER A H    7  
ATOM 11163 H HA   . SER A 1 35  ? -4.129  11.718  2.423   1.00 0.00 ? 35  SER A HA   7  
ATOM 11164 H HB2  . SER A 1 35  ? -4.152  13.985  3.218   1.00 0.00 ? 35  SER A HB2  7  
ATOM 11165 H HB3  . SER A 1 35  ? -5.756  13.273  3.389   1.00 0.00 ? 35  SER A HB3  7  
ATOM 11166 H HG   . SER A 1 35  ? -5.627  13.509  5.479   1.00 0.00 ? 35  SER A HG   7  
ATOM 11167 N N    . SER A 1 36  ? -1.826  12.456  3.342   1.00 0.00 ? 36  SER A N    7  
ATOM 11168 C CA   . SER A 1 36  ? -0.414  12.469  3.724   1.00 0.00 ? 36  SER A CA   7  
ATOM 11169 C C    . SER A 1 36  ? -0.224  12.520  5.241   1.00 0.00 ? 36  SER A C    7  
ATOM 11170 O O    . SER A 1 36  ? 0.659   11.856  5.780   1.00 0.00 ? 36  SER A O    7  
ATOM 11171 C CB   . SER A 1 36  ? 0.290   13.665  3.079   1.00 0.00 ? 36  SER A CB   7  
ATOM 11172 O OG   . SER A 1 36  ? 1.016   14.412  4.041   1.00 0.00 ? 36  SER A OG   7  
ATOM 11173 H H    . SER A 1 36  ? -2.107  12.948  2.541   1.00 0.00 ? 36  SER A H    7  
ATOM 11174 H HA   . SER A 1 36  ? 0.034   11.562  3.350   1.00 0.00 ? 36  SER A HA   7  
ATOM 11175 H HB2  . SER A 1 36  ? 0.977   13.309  2.324   1.00 0.00 ? 36  SER A HB2  7  
ATOM 11176 H HB3  . SER A 1 36  ? -0.445  14.309  2.621   1.00 0.00 ? 36  SER A HB3  7  
ATOM 11177 H HG   . SER A 1 36  ? 0.663   15.304  4.085   1.00 0.00 ? 36  SER A HG   7  
ATOM 11178 N N    . GLN A 1 37  ? -1.038  13.323  5.921   1.00 0.00 ? 37  GLN A N    7  
ATOM 11179 C CA   . GLN A 1 37  ? -0.931  13.466  7.372   1.00 0.00 ? 37  GLN A CA   7  
ATOM 11180 C C    . GLN A 1 37  ? -1.956  12.614  8.125   1.00 0.00 ? 37  GLN A C    7  
ATOM 11181 O O    . GLN A 1 37  ? -1.731  12.243  9.277   1.00 0.00 ? 37  GLN A O    7  
ATOM 11182 C CB   . GLN A 1 37  ? -1.095  14.936  7.767   1.00 0.00 ? 37  GLN A CB   7  
ATOM 11183 C CG   . GLN A 1 37  ? -2.174  15.661  6.977   1.00 0.00 ? 37  GLN A CG   7  
ATOM 11184 C CD   . GLN A 1 37  ? -1.746  17.053  6.555   1.00 0.00 ? 37  GLN A CD   7  
ATOM 11185 O OE1  . GLN A 1 37  ? -1.771  17.389  5.371   1.00 0.00 ? 37  GLN A OE1  7  
ATOM 11186 N NE2  . GLN A 1 37  ? -1.349  17.870  7.524   1.00 0.00 ? 37  GLN A NE2  7  
ATOM 11187 H H    . GLN A 1 37  ? -1.716  13.839  5.436   1.00 0.00 ? 37  GLN A H    7  
ATOM 11188 H HA   . GLN A 1 37  ? 0.058   13.144  7.658   1.00 0.00 ? 37  GLN A HA   7  
ATOM 11189 H HB2  . GLN A 1 37  ? -1.348  14.987  8.815   1.00 0.00 ? 37  GLN A HB2  7  
ATOM 11190 H HB3  . GLN A 1 37  ? -0.156  15.446  7.607   1.00 0.00 ? 37  GLN A HB3  7  
ATOM 11191 H HG2  . GLN A 1 37  ? -2.402  15.088  6.093   1.00 0.00 ? 37  GLN A HG2  7  
ATOM 11192 H HG3  . GLN A 1 37  ? -3.059  15.743  7.593   1.00 0.00 ? 37  GLN A HG3  7  
ATOM 11193 H HE21 . GLN A 1 37  ? -1.356  17.534  8.444   1.00 0.00 ? 37  GLN A HE21 7  
ATOM 11194 H HE22 . GLN A 1 37  ? -1.071  18.778  7.279   1.00 0.00 ? 37  GLN A HE22 7  
ATOM 11195 N N    . ASP A 1 38  ? -3.087  12.328  7.487   1.00 0.00 ? 38  ASP A N    7  
ATOM 11196 C CA   . ASP A 1 38  ? -4.145  11.546  8.128   1.00 0.00 ? 38  ASP A CA   7  
ATOM 11197 C C    . ASP A 1 38  ? -3.836  10.050  8.142   1.00 0.00 ? 38  ASP A C    7  
ATOM 11198 O O    . ASP A 1 38  ? -4.581  9.269   8.736   1.00 0.00 ? 38  ASP A O    7  
ATOM 11199 C CB   . ASP A 1 38  ? -5.479  11.782  7.423   1.00 0.00 ? 38  ASP A CB   7  
ATOM 11200 C CG   . ASP A 1 38  ? -6.061  13.151  7.726   1.00 0.00 ? 38  ASP A CG   7  
ATOM 11201 O OD1  . ASP A 1 38  ? -5.282  14.125  7.798   1.00 0.00 ? 38  ASP A OD1  7  
ATOM 11202 O OD2  . ASP A 1 38  ? -7.293  13.248  7.892   1.00 0.00 ? 38  ASP A OD2  7  
ATOM 11203 H H    . ASP A 1 38  ? -3.222  12.664  6.577   1.00 0.00 ? 38  ASP A H    7  
ATOM 11204 H HA   . ASP A 1 38  ? -4.229  11.887  9.148   1.00 0.00 ? 38  ASP A HA   7  
ATOM 11205 H HB2  . ASP A 1 38  ? -5.336  11.701  6.356   1.00 0.00 ? 38  ASP A HB2  7  
ATOM 11206 H HB3  . ASP A 1 38  ? -6.186  11.033  7.745   1.00 0.00 ? 38  ASP A HB3  7  
ATOM 11207 N N    . LEU A 1 39  ? -2.754  9.645   7.487   1.00 0.00 ? 39  LEU A N    7  
ATOM 11208 C CA   . LEU A 1 39  ? -2.397  8.229   7.441   1.00 0.00 ? 39  LEU A CA   7  
ATOM 11209 C C    . LEU A 1 39  ? -0.927  7.997   7.790   1.00 0.00 ? 39  LEU A C    7  
ATOM 11210 O O    . LEU A 1 39  ? -0.515  6.862   8.041   1.00 0.00 ? 39  LEU A O    7  
ATOM 11211 C CB   . LEU A 1 39  ? -2.715  7.650   6.059   1.00 0.00 ? 39  LEU A CB   7  
ATOM 11212 C CG   . LEU A 1 39  ? -1.849  8.167   4.909   1.00 0.00 ? 39  LEU A CG   7  
ATOM 11213 C CD1  . LEU A 1 39  ? -0.661  7.247   4.675   1.00 0.00 ? 39  LEU A CD1  7  
ATOM 11214 C CD2  . LEU A 1 39  ? -2.678  8.297   3.643   1.00 0.00 ? 39  LEU A CD2  7  
ATOM 11215 H H    . LEU A 1 39  ? -2.196  10.301  7.021   1.00 0.00 ? 39  LEU A H    7  
ATOM 11216 H HA   . LEU A 1 39  ? -3.003  7.719   8.173   1.00 0.00 ? 39  LEU A HA   7  
ATOM 11217 H HB2  . LEU A 1 39  ? -2.614  6.577   6.109   1.00 0.00 ? 39  LEU A HB2  7  
ATOM 11218 H HB3  . LEU A 1 39  ? -3.745  7.882   5.831   1.00 0.00 ? 39  LEU A HB3  7  
ATOM 11219 H HG   . LEU A 1 39  ? -1.468  9.146   5.164   1.00 0.00 ? 39  LEU A HG   7  
ATOM 11220 H HD11 . LEU A 1 39  ? -0.908  6.532   3.903   1.00 0.00 ? 39  LEU A HD11 7  
ATOM 11221 H HD12 . LEU A 1 39  ? -0.425  6.723   5.587   1.00 0.00 ? 39  LEU A HD12 7  
ATOM 11222 H HD13 . LEU A 1 39  ? 0.190   7.832   4.362   1.00 0.00 ? 39  LEU A HD13 7  
ATOM 11223 H HD21 . LEU A 1 39  ? -2.900  7.312   3.257   1.00 0.00 ? 39  LEU A HD21 7  
ATOM 11224 H HD22 . LEU A 1 39  ? -2.122  8.857   2.906   1.00 0.00 ? 39  LEU A HD22 7  
ATOM 11225 H HD23 . LEU A 1 39  ? -3.599  8.812   3.868   1.00 0.00 ? 39  LEU A HD23 7  
ATOM 11226 N N    . ILE A 1 40  ? -0.140  9.067   7.815   1.00 0.00 ? 40  ILE A N    7  
ATOM 11227 C CA   . ILE A 1 40  ? 1.277   8.956   8.141   1.00 0.00 ? 40  ILE A CA   7  
ATOM 11228 C C    . ILE A 1 40  ? 1.469   8.498   9.584   1.00 0.00 ? 40  ILE A C    7  
ATOM 11229 O O    . ILE A 1 40  ? 0.752   8.928   10.487  1.00 0.00 ? 40  ILE A O    7  
ATOM 11230 C CB   . ILE A 1 40  ? 2.014   10.297  7.924   1.00 0.00 ? 40  ILE A CB   7  
ATOM 11231 C CG1  . ILE A 1 40  ? 3.538   10.089  7.968   1.00 0.00 ? 40  ILE A CG1  7  
ATOM 11232 C CG2  . ILE A 1 40  ? 1.564   11.334  8.945   1.00 0.00 ? 40  ILE A CG2  7  
ATOM 11233 C CD1  . ILE A 1 40  ? 4.144   10.175  9.355   1.00 0.00 ? 40  ILE A CD1  7  
ATOM 11234 H H    . ILE A 1 40  ? -0.520  9.948   7.612   1.00 0.00 ? 40  ILE A H    7  
ATOM 11235 H HA   . ILE A 1 40  ? 1.711   8.221   7.480   1.00 0.00 ? 40  ILE A HA   7  
ATOM 11236 H HB   . ILE A 1 40  ? 1.745   10.663  6.944   1.00 0.00 ? 40  ILE A HB   7  
ATOM 11237 H HG12 . ILE A 1 40  ? 3.770   9.113   7.571   1.00 0.00 ? 40  ILE A HG12 7  
ATOM 11238 H HG13 . ILE A 1 40  ? 4.011   10.841  7.353   1.00 0.00 ? 40  ILE A HG13 7  
ATOM 11239 H HG21 . ILE A 1 40  ? 1.797   10.986  9.940   1.00 0.00 ? 40  ILE A HG21 7  
ATOM 11240 H HG22 . ILE A 1 40  ? 0.500   11.489  8.857   1.00 0.00 ? 40  ILE A HG22 7  
ATOM 11241 H HG23 . ILE A 1 40  ? 2.080   12.268  8.761   1.00 0.00 ? 40  ILE A HG23 7  
ATOM 11242 H HD11 . ILE A 1 40  ? 3.378   10.001  10.096  1.00 0.00 ? 40  ILE A HD11 7  
ATOM 11243 H HD12 . ILE A 1 40  ? 4.572   11.156  9.503   1.00 0.00 ? 40  ILE A HD12 7  
ATOM 11244 H HD13 . ILE A 1 40  ? 4.919   9.427   9.456   1.00 0.00 ? 40  ILE A HD13 7  
ATOM 11245 N N    . GLY A 1 41  ? 2.445   7.616   9.791   1.00 0.00 ? 41  GLY A N    7  
ATOM 11246 C CA   . GLY A 1 41  ? 2.717   7.114   11.126  1.00 0.00 ? 41  GLY A CA   7  
ATOM 11247 C C    . GLY A 1 41  ? 2.287   5.672   11.309  1.00 0.00 ? 41  GLY A C    7  
ATOM 11248 O O    . GLY A 1 41  ? 2.837   4.958   12.147  1.00 0.00 ? 41  GLY A O    7  
ATOM 11249 H H    . GLY A 1 41  ? 2.985   7.309   9.035   1.00 0.00 ? 41  GLY A H    7  
ATOM 11250 H HA2  . GLY A 1 41  ? 3.778   7.186   11.314  1.00 0.00 ? 41  GLY A HA2  7  
ATOM 11251 H HA3  . GLY A 1 41  ? 2.193   7.728   11.843  1.00 0.00 ? 41  GLY A HA3  7  
ATOM 11252 N N    . GLN A 1 42  ? 1.303   5.241   10.526  1.00 0.00 ? 42  GLN A N    7  
ATOM 11253 C CA   . GLN A 1 42  ? 0.804   3.875   10.611  1.00 0.00 ? 42  GLN A CA   7  
ATOM 11254 C C    . GLN A 1 42  ? 1.234   3.061   9.395   1.00 0.00 ? 42  GLN A C    7  
ATOM 11255 O O    . GLN A 1 42  ? 2.075   3.499   8.610   1.00 0.00 ? 42  GLN A O    7  
ATOM 11256 C CB   . GLN A 1 42  ? -0.723  3.869   10.729  1.00 0.00 ? 42  GLN A CB   7  
ATOM 11257 C CG   . GLN A 1 42  ? -1.274  5.006   11.577  1.00 0.00 ? 42  GLN A CG   7  
ATOM 11258 C CD   . GLN A 1 42  ? -2.647  5.458   11.122  1.00 0.00 ? 42  GLN A CD   7  
ATOM 11259 O OE1  . GLN A 1 42  ? -3.545  5.668   11.936  1.00 0.00 ? 42  GLN A OE1  7  
ATOM 11260 N NE2  . GLN A 1 42  ? -2.817  5.607   9.813   1.00 0.00 ? 42  GLN A NE2  7  
ATOM 11261 H H    . GLN A 1 42  ? 0.904   5.859   9.874   1.00 0.00 ? 42  GLN A H    7  
ATOM 11262 H HA   . GLN A 1 42  ? 1.226   3.423   11.498  1.00 0.00 ? 42  GLN A HA   7  
ATOM 11263 H HB2  . GLN A 1 42  ? -1.149  3.950   9.740   1.00 0.00 ? 42  GLN A HB2  7  
ATOM 11264 H HB3  . GLN A 1 42  ? -1.035  2.936   11.172  1.00 0.00 ? 42  GLN A HB3  7  
ATOM 11265 H HG2  . GLN A 1 42  ? -1.343  4.672   12.601  1.00 0.00 ? 42  GLN A HG2  7  
ATOM 11266 H HG3  . GLN A 1 42  ? -0.597  5.846   11.516  1.00 0.00 ? 42  GLN A HG3  7  
ATOM 11267 H HE21 . GLN A 1 42  ? -2.058  5.421   9.223   1.00 0.00 ? 42  GLN A HE21 7  
ATOM 11268 H HE22 . GLN A 1 42  ? -3.695  5.899   9.491   1.00 0.00 ? 42  GLN A HE22 7  
ATOM 11269 N N    . LYS A 1 43  ? 0.654   1.874   9.245   1.00 0.00 ? 43  LYS A N    7  
ATOM 11270 C CA   . LYS A 1 43  ? 0.972   1.000   8.121   1.00 0.00 ? 43  LYS A CA   7  
ATOM 11271 C C    . LYS A 1 43  ? -0.204  0.929   7.152   1.00 0.00 ? 43  LYS A C    7  
ATOM 11272 O O    . LYS A 1 43  ? -1.328  0.637   7.553   1.00 0.00 ? 43  LYS A O    7  
ATOM 11273 C CB   . LYS A 1 43  ? 1.324   -0.404  8.622   1.00 0.00 ? 43  LYS A CB   7  
ATOM 11274 C CG   . LYS A 1 43  ? 2.373   -0.412  9.722   1.00 0.00 ? 43  LYS A CG   7  
ATOM 11275 C CD   . LYS A 1 43  ? 1.738   -0.512  11.100  1.00 0.00 ? 43  LYS A CD   7  
ATOM 11276 C CE   . LYS A 1 43  ? 2.020   -1.857  11.748  1.00 0.00 ? 43  LYS A CE   7  
ATOM 11277 N NZ   . LYS A 1 43  ? 3.472   -2.053  12.012  1.00 0.00 ? 43  LYS A NZ   7  
ATOM 11278 H H    . LYS A 1 43  ? -0.010  1.582   9.904   1.00 0.00 ? 43  LYS A H    7  
ATOM 11279 H HA   . LYS A 1 43  ? 1.825   1.415   7.607   1.00 0.00 ? 43  LYS A HA   7  
ATOM 11280 H HB2  . LYS A 1 43  ? 0.429   -0.872  9.003   1.00 0.00 ? 43  LYS A HB2  7  
ATOM 11281 H HB3  . LYS A 1 43  ? 1.698   -0.985  7.791   1.00 0.00 ? 43  LYS A HB3  7  
ATOM 11282 H HG2  . LYS A 1 43  ? 3.027   -1.260  9.577   1.00 0.00 ? 43  LYS A HG2  7  
ATOM 11283 H HG3  . LYS A 1 43  ? 2.946   0.500   9.664   1.00 0.00 ? 43  LYS A HG3  7  
ATOM 11284 H HD2  . LYS A 1 43  ? 2.138   0.270   11.728  1.00 0.00 ? 43  LYS A HD2  7  
ATOM 11285 H HD3  . LYS A 1 43  ? 0.670   -0.386  11.002  1.00 0.00 ? 43  LYS A HD3  7  
ATOM 11286 H HE2  . LYS A 1 43  ? 1.483   -1.911  12.684  1.00 0.00 ? 43  LYS A HE2  7  
ATOM 11287 H HE3  . LYS A 1 43  ? 1.674   -2.639  11.089  1.00 0.00 ? 43  LYS A HE3  7  
ATOM 11288 H HZ1  . LYS A 1 43  ? 3.708   -3.065  11.974  1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 11289 H HZ2  . LYS A 1 43  ? 3.718   -1.687  12.952  1.00 0.00 ? 43  LYS A HZ2  7  
ATOM 11290 H HZ3  . LYS A 1 43  ? 4.035   -1.550  11.297  1.00 0.00 ? 43  LYS A HZ3  7  
ATOM 11291 N N    . LEU A 1 44  ? 0.061   1.234   5.883   1.00 0.00 ? 44  LEU A N    7  
ATOM 11292 C CA   . LEU A 1 44  ? -0.980  1.238   4.856   1.00 0.00 ? 44  LEU A CA   7  
ATOM 11293 C C    . LEU A 1 44  ? -1.879  0.000   4.922   1.00 0.00 ? 44  LEU A C    7  
ATOM 11294 O O    . LEU A 1 44  ? -3.094  0.114   4.787   1.00 0.00 ? 44  LEU A O    7  
ATOM 11295 C CB   . LEU A 1 44  ? -0.369  1.357   3.452   1.00 0.00 ? 44  LEU A CB   7  
ATOM 11296 C CG   . LEU A 1 44  ? 1.102   0.947   3.319   1.00 0.00 ? 44  LEU A CG   7  
ATOM 11297 C CD1  . LEU A 1 44  ? 1.277   -0.542  3.572   1.00 0.00 ? 44  LEU A CD1  7  
ATOM 11298 C CD2  . LEU A 1 44  ? 1.621   1.311   1.938   1.00 0.00 ? 44  LEU A CD2  7  
ATOM 11299 H H    . LEU A 1 44  ? 0.972   1.495   5.636   1.00 0.00 ? 44  LEU A H    7  
ATOM 11300 H HA   . LEU A 1 44  ? -1.596  2.106   5.031   1.00 0.00 ? 44  LEU A HA   7  
ATOM 11301 H HB2  . LEU A 1 44  ? -0.949  0.744   2.780   1.00 0.00 ? 44  LEU A HB2  7  
ATOM 11302 H HB3  . LEU A 1 44  ? -0.459  2.386   3.135   1.00 0.00 ? 44  LEU A HB3  7  
ATOM 11303 H HG   . LEU A 1 44  ? 1.689   1.484   4.049   1.00 0.00 ? 44  LEU A HG   7  
ATOM 11304 H HD11 . LEU A 1 44  ? 1.679   -1.014  2.687   1.00 0.00 ? 44  LEU A HD11 7  
ATOM 11305 H HD12 . LEU A 1 44  ? 0.320   -0.980  3.812   1.00 0.00 ? 44  LEU A HD12 7  
ATOM 11306 H HD13 . LEU A 1 44  ? 1.956   -0.688  4.400   1.00 0.00 ? 44  LEU A HD13 7  
ATOM 11307 H HD21 . LEU A 1 44  ? 1.114   0.714   1.193   1.00 0.00 ? 44  LEU A HD21 7  
ATOM 11308 H HD22 . LEU A 1 44  ? 2.684   1.119   1.890   1.00 0.00 ? 44  LEU A HD22 7  
ATOM 11309 H HD23 . LEU A 1 44  ? 1.436   2.358   1.747   1.00 0.00 ? 44  LEU A HD23 7  
ATOM 11310 N N    . THR A 1 45  ? -1.283  -1.175  5.100   1.00 0.00 ? 45  THR A N    7  
ATOM 11311 C CA   . THR A 1 45  ? -2.043  -2.429  5.147   1.00 0.00 ? 45  THR A CA   7  
ATOM 11312 C C    . THR A 1 45  ? -3.179  -2.395  6.161   1.00 0.00 ? 45  THR A C    7  
ATOM 11313 O O    . THR A 1 45  ? -4.122  -3.182  6.065   1.00 0.00 ? 45  THR A O    7  
ATOM 11314 C CB   . THR A 1 45  ? -1.140  -3.627  5.448   1.00 0.00 ? 45  THR A CB   7  
ATOM 11315 O OG1  . THR A 1 45  ? -0.336  -3.368  6.605   1.00 0.00 ? 45  THR A OG1  7  
ATOM 11316 C CG2  . THR A 1 45  ? -0.260  -3.919  4.253   1.00 0.00 ? 45  THR A CG2  7  
ATOM 11317 H H    . THR A 1 45  ? -0.307  -1.204  5.181   1.00 0.00 ? 45  THR A H    7  
ATOM 11318 H HA   . THR A 1 45  ? -2.470  -2.583  4.170   1.00 0.00 ? 45  THR A HA   7  
ATOM 11319 H HB   . THR A 1 45  ? -1.765  -4.485  5.630   1.00 0.00 ? 45  THR A HB   7  
ATOM 11320 H HG1  . THR A 1 45  ? -0.447  -4.081  7.237   1.00 0.00 ? 45  THR A HG1  7  
ATOM 11321 H HG21 . THR A 1 45  ? -0.315  -3.089  3.564   1.00 0.00 ? 45  THR A HG21 7  
ATOM 11322 H HG22 . THR A 1 45  ? -0.605  -4.819  3.764   1.00 0.00 ? 45  THR A HG22 7  
ATOM 11323 H HG23 . THR A 1 45  ? 0.760   -4.051  4.580   1.00 0.00 ? 45  THR A HG23 7  
ATOM 11324 N N    . GLN A 1 46  ? -3.105  -1.479  7.116   1.00 0.00 ? 46  GLN A N    7  
ATOM 11325 C CA   . GLN A 1 46  ? -4.152  -1.354  8.119   1.00 0.00 ? 46  GLN A CA   7  
ATOM 11326 C C    . GLN A 1 46  ? -5.461  -0.998  7.433   1.00 0.00 ? 46  GLN A C    7  
ATOM 11327 O O    . GLN A 1 46  ? -6.548  -1.260  7.947   1.00 0.00 ? 46  GLN A O    7  
ATOM 11328 C CB   . GLN A 1 46  ? -3.787  -0.286  9.151   1.00 0.00 ? 46  GLN A CB   7  
ATOM 11329 C CG   . GLN A 1 46  ? -3.740  -0.808  10.576  1.00 0.00 ? 46  GLN A CG   7  
ATOM 11330 C CD   . GLN A 1 46  ? -2.341  -0.776  11.164  1.00 0.00 ? 46  GLN A CD   7  
ATOM 11331 O OE1  . GLN A 1 46  ? -1.911  -1.723  11.823  1.00 0.00 ? 46  GLN A OE1  7  
ATOM 11332 N NE2  . GLN A 1 46  ? -1.624  0.317   10.930  1.00 0.00 ? 46  GLN A NE2  7  
ATOM 11333 H H    . GLN A 1 46  ? -2.341  -0.870  7.135   1.00 0.00 ? 46  GLN A H    7  
ATOM 11334 H HA   . GLN A 1 46  ? -4.260  -2.308  8.613   1.00 0.00 ? 46  GLN A HA   7  
ATOM 11335 H HB2  . GLN A 1 46  ? -2.814  0.118   8.906   1.00 0.00 ? 46  GLN A HB2  7  
ATOM 11336 H HB3  . GLN A 1 46  ? -4.518  0.509   9.104   1.00 0.00 ? 46  GLN A HB3  7  
ATOM 11337 H HG2  . GLN A 1 46  ? -4.386  -0.198  11.192  1.00 0.00 ? 46  GLN A HG2  7  
ATOM 11338 H HG3  . GLN A 1 46  ? -4.094  -1.827  10.584  1.00 0.00 ? 46  GLN A HG3  7  
ATOM 11339 H HE21 . GLN A 1 46  ? -2.029  1.032   10.398  1.00 0.00 ? 46  GLN A HE21 7  
ATOM 11340 H HE22 . GLN A 1 46  ? -0.717  0.362   11.300  1.00 0.00 ? 46  GLN A HE22 7  
ATOM 11341 N N    . PHE A 1 47  ? -5.334  -0.385  6.265   1.00 0.00 ? 47  PHE A N    7  
ATOM 11342 C CA   . PHE A 1 47  ? -6.486  0.031   5.482   1.00 0.00 ? 47  PHE A CA   7  
ATOM 11343 C C    . PHE A 1 47  ? -6.613  -0.815  4.217   1.00 0.00 ? 47  PHE A C    7  
ATOM 11344 O O    . PHE A 1 47  ? -7.017  -0.323  3.165   1.00 0.00 ? 47  PHE A O    7  
ATOM 11345 C CB   . PHE A 1 47  ? -6.369  1.514   5.112   1.00 0.00 ? 47  PHE A CB   7  
ATOM 11346 C CG   . PHE A 1 47  ? -5.327  2.265   5.899   1.00 0.00 ? 47  PHE A CG   7  
ATOM 11347 C CD1  . PHE A 1 47  ? -5.427  2.381   7.277   1.00 0.00 ? 47  PHE A CD1  7  
ATOM 11348 C CD2  . PHE A 1 47  ? -4.249  2.853   5.259   1.00 0.00 ? 47  PHE A CD2  7  
ATOM 11349 C CE1  . PHE A 1 47  ? -4.471  3.071   8.001   1.00 0.00 ? 47  PHE A CE1  7  
ATOM 11350 C CE2  . PHE A 1 47  ? -3.290  3.543   5.975   1.00 0.00 ? 47  PHE A CE2  7  
ATOM 11351 C CZ   . PHE A 1 47  ? -3.400  3.651   7.348   1.00 0.00 ? 47  PHE A CZ   7  
ATOM 11352 H H    . PHE A 1 47  ? -4.435  -0.193  5.924   1.00 0.00 ? 47  PHE A H    7  
ATOM 11353 H HA   . PHE A 1 47  ? -7.369  -0.111  6.085   1.00 0.00 ? 47  PHE A HA   7  
ATOM 11354 H HB2  . PHE A 1 47  ? -6.109  1.594   4.068   1.00 0.00 ? 47  PHE A HB2  7  
ATOM 11355 H HB3  . PHE A 1 47  ? -7.322  1.995   5.278   1.00 0.00 ? 47  PHE A HB3  7  
ATOM 11356 H HD1  . PHE A 1 47  ? -6.263  1.928   7.787   1.00 0.00 ? 47  PHE A HD1  7  
ATOM 11357 H HD2  . PHE A 1 47  ? -4.162  2.769   4.186   1.00 0.00 ? 47  PHE A HD2  7  
ATOM 11358 H HE1  . PHE A 1 47  ? -4.559  3.153   9.073   1.00 0.00 ? 47  PHE A HE1  7  
ATOM 11359 H HE2  . PHE A 1 47  ? -2.453  3.996   5.463   1.00 0.00 ? 47  PHE A HE2  7  
ATOM 11360 H HZ   . PHE A 1 47  ? -2.652  4.190   7.911   1.00 0.00 ? 47  PHE A HZ   7  
ATOM 11361 N N    . PHE A 1 48  ? -6.270  -2.095  4.339   1.00 0.00 ? 48  PHE A N    7  
ATOM 11362 C CA   . PHE A 1 48  ? -6.345  -3.029  3.219   1.00 0.00 ? 48  PHE A CA   7  
ATOM 11363 C C    . PHE A 1 48  ? -6.694  -4.431  3.718   1.00 0.00 ? 48  PHE A C    7  
ATOM 11364 O O    . PHE A 1 48  ? -6.223  -4.851  4.774   1.00 0.00 ? 48  PHE A O    7  
ATOM 11365 C CB   . PHE A 1 48  ? -5.021  -3.066  2.446   1.00 0.00 ? 48  PHE A CB   7  
ATOM 11366 C CG   . PHE A 1 48  ? -4.618  -1.740  1.857   1.00 0.00 ? 48  PHE A CG   7  
ATOM 11367 C CD1  . PHE A 1 48  ? -5.395  -1.128  0.890   1.00 0.00 ? 48  PHE A CD1  7  
ATOM 11368 C CD2  . PHE A 1 48  ? -3.460  -1.108  2.270   1.00 0.00 ? 48  PHE A CD2  7  
ATOM 11369 C CE1  . PHE A 1 48  ? -5.029  0.089   0.350   1.00 0.00 ? 48  PHE A CE1  7  
ATOM 11370 C CE2  . PHE A 1 48  ? -3.085  0.109   1.733   1.00 0.00 ? 48  PHE A CE2  7  
ATOM 11371 C CZ   . PHE A 1 48  ? -3.872  0.708   0.772   1.00 0.00 ? 48  PHE A CZ   7  
ATOM 11372 H H    . PHE A 1 48  ? -5.962  -2.421  5.209   1.00 0.00 ? 48  PHE A H    7  
ATOM 11373 H HA   . PHE A 1 48  ? -7.126  -2.693  2.556   1.00 0.00 ? 48  PHE A HA   7  
ATOM 11374 H HB2  . PHE A 1 48  ? -4.233  -3.382  3.113   1.00 0.00 ? 48  PHE A HB2  7  
ATOM 11375 H HB3  . PHE A 1 48  ? -5.103  -3.778  1.635   1.00 0.00 ? 48  PHE A HB3  7  
ATOM 11376 H HD1  . PHE A 1 48  ? -6.301  -1.609  0.561   1.00 0.00 ? 48  PHE A HD1  7  
ATOM 11377 H HD2  . PHE A 1 48  ? -2.843  -1.576  3.024   1.00 0.00 ? 48  PHE A HD2  7  
ATOM 11378 H HE1  . PHE A 1 48  ? -5.648  0.553   -0.405  1.00 0.00 ? 48  PHE A HE1  7  
ATOM 11379 H HE2  . PHE A 1 48  ? -2.178  0.589   2.066   1.00 0.00 ? 48  PHE A HE2  7  
ATOM 11380 H HZ   . PHE A 1 48  ? -3.581  1.659   0.350   1.00 0.00 ? 48  PHE A HZ   7  
ATOM 11381 N N    . LEU A 1 49  ? -7.515  -5.142  2.942   1.00 0.00 ? 49  LEU A N    7  
ATOM 11382 C CA   . LEU A 1 49  ? -7.942  -6.508  3.275   1.00 0.00 ? 49  LEU A CA   7  
ATOM 11383 C C    . LEU A 1 49  ? -8.312  -6.656  4.752   1.00 0.00 ? 49  LEU A C    7  
ATOM 11384 O O    . LEU A 1 49  ? -9.476  -6.509  5.124   1.00 0.00 ? 49  LEU A O    7  
ATOM 11385 C CB   . LEU A 1 49  ? -6.855  -7.524  2.897   1.00 0.00 ? 49  LEU A CB   7  
ATOM 11386 C CG   . LEU A 1 49  ? -5.625  -6.945  2.192   1.00 0.00 ? 49  LEU A CG   7  
ATOM 11387 C CD1  . LEU A 1 49  ? -4.504  -6.691  3.190   1.00 0.00 ? 49  LEU A CD1  7  
ATOM 11388 C CD2  . LEU A 1 49  ? -5.148  -7.880  1.094   1.00 0.00 ? 49  LEU A CD2  7  
ATOM 11389 H H    . LEU A 1 49  ? -7.843  -4.738  2.115   1.00 0.00 ? 49  LEU A H    7  
ATOM 11390 H HA   . LEU A 1 49  ? -8.822  -6.718  2.685   1.00 0.00 ? 49  LEU A HA   7  
ATOM 11391 H HB2  . LEU A 1 49  ? -6.528  -8.016  3.798   1.00 0.00 ? 49  LEU A HB2  7  
ATOM 11392 H HB3  . LEU A 1 49  ? -7.297  -8.263  2.246   1.00 0.00 ? 49  LEU A HB3  7  
ATOM 11393 H HG   . LEU A 1 49  ? -5.890  -6.003  1.736   1.00 0.00 ? 49  LEU A HG   7  
ATOM 11394 H HD11 . LEU A 1 49  ? -4.656  -7.302  4.066   1.00 0.00 ? 49  LEU A HD11 7  
ATOM 11395 H HD12 . LEU A 1 49  ? -4.506  -5.650  3.472   1.00 0.00 ? 49  LEU A HD12 7  
ATOM 11396 H HD13 . LEU A 1 49  ? -3.555  -6.940  2.737   1.00 0.00 ? 49  LEU A HD13 7  
ATOM 11397 H HD21 . LEU A 1 49  ? -4.069  -7.850  1.044   1.00 0.00 ? 49  LEU A HD21 7  
ATOM 11398 H HD22 . LEU A 1 49  ? -5.563  -7.563  0.149   1.00 0.00 ? 49  LEU A HD22 7  
ATOM 11399 H HD23 . LEU A 1 49  ? -5.472  -8.887  1.311   1.00 0.00 ? 49  LEU A HD23 7  
ATOM 11400 N N    . ARG A 1 50  ? -7.320  -6.953  5.586   1.00 0.00 ? 50  ARG A N    7  
ATOM 11401 C CA   . ARG A 1 50  ? -7.542  -7.122  7.019   1.00 0.00 ? 50  ARG A CA   7  
ATOM 11402 C C    . ARG A 1 50  ? -6.420  -6.466  7.816   1.00 0.00 ? 50  ARG A C    7  
ATOM 11403 O O    . ARG A 1 50  ? -5.242  -6.749  7.598   1.00 0.00 ? 50  ARG A O    7  
ATOM 11404 C CB   . ARG A 1 50  ? -7.645  -8.609  7.370   1.00 0.00 ? 50  ARG A CB   7  
ATOM 11405 C CG   . ARG A 1 50  ? -7.645  -8.890  8.866   1.00 0.00 ? 50  ARG A CG   7  
ATOM 11406 C CD   . ARG A 1 50  ? -9.030  -8.714  9.468   1.00 0.00 ? 50  ARG A CD   7  
ATOM 11407 N NE   . ARG A 1 50  ? -9.519  -9.947  10.083  1.00 0.00 ? 50  ARG A NE   7  
ATOM 11408 C CZ   . ARG A 1 50  ? -10.788 -10.146 10.432  1.00 0.00 ? 50  ARG A CZ   7  
ATOM 11409 N NH1  . ARG A 1 50  ? -11.693 -9.197  10.235  1.00 0.00 ? 50  ARG A NH1  7  
ATOM 11410 N NH2  . ARG A 1 50  ? -11.150 -11.298 10.983  1.00 0.00 ? 50  ARG A NH2  7  
ATOM 11411 H H    . ARG A 1 50  ? -6.414  -7.062  5.229   1.00 0.00 ? 50  ARG A H    7  
ATOM 11412 H HA   . ARG A 1 50  ? -8.476  -6.637  7.267   1.00 0.00 ? 50  ARG A HA   7  
ATOM 11413 H HB2  . ARG A 1 50  ? -8.561  -9.003  6.955   1.00 0.00 ? 50  ARG A HB2  7  
ATOM 11414 H HB3  . ARG A 1 50  ? -6.809  -9.130  6.929   1.00 0.00 ? 50  ARG A HB3  7  
ATOM 11415 H HG2  . ARG A 1 50  ? -7.317  -9.905  9.031   1.00 0.00 ? 50  ARG A HG2  7  
ATOM 11416 H HG3  . ARG A 1 50  ? -6.962  -8.206  9.350   1.00 0.00 ? 50  ARG A HG3  7  
ATOM 11417 H HD2  . ARG A 1 50  ? -8.986  -7.942  10.221  1.00 0.00 ? 50  ARG A HD2  7  
ATOM 11418 H HD3  . ARG A 1 50  ? -9.713  -8.417  8.687   1.00 0.00 ? 50  ARG A HD3  7  
ATOM 11419 H HE   . ARG A 1 50  ? -8.869  -10.663 10.244  1.00 0.00 ? 50  ARG A HE   7  
ATOM 11420 H HH11 . ARG A 1 50  ? -11.423 -8.326  9.823   1.00 0.00 ? 50  ARG A HH11 7  
ATOM 11421 H HH12 . ARG A 1 50  ? -12.645 -9.351  10.498  1.00 0.00 ? 50  ARG A HH12 7  
ATOM 11422 H HH21 . ARG A 1 50  ? -10.472 -12.015 11.135  1.00 0.00 ? 50  ARG A HH21 7  
ATOM 11423 H HH22 . ARG A 1 50  ? -12.105 -11.448 11.245  1.00 0.00 ? 50  ARG A HH22 7  
ATOM 11424 N N    . SER A 1 51  ? -6.794  -5.578  8.733   1.00 0.00 ? 51  SER A N    7  
ATOM 11425 C CA   . SER A 1 51  ? -5.823  -4.865  9.555   1.00 0.00 ? 51  SER A CA   7  
ATOM 11426 C C    . SER A 1 51  ? -5.481  -5.638  10.826  1.00 0.00 ? 51  SER A C    7  
ATOM 11427 O O    . SER A 1 51  ? -4.628  -5.213  11.606  1.00 0.00 ? 51  SER A O    7  
ATOM 11428 C CB   . SER A 1 51  ? -6.361  -3.485  9.928   1.00 0.00 ? 51  SER A CB   7  
ATOM 11429 O OG   . SER A 1 51  ? -7.673  -3.575  10.459  1.00 0.00 ? 51  SER A OG   7  
ATOM 11430 H H    . SER A 1 51  ? -7.749  -5.389  8.851   1.00 0.00 ? 51  SER A H    7  
ATOM 11431 H HA   . SER A 1 51  ? -4.924  -4.741  8.972   1.00 0.00 ? 51  SER A HA   7  
ATOM 11432 H HB2  . SER A 1 51  ? -5.717  -3.038  10.670  1.00 0.00 ? 51  SER A HB2  7  
ATOM 11433 H HB3  . SER A 1 51  ? -6.384  -2.862  9.048   1.00 0.00 ? 51  SER A HB3  7  
ATOM 11434 H HG   . SER A 1 51  ? -7.638  -3.489  11.415  1.00 0.00 ? 51  SER A HG   7  
ATOM 11435 N N    . ASP A 1 52  ? -6.158  -6.761  11.041  1.00 0.00 ? 52  ASP A N    7  
ATOM 11436 C CA   . ASP A 1 52  ? -5.924  -7.564  12.234  1.00 0.00 ? 52  ASP A CA   7  
ATOM 11437 C C    . ASP A 1 52  ? -4.863  -8.638  12.002  1.00 0.00 ? 52  ASP A C    7  
ATOM 11438 O O    . ASP A 1 52  ? -3.757  -8.555  12.538  1.00 0.00 ? 52  ASP A O    7  
ATOM 11439 C CB   . ASP A 1 52  ? -7.231  -8.217  12.689  1.00 0.00 ? 52  ASP A CB   7  
ATOM 11440 C CG   . ASP A 1 52  ? -7.953  -7.391  13.735  1.00 0.00 ? 52  ASP A CG   7  
ATOM 11441 O OD1  . ASP A 1 52  ? -7.608  -7.512  14.930  1.00 0.00 ? 52  ASP A OD1  7  
ATOM 11442 O OD2  . ASP A 1 52  ? -8.866  -6.625  13.360  1.00 0.00 ? 52  ASP A OD2  7  
ATOM 11443 H H    . ASP A 1 52  ? -6.835  -7.045  10.393  1.00 0.00 ? 52  ASP A H    7  
ATOM 11444 H HA   . ASP A 1 52  ? -5.578  -6.901  13.013  1.00 0.00 ? 52  ASP A HA   7  
ATOM 11445 H HB2  . ASP A 1 52  ? -7.884  -8.333  11.837  1.00 0.00 ? 52  ASP A HB2  7  
ATOM 11446 H HB3  . ASP A 1 52  ? -7.017  -9.189  13.108  1.00 0.00 ? 52  ASP A HB3  7  
ATOM 11447 N N    . SER A 1 53  ? -5.210  -9.655  11.220  1.00 0.00 ? 53  SER A N    7  
ATOM 11448 C CA   . SER A 1 53  ? -4.291  -10.756 10.944  1.00 0.00 ? 53  SER A CA   7  
ATOM 11449 C C    . SER A 1 53  ? -3.484  -10.532 9.666   1.00 0.00 ? 53  SER A C    7  
ATOM 11450 O O    . SER A 1 53  ? -2.253  -10.494 9.702   1.00 0.00 ? 53  SER A O    7  
ATOM 11451 C CB   . SER A 1 53  ? -5.065  -12.071 10.842  1.00 0.00 ? 53  SER A CB   7  
ATOM 11452 O OG   . SER A 1 53  ? -6.107  -11.979 9.886   1.00 0.00 ? 53  SER A OG   7  
ATOM 11453 H H    . SER A 1 53  ? -6.111  -9.676  10.834  1.00 0.00 ? 53  SER A H    7  
ATOM 11454 H HA   . SER A 1 53  ? -3.606  -10.824 11.774  1.00 0.00 ? 53  SER A HA   7  
ATOM 11455 H HB2  . SER A 1 53  ? -4.389  -12.861 10.546  1.00 0.00 ? 53  SER A HB2  7  
ATOM 11456 H HB3  . SER A 1 53  ? -5.493  -12.308 11.804  1.00 0.00 ? 53  SER A HB3  7  
ATOM 11457 H HG   . SER A 1 53  ? -5.935  -12.590 9.165   1.00 0.00 ? 53  SER A HG   7  
ATOM 11458 N N    . ASP A 1 54  ? -4.184  -10.417 8.540   1.00 0.00 ? 54  ASP A N    7  
ATOM 11459 C CA   . ASP A 1 54  ? -3.544  -10.231 7.235   1.00 0.00 ? 54  ASP A CA   7  
ATOM 11460 C C    . ASP A 1 54  ? -2.434  -9.184  7.267   1.00 0.00 ? 54  ASP A C    7  
ATOM 11461 O O    . ASP A 1 54  ? -1.523  -9.219  6.440   1.00 0.00 ? 54  ASP A O    7  
ATOM 11462 C CB   . ASP A 1 54  ? -4.587  -9.846  6.185   1.00 0.00 ? 54  ASP A CB   7  
ATOM 11463 C CG   . ASP A 1 54  ? -4.936  -10.997 5.263   1.00 0.00 ? 54  ASP A CG   7  
ATOM 11464 O OD1  . ASP A 1 54  ? -4.389  -12.103 5.458   1.00 0.00 ? 54  ASP A OD1  7  
ATOM 11465 O OD2  . ASP A 1 54  ? -5.757  -10.794 4.345   1.00 0.00 ? 54  ASP A OD2  7  
ATOM 11466 H H    . ASP A 1 54  ? -5.161  -10.479 8.582   1.00 0.00 ? 54  ASP A H    7  
ATOM 11467 H HA   . ASP A 1 54  ? -3.109  -11.177 6.953   1.00 0.00 ? 54  ASP A HA   7  
ATOM 11468 H HB2  . ASP A 1 54  ? -5.488  -9.525  6.686   1.00 0.00 ? 54  ASP A HB2  7  
ATOM 11469 H HB3  . ASP A 1 54  ? -4.203  -9.033  5.588   1.00 0.00 ? 54  ASP A HB3  7  
ATOM 11470 N N    . VAL A 1 55  ? -2.507  -8.252  8.207   1.00 0.00 ? 55  VAL A N    7  
ATOM 11471 C CA   . VAL A 1 55  ? -1.497  -7.209  8.316   1.00 0.00 ? 55  VAL A CA   7  
ATOM 11472 C C    . VAL A 1 55  ? -0.135  -7.790  8.699   1.00 0.00 ? 55  VAL A C    7  
ATOM 11473 O O    . VAL A 1 55  ? 0.878   -7.497  8.065   1.00 0.00 ? 55  VAL A O    7  
ATOM 11474 C CB   . VAL A 1 55  ? -1.914  -6.138  9.350   1.00 0.00 ? 55  VAL A CB   7  
ATOM 11475 C CG1  . VAL A 1 55  ? -0.729  -5.693  10.200  1.00 0.00 ? 55  VAL A CG1  7  
ATOM 11476 C CG2  . VAL A 1 55  ? -2.547  -4.948  8.649   1.00 0.00 ? 55  VAL A CG2  7  
ATOM 11477 H H    . VAL A 1 55  ? -3.256  -8.266  8.838   1.00 0.00 ? 55  VAL A H    7  
ATOM 11478 H HA   . VAL A 1 55  ? -1.412  -6.730  7.352   1.00 0.00 ? 55  VAL A HA   7  
ATOM 11479 H HB   . VAL A 1 55  ? -2.654  -6.571  10.007  1.00 0.00 ? 55  VAL A HB   7  
ATOM 11480 H HG11 . VAL A 1 55  ? -0.066  -5.085  9.603   1.00 0.00 ? 55  VAL A HG11 7  
ATOM 11481 H HG12 . VAL A 1 55  ? -0.197  -6.565  10.555  1.00 0.00 ? 55  VAL A HG12 7  
ATOM 11482 H HG13 . VAL A 1 55  ? -1.085  -5.118  11.042  1.00 0.00 ? 55  VAL A HG13 7  
ATOM 11483 H HG21 . VAL A 1 55  ? -3.364  -5.289  8.031   1.00 0.00 ? 55  VAL A HG21 7  
ATOM 11484 H HG22 . VAL A 1 55  ? -1.807  -4.461  8.030   1.00 0.00 ? 55  VAL A HG22 7  
ATOM 11485 H HG23 . VAL A 1 55  ? -2.917  -4.251  9.385   1.00 0.00 ? 55  VAL A HG23 7  
ATOM 11486 N N    . VAL A 1 56  ? -0.122  -8.600  9.750   1.00 0.00 ? 56  VAL A N    7  
ATOM 11487 C CA   . VAL A 1 56  ? 1.110   -9.209  10.241  1.00 0.00 ? 56  VAL A CA   7  
ATOM 11488 C C    . VAL A 1 56  ? 1.701   -10.195 9.237   1.00 0.00 ? 56  VAL A C    7  
ATOM 11489 O O    . VAL A 1 56  ? 2.889   -10.517 9.298   1.00 0.00 ? 56  VAL A O    7  
ATOM 11490 C CB   . VAL A 1 56  ? 0.865   -9.929  11.586  1.00 0.00 ? 56  VAL A CB   7  
ATOM 11491 C CG1  . VAL A 1 56  ? 0.482   -11.388 11.370  1.00 0.00 ? 56  VAL A CG1  7  
ATOM 11492 C CG2  . VAL A 1 56  ? 2.087   -9.817  12.483  1.00 0.00 ? 56  VAL A CG2  7  
ATOM 11493 H H    . VAL A 1 56  ? -0.961  -8.781  10.221  1.00 0.00 ? 56  VAL A H    7  
ATOM 11494 H HA   . VAL A 1 56  ? 1.824   -8.416  10.413  1.00 0.00 ? 56  VAL A HA   7  
ATOM 11495 H HB   . VAL A 1 56  ? 0.039   -9.441  12.080  1.00 0.00 ? 56  VAL A HB   7  
ATOM 11496 H HG11 . VAL A 1 56  ? -0.037  -11.488 10.429  1.00 0.00 ? 56  VAL A HG11 7  
ATOM 11497 H HG12 . VAL A 1 56  ? -0.162  -11.713 12.173  1.00 0.00 ? 56  VAL A HG12 7  
ATOM 11498 H HG13 . VAL A 1 56  ? 1.375   -11.995 11.355  1.00 0.00 ? 56  VAL A HG13 7  
ATOM 11499 H HG21 . VAL A 1 56  ? 2.174   -8.804  12.847  1.00 0.00 ? 56  VAL A HG21 7  
ATOM 11500 H HG22 . VAL A 1 56  ? 2.972   -10.074 11.919  1.00 0.00 ? 56  VAL A HG22 7  
ATOM 11501 H HG23 . VAL A 1 56  ? 1.983   -10.493 13.319  1.00 0.00 ? 56  VAL A HG23 7  
ATOM 11502 N N    . GLU A 1 57  ? 0.868   -10.684 8.329   1.00 0.00 ? 57  GLU A N    7  
ATOM 11503 C CA   . GLU A 1 57  ? 1.311   -11.650 7.325   1.00 0.00 ? 57  GLU A CA   7  
ATOM 11504 C C    . GLU A 1 57  ? 1.825   -10.959 6.065   1.00 0.00 ? 57  GLU A C    7  
ATOM 11505 O O    . GLU A 1 57  ? 2.900   -11.282 5.562   1.00 0.00 ? 57  GLU A O    7  
ATOM 11506 C CB   . GLU A 1 57  ? 0.175   -12.607 6.958   1.00 0.00 ? 57  GLU A CB   7  
ATOM 11507 C CG   . GLU A 1 57  ? -1.004  -12.570 7.918   1.00 0.00 ? 57  GLU A CG   7  
ATOM 11508 C CD   . GLU A 1 57  ? -1.144  -13.851 8.715   1.00 0.00 ? 57  GLU A CD   7  
ATOM 11509 O OE1  . GLU A 1 57  ? -1.692  -14.832 8.171   1.00 0.00 ? 57  GLU A OE1  7  
ATOM 11510 O OE2  . GLU A 1 57  ? -0.705  -13.874 9.884   1.00 0.00 ? 57  GLU A OE2  7  
ATOM 11511 H H    . GLU A 1 57  ? -0.072  -10.397 8.339   1.00 0.00 ? 57  GLU A H    7  
ATOM 11512 H HA   . GLU A 1 57  ? 2.120   -12.221 7.758   1.00 0.00 ? 57  GLU A HA   7  
ATOM 11513 H HB2  . GLU A 1 57  ? -0.187  -12.354 5.973   1.00 0.00 ? 57  GLU A HB2  7  
ATOM 11514 H HB3  . GLU A 1 57  ? 0.562   -13.614 6.939   1.00 0.00 ? 57  GLU A HB3  7  
ATOM 11515 H HG2  . GLU A 1 57  ? -0.868  -11.749 8.605   1.00 0.00 ? 57  GLU A HG2  7  
ATOM 11516 H HG3  . GLU A 1 57  ? -1.907  -12.416 7.350   1.00 0.00 ? 57  GLU A HG3  7  
ATOM 11517 N N    . ALA A 1 58  ? 1.040   -10.023 5.551   1.00 0.00 ? 58  ALA A N    7  
ATOM 11518 C CA   . ALA A 1 58  ? 1.401   -9.295  4.339   1.00 0.00 ? 58  ALA A CA   7  
ATOM 11519 C C    . ALA A 1 58  ? 2.639   -8.427  4.548   1.00 0.00 ? 58  ALA A C    7  
ATOM 11520 O O    . ALA A 1 58  ? 3.520   -8.374  3.689   1.00 0.00 ? 58  ALA A O    7  
ATOM 11521 C CB   . ALA A 1 58  ? 0.232   -8.442  3.875   1.00 0.00 ? 58  ALA A CB   7  
ATOM 11522 H H    . ALA A 1 58  ? 0.193   -9.821  5.992   1.00 0.00 ? 58  ALA A H    7  
ATOM 11523 H HA   . ALA A 1 58  ? 1.611   -10.021 3.567   1.00 0.00 ? 58  ALA A HA   7  
ATOM 11524 H HB1  . ALA A 1 58  ? 0.147   -7.571  4.509   1.00 0.00 ? 58  ALA A HB1  7  
ATOM 11525 H HB2  . ALA A 1 58  ? -0.680  -9.017  3.933   1.00 0.00 ? 58  ALA A HB2  7  
ATOM 11526 H HB3  . ALA A 1 58  ? 0.397   -8.130  2.854   1.00 0.00 ? 58  ALA A HB3  7  
ATOM 11527 N N    . LEU A 1 59  ? 2.697   -7.742  5.686   1.00 0.00 ? 59  LEU A N    7  
ATOM 11528 C CA   . LEU A 1 59  ? 3.823   -6.866  6.001   1.00 0.00 ? 59  LEU A CA   7  
ATOM 11529 C C    . LEU A 1 59  ? 5.099   -7.662  6.263   1.00 0.00 ? 59  LEU A C    7  
ATOM 11530 O O    . LEU A 1 59  ? 6.162   -7.082  6.485   1.00 0.00 ? 59  LEU A O    7  
ATOM 11531 C CB   . LEU A 1 59  ? 3.495   -5.991  7.213   1.00 0.00 ? 59  LEU A CB   7  
ATOM 11532 C CG   . LEU A 1 59  ? 2.374   -4.973  6.995   1.00 0.00 ? 59  LEU A CG   7  
ATOM 11533 C CD1  . LEU A 1 59  ? 2.024   -4.278  8.301   1.00 0.00 ? 59  LEU A CD1  7  
ATOM 11534 C CD2  . LEU A 1 59  ? 2.775   -3.957  5.935   1.00 0.00 ? 59  LEU A CD2  7  
ATOM 11535 H H    . LEU A 1 59  ? 1.962   -7.817  6.329   1.00 0.00 ? 59  LEU A H    7  
ATOM 11536 H HA   . LEU A 1 59  ? 3.986   -6.226  5.147   1.00 0.00 ? 59  LEU A HA   7  
ATOM 11537 H HB2  . LEU A 1 59  ? 3.212   -6.639  8