data_1LPB
# 
_entry.id   1LPB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LPB         
WWPDB D_1000174787 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LPB 
_pdbx_database_status.recvd_initial_deposition_date   1994-08-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Egloff, M.-P.'     1 
'Van Tilbeurgh, H.' 2 
'Cambillau, C.'     3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The 2.46 A resolution structure of the pancreatic lipase-colipase complex inhibited by a C11 alkyl phosphonate.' 
Biochemistry 34  2751 2762 1995 BICHAW US 0006-2960 0033 ? 7893686 10.1021/bi00009a003 
1       'Interfacial Activation of the Lipase-Procolipase Complex by Mixed Micelles Revealed by X-Ray Crystallography'    Nature 
362 814  ?    1993 NATUAS UK 0028-0836 0006 ? ?       ?                   
2       'Structure of the Pancreatic Lipase-Procolipase Complex'                                                          Nature 
359 159  ?    1992 NATUAS UK 0028-0836 0006 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Egloff, M.P.'      1  ? 
primary 'Marguet, F.'       2  ? 
primary 'Buono, G.'         3  ? 
primary 'Verger, R.'        4  ? 
primary 'Cambillau, C.'     5  ? 
primary 'van Tilbeurgh, H.' 6  ? 
1       'Van Tilbeurgh, H.' 7  ? 
1       'Egloff, M.-P.'     8  ? 
1       'Martinez, C.'      9  ? 
1       'Rugani, N.'        10 ? 
1       'Verger, R.'        11 ? 
1       'Cambillau, C.'     12 ? 
2       'Van Tilbeurgh, H.' 13 ? 
2       'Sarda, L.'         14 ? 
2       'Verger, R.'        15 ? 
2       'Cambillau, C.'     16 ? 
# 
_cell.entry_id           1LPB 
_cell.length_a           133.700 
_cell.length_b           133.700 
_cell.length_c           93.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LPB 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man COLIPASE                        10319.651 1   ?       ? ? ? 
2 polymer     man LIPASE                          49573.562 1   3.1.1.3 ? ? ? 
3 non-polymer man 'octyl beta-D-glucopyranoside'  292.369   5   ?       ? ? ? 
4 non-polymer syn 'CALCIUM ION'                   40.078    1   ?       ? ? ? 
5 non-polymer syn 'METHOXYUNDECYLPHOSPHINIC ACID' 250.315   1   ?       ? ? ? 
6 water       nat water                           18.015    285 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT
NTNFGICHNVGRSDS
;
;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT
NTNFGICHNVGRSDS
;
A ? 
2 'polypeptide(L)' no no 
;KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFID
KGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAG
EAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKK
NILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTN
DVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVK
FIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
;
;KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFID
KGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAG
EAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKK
NILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTN
DVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVK
FIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   ASP n 
1 4   PRO n 
1 5   ARG n 
1 6   GLY n 
1 7   ILE n 
1 8   ILE n 
1 9   ILE n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  GLU n 
1 14  GLY n 
1 15  GLU n 
1 16  LEU n 
1 17  CYS n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  ALA n 
1 22  GLN n 
1 23  CYS n 
1 24  LYS n 
1 25  SER n 
1 26  ASN n 
1 27  CYS n 
1 28  CYS n 
1 29  GLN n 
1 30  HIS n 
1 31  ASP n 
1 32  THR n 
1 33  ILE n 
1 34  LEU n 
1 35  SER n 
1 36  LEU n 
1 37  SER n 
1 38  ARG n 
1 39  CYS n 
1 40  ALA n 
1 41  LEU n 
1 42  LYS n 
1 43  ALA n 
1 44  ARG n 
1 45  GLU n 
1 46  ASN n 
1 47  SER n 
1 48  GLU n 
1 49  CYS n 
1 50  SER n 
1 51  ALA n 
1 52  PHE n 
1 53  THR n 
1 54  LEU n 
1 55  TYR n 
1 56  GLY n 
1 57  VAL n 
1 58  TYR n 
1 59  TYR n 
1 60  LYS n 
1 61  CYS n 
1 62  PRO n 
1 63  CYS n 
1 64  GLU n 
1 65  ARG n 
1 66  GLY n 
1 67  LEU n 
1 68  THR n 
1 69  CYS n 
1 70  GLU n 
1 71  GLY n 
1 72  ASP n 
1 73  LYS n 
1 74  SER n 
1 75  LEU n 
1 76  VAL n 
1 77  GLY n 
1 78  SER n 
1 79  ILE n 
1 80  THR n 
1 81  ASN n 
1 82  THR n 
1 83  ASN n 
1 84  PHE n 
1 85  GLY n 
1 86  ILE n 
1 87  CYS n 
1 88  HIS n 
1 89  ASN n 
1 90  VAL n 
1 91  GLY n 
1 92  ARG n 
1 93  SER n 
1 94  ASP n 
1 95  SER n 
2 1   LYS n 
2 2   GLU n 
2 3   VAL n 
2 4   CYS n 
2 5   TYR n 
2 6   GLU n 
2 7   ARG n 
2 8   LEU n 
2 9   GLY n 
2 10  CYS n 
2 11  PHE n 
2 12  SER n 
2 13  ASP n 
2 14  ASP n 
2 15  SER n 
2 16  PRO n 
2 17  TRP n 
2 18  SER n 
2 19  GLY n 
2 20  ILE n 
2 21  THR n 
2 22  GLU n 
2 23  ARG n 
2 24  PRO n 
2 25  LEU n 
2 26  HIS n 
2 27  ILE n 
2 28  LEU n 
2 29  PRO n 
2 30  TRP n 
2 31  SER n 
2 32  PRO n 
2 33  LYS n 
2 34  ASP n 
2 35  VAL n 
2 36  ASN n 
2 37  THR n 
2 38  ARG n 
2 39  PHE n 
2 40  LEU n 
2 41  LEU n 
2 42  TYR n 
2 43  THR n 
2 44  ASN n 
2 45  GLU n 
2 46  ASN n 
2 47  PRO n 
2 48  ASN n 
2 49  ASN n 
2 50  PHE n 
2 51  GLN n 
2 52  GLU n 
2 53  VAL n 
2 54  ALA n 
2 55  ALA n 
2 56  ASP n 
2 57  SER n 
2 58  SER n 
2 59  SER n 
2 60  ILE n 
2 61  SER n 
2 62  GLY n 
2 63  SER n 
2 64  ASN n 
2 65  PHE n 
2 66  LYS n 
2 67  THR n 
2 68  ASN n 
2 69  ARG n 
2 70  LYS n 
2 71  THR n 
2 72  ARG n 
2 73  PHE n 
2 74  ILE n 
2 75  ILE n 
2 76  HIS n 
2 77  GLY n 
2 78  PHE n 
2 79  ILE n 
2 80  ASP n 
2 81  LYS n 
2 82  GLY n 
2 83  GLU n 
2 84  GLU n 
2 85  ASN n 
2 86  TRP n 
2 87  LEU n 
2 88  ALA n 
2 89  ASN n 
2 90  VAL n 
2 91  CYS n 
2 92  LYS n 
2 93  ASN n 
2 94  LEU n 
2 95  PHE n 
2 96  LYS n 
2 97  VAL n 
2 98  GLU n 
2 99  SER n 
2 100 VAL n 
2 101 ASN n 
2 102 CYS n 
2 103 ILE n 
2 104 CYS n 
2 105 VAL n 
2 106 ASP n 
2 107 TRP n 
2 108 LYS n 
2 109 GLY n 
2 110 GLY n 
2 111 SER n 
2 112 ARG n 
2 113 THR n 
2 114 GLY n 
2 115 TYR n 
2 116 THR n 
2 117 GLN n 
2 118 ALA n 
2 119 SER n 
2 120 GLN n 
2 121 ASN n 
2 122 ILE n 
2 123 ARG n 
2 124 ILE n 
2 125 VAL n 
2 126 GLY n 
2 127 ALA n 
2 128 GLU n 
2 129 VAL n 
2 130 ALA n 
2 131 TYR n 
2 132 PHE n 
2 133 VAL n 
2 134 GLU n 
2 135 PHE n 
2 136 LEU n 
2 137 GLN n 
2 138 SER n 
2 139 ALA n 
2 140 PHE n 
2 141 GLY n 
2 142 TYR n 
2 143 SER n 
2 144 PRO n 
2 145 SER n 
2 146 ASN n 
2 147 VAL n 
2 148 HIS n 
2 149 VAL n 
2 150 ILE n 
2 151 GLY n 
2 152 HIS n 
2 153 SER n 
2 154 LEU n 
2 155 GLY n 
2 156 ALA n 
2 157 HIS n 
2 158 ALA n 
2 159 ALA n 
2 160 GLY n 
2 161 GLU n 
2 162 ALA n 
2 163 GLY n 
2 164 ARG n 
2 165 ARG n 
2 166 THR n 
2 167 ASN n 
2 168 GLY n 
2 169 THR n 
2 170 ILE n 
2 171 GLY n 
2 172 ARG n 
2 173 ILE n 
2 174 THR n 
2 175 GLY n 
2 176 LEU n 
2 177 ASP n 
2 178 PRO n 
2 179 ALA n 
2 180 GLU n 
2 181 PRO n 
2 182 CYS n 
2 183 PHE n 
2 184 GLN n 
2 185 GLY n 
2 186 THR n 
2 187 PRO n 
2 188 GLU n 
2 189 LEU n 
2 190 VAL n 
2 191 ARG n 
2 192 LEU n 
2 193 ASP n 
2 194 PRO n 
2 195 SER n 
2 196 ASP n 
2 197 ALA n 
2 198 LYS n 
2 199 PHE n 
2 200 VAL n 
2 201 ASP n 
2 202 VAL n 
2 203 ILE n 
2 204 HIS n 
2 205 THR n 
2 206 ASP n 
2 207 GLY n 
2 208 ALA n 
2 209 PRO n 
2 210 ILE n 
2 211 VAL n 
2 212 PRO n 
2 213 ASN n 
2 214 LEU n 
2 215 GLY n 
2 216 PHE n 
2 217 GLY n 
2 218 MET n 
2 219 SER n 
2 220 GLN n 
2 221 VAL n 
2 222 VAL n 
2 223 GLY n 
2 224 HIS n 
2 225 LEU n 
2 226 ASP n 
2 227 PHE n 
2 228 PHE n 
2 229 PRO n 
2 230 ASN n 
2 231 GLY n 
2 232 GLY n 
2 233 VAL n 
2 234 GLU n 
2 235 MET n 
2 236 PRO n 
2 237 GLY n 
2 238 CYS n 
2 239 LYS n 
2 240 LYS n 
2 241 ASN n 
2 242 ILE n 
2 243 LEU n 
2 244 SER n 
2 245 GLN n 
2 246 ILE n 
2 247 VAL n 
2 248 ASP n 
2 249 ILE n 
2 250 ASP n 
2 251 GLY n 
2 252 ILE n 
2 253 TRP n 
2 254 GLU n 
2 255 GLY n 
2 256 THR n 
2 257 ARG n 
2 258 ASP n 
2 259 PHE n 
2 260 ALA n 
2 261 ALA n 
2 262 CYS n 
2 263 ASN n 
2 264 HIS n 
2 265 LEU n 
2 266 ARG n 
2 267 SER n 
2 268 TYR n 
2 269 LYS n 
2 270 TYR n 
2 271 TYR n 
2 272 THR n 
2 273 ASP n 
2 274 SER n 
2 275 ILE n 
2 276 VAL n 
2 277 ASN n 
2 278 PRO n 
2 279 ASP n 
2 280 GLY n 
2 281 PHE n 
2 282 ALA n 
2 283 GLY n 
2 284 PHE n 
2 285 PRO n 
2 286 CYS n 
2 287 ALA n 
2 288 SER n 
2 289 TYR n 
2 290 ASN n 
2 291 VAL n 
2 292 PHE n 
2 293 THR n 
2 294 ALA n 
2 295 ASN n 
2 296 LYS n 
2 297 CYS n 
2 298 PHE n 
2 299 PRO n 
2 300 CYS n 
2 301 PRO n 
2 302 SER n 
2 303 GLY n 
2 304 GLY n 
2 305 CYS n 
2 306 PRO n 
2 307 GLN n 
2 308 MET n 
2 309 GLY n 
2 310 HIS n 
2 311 TYR n 
2 312 ALA n 
2 313 ASP n 
2 314 ARG n 
2 315 TYR n 
2 316 PRO n 
2 317 GLY n 
2 318 LYS n 
2 319 THR n 
2 320 ASN n 
2 321 ASP n 
2 322 VAL n 
2 323 GLY n 
2 324 GLN n 
2 325 LYS n 
2 326 PHE n 
2 327 TYR n 
2 328 LEU n 
2 329 ASP n 
2 330 THR n 
2 331 GLY n 
2 332 ASP n 
2 333 ALA n 
2 334 SER n 
2 335 ASN n 
2 336 PHE n 
2 337 ALA n 
2 338 ARG n 
2 339 TRP n 
2 340 ARG n 
2 341 TYR n 
2 342 LYS n 
2 343 VAL n 
2 344 SER n 
2 345 VAL n 
2 346 THR n 
2 347 LEU n 
2 348 SER n 
2 349 GLY n 
2 350 LYS n 
2 351 LYS n 
2 352 VAL n 
2 353 THR n 
2 354 GLY n 
2 355 HIS n 
2 356 ILE n 
2 357 LEU n 
2 358 VAL n 
2 359 SER n 
2 360 LEU n 
2 361 PHE n 
2 362 GLY n 
2 363 ASN n 
2 364 LYS n 
2 365 GLY n 
2 366 ASN n 
2 367 SER n 
2 368 LYS n 
2 369 GLN n 
2 370 TYR n 
2 371 GLU n 
2 372 ILE n 
2 373 PHE n 
2 374 LYS n 
2 375 GLY n 
2 376 THR n 
2 377 LEU n 
2 378 LYS n 
2 379 PRO n 
2 380 ASP n 
2 381 SER n 
2 382 THR n 
2 383 HIS n 
2 384 SER n 
2 385 ASN n 
2 386 GLU n 
2 387 PHE n 
2 388 ASP n 
2 389 SER n 
2 390 ASP n 
2 391 VAL n 
2 392 ASP n 
2 393 VAL n 
2 394 GLY n 
2 395 ASP n 
2 396 LEU n 
2 397 GLN n 
2 398 MET n 
2 399 VAL n 
2 400 LYS n 
2 401 PHE n 
2 402 ILE n 
2 403 TRP n 
2 404 TYR n 
2 405 ASN n 
2 406 ASN n 
2 407 VAL n 
2 408 ILE n 
2 409 ASN n 
2 410 PRO n 
2 411 THR n 
2 412 LEU n 
2 413 PRO n 
2 414 ARG n 
2 415 VAL n 
2 416 GLY n 
2 417 ALA n 
2 418 SER n 
2 419 LYS n 
2 420 ILE n 
2 421 ILE n 
2 422 VAL n 
2 423 GLU n 
2 424 THR n 
2 425 ASN n 
2 426 VAL n 
2 427 GLY n 
2 428 LYS n 
2 429 GLN n 
2 430 PHE n 
2 431 ASN n 
2 432 PHE n 
2 433 CYS n 
2 434 SER n 
2 435 PRO n 
2 436 GLU n 
2 437 THR n 
2 438 VAL n 
2 439 ARG n 
2 440 GLU n 
2 441 GLU n 
2 442 VAL n 
2 443 LEU n 
2 444 LEU n 
2 445 THR n 
2 446 LEU n 
2 447 THR n 
2 448 PRO n 
2 449 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? pig   Sus  ? ? ? ? ? ? ? 'Sus scrofa'   9823 ? ? ? PANCREAS ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP COL_PIG    1 P02703 1 
;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT
NTNFGICHNVGRSDS
;
? 
2 UNP LIPP_HUMAN 2 P16233 1 
;MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSN
FKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSP
SNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGG
CPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHS
NEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LPB A 1 ? 95  ? P02703 1  ? 95  ? 1 95  
2 2 1LPB B 1 ? 449 ? P16233 17 ? 465 ? 1 449 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
BOG D-saccharide        n 'octyl beta-D-glucopyranoside'  ? 'C14 H28 O6'     292.369 
CA  non-polymer         . 'CALCIUM ION'                   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MUP non-polymer         . 'METHOXYUNDECYLPHOSPHINIC ACID' ? 'C12 H27 O3 P'   250.315 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LPB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.48 
_exptl_crystal.density_percent_sol   64.65 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1LPB 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.46 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5060 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         199 
_refine_hist.number_atoms_solvent             855 
_refine_hist.number_atoms_total               6114 
_refine_hist.d_res_high                       2.46 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.96  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LPB 
_struct.title                     
'THE 2.46 ANGSTROMS RESOLUTION STRUCTURE OF THE PANCREATIC LIPASE COLIPASE COMPLEX INHIBITED BY A C11 ALKYL PHOSPHONATE' 
_struct.pdbx_descriptor           
'LIPASE (E.C.3.1.1.3) COMPLEXED WITH COLIPASE AND INHIBITED BY UNDECANE PHOSPHONATE METHYL ESTER (TWO CONFORMATIONS)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LPB 
_struct_keywords.pdbx_keywords   'HYDROLASE(CARBOXYLIC ESTERASE)' 
_struct_keywords.text            'HYDROLASE(CARBOXYLIC ESTERASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A ASP A 31  ? LEU A 34  ? ASP A 31  LEU A 34  1 ?                            4  
HELX_P HELX_P2 B GLY A 56  ? CYS A 61  ? GLY A 56  CYS A 61  1 ?                            6  
HELX_P HELX_P3 J LEU A 75  ? THR A 80  ? LEU A 75  THR A 80  1 ?                            6  
HELX_P HELX_P4 D LYS B 108 ? SER B 111 ? LYS B 107 SER B 110 1 ?                            4  
HELX_P HELX_P5 E TYR B 115 ? PHE B 140 ? TYR B 114 PHE B 139 1 ?                            26 
HELX_P HELX_P6 F LEU B 154 ? ARG B 164 ? LEU B 153 ARG B 163 1 ?                            11 
HELX_P HELX_P7 G ILE B 242 ? ILE B 246 ? ILE B 241 ILE B 245 1 'THE TWO HELICES OF THE LID' 5  
HELX_P HELX_P8 H ILE B 252 ? ILE B 275 ? ILE B 251 ILE B 274 1 ?                            24 
HELX_P HELX_P9 I TYR B 289 ? THR B 293 ? TYR B 288 THR B 292 1 ?                            5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 17  SG  ? ? ? 1_555 A CYS 28  SG ? ? A CYS 17  A CYS 28   1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf2  disulf ?   ? A CYS 23  SG  ? ? ? 1_555 A CYS 39  SG ? ? A CYS 23  A CYS 39   1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf3  disulf ?   ? A CYS 27  SG  ? ? ? 1_555 A CYS 61  SG ? ? A CYS 27  A CYS 61   1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf4  disulf ?   ? A CYS 49  SG  ? ? ? 1_555 A CYS 69  SG ? ? A CYS 49  A CYS 69   1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf5  disulf ?   ? A CYS 63  SG  ? ? ? 1_555 A CYS 87  SG ? ? A CYS 63  A CYS 87   1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf6  disulf ?   ? B CYS 4   SG  ? ? ? 1_555 B CYS 10  SG ? ? B CYS 4   B CYS 10   1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf7  disulf ?   ? B CYS 91  SG  ? ? ? 1_555 B CYS 102 SG ? ? B CYS 90  B CYS 101  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf8  disulf ?   ? B CYS 238 SG  ? ? ? 1_555 B CYS 262 SG ? ? B CYS 237 B CYS 261  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf9  disulf ?   ? B CYS 286 SG  ? ? ? 1_555 B CYS 297 SG ? ? B CYS 285 B CYS 296  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf10 disulf ?   ? B CYS 300 SG  ? ? ? 1_555 B CYS 305 SG ? ? B CYS 299 B CYS 304  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf11 disulf ?   ? B CYS 433 SG  ? ? ? 1_555 B CYS 449 SG ? ? B CYS 433 B CYS 449  1_555 ? ? ? ? ? ? ? 2.007 ? ? 
covale1  covale one ? B SER 153 OG  ? ? ? 1_555 I MUP .   P  A ? B SER 152 B MUP 901  1_555 ? ? ? ? ? ? ? 1.603 ? ? 
covale2  covale one ? B SER 153 OG  ? ? ? 1_555 I MUP .   P  B ? B SER 152 B MUP 901  1_555 ? ? ? ? ? ? ? 1.652 ? ? 
metalc1  metalc ?   ? B GLU 188 O   ? ? ? 1_555 H CA  .   CA ? ? B GLU 187 B CA  453  1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc2  metalc ?   ? B ARG 191 O   ? ? ? 1_555 H CA  .   CA ? ? B ARG 190 B CA  453  1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc3  metalc ?   ? B ASP 193 OD1 ? ? ? 1_555 H CA  .   CA ? ? B ASP 192 B CA  453  1_555 ? ? ? ? ? ? ? 2.256 ? ? 
metalc4  metalc ?   ? B ASP 196 OD1 ? ? ? 1_555 H CA  .   CA ? ? B ASP 195 B CA  453  1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc5  metalc ?   ? B ASP 196 OD2 ? ? ? 1_555 H CA  .   CA ? ? B ASP 195 B CA  453  1_555 ? ? ? ? ? ? ? 2.544 ? ? 
metalc6  metalc ?   ? H CA  .   CA  ? ? ? 1_555 K HOH .   O  ? ? B CA  453 B HOH 989  1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc7  metalc ?   ? H CA  .   CA  ? ? ? 1_555 K HOH .   O  ? ? B CA  453 B HOH 1072 1_555 ? ? ? ? ? ? ? 2.232 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 15  B . ? SER 15  B PRO 16  B ? PRO 16  B 1 0.64 
2 VAL 211 B . ? VAL 210 B PRO 212 B ? PRO 211 B 1 0.48 
3 PHE 298 B . ? PHE 297 B PRO 299 B ? PRO 298 B 1 0.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
SA ? 2 ? 
SB ? 9 ? 
SC ? 4 ? 
SD ? 4 ? 
SE ? 1 ? 
SF ? 1 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
SA 1 2 ? anti-parallel 
SB 1 2 ? anti-parallel 
SB 2 3 ? anti-parallel 
SB 3 4 ? parallel      
SB 4 5 ? parallel      
SB 5 6 ? parallel      
SB 6 7 ? parallel      
SB 7 8 ? parallel      
SB 8 9 ? parallel      
SC 1 2 ? anti-parallel 
SC 2 3 ? anti-parallel 
SC 3 4 ? anti-parallel 
SD 1 2 ? anti-parallel 
SD 2 3 ? anti-parallel 
SD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
SA 1 GLU B 2   ? TYR B 5   ? GLU B 2   TYR B 5   
SA 2 ILE A 9   ? ASP A 12  ? ILE A 9   ASP A 12  
SB 1 SER A 37  ? LEU A 41  ? SER A 37  LEU A 41  
SB 2 SER A 50  ? PHE A 52  ? SER A 50  PHE A 52  
SB 3 GLU A 70  ? SER A 74  ? GLU A 70  SER A 74  
SB 4 ASN B 101 ? ASP B 106 ? ASN B 100 ASP B 105 
SB 5 VAL B 147 ? HIS B 152 ? VAL B 146 HIS B 151 
SB 6 ARG B 172 ? LEU B 176 ? ARG B 171 LEU B 175 
SB 7 VAL B 200 ? ILE B 203 ? VAL B 199 ILE B 202 
SB 8 LEU B 225 ? PRO B 229 ? LEU B 224 PRO B 228 
SB 9 GLN B 324 ? LEU B 328 ? GLN B 323 LEU B 327 
SC 1 TRP B 339 ? GLY B 349 ? TRP B 338 GLY B 348 
SC 2 THR B 382 ? SER B 389 ? THR B 381 SER B 388 
SC 3 VAL B 415 ? THR B 424 ? VAL B 415 THR B 424 
SC 4 GLN B 429 ? CYS B 433 ? GLN B 429 CYS B 433 
SD 1 VAL B 352 ? GLY B 362 ? VAL B 351 GLY B 361 
SD 2 TYR B 370 ? LEU B 377 ? TYR B 369 LEU B 376 
SD 3 LEU B 396 ? TYR B 404 ? LEU B 395 TYR B 403 
SD 4 LEU B 444 ? PRO B 448 ? LEU B 444 PRO B 448 
SE 1 LEU A 67  ? GLU A 70  ? LEU A 67  GLU A 70  
SF 1 PHE A 84  ? ASN A 89  ? PHE A 84  ASN A 89  
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              ? 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER B 153 ? SER B 152 . ? 1_555 ? 
2 CAT 3 ASP B 177 ? ASP B 176 . ? 1_555 ? 
3 CAT 3 HIS B 264 ? HIS B 263 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LPB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LPB 
_atom_sites.fract_transf_matrix[1][1]   0.007479 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007479 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010718 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO B    16' 
2 'CIS PROLINE - PRO B   211' 
3 'CIS PROLINE - PRO B   298' 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 6   ? -1.258  3.012  32.603 1.00 65.70 ? 6    GLY A N     1 
ATOM   2    C  CA    . GLY A 1 6   ? -1.461  1.603  32.125 1.00 68.62 ? 6    GLY A CA    1 
ATOM   3    C  C     . GLY A 1 6   ? -2.350  0.941  33.147 1.00 68.79 ? 6    GLY A C     1 
ATOM   4    O  O     . GLY A 1 6   ? -2.220  1.277  34.317 1.00 72.58 ? 6    GLY A O     1 
ATOM   5    N  N     . ILE A 1 7   ? -3.214  0.012  32.737 1.00 67.28 ? 7    ILE A N     1 
ATOM   6    C  CA    . ILE A 1 7   ? -4.145  -0.647 33.662 1.00 67.89 ? 7    ILE A CA    1 
ATOM   7    C  C     . ILE A 1 7   ? -4.565  0.270  34.823 1.00 65.55 ? 7    ILE A C     1 
ATOM   8    O  O     . ILE A 1 7   ? -4.052  0.201  35.943 1.00 64.53 ? 7    ILE A O     1 
ATOM   9    C  CB    . ILE A 1 7   ? -3.626  -2.027 34.178 1.00 71.24 ? 7    ILE A CB    1 
ATOM   10   C  CG1   . ILE A 1 7   ? -4.598  -2.608 35.231 1.00 74.16 ? 7    ILE A CG1   1 
ATOM   11   C  CG2   . ILE A 1 7   ? -2.202  -1.908 34.747 1.00 71.29 ? 7    ILE A CG2   1 
ATOM   12   C  CD1   . ILE A 1 7   ? -6.078  -2.757 34.783 1.00 74.14 ? 7    ILE A CD1   1 
ATOM   13   H  H     . ILE A 1 7   ? -3.239  -0.259 31.796 1.00 0.00  ? 7    ILE A H     1 
ATOM   14   N  N     . ILE A 1 8   ? -5.409  1.223  34.473 1.00 61.89 ? 8    ILE A N     1 
ATOM   15   C  CA    . ILE A 1 8   ? -5.940  2.196  35.406 1.00 60.01 ? 8    ILE A CA    1 
ATOM   16   C  C     . ILE A 1 8   ? -6.906  2.993  34.526 1.00 58.03 ? 8    ILE A C     1 
ATOM   17   O  O     . ILE A 1 8   ? -6.555  3.479  33.440 1.00 56.33 ? 8    ILE A O     1 
ATOM   18   C  CB    . ILE A 1 8   ? -4.812  3.028  36.101 1.00 60.43 ? 8    ILE A CB    1 
ATOM   19   C  CG1   . ILE A 1 8   ? -5.405  4.009  37.119 1.00 61.24 ? 8    ILE A CG1   1 
ATOM   20   C  CG2   . ILE A 1 8   ? -3.908  3.692  35.080 1.00 62.91 ? 8    ILE A CG2   1 
ATOM   21   C  CD1   . ILE A 1 8   ? -4.378  4.605  38.076 1.00 61.96 ? 8    ILE A CD1   1 
ATOM   22   H  H     . ILE A 1 8   ? -5.699  1.280  33.542 1.00 0.00  ? 8    ILE A H     1 
ATOM   23   N  N     . ILE A 1 9   ? -8.166  2.881  34.926 1.00 55.95 ? 9    ILE A N     1 
ATOM   24   C  CA    . ILE A 1 9   ? -9.325  3.444  34.252 1.00 51.57 ? 9    ILE A CA    1 
ATOM   25   C  C     . ILE A 1 9   ? -9.733  4.805  34.839 1.00 47.72 ? 9    ILE A C     1 
ATOM   26   O  O     . ILE A 1 9   ? -9.176  5.235  35.843 1.00 43.40 ? 9    ILE A O     1 
ATOM   27   C  CB    . ILE A 1 9   ? -10.493 2.374  34.366 1.00 51.42 ? 9    ILE A CB    1 
ATOM   28   C  CG1   . ILE A 1 9   ? -11.305 2.299  33.077 1.00 50.84 ? 9    ILE A CG1   1 
ATOM   29   C  CG2   . ILE A 1 9   ? -11.345 2.584  35.613 1.00 47.46 ? 9    ILE A CG2   1 
ATOM   30   C  CD1   . ILE A 1 9   ? -10.603 1.539  31.966 1.00 49.59 ? 9    ILE A CD1   1 
ATOM   31   H  H     . ILE A 1 9   ? -8.325  2.416  35.769 1.00 0.00  ? 9    ILE A H     1 
ATOM   32   N  N     . ASN A 1 10  ? -10.678 5.483  34.189 1.00 46.69 ? 10   ASN A N     1 
ATOM   33   C  CA    . ASN A 1 10  ? -11.180 6.789  34.642 1.00 45.66 ? 10   ASN A CA    1 
ATOM   34   C  C     . ASN A 1 10  ? -10.153 7.910  34.881 1.00 42.60 ? 10   ASN A C     1 
ATOM   35   O  O     . ASN A 1 10  ? -10.333 8.786  35.731 1.00 37.49 ? 10   ASN A O     1 
ATOM   36   C  CB    . ASN A 1 10  ? -12.114 6.620  35.846 1.00 46.41 ? 10   ASN A CB    1 
ATOM   37   C  CG    . ASN A 1 10  ? -13.575 6.681  35.450 1.00 47.28 ? 10   ASN A CG    1 
ATOM   38   O  OD1   . ASN A 1 10  ? -13.908 6.602  34.262 1.00 49.33 ? 10   ASN A OD1   1 
ATOM   39   N  ND2   . ASN A 1 10  ? -14.452 6.869  36.428 1.00 42.95 ? 10   ASN A ND2   1 
ATOM   40   H  H     . ASN A 1 10  ? -11.071 5.126  33.359 1.00 0.00  ? 10   ASN A H     1 
ATOM   41   H  HD21  . ASN A 1 10  ? -15.390 6.880  36.162 1.00 0.00  ? 10   ASN A HD21  1 
ATOM   42   H  HD22  . ASN A 1 10  ? -14.124 6.980  37.342 1.00 0.00  ? 10   ASN A HD22  1 
ATOM   43   N  N     . LEU A 1 11  ? -9.112  7.892  34.060 1.00 39.73 ? 11   LEU A N     1 
ATOM   44   C  CA    . LEU A 1 11  ? -8.038  8.861  34.092 1.00 35.61 ? 11   LEU A CA    1 
ATOM   45   C  C     . LEU A 1 11  ? -8.495  10.273 33.723 1.00 36.96 ? 11   LEU A C     1 
ATOM   46   O  O     . LEU A 1 11  ? -9.444  10.464 32.946 1.00 33.33 ? 11   LEU A O     1 
ATOM   47   C  CB    . LEU A 1 11  ? -6.941  8.424  33.114 1.00 35.08 ? 11   LEU A CB    1 
ATOM   48   C  CG    . LEU A 1 11  ? -5.743  7.607  33.608 1.00 33.80 ? 11   LEU A CG    1 
ATOM   49   C  CD1   . LEU A 1 11  ? -6.136  6.589  34.655 1.00 30.13 ? 11   LEU A CD1   1 
ATOM   50   C  CD2   . LEU A 1 11  ? -5.068  6.957  32.425 1.00 32.10 ? 11   LEU A CD2   1 
ATOM   51   H  H     . LEU A 1 11  ? -9.077  7.178  33.392 1.00 0.00  ? 11   LEU A H     1 
ATOM   52   N  N     . ASP A 1 12  ? -7.754  11.249 34.243 1.00 38.29 ? 12   ASP A N     1 
ATOM   53   C  CA    . ASP A 1 12  ? -7.999  12.664 34.002 1.00 38.59 ? 12   ASP A CA    1 
ATOM   54   C  C     . ASP A 1 12  ? -7.131  13.179 32.874 1.00 40.15 ? 12   ASP A C     1 
ATOM   55   O  O     . ASP A 1 12  ? -6.122  12.559 32.493 1.00 39.78 ? 12   ASP A O     1 
ATOM   56   C  CB    . ASP A 1 12  ? -7.691  13.482 35.245 1.00 43.03 ? 12   ASP A CB    1 
ATOM   57   C  CG    . ASP A 1 12  ? -8.555  13.102 36.407 1.00 47.98 ? 12   ASP A CG    1 
ATOM   58   O  OD1   . ASP A 1 12  ? -9.804  13.115 36.261 1.00 48.30 ? 12   ASP A OD1   1 
ATOM   59   O  OD2   . ASP A 1 12  ? -7.975  12.770 37.462 1.00 52.37 ? 12   ASP A OD2   1 
ATOM   60   H  H     . ASP A 1 12  ? -7.007  10.985 34.796 1.00 0.00  ? 12   ASP A H     1 
ATOM   61   N  N     . GLU A 1 13  ? -7.508  14.345 32.364 1.00 37.25 ? 13   GLU A N     1 
ATOM   62   C  CA    . GLU A 1 13  ? -6.775  14.959 31.279 1.00 34.33 ? 13   GLU A CA    1 
ATOM   63   C  C     . GLU A 1 13  ? -5.334  15.206 31.744 1.00 33.46 ? 13   GLU A C     1 
ATOM   64   O  O     . GLU A 1 13  ? -5.096  15.465 32.929 1.00 29.94 ? 13   GLU A O     1 
ATOM   65   C  CB    . GLU A 1 13  ? -7.499  16.226 30.827 1.00 33.22 ? 13   GLU A CB    1 
ATOM   66   C  CG    . GLU A 1 13  ? -8.880  15.925 30.220 1.00 34.79 ? 13   GLU A CG    1 
ATOM   67   C  CD    . GLU A 1 13  ? -10.050 16.073 31.208 1.00 42.11 ? 13   GLU A CD    1 
ATOM   68   O  OE1   . GLU A 1 13  ? -10.073 17.077 31.970 1.00 44.05 ? 13   GLU A OE1   1 
ATOM   69   O  OE2   . GLU A 1 13  ? -10.969 15.210 31.201 1.00 39.07 ? 13   GLU A OE2   1 
ATOM   70   H  H     . GLU A 1 13  ? -8.281  14.806 32.745 1.00 0.00  ? 13   GLU A H     1 
ATOM   71   N  N     . GLY A 1 14  ? -4.373  15.000 30.848 1.00 29.62 ? 14   GLY A N     1 
ATOM   72   C  CA    . GLY A 1 14  ? -2.984  15.182 31.209 1.00 32.79 ? 14   GLY A CA    1 
ATOM   73   C  C     . GLY A 1 14  ? -2.347  13.947 31.820 1.00 36.60 ? 14   GLY A C     1 
ATOM   74   O  O     . GLY A 1 14  ? -1.120  13.895 31.984 1.00 38.49 ? 14   GLY A O     1 
ATOM   75   H  H     . GLY A 1 14  ? -4.576  14.751 29.929 1.00 0.00  ? 14   GLY A H     1 
ATOM   76   N  N     . GLU A 1 15  ? -3.167  12.975 32.211 1.00 34.35 ? 15   GLU A N     1 
ATOM   77   C  CA    . GLU A 1 15  ? -2.647  11.735 32.770 1.00 32.77 ? 15   GLU A CA    1 
ATOM   78   C  C     . GLU A 1 15  ? -2.239  10.853 31.593 1.00 32.38 ? 15   GLU A C     1 
ATOM   79   O  O     . GLU A 1 15  ? -2.907  10.862 30.557 1.00 36.15 ? 15   GLU A O     1 
ATOM   80   C  CB    . GLU A 1 15  ? -3.721  11.054 33.589 1.00 31.40 ? 15   GLU A CB    1 
ATOM   81   C  CG    . GLU A 1 15  ? -3.188  10.465 34.854 1.00 37.56 ? 15   GLU A CG    1 
ATOM   82   C  CD    . GLU A 1 15  ? -4.124  10.676 36.022 1.00 40.22 ? 15   GLU A CD    1 
ATOM   83   O  OE1   . GLU A 1 15  ? -5.356  10.609 35.836 1.00 42.66 ? 15   GLU A OE1   1 
ATOM   84   O  OE2   . GLU A 1 15  ? -3.631  10.912 37.136 1.00 41.66 ? 15   GLU A OE2   1 
ATOM   85   H  H     . GLU A 1 15  ? -4.138  13.077 32.141 1.00 0.00  ? 15   GLU A H     1 
ATOM   86   N  N     . LEU A 1 16  ? -1.109  10.164 31.699 1.00 32.33 ? 16   LEU A N     1 
ATOM   87   C  CA    . LEU A 1 16  ? -0.649  9.292  30.604 1.00 31.73 ? 16   LEU A CA    1 
ATOM   88   C  C     . LEU A 1 16  ? -1.634  8.146  30.346 1.00 31.57 ? 16   LEU A C     1 
ATOM   89   O  O     . LEU A 1 16  ? -2.315  7.659  31.266 1.00 33.12 ? 16   LEU A O     1 
ATOM   90   C  CB    . LEU A 1 16  ? 0.716   8.686  30.914 1.00 26.56 ? 16   LEU A CB    1 
ATOM   91   C  CG    . LEU A 1 16  ? 1.933   9.584  31.035 1.00 24.91 ? 16   LEU A CG    1 
ATOM   92   C  CD1   . LEU A 1 16  ? 2.761   9.104  32.202 1.00 24.16 ? 16   LEU A CD1   1 
ATOM   93   C  CD2   . LEU A 1 16  ? 2.729   9.588  29.755 1.00 19.68 ? 16   LEU A CD2   1 
ATOM   94   H  H     . LEU A 1 16  ? -0.580  10.232 32.524 1.00 0.00  ? 16   LEU A H     1 
ATOM   95   N  N     . CYS A 1 17  ? -1.686  7.690  29.106 1.00 27.87 ? 17   CYS A N     1 
ATOM   96   C  CA    . CYS A 1 17  ? -2.572  6.608  28.773 1.00 28.73 ? 17   CYS A CA    1 
ATOM   97   C  C     . CYS A 1 17  ? -1.985  5.834  27.625 1.00 29.84 ? 17   CYS A C     1 
ATOM   98   O  O     . CYS A 1 17  ? -1.103  6.311  26.916 1.00 28.94 ? 17   CYS A O     1 
ATOM   99   C  CB    . CYS A 1 17  ? -3.954  7.138  28.403 1.00 27.50 ? 17   CYS A CB    1 
ATOM   100  S  SG    . CYS A 1 17  ? -3.854  8.564  27.300 1.00 33.63 ? 17   CYS A SG    1 
ATOM   101  H  H     . CYS A 1 17  ? -1.121  8.070  28.395 1.00 0.00  ? 17   CYS A H     1 
ATOM   102  N  N     . LEU A 1 18  ? -2.498  4.623  27.470 1.00 29.82 ? 18   LEU A N     1 
ATOM   103  C  CA    . LEU A 1 18  ? -2.096  3.701  26.436 1.00 30.75 ? 18   LEU A CA    1 
ATOM   104  C  C     . LEU A 1 18  ? -3.243  3.577  25.458 1.00 33.52 ? 18   LEU A C     1 
ATOM   105  O  O     . LEU A 1 18  ? -3.025  3.322  24.276 1.00 40.27 ? 18   LEU A O     1 
ATOM   106  C  CB    . LEU A 1 18  ? -1.797  2.332  27.063 1.00 29.86 ? 18   LEU A CB    1 
ATOM   107  C  CG    . LEU A 1 18  ? -0.386  2.087  27.616 1.00 32.41 ? 18   LEU A CG    1 
ATOM   108  C  CD1   . LEU A 1 18  ? 0.629   2.199  26.502 1.00 31.94 ? 18   LEU A CD1   1 
ATOM   109  C  CD2   . LEU A 1 18  ? -0.033  3.060  28.717 1.00 36.93 ? 18   LEU A CD2   1 
ATOM   110  H  H     . LEU A 1 18  ? -3.197  4.357  28.077 1.00 0.00  ? 18   LEU A H     1 
ATOM   111  N  N     . ASN A 1 19  ? -4.463  3.810  25.941 1.00 35.22 ? 19   ASN A N     1 
ATOM   112  C  CA    . ASN A 1 19  ? -5.666  3.690  25.116 1.00 36.94 ? 19   ASN A CA    1 
ATOM   113  C  C     . ASN A 1 19  ? -6.824  4.577  25.612 1.00 34.28 ? 19   ASN A C     1 
ATOM   114  O  O     . ASN A 1 19  ? -7.030  4.710  26.824 1.00 31.37 ? 19   ASN A O     1 
ATOM   115  C  CB    . ASN A 1 19  ? -6.098  2.219  25.145 1.00 41.35 ? 19   ASN A CB    1 
ATOM   116  C  CG    . ASN A 1 19  ? -7.306  1.949  24.303 1.00 42.40 ? 19   ASN A CG    1 
ATOM   117  O  OD1   . ASN A 1 19  ? -8.446  2.136  24.740 1.00 37.86 ? 19   ASN A OD1   1 
ATOM   118  N  ND2   . ASN A 1 19  ? -7.070  1.500  23.077 1.00 46.31 ? 19   ASN A ND2   1 
ATOM   119  H  H     . ASN A 1 19  ? -4.579  4.042  26.883 1.00 0.00  ? 19   ASN A H     1 
ATOM   120  H  HD21  . ASN A 1 19  ? -7.841  1.282  22.517 1.00 0.00  ? 19   ASN A HD21  1 
ATOM   121  H  HD22  . ASN A 1 19  ? -6.133  1.388  22.798 1.00 0.00  ? 19   ASN A HD22  1 
ATOM   122  N  N     . SER A 1 20  ? -7.624  5.108  24.683 1.00 35.88 ? 20   SER A N     1 
ATOM   123  C  CA    . SER A 1 20  ? -8.771  5.980  25.030 1.00 37.73 ? 20   SER A CA    1 
ATOM   124  C  C     . SER A 1 20  ? -9.758  5.415  26.044 1.00 39.62 ? 20   SER A C     1 
ATOM   125  O  O     . SER A 1 20  ? -10.427 6.173  26.761 1.00 40.43 ? 20   SER A O     1 
ATOM   126  C  CB    . SER A 1 20  ? -9.546  6.421  23.787 1.00 32.83 ? 20   SER A CB    1 
ATOM   127  O  OG    . SER A 1 20  ? -8.765  7.282  22.981 1.00 35.75 ? 20   SER A OG    1 
ATOM   128  H  H     . SER A 1 20  ? -7.451  4.932  23.735 1.00 0.00  ? 20   SER A H     1 
ATOM   129  H  HG    . SER A 1 20  ? -8.017  6.791  22.635 1.00 0.00  ? 20   SER A HG    1 
ATOM   130  N  N     . ALA A 1 21  ? -9.854  4.093  26.115 1.00 41.05 ? 21   ALA A N     1 
ATOM   131  C  CA    . ALA A 1 21  ? -10.761 3.473  27.064 1.00 41.04 ? 21   ALA A CA    1 
ATOM   132  C  C     . ALA A 1 21  ? -10.435 3.941  28.480 1.00 41.17 ? 21   ALA A C     1 
ATOM   133  O  O     . ALA A 1 21  ? -11.335 4.099  29.308 1.00 42.37 ? 21   ALA A O     1 
ATOM   134  C  CB    . ALA A 1 21  ? -10.672 1.967  26.968 1.00 41.67 ? 21   ALA A CB    1 
ATOM   135  H  H     . ALA A 1 21  ? -9.317  3.535  25.529 1.00 0.00  ? 21   ALA A H     1 
ATOM   136  N  N     . GLN A 1 22  ? -9.160  4.224  28.743 1.00 41.32 ? 22   GLN A N     1 
ATOM   137  C  CA    . GLN A 1 22  ? -8.745  4.668  30.078 1.00 43.24 ? 22   GLN A CA    1 
ATOM   138  C  C     . GLN A 1 22  ? -9.139  6.113  30.455 1.00 46.48 ? 22   GLN A C     1 
ATOM   139  O  O     . GLN A 1 22  ? -9.244  6.450  31.648 1.00 45.03 ? 22   GLN A O     1 
ATOM   140  C  CB    . GLN A 1 22  ? -7.235  4.560  30.232 1.00 39.82 ? 22   GLN A CB    1 
ATOM   141  C  CG    . GLN A 1 22  ? -6.603  3.343  29.622 1.00 40.14 ? 22   GLN A CG    1 
ATOM   142  C  CD    . GLN A 1 22  ? -5.097  3.321  29.842 1.00 38.01 ? 22   GLN A CD    1 
ATOM   143  O  OE1   . GLN A 1 22  ? -4.313  3.208  28.895 1.00 30.93 ? 22   GLN A OE1   1 
ATOM   144  N  NE2   . GLN A 1 22  ? -4.686  3.444  31.107 1.00 42.02 ? 22   GLN A NE2   1 
ATOM   145  H  H     . GLN A 1 22  ? -8.496  4.148  28.025 1.00 0.00  ? 22   GLN A H     1 
ATOM   146  H  HE21  . GLN A 1 22  ? -3.746  3.476  31.281 1.00 0.00  ? 22   GLN A HE21  1 
ATOM   147  H  HE22  . GLN A 1 22  ? -5.388  3.525  31.804 1.00 0.00  ? 22   GLN A HE22  1 
ATOM   148  N  N     . CYS A 1 23  ? -9.370  6.952  29.446 1.00 44.92 ? 23   CYS A N     1 
ATOM   149  C  CA    . CYS A 1 23  ? -9.672  8.356  29.673 1.00 39.74 ? 23   CYS A CA    1 
ATOM   150  C  C     . CYS A 1 23  ? -11.129 8.712  29.802 1.00 39.96 ? 23   CYS A C     1 
ATOM   151  O  O     . CYS A 1 23  ? -11.935 8.305  28.965 1.00 39.81 ? 23   CYS A O     1 
ATOM   152  C  CB    . CYS A 1 23  ? -9.063  9.183  28.559 1.00 35.94 ? 23   CYS A CB    1 
ATOM   153  S  SG    . CYS A 1 23  ? -7.285  8.915  28.309 1.00 36.36 ? 23   CYS A SG    1 
ATOM   154  H  H     . CYS A 1 23  ? -9.377  6.617  28.527 1.00 0.00  ? 23   CYS A H     1 
ATOM   155  N  N     . LYS A 1 24  ? -11.456 9.501  30.832 1.00 40.21 ? 24   LYS A N     1 
ATOM   156  C  CA    . LYS A 1 24  ? -12.838 9.954  31.056 1.00 43.67 ? 24   LYS A CA    1 
ATOM   157  C  C     . LYS A 1 24  ? -13.289 10.618 29.750 1.00 44.11 ? 24   LYS A C     1 
ATOM   158  O  O     . LYS A 1 24  ? -14.380 10.345 29.242 1.00 50.73 ? 24   LYS A O     1 
ATOM   159  C  CB    . LYS A 1 24  ? -12.920 10.963 32.209 1.00 43.02 ? 24   LYS A CB    1 
ATOM   160  C  CG    . LYS A 1 24  ? -12.570 10.430 33.580 1.00 41.95 ? 24   LYS A CG    1 
ATOM   161  C  CD    . LYS A 1 24  ? -12.445 11.567 34.587 1.00 42.57 ? 24   LYS A CD    1 
ATOM   162  C  CE    . LYS A 1 24  ? -12.465 11.038 36.022 1.00 49.63 ? 24   LYS A CE    1 
ATOM   163  N  NZ    . LYS A 1 24  ? -12.377 12.122 37.060 1.00 51.90 ? 24   LYS A NZ    1 
ATOM   164  H  H     . LYS A 1 24  ? -10.745 9.797  31.443 1.00 0.00  ? 24   LYS A H     1 
ATOM   165  H  HZ1   . LYS A 1 24  ? -11.496 12.650 36.937 1.00 0.00  ? 24   LYS A HZ1   1 
ATOM   166  H  HZ2   . LYS A 1 24  ? -13.187 12.768 36.958 1.00 0.00  ? 24   LYS A HZ2   1 
ATOM   167  H  HZ3   . LYS A 1 24  ? -12.396 11.709 38.016 1.00 0.00  ? 24   LYS A HZ3   1 
ATOM   168  N  N     . SER A 1 25  ? -12.470 11.543 29.258 1.00 40.94 ? 25   SER A N     1 
ATOM   169  C  CA    . SER A 1 25  ? -12.717 12.194 27.985 1.00 38.40 ? 25   SER A CA    1 
ATOM   170  C  C     . SER A 1 25  ? -12.204 11.051 27.137 1.00 44.05 ? 25   SER A C     1 
ATOM   171  O  O     . SER A 1 25  ? -11.045 10.670 27.279 1.00 50.26 ? 25   SER A O     1 
ATOM   172  C  CB    . SER A 1 25  ? -11.782 13.388 27.826 1.00 35.92 ? 25   SER A CB    1 
ATOM   173  O  OG    . SER A 1 25  ? -10.420 12.979 27.807 1.00 32.37 ? 25   SER A OG    1 
ATOM   174  H  H     . SER A 1 25  ? -11.646 11.776 29.737 1.00 0.00  ? 25   SER A H     1 
ATOM   175  H  HG    . SER A 1 25  ? -10.165 12.858 26.879 1.00 0.00  ? 25   SER A HG    1 
ATOM   176  N  N     . ASN A 1 26  ? -13.023 10.470 26.282 1.00 42.13 ? 26   ASN A N     1 
ATOM   177  C  CA    . ASN A 1 26  ? -12.519 9.339  25.532 1.00 43.09 ? 26   ASN A CA    1 
ATOM   178  C  C     . ASN A 1 26  ? -11.586 9.715  24.400 1.00 38.16 ? 26   ASN A C     1 
ATOM   179  O  O     . ASN A 1 26  ? -11.910 9.583  23.222 1.00 38.21 ? 26   ASN A O     1 
ATOM   180  C  CB    . ASN A 1 26  ? -13.671 8.442  25.090 1.00 51.88 ? 26   ASN A CB    1 
ATOM   181  C  CG    . ASN A 1 26  ? -14.635 8.148  26.233 1.00 59.60 ? 26   ASN A CG    1 
ATOM   182  O  OD1   . ASN A 1 26  ? -15.776 8.620  26.226 1.00 65.13 ? 26   ASN A OD1   1 
ATOM   183  N  ND2   . ASN A 1 26  ? -14.164 7.420  27.248 1.00 59.17 ? 26   ASN A ND2   1 
ATOM   184  H  H     . ASN A 1 26  ? -13.943 10.783 26.171 1.00 0.00  ? 26   ASN A H     1 
ATOM   185  H  HD21  . ASN A 1 26  ? -14.814 7.217  27.943 1.00 0.00  ? 26   ASN A HD21  1 
ATOM   186  H  HD22  . ASN A 1 26  ? -13.235 7.118  27.262 1.00 0.00  ? 26   ASN A HD22  1 
ATOM   187  N  N     . CYS A 1 27  ? -10.396 10.165 24.778 1.00 36.26 ? 27   CYS A N     1 
ATOM   188  C  CA    . CYS A 1 27  ? -9.381  10.564 23.818 1.00 32.10 ? 27   CYS A CA    1 
ATOM   189  C  C     . CYS A 1 27  ? -7.991  10.511 24.431 1.00 30.60 ? 27   CYS A C     1 
ATOM   190  O  O     . CYS A 1 27  ? -7.647  11.348 25.262 1.00 35.65 ? 27   CYS A O     1 
ATOM   191  C  CB    . CYS A 1 27  ? -9.655  11.982 23.272 1.00 26.59 ? 27   CYS A CB    1 
ATOM   192  S  SG    . CYS A 1 27  ? -8.367  12.527 22.105 1.00 34.69 ? 27   CYS A SG    1 
ATOM   193  H  H     . CYS A 1 27  ? -10.162 10.213 25.725 1.00 0.00  ? 27   CYS A H     1 
ATOM   194  N  N     . CYS A 1 28  ? -7.239  9.463  24.129 1.00 29.21 ? 28   CYS A N     1 
ATOM   195  C  CA    . CYS A 1 28  ? -5.870  9.388  24.608 1.00 32.68 ? 28   CYS A CA    1 
ATOM   196  C  C     . CYS A 1 28  ? -5.207  10.049 23.419 1.00 33.11 ? 28   CYS A C     1 
ATOM   197  O  O     . CYS A 1 28  ? -5.395  9.603  22.290 1.00 36.45 ? 28   CYS A O     1 
ATOM   198  C  CB    . CYS A 1 28  ? -5.390  7.939  24.767 1.00 35.75 ? 28   CYS A CB    1 
ATOM   199  S  SG    . CYS A 1 28  ? -3.686  7.829  25.420 1.00 36.20 ? 28   CYS A SG    1 
ATOM   200  H  H     . CYS A 1 28  ? -7.604  8.762  23.558 1.00 0.00  ? 28   CYS A H     1 
ATOM   201  N  N     . GLN A 1 29  ? -4.415  11.083 23.641 1.00 33.32 ? 29   GLN A N     1 
ATOM   202  C  CA    . GLN A 1 29  ? -3.864  11.796 22.505 1.00 40.21 ? 29   GLN A CA    1 
ATOM   203  C  C     . GLN A 1 29  ? -2.375  12.059 22.587 1.00 45.44 ? 29   GLN A C     1 
ATOM   204  O  O     . GLN A 1 29  ? -1.791  12.048 23.666 1.00 47.77 ? 29   GLN A O     1 
ATOM   205  C  CB    . GLN A 1 29  ? -4.636  13.134 22.386 1.00 42.41 ? 29   GLN A CB    1 
ATOM   206  C  CG    . GLN A 1 29  ? -4.528  13.927 21.071 1.00 42.22 ? 29   GLN A CG    1 
ATOM   207  C  CD    . GLN A 1 29  ? -3.517  15.076 21.109 1.00 37.45 ? 29   GLN A CD    1 
ATOM   208  O  OE1   . GLN A 1 29  ? -2.746  15.211 22.038 1.00 37.02 ? 29   GLN A OE1   1 
ATOM   209  N  NE2   . GLN A 1 29  ? -3.505  15.880 20.066 1.00 42.68 ? 29   GLN A NE2   1 
ATOM   210  H  H     . GLN A 1 29  ? -4.189  11.377 24.549 1.00 0.00  ? 29   GLN A H     1 
ATOM   211  H  HE21  . GLN A 1 29  ? -2.905  16.659 20.106 1.00 0.00  ? 29   GLN A HE21  1 
ATOM   212  H  HE22  . GLN A 1 29  ? -4.102  15.729 19.314 1.00 0.00  ? 29   GLN A HE22  1 
ATOM   213  N  N     . HIS A 1 30  ? -1.754  12.230 21.429 1.00 47.07 ? 30   HIS A N     1 
ATOM   214  C  CA    . HIS A 1 30  ? -0.349  12.578 21.365 1.00 52.92 ? 30   HIS A CA    1 
ATOM   215  C  C     . HIS A 1 30  ? -0.140  13.322 20.054 1.00 55.25 ? 30   HIS A C     1 
ATOM   216  O  O     . HIS A 1 30  ? -0.852  13.079 19.078 1.00 54.55 ? 30   HIS A O     1 
ATOM   217  C  CB    . HIS A 1 30  ? 0.595   11.378 21.566 1.00 54.24 ? 30   HIS A CB    1 
ATOM   218  C  CG    . HIS A 1 30  ? 0.563   10.356 20.471 1.00 58.53 ? 30   HIS A CG    1 
ATOM   219  N  ND1   . HIS A 1 30  ? 1.613   9.488  20.243 1.00 59.85 ? 30   HIS A ND1   1 
ATOM   220  C  CD2   . HIS A 1 30  ? -0.386  10.047 19.557 1.00 59.23 ? 30   HIS A CD2   1 
ATOM   221  C  CE1   . HIS A 1 30  ? 1.315   8.691  19.234 1.00 59.42 ? 30   HIS A CE1   1 
ATOM   222  N  NE2   . HIS A 1 30  ? 0.107   9.008  18.799 1.00 61.98 ? 30   HIS A NE2   1 
ATOM   223  H  H     . HIS A 1 30  ? -2.262  12.164 20.581 1.00 0.00  ? 30   HIS A H     1 
ATOM   224  H  HD1   . HIS A 1 30  ? 2.456   9.425  20.767 1.00 0.00  ? 30   HIS A HD1   1 
ATOM   225  H  HE2   . HIS A 1 30  ? -0.382  8.544  18.072 1.00 0.00  ? 30   HIS A HE2   1 
ATOM   226  N  N     . ASP A 1 31  ? 0.776   14.283 20.064 1.00 56.04 ? 31   ASP A N     1 
ATOM   227  C  CA    . ASP A 1 31  ? 1.036   15.098 18.889 1.00 59.94 ? 31   ASP A CA    1 
ATOM   228  C  C     . ASP A 1 31  ? 1.853   14.445 17.778 1.00 59.66 ? 31   ASP A C     1 
ATOM   229  O  O     . ASP A 1 31  ? 1.631   14.715 16.598 1.00 57.88 ? 31   ASP A O     1 
ATOM   230  C  CB    . ASP A 1 31  ? 1.622   16.454 19.304 1.00 61.30 ? 31   ASP A CB    1 
ATOM   231  C  CG    . ASP A 1 31  ? 0.615   17.308 20.071 1.00 66.35 ? 31   ASP A CG    1 
ATOM   232  O  OD1   . ASP A 1 31  ? 0.221   16.916 21.195 1.00 67.71 ? 31   ASP A OD1   1 
ATOM   233  O  OD2   . ASP A 1 31  ? 0.192   18.359 19.539 1.00 69.28 ? 31   ASP A OD2   1 
ATOM   234  H  H     . ASP A 1 31  ? 1.264   14.439 20.892 1.00 0.00  ? 31   ASP A H     1 
ATOM   235  N  N     . THR A 1 32  ? 2.783   13.573 18.139 1.00 60.17 ? 32   THR A N     1 
ATOM   236  C  CA    . THR A 1 32  ? 3.584   12.914 17.124 1.00 61.24 ? 32   THR A CA    1 
ATOM   237  C  C     . THR A 1 32  ? 3.650   11.422 17.392 1.00 59.88 ? 32   THR A C     1 
ATOM   238  O  O     . THR A 1 32  ? 3.187   10.953 18.432 1.00 60.91 ? 32   THR A O     1 
ATOM   239  C  CB    . THR A 1 32  ? 4.998   13.502 17.060 1.00 61.88 ? 32   THR A CB    1 
ATOM   240  O  OG1   . THR A 1 32  ? 5.682   13.233 18.288 1.00 66.21 ? 32   THR A OG1   1 
ATOM   241  C  CG2   . THR A 1 32  ? 4.931   15.004 16.844 1.00 60.74 ? 32   THR A CG2   1 
ATOM   242  H  H     . THR A 1 32  ? 2.944   13.347 19.076 1.00 0.00  ? 32   THR A H     1 
ATOM   243  H  HG1   . THR A 1 32  ? 5.302   13.783 18.985 1.00 0.00  ? 32   THR A HG1   1 
ATOM   244  N  N     . ILE A 1 33  ? 4.221   10.680 16.450 1.00 60.87 ? 33   ILE A N     1 
ATOM   245  C  CA    . ILE A 1 33  ? 4.340   9.225  16.558 1.00 60.74 ? 33   ILE A CA    1 
ATOM   246  C  C     . ILE A 1 33  ? 5.233   8.775  17.728 1.00 61.33 ? 33   ILE A C     1 
ATOM   247  O  O     . ILE A 1 33  ? 4.842   7.941  18.546 1.00 59.87 ? 33   ILE A O     1 
ATOM   248  C  CB    . ILE A 1 33  ? 4.788   8.603  15.185 1.00 59.42 ? 33   ILE A CB    1 
ATOM   249  C  CG1   . ILE A 1 33  ? 4.871   7.086  15.277 1.00 59.15 ? 33   ILE A CG1   1 
ATOM   250  C  CG2   . ILE A 1 33  ? 6.116   9.192  14.719 1.00 60.72 ? 33   ILE A CG2   1 
ATOM   251  C  CD1   . ILE A 1 33  ? 3.595   6.460  15.766 1.00 62.53 ? 33   ILE A CD1   1 
ATOM   252  H  H     . ILE A 1 33  ? 4.562   11.125 15.647 1.00 0.00  ? 33   ILE A H     1 
ATOM   253  N  N     . LEU A 1 34  ? 6.409   9.371  17.840 1.00 60.92 ? 34   LEU A N     1 
ATOM   254  C  CA    . LEU A 1 34  ? 7.318   9.016  18.915 1.00 61.37 ? 34   LEU A CA    1 
ATOM   255  C  C     . LEU A 1 34  ? 7.203   10.027 20.054 1.00 60.85 ? 34   LEU A C     1 
ATOM   256  O  O     . LEU A 1 34  ? 8.056   10.912 20.210 1.00 63.36 ? 34   LEU A O     1 
ATOM   257  C  CB    . LEU A 1 34  ? 8.753   8.939  18.385 1.00 60.96 ? 34   LEU A CB    1 
ATOM   258  C  CG    . LEU A 1 34  ? 9.042   7.726  17.500 1.00 59.65 ? 34   LEU A CG    1 
ATOM   259  C  CD1   . LEU A 1 34  ? 10.311  7.938  16.696 1.00 61.25 ? 34   LEU A CD1   1 
ATOM   260  C  CD2   . LEU A 1 34  ? 9.147   6.488  18.361 1.00 61.12 ? 34   LEU A CD2   1 
ATOM   261  H  H     . LEU A 1 34  ? 6.668   10.084 17.226 1.00 0.00  ? 34   LEU A H     1 
ATOM   262  N  N     . SER A 1 35  ? 6.109   9.930  20.804 1.00 57.12 ? 35   SER A N     1 
ATOM   263  C  CA    . SER A 1 35  ? 5.860   10.811 21.940 1.00 52.17 ? 35   SER A CA    1 
ATOM   264  C  C     . SER A 1 35  ? 4.728   10.233 22.781 1.00 52.03 ? 35   SER A C     1 
ATOM   265  O  O     . SER A 1 35  ? 3.783   9.626  22.252 1.00 51.94 ? 35   SER A O     1 
ATOM   266  C  CB    . SER A 1 35  ? 5.524   12.231 21.479 1.00 48.40 ? 35   SER A CB    1 
ATOM   267  O  OG    . SER A 1 35  ? 4.387   12.246 20.639 1.00 50.11 ? 35   SER A OG    1 
ATOM   268  H  H     . SER A 1 35  ? 5.445   9.228  20.613 1.00 0.00  ? 35   SER A H     1 
ATOM   269  H  HG    . SER A 1 35  ? 4.528   11.598 19.940 1.00 0.00  ? 35   SER A HG    1 
ATOM   270  N  N     . LEU A 1 36  ? 4.842   10.423 24.093 1.00 49.08 ? 36   LEU A N     1 
ATOM   271  C  CA    . LEU A 1 36  ? 3.880   9.916  25.057 1.00 41.01 ? 36   LEU A CA    1 
ATOM   272  C  C     . LEU A 1 36  ? 2.496   10.508 24.904 1.00 37.66 ? 36   LEU A C     1 
ATOM   273  O  O     . LEU A 1 36  ? 2.355   11.673 24.578 1.00 37.41 ? 36   LEU A O     1 
ATOM   274  C  CB    . LEU A 1 36  ? 4.418   10.181 26.442 1.00 42.76 ? 36   LEU A CB    1 
ATOM   275  C  CG    . LEU A 1 36  ? 5.720   9.431  26.670 1.00 42.35 ? 36   LEU A CG    1 
ATOM   276  C  CD1   . LEU A 1 36  ? 6.275   9.826  28.015 1.00 42.92 ? 36   LEU A CD1   1 
ATOM   277  C  CD2   . LEU A 1 36  ? 5.466   7.916  26.577 1.00 39.44 ? 36   LEU A CD2   1 
ATOM   278  H  H     . LEU A 1 36  ? 5.600   10.947 24.411 1.00 0.00  ? 36   LEU A H     1 
ATOM   279  N  N     . SER A 1 37  ? 1.463   9.713  25.144 1.00 36.57 ? 37   SER A N     1 
ATOM   280  C  CA    . SER A 1 37  ? 0.109   10.224 24.991 1.00 33.86 ? 37   SER A CA    1 
ATOM   281  C  C     . SER A 1 37  ? -0.619  10.333 26.316 1.00 32.57 ? 37   SER A C     1 
ATOM   282  O  O     . SER A 1 37  ? -0.434  9.499  27.200 1.00 40.44 ? 37   SER A O     1 
ATOM   283  C  CB    . SER A 1 37  ? -0.675  9.373  23.981 1.00 34.06 ? 37   SER A CB    1 
ATOM   284  O  OG    . SER A 1 37  ? -0.945  8.068  24.456 1.00 34.84 ? 37   SER A OG    1 
ATOM   285  H  H     . SER A 1 37  ? 1.595   8.783  25.426 1.00 0.00  ? 37   SER A H     1 
ATOM   286  H  HG    . SER A 1 37  ? -0.272  7.678  25.028 1.00 0.00  ? 37   SER A HG    1 
ATOM   287  N  N     . ARG A 1 38  ? -1.401  11.395 26.480 1.00 31.51 ? 38   ARG A N     1 
ATOM   288  C  CA    . ARG A 1 38  ? -2.143  11.618 27.715 1.00 27.70 ? 38   ARG A CA    1 
ATOM   289  C  C     . ARG A 1 38  ? -3.601  11.917 27.403 1.00 25.55 ? 38   ARG A C     1 
ATOM   290  O  O     . ARG A 1 38  ? -3.960  12.161 26.259 1.00 30.16 ? 38   ARG A O     1 
ATOM   291  C  CB    . ARG A 1 38  ? -1.508  12.761 28.512 1.00 30.05 ? 38   ARG A CB    1 
ATOM   292  C  CG    . ARG A 1 38  ? 0.013   12.649 28.615 1.00 32.79 ? 38   ARG A CG    1 
ATOM   293  C  CD    . ARG A 1 38  ? 0.606   13.649 29.580 1.00 35.34 ? 38   ARG A CD    1 
ATOM   294  N  NE    . ARG A 1 38  ? 1.930   14.073 29.138 1.00 39.04 ? 38   ARG A NE    1 
ATOM   295  C  CZ    . ARG A 1 38  ? 3.071   13.504 29.510 1.00 42.17 ? 38   ARG A CZ    1 
ATOM   296  N  NH1   . ARG A 1 38  ? 3.067   12.466 30.336 1.00 44.32 ? 38   ARG A NH1   1 
ATOM   297  N  NH2   . ARG A 1 38  ? 4.225   14.007 29.100 1.00 41.52 ? 38   ARG A NH2   1 
ATOM   298  H  H     . ARG A 1 38  ? -1.515  12.050 25.754 1.00 0.00  ? 38   ARG A H     1 
ATOM   299  H  HE    . ARG A 1 38  ? 1.990   14.821 28.505 1.00 0.00  ? 38   ARG A HE    1 
ATOM   300  H  HH11  . ARG A 1 38  ? 2.196   12.119 30.686 1.00 0.00  ? 38   ARG A HH11  1 
ATOM   301  H  HH12  . ARG A 1 38  ? 3.926   12.045 30.623 1.00 0.00  ? 38   ARG A HH12  1 
ATOM   302  H  HH21  . ARG A 1 38  ? 4.225   14.819 28.513 1.00 0.00  ? 38   ARG A HH21  1 
ATOM   303  H  HH22  . ARG A 1 38  ? 5.092   13.598 29.384 1.00 0.00  ? 38   ARG A HH22  1 
ATOM   304  N  N     . CYS A 1 39  ? -4.459  11.881 28.402 1.00 23.25 ? 39   CYS A N     1 
ATOM   305  C  CA    . CYS A 1 39  ? -5.854  12.139 28.144 1.00 24.95 ? 39   CYS A CA    1 
ATOM   306  C  C     . CYS A 1 39  ? -6.077  13.591 27.784 1.00 26.48 ? 39   CYS A C     1 
ATOM   307  O  O     . CYS A 1 39  ? -5.548  14.489 28.442 1.00 29.20 ? 39   CYS A O     1 
ATOM   308  C  CB    . CYS A 1 39  ? -6.687  11.738 29.344 1.00 24.99 ? 39   CYS A CB    1 
ATOM   309  S  SG    . CYS A 1 39  ? -6.431  10.004 29.805 1.00 33.65 ? 39   CYS A SG    1 
ATOM   310  H  H     . CYS A 1 39  ? -4.149  11.671 29.307 1.00 0.00  ? 39   CYS A H     1 
ATOM   311  N  N     . ALA A 1 40  ? -6.852  13.824 26.728 1.00 30.54 ? 40   ALA A N     1 
ATOM   312  C  CA    . ALA A 1 40  ? -7.143  15.182 26.281 1.00 29.02 ? 40   ALA A CA    1 
ATOM   313  C  C     . ALA A 1 40  ? -8.638  15.354 26.057 1.00 28.28 ? 40   ALA A C     1 
ATOM   314  O  O     . ALA A 1 40  ? -9.357  14.379 25.895 1.00 24.56 ? 40   ALA A O     1 
ATOM   315  C  CB    . ALA A 1 40  ? -6.374  15.473 25.009 1.00 28.25 ? 40   ALA A CB    1 
ATOM   316  H  H     . ALA A 1 40  ? -7.247  13.075 26.228 1.00 0.00  ? 40   ALA A H     1 
ATOM   317  N  N     . LEU A 1 41  ? -9.119  16.590 26.105 1.00 33.39 ? 41   LEU A N     1 
ATOM   318  C  CA    . LEU A 1 41  ? -10.545 16.848 25.866 1.00 34.29 ? 41   LEU A CA    1 
ATOM   319  C  C     . LEU A 1 41  ? -10.866 16.692 24.382 1.00 30.98 ? 41   LEU A C     1 
ATOM   320  O  O     . LEU A 1 41  ? -9.997  16.915 23.534 1.00 29.78 ? 41   LEU A O     1 
ATOM   321  C  CB    . LEU A 1 41  ? -10.932 18.256 26.319 1.00 31.17 ? 41   LEU A CB    1 
ATOM   322  C  CG    . LEU A 1 41  ? -10.737 18.535 27.809 1.00 30.09 ? 41   LEU A CG    1 
ATOM   323  C  CD1   . LEU A 1 41  ? -10.752 20.020 28.049 1.00 29.63 ? 41   LEU A CD1   1 
ATOM   324  C  CD2   . LEU A 1 41  ? -11.788 17.834 28.629 1.00 25.58 ? 41   LEU A CD2   1 
ATOM   325  H  H     . LEU A 1 41  ? -8.503  17.334 26.299 1.00 0.00  ? 41   LEU A H     1 
ATOM   326  N  N     . LYS A 1 42  ? -12.093 16.269 24.076 1.00 30.76 ? 42   LYS A N     1 
ATOM   327  C  CA    . LYS A 1 42  ? -12.514 16.113 22.680 1.00 31.86 ? 42   LYS A CA    1 
ATOM   328  C  C     . LYS A 1 42  ? -12.591 17.493 22.020 1.00 27.56 ? 42   LYS A C     1 
ATOM   329  O  O     . LYS A 1 42  ? -12.852 18.500 22.696 1.00 30.33 ? 42   LYS A O     1 
ATOM   330  C  CB    . LYS A 1 42  ? -13.875 15.416 22.586 1.00 34.03 ? 42   LYS A CB    1 
ATOM   331  C  CG    . LYS A 1 42  ? -13.907 14.016 23.154 1.00 36.18 ? 42   LYS A CG    1 
ATOM   332  C  CD    . LYS A 1 42  ? -15.159 13.298 22.701 1.00 40.08 ? 42   LYS A CD    1 
ATOM   333  C  CE    . LYS A 1 42  ? -15.602 12.204 23.670 1.00 41.94 ? 42   LYS A CE    1 
ATOM   334  N  NZ    . LYS A 1 42  ? -14.673 11.039 23.732 1.00 46.93 ? 42   LYS A NZ    1 
ATOM   335  H  H     . LYS A 1 42  ? -12.716 16.042 24.800 1.00 0.00  ? 42   LYS A H     1 
ATOM   336  H  HZ1   . LYS A 1 42  ? -14.591 10.585 22.799 1.00 0.00  ? 42   LYS A HZ1   1 
ATOM   337  H  HZ2   . LYS A 1 42  ? -13.734 11.349 24.052 1.00 0.00  ? 42   LYS A HZ2   1 
ATOM   338  H  HZ3   . LYS A 1 42  ? -15.069 10.366 24.419 1.00 0.00  ? 42   LYS A HZ3   1 
ATOM   339  N  N     . ALA A 1 43  ? -12.387 17.540 20.707 1.00 24.05 ? 43   ALA A N     1 
ATOM   340  C  CA    . ALA A 1 43  ? -12.413 18.802 19.963 1.00 18.81 ? 43   ALA A CA    1 
ATOM   341  C  C     . ALA A 1 43  ? -13.749 19.550 20.033 1.00 22.61 ? 43   ALA A C     1 
ATOM   342  O  O     . ALA A 1 43  ? -14.818 18.958 19.848 1.00 26.44 ? 43   ALA A O     1 
ATOM   343  C  CB    . ALA A 1 43  ? -12.034 18.559 18.540 1.00 17.14 ? 43   ALA A CB    1 
ATOM   344  H  H     . ALA A 1 43  ? -12.249 16.707 20.215 1.00 0.00  ? 43   ALA A H     1 
ATOM   345  N  N     . ARG A 1 44  ? -13.686 20.842 20.363 1.00 23.88 ? 44   ARG A N     1 
ATOM   346  C  CA    . ARG A 1 44  ? -14.874 21.691 20.436 1.00 21.51 ? 44   ARG A CA    1 
ATOM   347  C  C     . ARG A 1 44  ? -15.232 22.071 19.001 1.00 21.75 ? 44   ARG A C     1 
ATOM   348  O  O     . ARG A 1 44  ? -14.480 21.783 18.078 1.00 23.07 ? 44   ARG A O     1 
ATOM   349  C  CB    . ARG A 1 44  ? -14.607 22.946 21.288 1.00 19.56 ? 44   ARG A CB    1 
ATOM   350  C  CG    . ARG A 1 44  ? -13.844 24.086 20.605 1.00 21.01 ? 44   ARG A CG    1 
ATOM   351  C  CD    . ARG A 1 44  ? -13.438 25.159 21.612 1.00 23.42 ? 44   ARG A CD    1 
ATOM   352  N  NE    . ARG A 1 44  ? -12.651 24.582 22.707 1.00 29.85 ? 44   ARG A NE    1 
ATOM   353  C  CZ    . ARG A 1 44  ? -12.168 25.262 23.752 1.00 30.91 ? 44   ARG A CZ    1 
ATOM   354  N  NH1   . ARG A 1 44  ? -12.380 26.570 23.869 1.00 27.66 ? 44   ARG A NH1   1 
ATOM   355  N  NH2   . ARG A 1 44  ? -11.473 24.626 24.692 1.00 25.55 ? 44   ARG A NH2   1 
ATOM   356  H  H     . ARG A 1 44  ? -12.804 21.222 20.531 1.00 0.00  ? 44   ARG A H     1 
ATOM   357  H  HE    . ARG A 1 44  ? -12.452 23.625 22.681 1.00 0.00  ? 44   ARG A HE    1 
ATOM   358  H  HH11  . ARG A 1 44  ? -12.898 27.070 23.173 1.00 0.00  ? 44   ARG A HH11  1 
ATOM   359  H  HH12  . ARG A 1 44  ? -12.008 27.060 24.653 1.00 0.00  ? 44   ARG A HH12  1 
ATOM   360  H  HH21  . ARG A 1 44  ? -11.314 23.645 24.613 1.00 0.00  ? 44   ARG A HH21  1 
ATOM   361  H  HH22  . ARG A 1 44  ? -11.122 25.128 25.471 1.00 0.00  ? 44   ARG A HH22  1 
ATOM   362  N  N     . GLU A 1 45  ? -16.379 22.703 18.805 1.00 23.59 ? 45   GLU A N     1 
ATOM   363  C  CA    . GLU A 1 45  ? -16.800 23.105 17.462 1.00 23.91 ? 45   GLU A CA    1 
ATOM   364  C  C     . GLU A 1 45  ? -15.783 24.023 16.779 1.00 21.23 ? 45   GLU A C     1 
ATOM   365  O  O     . GLU A 1 45  ? -15.145 24.847 17.433 1.00 17.17 ? 45   GLU A O     1 
ATOM   366  C  CB    . GLU A 1 45  ? -18.177 23.794 17.522 1.00 22.36 ? 45   GLU A CB    1 
ATOM   367  C  CG    . GLU A 1 45  ? -18.817 24.102 16.171 1.00 21.88 ? 45   GLU A CG    1 
ATOM   368  C  CD    . GLU A 1 45  ? -20.301 24.421 16.285 1.00 23.74 ? 45   GLU A CD    1 
ATOM   369  O  OE1   . GLU A 1 45  ? -20.943 23.902 17.205 1.00 24.03 ? 45   GLU A OE1   1 
ATOM   370  O  OE2   . GLU A 1 45  ? -20.828 25.202 15.465 1.00 26.31 ? 45   GLU A OE2   1 
ATOM   371  H  H     . GLU A 1 45  ? -16.935 22.915 19.566 1.00 0.00  ? 45   GLU A H     1 
ATOM   372  N  N     . ASN A 1 46  ? -15.640 23.828 15.470 1.00 25.85 ? 46   ASN A N     1 
ATOM   373  C  CA    . ASN A 1 46  ? -14.767 24.599 14.577 1.00 28.35 ? 46   ASN A CA    1 
ATOM   374  C  C     . ASN A 1 46  ? -13.279 24.435 14.690 1.00 32.84 ? 46   ASN A C     1 
ATOM   375  O  O     . ASN A 1 46  ? -12.533 25.194 14.036 1.00 32.28 ? 46   ASN A O     1 
ATOM   376  C  CB    . ASN A 1 46  ? -15.078 26.079 14.640 1.00 29.69 ? 46   ASN A CB    1 
ATOM   377  C  CG    . ASN A 1 46  ? -16.480 26.364 14.290 1.00 31.74 ? 46   ASN A CG    1 
ATOM   378  O  OD1   . ASN A 1 46  ? -16.948 25.958 13.231 1.00 36.41 ? 46   ASN A OD1   1 
ATOM   379  N  ND2   . ASN A 1 46  ? -17.199 27.009 15.194 1.00 36.09 ? 46   ASN A ND2   1 
ATOM   380  H  H     . ASN A 1 46  ? -16.167 23.116 15.075 1.00 0.00  ? 46   ASN A H     1 
ATOM   381  H  HD21  . ASN A 1 46  ? -18.124 27.149 14.964 1.00 0.00  ? 46   ASN A HD21  1 
ATOM   382  H  HD22  . ASN A 1 46  ? -16.791 27.300 16.038 1.00 0.00  ? 46   ASN A HD22  1 
ATOM   383  N  N     . SER A 1 47  ? -12.837 23.468 15.501 1.00 31.90 ? 47   SER A N     1 
ATOM   384  C  CA    . SER A 1 47  ? -11.413 23.207 15.657 1.00 29.30 ? 47   SER A CA    1 
ATOM   385  C  C     . SER A 1 47  ? -11.066 21.853 15.065 1.00 32.10 ? 47   SER A C     1 
ATOM   386  O  O     . SER A 1 47  ? -11.946 21.082 14.679 1.00 38.22 ? 47   SER A O     1 
ATOM   387  C  CB    . SER A 1 47  ? -11.017 23.281 17.114 1.00 27.97 ? 47   SER A CB    1 
ATOM   388  O  OG    . SER A 1 47  ? -11.757 22.339 17.858 1.00 32.44 ? 47   SER A OG    1 
ATOM   389  H  H     . SER A 1 47  ? -13.470 22.937 16.028 1.00 0.00  ? 47   SER A H     1 
ATOM   390  H  HG    . SER A 1 47  ? -11.813 21.485 17.415 1.00 0.00  ? 47   SER A HG    1 
ATOM   391  N  N     . GLU A 1 48  ? -9.781  21.561 14.971 1.00 36.80 ? 48   GLU A N     1 
ATOM   392  C  CA    . GLU A 1 48  ? -9.337  20.298 14.392 1.00 41.27 ? 48   GLU A CA    1 
ATOM   393  C  C     . GLU A 1 48  ? -9.657  19.029 15.188 1.00 43.53 ? 48   GLU A C     1 
ATOM   394  O  O     . GLU A 1 48  ? -9.560  18.990 16.421 1.00 41.05 ? 48   GLU A O     1 
ATOM   395  C  CB    . GLU A 1 48  ? -7.856  20.375 14.031 1.00 37.37 ? 48   GLU A CB    1 
ATOM   396  C  CG    . GLU A 1 48  ? -7.642  21.236 12.842 1.00 37.21 ? 48   GLU A CG    1 
ATOM   397  C  CD    . GLU A 1 48  ? -6.254  21.761 12.766 1.00 44.11 ? 48   GLU A CD    1 
ATOM   398  O  OE1   . GLU A 1 48  ? -5.321  21.008 13.110 1.00 48.80 ? 48   GLU A OE1   1 
ATOM   399  O  OE2   . GLU A 1 48  ? -6.086  22.935 12.363 1.00 48.17 ? 48   GLU A OE2   1 
ATOM   400  H  H     . GLU A 1 48  ? -9.125  22.200 15.313 1.00 0.00  ? 48   GLU A H     1 
ATOM   401  N  N     . CYS A 1 49  ? -10.006 17.985 14.447 1.00 44.78 ? 49   CYS A N     1 
ATOM   402  C  CA    . CYS A 1 49  ? -10.377 16.709 15.023 1.00 44.02 ? 49   CYS A CA    1 
ATOM   403  C  C     . CYS A 1 49  ? -9.837  15.544 14.206 1.00 44.06 ? 49   CYS A C     1 
ATOM   404  O  O     . CYS A 1 49  ? -9.060  15.719 13.260 1.00 44.47 ? 49   CYS A O     1 
ATOM   405  C  CB    . CYS A 1 49  ? -11.906 16.618 15.078 1.00 40.81 ? 49   CYS A CB    1 
ATOM   406  S  SG    . CYS A 1 49  ? -12.697 17.175 13.537 1.00 38.03 ? 49   CYS A SG    1 
ATOM   407  H  H     . CYS A 1 49  ? -10.029 18.069 13.469 1.00 0.00  ? 49   CYS A H     1 
ATOM   408  N  N     . SER A 1 50  ? -10.267 14.351 14.589 1.00 42.63 ? 50   SER A N     1 
ATOM   409  C  CA    . SER A 1 50  ? -9.890  13.138 13.905 1.00 45.08 ? 50   SER A CA    1 
ATOM   410  C  C     . SER A 1 50  ? -11.110 12.265 13.881 1.00 48.01 ? 50   SER A C     1 
ATOM   411  O  O     . SER A 1 50  ? -12.003 12.389 14.736 1.00 44.67 ? 50   SER A O     1 
ATOM   412  C  CB    . SER A 1 50  ? -8.761  12.410 14.628 1.00 44.45 ? 50   SER A CB    1 
ATOM   413  O  OG    . SER A 1 50  ? -8.508  11.144 14.035 1.00 41.82 ? 50   SER A OG    1 
ATOM   414  H  H     . SER A 1 50  ? -10.887 14.259 15.344 1.00 0.00  ? 50   SER A H     1 
ATOM   415  H  HG    . SER A 1 50  ? -7.850  10.760 14.635 1.00 0.00  ? 50   SER A HG    1 
ATOM   416  N  N     . ALA A 1 51  ? -11.190 11.436 12.850 1.00 53.55 ? 51   ALA A N     1 
ATOM   417  C  CA    . ALA A 1 51  ? -12.311 10.524 12.738 1.00 61.45 ? 51   ALA A CA    1 
ATOM   418  C  C     . ALA A 1 51  ? -12.039 9.398  13.747 1.00 65.76 ? 51   ALA A C     1 
ATOM   419  O  O     . ALA A 1 51  ? -10.881 8.999  13.939 1.00 65.40 ? 51   ALA A O     1 
ATOM   420  C  CB    . ALA A 1 51  ? -12.418 9.985  11.305 1.00 59.16 ? 51   ALA A CB    1 
ATOM   421  H  H     . ALA A 1 51  ? -10.479 11.446 12.176 1.00 0.00  ? 51   ALA A H     1 
ATOM   422  N  N     . PHE A 1 52  ? -13.087 8.962  14.446 1.00 68.91 ? 52   PHE A N     1 
ATOM   423  C  CA    . PHE A 1 52  ? -12.989 7.889  15.433 1.00 73.45 ? 52   PHE A CA    1 
ATOM   424  C  C     . PHE A 1 52  ? -12.055 6.808  14.886 1.00 73.45 ? 52   PHE A C     1 
ATOM   425  O  O     . PHE A 1 52  ? -12.096 6.513  13.688 1.00 77.48 ? 52   PHE A O     1 
ATOM   426  C  CB    . PHE A 1 52  ? -14.404 7.341  15.719 1.00 76.72 ? 52   PHE A CB    1 
ATOM   427  C  CG    . PHE A 1 52  ? -14.433 5.922  16.230 1.00 80.45 ? 52   PHE A CG    1 
ATOM   428  C  CD1   . PHE A 1 52  ? -14.111 5.630  17.552 1.00 82.89 ? 52   PHE A CD1   1 
ATOM   429  C  CD2   . PHE A 1 52  ? -14.787 4.873  15.381 1.00 81.57 ? 52   PHE A CD2   1 
ATOM   430  C  CE1   . PHE A 1 52  ? -14.138 4.311  18.024 1.00 84.02 ? 52   PHE A CE1   1 
ATOM   431  C  CE2   . PHE A 1 52  ? -14.818 3.553  15.839 1.00 82.99 ? 52   PHE A CE2   1 
ATOM   432  C  CZ    . PHE A 1 52  ? -14.492 3.271  17.165 1.00 83.93 ? 52   PHE A CZ    1 
ATOM   433  H  H     . PHE A 1 52  ? -13.948 9.388  14.286 1.00 0.00  ? 52   PHE A H     1 
ATOM   434  N  N     . THR A 1 53  ? -11.178 6.262  15.723 1.00 71.24 ? 53   THR A N     1 
ATOM   435  C  CA    . THR A 1 53  ? -10.264 5.244  15.223 1.00 72.67 ? 53   THR A CA    1 
ATOM   436  C  C     . THR A 1 53  ? -10.238 3.906  15.950 1.00 73.72 ? 53   THR A C     1 
ATOM   437  O  O     . THR A 1 53  ? -10.892 3.727  16.979 1.00 72.38 ? 53   THR A O     1 
ATOM   438  C  CB    . THR A 1 53  ? -8.808  5.786  15.077 1.00 74.66 ? 53   THR A CB    1 
ATOM   439  O  OG1   . THR A 1 53  ? -8.292  6.212  16.347 1.00 71.63 ? 53   THR A OG1   1 
ATOM   440  C  CG2   . THR A 1 53  ? -8.765  6.940  14.086 1.00 75.90 ? 53   THR A CG2   1 
ATOM   441  H  H     . THR A 1 53  ? -11.157 6.531  16.666 1.00 0.00  ? 53   THR A H     1 
ATOM   442  H  HG1   . THR A 1 53  ? -8.821  6.975  16.620 1.00 0.00  ? 53   THR A HG1   1 
ATOM   443  N  N     . LEU A 1 54  ? -9.478  2.973  15.368 1.00 75.55 ? 54   LEU A N     1 
ATOM   444  C  CA    . LEU A 1 54  ? -9.287  1.612  15.882 1.00 76.55 ? 54   LEU A CA    1 
ATOM   445  C  C     . LEU A 1 54  ? -7.955  1.483  16.622 1.00 74.74 ? 54   LEU A C     1 
ATOM   446  O  O     . LEU A 1 54  ? -7.720  0.496  17.322 1.00 74.89 ? 54   LEU A O     1 
ATOM   447  C  CB    . LEU A 1 54  ? -9.322  0.584  14.729 1.00 79.89 ? 54   LEU A CB    1 
ATOM   448  C  CG    . LEU A 1 54  ? -8.203  0.397  13.662 1.00 82.15 ? 54   LEU A CG    1 
ATOM   449  C  CD1   . LEU A 1 54  ? -7.801  1.716  12.992 1.00 81.58 ? 54   LEU A CD1   1 
ATOM   450  C  CD2   . LEU A 1 54  ? -6.972  -0.300 14.238 1.00 81.07 ? 54   LEU A CD2   1 
ATOM   451  H  H     . LEU A 1 54  ? -9.048  3.197  14.521 1.00 0.00  ? 54   LEU A H     1 
ATOM   452  N  N     . TYR A 1 55  ? -7.070  2.459  16.428 1.00 70.45 ? 55   TYR A N     1 
ATOM   453  C  CA    . TYR A 1 55  ? -5.760  2.440  17.068 1.00 65.23 ? 55   TYR A CA    1 
ATOM   454  C  C     . TYR A 1 55  ? -5.738  2.813  18.548 1.00 62.83 ? 55   TYR A C     1 
ATOM   455  O  O     . TYR A 1 55  ? -4.709  2.672  19.218 1.00 62.66 ? 55   TYR A O     1 
ATOM   456  C  CB    . TYR A 1 55  ? -4.789  3.308  16.286 1.00 65.55 ? 55   TYR A CB    1 
ATOM   457  C  CG    . TYR A 1 55  ? -4.350  2.678  14.995 1.00 65.52 ? 55   TYR A CG    1 
ATOM   458  C  CD1   . TYR A 1 55  ? -3.909  1.360  14.961 1.00 66.32 ? 55   TYR A CD1   1 
ATOM   459  C  CD2   . TYR A 1 55  ? -4.366  3.398  13.808 1.00 67.11 ? 55   TYR A CD2   1 
ATOM   460  C  CE1   . TYR A 1 55  ? -3.492  0.772  13.773 1.00 68.63 ? 55   TYR A CE1   1 
ATOM   461  C  CE2   . TYR A 1 55  ? -3.951  2.824  12.613 1.00 69.65 ? 55   TYR A CE2   1 
ATOM   462  C  CZ    . TYR A 1 55  ? -3.515  1.509  12.600 1.00 69.08 ? 55   TYR A CZ    1 
ATOM   463  O  OH    . TYR A 1 55  ? -3.102  0.933  11.421 1.00 68.57 ? 55   TYR A OH    1 
ATOM   464  H  H     . TYR A 1 55  ? -7.304  3.203  15.845 1.00 0.00  ? 55   TYR A H     1 
ATOM   465  H  HH    . TYR A 1 55  ? -2.789  0.046  11.594 1.00 0.00  ? 55   TYR A HH    1 
ATOM   466  N  N     . GLY A 1 56  ? -6.862  3.313  19.051 1.00 57.23 ? 56   GLY A N     1 
ATOM   467  C  CA    . GLY A 1 56  ? -6.942  3.670  20.454 1.00 51.43 ? 56   GLY A CA    1 
ATOM   468  C  C     . GLY A 1 56  ? -6.477  5.064  20.821 1.00 44.25 ? 56   GLY A C     1 
ATOM   469  O  O     . GLY A 1 56  ? -6.931  5.614  21.825 1.00 40.93 ? 56   GLY A O     1 
ATOM   470  H  H     . GLY A 1 56  ? -7.633  3.450  18.468 1.00 0.00  ? 56   GLY A H     1 
ATOM   471  N  N     . VAL A 1 57  ? -5.519  5.603  20.079 1.00 42.20 ? 57   VAL A N     1 
ATOM   472  C  CA    . VAL A 1 57  ? -5.030  6.949  20.349 1.00 44.07 ? 57   VAL A CA    1 
ATOM   473  C  C     . VAL A 1 57  ? -5.240  7.822  19.117 1.00 46.75 ? 57   VAL A C     1 
ATOM   474  O  O     . VAL A 1 57  ? -5.448  7.309  18.004 1.00 51.75 ? 57   VAL A O     1 
ATOM   475  C  CB    . VAL A 1 57  ? -3.534  6.994  20.794 1.00 42.89 ? 57   VAL A CB    1 
ATOM   476  C  CG1   . VAL A 1 57  ? -3.248  5.903  21.811 1.00 43.81 ? 57   VAL A CG1   1 
ATOM   477  C  CG2   . VAL A 1 57  ? -2.602  6.913  19.609 1.00 42.70 ? 57   VAL A CG2   1 
ATOM   478  H  H     . VAL A 1 57  ? -5.107  5.101  19.351 1.00 0.00  ? 57   VAL A H     1 
ATOM   479  N  N     . TYR A 1 58  ? -5.164  9.135  19.319 1.00 43.83 ? 58   TYR A N     1 
ATOM   480  C  CA    . TYR A 1 58  ? -5.372  10.105 18.260 1.00 36.90 ? 58   TYR A CA    1 
ATOM   481  C  C     . TYR A 1 58  ? -4.249  11.123 18.205 1.00 37.62 ? 58   TYR A C     1 
ATOM   482  O  O     . TYR A 1 58  ? -3.478  11.251 19.164 1.00 44.76 ? 58   TYR A O     1 
ATOM   483  C  CB    . TYR A 1 58  ? -6.644  10.873 18.575 1.00 35.97 ? 58   TYR A CB    1 
ATOM   484  C  CG    . TYR A 1 58  ? -7.904  10.053 18.601 1.00 31.72 ? 58   TYR A CG    1 
ATOM   485  C  CD1   . TYR A 1 58  ? -8.308  9.395  19.762 1.00 24.31 ? 58   TYR A CD1   1 
ATOM   486  C  CD2   . TYR A 1 58  ? -8.698  9.941  17.455 1.00 28.84 ? 58   TYR A CD2   1 
ATOM   487  C  CE1   . TYR A 1 58  ? -9.465  8.643  19.780 1.00 29.78 ? 58   TYR A CE1   1 
ATOM   488  C  CE2   . TYR A 1 58  ? -9.865  9.196  17.462 1.00 29.80 ? 58   TYR A CE2   1 
ATOM   489  C  CZ    . TYR A 1 58  ? -10.248 8.543  18.624 1.00 31.67 ? 58   TYR A CZ    1 
ATOM   490  O  OH    . TYR A 1 58  ? -11.408 7.777  18.606 1.00 33.33 ? 58   TYR A OH    1 
ATOM   491  H  H     . TYR A 1 58  ? -4.961  9.464  20.218 1.00 0.00  ? 58   TYR A H     1 
ATOM   492  H  HH    . TYR A 1 58  ? -11.536 7.347  19.468 1.00 0.00  ? 58   TYR A HH    1 
ATOM   493  N  N     . TYR A 1 59  ? -4.103  11.799 17.070 1.00 32.04 ? 59   TYR A N     1 
ATOM   494  C  CA    . TYR A 1 59  ? -3.136  12.885 16.967 1.00 30.37 ? 59   TYR A CA    1 
ATOM   495  C  C     . TYR A 1 59  ? -3.984  14.135 17.198 1.00 26.05 ? 59   TYR A C     1 
ATOM   496  O  O     . TYR A 1 59  ? -3.502  15.171 17.622 1.00 23.92 ? 59   TYR A O     1 
ATOM   497  C  CB    . TYR A 1 59  ? -2.459  12.910 15.611 1.00 33.90 ? 59   TYR A CB    1 
ATOM   498  C  CG    . TYR A 1 59  ? -1.433  11.821 15.488 1.00 46.40 ? 59   TYR A CG    1 
ATOM   499  C  CD1   . TYR A 1 59  ? -0.189  11.937 16.116 1.00 48.78 ? 59   TYR A CD1   1 
ATOM   500  C  CD2   . TYR A 1 59  ? -1.708  10.648 14.772 1.00 50.97 ? 59   TYR A CD2   1 
ATOM   501  C  CE1   . TYR A 1 59  ? 0.749   10.918 16.035 1.00 51.46 ? 59   TYR A CE1   1 
ATOM   502  C  CE2   . TYR A 1 59  ? -0.770  9.619  14.690 1.00 52.76 ? 59   TYR A CE2   1 
ATOM   503  C  CZ    . TYR A 1 59  ? 0.450   9.762  15.324 1.00 52.39 ? 59   TYR A CZ    1 
ATOM   504  O  OH    . TYR A 1 59  ? 1.365   8.741  15.271 1.00 55.38 ? 59   TYR A OH    1 
ATOM   505  H  H     . TYR A 1 59  ? -4.587  11.600 16.262 1.00 0.00  ? 59   TYR A H     1 
ATOM   506  H  HH    . TYR A 1 59  ? 2.179   9.027  15.672 1.00 0.00  ? 59   TYR A HH    1 
ATOM   507  N  N     . LYS A 1 60  ? -5.282  13.974 16.982 1.00 27.35 ? 60   LYS A N     1 
ATOM   508  C  CA    . LYS A 1 60  ? -6.280  15.012 17.185 1.00 29.98 ? 60   LYS A CA    1 
ATOM   509  C  C     . LYS A 1 60  ? -7.467  14.250 17.732 1.00 28.26 ? 60   LYS A C     1 
ATOM   510  O  O     . LYS A 1 60  ? -7.666  13.102 17.395 1.00 26.02 ? 60   LYS A O     1 
ATOM   511  C  CB    . LYS A 1 60  ? -6.638  15.704 15.868 1.00 36.12 ? 60   LYS A CB    1 
ATOM   512  C  CG    . LYS A 1 60  ? -5.486  16.527 15.303 1.00 39.38 ? 60   LYS A CG    1 
ATOM   513  C  CD    . LYS A 1 60  ? -5.830  17.153 13.990 1.00 42.02 ? 60   LYS A CD    1 
ATOM   514  C  CE    . LYS A 1 60  ? -4.604  17.808 13.420 1.00 43.81 ? 60   LYS A CE    1 
ATOM   515  N  NZ    . LYS A 1 60  ? -4.895  18.410 12.098 1.00 49.79 ? 60   LYS A NZ    1 
ATOM   516  H  H     . LYS A 1 60  ? -5.622  13.109 16.674 1.00 0.00  ? 60   LYS A H     1 
ATOM   517  H  HZ1   . LYS A 1 60  ? -5.211  17.651 11.465 1.00 0.00  ? 60   LYS A HZ1   1 
ATOM   518  H  HZ2   . LYS A 1 60  ? -5.632  19.133 12.190 1.00 0.00  ? 60   LYS A HZ2   1 
ATOM   519  H  HZ3   . LYS A 1 60  ? -4.035  18.848 11.713 1.00 0.00  ? 60   LYS A HZ3   1 
ATOM   520  N  N     . CYS A 1 61  ? -8.227  14.873 18.610 1.00 28.57 ? 61   CYS A N     1 
ATOM   521  C  CA    . CYS A 1 61  ? -9.352  14.222 19.230 1.00 27.56 ? 61   CYS A CA    1 
ATOM   522  C  C     . CYS A 1 61  ? -10.642 14.307 18.435 1.00 31.44 ? 61   CYS A C     1 
ATOM   523  O  O     . CYS A 1 61  ? -10.828 15.216 17.622 1.00 31.56 ? 61   CYS A O     1 
ATOM   524  C  CB    . CYS A 1 61  ? -9.637  14.866 20.588 1.00 26.97 ? 61   CYS A CB    1 
ATOM   525  S  SG    . CYS A 1 61  ? -8.478  14.554 21.944 1.00 32.37 ? 61   CYS A SG    1 
ATOM   526  H  H     . CYS A 1 61  ? -8.008  15.798 18.863 1.00 0.00  ? 61   CYS A H     1 
ATOM   527  N  N     . PRO A 1 62  ? -11.543 13.330 18.644 1.00 27.10 ? 62   PRO A N     1 
ATOM   528  C  CA    . PRO A 1 62  ? -12.826 13.334 17.959 1.00 26.17 ? 62   PRO A CA    1 
ATOM   529  C  C     . PRO A 1 62  ? -13.610 14.519 18.558 1.00 28.50 ? 62   PRO A C     1 
ATOM   530  O  O     . PRO A 1 62  ? -13.260 15.045 19.632 1.00 26.80 ? 62   PRO A O     1 
ATOM   531  C  CB    . PRO A 1 62  ? -13.430 11.990 18.388 1.00 28.65 ? 62   PRO A CB    1 
ATOM   532  C  CG    . PRO A 1 62  ? -12.774 11.705 19.734 1.00 25.41 ? 62   PRO A CG    1 
ATOM   533  C  CD    . PRO A 1 62  ? -11.370 12.090 19.428 1.00 26.39 ? 62   PRO A CD    1 
ATOM   534  N  N     . CYS A 1 63  ? -14.668 14.936 17.879 1.00 31.01 ? 63   CYS A N     1 
ATOM   535  C  CA    . CYS A 1 63  ? -15.484 16.061 18.338 1.00 29.55 ? 63   CYS A CA    1 
ATOM   536  C  C     . CYS A 1 63  ? -16.377 15.707 19.510 1.00 27.01 ? 63   CYS A C     1 
ATOM   537  O  O     . CYS A 1 63  ? -16.498 14.543 19.876 1.00 27.69 ? 63   CYS A O     1 
ATOM   538  C  CB    . CYS A 1 63  ? -16.360 16.573 17.203 1.00 28.92 ? 63   CYS A CB    1 
ATOM   539  S  SG    . CYS A 1 63  ? -15.436 16.969 15.694 1.00 30.31 ? 63   CYS A SG    1 
ATOM   540  H  H     . CYS A 1 63  ? -14.941 14.481 17.052 1.00 0.00  ? 63   CYS A H     1 
ATOM   541  N  N     . GLU A 1 64  ? -16.953 16.737 20.119 1.00 26.71 ? 64   GLU A N     1 
ATOM   542  C  CA    . GLU A 1 64  ? -17.871 16.577 21.236 1.00 27.93 ? 64   GLU A CA    1 
ATOM   543  C  C     . GLU A 1 64  ? -19.253 16.132 20.708 1.00 26.74 ? 64   GLU A C     1 
ATOM   544  O  O     . GLU A 1 64  ? -19.474 16.015 19.501 1.00 32.34 ? 64   GLU A O     1 
ATOM   545  C  CB    . GLU A 1 64  ? -18.032 17.903 21.974 1.00 31.82 ? 64   GLU A CB    1 
ATOM   546  C  CG    . GLU A 1 64  ? -16.769 18.493 22.567 1.00 31.56 ? 64   GLU A CG    1 
ATOM   547  C  CD    . GLU A 1 64  ? -16.997 19.927 22.975 1.00 30.54 ? 64   GLU A CD    1 
ATOM   548  O  OE1   . GLU A 1 64  ? -17.380 20.715 22.103 1.00 31.40 ? 64   GLU A OE1   1 
ATOM   549  O  OE2   . GLU A 1 64  ? -16.832 20.267 24.157 1.00 29.53 ? 64   GLU A OE2   1 
ATOM   550  H  H     . GLU A 1 64  ? -16.743 17.639 19.805 1.00 0.00  ? 64   GLU A H     1 
ATOM   551  N  N     . ARG A 1 65  ? -20.215 15.983 21.596 1.00 22.90 ? 65   ARG A N     1 
ATOM   552  C  CA    . ARG A 1 65  ? -21.516 15.523 21.164 1.00 28.05 ? 65   ARG A CA    1 
ATOM   553  C  C     . ARG A 1 65  ? -22.234 16.419 20.184 1.00 30.80 ? 65   ARG A C     1 
ATOM   554  O  O     . ARG A 1 65  ? -22.124 17.660 20.238 1.00 32.61 ? 65   ARG A O     1 
ATOM   555  C  CB    . ARG A 1 65  ? -22.420 15.204 22.351 1.00 29.02 ? 65   ARG A CB    1 
ATOM   556  C  CG    . ARG A 1 65  ? -21.911 15.727 23.655 1.00 33.19 ? 65   ARG A CG    1 
ATOM   557  C  CD    . ARG A 1 65  ? -22.784 15.259 24.763 1.00 36.88 ? 65   ARG A CD    1 
ATOM   558  N  NE    . ARG A 1 65  ? -22.755 13.812 24.827 1.00 36.00 ? 65   ARG A NE    1 
ATOM   559  C  CZ    . ARG A 1 65  ? -22.062 13.126 25.719 1.00 35.10 ? 65   ARG A CZ    1 
ATOM   560  N  NH1   . ARG A 1 65  ? -21.353 13.767 26.648 1.00 34.17 ? 65   ARG A NH1   1 
ATOM   561  N  NH2   . ARG A 1 65  ? -22.107 11.797 25.685 1.00 37.33 ? 65   ARG A NH2   1 
ATOM   562  H  H     . ARG A 1 65  ? -20.008 16.201 22.522 1.00 0.00  ? 65   ARG A H     1 
ATOM   563  H  HE    . ARG A 1 65  ? -23.283 13.309 24.171 1.00 0.00  ? 65   ARG A HE    1 
ATOM   564  H  HH11  . ARG A 1 65  ? -21.329 14.767 26.684 1.00 0.00  ? 65   ARG A HH11  1 
ATOM   565  H  HH12  . ARG A 1 65  ? -20.830 13.242 27.322 1.00 0.00  ? 65   ARG A HH12  1 
ATOM   566  H  HH21  . ARG A 1 65  ? -22.656 11.334 24.990 1.00 0.00  ? 65   ARG A HH21  1 
ATOM   567  H  HH22  . ARG A 1 65  ? -21.588 11.263 26.353 1.00 0.00  ? 65   ARG A HH22  1 
ATOM   568  N  N     . GLY A 1 66  ? -22.938 15.751 19.268 1.00 29.46 ? 66   GLY A N     1 
ATOM   569  C  CA    . GLY A 1 66  ? -23.730 16.407 18.243 1.00 26.28 ? 66   GLY A CA    1 
ATOM   570  C  C     . GLY A 1 66  ? -22.898 17.013 17.144 1.00 25.80 ? 66   GLY A C     1 
ATOM   571  O  O     . GLY A 1 66  ? -23.420 17.658 16.228 1.00 28.71 ? 66   GLY A O     1 
ATOM   572  H  H     . GLY A 1 66  ? -22.891 14.771 19.263 1.00 0.00  ? 66   GLY A H     1 
ATOM   573  N  N     . LEU A 1 67  ? -21.602 16.762 17.198 1.00 24.71 ? 67   LEU A N     1 
ATOM   574  C  CA    . LEU A 1 67  ? -20.713 17.324 16.218 1.00 24.13 ? 67   LEU A CA    1 
ATOM   575  C  C     . LEU A 1 67  ? -20.106 16.297 15.265 1.00 27.50 ? 67   LEU A C     1 
ATOM   576  O  O     . LEU A 1 67  ? -19.812 15.160 15.644 1.00 32.31 ? 67   LEU A O     1 
ATOM   577  C  CB    . LEU A 1 67  ? -19.627 18.069 16.964 1.00 22.78 ? 67   LEU A CB    1 
ATOM   578  C  CG    . LEU A 1 67  ? -19.589 19.586 17.045 1.00 21.51 ? 67   LEU A CG    1 
ATOM   579  C  CD1   . LEU A 1 67  ? -20.951 20.196 17.141 1.00 18.45 ? 67   LEU A CD1   1 
ATOM   580  C  CD2   . LEU A 1 67  ? -18.726 19.928 18.235 1.00 19.96 ? 67   LEU A CD2   1 
ATOM   581  H  H     . LEU A 1 67  ? -21.224 16.177 17.889 1.00 0.00  ? 67   LEU A H     1 
ATOM   582  N  N     . THR A 1 68  ? -19.891 16.718 14.028 1.00 32.23 ? 68   THR A N     1 
ATOM   583  C  CA    . THR A 1 68  ? -19.302 15.864 13.012 1.00 30.97 ? 68   THR A CA    1 
ATOM   584  C  C     . THR A 1 68  ? -17.934 16.369 12.610 1.00 31.20 ? 68   THR A C     1 
ATOM   585  O  O     . THR A 1 68  ? -17.769 17.541 12.274 1.00 31.77 ? 68   THR A O     1 
ATOM   586  C  CB    . THR A 1 68  ? -20.116 15.865 11.711 1.00 31.77 ? 68   THR A CB    1 
ATOM   587  O  OG1   . THR A 1 68  ? -21.488 15.543 11.969 1.00 32.40 ? 68   THR A OG1   1 
ATOM   588  C  CG2   . THR A 1 68  ? -19.523 14.848 10.758 1.00 31.81 ? 68   THR A CG2   1 
ATOM   589  H  H     . THR A 1 68  ? -20.138 17.628 13.759 1.00 0.00  ? 68   THR A H     1 
ATOM   590  H  HG1   . THR A 1 68  ? -21.959 15.806 11.148 1.00 0.00  ? 68   THR A HG1   1 
ATOM   591  N  N     . CYS A 1 69  ? -16.964 15.473 12.570 1.00 32.89 ? 69   CYS A N     1 
ATOM   592  C  CA    . CYS A 1 69  ? -15.639 15.864 12.150 1.00 33.26 ? 69   CYS A CA    1 
ATOM   593  C  C     . CYS A 1 69  ? -15.570 15.760 10.627 1.00 34.88 ? 69   CYS A C     1 
ATOM   594  O  O     . CYS A 1 69  ? -15.376 14.683 10.076 1.00 39.97 ? 69   CYS A O     1 
ATOM   595  C  CB    . CYS A 1 69  ? -14.584 14.965 12.788 1.00 33.05 ? 69   CYS A CB    1 
ATOM   596  S  SG    . CYS A 1 69  ? -12.904 15.520 12.384 1.00 35.61 ? 69   CYS A SG    1 
ATOM   597  H  H     . CYS A 1 69  ? -17.115 14.540 12.836 1.00 0.00  ? 69   CYS A H     1 
ATOM   598  N  N     . GLU A 1 70  ? -15.753 16.882 9.948  1.00 37.53 ? 70   GLU A N     1 
ATOM   599  C  CA    . GLU A 1 70  ? -15.713 16.911 8.494  1.00 36.76 ? 70   GLU A CA    1 
ATOM   600  C  C     . GLU A 1 70  ? -14.315 17.069 7.926  1.00 36.93 ? 70   GLU A C     1 
ATOM   601  O  O     . GLU A 1 70  ? -13.600 18.004 8.246  1.00 32.72 ? 70   GLU A O     1 
ATOM   602  C  CB    . GLU A 1 70  ? -16.548 18.059 7.965  1.00 41.81 ? 70   GLU A CB    1 
ATOM   603  C  CG    . GLU A 1 70  ? -18.010 17.991 8.260  1.00 46.91 ? 70   GLU A CG    1 
ATOM   604  C  CD    . GLU A 1 70  ? -18.759 19.151 7.639  1.00 50.81 ? 70   GLU A CD    1 
ATOM   605  O  OE1   . GLU A 1 70  ? -18.109 20.026 7.019  1.00 52.42 ? 70   GLU A OE1   1 
ATOM   606  O  OE2   . GLU A 1 70  ? -20.002 19.185 7.764  1.00 53.07 ? 70   GLU A OE2   1 
ATOM   607  H  H     . GLU A 1 70  ? -15.880 17.711 10.455 1.00 0.00  ? 70   GLU A H     1 
ATOM   608  N  N     . GLY A 1 71  ? -13.980 16.187 7.005  1.00 43.98 ? 71   GLY A N     1 
ATOM   609  C  CA    . GLY A 1 71  ? -12.690 16.213 6.350  1.00 51.51 ? 71   GLY A CA    1 
ATOM   610  C  C     . GLY A 1 71  ? -12.570 15.001 5.436  1.00 56.44 ? 71   GLY A C     1 
ATOM   611  O  O     . GLY A 1 71  ? -13.481 14.154 5.365  1.00 54.00 ? 71   GLY A O     1 
ATOM   612  H  H     . GLY A 1 71  ? -14.571 15.438 6.767  1.00 0.00  ? 71   GLY A H     1 
ATOM   613  N  N     . ASP A 1 72  ? -11.460 14.913 4.716  1.00 57.87 ? 72   ASP A N     1 
ATOM   614  C  CA    . ASP A 1 72  ? -11.271 13.790 3.828  1.00 59.25 ? 72   ASP A CA    1 
ATOM   615  C  C     . ASP A 1 72  ? -10.966 12.558 4.638  1.00 58.34 ? 72   ASP A C     1 
ATOM   616  O  O     . ASP A 1 72  ? -10.111 12.576 5.528  1.00 59.26 ? 72   ASP A O     1 
ATOM   617  C  CB    . ASP A 1 72  ? -10.162 14.071 2.823  1.00 64.51 ? 72   ASP A CB    1 
ATOM   618  C  CG    . ASP A 1 72  ? -10.627 14.958 1.682  1.00 70.41 ? 72   ASP A CG    1 
ATOM   619  O  OD1   . ASP A 1 72  ? -10.649 16.203 1.854  1.00 72.50 ? 72   ASP A OD1   1 
ATOM   620  O  OD2   . ASP A 1 72  ? -10.989 14.400 0.618  1.00 72.53 ? 72   ASP A OD2   1 
ATOM   621  H  H     . ASP A 1 72  ? -10.755 15.588 4.813  1.00 0.00  ? 72   ASP A H     1 
ATOM   622  N  N     . LYS A 1 73  ? -11.740 11.515 4.383  1.00 58.28 ? 73   LYS A N     1 
ATOM   623  C  CA    . LYS A 1 73  ? -11.567 10.239 5.056  1.00 59.82 ? 73   LYS A CA    1 
ATOM   624  C  C     . LYS A 1 73  ? -11.015 9.309  3.979  1.00 61.90 ? 73   LYS A C     1 
ATOM   625  O  O     . LYS A 1 73  ? -11.675 9.086  2.957  1.00 67.79 ? 73   LYS A O     1 
ATOM   626  C  CB    . LYS A 1 73  ? -12.917 9.732  5.554  1.00 58.97 ? 73   LYS A CB    1 
ATOM   627  C  CG    . LYS A 1 73  ? -12.835 8.652  6.616  1.00 62.77 ? 73   LYS A CG    1 
ATOM   628  C  CD    . LYS A 1 73  ? -14.215 8.319  7.201  1.00 64.15 ? 73   LYS A CD    1 
ATOM   629  C  CE    . LYS A 1 73  ? -15.050 9.572  7.522  1.00 63.96 ? 73   LYS A CE    1 
ATOM   630  N  NZ    . LYS A 1 73  ? -14.410 10.559 8.451  1.00 63.74 ? 73   LYS A NZ    1 
ATOM   631  H  H     . LYS A 1 73  ? -12.458 11.592 3.729  1.00 0.00  ? 73   LYS A H     1 
ATOM   632  H  HZ1   . LYS A 1 73  ? -14.206 10.101 9.361  1.00 0.00  ? 73   LYS A HZ1   1 
ATOM   633  H  HZ2   . LYS A 1 73  ? -13.527 10.924 8.041  1.00 0.00  ? 73   LYS A HZ2   1 
ATOM   634  H  HZ3   . LYS A 1 73  ? -15.070 11.348 8.603  1.00 0.00  ? 73   LYS A HZ3   1 
ATOM   635  N  N     . SER A 1 74  ? -9.797  8.811  4.172  1.00 59.41 ? 74   SER A N     1 
ATOM   636  C  CA    . SER A 1 74  ? -9.177  7.931  3.191  1.00 56.04 ? 74   SER A CA    1 
ATOM   637  C  C     . SER A 1 74  ? -8.884  6.552  3.742  1.00 54.24 ? 74   SER A C     1 
ATOM   638  O  O     . SER A 1 74  ? -8.903  6.336  4.950  1.00 52.60 ? 74   SER A O     1 
ATOM   639  C  CB    . SER A 1 74  ? -7.875  8.553  2.698  1.00 56.95 ? 74   SER A CB    1 
ATOM   640  O  OG    . SER A 1 74  ? -7.266  7.753  1.699  1.00 59.03 ? 74   SER A OG    1 
ATOM   641  H  H     . SER A 1 74  ? -9.308  9.021  4.988  1.00 0.00  ? 74   SER A H     1 
ATOM   642  H  HG    . SER A 1 74  ? -7.315  6.799  1.816  1.00 0.00  ? 74   SER A HG    1 
ATOM   643  N  N     . LEU A 1 75  ? -8.573  5.629  2.837  1.00 56.55 ? 75   LEU A N     1 
ATOM   644  C  CA    . LEU A 1 75  ? -8.220  4.254  3.206  1.00 56.83 ? 75   LEU A CA    1 
ATOM   645  C  C     . LEU A 1 75  ? -6.811  4.323  3.763  1.00 54.28 ? 75   LEU A C     1 
ATOM   646  O  O     . LEU A 1 75  ? -6.481  3.628  4.712  1.00 55.68 ? 75   LEU A O     1 
ATOM   647  C  CB    . LEU A 1 75  ? -8.291  3.309  1.987  1.00 53.00 ? 75   LEU A CB    1 
ATOM   648  C  CG    . LEU A 1 75  ? -7.910  1.833  2.135  1.00 51.95 ? 75   LEU A CG    1 
ATOM   649  C  CD1   . LEU A 1 75  ? -6.395  1.615  2.059  1.00 49.41 ? 75   LEU A CD1   1 
ATOM   650  C  CD2   . LEU A 1 75  ? -8.475  1.321  3.437  1.00 52.67 ? 75   LEU A CD2   1 
ATOM   651  H  H     . LEU A 1 75  ? -8.600  5.846  1.883  1.00 0.00  ? 75   LEU A H     1 
ATOM   652  N  N     . VAL A 1 76  ? -5.968  5.139  3.146  1.00 54.55 ? 76   VAL A N     1 
ATOM   653  C  CA    . VAL A 1 76  ? -4.617  5.307  3.657  1.00 59.84 ? 76   VAL A CA    1 
ATOM   654  C  C     . VAL A 1 76  ? -4.746  6.036  5.011  1.00 62.68 ? 76   VAL A C     1 
ATOM   655  O  O     . VAL A 1 76  ? -4.193  5.593  6.029  1.00 62.20 ? 76   VAL A O     1 
ATOM   656  C  CB    . VAL A 1 76  ? -3.737  6.090  2.647  1.00 59.24 ? 76   VAL A CB    1 
ATOM   657  C  CG1   . VAL A 1 76  ? -2.542  6.743  3.335  1.00 59.61 ? 76   VAL A CG1   1 
ATOM   658  C  CG2   . VAL A 1 76  ? -3.240  5.131  1.582  1.00 60.78 ? 76   VAL A CG2   1 
ATOM   659  H  H     . VAL A 1 76  ? -6.234  5.574  2.309  1.00 0.00  ? 76   VAL A H     1 
ATOM   660  N  N     . GLY A 1 77  ? -5.565  7.093  5.023  1.00 64.65 ? 77   GLY A N     1 
ATOM   661  C  CA    . GLY A 1 77  ? -5.809  7.879  6.226  1.00 61.21 ? 77   GLY A CA    1 
ATOM   662  C  C     . GLY A 1 77  ? -6.261  7.047  7.418  1.00 59.54 ? 77   GLY A C     1 
ATOM   663  O  O     . GLY A 1 77  ? -5.971  7.392  8.560  1.00 60.77 ? 77   GLY A O     1 
ATOM   664  H  H     . GLY A 1 77  ? -6.006  7.350  4.193  1.00 0.00  ? 77   GLY A H     1 
ATOM   665  N  N     . SER A 1 78  ? -6.975  5.960  7.163  1.00 55.25 ? 78   SER A N     1 
ATOM   666  C  CA    . SER A 1 78  ? -7.419  5.103  8.240  1.00 55.03 ? 78   SER A CA    1 
ATOM   667  C  C     . SER A 1 78  ? -6.251  4.310  8.832  1.00 59.45 ? 78   SER A C     1 
ATOM   668  O  O     . SER A 1 78  ? -6.019  4.369  10.052 1.00 62.61 ? 78   SER A O     1 
ATOM   669  C  CB    . SER A 1 78  ? -8.507  4.171  7.741  1.00 53.91 ? 78   SER A CB    1 
ATOM   670  O  OG    . SER A 1 78  ? -9.519  4.919  7.102  1.00 52.87 ? 78   SER A OG    1 
ATOM   671  H  H     . SER A 1 78  ? -7.255  5.729  6.251  1.00 0.00  ? 78   SER A H     1 
ATOM   672  H  HG    . SER A 1 78  ? -10.014 5.421  7.758  1.00 0.00  ? 78   SER A HG    1 
ATOM   673  N  N     . ILE A 1 79  ? -5.477  3.627  7.977  1.00 60.30 ? 79   ILE A N     1 
ATOM   674  C  CA    . ILE A 1 79  ? -4.338  2.827  8.462  1.00 58.54 ? 79   ILE A CA    1 
ATOM   675  C  C     . ILE A 1 79  ? -3.245  3.722  9.025  1.00 56.32 ? 79   ILE A C     1 
ATOM   676  O  O     . ILE A 1 79  ? -2.443  3.297  9.853  1.00 56.76 ? 79   ILE A O     1 
ATOM   677  C  CB    . ILE A 1 79  ? -3.743  1.780  7.396  1.00 58.68 ? 79   ILE A CB    1 
ATOM   678  C  CG1   . ILE A 1 79  ? -2.261  2.052  7.091  1.00 58.47 ? 79   ILE A CG1   1 
ATOM   679  C  CG2   . ILE A 1 79  ? -4.587  1.694  6.117  1.00 55.64 ? 79   ILE A CG2   1 
ATOM   680  C  CD1   . ILE A 1 79  ? -1.987  3.254  6.201  1.00 60.37 ? 79   ILE A CD1   1 
ATOM   681  H  H     . ILE A 1 79  ? -5.668  3.673  7.017  1.00 0.00  ? 79   ILE A H     1 
ATOM   682  N  N     . THR A 1 80  ? -3.229  4.970  8.589  1.00 52.13 ? 80   THR A N     1 
ATOM   683  C  CA    . THR A 1 80  ? -2.228  5.883  9.084  1.00 52.47 ? 80   THR A CA    1 
ATOM   684  C  C     . THR A 1 80  ? -2.694  6.771  10.272 1.00 52.54 ? 80   THR A C     1 
ATOM   685  O  O     . THR A 1 80  ? -1.877  7.492  10.859 1.00 46.57 ? 80   THR A O     1 
ATOM   686  C  CB    . THR A 1 80  ? -1.674  6.711  7.930  1.00 52.13 ? 80   THR A CB    1 
ATOM   687  O  OG1   . THR A 1 80  ? -0.450  7.323  8.331  1.00 56.51 ? 80   THR A OG1   1 
ATOM   688  C  CG2   . THR A 1 80  ? -2.659  7.777  7.511  1.00 53.49 ? 80   THR A CG2   1 
ATOM   689  H  H     . THR A 1 80  ? -3.873  5.271  7.923  1.00 0.00  ? 80   THR A H     1 
ATOM   690  H  HG1   . THR A 1 80  ? -0.616  7.819  9.147  1.00 0.00  ? 80   THR A HG1   1 
ATOM   691  N  N     . ASN A 1 81  ? -3.982  6.683  10.645 1.00 53.58 ? 81   ASN A N     1 
ATOM   692  C  CA    . ASN A 1 81  ? -4.552  7.466  11.762 1.00 53.08 ? 81   ASN A CA    1 
ATOM   693  C  C     . ASN A 1 81  ? -4.404  8.981  11.459 1.00 51.61 ? 81   ASN A C     1 
ATOM   694  O  O     . ASN A 1 81  ? -3.970  9.783  12.297 1.00 49.90 ? 81   ASN A O     1 
ATOM   695  C  CB    . ASN A 1 81  ? -3.826  7.069  13.066 1.00 57.29 ? 81   ASN A CB    1 
ATOM   696  C  CG    . ASN A 1 81  ? -4.612  7.403  14.338 1.00 56.75 ? 81   ASN A CG    1 
ATOM   697  O  OD1   . ASN A 1 81  ? -4.264  8.340  15.061 1.00 60.53 ? 81   ASN A OD1   1 
ATOM   698  N  ND2   . ASN A 1 81  ? -5.595  6.573  14.671 1.00 54.86 ? 81   ASN A ND2   1 
ATOM   699  H  H     . ASN A 1 81  ? -4.573  6.055  10.176 1.00 0.00  ? 81   ASN A H     1 
ATOM   700  H  HD21  . ASN A 1 81  ? -6.121  6.791  15.471 1.00 0.00  ? 81   ASN A HD21  1 
ATOM   701  H  HD22  . ASN A 1 81  ? -5.741  5.792  14.093 1.00 0.00  ? 81   ASN A HD22  1 
ATOM   702  N  N     . THR A 1 82  ? -4.823  9.364  10.258 1.00 50.09 ? 82   THR A N     1 
ATOM   703  C  CA    . THR A 1 82  ? -4.720  10.740 9.786  1.00 47.94 ? 82   THR A CA    1 
ATOM   704  C  C     . THR A 1 82  ? -6.017  11.198 9.127  1.00 44.09 ? 82   THR A C     1 
ATOM   705  O  O     . THR A 1 82  ? -6.012  12.033 8.234  1.00 41.50 ? 82   THR A O     1 
ATOM   706  C  CB    . THR A 1 82  ? -3.533  10.846 8.789  1.00 46.69 ? 82   THR A CB    1 
ATOM   707  O  OG1   . THR A 1 82  ? -2.358  10.369 9.441  1.00 52.26 ? 82   THR A OG1   1 
ATOM   708  C  CG2   . THR A 1 82  ? -3.262  12.274 8.349  1.00 50.06 ? 82   THR A CG2   1 
ATOM   709  H  H     . THR A 1 82  ? -5.220  8.700  9.665  1.00 0.00  ? 82   THR A H     1 
ATOM   710  H  HG1   . THR A 1 82  ? -2.212  10.867 10.256 1.00 0.00  ? 82   THR A HG1   1 
ATOM   711  N  N     . ASN A 1 83  ? -7.143  10.663 9.571  1.00 46.00 ? 83   ASN A N     1 
ATOM   712  C  CA    . ASN A 1 83  ? -8.413  11.069 8.979  1.00 49.67 ? 83   ASN A CA    1 
ATOM   713  C  C     . ASN A 1 83  ? -8.887  12.336 9.662  1.00 50.74 ? 83   ASN A C     1 
ATOM   714  O  O     . ASN A 1 83  ? -9.885  12.334 10.406 1.00 52.02 ? 83   ASN A O     1 
ATOM   715  C  CB    . ASN A 1 83  ? -9.456  9.953  9.072  1.00 52.63 ? 83   ASN A CB    1 
ATOM   716  C  CG    . ASN A 1 83  ? -9.369  8.983  7.912  1.00 52.43 ? 83   ASN A CG    1 
ATOM   717  O  OD1   . ASN A 1 83  ? -9.309  9.394  6.751  1.00 48.26 ? 83   ASN A OD1   1 
ATOM   718  N  ND2   . ASN A 1 83  ? -9.349  7.690  8.217  1.00 53.57 ? 83   ASN A ND2   1 
ATOM   719  H  H     . ASN A 1 83  ? -7.135  10.018 10.320 1.00 0.00  ? 83   ASN A H     1 
ATOM   720  H  HD21  . ASN A 1 83  ? -9.264  7.054  7.473  1.00 0.00  ? 83   ASN A HD21  1 
ATOM   721  H  HD22  . ASN A 1 83  ? -9.408  7.422  9.165  1.00 0.00  ? 83   ASN A HD22  1 
ATOM   722  N  N     . PHE A 1 84  ? -8.127  13.404 9.413  1.00 47.90 ? 84   PHE A N     1 
ATOM   723  C  CA    . PHE A 1 84  ? -8.362  14.730 9.975  1.00 45.42 ? 84   PHE A CA    1 
ATOM   724  C  C     . PHE A 1 84  ? -9.511  15.516 9.337  1.00 47.46 ? 84   PHE A C     1 
ATOM   725  O  O     . PHE A 1 84  ? -9.890  15.260 8.186  1.00 51.65 ? 84   PHE A O     1 
ATOM   726  C  CB    . PHE A 1 84  ? -7.073  15.539 9.897  1.00 41.51 ? 84   PHE A CB    1 
ATOM   727  C  CG    . PHE A 1 84  ? -5.929  14.941 10.680 1.00 37.21 ? 84   PHE A CG    1 
ATOM   728  C  CD1   . PHE A 1 84  ? -6.169  14.085 11.747 1.00 36.76 ? 84   PHE A CD1   1 
ATOM   729  C  CD2   . PHE A 1 84  ? -4.614  15.258 10.359 1.00 35.03 ? 84   PHE A CD2   1 
ATOM   730  C  CE1   . PHE A 1 84  ? -5.115  13.561 12.478 1.00 39.44 ? 84   PHE A CE1   1 
ATOM   731  C  CE2   . PHE A 1 84  ? -3.549  14.740 11.081 1.00 34.66 ? 84   PHE A CE2   1 
ATOM   732  C  CZ    . PHE A 1 84  ? -3.792  13.892 12.143 1.00 37.15 ? 84   PHE A CZ    1 
ATOM   733  H  H     . PHE A 1 84  ? -7.375  13.309 8.798  1.00 0.00  ? 84   PHE A H     1 
ATOM   734  N  N     . GLY A 1 85  ? -10.080 16.436 10.114 1.00 44.40 ? 85   GLY A N     1 
ATOM   735  C  CA    . GLY A 1 85  ? -11.174 17.276 9.656  1.00 36.58 ? 85   GLY A CA    1 
ATOM   736  C  C     . GLY A 1 85  ? -11.405 18.356 10.700 1.00 34.09 ? 85   GLY A C     1 
ATOM   737  O  O     . GLY A 1 85  ? -10.556 18.548 11.567 1.00 33.60 ? 85   GLY A O     1 
ATOM   738  H  H     . GLY A 1 85  ? -9.767  16.568 11.039 1.00 0.00  ? 85   GLY A H     1 
ATOM   739  N  N     . ILE A 1 86  ? -12.530 19.063 10.634 1.00 32.24 ? 86   ILE A N     1 
ATOM   740  C  CA    . ILE A 1 86  ? -12.852 20.111 11.608 1.00 30.69 ? 86   ILE A CA    1 
ATOM   741  C  C     . ILE A 1 86  ? -14.231 19.815 12.157 1.00 32.18 ? 86   ILE A C     1 
ATOM   742  O  O     . ILE A 1 86  ? -15.109 19.383 11.418 1.00 35.35 ? 86   ILE A O     1 
ATOM   743  C  CB    . ILE A 1 86  ? -12.943 21.505 10.958 1.00 31.52 ? 86   ILE A CB    1 
ATOM   744  C  CG1   . ILE A 1 86  ? -11.593 21.950 10.401 1.00 29.39 ? 86   ILE A CG1   1 
ATOM   745  C  CG2   . ILE A 1 86  ? -13.422 22.526 11.978 1.00 31.32 ? 86   ILE A CG2   1 
ATOM   746  C  CD1   . ILE A 1 86  ? -11.683 23.272 9.654  1.00 34.29 ? 86   ILE A CD1   1 
ATOM   747  H  H     . ILE A 1 86  ? -13.166 18.882 9.913  1.00 0.00  ? 86   ILE A H     1 
ATOM   748  N  N     . CYS A 1 87  ? -14.451 20.113 13.430 1.00 31.05 ? 87   CYS A N     1 
ATOM   749  C  CA    . CYS A 1 87  ? -15.741 19.871 14.064 1.00 26.39 ? 87   CYS A CA    1 
ATOM   750  C  C     . CYS A 1 87  ? -16.859 20.795 13.591 1.00 25.66 ? 87   CYS A C     1 
ATOM   751  O  O     . CYS A 1 87  ? -16.835 21.981 13.856 1.00 28.29 ? 87   CYS A O     1 
ATOM   752  C  CB    . CYS A 1 87  ? -15.586 19.973 15.572 1.00 25.74 ? 87   CYS A CB    1 
ATOM   753  S  SG    . CYS A 1 87  ? -14.479 18.681 16.196 1.00 30.66 ? 87   CYS A SG    1 
ATOM   754  H  H     . CYS A 1 87  ? -13.718 20.489 13.961 1.00 0.00  ? 87   CYS A H     1 
ATOM   755  N  N     . HIS A 1 88  ? -17.862 20.243 12.924 1.00 26.83 ? 88   HIS A N     1 
ATOM   756  C  CA    . HIS A 1 88  ? -18.970 21.042 12.433 1.00 27.85 ? 88   HIS A CA    1 
ATOM   757  C  C     . HIS A 1 88  ? -20.332 20.608 12.911 1.00 27.31 ? 88   HIS A C     1 
ATOM   758  O  O     . HIS A 1 88  ? -20.562 19.431 13.122 1.00 27.21 ? 88   HIS A O     1 
ATOM   759  C  CB    . HIS A 1 88  ? -18.958 21.077 10.911 1.00 30.13 ? 88   HIS A CB    1 
ATOM   760  C  CG    . HIS A 1 88  ? -17.953 22.026 10.361 1.00 31.30 ? 88   HIS A CG    1 
ATOM   761  N  ND1   . HIS A 1 88  ? -17.239 21.779 9.209  1.00 32.34 ? 88   HIS A ND1   1 
ATOM   762  C  CD2   . HIS A 1 88  ? -17.490 23.202 10.849 1.00 33.55 ? 88   HIS A CD2   1 
ATOM   763  C  CE1   . HIS A 1 88  ? -16.377 22.761 9.015  1.00 33.48 ? 88   HIS A CE1   1 
ATOM   764  N  NE2   . HIS A 1 88  ? -16.508 23.636 9.997  1.00 29.53 ? 88   HIS A NE2   1 
ATOM   765  H  H     . HIS A 1 88  ? -17.863 19.282 12.756 1.00 0.00  ? 88   HIS A H     1 
ATOM   766  H  HD1   . HIS A 1 88  ? -17.299 20.974 8.650  1.00 0.00  ? 88   HIS A HD1   1 
ATOM   767  H  HE2   . HIS A 1 88  ? -16.022 24.493 10.120 1.00 0.00  ? 88   HIS A HE2   1 
ATOM   768  N  N     . ASN A 1 89  ? -21.221 21.579 13.110 1.00 30.80 ? 89   ASN A N     1 
ATOM   769  C  CA    . ASN A 1 89  ? -22.577 21.292 13.544 1.00 33.08 ? 89   ASN A CA    1 
ATOM   770  C  C     . ASN A 1 89  ? -23.263 20.758 12.306 1.00 35.24 ? 89   ASN A C     1 
ATOM   771  O  O     . ASN A 1 89  ? -23.434 21.474 11.326 1.00 28.81 ? 89   ASN A O     1 
ATOM   772  C  CB    . ASN A 1 89  ? -23.285 22.553 14.056 1.00 34.78 ? 89   ASN A CB    1 
ATOM   773  C  CG    . ASN A 1 89  ? -24.660 22.263 14.688 1.00 33.89 ? 89   ASN A CG    1 
ATOM   774  O  OD1   . ASN A 1 89  ? -25.305 23.168 15.218 1.00 36.58 ? 89   ASN A OD1   1 
ATOM   775  N  ND2   . ASN A 1 89  ? -25.105 21.023 14.631 1.00 34.93 ? 89   ASN A ND2   1 
ATOM   776  H  H     . ASN A 1 89  ? -20.977 22.518 12.941 1.00 0.00  ? 89   ASN A H     1 
ATOM   777  H  HD21  . ASN A 1 89  ? -25.938 20.902 15.132 1.00 0.00  ? 89   ASN A HD21  1 
ATOM   778  H  HD22  . ASN A 1 89  ? -24.652 20.285 14.179 1.00 0.00  ? 89   ASN A HD22  1 
ATOM   779  N  N     . VAL A 1 90  ? -23.551 19.463 12.368 1.00 42.23 ? 90   VAL A N     1 
ATOM   780  C  CA    . VAL A 1 90  ? -24.206 18.693 11.328 1.00 46.60 ? 90   VAL A CA    1 
ATOM   781  C  C     . VAL A 1 90  ? -23.340 18.480 10.091 1.00 51.49 ? 90   VAL A C     1 
ATOM   782  O  O     . VAL A 1 90  ? -23.018 17.292 9.815  1.00 53.83 ? 90   VAL A O     1 
ATOM   783  C  CB    . VAL A 1 90  ? -25.628 19.227 11.029 1.00 44.64 ? 90   VAL A CB    1 
ATOM   784  C  CG1   . VAL A 1 90  ? -25.918 19.228 9.533  1.00 50.31 ? 90   VAL A CG1   1 
ATOM   785  C  CG2   . VAL A 1 90  ? -26.661 18.344 11.752 1.00 42.40 ? 90   VAL A CG2   1 
ATOM   786  H  H     . VAL A 1 90  ? -23.256 18.943 13.141 1.00 0.00  ? 90   VAL A H     1 
ATOM   787  N  N     . LYS B 2 1   ? 20.403  36.237 73.486 1.00 29.82 ? 1    LYS B N     1 
ATOM   788  C  CA    . LYS B 2 1   ? 21.698  36.184 72.765 1.00 29.85 ? 1    LYS B CA    1 
ATOM   789  C  C     . LYS B 2 1   ? 21.592  37.139 71.595 1.00 32.41 ? 1    LYS B C     1 
ATOM   790  O  O     . LYS B 2 1   ? 20.498  37.347 71.059 1.00 34.90 ? 1    LYS B O     1 
ATOM   791  C  CB    . LYS B 2 1   ? 21.957  34.781 72.274 1.00 30.79 ? 1    LYS B CB    1 
ATOM   792  C  CG    . LYS B 2 1   ? 23.344  34.530 71.756 1.00 31.14 ? 1    LYS B CG    1 
ATOM   793  C  CD    . LYS B 2 1   ? 23.461  33.034 71.507 1.00 29.67 ? 1    LYS B CD    1 
ATOM   794  C  CE    . LYS B 2 1   ? 24.768  32.662 70.866 1.00 27.47 ? 1    LYS B CE    1 
ATOM   795  N  NZ    . LYS B 2 1   ? 25.904  32.824 71.810 1.00 32.65 ? 1    LYS B NZ    1 
ATOM   796  H  H1    . LYS B 2 1   ? 19.645  36.071 72.822 1.00 0.00  ? 1    LYS B H1    1 
ATOM   797  H  H2    . LYS B 2 1   ? 20.394  35.578 74.299 1.00 0.00  ? 1    LYS B H2    1 
ATOM   798  H  H3    . LYS B 2 1   ? 20.314  37.217 73.823 1.00 0.00  ? 1    LYS B H3    1 
ATOM   799  H  HZ1   . LYS B 2 1   ? 25.742  32.233 72.648 1.00 0.00  ? 1    LYS B HZ1   1 
ATOM   800  H  HZ2   . LYS B 2 1   ? 26.799  32.523 71.389 1.00 0.00  ? 1    LYS B HZ2   1 
ATOM   801  H  HZ3   . LYS B 2 1   ? 25.991  33.818 72.103 1.00 0.00  ? 1    LYS B HZ3   1 
ATOM   802  N  N     . GLU B 2 2   ? 22.707  37.757 71.234 1.00 30.40 ? 2    GLU B N     1 
ATOM   803  C  CA    . GLU B 2 2   ? 22.716  38.720 70.149 1.00 30.58 ? 2    GLU B CA    1 
ATOM   804  C  C     . GLU B 2 2   ? 24.033  38.671 69.395 1.00 30.55 ? 2    GLU B C     1 
ATOM   805  O  O     . GLU B 2 2   ? 25.116  38.598 69.983 1.00 30.50 ? 2    GLU B O     1 
ATOM   806  C  CB    . GLU B 2 2   ? 22.475  40.116 70.695 1.00 31.26 ? 2    GLU B CB    1 
ATOM   807  C  CG    . GLU B 2 2   ? 22.067  41.131 69.652 1.00 37.46 ? 2    GLU B CG    1 
ATOM   808  C  CD    . GLU B 2 2   ? 21.633  42.455 70.260 1.00 39.43 ? 2    GLU B CD    1 
ATOM   809  O  OE1   . GLU B 2 2   ? 21.179  42.472 71.425 1.00 44.57 ? 2    GLU B OE1   1 
ATOM   810  O  OE2   . GLU B 2 2   ? 21.736  43.482 69.567 1.00 42.50 ? 2    GLU B OE2   1 
ATOM   811  H  H     . GLU B 2 2   ? 23.550  37.578 71.707 1.00 0.00  ? 2    GLU B H     1 
ATOM   812  N  N     . VAL B 2 3   ? 23.910  38.678 68.081 1.00 26.13 ? 3    VAL B N     1 
ATOM   813  C  CA    . VAL B 2 3   ? 25.040  38.617 67.179 1.00 27.10 ? 3    VAL B CA    1 
ATOM   814  C  C     . VAL B 2 3   ? 24.823  39.791 66.225 1.00 24.87 ? 3    VAL B C     1 
ATOM   815  O  O     . VAL B 2 3   ? 23.720  39.949 65.685 1.00 21.87 ? 3    VAL B O     1 
ATOM   816  C  CB    . VAL B 2 3   ? 25.036  37.257 66.417 1.00 25.87 ? 3    VAL B CB    1 
ATOM   817  C  CG1   . VAL B 2 3   ? 25.799  37.376 65.176 1.00 31.38 ? 3    VAL B CG1   1 
ATOM   818  C  CG2   . VAL B 2 3   ? 25.670  36.160 67.256 1.00 23.14 ? 3    VAL B CG2   1 
ATOM   819  H  H     . VAL B 2 3   ? 23.012  38.744 67.690 1.00 0.00  ? 3    VAL B H     1 
ATOM   820  N  N     . CYS B 2 4   ? 25.859  40.603 66.016 1.00 22.13 ? 4    CYS B N     1 
ATOM   821  C  CA    . CYS B 2 4   ? 25.728  41.776 65.170 1.00 24.27 ? 4    CYS B CA    1 
ATOM   822  C  C     . CYS B 2 4   ? 26.640  41.710 63.979 1.00 25.46 ? 4    CYS B C     1 
ATOM   823  O  O     . CYS B 2 4   ? 27.704  41.099 64.057 1.00 28.78 ? 4    CYS B O     1 
ATOM   824  C  CB    . CYS B 2 4   ? 26.024  43.046 65.970 1.00 24.28 ? 4    CYS B CB    1 
ATOM   825  S  SG    . CYS B 2 4   ? 25.034  43.288 67.490 1.00 17.70 ? 4    CYS B SG    1 
ATOM   826  H  H     . CYS B 2 4   ? 26.739  40.394 66.386 1.00 0.00  ? 4    CYS B H     1 
ATOM   827  N  N     . TYR B 2 5   ? 26.208  42.327 62.876 1.00 25.17 ? 5    TYR B N     1 
ATOM   828  C  CA    . TYR B 2 5   ? 26.984  42.362 61.630 1.00 28.86 ? 5    TYR B CA    1 
ATOM   829  C  C     . TYR B 2 5   ? 27.038  43.735 61.003 1.00 30.00 ? 5    TYR B C     1 
ATOM   830  O  O     . TYR B 2 5   ? 26.111  44.531 61.133 1.00 36.76 ? 5    TYR B O     1 
ATOM   831  C  CB    . TYR B 2 5   ? 26.438  41.373 60.595 1.00 22.30 ? 5    TYR B CB    1 
ATOM   832  C  CG    . TYR B 2 5   ? 26.521  39.971 61.090 1.00 25.03 ? 5    TYR B CG    1 
ATOM   833  C  CD1   . TYR B 2 5   ? 27.742  39.324 61.177 1.00 22.64 ? 5    TYR B CD1   1 
ATOM   834  C  CD2   . TYR B 2 5   ? 25.391  39.314 61.558 1.00 26.19 ? 5    TYR B CD2   1 
ATOM   835  C  CE1   . TYR B 2 5   ? 27.841  38.051 61.736 1.00 29.12 ? 5    TYR B CE1   1 
ATOM   836  C  CE2   . TYR B 2 5   ? 25.473  38.045 62.109 1.00 24.97 ? 5    TYR B CE2   1 
ATOM   837  C  CZ    . TYR B 2 5   ? 26.700  37.417 62.199 1.00 27.92 ? 5    TYR B CZ    1 
ATOM   838  O  OH    . TYR B 2 5   ? 26.790  36.160 62.757 1.00 27.45 ? 5    TYR B OH    1 
ATOM   839  H  H     . TYR B 2 5   ? 25.331  42.756 62.888 1.00 0.00  ? 5    TYR B H     1 
ATOM   840  H  HH    . TYR B 2 5   ? 27.715  35.887 62.776 1.00 0.00  ? 5    TYR B HH    1 
ATOM   841  N  N     . GLU B 2 6   ? 28.144  44.016 60.338 1.00 32.67 ? 6    GLU B N     1 
ATOM   842  C  CA    . GLU B 2 6   ? 28.304  45.281 59.663 1.00 37.68 ? 6    GLU B CA    1 
ATOM   843  C  C     . GLU B 2 6   ? 27.228  45.322 58.580 1.00 34.90 ? 6    GLU B C     1 
ATOM   844  O  O     . GLU B 2 6   ? 26.802  44.285 58.085 1.00 36.73 ? 6    GLU B O     1 
ATOM   845  C  CB    . GLU B 2 6   ? 29.687  45.344 59.022 1.00 44.82 ? 6    GLU B CB    1 
ATOM   846  C  CG    . GLU B 2 6   ? 30.097  46.735 58.572 1.00 56.15 ? 6    GLU B CG    1 
ATOM   847  C  CD    . GLU B 2 6   ? 31.501  46.785 57.982 1.00 63.63 ? 6    GLU B CD    1 
ATOM   848  O  OE1   . GLU B 2 6   ? 32.212  45.744 57.977 1.00 65.01 ? 6    GLU B OE1   1 
ATOM   849  O  OE2   . GLU B 2 6   ? 31.888  47.882 57.514 1.00 69.39 ? 6    GLU B OE2   1 
ATOM   850  H  H     . GLU B 2 6   ? 28.850  43.342 60.306 1.00 0.00  ? 6    GLU B H     1 
ATOM   851  N  N     . ARG B 2 7   ? 26.767  46.514 58.233 1.00 34.10 ? 7    ARG B N     1 
ATOM   852  C  CA    . ARG B 2 7   ? 25.739  46.671 57.199 1.00 32.05 ? 7    ARG B CA    1 
ATOM   853  C  C     . ARG B 2 7   ? 24.323  46.235 57.621 1.00 32.24 ? 7    ARG B C     1 
ATOM   854  O  O     . ARG B 2 7   ? 23.354  46.962 57.404 1.00 30.36 ? 7    ARG B O     1 
ATOM   855  C  CB    . ARG B 2 7   ? 26.119  45.893 55.926 1.00 28.62 ? 7    ARG B CB    1 
ATOM   856  C  CG    . ARG B 2 7   ? 27.167  46.521 55.053 1.00 24.16 ? 7    ARG B CG    1 
ATOM   857  C  CD    . ARG B 2 7   ? 27.584  45.546 53.982 1.00 24.98 ? 7    ARG B CD    1 
ATOM   858  N  NE    . ARG B 2 7   ? 26.450  45.090 53.179 1.00 29.03 ? 7    ARG B NE    1 
ATOM   859  C  CZ    . ARG B 2 7   ? 25.911  43.870 53.223 1.00 27.37 ? 7    ARG B CZ    1 
ATOM   860  N  NH1   . ARG B 2 7   ? 26.368  42.934 54.042 1.00 22.58 ? 7    ARG B NH1   1 
ATOM   861  N  NH2   . ARG B 2 7   ? 24.912  43.576 52.415 1.00 32.41 ? 7    ARG B NH2   1 
ATOM   862  H  H     . ARG B 2 7   ? 27.121  47.321 58.662 1.00 0.00  ? 7    ARG B H     1 
ATOM   863  H  HE    . ARG B 2 7   ? 26.044  45.710 52.540 1.00 0.00  ? 7    ARG B HE    1 
ATOM   864  H  HH11  . ARG B 2 7   ? 27.132  43.137 54.652 1.00 0.00  ? 7    ARG B HH11  1 
ATOM   865  H  HH12  . ARG B 2 7   ? 25.940  42.029 54.052 1.00 0.00  ? 7    ARG B HH12  1 
ATOM   866  H  HH21  . ARG B 2 7   ? 24.536  44.241 51.769 1.00 0.00  ? 7    ARG B HH21  1 
ATOM   867  H  HH22  . ARG B 2 7   ? 24.531  42.667 52.504 1.00 0.00  ? 7    ARG B HH22  1 
ATOM   868  N  N     . LEU B 2 8   ? 24.206  45.057 58.229 1.00 28.37 ? 8    LEU B N     1 
ATOM   869  C  CA    . LEU B 2 8   ? 22.893  44.553 58.576 1.00 24.00 ? 8    LEU B CA    1 
ATOM   870  C  C     . LEU B 2 8   ? 22.384  44.802 59.964 1.00 21.31 ? 8    LEU B C     1 
ATOM   871  O  O     . LEU B 2 8   ? 21.190  44.728 60.183 1.00 21.01 ? 8    LEU B O     1 
ATOM   872  C  CB    . LEU B 2 8   ? 22.789  43.068 58.219 1.00 19.24 ? 8    LEU B CB    1 
ATOM   873  C  CG    . LEU B 2 8   ? 23.344  42.762 56.822 1.00 14.90 ? 8    LEU B CG    1 
ATOM   874  C  CD1   . LEU B 2 8   ? 23.246  41.292 56.566 1.00 16.38 ? 8    LEU B CD1   1 
ATOM   875  C  CD2   . LEU B 2 8   ? 22.614  43.580 55.730 1.00 10.80 ? 8    LEU B CD2   1 
ATOM   876  H  H     . LEU B 2 8   ? 24.970  44.492 58.447 1.00 0.00  ? 8    LEU B H     1 
ATOM   877  N  N     . GLY B 2 9   ? 23.264  45.083 60.914 1.00 18.83 ? 9    GLY B N     1 
ATOM   878  C  CA    . GLY B 2 9   ? 22.767  45.330 62.257 1.00 11.92 ? 9    GLY B CA    1 
ATOM   879  C  C     . GLY B 2 9   ? 22.785  44.087 63.120 1.00 16.03 ? 9    GLY B C     1 
ATOM   880  O  O     . GLY B 2 9   ? 23.454  43.098 62.794 1.00 13.70 ? 9    GLY B O     1 
ATOM   881  H  H     . GLY B 2 9   ? 24.223  45.105 60.721 1.00 0.00  ? 9    GLY B H     1 
ATOM   882  N  N     . CYS B 2 10  ? 22.071  44.128 64.236 1.00 15.44 ? 10   CYS B N     1 
ATOM   883  C  CA    . CYS B 2 10  ? 22.062  42.998 65.131 1.00 20.69 ? 10   CYS B CA    1 
ATOM   884  C  C     . CYS B 2 10  ? 20.887  42.069 64.922 1.00 23.91 ? 10   CYS B C     1 
ATOM   885  O  O     . CYS B 2 10  ? 19.904  42.425 64.291 1.00 30.88 ? 10   CYS B O     1 
ATOM   886  C  CB    . CYS B 2 10  ? 22.118  43.485 66.574 1.00 20.22 ? 10   CYS B CB    1 
ATOM   887  S  SG    . CYS B 2 10  ? 23.551  44.552 66.912 1.00 21.54 ? 10   CYS B SG    1 
ATOM   888  H  H     . CYS B 2 10  ? 21.556  44.931 64.463 1.00 0.00  ? 10   CYS B H     1 
ATOM   889  N  N     . PHE B 2 11  ? 21.015  40.852 65.415 1.00 23.79 ? 11   PHE B N     1 
ATOM   890  C  CA    . PHE B 2 11  ? 19.959  39.878 65.285 1.00 24.59 ? 11   PHE B CA    1 
ATOM   891  C  C     . PHE B 2 11  ? 19.956  39.190 66.636 1.00 25.76 ? 11   PHE B C     1 
ATOM   892  O  O     . PHE B 2 11  ? 21.015  38.918 67.197 1.00 33.37 ? 11   PHE B O     1 
ATOM   893  C  CB    . PHE B 2 11  ? 20.259  38.927 64.123 1.00 21.30 ? 11   PHE B CB    1 
ATOM   894  C  CG    . PHE B 2 11  ? 20.396  39.626 62.786 1.00 23.61 ? 11   PHE B CG    1 
ATOM   895  C  CD1   . PHE B 2 11  ? 21.636  40.103 62.353 1.00 25.30 ? 11   PHE B CD1   1 
ATOM   896  C  CD2   . PHE B 2 11  ? 19.281  39.797 61.949 1.00 27.33 ? 11   PHE B CD2   1 
ATOM   897  C  CE1   . PHE B 2 11  ? 21.776  40.752 61.086 1.00 29.44 ? 11   PHE B CE1   1 
ATOM   898  C  CE2   . PHE B 2 11  ? 19.393  40.447 60.677 1.00 28.15 ? 11   PHE B CE2   1 
ATOM   899  C  CZ    . PHE B 2 11  ? 20.647  40.922 60.247 1.00 29.27 ? 11   PHE B CZ    1 
ATOM   900  H  H     . PHE B 2 11  ? 21.830  40.587 65.892 1.00 0.00  ? 11   PHE B H     1 
ATOM   901  N  N     . SER B 2 12  ? 18.782  39.024 67.215 1.00 26.12 ? 12   SER B N     1 
ATOM   902  C  CA    . SER B 2 12  ? 18.674  38.432 68.525 1.00 27.01 ? 12   SER B CA    1 
ATOM   903  C  C     . SER B 2 12  ? 17.665  37.298 68.575 1.00 31.89 ? 12   SER B C     1 
ATOM   904  O  O     . SER B 2 12  ? 16.710  37.279 67.799 1.00 34.28 ? 12   SER B O     1 
ATOM   905  C  CB    . SER B 2 12  ? 18.246  39.518 69.496 1.00 26.42 ? 12   SER B CB    1 
ATOM   906  O  OG    . SER B 2 12  ? 17.795  38.963 70.721 1.00 33.86 ? 12   SER B OG    1 
ATOM   907  H  H     . SER B 2 12  ? 17.961  39.340 66.771 1.00 0.00  ? 12   SER B H     1 
ATOM   908  H  HG    . SER B 2 12  ? 18.557  38.792 71.289 1.00 0.00  ? 12   SER B HG    1 
ATOM   909  N  N     . ASP B 2 13  ? 17.860  36.378 69.518 1.00 32.73 ? 13   ASP B N     1 
ATOM   910  C  CA    . ASP B 2 13  ? 16.946  35.257 69.704 1.00 35.89 ? 13   ASP B CA    1 
ATOM   911  C  C     . ASP B 2 13  ? 15.917  35.551 70.803 1.00 42.22 ? 13   ASP B C     1 
ATOM   912  O  O     . ASP B 2 13  ? 15.512  34.645 71.561 1.00 42.80 ? 13   ASP B O     1 
ATOM   913  C  CB    . ASP B 2 13  ? 17.696  33.951 69.994 1.00 33.49 ? 13   ASP B CB    1 
ATOM   914  C  CG    . ASP B 2 13  ? 18.469  33.971 71.314 1.00 34.96 ? 13   ASP B CG    1 
ATOM   915  O  OD1   . ASP B 2 13  ? 18.460  34.986 72.065 1.00 28.09 ? 13   ASP B OD1   1 
ATOM   916  O  OD2   . ASP B 2 13  ? 19.101  32.928 71.592 1.00 35.30 ? 13   ASP B OD2   1 
ATOM   917  H  H     . ASP B 2 13  ? 18.625  36.510 70.103 1.00 0.00  ? 13   ASP B H     1 
ATOM   918  N  N     . ASP B 2 14  ? 15.573  36.834 70.947 1.00 43.59 ? 14   ASP B N     1 
ATOM   919  C  CA    . ASP B 2 14  ? 14.569  37.256 71.915 1.00 43.88 ? 14   ASP B CA    1 
ATOM   920  C  C     . ASP B 2 14  ? 13.203  37.009 71.319 1.00 43.03 ? 14   ASP B C     1 
ATOM   921  O  O     . ASP B 2 14  ? 13.061  36.861 70.101 1.00 42.82 ? 14   ASP B O     1 
ATOM   922  C  CB    . ASP B 2 14  ? 14.671  38.743 72.212 1.00 48.73 ? 14   ASP B CB    1 
ATOM   923  C  CG    . ASP B 2 14  ? 15.955  39.111 72.887 1.00 54.26 ? 14   ASP B CG    1 
ATOM   924  O  OD1   . ASP B 2 14  ? 16.520  38.254 73.613 1.00 53.69 ? 14   ASP B OD1   1 
ATOM   925  O  OD2   . ASP B 2 14  ? 16.393  40.270 72.677 1.00 57.97 ? 14   ASP B OD2   1 
ATOM   926  H  H     . ASP B 2 14  ? 15.987  37.513 70.376 1.00 0.00  ? 14   ASP B H     1 
ATOM   927  N  N     . SER B 2 15  ? 12.203  36.951 72.190 1.00 41.50 ? 15   SER B N     1 
ATOM   928  C  CA    . SER B 2 15  ? 10.830  36.735 71.766 1.00 42.69 ? 15   SER B CA    1 
ATOM   929  C  C     . SER B 2 15  ? 10.463  37.999 70.998 1.00 39.38 ? 15   SER B C     1 
ATOM   930  O  O     . SER B 2 15  ? 10.836  39.097 71.410 1.00 45.74 ? 15   SER B O     1 
ATOM   931  C  CB    . SER B 2 15  ? 9.922   36.580 72.990 1.00 43.95 ? 15   SER B CB    1 
ATOM   932  O  OG    . SER B 2 15  ? 8.766   35.821 72.688 1.00 47.26 ? 15   SER B OG    1 
ATOM   933  H  H     . SER B 2 15  ? 12.394  37.070 73.142 1.00 0.00  ? 15   SER B H     1 
ATOM   934  H  HG    . SER B 2 15  ? 8.999   34.877 72.653 1.00 0.00  ? 15   SER B HG    1 
ATOM   935  N  N     . PRO B 2 16  ? 9.659   37.873 69.930 1.00 33.07 ? 16   PRO B N     1 
ATOM   936  C  CA    . PRO B 2 16  ? 9.100   36.604 69.461 1.00 30.81 ? 16   PRO B CA    1 
ATOM   937  C  C     . PRO B 2 16  ? 9.916   35.774 68.433 1.00 33.63 ? 16   PRO B C     1 
ATOM   938  O  O     . PRO B 2 16  ? 9.448   34.724 67.961 1.00 32.11 ? 16   PRO B O     1 
ATOM   939  C  CB    . PRO B 2 16  ? 7.749   37.049 68.919 1.00 25.49 ? 16   PRO B CB    1 
ATOM   940  C  CG    . PRO B 2 16  ? 8.090   38.346 68.278 1.00 21.82 ? 16   PRO B CG    1 
ATOM   941  C  CD    . PRO B 2 16  ? 9.051   39.010 69.218 1.00 27.15 ? 16   PRO B CD    1 
ATOM   942  N  N     . TRP B 2 17  ? 11.136  36.206 68.113 1.00 35.30 ? 17   TRP B N     1 
ATOM   943  C  CA    . TRP B 2 17  ? 11.969  35.482 67.143 1.00 35.30 ? 17   TRP B CA    1 
ATOM   944  C  C     . TRP B 2 17  ? 12.164  34.005 67.510 1.00 37.35 ? 17   TRP B C     1 
ATOM   945  O  O     . TRP B 2 17  ? 12.244  33.153 66.618 1.00 39.71 ? 17   TRP B O     1 
ATOM   946  C  CB    . TRP B 2 17  ? 13.314  36.181 66.959 1.00 33.07 ? 17   TRP B CB    1 
ATOM   947  C  CG    . TRP B 2 17  ? 13.197  37.642 66.588 1.00 29.63 ? 17   TRP B CG    1 
ATOM   948  C  CD1   . TRP B 2 17  ? 13.329  38.701 67.431 1.00 30.31 ? 17   TRP B CD1   1 
ATOM   949  C  CD2   . TRP B 2 17  ? 12.920  38.198 65.284 1.00 27.65 ? 17   TRP B CD2   1 
ATOM   950  N  NE1   . TRP B 2 17  ? 13.150  39.882 66.746 1.00 31.63 ? 17   TRP B NE1   1 
ATOM   951  C  CE2   . TRP B 2 17  ? 12.899  39.606 65.427 1.00 29.90 ? 17   TRP B CE2   1 
ATOM   952  C  CE3   . TRP B 2 17  ? 12.693  37.645 64.016 1.00 26.20 ? 17   TRP B CE3   1 
ATOM   953  C  CZ2   . TRP B 2 17  ? 12.658  40.478 64.345 1.00 29.55 ? 17   TRP B CZ2   1 
ATOM   954  C  CZ3   . TRP B 2 17  ? 12.457  38.510 62.932 1.00 27.16 ? 17   TRP B CZ3   1 
ATOM   955  C  CH2   . TRP B 2 17  ? 12.443  39.916 63.110 1.00 28.35 ? 17   TRP B CH2   1 
ATOM   956  H  H     . TRP B 2 17  ? 11.515  37.006 68.533 1.00 0.00  ? 17   TRP B H     1 
ATOM   957  H  HE1   . TRP B 2 17  ? 13.202  40.770 67.146 1.00 0.00  ? 17   TRP B HE1   1 
ATOM   958  N  N     . SER B 2 18  ? 12.227  33.730 68.820 1.00 36.33 ? 18   SER B N     1 
ATOM   959  C  CA    . SER B 2 18  ? 12.371  32.384 69.406 1.00 31.47 ? 18   SER B CA    1 
ATOM   960  C  C     . SER B 2 18  ? 11.579  32.421 70.704 1.00 32.45 ? 18   SER B C     1 
ATOM   961  O  O     . SER B 2 18  ? 11.204  33.500 71.181 1.00 35.25 ? 18   SER B O     1 
ATOM   962  C  CB    . SER B 2 18  ? 13.825  32.074 69.820 1.00 28.45 ? 18   SER B CB    1 
ATOM   963  O  OG    . SER B 2 18  ? 14.695  31.793 68.752 1.00 24.27 ? 18   SER B OG    1 
ATOM   964  H  H     . SER B 2 18  ? 12.151  34.482 69.443 1.00 0.00  ? 18   SER B H     1 
ATOM   965  H  HG    . SER B 2 18  ? 14.625  32.530 68.132 1.00 0.00  ? 18   SER B HG    1 
ATOM   966  N  N     . GLY B 2 19  ? 11.431  31.262 71.333 1.00 30.47 ? 19   GLY B N     1 
ATOM   967  C  CA    . GLY B 2 19  ? 10.728  31.194 72.600 1.00 35.20 ? 19   GLY B CA    1 
ATOM   968  C  C     . GLY B 2 19  ? 9.239   31.536 72.600 1.00 40.03 ? 19   GLY B C     1 
ATOM   969  O  O     . GLY B 2 19  ? 8.787   32.486 73.269 1.00 37.73 ? 19   GLY B O     1 
ATOM   970  H  H     . GLY B 2 19  ? 11.774  30.456 70.894 1.00 0.00  ? 19   GLY B H     1 
ATOM   971  N  N     . ILE B 2 20  ? 8.495   30.779 71.793 1.00 43.36 ? 20   ILE B N     1 
ATOM   972  C  CA    . ILE B 2 20  ? 7.036   30.873 71.654 1.00 37.54 ? 20   ILE B CA    1 
ATOM   973  C  C     . ILE B 2 20  ? 6.571   29.530 71.076 1.00 38.10 ? 20   ILE B C     1 
ATOM   974  O  O     . ILE B 2 20  ? 7.375   28.722 70.584 1.00 38.85 ? 20   ILE B O     1 
ATOM   975  C  CB    . ILE B 2 20  ? 6.565   32.044 70.739 1.00 31.36 ? 20   ILE B CB    1 
ATOM   976  C  CG1   . ILE B 2 20  ? 7.218   31.955 69.360 1.00 29.57 ? 20   ILE B CG1   1 
ATOM   977  C  CG2   . ILE B 2 20  ? 6.850   33.381 71.394 1.00 27.35 ? 20   ILE B CG2   1 
ATOM   978  C  CD1   . ILE B 2 20  ? 6.733   33.016 68.406 1.00 24.32 ? 20   ILE B CD1   1 
ATOM   979  H  H     . ILE B 2 20  ? 8.959   30.119 71.224 1.00 0.00  ? 20   ILE B H     1 
ATOM   980  N  N     . THR B 2 21  ? 5.277   29.280 71.160 1.00 40.85 ? 21   THR B N     1 
ATOM   981  C  CA    . THR B 2 21  ? 4.720   28.034 70.653 1.00 42.71 ? 21   THR B CA    1 
ATOM   982  C  C     . THR B 2 21  ? 5.100   27.733 69.195 1.00 40.46 ? 21   THR B C     1 
ATOM   983  O  O     . THR B 2 21  ? 5.467   26.608 68.877 1.00 42.44 ? 21   THR B O     1 
ATOM   984  C  CB    . THR B 2 21  ? 3.198   28.033 70.805 1.00 39.80 ? 21   THR B CB    1 
ATOM   985  O  OG1   . THR B 2 21  ? 2.869   28.412 72.142 1.00 42.64 ? 21   THR B OG1   1 
ATOM   986  C  CG2   . THR B 2 21  ? 2.649   26.661 70.553 1.00 45.29 ? 21   THR B CG2   1 
ATOM   987  H  H     . THR B 2 21  ? 4.671   29.912 71.602 1.00 0.00  ? 21   THR B H     1 
ATOM   988  H  HG1   . THR B 2 21  ? 1.977   28.130 72.360 1.00 0.00  ? 21   THR B HG1   1 
ATOM   989  N  N     . GLU B 2 22  ? 5.041   28.737 68.321 1.00 37.24 ? 22   GLU B N     1 
ATOM   990  C  CA    . GLU B 2 22  ? 5.361   28.534 66.911 1.00 38.16 ? 22   GLU B CA    1 
ATOM   991  C  C     . GLU B 2 22  ? 6.852   28.479 66.549 1.00 35.63 ? 22   GLU B C     1 
ATOM   992  O  O     . GLU B 2 22  ? 7.226   27.971 65.490 1.00 34.13 ? 22   GLU B O     1 
ATOM   993  C  CB    . GLU B 2 22  ? 4.635   29.559 66.046 1.00 41.63 ? 22   GLU B CB    1 
ATOM   994  C  CG    . GLU B 2 22  ? 3.127   29.405 66.030 1.00 47.36 ? 22   GLU B CG    1 
ATOM   995  C  CD    . GLU B 2 22  ? 2.423   30.324 67.009 1.00 52.19 ? 22   GLU B CD    1 
ATOM   996  O  OE1   . GLU B 2 22  ? 2.633   30.205 68.237 1.00 54.22 ? 22   GLU B OE1   1 
ATOM   997  O  OE2   . GLU B 2 22  ? 1.644   31.170 66.541 1.00 55.27 ? 22   GLU B OE2   1 
ATOM   998  H  H     . GLU B 2 22  ? 4.768   29.617 68.634 1.00 0.00  ? 22   GLU B H     1 
ATOM   999  N  N     . ARG B 2 23  ? 7.690   29.023 67.416 1.00 37.04 ? 23   ARG B N     1 
ATOM   1000 C  CA    . ARG B 2 23  ? 9.136   29.022 67.211 1.00 40.69 ? 23   ARG B CA    1 
ATOM   1001 C  C     . ARG B 2 23  ? 9.793   28.954 68.594 1.00 42.71 ? 23   ARG B C     1 
ATOM   1002 O  O     . ARG B 2 23  ? 10.080  29.978 69.219 1.00 39.51 ? 23   ARG B O     1 
ATOM   1003 C  CB    . ARG B 2 23  ? 9.614   30.270 66.443 1.00 38.64 ? 23   ARG B CB    1 
ATOM   1004 C  CG    . ARG B 2 23  ? 8.527   31.234 65.984 1.00 35.10 ? 23   ARG B CG    1 
ATOM   1005 C  CD    . ARG B 2 23  ? 9.132   32.506 65.431 1.00 27.79 ? 23   ARG B CD    1 
ATOM   1006 N  NE    . ARG B 2 23  ? 9.400   32.385 64.016 1.00 26.21 ? 23   ARG B NE    1 
ATOM   1007 C  CZ    . ARG B 2 23  ? 10.411  32.967 63.384 1.00 27.62 ? 23   ARG B CZ    1 
ATOM   1008 N  NH1   . ARG B 2 23  ? 11.282  33.715 64.048 1.00 23.80 ? 23   ARG B NH1   1 
ATOM   1009 N  NH2   . ARG B 2 23  ? 10.545  32.792 62.079 1.00 28.30 ? 23   ARG B NH2   1 
ATOM   1010 H  H     . ARG B 2 23  ? 7.339   29.423 68.236 1.00 0.00  ? 23   ARG B H     1 
ATOM   1011 H  HE    . ARG B 2 23  ? 8.805   31.820 63.488 1.00 0.00  ? 23   ARG B HE    1 
ATOM   1012 H  HH11  . ARG B 2 23  ? 11.179  33.846 65.031 1.00 0.00  ? 23   ARG B HH11  1 
ATOM   1013 H  HH12  . ARG B 2 23  ? 12.045  34.155 63.565 1.00 0.00  ? 23   ARG B HH12  1 
ATOM   1014 H  HH21  . ARG B 2 23  ? 9.885   32.231 61.577 1.00 0.00  ? 23   ARG B HH21  1 
ATOM   1015 H  HH22  . ARG B 2 23  ? 11.283  33.220 61.584 1.00 0.00  ? 23   ARG B HH22  1 
ATOM   1016 N  N     . PRO B 2 24  ? 9.972   27.727 69.110 1.00 47.04 ? 24   PRO B N     1 
ATOM   1017 C  CA    . PRO B 2 24  ? 10.564  27.380 70.405 1.00 49.94 ? 24   PRO B CA    1 
ATOM   1018 C  C     . PRO B 2 24  ? 12.077  27.484 70.416 1.00 51.88 ? 24   PRO B C     1 
ATOM   1019 O  O     . PRO B 2 24  ? 12.661  28.100 71.310 1.00 57.78 ? 24   PRO B O     1 
ATOM   1020 C  CB    . PRO B 2 24  ? 10.163  25.906 70.585 1.00 50.39 ? 24   PRO B CB    1 
ATOM   1021 C  CG    . PRO B 2 24  ? 9.049   25.692 69.592 1.00 49.45 ? 24   PRO B CG    1 
ATOM   1022 C  CD    . PRO B 2 24  ? 9.497   26.512 68.433 1.00 48.33 ? 24   PRO B CD    1 
ATOM   1023 N  N     . LEU B 2 25  ? 12.698  26.838 69.432 1.00 51.02 ? 25   LEU B N     1 
ATOM   1024 C  CA    . LEU B 2 25  ? 14.147  26.798 69.296 1.00 47.03 ? 25   LEU B CA    1 
ATOM   1025 C  C     . LEU B 2 25  ? 14.743  28.190 69.265 1.00 46.70 ? 25   LEU B C     1 
ATOM   1026 O  O     . LEU B 2 25  ? 14.153  29.114 68.716 1.00 44.58 ? 25   LEU B O     1 
ATOM   1027 C  CB    . LEU B 2 25  ? 14.539  26.027 68.032 1.00 46.88 ? 25   LEU B CB    1 
ATOM   1028 C  CG    . LEU B 2 25  ? 13.910  24.632 67.848 1.00 46.16 ? 25   LEU B CG    1 
ATOM   1029 C  CD1   . LEU B 2 25  ? 14.611  23.884 66.726 1.00 42.37 ? 25   LEU B CD1   1 
ATOM   1030 C  CD2   . LEU B 2 25  ? 13.988  23.824 69.143 1.00 42.41 ? 25   LEU B CD2   1 
ATOM   1031 H  H     . LEU B 2 25  ? 12.156  26.391 68.758 1.00 0.00  ? 25   LEU B H     1 
ATOM   1032 N  N     . HIS B 2 26  ? 15.901  28.338 69.900 1.00 47.17 ? 26   HIS B N     1 
ATOM   1033 C  CA    . HIS B 2 26  ? 16.600  29.615 69.955 1.00 43.65 ? 26   HIS B CA    1 
ATOM   1034 C  C     . HIS B 2 26  ? 17.657  29.617 68.881 1.00 42.65 ? 26   HIS B C     1 
ATOM   1035 O  O     . HIS B 2 26  ? 18.838  29.419 69.146 1.00 48.42 ? 26   HIS B O     1 
ATOM   1036 C  CB    . HIS B 2 26  ? 17.214  29.805 71.333 1.00 36.35 ? 26   HIS B CB    1 
ATOM   1037 C  CG    . HIS B 2 26  ? 16.196  30.049 72.390 1.00 36.21 ? 26   HIS B CG    1 
ATOM   1038 N  ND1   . HIS B 2 26  ? 15.758  31.316 72.720 1.00 36.15 ? 26   HIS B ND1   1 
ATOM   1039 C  CD2   . HIS B 2 26  ? 15.457  29.188 73.126 1.00 34.25 ? 26   HIS B CD2   1 
ATOM   1040 C  CE1   . HIS B 2 26  ? 14.786  31.226 73.610 1.00 31.51 ? 26   HIS B CE1   1 
ATOM   1041 N  NE2   . HIS B 2 26  ? 14.584  29.945 73.871 1.00 36.08 ? 26   HIS B NE2   1 
ATOM   1042 H  H     . HIS B 2 26  ? 16.326  27.559 70.313 1.00 0.00  ? 26   HIS B H     1 
ATOM   1043 H  HD1   . HIS B 2 26  ? 16.071  32.169 72.328 1.00 0.00  ? 26   HIS B HD1   1 
ATOM   1044 H  HE2   . HIS B 2 26  ? 13.918  29.565 74.489 1.00 0.00  ? 26   HIS B HE2   1 
ATOM   1045 N  N     . ILE B 2 27  ? 17.233  29.850 67.655 1.00 40.95 ? 27   ILE B N     1 
ATOM   1046 C  CA    . ILE B 2 27  ? 18.171  29.811 66.557 1.00 39.54 ? 27   ILE B CA    1 
ATOM   1047 C  C     . ILE B 2 27  ? 18.495  31.190 66.064 1.00 34.45 ? 27   ILE B C     1 
ATOM   1048 O  O     . ILE B 2 27  ? 17.633  32.065 66.036 1.00 36.84 ? 27   ILE B O     1 
ATOM   1049 C  CB    . ILE B 2 27  ? 17.633  28.937 65.394 1.00 40.99 ? 27   ILE B CB    1 
ATOM   1050 C  CG1   . ILE B 2 27  ? 17.027  27.646 65.940 1.00 43.92 ? 27   ILE B CG1   1 
ATOM   1051 C  CG2   . ILE B 2 27  ? 18.766  28.538 64.477 1.00 44.92 ? 27   ILE B CG2   1 
ATOM   1052 C  CD1   . ILE B 2 27  ? 17.981  26.836 66.817 1.00 46.01 ? 27   ILE B CD1   1 
ATOM   1053 H  H     . ILE B 2 27  ? 16.298  30.117 67.494 1.00 0.00  ? 27   ILE B H     1 
ATOM   1054 N  N     . LEU B 2 28  ? 19.764  31.401 65.752 1.00 29.78 ? 28   LEU B N     1 
ATOM   1055 C  CA    . LEU B 2 28  ? 20.200  32.681 65.230 1.00 31.49 ? 28   LEU B CA    1 
ATOM   1056 C  C     . LEU B 2 28  ? 20.509  32.434 63.754 1.00 31.50 ? 28   LEU B C     1 
ATOM   1057 O  O     . LEU B 2 28  ? 20.848  31.310 63.355 1.00 33.93 ? 28   LEU B O     1 
ATOM   1058 C  CB    . LEU B 2 28  ? 21.449  33.208 65.967 1.00 29.81 ? 28   LEU B CB    1 
ATOM   1059 C  CG    . LEU B 2 28  ? 21.409  33.743 67.410 1.00 24.03 ? 28   LEU B CG    1 
ATOM   1060 C  CD1   . LEU B 2 28  ? 22.793  34.191 67.782 1.00 23.06 ? 28   LEU B CD1   1 
ATOM   1061 C  CD2   . LEU B 2 28  ? 20.451  34.904 67.554 1.00 24.87 ? 28   LEU B CD2   1 
ATOM   1062 H  H     . LEU B 2 28  ? 20.419  30.676 65.826 1.00 0.00  ? 28   LEU B H     1 
ATOM   1063 N  N     . PRO B 2 29  ? 20.318  33.456 62.911 1.00 28.27 ? 29   PRO B N     1 
ATOM   1064 C  CA    . PRO B 2 29  ? 20.605  33.251 61.494 1.00 25.37 ? 29   PRO B CA    1 
ATOM   1065 C  C     . PRO B 2 29  ? 22.105  33.146 61.246 1.00 23.58 ? 29   PRO B C     1 
ATOM   1066 O  O     . PRO B 2 29  ? 22.899  33.641 62.036 1.00 24.20 ? 29   PRO B O     1 
ATOM   1067 C  CB    . PRO B 2 29  ? 19.976  34.493 60.835 1.00 24.27 ? 29   PRO B CB    1 
ATOM   1068 C  CG    . PRO B 2 29  ? 20.027  35.534 61.901 1.00 22.10 ? 29   PRO B CG    1 
ATOM   1069 C  CD    . PRO B 2 29  ? 19.749  34.794 63.173 1.00 25.83 ? 29   PRO B CD    1 
ATOM   1070 N  N     . TRP B 2 30  ? 22.489  32.461 60.173 1.00 28.29 ? 30   TRP B N     1 
ATOM   1071 C  CA    . TRP B 2 30  ? 23.899  32.326 59.799 1.00 25.06 ? 30   TRP B CA    1 
ATOM   1072 C  C     . TRP B 2 30  ? 24.512  33.664 59.437 1.00 26.59 ? 30   TRP B C     1 
ATOM   1073 O  O     . TRP B 2 30  ? 23.820  34.677 59.287 1.00 29.04 ? 30   TRP B O     1 
ATOM   1074 C  CB    . TRP B 2 30  ? 24.066  31.419 58.596 1.00 20.90 ? 30   TRP B CB    1 
ATOM   1075 C  CG    . TRP B 2 30  ? 23.960  30.015 58.915 1.00 19.64 ? 30   TRP B CG    1 
ATOM   1076 C  CD1   . TRP B 2 30  ? 23.875  29.451 60.162 1.00 19.09 ? 30   TRP B CD1   1 
ATOM   1077 C  CD2   . TRP B 2 30  ? 23.947  28.944 57.979 1.00 18.47 ? 30   TRP B CD2   1 
ATOM   1078 N  NE1   . TRP B 2 30  ? 23.810  28.078 60.049 1.00 23.28 ? 30   TRP B NE1   1 
ATOM   1079 C  CE2   . TRP B 2 30  ? 23.853  27.743 58.719 1.00 21.46 ? 30   TRP B CE2   1 
ATOM   1080 C  CE3   . TRP B 2 30  ? 24.005  28.880 56.582 1.00 18.34 ? 30   TRP B CE3   1 
ATOM   1081 C  CZ2   . TRP B 2 30  ? 23.828  26.497 58.109 1.00 21.80 ? 30   TRP B CZ2   1 
ATOM   1082 C  CZ3   . TRP B 2 30  ? 23.979  27.648 55.978 1.00 19.71 ? 30   TRP B CZ3   1 
ATOM   1083 C  CH2   . TRP B 2 30  ? 23.888  26.468 56.738 1.00 23.18 ? 30   TRP B CH2   1 
ATOM   1084 H  H     . TRP B 2 30  ? 21.801  32.062 59.600 1.00 0.00  ? 30   TRP B H     1 
ATOM   1085 H  HE1   . TRP B 2 30  ? 23.723  27.466 60.817 1.00 0.00  ? 30   TRP B HE1   1 
ATOM   1086 N  N     . SER B 2 31  A 25.814  33.647 59.230 1.00 27.79 ? 30   SER B N     1 
ATOM   1087 C  CA    . SER B 2 31  A 26.503  34.864 58.892 1.00 32.28 ? 30   SER B CA    1 
ATOM   1088 C  C     . SER B 2 31  A 26.143  35.271 57.472 1.00 34.61 ? 30   SER B C     1 
ATOM   1089 O  O     . SER B 2 31  A 25.771  34.419 56.645 1.00 32.87 ? 30   SER B O     1 
ATOM   1090 C  CB    . SER B 2 31  A 28.006  34.658 58.991 1.00 31.45 ? 30   SER B CB    1 
ATOM   1091 O  OG    . SER B 2 31  A 28.646  35.914 58.975 1.00 35.59 ? 30   SER B OG    1 
ATOM   1092 H  H     . SER B 2 31  A 26.304  32.803 59.307 1.00 0.00  ? 30   SER B H     1 
ATOM   1093 H  HG    . SER B 2 31  A 29.596  35.773 59.086 1.00 0.00  ? 30   SER B HG    1 
ATOM   1094 N  N     . PRO B 2 32  ? 26.190  36.590 57.189 1.00 32.30 ? 31   PRO B N     1 
ATOM   1095 C  CA    . PRO B 2 32  ? 25.892  37.161 55.877 1.00 30.26 ? 31   PRO B CA    1 
ATOM   1096 C  C     . PRO B 2 32  ? 26.759  36.460 54.830 1.00 31.01 ? 31   PRO B C     1 
ATOM   1097 O  O     . PRO B 2 32  ? 26.302  36.141 53.731 1.00 28.74 ? 31   PRO B O     1 
ATOM   1098 C  CB    . PRO B 2 32  ? 26.304  38.617 56.066 1.00 28.00 ? 31   PRO B CB    1 
ATOM   1099 C  CG    . PRO B 2 32  ? 25.851  38.871 57.441 1.00 25.54 ? 31   PRO B CG    1 
ATOM   1100 C  CD    . PRO B 2 32  ? 26.320  37.663 58.191 1.00 28.74 ? 31   PRO B CD    1 
ATOM   1101 N  N     . LYS B 2 33  ? 27.997  36.181 55.217 1.00 33.81 ? 32   LYS B N     1 
ATOM   1102 C  CA    . LYS B 2 33  ? 28.953  35.516 54.351 1.00 38.58 ? 32   LYS B CA    1 
ATOM   1103 C  C     . LYS B 2 33  ? 28.478  34.124 53.947 1.00 35.62 ? 32   LYS B C     1 
ATOM   1104 O  O     . LYS B 2 33  ? 28.631  33.724 52.796 1.00 33.19 ? 32   LYS B O     1 
ATOM   1105 C  CB    . LYS B 2 33  ? 30.301  35.437 55.065 1.00 45.82 ? 32   LYS B CB    1 
ATOM   1106 C  CG    . LYS B 2 33  ? 30.248  34.699 56.401 1.00 54.96 ? 32   LYS B CG    1 
ATOM   1107 C  CD    . LYS B 2 33  ? 31.561  34.840 57.187 1.00 61.93 ? 32   LYS B CD    1 
ATOM   1108 C  CE    . LYS B 2 33  ? 31.857  33.589 58.034 1.00 66.13 ? 32   LYS B CE    1 
ATOM   1109 N  NZ    . LYS B 2 33  ? 30.700  33.133 58.860 1.00 67.23 ? 32   LYS B NZ    1 
ATOM   1110 H  H     . LYS B 2 33  ? 28.297  36.466 56.108 1.00 0.00  ? 32   LYS B H     1 
ATOM   1111 H  HZ1   . LYS B 2 33  ? 30.408  33.902 59.498 1.00 0.00  ? 32   LYS B HZ1   1 
ATOM   1112 H  HZ2   . LYS B 2 33  ? 29.903  32.877 58.241 1.00 0.00  ? 32   LYS B HZ2   1 
ATOM   1113 H  HZ3   . LYS B 2 33  ? 30.986  32.302 59.416 1.00 0.00  ? 32   LYS B HZ3   1 
ATOM   1114 N  N     . ASP B 2 34  ? 27.897  33.397 54.898 1.00 32.23 ? 33   ASP B N     1 
ATOM   1115 C  CA    . ASP B 2 34  ? 27.394  32.057 54.637 1.00 31.23 ? 33   ASP B CA    1 
ATOM   1116 C  C     . ASP B 2 34  ? 26.114  32.046 53.838 1.00 31.95 ? 33   ASP B C     1 
ATOM   1117 O  O     . ASP B 2 34  ? 25.992  31.254 52.901 1.00 35.81 ? 33   ASP B O     1 
ATOM   1118 C  CB    . ASP B 2 34  ? 27.140  31.288 55.926 1.00 32.89 ? 33   ASP B CB    1 
ATOM   1119 C  CG    . ASP B 2 34  ? 28.380  31.091 56.731 1.00 34.92 ? 33   ASP B CG    1 
ATOM   1120 O  OD1   . ASP B 2 34  ? 29.465  30.901 56.130 1.00 38.47 ? 33   ASP B OD1   1 
ATOM   1121 O  OD2   . ASP B 2 34  ? 28.263  31.136 57.969 1.00 34.41 ? 33   ASP B OD2   1 
ATOM   1122 H  H     . ASP B 2 34  ? 27.791  33.790 55.791 1.00 0.00  ? 33   ASP B H     1 
ATOM   1123 N  N     . VAL B 2 35  ? 25.145  32.883 54.223 1.00 31.31 ? 34   VAL B N     1 
ATOM   1124 C  CA    . VAL B 2 35  ? 23.860  32.922 53.512 1.00 31.59 ? 34   VAL B CA    1 
ATOM   1125 C  C     . VAL B 2 35  ? 24.211  33.301 52.076 1.00 30.24 ? 34   VAL B C     1 
ATOM   1126 O  O     . VAL B 2 35  ? 23.709  32.711 51.118 1.00 32.04 ? 34   VAL B O     1 
ATOM   1127 C  CB    . VAL B 2 35  ? 22.843  33.913 54.171 1.00 30.82 ? 34   VAL B CB    1 
ATOM   1128 C  CG1   . VAL B 2 35  ? 21.540  33.931 53.393 1.00 32.58 ? 34   VAL B CG1   1 
ATOM   1129 C  CG2   . VAL B 2 35  ? 22.558  33.498 55.603 1.00 25.15 ? 34   VAL B CG2   1 
ATOM   1130 H  H     . VAL B 2 35  ? 25.297  33.479 54.987 1.00 0.00  ? 34   VAL B H     1 
ATOM   1131 N  N     . ASN B 2 36  ? 25.122  34.258 51.949 1.00 28.38 ? 35   ASN B N     1 
ATOM   1132 C  CA    . ASN B 2 36  ? 25.624  34.687 50.656 1.00 27.54 ? 35   ASN B CA    1 
ATOM   1133 C  C     . ASN B 2 36  ? 24.536  35.066 49.662 1.00 27.62 ? 35   ASN B C     1 
ATOM   1134 O  O     . ASN B 2 36  ? 24.353  34.423 48.615 1.00 25.50 ? 35   ASN B O     1 
ATOM   1135 C  CB    . ASN B 2 36  ? 26.497  33.583 50.083 1.00 25.36 ? 35   ASN B CB    1 
ATOM   1136 C  CG    . ASN B 2 36  ? 27.401  34.067 48.986 1.00 26.76 ? 35   ASN B CG    1 
ATOM   1137 O  OD1   . ASN B 2 36  ? 27.676  33.326 48.041 1.00 28.51 ? 35   ASN B OD1   1 
ATOM   1138 N  ND2   . ASN B 2 36  ? 27.915  35.290 49.118 1.00 20.83 ? 35   ASN B ND2   1 
ATOM   1139 H  H     . ASN B 2 36  ? 25.429  34.703 52.768 1.00 0.00  ? 35   ASN B H     1 
ATOM   1140 H  HD21  . ASN B 2 36  ? 28.470  35.641 48.386 1.00 0.00  ? 35   ASN B HD21  1 
ATOM   1141 H  HD22  . ASN B 2 36  ? 27.750  35.835 49.910 1.00 0.00  ? 35   ASN B HD22  1 
ATOM   1142 N  N     . THR B 2 37  ? 23.811  36.118 50.023 1.00 28.31 ? 36   THR B N     1 
ATOM   1143 C  CA    . THR B 2 37  ? 22.735  36.667 49.216 1.00 25.40 ? 36   THR B CA    1 
ATOM   1144 C  C     . THR B 2 37  ? 23.371  37.338 48.004 1.00 30.44 ? 36   THR B C     1 
ATOM   1145 O  O     . THR B 2 37  ? 24.303  38.138 48.149 1.00 33.14 ? 36   THR B O     1 
ATOM   1146 C  CB    . THR B 2 37  ? 21.953  37.705 50.032 1.00 23.73 ? 36   THR B CB    1 
ATOM   1147 O  OG1   . THR B 2 37  ? 21.528  37.105 51.270 1.00 21.55 ? 36   THR B OG1   1 
ATOM   1148 C  CG2   . THR B 2 37  ? 20.736  38.238 49.239 1.00 20.45 ? 36   THR B CG2   1 
ATOM   1149 H  H     . THR B 2 37  ? 24.022  36.578 50.852 1.00 0.00  ? 36   THR B H     1 
ATOM   1150 H  HG1   . THR B 2 37  ? 22.275  36.786 51.775 1.00 0.00  ? 36   THR B HG1   1 
ATOM   1151 N  N     . ARG B 2 38  ? 22.908  36.977 46.812 1.00 30.47 ? 37   ARG B N     1 
ATOM   1152 C  CA    . ARG B 2 38  ? 23.444  37.558 45.598 1.00 29.41 ? 37   ARG B CA    1 
ATOM   1153 C  C     . ARG B 2 38  ? 22.293  38.170 44.805 1.00 34.33 ? 37   ARG B C     1 
ATOM   1154 O  O     . ARG B 2 38  ? 21.176  37.638 44.811 1.00 38.30 ? 37   ARG B O     1 
ATOM   1155 C  CB    . ARG B 2 38  ? 24.108  36.478 44.754 1.00 25.46 ? 37   ARG B CB    1 
ATOM   1156 C  CG    . ARG B 2 38  ? 24.924  35.471 45.515 1.00 19.96 ? 37   ARG B CG    1 
ATOM   1157 C  CD    . ARG B 2 38  ? 25.852  34.751 44.566 1.00 20.92 ? 37   ARG B CD    1 
ATOM   1158 N  NE    . ARG B 2 38  ? 25.126  34.028 43.521 1.00 24.49 ? 37   ARG B NE    1 
ATOM   1159 C  CZ    . ARG B 2 38  ? 25.441  34.044 42.232 1.00 24.90 ? 37   ARG B CZ    1 
ATOM   1160 N  NH1   . ARG B 2 38  ? 26.447  34.769 41.791 1.00 33.55 ? 37   ARG B NH1   1 
ATOM   1161 N  NH2   . ARG B 2 38  ? 24.724  33.360 41.368 1.00 32.68 ? 37   ARG B NH2   1 
ATOM   1162 H  H     . ARG B 2 38  ? 22.191  36.322 46.754 1.00 0.00  ? 37   ARG B H     1 
ATOM   1163 H  HE    . ARG B 2 38  ? 24.342  33.508 43.794 1.00 0.00  ? 37   ARG B HE    1 
ATOM   1164 H  HH11  . ARG B 2 38  ? 26.984  35.319 42.430 1.00 0.00  ? 37   ARG B HH11  1 
ATOM   1165 H  HH12  . ARG B 2 38  ? 26.683  34.765 40.819 1.00 0.00  ? 37   ARG B HH12  1 
ATOM   1166 H  HH21  . ARG B 2 38  ? 23.938  32.841 41.698 1.00 0.00  ? 37   ARG B HH21  1 
ATOM   1167 H  HH22  . ARG B 2 38  ? 24.955  33.356 40.395 1.00 0.00  ? 37   ARG B HH22  1 
ATOM   1168 N  N     . PHE B 2 39  ? 22.558  39.284 44.127 1.00 32.60 ? 38   PHE B N     1 
ATOM   1169 C  CA    . PHE B 2 39  ? 21.546  39.949 43.307 1.00 29.01 ? 38   PHE B CA    1 
ATOM   1170 C  C     . PHE B 2 39  ? 21.907  39.739 41.839 1.00 28.84 ? 38   PHE B C     1 
ATOM   1171 O  O     . PHE B 2 39  ? 22.971  40.142 41.379 1.00 31.66 ? 38   PHE B O     1 
ATOM   1172 C  CB    . PHE B 2 39  ? 21.446  41.436 43.659 1.00 24.00 ? 38   PHE B CB    1 
ATOM   1173 C  CG    . PHE B 2 39  ? 21.083  41.680 45.094 1.00 22.61 ? 38   PHE B CG    1 
ATOM   1174 C  CD1   . PHE B 2 39  ? 19.767  41.615 45.512 1.00 23.64 ? 38   PHE B CD1   1 
ATOM   1175 C  CD2   . PHE B 2 39  ? 22.061  41.924 46.042 1.00 23.56 ? 38   PHE B CD2   1 
ATOM   1176 C  CE1   . PHE B 2 39  ? 19.430  41.787 46.877 1.00 21.91 ? 38   PHE B CE1   1 
ATOM   1177 C  CE2   . PHE B 2 39  ? 21.730  42.093 47.398 1.00 23.90 ? 38   PHE B CE2   1 
ATOM   1178 C  CZ    . PHE B 2 39  ? 20.411  42.022 47.807 1.00 21.29 ? 38   PHE B CZ    1 
ATOM   1179 H  H     . PHE B 2 39  ? 23.443  39.652 44.158 1.00 0.00  ? 38   PHE B H     1 
ATOM   1180 N  N     . LEU B 2 40  ? 21.055  39.008 41.137 1.00 28.86 ? 39   LEU B N     1 
ATOM   1181 C  CA    . LEU B 2 40  ? 21.276  38.712 39.738 1.00 27.78 ? 39   LEU B CA    1 
ATOM   1182 C  C     . LEU B 2 40  ? 20.275  39.517 38.895 1.00 32.67 ? 39   LEU B C     1 
ATOM   1183 O  O     . LEU B 2 40  ? 19.061  39.222 38.891 1.00 32.11 ? 39   LEU B O     1 
ATOM   1184 C  CB    . LEU B 2 40  ? 21.096  37.207 39.492 1.00 27.63 ? 39   LEU B CB    1 
ATOM   1185 C  CG    . LEU B 2 40  ? 21.590  36.138 40.496 1.00 27.86 ? 39   LEU B CG    1 
ATOM   1186 C  CD1   . LEU B 2 40  ? 21.177  34.770 39.947 1.00 26.82 ? 39   LEU B CD1   1 
ATOM   1187 C  CD2   . LEU B 2 40  ? 23.097  36.185 40.757 1.00 22.09 ? 39   LEU B CD2   1 
ATOM   1188 H  H     . LEU B 2 40  ? 20.253  38.647 41.568 1.00 0.00  ? 39   LEU B H     1 
ATOM   1189 N  N     . LEU B 2 41  ? 20.793  40.501 38.152 1.00 32.89 ? 40   LEU B N     1 
ATOM   1190 C  CA    . LEU B 2 41  ? 19.963  41.374 37.306 1.00 31.09 ? 40   LEU B CA    1 
ATOM   1191 C  C     . LEU B 2 41  ? 19.731  40.940 35.863 1.00 26.45 ? 40   LEU B C     1 
ATOM   1192 O  O     . LEU B 2 41  ? 20.642  40.530 35.149 1.00 26.28 ? 40   LEU B O     1 
ATOM   1193 C  CB    . LEU B 2 41  ? 20.524  42.801 37.314 1.00 32.21 ? 40   LEU B CB    1 
ATOM   1194 C  CG    . LEU B 2 41  ? 19.848  43.927 36.518 1.00 33.55 ? 40   LEU B CG    1 
ATOM   1195 C  CD1   . LEU B 2 41  ? 18.394  44.075 36.911 1.00 30.91 ? 40   LEU B CD1   1 
ATOM   1196 C  CD2   . LEU B 2 41  ? 20.601  45.230 36.777 1.00 32.57 ? 40   LEU B CD2   1 
ATOM   1197 H  H     . LEU B 2 41  ? 21.757  40.645 38.162 1.00 0.00  ? 40   LEU B H     1 
ATOM   1198 N  N     . TYR B 2 42  ? 18.488  41.079 35.439 1.00 27.14 ? 41   TYR B N     1 
ATOM   1199 C  CA    . TYR B 2 42  ? 18.044  40.770 34.082 1.00 20.72 ? 41   TYR B CA    1 
ATOM   1200 C  C     . TYR B 2 42  ? 17.323  42.033 33.670 1.00 21.73 ? 41   TYR B C     1 
ATOM   1201 O  O     . TYR B 2 42  ? 16.762  42.734 34.524 1.00 19.37 ? 41   TYR B O     1 
ATOM   1202 C  CB    . TYR B 2 42  ? 17.027  39.648 34.090 1.00 15.16 ? 41   TYR B CB    1 
ATOM   1203 C  CG    . TYR B 2 42  ? 17.611  38.284 34.221 1.00 22.44 ? 41   TYR B CG    1 
ATOM   1204 C  CD1   . TYR B 2 42  ? 18.104  37.617 33.101 1.00 26.06 ? 41   TYR B CD1   1 
ATOM   1205 C  CD2   . TYR B 2 42  ? 17.653  37.628 35.453 1.00 24.08 ? 41   TYR B CD2   1 
ATOM   1206 C  CE1   . TYR B 2 42  ? 18.615  36.335 33.192 1.00 23.95 ? 41   TYR B CE1   1 
ATOM   1207 C  CE2   . TYR B 2 42  ? 18.174  36.334 35.552 1.00 25.57 ? 41   TYR B CE2   1 
ATOM   1208 C  CZ    . TYR B 2 42  ? 18.646  35.709 34.406 1.00 25.64 ? 41   TYR B CZ    1 
ATOM   1209 O  OH    . TYR B 2 42  ? 19.145  34.447 34.462 1.00 34.12 ? 41   TYR B OH    1 
ATOM   1210 H  H     . TYR B 2 42  ? 17.820  41.451 36.042 1.00 0.00  ? 41   TYR B H     1 
ATOM   1211 H  HH    . TYR B 2 42  ? 19.336  34.129 33.573 1.00 0.00  ? 41   TYR B HH    1 
ATOM   1212 N  N     . THR B 2 43  ? 17.340  42.344 32.384 1.00 26.75 ? 42   THR B N     1 
ATOM   1213 C  CA    . THR B 2 43  ? 16.647  43.533 31.899 1.00 28.51 ? 42   THR B CA    1 
ATOM   1214 C  C     . THR B 2 43  ? 16.198  43.287 30.478 1.00 27.29 ? 42   THR B C     1 
ATOM   1215 O  O     . THR B 2 43  ? 16.447  42.234 29.905 1.00 22.10 ? 42   THR B O     1 
ATOM   1216 C  CB    . THR B 2 43  ? 17.524  44.842 31.920 1.00 30.17 ? 42   THR B CB    1 
ATOM   1217 O  OG1   . THR B 2 43  ? 18.497  44.814 30.865 1.00 26.96 ? 42   THR B OG1   1 
ATOM   1218 C  CG2   . THR B 2 43  ? 18.215  45.048 33.273 1.00 29.69 ? 42   THR B CG2   1 
ATOM   1219 H  H     . THR B 2 43  ? 17.815  41.778 31.742 1.00 0.00  ? 42   THR B H     1 
ATOM   1220 H  HG1   . THR B 2 43  ? 18.905  45.711 30.946 1.00 0.00  ? 42   THR B HG1   1 
ATOM   1221 N  N     . ASN B 2 44  ? 15.472  44.249 29.938 1.00 28.48 ? 43   ASN B N     1 
ATOM   1222 C  CA    . ASN B 2 44  ? 15.007  44.142 28.577 1.00 30.99 ? 43   ASN B CA    1 
ATOM   1223 C  C     . ASN B 2 44  ? 16.270  44.194 27.729 1.00 31.38 ? 43   ASN B C     1 
ATOM   1224 O  O     . ASN B 2 44  ? 16.341  43.561 26.687 1.00 38.36 ? 43   ASN B O     1 
ATOM   1225 C  CB    . ASN B 2 44  ? 14.088  45.316 28.236 1.00 32.41 ? 43   ASN B CB    1 
ATOM   1226 C  CG    . ASN B 2 44  ? 12.933  45.467 29.208 1.00 30.88 ? 43   ASN B CG    1 
ATOM   1227 O  OD1   . ASN B 2 44  ? 13.076  46.027 30.311 1.00 29.29 ? 43   ASN B OD1   1 
ATOM   1228 N  ND2   . ASN B 2 44  ? 11.774  45.003 28.790 1.00 30.52 ? 43   ASN B ND2   1 
ATOM   1229 H  H     . ASN B 2 44  ? 15.212  45.018 30.489 1.00 0.00  ? 43   ASN B H     1 
ATOM   1230 H  HD21  . ASN B 2 44  ? 11.013  45.061 29.394 1.00 0.00  ? 43   ASN B HD21  1 
ATOM   1231 H  HD22  . ASN B 2 44  ? 11.703  44.599 27.899 1.00 0.00  ? 43   ASN B HD22  1 
ATOM   1232 N  N     . GLU B 2 45  ? 17.283  44.909 28.212 1.00 29.14 ? 44   GLU B N     1 
ATOM   1233 C  CA    . GLU B 2 45  ? 18.548  45.017 27.501 1.00 33.09 ? 44   GLU B CA    1 
ATOM   1234 C  C     . GLU B 2 45  ? 19.313  43.711 27.593 1.00 34.79 ? 44   GLU B C     1 
ATOM   1235 O  O     . GLU B 2 45  ? 20.027  43.353 26.661 1.00 37.11 ? 44   GLU B O     1 
ATOM   1236 C  CB    . GLU B 2 45  ? 19.410  46.157 28.051 1.00 33.20 ? 44   GLU B CB    1 
ATOM   1237 C  CG    . GLU B 2 45  ? 18.909  47.551 27.691 1.00 33.76 ? 44   GLU B CG    1 
ATOM   1238 C  CD    . GLU B 2 45  ? 17.737  47.995 28.543 1.00 35.23 ? 44   GLU B CD    1 
ATOM   1239 O  OE1   . GLU B 2 45  ? 17.986  48.411 29.686 1.00 36.34 ? 44   GLU B OE1   1 
ATOM   1240 O  OE2   . GLU B 2 45  ? 16.577  47.928 28.079 1.00 35.80 ? 44   GLU B OE2   1 
ATOM   1241 H  H     . GLU B 2 45  ? 17.207  45.333 29.088 1.00 0.00  ? 44   GLU B H     1 
ATOM   1242 N  N     . ASN B 2 46  ? 19.198  43.024 28.732 1.00 37.81 ? 45   ASN B N     1 
ATOM   1243 C  CA    . ASN B 2 46  ? 19.862  41.727 28.933 1.00 36.02 ? 45   ASN B CA    1 
ATOM   1244 C  C     . ASN B 2 46  ? 18.885  40.673 29.487 1.00 33.12 ? 45   ASN B C     1 
ATOM   1245 O  O     . ASN B 2 46  ? 18.926  40.322 30.654 1.00 33.17 ? 45   ASN B O     1 
ATOM   1246 C  CB    . ASN B 2 46  ? 21.171  41.858 29.787 1.00 38.23 ? 45   ASN B CB    1 
ATOM   1247 C  CG    . ASN B 2 46  ? 20.946  42.390 31.226 1.00 36.21 ? 45   ASN B CG    1 
ATOM   1248 O  OD1   . ASN B 2 46  ? 20.583  43.554 31.433 1.00 34.50 ? 45   ASN B OD1   1 
ATOM   1249 N  ND2   . ASN B 2 46  ? 21.266  41.565 32.212 1.00 31.87 ? 45   ASN B ND2   1 
ATOM   1250 H  H     . ASN B 2 46  ? 18.667  43.386 29.471 1.00 0.00  ? 45   ASN B H     1 
ATOM   1251 H  HD21  . ASN B 2 46  ? 21.126  41.820 33.146 1.00 0.00  ? 45   ASN B HD21  1 
ATOM   1252 H  HD22  . ASN B 2 46  ? 21.623  40.704 31.943 1.00 0.00  ? 45   ASN B HD22  1 
ATOM   1253 N  N     . PRO B 2 47  ? 17.957  40.193 28.644 1.00 32.50 ? 46   PRO B N     1 
ATOM   1254 C  CA    . PRO B 2 47  ? 16.943  39.193 28.984 1.00 35.72 ? 46   PRO B CA    1 
ATOM   1255 C  C     . PRO B 2 47  ? 17.367  37.761 29.224 1.00 36.44 ? 46   PRO B C     1 
ATOM   1256 O  O     . PRO B 2 47  ? 16.595  36.996 29.791 1.00 36.72 ? 46   PRO B O     1 
ATOM   1257 C  CB    . PRO B 2 47  ? 15.994  39.256 27.791 1.00 36.92 ? 46   PRO B CB    1 
ATOM   1258 C  CG    . PRO B 2 47  ? 16.877  39.649 26.685 1.00 34.12 ? 46   PRO B CG    1 
ATOM   1259 C  CD    . PRO B 2 47  ? 17.670  40.749 27.316 1.00 33.20 ? 46   PRO B CD    1 
ATOM   1260 N  N     . ASN B 2 48  ? 18.564  37.376 28.790 1.00 38.51 ? 47   ASN B N     1 
ATOM   1261 C  CA    . ASN B 2 48  ? 19.003  35.986 28.989 1.00 37.62 ? 47   ASN B CA    1 
ATOM   1262 C  C     . ASN B 2 48  ? 20.255  35.811 29.817 1.00 34.42 ? 47   ASN B C     1 
ATOM   1263 O  O     . ASN B 2 48  ? 20.576  34.702 30.213 1.00 35.41 ? 47   ASN B O     1 
ATOM   1264 C  CB    . ASN B 2 48  ? 19.182  35.273 27.654 1.00 36.28 ? 47   ASN B CB    1 
ATOM   1265 C  CG    . ASN B 2 48  ? 17.896  35.190 26.874 1.00 40.45 ? 47   ASN B CG    1 
ATOM   1266 O  OD1   . ASN B 2 48  ? 16.905  34.625 27.345 1.00 42.06 ? 47   ASN B OD1   1 
ATOM   1267 N  ND2   . ASN B 2 48  ? 17.894  35.763 25.671 1.00 42.19 ? 47   ASN B ND2   1 
ATOM   1268 H  H     . ASN B 2 48  ? 19.153  38.027 28.363 1.00 0.00  ? 47   ASN B H     1 
ATOM   1269 H  HD21  . ASN B 2 48  ? 17.049  35.697 25.176 1.00 0.00  ? 47   ASN B HD21  1 
ATOM   1270 H  HD22  . ASN B 2 48  ? 18.701  36.202 25.341 1.00 0.00  ? 47   ASN B HD22  1 
ATOM   1271 N  N     . ASN B 2 49  ? 20.968  36.897 30.073 1.00 33.88 ? 48   ASN B N     1 
ATOM   1272 C  CA    . ASN B 2 49  ? 22.189  36.825 30.863 1.00 37.06 ? 48   ASN B CA    1 
ATOM   1273 C  C     . ASN B 2 49  ? 22.108  37.731 32.084 1.00 40.57 ? 48   ASN B C     1 
ATOM   1274 O  O     . ASN B 2 49  ? 21.821  38.927 31.963 1.00 45.53 ? 48   ASN B O     1 
ATOM   1275 C  CB    . ASN B 2 49  ? 23.393  37.196 30.005 1.00 36.82 ? 48   ASN B CB    1 
ATOM   1276 C  CG    . ASN B 2 49  ? 23.689  36.148 28.959 1.00 42.11 ? 48   ASN B CG    1 
ATOM   1277 O  OD1   . ASN B 2 49  ? 23.328  36.302 27.788 1.00 48.84 ? 48   ASN B OD1   1 
ATOM   1278 N  ND2   . ASN B 2 49  ? 24.324  35.063 29.373 1.00 38.80 ? 48   ASN B ND2   1 
ATOM   1279 H  H     . ASN B 2 49  ? 20.671  37.775 29.762 1.00 0.00  ? 48   ASN B H     1 
ATOM   1280 H  HD21  . ASN B 2 49  ? 24.453  34.333 28.728 1.00 0.00  ? 48   ASN B HD21  1 
ATOM   1281 H  HD22  . ASN B 2 49  ? 24.606  35.005 30.305 1.00 0.00  ? 48   ASN B HD22  1 
ATOM   1282 N  N     . PHE B 2 50  ? 22.349  37.178 33.267 1.00 35.99 ? 49   PHE B N     1 
ATOM   1283 C  CA    . PHE B 2 50  ? 22.279  38.013 34.444 1.00 34.83 ? 49   PHE B CA    1 
ATOM   1284 C  C     . PHE B 2 50  ? 23.569  38.757 34.772 1.00 32.52 ? 49   PHE B C     1 
ATOM   1285 O  O     . PHE B 2 50  ? 24.654  38.226 34.579 1.00 37.38 ? 49   PHE B O     1 
ATOM   1286 C  CB    . PHE B 2 50  ? 21.775  37.217 35.662 1.00 33.87 ? 49   PHE B CB    1 
ATOM   1287 C  CG    . PHE B 2 50  ? 22.728  36.156 36.176 1.00 33.23 ? 49   PHE B CG    1 
ATOM   1288 C  CD1   . PHE B 2 50  ? 23.931  36.500 36.782 1.00 31.51 ? 49   PHE B CD1   1 
ATOM   1289 C  CD2   . PHE B 2 50  ? 22.362  34.810 36.154 1.00 32.64 ? 49   PHE B CD2   1 
ATOM   1290 C  CE1   . PHE B 2 50  ? 24.744  35.523 37.362 1.00 30.92 ? 49   PHE B CE1   1 
ATOM   1291 C  CE2   . PHE B 2 50  ? 23.166  33.835 36.729 1.00 30.32 ? 49   PHE B CE2   1 
ATOM   1292 C  CZ    . PHE B 2 50  ? 24.356  34.187 37.337 1.00 27.51 ? 49   PHE B CZ    1 
ATOM   1293 H  H     . PHE B 2 50  ? 22.596  36.237 33.338 1.00 0.00  ? 49   PHE B H     1 
ATOM   1294 N  N     . GLN B 2 51  ? 23.447  40.016 35.168 1.00 26.50 ? 50   GLN B N     1 
ATOM   1295 C  CA    . GLN B 2 51  ? 24.595  40.790 35.593 1.00 25.83 ? 50   GLN B CA    1 
ATOM   1296 C  C     . GLN B 2 51  ? 24.475  40.773 37.106 1.00 27.22 ? 50   GLN B C     1 
ATOM   1297 O  O     . GLN B 2 51  ? 23.490  41.230 37.652 1.00 30.63 ? 50   GLN B O     1 
ATOM   1298 C  CB    . GLN B 2 51  ? 24.537  42.241 35.106 1.00 24.08 ? 50   GLN B CB    1 
ATOM   1299 C  CG    . GLN B 2 51  ? 24.549  42.404 33.583 1.00 30.88 ? 50   GLN B CG    1 
ATOM   1300 C  CD    . GLN B 2 51  ? 24.509  43.861 33.136 1.00 35.02 ? 50   GLN B CD    1 
ATOM   1301 O  OE1   . GLN B 2 51  ? 23.552  44.595 33.425 1.00 35.25 ? 50   GLN B OE1   1 
ATOM   1302 N  NE2   . GLN B 2 51  ? 25.548  44.288 32.421 1.00 35.19 ? 50   GLN B NE2   1 
ATOM   1303 H  H     . GLN B 2 51  ? 22.558  40.425 35.165 1.00 0.00  ? 50   GLN B H     1 
ATOM   1304 H  HE21  . GLN B 2 51  ? 25.545  45.223 32.134 1.00 0.00  ? 50   GLN B HE21  1 
ATOM   1305 H  HE22  . GLN B 2 51  ? 26.267  43.653 32.206 1.00 0.00  ? 50   GLN B HE22  1 
ATOM   1306 N  N     . GLU B 2 52  ? 25.435  40.165 37.779 1.00 32.30 ? 51   GLU B N     1 
ATOM   1307 C  CA    . GLU B 2 52  ? 25.424  40.115 39.230 1.00 32.89 ? 51   GLU B CA    1 
ATOM   1308 C  C     . GLU B 2 52  ? 25.823  41.487 39.745 1.00 32.66 ? 51   GLU B C     1 
ATOM   1309 O  O     . GLU B 2 52  ? 26.951  41.904 39.534 1.00 35.49 ? 51   GLU B O     1 
ATOM   1310 C  CB    . GLU B 2 52  ? 26.426  39.080 39.723 1.00 29.88 ? 51   GLU B CB    1 
ATOM   1311 C  CG    . GLU B 2 52  ? 26.431  38.954 41.216 1.00 35.41 ? 51   GLU B CG    1 
ATOM   1312 C  CD    . GLU B 2 52  ? 27.288  37.817 41.720 1.00 40.14 ? 51   GLU B CD    1 
ATOM   1313 O  OE1   . GLU B 2 52  ? 27.654  36.909 40.921 1.00 40.30 ? 51   GLU B OE1   1 
ATOM   1314 O  OE2   . GLU B 2 52  ? 27.580  37.828 42.939 1.00 43.85 ? 51   GLU B OE2   1 
ATOM   1315 H  H     . GLU B 2 52  ? 26.192  39.769 37.290 1.00 0.00  ? 51   GLU B H     1 
ATOM   1316 N  N     . VAL B 2 53  ? 24.898  42.178 40.410 1.00 34.14 ? 52   VAL B N     1 
ATOM   1317 C  CA    . VAL B 2 53  ? 25.134  43.517 40.950 1.00 28.99 ? 52   VAL B CA    1 
ATOM   1318 C  C     . VAL B 2 53  ? 25.155  43.451 42.479 1.00 29.20 ? 52   VAL B C     1 
ATOM   1319 O  O     . VAL B 2 53  ? 24.983  42.380 43.051 1.00 30.85 ? 52   VAL B O     1 
ATOM   1320 C  CB    . VAL B 2 53  ? 24.041  44.539 40.476 1.00 28.90 ? 52   VAL B CB    1 
ATOM   1321 C  CG1   . VAL B 2 53  ? 23.958  44.580 38.951 1.00 26.17 ? 52   VAL B CG1   1 
ATOM   1322 C  CG2   . VAL B 2 53  ? 22.692  44.194 41.059 1.00 29.33 ? 52   VAL B CG2   1 
ATOM   1323 H  H     . VAL B 2 53  ? 24.032  41.741 40.558 1.00 0.00  ? 52   VAL B H     1 
ATOM   1324 N  N     . ALA B 2 54  ? 25.387  44.587 43.130 1.00 27.09 ? 53   ALA B N     1 
ATOM   1325 C  CA    . ALA B 2 54  ? 25.438  44.665 44.582 1.00 25.99 ? 53   ALA B CA    1 
ATOM   1326 C  C     . ALA B 2 54  ? 25.259  46.103 44.986 1.00 29.08 ? 53   ALA B C     1 
ATOM   1327 O  O     . ALA B 2 54  ? 25.445  47.008 44.170 1.00 30.66 ? 53   ALA B O     1 
ATOM   1328 C  CB    . ALA B 2 54  ? 26.755  44.180 45.077 1.00 30.55 ? 53   ALA B CB    1 
ATOM   1329 H  H     . ALA B 2 54  ? 25.532  45.420 42.629 1.00 0.00  ? 53   ALA B H     1 
ATOM   1330 N  N     . ALA B 2 55  ? 24.969  46.324 46.259 1.00 29.71 ? 54   ALA B N     1 
ATOM   1331 C  CA    . ALA B 2 55  ? 24.746  47.677 46.764 1.00 34.67 ? 54   ALA B CA    1 
ATOM   1332 C  C     . ALA B 2 55  ? 26.009  48.559 46.793 1.00 39.45 ? 54   ALA B C     1 
ATOM   1333 O  O     . ALA B 2 55  ? 26.530  48.891 47.865 1.00 43.25 ? 54   ALA B O     1 
ATOM   1334 C  CB    . ALA B 2 55  ? 24.058  47.639 48.147 1.00 28.40 ? 54   ALA B CB    1 
ATOM   1335 H  H     . ALA B 2 55  ? 24.942  45.573 46.871 1.00 0.00  ? 54   ALA B H     1 
ATOM   1336 N  N     . ASP B 2 56  ? 26.504  48.914 45.605 1.00 40.37 ? 55   ASP B N     1 
ATOM   1337 C  CA    . ASP B 2 56  ? 27.675  49.771 45.456 1.00 40.06 ? 55   ASP B CA    1 
ATOM   1338 C  C     . ASP B 2 56  ? 27.604  50.443 44.087 1.00 41.77 ? 55   ASP B C     1 
ATOM   1339 O  O     . ASP B 2 56  ? 27.377  49.785 43.062 1.00 38.28 ? 55   ASP B O     1 
ATOM   1340 C  CB    . ASP B 2 56  ? 28.983  48.991 45.634 1.00 42.74 ? 55   ASP B CB    1 
ATOM   1341 C  CG    . ASP B 2 56  ? 29.265  48.030 44.494 1.00 48.45 ? 55   ASP B CG    1 
ATOM   1342 O  OD1   . ASP B 2 56  ? 29.642  48.486 43.394 1.00 48.73 ? 55   ASP B OD1   1 
ATOM   1343 O  OD2   . ASP B 2 56  ? 29.144  46.805 44.702 1.00 54.32 ? 55   ASP B OD2   1 
ATOM   1344 H  H     . ASP B 2 56  ? 26.064  48.612 44.788 1.00 0.00  ? 55   ASP B H     1 
ATOM   1345 N  N     . SER B 2 57  ? 27.771  51.761 44.093 1.00 41.90 ? 56   SER B N     1 
ATOM   1346 C  CA    . SER B 2 57  ? 27.714  52.585 42.892 1.00 45.67 ? 56   SER B CA    1 
ATOM   1347 C  C     . SER B 2 57  ? 28.379  51.996 41.644 1.00 45.13 ? 56   SER B C     1 
ATOM   1348 O  O     . SER B 2 57  ? 27.805  52.044 40.556 1.00 43.94 ? 56   SER B O     1 
ATOM   1349 C  CB    . SER B 2 57  ? 28.292  53.970 43.198 1.00 46.24 ? 56   SER B CB    1 
ATOM   1350 O  OG    . SER B 2 57  ? 27.871  54.405 44.479 1.00 48.74 ? 56   SER B OG    1 
ATOM   1351 H  H     . SER B 2 57  ? 27.934  52.232 44.939 1.00 0.00  ? 56   SER B H     1 
ATOM   1352 H  HG    . SER B 2 57  ? 27.435  55.271 44.399 1.00 0.00  ? 56   SER B HG    1 
ATOM   1353 N  N     . SER B 2 58  ? 29.562  51.406 41.787 1.00 46.08 ? 57   SER B N     1 
ATOM   1354 C  CA    . SER B 2 58  ? 30.226  50.844 40.611 1.00 48.81 ? 57   SER B CA    1 
ATOM   1355 C  C     . SER B 2 58  ? 29.394  49.742 39.964 1.00 44.74 ? 57   SER B C     1 
ATOM   1356 O  O     . SER B 2 58  ? 29.321  49.650 38.740 1.00 41.30 ? 57   SER B O     1 
ATOM   1357 C  CB    . SER B 2 58  ? 31.659  50.359 40.933 1.00 52.69 ? 57   SER B CB    1 
ATOM   1358 O  OG    . SER B 2 58  ? 31.704  49.327 41.914 1.00 58.72 ? 57   SER B OG    1 
ATOM   1359 H  H     . SER B 2 58  ? 29.995  51.334 42.658 1.00 0.00  ? 57   SER B H     1 
ATOM   1360 H  HG    . SER B 2 58  ? 31.731  48.477 41.464 1.00 0.00  ? 57   SER B HG    1 
ATOM   1361 N  N     . SER B 2 59  ? 28.710  48.961 40.791 1.00 43.91 ? 58   SER B N     1 
ATOM   1362 C  CA    . SER B 2 59  ? 27.899  47.873 40.290 1.00 44.86 ? 58   SER B CA    1 
ATOM   1363 C  C     . SER B 2 59  ? 26.723  48.405 39.522 1.00 46.00 ? 58   SER B C     1 
ATOM   1364 O  O     . SER B 2 59  ? 26.623  48.189 38.315 1.00 50.53 ? 58   SER B O     1 
ATOM   1365 C  CB    . SER B 2 59  ? 27.419  46.966 41.423 1.00 43.31 ? 58   SER B CB    1 
ATOM   1366 O  OG    . SER B 2 59  ? 28.153  45.754 41.446 1.00 42.37 ? 58   SER B OG    1 
ATOM   1367 H  H     . SER B 2 59  ? 28.706  49.135 41.751 1.00 0.00  ? 58   SER B H     1 
ATOM   1368 H  HG    . SER B 2 59  ? 29.094  45.932 41.500 1.00 0.00  ? 58   SER B HG    1 
ATOM   1369 N  N     . ILE B 2 60  ? 25.855  49.133 40.212 1.00 46.55 ? 59   ILE B N     1 
ATOM   1370 C  CA    . ILE B 2 60  ? 24.661  49.687 39.594 1.00 49.54 ? 59   ILE B CA    1 
ATOM   1371 C  C     . ILE B 2 60  ? 25.045  50.442 38.319 1.00 51.90 ? 59   ILE B C     1 
ATOM   1372 O  O     . ILE B 2 60  ? 24.430  50.234 37.259 1.00 51.52 ? 59   ILE B O     1 
ATOM   1373 C  CB    . ILE B 2 60  ? 23.907  50.631 40.579 1.00 51.23 ? 59   ILE B CB    1 
ATOM   1374 C  CG1   . ILE B 2 60  ? 23.532  49.884 41.867 1.00 46.99 ? 59   ILE B CG1   1 
ATOM   1375 C  CG2   . ILE B 2 60  ? 22.662  51.236 39.906 1.00 53.26 ? 59   ILE B CG2   1 
ATOM   1376 C  CD1   . ILE B 2 60  ? 22.600  48.727 41.652 1.00 45.70 ? 59   ILE B CD1   1 
ATOM   1377 H  H     . ILE B 2 60  ? 26.025  49.313 41.161 1.00 0.00  ? 59   ILE B H     1 
ATOM   1378 N  N     . SER B 2 61  ? 26.110  51.244 38.419 1.00 50.98 ? 60   SER B N     1 
ATOM   1379 C  CA    . SER B 2 61  ? 26.625  52.049 37.306 1.00 51.72 ? 60   SER B CA    1 
ATOM   1380 C  C     . SER B 2 61  ? 27.148  51.233 36.121 1.00 47.88 ? 60   SER B C     1 
ATOM   1381 O  O     . SER B 2 61  ? 26.780  51.472 34.977 1.00 52.05 ? 60   SER B O     1 
ATOM   1382 C  CB    . SER B 2 61  ? 27.734  52.977 37.804 1.00 53.94 ? 60   SER B CB    1 
ATOM   1383 O  OG    . SER B 2 61  ? 27.288  53.761 38.897 1.00 57.72 ? 60   SER B OG    1 
ATOM   1384 H  H     . SER B 2 61  ? 26.580  51.326 39.272 1.00 0.00  ? 60   SER B H     1 
ATOM   1385 H  HG    . SER B 2 61  ? 28.044  54.208 39.276 1.00 0.00  ? 60   SER B HG    1 
ATOM   1386 N  N     . GLY B 2 62  ? 28.010  50.269 36.387 1.00 42.50 ? 61   GLY B N     1 
ATOM   1387 C  CA    . GLY B 2 62  ? 28.533  49.478 35.300 1.00 41.19 ? 61   GLY B CA    1 
ATOM   1388 C  C     . GLY B 2 62  ? 27.470  48.668 34.599 1.00 44.14 ? 61   GLY B C     1 
ATOM   1389 O  O     . GLY B 2 62  ? 27.577  48.424 33.393 1.00 48.68 ? 61   GLY B O     1 
ATOM   1390 H  H     . GLY B 2 62  ? 28.250  50.065 37.308 1.00 0.00  ? 61   GLY B H     1 
ATOM   1391 N  N     . SER B 2 63  ? 26.444  48.265 35.350 1.00 42.38 ? 62   SER B N     1 
ATOM   1392 C  CA    . SER B 2 63  ? 25.343  47.438 34.851 1.00 42.38 ? 62   SER B CA    1 
ATOM   1393 C  C     . SER B 2 63  ? 24.216  48.132 34.050 1.00 44.52 ? 62   SER B C     1 
ATOM   1394 O  O     . SER B 2 63  ? 24.212  49.365 33.879 1.00 41.12 ? 62   SER B O     1 
ATOM   1395 C  CB    . SER B 2 63  ? 24.726  46.681 36.028 1.00 41.10 ? 62   SER B CB    1 
ATOM   1396 O  OG    . SER B 2 63  ? 24.137  47.598 36.936 1.00 40.80 ? 62   SER B OG    1 
ATOM   1397 H  H     . SER B 2 63  ? 26.437  48.519 36.298 1.00 0.00  ? 62   SER B H     1 
ATOM   1398 H  HG    . SER B 2 63  ? 24.440  48.488 36.732 1.00 0.00  ? 62   SER B HG    1 
ATOM   1399 N  N     . ASN B 2 64  ? 23.235  47.309 33.639 1.00 43.64 ? 63   ASN B N     1 
ATOM   1400 C  CA    . ASN B 2 64  ? 22.049  47.708 32.863 1.00 37.49 ? 63   ASN B CA    1 
ATOM   1401 C  C     . ASN B 2 64  ? 20.914  48.301 33.691 1.00 35.17 ? 63   ASN B C     1 
ATOM   1402 O  O     . ASN B 2 64  ? 19.868  48.654 33.157 1.00 33.26 ? 63   ASN B O     1 
ATOM   1403 C  CB    . ASN B 2 64  ? 21.496  46.513 32.086 1.00 41.05 ? 63   ASN B CB    1 
ATOM   1404 C  CG    . ASN B 2 64  ? 22.238  46.267 30.805 1.00 44.93 ? 63   ASN B CG    1 
ATOM   1405 O  OD1   . ASN B 2 64  ? 22.607  47.211 30.121 1.00 51.53 ? 63   ASN B OD1   1 
ATOM   1406 N  ND2   . ASN B 2 64  ? 22.498  45.008 30.485 1.00 46.79 ? 63   ASN B ND2   1 
ATOM   1407 H  H     . ASN B 2 64  ? 23.294  46.368 33.891 1.00 0.00  ? 63   ASN B H     1 
ATOM   1408 H  HD21  . ASN B 2 64  ? 22.925  44.819 29.633 1.00 0.00  ? 63   ASN B HD21  1 
ATOM   1409 H  HD22  . ASN B 2 64  ? 22.226  44.332 31.129 1.00 0.00  ? 63   ASN B HD22  1 
ATOM   1410 N  N     . PHE B 2 65  ? 21.101  48.372 35.001 1.00 33.70 ? 64   PHE B N     1 
ATOM   1411 C  CA    . PHE B 2 65  ? 20.089  48.941 35.884 1.00 31.69 ? 64   PHE B CA    1 
ATOM   1412 C  C     . PHE B 2 65  ? 19.746  50.368 35.446 1.00 33.95 ? 64   PHE B C     1 
ATOM   1413 O  O     . PHE B 2 65  ? 20.626  51.209 35.353 1.00 38.84 ? 64   PHE B O     1 
ATOM   1414 C  CB    . PHE B 2 65  ? 20.608  48.956 37.326 1.00 26.01 ? 64   PHE B CB    1 
ATOM   1415 C  CG    . PHE B 2 65  ? 19.624  49.465 38.326 1.00 27.08 ? 64   PHE B CG    1 
ATOM   1416 C  CD1   . PHE B 2 65  ? 19.393  50.833 38.471 1.00 29.80 ? 64   PHE B CD1   1 
ATOM   1417 C  CD2   . PHE B 2 65  ? 18.926  48.573 39.144 1.00 31.57 ? 64   PHE B CD2   1 
ATOM   1418 C  CE1   . PHE B 2 65  ? 18.480  51.310 39.416 1.00 32.92 ? 64   PHE B CE1   1 
ATOM   1419 C  CE2   . PHE B 2 65  ? 18.005  49.033 40.101 1.00 29.17 ? 64   PHE B CE2   1 
ATOM   1420 C  CZ    . PHE B 2 65  ? 17.783  50.399 40.235 1.00 33.26 ? 64   PHE B CZ    1 
ATOM   1421 H  H     . PHE B 2 65  ? 21.930  48.049 35.407 1.00 0.00  ? 64   PHE B H     1 
ATOM   1422 N  N     . LYS B 2 66  ? 18.482  50.614 35.119 1.00 35.70 ? 65   LYS B N     1 
ATOM   1423 C  CA    . LYS B 2 66  ? 18.040  51.939 34.749 1.00 34.64 ? 65   LYS B CA    1 
ATOM   1424 C  C     . LYS B 2 66  ? 17.164  52.445 35.868 1.00 39.32 ? 65   LYS B C     1 
ATOM   1425 O  O     . LYS B 2 66  ? 16.197  51.812 36.276 1.00 44.85 ? 65   LYS B O     1 
ATOM   1426 C  CB    . LYS B 2 66  ? 17.304  51.926 33.427 1.00 35.44 ? 65   LYS B CB    1 
ATOM   1427 C  CG    . LYS B 2 66  ? 18.255  51.879 32.266 1.00 35.19 ? 65   LYS B CG    1 
ATOM   1428 C  CD    . LYS B 2 66  ? 17.535  51.880 30.937 1.00 34.57 ? 65   LYS B CD    1 
ATOM   1429 C  CE    . LYS B 2 66  ? 18.559  51.715 29.818 1.00 41.39 ? 65   LYS B CE    1 
ATOM   1430 N  NZ    . LYS B 2 66  ? 19.652  50.731 30.169 1.00 41.71 ? 65   LYS B NZ    1 
ATOM   1431 H  H     . LYS B 2 66  ? 17.828  49.885 35.125 1.00 0.00  ? 65   LYS B H     1 
ATOM   1432 H  HZ1   . LYS B 2 66  ? 19.252  49.791 30.353 1.00 0.00  ? 65   LYS B HZ1   1 
ATOM   1433 H  HZ2   . LYS B 2 66  ? 20.298  50.681 29.357 1.00 0.00  ? 65   LYS B HZ2   1 
ATOM   1434 H  HZ3   . LYS B 2 66  ? 20.181  51.051 31.006 1.00 0.00  ? 65   LYS B HZ3   1 
ATOM   1435 N  N     . THR B 2 67  ? 17.521  53.608 36.369 1.00 42.74 ? 66   THR B N     1 
ATOM   1436 C  CA    . THR B 2 67  ? 16.837  54.226 37.481 1.00 41.25 ? 66   THR B CA    1 
ATOM   1437 C  C     . THR B 2 67  ? 15.467  54.848 37.140 1.00 41.62 ? 66   THR B C     1 
ATOM   1438 O  O     . THR B 2 67  ? 14.761  55.338 38.020 1.00 45.07 ? 66   THR B O     1 
ATOM   1439 C  CB    . THR B 2 67  ? 17.827  55.243 38.129 1.00 41.61 ? 66   THR B CB    1 
ATOM   1440 O  OG1   . THR B 2 67  ? 17.980  54.964 39.529 1.00 45.51 ? 66   THR B OG1   1 
ATOM   1441 C  CG2   . THR B 2 67  ? 17.391  56.677 37.907 1.00 44.97 ? 66   THR B CG2   1 
ATOM   1442 H  H     . THR B 2 67  ? 18.292  54.056 35.959 1.00 0.00  ? 66   THR B H     1 
ATOM   1443 H  HG1   . THR B 2 67  ? 18.360  54.096 39.668 1.00 0.00  ? 66   THR B HG1   1 
ATOM   1444 N  N     . ASN B 2 68  ? 15.043  54.744 35.890 1.00 38.45 ? 67   ASN B N     1 
ATOM   1445 C  CA    . ASN B 2 68  ? 13.777  55.353 35.472 1.00 42.47 ? 67   ASN B CA    1 
ATOM   1446 C  C     . ASN B 2 68  ? 12.659  54.341 35.270 1.00 44.39 ? 67   ASN B C     1 
ATOM   1447 O  O     . ASN B 2 68  ? 11.690  54.621 34.563 1.00 44.62 ? 67   ASN B O     1 
ATOM   1448 C  CB    . ASN B 2 68  ? 13.985  56.060 34.139 1.00 42.07 ? 67   ASN B CB    1 
ATOM   1449 C  CG    . ASN B 2 68  ? 14.481  55.104 33.090 1.00 42.44 ? 67   ASN B CG    1 
ATOM   1450 O  OD1   . ASN B 2 68  ? 15.369  54.309 33.379 1.00 48.83 ? 67   ASN B OD1   1 
ATOM   1451 N  ND2   . ASN B 2 68  ? 13.874  55.104 31.913 1.00 40.23 ? 67   ASN B ND2   1 
ATOM   1452 H  H     . ASN B 2 68  ? 15.574  54.237 35.244 1.00 0.00  ? 67   ASN B H     1 
ATOM   1453 H  HD21  . ASN B 2 68  ? 14.162  54.419 31.263 1.00 0.00  ? 67   ASN B HD21  1 
ATOM   1454 H  HD22  . ASN B 2 68  ? 13.155  55.739 31.741 1.00 0.00  ? 67   ASN B HD22  1 
ATOM   1455 N  N     . ARG B 2 69  ? 12.814  53.142 35.804 1.00 44.86 ? 68   ARG B N     1 
ATOM   1456 C  CA    . ARG B 2 69  ? 11.777  52.140 35.640 1.00 41.46 ? 68   ARG B CA    1 
ATOM   1457 C  C     . ARG B 2 69  ? 11.647  51.333 36.908 1.00 43.73 ? 68   ARG B C     1 
ATOM   1458 O  O     . ARG B 2 69  ? 12.534  51.363 37.750 1.00 42.99 ? 68   ARG B O     1 
ATOM   1459 C  CB    . ARG B 2 69  ? 12.063  51.248 34.423 1.00 36.39 ? 68   ARG B CB    1 
ATOM   1460 C  CG    . ARG B 2 69  ? 13.365  50.477 34.449 1.00 31.51 ? 68   ARG B CG    1 
ATOM   1461 C  CD    . ARG B 2 69  ? 13.766  50.068 33.025 1.00 30.13 ? 68   ARG B CD    1 
ATOM   1462 N  NE    . ARG B 2 69  ? 15.014  49.307 33.033 1.00 30.80 ? 68   ARG B NE    1 
ATOM   1463 C  CZ    . ARG B 2 69  ? 15.646  48.839 31.959 1.00 25.27 ? 68   ARG B CZ    1 
ATOM   1464 N  NH1   . ARG B 2 69  ? 15.186  49.039 30.738 1.00 23.61 ? 68   ARG B NH1   1 
ATOM   1465 N  NH2   . ARG B 2 69  ? 16.749  48.139 32.123 1.00 24.48 ? 68   ARG B NH2   1 
ATOM   1466 H  H     . ARG B 2 69  ? 13.619  52.897 36.314 1.00 0.00  ? 68   ARG B H     1 
ATOM   1467 H  HE    . ARG B 2 69  ? 15.423  49.126 33.905 1.00 0.00  ? 68   ARG B HE    1 
ATOM   1468 H  HH11  . ARG B 2 69  ? 14.345  49.562 30.605 1.00 0.00  ? 68   ARG B HH11  1 
ATOM   1469 H  HH12  . ARG B 2 69  ? 15.684  48.674 29.954 1.00 0.00  ? 68   ARG B HH12  1 
ATOM   1470 H  HH21  . ARG B 2 69  ? 17.101  47.956 33.042 1.00 0.00  ? 68   ARG B HH21  1 
ATOM   1471 H  HH22  . ARG B 2 69  ? 17.224  47.767 31.324 1.00 0.00  ? 68   ARG B HH22  1 
ATOM   1472 N  N     . LYS B 2 70  ? 10.506  50.676 37.073 1.00 45.44 ? 69   LYS B N     1 
ATOM   1473 C  CA    . LYS B 2 70  ? 10.264  49.861 38.256 1.00 45.65 ? 69   LYS B CA    1 
ATOM   1474 C  C     . LYS B 2 70  ? 11.345  48.800 38.448 1.00 43.44 ? 69   LYS B C     1 
ATOM   1475 O  O     . LYS B 2 70  ? 12.053  48.425 37.507 1.00 44.81 ? 69   LYS B O     1 
ATOM   1476 C  CB    . LYS B 2 70  ? 8.898   49.176 38.142 1.00 48.17 ? 69   LYS B CB    1 
ATOM   1477 C  CG    . LYS B 2 70  ? 7.766   49.923 38.828 1.00 52.09 ? 69   LYS B CG    1 
ATOM   1478 C  CD    . LYS B 2 70  ? 6.389   49.363 38.447 1.00 52.08 ? 69   LYS B CD    1 
ATOM   1479 C  CE    . LYS B 2 70  ? 5.363   49.606 39.549 1.00 50.58 ? 69   LYS B CE    1 
ATOM   1480 N  NZ    . LYS B 2 70  ? 5.715   48.810 40.777 1.00 51.07 ? 69   LYS B NZ    1 
ATOM   1481 H  H     . LYS B 2 70  ? 9.826   50.731 36.375 1.00 0.00  ? 69   LYS B H     1 
ATOM   1482 H  HZ1   . LYS B 2 70  ? 6.652   49.083 41.129 1.00 0.00  ? 69   LYS B HZ1   1 
ATOM   1483 H  HZ2   . LYS B 2 70  ? 5.002   48.982 41.513 1.00 0.00  ? 69   LYS B HZ2   1 
ATOM   1484 H  HZ3   . LYS B 2 70  ? 5.719   47.798 40.536 1.00 0.00  ? 69   LYS B HZ3   1 
ATOM   1485 N  N     . THR B 2 71  ? 11.479  48.326 39.676 1.00 39.90 ? 70   THR B N     1 
ATOM   1486 C  CA    . THR B 2 71  ? 12.434  47.272 39.983 1.00 33.06 ? 70   THR B CA    1 
ATOM   1487 C  C     . THR B 2 71  ? 11.654  46.194 40.724 1.00 30.14 ? 70   THR B C     1 
ATOM   1488 O  O     . THR B 2 71  ? 10.877  46.489 41.642 1.00 22.77 ? 70   THR B O     1 
ATOM   1489 C  CB    . THR B 2 71  ? 13.611  47.793 40.838 1.00 31.89 ? 70   THR B CB    1 
ATOM   1490 O  OG1   . THR B 2 71  ? 14.376  48.712 40.048 1.00 34.52 ? 70   THR B OG1   1 
ATOM   1491 C  CG2   . THR B 2 71  ? 14.501  46.647 41.318 1.00 23.28 ? 70   THR B CG2   1 
ATOM   1492 H  H     . THR B 2 71  ? 10.941  48.699 40.407 1.00 0.00  ? 70   THR B H     1 
ATOM   1493 H  HG1   . THR B 2 71  ? 14.425  48.317 39.182 1.00 0.00  ? 70   THR B HG1   1 
ATOM   1494 N  N     . ARG B 2 72  ? 11.799  44.956 40.267 1.00 27.89 ? 71   ARG B N     1 
ATOM   1495 C  CA    . ARG B 2 72  ? 11.108  43.846 40.896 1.00 24.77 ? 71   ARG B CA    1 
ATOM   1496 C  C     . ARG B 2 72  ? 12.129  42.799 41.314 1.00 20.43 ? 71   ARG B C     1 
ATOM   1497 O  O     . ARG B 2 72  ? 12.945  42.363 40.511 1.00 14.79 ? 71   ARG B O     1 
ATOM   1498 C  CB    . ARG B 2 72  ? 10.076  43.247 39.929 1.00 26.10 ? 71   ARG B CB    1 
ATOM   1499 C  CG    . ARG B 2 72  ? 9.079   44.245 39.360 1.00 24.28 ? 71   ARG B CG    1 
ATOM   1500 C  CD    . ARG B 2 72  ? 7.845   43.522 38.832 1.00 30.40 ? 71   ARG B CD    1 
ATOM   1501 N  NE    . ARG B 2 72  ? 7.013   44.323 37.932 1.00 30.45 ? 71   ARG B NE    1 
ATOM   1502 C  CZ    . ARG B 2 72  ? 6.112   45.221 38.318 1.00 31.12 ? 71   ARG B CZ    1 
ATOM   1503 N  NH1   . ARG B 2 72  ? 5.910   45.475 39.604 1.00 29.19 ? 71   ARG B NH1   1 
ATOM   1504 N  NH2   . ARG B 2 72  ? 5.416   45.870 37.401 1.00 30.85 ? 71   ARG B NH2   1 
ATOM   1505 H  H     . ARG B 2 72  ? 12.387  44.775 39.504 1.00 0.00  ? 71   ARG B H     1 
ATOM   1506 H  HE    . ARG B 2 72  ? 7.123   44.175 36.974 1.00 0.00  ? 71   ARG B HE    1 
ATOM   1507 H  HH11  . ARG B 2 72  ? 6.440   44.984 40.295 1.00 0.00  ? 71   ARG B HH11  1 
ATOM   1508 H  HH12  . ARG B 2 72  ? 5.217   46.141 39.902 1.00 0.00  ? 71   ARG B HH12  1 
ATOM   1509 H  HH21  . ARG B 2 72  ? 5.576   45.693 36.435 1.00 0.00  ? 71   ARG B HH21  1 
ATOM   1510 H  HH22  . ARG B 2 72  ? 4.751   46.559 37.684 1.00 0.00  ? 71   ARG B HH22  1 
ATOM   1511 N  N     . PHE B 2 73  ? 12.125  42.467 42.596 1.00 20.80 ? 72   PHE B N     1 
ATOM   1512 C  CA    . PHE B 2 73  ? 13.029  41.474 43.159 1.00 21.24 ? 72   PHE B CA    1 
ATOM   1513 C  C     . PHE B 2 73  ? 12.213  40.196 43.270 1.00 21.83 ? 72   PHE B C     1 
ATOM   1514 O  O     . PHE B 2 73  ? 11.006  40.263 43.501 1.00 27.32 ? 72   PHE B O     1 
ATOM   1515 C  CB    . PHE B 2 73  ? 13.471  41.899 44.569 1.00 20.40 ? 72   PHE B CB    1 
ATOM   1516 C  CG    . PHE B 2 73  ? 14.350  43.127 44.603 1.00 24.65 ? 72   PHE B CG    1 
ATOM   1517 C  CD1   . PHE B 2 73  ? 13.787  44.417 44.573 1.00 24.81 ? 72   PHE B CD1   1 
ATOM   1518 C  CD2   . PHE B 2 73  ? 15.747  43.002 44.693 1.00 22.70 ? 72   PHE B CD2   1 
ATOM   1519 C  CE1   . PHE B 2 73  ? 14.603  45.558 44.633 1.00 20.17 ? 72   PHE B CE1   1 
ATOM   1520 C  CE2   . PHE B 2 73  ? 16.569  44.129 44.758 1.00 19.80 ? 72   PHE B CE2   1 
ATOM   1521 C  CZ    . PHE B 2 73  ? 15.989  45.421 44.726 1.00 22.64 ? 72   PHE B CZ    1 
ATOM   1522 H  H     . PHE B 2 73  ? 11.473  42.872 43.189 1.00 0.00  ? 72   PHE B H     1 
ATOM   1523 N  N     . ILE B 2 74  ? 12.841  39.038 43.095 1.00 22.38 ? 73   ILE B N     1 
ATOM   1524 C  CA    . ILE B 2 74  ? 12.129  37.758 43.220 1.00 20.49 ? 73   ILE B CA    1 
ATOM   1525 C  C     . ILE B 2 74  ? 12.988  36.934 44.158 1.00 19.13 ? 73   ILE B C     1 
ATOM   1526 O  O     . ILE B 2 74  ? 14.172  36.733 43.882 1.00 20.66 ? 73   ILE B O     1 
ATOM   1527 C  CB    . ILE B 2 74  ? 11.959  37.050 41.849 1.00 20.99 ? 73   ILE B CB    1 
ATOM   1528 C  CG1   . ILE B 2 74  ? 11.290  38.004 40.855 1.00 18.12 ? 73   ILE B CG1   1 
ATOM   1529 C  CG2   . ILE B 2 74  ? 11.082  35.813 41.998 1.00 13.97 ? 73   ILE B CG2   1 
ATOM   1530 C  CD1   . ILE B 2 74  ? 11.257  37.472 39.448 1.00 25.40 ? 73   ILE B CD1   1 
ATOM   1531 H  H     . ILE B 2 74  ? 13.793  39.038 42.880 1.00 0.00  ? 73   ILE B H     1 
ATOM   1532 N  N     . ILE B 2 75  ? 12.424  36.542 45.299 1.00 17.66 ? 74   ILE B N     1 
ATOM   1533 C  CA    . ILE B 2 75  ? 13.153  35.779 46.317 1.00 18.89 ? 74   ILE B CA    1 
ATOM   1534 C  C     . ILE B 2 75  ? 12.553  34.397 46.413 1.00 19.60 ? 74   ILE B C     1 
ATOM   1535 O  O     . ILE B 2 75  ? 11.351  34.252 46.561 1.00 25.07 ? 74   ILE B O     1 
ATOM   1536 C  CB    . ILE B 2 75  ? 13.061  36.462 47.707 1.00 17.69 ? 74   ILE B CB    1 
ATOM   1537 C  CG1   . ILE B 2 75  ? 13.544  37.915 47.608 1.00 18.00 ? 74   ILE B CG1   1 
ATOM   1538 C  CG2   . ILE B 2 75  ? 13.854  35.670 48.727 1.00 12.46 ? 74   ILE B CG2   1 
ATOM   1539 C  CD1   . ILE B 2 75  ? 13.291  38.770 48.809 1.00 15.08 ? 74   ILE B CD1   1 
ATOM   1540 H  H     . ILE B 2 75  ? 11.488  36.761 45.469 1.00 0.00  ? 74   ILE B H     1 
ATOM   1541 N  N     . HIS B 2 76  ? 13.387  33.375 46.313 1.00 21.95 ? 75   HIS B N     1 
ATOM   1542 C  CA    . HIS B 2 76  ? 12.902  31.989 46.348 1.00 18.57 ? 75   HIS B CA    1 
ATOM   1543 C  C     . HIS B 2 76  ? 12.740  31.493 47.760 1.00 17.00 ? 75   HIS B C     1 
ATOM   1544 O  O     . HIS B 2 76  ? 12.963  32.212 48.723 1.00 24.60 ? 75   HIS B O     1 
ATOM   1545 C  CB    . HIS B 2 76  ? 13.889  31.079 45.619 1.00 16.88 ? 75   HIS B CB    1 
ATOM   1546 C  CG    . HIS B 2 76  ? 15.264  31.072 46.235 1.00 17.08 ? 75   HIS B CG    1 
ATOM   1547 N  ND1   . HIS B 2 76  ? 16.347  31.699 45.651 1.00 15.36 ? 75   HIS B ND1   1 
ATOM   1548 C  CD2   . HIS B 2 76  ? 15.716  30.552 47.400 1.00 10.27 ? 75   HIS B CD2   1 
ATOM   1549 C  CE1   . HIS B 2 76  ? 17.401  31.570 46.439 1.00 13.00 ? 75   HIS B CE1   1 
ATOM   1550 N  NE2   . HIS B 2 76  ? 17.044  30.879 47.502 1.00 10.84 ? 75   HIS B NE2   1 
ATOM   1551 H  H     . HIS B 2 76  ? 14.333  33.598 46.244 1.00 0.00  ? 75   HIS B H     1 
ATOM   1552 H  HD1   . HIS B 2 76  ? 16.314  32.207 44.805 1.00 0.00  ? 75   HIS B HD1   1 
ATOM   1553 H  HE2   . HIS B 2 76  ? 17.598  30.582 48.262 1.00 0.00  ? 75   HIS B HE2   1 
ATOM   1554 N  N     . GLY B 2 77  ? 12.394  30.232 47.889 1.00 20.14 ? 76   GLY B N     1 
ATOM   1555 C  CA    . GLY B 2 77  ? 12.256  29.671 49.213 1.00 19.76 ? 76   GLY B CA    1 
ATOM   1556 C  C     . GLY B 2 77  ? 13.323  28.634 49.506 1.00 23.20 ? 76   GLY B C     1 
ATOM   1557 O  O     . GLY B 2 77  ? 14.440  28.653 48.961 1.00 22.36 ? 76   GLY B O     1 
ATOM   1558 H  H     . GLY B 2 77  ? 12.213  29.675 47.115 1.00 0.00  ? 76   GLY B H     1 
ATOM   1559 N  N     . PHE B 2 78  ? 12.936  27.729 50.396 1.00 21.47 ? 77   PHE B N     1 
ATOM   1560 C  CA    . PHE B 2 78  ? 13.724  26.626 50.879 1.00 17.06 ? 77   PHE B CA    1 
ATOM   1561 C  C     . PHE B 2 78  ? 14.153  25.712 49.729 1.00 22.18 ? 77   PHE B C     1 
ATOM   1562 O  O     . PHE B 2 78  ? 13.406  25.509 48.778 1.00 21.39 ? 77   PHE B O     1 
ATOM   1563 C  CB    . PHE B 2 78  ? 12.857  25.875 51.860 1.00 22.27 ? 77   PHE B CB    1 
ATOM   1564 C  CG    . PHE B 2 78  ? 13.557  24.817 52.623 1.00 28.35 ? 77   PHE B CG    1 
ATOM   1565 C  CD1   . PHE B 2 78  ? 14.723  25.098 53.331 1.00 30.11 ? 77   PHE B CD1   1 
ATOM   1566 C  CD2   . PHE B 2 78  ? 13.001  23.546 52.713 1.00 28.82 ? 77   PHE B CD2   1 
ATOM   1567 C  CE1   . PHE B 2 78  ? 15.322  24.126 54.128 1.00 31.75 ? 77   PHE B CE1   1 
ATOM   1568 C  CE2   . PHE B 2 78  ? 13.594  22.577 53.507 1.00 33.24 ? 77   PHE B CE2   1 
ATOM   1569 C  CZ    . PHE B 2 78  ? 14.761  22.871 54.220 1.00 28.81 ? 77   PHE B CZ    1 
ATOM   1570 H  H     . PHE B 2 78  ? 12.066  27.807 50.752 1.00 0.00  ? 77   PHE B H     1 
ATOM   1571 N  N     . ILE B 2 79  ? 15.392  25.223 49.828 1.00 24.89 ? 78   ILE B N     1 
ATOM   1572 C  CA    . ILE B 2 79  ? 16.041  24.339 48.872 1.00 19.08 ? 78   ILE B CA    1 
ATOM   1573 C  C     . ILE B 2 79  ? 16.346  24.908 47.496 1.00 22.98 ? 78   ILE B C     1 
ATOM   1574 O  O     . ILE B 2 79  ? 17.245  24.390 46.817 1.00 24.80 ? 78   ILE B O     1 
ATOM   1575 C  CB    . ILE B 2 79  ? 15.286  23.031 48.707 1.00 23.25 ? 78   ILE B CB    1 
ATOM   1576 C  CG1   . ILE B 2 79  ? 15.237  22.284 50.026 1.00 21.22 ? 78   ILE B CG1   1 
ATOM   1577 C  CG2   . ILE B 2 79  ? 15.989  22.136 47.709 1.00 23.00 ? 78   ILE B CG2   1 
ATOM   1578 C  CD1   . ILE B 2 79  ? 14.133  21.306 50.029 1.00 22.58 ? 78   ILE B CD1   1 
ATOM   1579 H  H     . ILE B 2 79  ? 15.906  25.464 50.626 1.00 0.00  ? 78   ILE B H     1 
ATOM   1580 N  N     . ASP B 2 80  ? 15.619  25.944 47.074 1.00 22.07 ? 79   ASP B N     1 
ATOM   1581 C  CA    . ASP B 2 80  ? 15.830  26.549 45.754 1.00 23.13 ? 79   ASP B CA    1 
ATOM   1582 C  C     . ASP B 2 80  ? 17.031  27.482 45.696 1.00 21.18 ? 79   ASP B C     1 
ATOM   1583 O  O     . ASP B 2 80  ? 17.658  27.778 46.711 1.00 19.16 ? 79   ASP B O     1 
ATOM   1584 C  CB    . ASP B 2 80  ? 14.597  27.349 45.314 1.00 23.15 ? 79   ASP B CB    1 
ATOM   1585 C  CG    . ASP B 2 80  ? 13.673  26.579 44.406 1.00 22.24 ? 79   ASP B CG    1 
ATOM   1586 O  OD1   . ASP B 2 80  ? 13.993  25.450 43.990 1.00 28.64 ? 79   ASP B OD1   1 
ATOM   1587 O  OD2   . ASP B 2 80  ? 12.607  27.119 44.088 1.00 21.75 ? 79   ASP B OD2   1 
ATOM   1588 H  H     . ASP B 2 80  ? 14.941  26.320 47.661 1.00 0.00  ? 79   ASP B H     1 
ATOM   1589 N  N     . LYS B 2 81  ? 17.286  27.979 44.493 1.00 18.45 ? 80   LYS B N     1 
ATOM   1590 C  CA    . LYS B 2 81  ? 18.354  28.927 44.214 1.00 23.34 ? 80   LYS B CA    1 
ATOM   1591 C  C     . LYS B 2 81  ? 17.804  29.999 43.230 1.00 26.17 ? 80   LYS B C     1 
ATOM   1592 O  O     . LYS B 2 81  ? 16.784  29.791 42.577 1.00 29.71 ? 80   LYS B O     1 
ATOM   1593 C  CB    . LYS B 2 81  ? 19.620  28.222 43.686 1.00 23.38 ? 80   LYS B CB    1 
ATOM   1594 C  CG    . LYS B 2 81  ? 19.420  27.042 42.684 1.00 21.24 ? 80   LYS B CG    1 
ATOM   1595 C  CD    . LYS B 2 81  ? 20.095  27.365 41.345 1.00 20.54 ? 80   LYS B CD    1 
ATOM   1596 C  CE    . LYS B 2 81  ? 20.781  26.175 40.683 1.00 18.22 ? 80   LYS B CE    1 
ATOM   1597 N  NZ    . LYS B 2 81  ? 19.972  25.449 39.685 1.00 17.20 ? 80   LYS B NZ    1 
ATOM   1598 H  H     . LYS B 2 81  ? 16.747  27.657 43.740 1.00 0.00  ? 80   LYS B H     1 
ATOM   1599 H  HZ1   . LYS B 2 81  ? 19.703  26.084 38.907 1.00 0.00  ? 80   LYS B HZ1   1 
ATOM   1600 H  HZ2   . LYS B 2 81  ? 20.538  24.665 39.301 1.00 0.00  ? 80   LYS B HZ2   1 
ATOM   1601 H  HZ3   . LYS B 2 81  ? 19.115  25.067 40.131 1.00 0.00  ? 80   LYS B HZ3   1 
ATOM   1602 N  N     . GLY B 2 82  ? 18.420  31.173 43.200 1.00 25.11 ? 81   GLY B N     1 
ATOM   1603 C  CA    . GLY B 2 82  ? 17.951  32.240 42.339 1.00 23.97 ? 81   GLY B CA    1 
ATOM   1604 C  C     . GLY B 2 82  ? 18.124  31.930 40.875 1.00 27.16 ? 81   GLY B C     1 
ATOM   1605 O  O     . GLY B 2 82  ? 17.609  32.639 40.024 1.00 29.03 ? 81   GLY B O     1 
ATOM   1606 H  H     . GLY B 2 82  ? 19.210  31.344 43.723 1.00 0.00  ? 81   GLY B H     1 
ATOM   1607 N  N     . GLU B 2 83  ? 18.875  30.879 40.570 1.00 30.84 ? 82   GLU B N     1 
ATOM   1608 C  CA    . GLU B 2 83  ? 19.098  30.500 39.186 1.00 27.26 ? 82   GLU B CA    1 
ATOM   1609 C  C     . GLU B 2 83  ? 18.073  29.512 38.698 1.00 26.20 ? 82   GLU B C     1 
ATOM   1610 O  O     . GLU B 2 83  ? 18.199  29.010 37.585 1.00 28.11 ? 82   GLU B O     1 
ATOM   1611 C  CB    . GLU B 2 83  ? 20.482  29.918 38.997 1.00 25.06 ? 82   GLU B CB    1 
ATOM   1612 C  CG    . GLU B 2 83  ? 21.573  30.913 39.158 1.00 23.49 ? 82   GLU B CG    1 
ATOM   1613 C  CD    . GLU B 2 83  ? 22.193  30.880 40.518 1.00 26.93 ? 82   GLU B CD    1 
ATOM   1614 O  OE1   . GLU B 2 83  ? 21.550  30.446 41.505 1.00 24.59 ? 82   GLU B OE1   1 
ATOM   1615 O  OE2   . GLU B 2 83  ? 23.358  31.292 40.586 1.00 31.15 ? 82   GLU B OE2   1 
ATOM   1616 H  H     . GLU B 2 83  ? 19.293  30.338 41.256 1.00 0.00  ? 82   GLU B H     1 
ATOM   1617 N  N     . GLU B 2 84  ? 17.127  29.144 39.560 1.00 23.13 ? 83   GLU B N     1 
ATOM   1618 C  CA    . GLU B 2 84  ? 16.068  28.237 39.135 1.00 25.74 ? 83   GLU B CA    1 
ATOM   1619 C  C     . GLU B 2 84  ? 15.355  28.854 37.922 1.00 24.21 ? 83   GLU B C     1 
ATOM   1620 O  O     . GLU B 2 84  ? 15.106  30.054 37.889 1.00 27.46 ? 83   GLU B O     1 
ATOM   1621 C  CB    . GLU B 2 84  ? 15.062  28.002 40.255 1.00 25.25 ? 83   GLU B CB    1 
ATOM   1622 C  CG    . GLU B 2 84  ? 15.182  26.626 40.889 1.00 34.41 ? 83   GLU B CG    1 
ATOM   1623 C  CD    . GLU B 2 84  ? 15.189  25.493 39.858 1.00 40.20 ? 83   GLU B CD    1 
ATOM   1624 O  OE1   . GLU B 2 84  ? 14.427  25.584 38.867 1.00 42.31 ? 83   GLU B OE1   1 
ATOM   1625 O  OE2   . GLU B 2 84  ? 15.964  24.517 40.033 1.00 42.19 ? 83   GLU B OE2   1 
ATOM   1626 H  H     . GLU B 2 84  ? 17.126  29.489 40.475 1.00 0.00  ? 83   GLU B H     1 
ATOM   1627 N  N     . ASN B 2 85  ? 15.001  28.041 36.940 1.00 28.48 ? 84   ASN B N     1 
ATOM   1628 C  CA    . ASN B 2 85  ? 14.338  28.577 35.760 1.00 30.69 ? 84   ASN B CA    1 
ATOM   1629 C  C     . ASN B 2 85  ? 13.057  29.347 36.034 1.00 27.25 ? 84   ASN B C     1 
ATOM   1630 O  O     . ASN B 2 85  ? 12.812  30.361 35.404 1.00 29.80 ? 84   ASN B O     1 
ATOM   1631 C  CB    . ASN B 2 85  ? 14.099  27.488 34.716 1.00 34.33 ? 84   ASN B CB    1 
ATOM   1632 C  CG    . ASN B 2 85  ? 15.370  27.119 33.984 1.00 42.67 ? 84   ASN B CG    1 
ATOM   1633 O  OD1   . ASN B 2 85  ? 15.701  25.947 33.844 1.00 47.11 ? 84   ASN B OD1   1 
ATOM   1634 N  ND2   . ASN B 2 85  ? 16.104  28.128 33.523 1.00 47.68 ? 84   ASN B ND2   1 
ATOM   1635 H  H     . ASN B 2 85  ? 15.220  27.081 36.999 1.00 0.00  ? 84   ASN B H     1 
ATOM   1636 H  HD21  . ASN B 2 85  ? 16.943  27.869 33.093 1.00 0.00  ? 84   ASN B HD21  1 
ATOM   1637 H  HD22  . ASN B 2 85  ? 15.810  29.055 33.635 1.00 0.00  ? 84   ASN B HD22  1 
ATOM   1638 N  N     . TRP B 2 86  ? 12.267  28.917 37.011 1.00 25.28 ? 85   TRP B N     1 
ATOM   1639 C  CA    . TRP B 2 86  ? 11.032  29.614 37.282 1.00 18.97 ? 85   TRP B CA    1 
ATOM   1640 C  C     . TRP B 2 86  ? 11.246  31.090 37.562 1.00 18.22 ? 85   TRP B C     1 
ATOM   1641 O  O     . TRP B 2 86  ? 10.465  31.911 37.080 1.00 19.71 ? 85   TRP B O     1 
ATOM   1642 C  CB    . TRP B 2 86  ? 10.214  28.915 38.380 1.00 19.29 ? 85   TRP B CB    1 
ATOM   1643 C  CG    . TRP B 2 86  ? 10.579  29.163 39.818 1.00 16.51 ? 85   TRP B CG    1 
ATOM   1644 C  CD1   . TRP B 2 86  ? 11.184  28.281 40.671 1.00 19.75 ? 85   TRP B CD1   1 
ATOM   1645 C  CD2   . TRP B 2 86  ? 10.237  30.314 40.610 1.00 21.56 ? 85   TRP B CD2   1 
ATOM   1646 N  NE1   . TRP B 2 86  ? 11.230  28.802 41.946 1.00 17.00 ? 85   TRP B NE1   1 
ATOM   1647 C  CE2   . TRP B 2 86  ? 10.656  30.043 41.944 1.00 18.54 ? 85   TRP B CE2   1 
ATOM   1648 C  CE3   . TRP B 2 86  ? 9.602   31.545 40.331 1.00 14.65 ? 85   TRP B CE3   1 
ATOM   1649 C  CZ2   . TRP B 2 86  ? 10.456  30.951 42.993 1.00 19.43 ? 85   TRP B CZ2   1 
ATOM   1650 C  CZ3   . TRP B 2 86  ? 9.403   32.444 41.373 1.00 17.67 ? 85   TRP B CZ3   1 
ATOM   1651 C  CH2   . TRP B 2 86  ? 9.829   32.143 42.691 1.00 20.30 ? 85   TRP B CH2   1 
ATOM   1652 H  H     . TRP B 2 86  ? 12.509  28.126 37.540 1.00 0.00  ? 85   TRP B H     1 
ATOM   1653 H  HE1   . TRP B 2 86  ? 11.621  28.334 42.705 1.00 0.00  ? 85   TRP B HE1   1 
ATOM   1654 N  N     . LEU B 2 87  ? 12.335  31.441 38.254 1.00 15.27 ? 86   LEU B N     1 
ATOM   1655 C  CA    . LEU B 2 87  ? 12.577  32.846 38.569 1.00 16.19 ? 86   LEU B CA    1 
ATOM   1656 C  C     . LEU B 2 87  ? 12.796  33.647 37.311 1.00 19.86 ? 86   LEU B C     1 
ATOM   1657 O  O     . LEU B 2 87  ? 11.988  34.496 37.012 1.00 27.65 ? 86   LEU B O     1 
ATOM   1658 C  CB    . LEU B 2 87  ? 13.747  33.050 39.540 1.00 16.70 ? 86   LEU B CB    1 
ATOM   1659 C  CG    . LEU B 2 87  ? 13.552  32.740 41.033 1.00 17.28 ? 86   LEU B CG    1 
ATOM   1660 C  CD1   . LEU B 2 87  ? 13.906  31.280 41.276 1.00 15.31 ? 86   LEU B CD1   1 
ATOM   1661 C  CD2   . LEU B 2 87  ? 14.422  33.676 41.906 1.00 9.26  ? 86   LEU B CD2   1 
ATOM   1662 H  H     . LEU B 2 87  ? 12.991  30.772 38.533 1.00 0.00  ? 86   LEU B H     1 
ATOM   1663 N  N     . ALA B 2 88  ? 13.848  33.353 36.550 1.00 22.60 ? 87   ALA B N     1 
ATOM   1664 C  CA    . ALA B 2 88  ? 14.133  34.071 35.301 1.00 25.37 ? 87   ALA B CA    1 
ATOM   1665 C  C     . ALA B 2 88  ? 12.933  34.011 34.335 1.00 26.86 ? 87   ALA B C     1 
ATOM   1666 O  O     . ALA B 2 88  ? 12.722  34.910 33.510 1.00 26.67 ? 87   ALA B O     1 
ATOM   1667 C  CB    . ALA B 2 88  ? 15.361  33.490 34.631 1.00 15.69 ? 87   ALA B CB    1 
ATOM   1668 H  H     . ALA B 2 88  ? 14.475  32.652 36.847 1.00 0.00  ? 87   ALA B H     1 
ATOM   1669 N  N     . ASN B 2 89  ? 12.157  32.947 34.461 1.00 26.13 ? 88   ASN B N     1 
ATOM   1670 C  CA    . ASN B 2 89  ? 10.967  32.707 33.659 1.00 33.20 ? 88   ASN B CA    1 
ATOM   1671 C  C     . ASN B 2 89  ? 9.930   33.804 33.883 1.00 31.18 ? 88   ASN B C     1 
ATOM   1672 O  O     . ASN B 2 89  ? 9.114   34.079 32.985 1.00 28.03 ? 88   ASN B O     1 
ATOM   1673 C  CB    . ASN B 2 89  ? 10.373  31.365 34.060 1.00 45.05 ? 88   ASN B CB    1 
ATOM   1674 C  CG    . ASN B 2 89  ? 9.669   30.675 32.939 1.00 45.48 ? 88   ASN B CG    1 
ATOM   1675 O  OD1   . ASN B 2 89  ? 9.281   29.515 33.077 1.00 48.27 ? 88   ASN B OD1   1 
ATOM   1676 N  ND2   . ASN B 2 89  ? 9.497   31.364 31.823 1.00 47.25 ? 88   ASN B ND2   1 
ATOM   1677 H  H     . ASN B 2 89  ? 12.423  32.273 35.120 1.00 0.00  ? 88   ASN B H     1 
ATOM   1678 H  HD21  . ASN B 2 89  ? 8.988   30.899 31.129 1.00 0.00  ? 88   ASN B HD21  1 
ATOM   1679 H  HD22  . ASN B 2 89  ? 9.808   32.279 31.683 1.00 0.00  ? 88   ASN B HD22  1 
ATOM   1680 N  N     . VAL B 2 90  ? 9.937   34.384 35.091 1.00 26.62 ? 89   VAL B N     1 
ATOM   1681 C  CA    . VAL B 2 90  ? 9.057   35.505 35.443 1.00 24.08 ? 89   VAL B CA    1 
ATOM   1682 C  C     . VAL B 2 90  ? 9.533   36.800 34.760 1.00 20.28 ? 89   VAL B C     1 
ATOM   1683 O  O     . VAL B 2 90  ? 8.738   37.514 34.152 1.00 22.25 ? 89   VAL B O     1 
ATOM   1684 C  CB    . VAL B 2 90  ? 9.004   35.749 36.973 1.00 26.25 ? 89   VAL B CB    1 
ATOM   1685 C  CG1   . VAL B 2 90  ? 8.250   37.072 37.287 1.00 16.35 ? 89   VAL B CG1   1 
ATOM   1686 C  CG2   . VAL B 2 90  ? 8.336   34.551 37.659 1.00 23.68 ? 89   VAL B CG2   1 
ATOM   1687 H  H     . VAL B 2 90  ? 10.530  34.029 35.785 1.00 0.00  ? 89   VAL B H     1 
ATOM   1688 N  N     . CYS B 2 91  ? 10.826  37.097 34.854 1.00 18.51 ? 90   CYS B N     1 
ATOM   1689 C  CA    . CYS B 2 91  ? 11.383  38.291 34.216 1.00 20.01 ? 90   CYS B CA    1 
ATOM   1690 C  C     . CYS B 2 91  ? 11.094  38.276 32.719 1.00 21.17 ? 90   CYS B C     1 
ATOM   1691 O  O     . CYS B 2 91  ? 10.709  39.277 32.124 1.00 23.95 ? 90   CYS B O     1 
ATOM   1692 C  CB    . CYS B 2 91  ? 12.901  38.321 34.346 1.00 19.98 ? 90   CYS B CB    1 
ATOM   1693 S  SG    . CYS B 2 91  ? 13.585  38.250 36.000 1.00 15.53 ? 90   CYS B SG    1 
ATOM   1694 H  H     . CYS B 2 91  ? 11.422  36.505 35.351 1.00 0.00  ? 90   CYS B H     1 
ATOM   1695 N  N     . LYS B 2 92  ? 11.316  37.126 32.107 1.00 24.12 ? 91   LYS B N     1 
ATOM   1696 C  CA    . LYS B 2 92  ? 11.122  36.997 30.689 1.00 25.02 ? 91   LYS B CA    1 
ATOM   1697 C  C     . LYS B 2 92  ? 9.709   37.279 30.245 1.00 22.75 ? 91   LYS B C     1 
ATOM   1698 O  O     . LYS B 2 92  ? 9.494   37.812 29.169 1.00 24.42 ? 91   LYS B O     1 
ATOM   1699 C  CB    . LYS B 2 92  ? 11.689  35.657 30.216 1.00 31.58 ? 91   LYS B CB    1 
ATOM   1700 C  CG    . LYS B 2 92  ? 13.226  35.622 30.444 1.00 36.70 ? 91   LYS B CG    1 
ATOM   1701 C  CD    . LYS B 2 92  ? 13.922  34.340 29.970 1.00 42.13 ? 91   LYS B CD    1 
ATOM   1702 C  CE    . LYS B 2 92  ? 15.329  34.235 30.610 1.00 45.05 ? 91   LYS B CE    1 
ATOM   1703 N  NZ    . LYS B 2 92  ? 15.993  32.898 30.492 1.00 42.53 ? 91   LYS B NZ    1 
ATOM   1704 H  H     . LYS B 2 92  ? 11.634  36.342 32.610 1.00 0.00  ? 91   LYS B H     1 
ATOM   1705 H  HZ1   . LYS B 2 92  ? 15.383  32.180 30.926 1.00 0.00  ? 91   LYS B HZ1   1 
ATOM   1706 H  HZ2   . LYS B 2 92  ? 16.149  32.659 29.493 1.00 0.00  ? 91   LYS B HZ2   1 
ATOM   1707 H  HZ3   . LYS B 2 92  ? 16.905  32.924 30.985 1.00 0.00  ? 91   LYS B HZ3   1 
ATOM   1708 N  N     . ASN B 2 93  ? 8.744   36.994 31.105 1.00 24.96 ? 92   ASN B N     1 
ATOM   1709 C  CA    . ASN B 2 93  ? 7.360   37.277 30.770 1.00 23.60 ? 92   ASN B CA    1 
ATOM   1710 C  C     . ASN B 2 93  ? 7.081   38.765 31.002 1.00 22.81 ? 92   ASN B C     1 
ATOM   1711 O  O     . ASN B 2 93  ? 6.201   39.360 30.345 1.00 23.14 ? 92   ASN B O     1 
ATOM   1712 C  CB    . ASN B 2 93  ? 6.404   36.428 31.612 1.00 25.45 ? 92   ASN B CB    1 
ATOM   1713 C  CG    . ASN B 2 93  ? 5.643   35.419 30.784 1.00 29.41 ? 92   ASN B CG    1 
ATOM   1714 O  OD1   . ASN B 2 93  ? 5.957   35.195 29.598 1.00 32.57 ? 92   ASN B OD1   1 
ATOM   1715 N  ND2   . ASN B 2 93  ? 4.632   34.795 31.394 1.00 26.15 ? 92   ASN B ND2   1 
ATOM   1716 H  H     . ASN B 2 93  ? 8.960   36.588 31.965 1.00 0.00  ? 92   ASN B H     1 
ATOM   1717 H  HD21  . ASN B 2 93  ? 4.168   34.103 30.879 1.00 0.00  ? 92   ASN B HD21  1 
ATOM   1718 H  HD22  . ASN B 2 93  ? 4.415   35.048 32.320 1.00 0.00  ? 92   ASN B HD22  1 
ATOM   1719 N  N     . LEU B 2 94  ? 7.809   39.346 31.956 1.00 18.62 ? 93   LEU B N     1 
ATOM   1720 C  CA    . LEU B 2 94  ? 7.689   40.768 32.296 1.00 19.77 ? 93   LEU B CA    1 
ATOM   1721 C  C     . LEU B 2 94  ? 8.226   41.569 31.134 1.00 21.60 ? 93   LEU B C     1 
ATOM   1722 O  O     . LEU B 2 94  ? 7.677   42.621 30.791 1.00 26.56 ? 93   LEU B O     1 
ATOM   1723 C  CB    . LEU B 2 94  ? 8.468   41.115 33.583 1.00 18.22 ? 93   LEU B CB    1 
ATOM   1724 C  CG    . LEU B 2 94  ? 7.926   40.590 34.933 1.00 20.12 ? 93   LEU B CG    1 
ATOM   1725 C  CD1   . LEU B 2 94  ? 8.842   40.899 36.119 1.00 13.45 ? 93   LEU B CD1   1 
ATOM   1726 C  CD2   . LEU B 2 94  ? 6.546   41.157 35.152 1.00 18.63 ? 93   LEU B CD2   1 
ATOM   1727 H  H     . LEU B 2 94  ? 8.430   38.796 32.477 1.00 0.00  ? 93   LEU B H     1 
ATOM   1728 N  N     . PHE B 2 95  ? 9.260   41.037 30.483 1.00 23.21 ? 94   PHE B N     1 
ATOM   1729 C  CA    . PHE B 2 95  ? 9.863   41.715 29.343 1.00 23.84 ? 94   PHE B CA    1 
ATOM   1730 C  C     . PHE B 2 95  ? 8.914   41.764 28.176 1.00 23.68 ? 94   PHE B C     1 
ATOM   1731 O  O     . PHE B 2 95  ? 9.113   42.536 27.259 1.00 32.69 ? 94   PHE B O     1 
ATOM   1732 C  CB    . PHE B 2 95  ? 11.186  41.067 28.938 1.00 17.82 ? 94   PHE B CB    1 
ATOM   1733 C  CG    . PHE B 2 95  ? 12.232  41.130 30.013 1.00 18.89 ? 94   PHE B CG    1 
ATOM   1734 C  CD1   . PHE B 2 95  ? 12.269  42.198 30.898 1.00 20.96 ? 94   PHE B CD1   1 
ATOM   1735 C  CD2   . PHE B 2 95  ? 13.133  40.097 30.185 1.00 15.87 ? 94   PHE B CD2   1 
ATOM   1736 C  CE1   . PHE B 2 95  ? 13.181  42.222 31.942 1.00 23.68 ? 94   PHE B CE1   1 
ATOM   1737 C  CE2   . PHE B 2 95  ? 14.047  40.112 31.221 1.00 18.36 ? 94   PHE B CE2   1 
ATOM   1738 C  CZ    . PHE B 2 95  ? 14.075  41.168 32.098 1.00 21.19 ? 94   PHE B CZ    1 
ATOM   1739 H  H     . PHE B 2 95  ? 9.640   40.187 30.778 1.00 0.00  ? 94   PHE B H     1 
ATOM   1740 N  N     . LYS B 2 96  ? 7.883   40.936 28.215 1.00 26.02 ? 95   LYS B N     1 
ATOM   1741 C  CA    . LYS B 2 96  ? 6.862   40.901 27.165 1.00 27.17 ? 95   LYS B CA    1 
ATOM   1742 C  C     . LYS B 2 96  ? 5.838   42.047 27.307 1.00 24.96 ? 95   LYS B C     1 
ATOM   1743 O  O     . LYS B 2 96  ? 5.053   42.264 26.389 1.00 30.44 ? 95   LYS B O     1 
ATOM   1744 C  CB    . LYS B 2 96  ? 6.046   39.592 27.223 1.00 24.11 ? 95   LYS B CB    1 
ATOM   1745 C  CG    . LYS B 2 96  ? 6.820   38.313 27.052 1.00 28.65 ? 95   LYS B CG    1 
ATOM   1746 C  CD    . LYS B 2 96  ? 6.227   37.438 25.954 1.00 26.67 ? 95   LYS B CD    1 
ATOM   1747 C  CE    . LYS B 2 96  ? 7.099   36.198 25.706 1.00 27.17 ? 95   LYS B CE    1 
ATOM   1748 N  NZ    . LYS B 2 96  ? 7.123   35.232 26.844 1.00 25.76 ? 95   LYS B NZ    1 
ATOM   1749 H  H     . LYS B 2 96  ? 7.776   40.326 28.975 1.00 0.00  ? 95   LYS B H     1 
ATOM   1750 H  HZ1   . LYS B 2 96  ? 7.491   35.684 27.706 1.00 0.00  ? 95   LYS B HZ1   1 
ATOM   1751 H  HZ2   . LYS B 2 96  ? 6.158   34.892 27.034 1.00 0.00  ? 95   LYS B HZ2   1 
ATOM   1752 H  HZ3   . LYS B 2 96  ? 7.730   34.423 26.602 1.00 0.00  ? 95   LYS B HZ3   1 
ATOM   1753 N  N     . VAL B 2 97  ? 5.841   42.771 28.426 1.00 19.52 ? 96   VAL B N     1 
ATOM   1754 C  CA    . VAL B 2 97  ? 4.829   43.799 28.652 1.00 18.21 ? 96   VAL B CA    1 
ATOM   1755 C  C     . VAL B 2 97  ? 5.316   45.075 29.284 1.00 23.02 ? 96   VAL B C     1 
ATOM   1756 O  O     . VAL B 2 97  ? 4.528   45.991 29.500 1.00 26.73 ? 96   VAL B O     1 
ATOM   1757 C  CB    . VAL B 2 97  ? 3.642   43.247 29.560 1.00 16.80 ? 96   VAL B CB    1 
ATOM   1758 C  CG1   . VAL B 2 97  ? 3.100   41.955 29.004 1.00 13.74 ? 96   VAL B CG1   1 
ATOM   1759 C  CG2   . VAL B 2 97  ? 4.087   43.020 31.012 1.00 10.91 ? 96   VAL B CG2   1 
ATOM   1760 H  H     . VAL B 2 97  ? 6.521   42.609 29.111 1.00 0.00  ? 96   VAL B H     1 
ATOM   1761 N  N     . GLU B 2 98  ? 6.579   45.120 29.678 1.00 32.19 ? 97   GLU B N     1 
ATOM   1762 C  CA    . GLU B 2 98  ? 7.114   46.337 30.298 1.00 35.10 ? 97   GLU B CA    1 
ATOM   1763 C  C     . GLU B 2 98  ? 8.654   46.424 30.283 1.00 33.29 ? 97   GLU B C     1 
ATOM   1764 O  O     . GLU B 2 98  ? 9.339   45.461 29.923 1.00 31.47 ? 97   GLU B O     1 
ATOM   1765 C  CB    . GLU B 2 98  ? 6.589   46.469 31.738 1.00 35.78 ? 97   GLU B CB    1 
ATOM   1766 C  CG    . GLU B 2 98  ? 6.869   45.270 32.659 1.00 38.90 ? 97   GLU B CG    1 
ATOM   1767 C  CD    . GLU B 2 98  ? 6.867   45.648 34.145 1.00 42.78 ? 97   GLU B CD    1 
ATOM   1768 O  OE1   . GLU B 2 98  ? 6.590   46.829 34.461 1.00 48.68 ? 97   GLU B OE1   1 
ATOM   1769 O  OE2   . GLU B 2 98  ? 7.141   44.777 35.004 1.00 40.13 ? 97   GLU B OE2   1 
ATOM   1770 H  H     . GLU B 2 98  ? 7.185   44.353 29.607 1.00 0.00  ? 97   GLU B H     1 
ATOM   1771 N  N     . SER B 2 99  ? 9.180   47.608 30.577 1.00 31.20 ? 98   SER B N     1 
ATOM   1772 C  CA    . SER B 2 99  ? 10.621  47.805 30.649 1.00 33.08 ? 98   SER B CA    1 
ATOM   1773 C  C     . SER B 2 99  ? 10.838  47.743 32.148 1.00 30.32 ? 98   SER B C     1 
ATOM   1774 O  O     . SER B 2 99  ? 10.143  48.443 32.896 1.00 24.86 ? 98   SER B O     1 
ATOM   1775 C  CB    . SER B 2 99  ? 11.021  49.173 30.098 1.00 35.26 ? 98   SER B CB    1 
ATOM   1776 O  OG    . SER B 2 99  ? 12.436  49.297 30.040 1.00 37.39 ? 98   SER B OG    1 
ATOM   1777 H  H     . SER B 2 99  ? 8.614   48.380 30.792 1.00 0.00  ? 98   SER B H     1 
ATOM   1778 H  HG    . SER B 2 99  ? 12.798  48.445 29.769 1.00 0.00  ? 98   SER B HG    1 
ATOM   1779 N  N     . VAL B 2 100 ? 11.791  46.924 32.593 1.00 28.83 ? 99   VAL B N     1 
ATOM   1780 C  CA    . VAL B 2 100 ? 11.990  46.741 34.031 1.00 24.12 ? 99   VAL B CA    1 
ATOM   1781 C  C     . VAL B 2 100 ? 13.349  46.164 34.419 1.00 20.66 ? 99   VAL B C     1 
ATOM   1782 O  O     . VAL B 2 100 ? 14.036  45.542 33.606 1.00 21.95 ? 99   VAL B O     1 
ATOM   1783 C  CB    . VAL B 2 100 ? 10.868  45.798 34.591 1.00 24.70 ? 99   VAL B CB    1 
ATOM   1784 C  CG1   . VAL B 2 100 ? 11.078  44.332 34.107 1.00 20.23 ? 99   VAL B CG1   1 
ATOM   1785 C  CG2   . VAL B 2 100 ? 10.785  45.888 36.089 1.00 25.44 ? 99   VAL B CG2   1 
ATOM   1786 H  H     . VAL B 2 100 ? 12.380  46.427 31.992 1.00 0.00  ? 99   VAL B H     1 
ATOM   1787 N  N     . ASN B 2 101 ? 13.748  46.438 35.653 1.00 20.58 ? 100  ASN B N     1 
ATOM   1788 C  CA    . ASN B 2 101 ? 14.987  45.920 36.206 1.00 21.73 ? 100  ASN B CA    1 
ATOM   1789 C  C     . ASN B 2 101 ? 14.501  44.713 36.973 1.00 22.25 ? 100  ASN B C     1 
ATOM   1790 O  O     . ASN B 2 101 ? 13.788  44.870 37.972 1.00 21.69 ? 100  ASN B O     1 
ATOM   1791 C  CB    . ASN B 2 101 ? 15.583  46.891 37.215 1.00 24.62 ? 100  ASN B CB    1 
ATOM   1792 C  CG    . ASN B 2 101 ? 15.947  48.211 36.607 1.00 28.64 ? 100  ASN B CG    1 
ATOM   1793 O  OD1   . ASN B 2 101 ? 16.598  48.277 35.554 1.00 27.03 ? 100  ASN B OD1   1 
ATOM   1794 N  ND2   . ASN B 2 101 ? 15.535  49.290 37.271 1.00 30.86 ? 100  ASN B ND2   1 
ATOM   1795 H  H     . ASN B 2 101 ? 13.181  47.004 36.212 1.00 0.00  ? 100  ASN B H     1 
ATOM   1796 H  HD21  . ASN B 2 101 ? 15.740  50.155 36.874 1.00 0.00  ? 100  ASN B HD21  1 
ATOM   1797 H  HD22  . ASN B 2 101 ? 15.042  49.214 38.112 1.00 0.00  ? 100  ASN B HD22  1 
ATOM   1798 N  N     . CYS B 2 102 ? 14.789  43.519 36.460 1.00 25.08 ? 101  CYS B N     1 
ATOM   1799 C  CA    . CYS B 2 102 ? 14.356  42.289 37.117 1.00 25.22 ? 101  CYS B CA    1 
ATOM   1800 C  C     . CYS B 2 102 ? 15.528  41.719 37.890 1.00 24.55 ? 101  CYS B C     1 
ATOM   1801 O  O     . CYS B 2 102 ? 16.564  41.409 37.333 1.00 25.27 ? 101  CYS B O     1 
ATOM   1802 C  CB    . CYS B 2 102 ? 13.812  41.274 36.109 1.00 23.69 ? 101  CYS B CB    1 
ATOM   1803 S  SG    . CYS B 2 102 ? 12.857  39.933 36.882 1.00 20.31 ? 101  CYS B SG    1 
ATOM   1804 H  H     . CYS B 2 102 ? 15.321  43.454 35.642 1.00 0.00  ? 101  CYS B H     1 
ATOM   1805 N  N     . ILE B 2 103 ? 15.346  41.600 39.192 1.00 27.30 ? 102  ILE B N     1 
ATOM   1806 C  CA    . ILE B 2 103 ? 16.379  41.120 40.073 1.00 23.92 ? 102  ILE B CA    1 
ATOM   1807 C  C     . ILE B 2 103 ? 15.991  39.831 40.802 1.00 24.55 ? 102  ILE B C     1 
ATOM   1808 O  O     . ILE B 2 103 ? 15.018  39.792 41.560 1.00 23.65 ? 102  ILE B O     1 
ATOM   1809 C  CB    . ILE B 2 103 ? 16.732  42.235 41.059 1.00 20.78 ? 102  ILE B CB    1 
ATOM   1810 C  CG1   . ILE B 2 103 ? 17.305  43.423 40.270 1.00 17.68 ? 102  ILE B CG1   1 
ATOM   1811 C  CG2   . ILE B 2 103 ? 17.655  41.718 42.166 1.00 23.13 ? 102  ILE B CG2   1 
ATOM   1812 C  CD1   . ILE B 2 103 ? 17.755  44.602 41.140 1.00 14.53 ? 102  ILE B CD1   1 
ATOM   1813 H  H     . ILE B 2 103 ? 14.471  41.803 39.571 1.00 0.00  ? 102  ILE B H     1 
ATOM   1814 N  N     . CYS B 2 104 ? 16.749  38.772 40.542 1.00 21.68 ? 103  CYS B N     1 
ATOM   1815 C  CA    . CYS B 2 104 ? 16.523  37.484 41.181 1.00 18.67 ? 103  CYS B CA    1 
ATOM   1816 C  C     . CYS B 2 104 ? 17.435  37.400 42.410 1.00 19.82 ? 103  CYS B C     1 
ATOM   1817 O  O     . CYS B 2 104 ? 18.637  37.657 42.331 1.00 19.88 ? 103  CYS B O     1 
ATOM   1818 C  CB    . CYS B 2 104 ? 16.799  36.358 40.180 1.00 15.79 ? 103  CYS B CB    1 
ATOM   1819 S  SG    . CYS B 2 104 ? 15.687  36.457 38.708 1.00 18.09 ? 103  CYS B SG    1 
ATOM   1820 H  H     . CYS B 2 104 ? 17.475  38.859 39.889 1.00 0.00  ? 103  CYS B H     1 
ATOM   1821 N  N     . VAL B 2 105 ? 16.845  37.193 43.576 1.00 17.46 ? 104  VAL B N     1 
ATOM   1822 C  CA    . VAL B 2 105 ? 17.648  37.109 44.780 1.00 21.38 ? 104  VAL B CA    1 
ATOM   1823 C  C     . VAL B 2 105 ? 17.992  35.660 45.144 1.00 24.71 ? 104  VAL B C     1 
ATOM   1824 O  O     . VAL B 2 105 ? 17.130  34.828 45.463 1.00 22.20 ? 104  VAL B O     1 
ATOM   1825 C  CB    . VAL B 2 105 ? 16.994  37.846 45.977 1.00 23.16 ? 104  VAL B CB    1 
ATOM   1826 C  CG1   . VAL B 2 105 ? 17.884  37.722 47.232 1.00 19.00 ? 104  VAL B CG1   1 
ATOM   1827 C  CG2   . VAL B 2 105 ? 16.741  39.308 45.607 1.00 12.43 ? 104  VAL B CG2   1 
ATOM   1828 H  H     . VAL B 2 105 ? 15.885  37.085 43.620 1.00 0.00  ? 104  VAL B H     1 
ATOM   1829 N  N     . ASP B 2 106 ? 19.272  35.344 45.012 1.00 26.73 ? 105  ASP B N     1 
ATOM   1830 C  CA    . ASP B 2 106 ? 19.729  34.025 45.328 1.00 23.83 ? 105  ASP B CA    1 
ATOM   1831 C  C     . ASP B 2 106 ? 20.311  34.016 46.720 1.00 25.38 ? 105  ASP B C     1 
ATOM   1832 O  O     . ASP B 2 106 ? 21.056  34.924 47.092 1.00 24.76 ? 105  ASP B O     1 
ATOM   1833 C  CB    . ASP B 2 106 ? 20.790  33.549 44.333 1.00 21.35 ? 105  ASP B CB    1 
ATOM   1834 C  CG    . ASP B 2 106 ? 21.474  32.273 44.795 1.00 23.33 ? 105  ASP B CG    1 
ATOM   1835 O  OD1   . ASP B 2 106 ? 20.801  31.228 44.817 1.00 20.97 ? 105  ASP B OD1   1 
ATOM   1836 O  OD2   . ASP B 2 106 ? 22.662  32.320 45.206 1.00 25.02 ? 105  ASP B OD2   1 
ATOM   1837 H  H     . ASP B 2 106 ? 19.912  36.050 44.760 1.00 0.00  ? 105  ASP B H     1 
ATOM   1838 N  N     . TRP B 2 107 ? 19.949  32.979 47.475 1.00 27.40 ? 106  TRP B N     1 
ATOM   1839 C  CA    . TRP B 2 107 ? 20.469  32.749 48.818 1.00 25.11 ? 106  TRP B CA    1 
ATOM   1840 C  C     . TRP B 2 107 ? 20.551  31.233 49.106 1.00 21.37 ? 106  TRP B C     1 
ATOM   1841 O  O     . TRP B 2 107 ? 20.262  30.792 50.218 1.00 19.46 ? 106  TRP B O     1 
ATOM   1842 C  CB    . TRP B 2 107 ? 19.657  33.502 49.890 1.00 26.49 ? 106  TRP B CB    1 
ATOM   1843 C  CG    . TRP B 2 107 ? 18.225  33.070 49.995 1.00 23.56 ? 106  TRP B CG    1 
ATOM   1844 C  CD1   . TRP B 2 107 ? 17.226  33.322 49.101 1.00 21.07 ? 106  TRP B CD1   1 
ATOM   1845 C  CD2   . TRP B 2 107 ? 17.644  32.292 51.042 1.00 17.18 ? 106  TRP B CD2   1 
ATOM   1846 N  NE1   . TRP B 2 107 ? 16.062  32.746 49.527 1.00 20.31 ? 106  TRP B NE1   1 
ATOM   1847 C  CE2   . TRP B 2 107 ? 16.287  32.109 50.719 1.00 18.17 ? 106  TRP B CE2   1 
ATOM   1848 C  CE3   . TRP B 2 107 ? 18.137  31.734 52.220 1.00 18.56 ? 106  TRP B CE3   1 
ATOM   1849 C  CZ2   . TRP B 2 107 ? 15.415  31.390 51.535 1.00 13.09 ? 106  TRP B CZ2   1 
ATOM   1850 C  CZ3   . TRP B 2 107 ? 17.271  31.022 53.036 1.00 18.03 ? 106  TRP B CZ3   1 
ATOM   1851 C  CH2   . TRP B 2 107 ? 15.926  30.858 52.688 1.00 18.12 ? 106  TRP B CH2   1 
ATOM   1852 H  H     . TRP B 2 107 ? 19.352  32.314 47.142 1.00 0.00  ? 106  TRP B H     1 
ATOM   1853 H  HE1   . TRP B 2 107 ? 15.170  32.817 49.110 1.00 0.00  ? 106  TRP B HE1   1 
ATOM   1854 N  N     . LYS B 2 108 ? 20.933  30.442 48.097 1.00 18.55 ? 107  LYS B N     1 
ATOM   1855 C  CA    . LYS B 2 108 ? 21.091  28.987 48.286 1.00 24.08 ? 107  LYS B CA    1 
ATOM   1856 C  C     . LYS B 2 108 ? 22.161  28.657 49.353 1.00 25.12 ? 107  LYS B C     1 
ATOM   1857 O  O     . LYS B 2 108 ? 22.217  27.538 49.873 1.00 28.74 ? 107  LYS B O     1 
ATOM   1858 C  CB    . LYS B 2 108 ? 21.448  28.275 46.982 1.00 19.11 ? 107  LYS B CB    1 
ATOM   1859 C  CG    . LYS B 2 108 ? 22.537  28.955 46.203 1.00 21.56 ? 107  LYS B CG    1 
ATOM   1860 C  CD    . LYS B 2 108 ? 23.169  28.006 45.239 1.00 22.27 ? 107  LYS B CD    1 
ATOM   1861 C  CE    . LYS B 2 108 ? 23.770  28.730 44.068 1.00 26.44 ? 107  LYS B CE    1 
ATOM   1862 N  NZ    . LYS B 2 108 ? 22.695  28.921 43.054 1.00 33.73 ? 107  LYS B NZ    1 
ATOM   1863 H  H     . LYS B 2 108 ? 21.201  30.846 47.250 1.00 0.00  ? 107  LYS B H     1 
ATOM   1864 H  HZ1   . LYS B 2 108 ? 22.325  27.987 42.784 1.00 0.00  ? 107  LYS B HZ1   1 
ATOM   1865 H  HZ2   . LYS B 2 108 ? 21.934  29.500 43.462 1.00 0.00  ? 107  LYS B HZ2   1 
ATOM   1866 H  HZ3   . LYS B 2 108 ? 23.102  29.392 42.223 1.00 0.00  ? 107  LYS B HZ3   1 
ATOM   1867 N  N     . GLY B 2 109 ? 23.028  29.621 49.650 1.00 23.53 ? 108  GLY B N     1 
ATOM   1868 C  CA    . GLY B 2 109 ? 24.030  29.422 50.680 1.00 21.24 ? 108  GLY B CA    1 
ATOM   1869 C  C     . GLY B 2 109 ? 23.333  29.243 52.015 1.00 18.08 ? 108  GLY B C     1 
ATOM   1870 O  O     . GLY B 2 109 ? 23.854  28.620 52.919 1.00 22.74 ? 108  GLY B O     1 
ATOM   1871 H  H     . GLY B 2 109 ? 23.033  30.454 49.141 1.00 0.00  ? 108  GLY B H     1 
ATOM   1872 N  N     . GLY B 2 110 ? 22.131  29.776 52.137 1.00 15.27 ? 109  GLY B N     1 
ATOM   1873 C  CA    . GLY B 2 110 ? 21.408  29.614 53.374 1.00 17.71 ? 109  GLY B CA    1 
ATOM   1874 C  C     . GLY B 2 110 ? 20.101  28.825 53.272 1.00 20.87 ? 109  GLY B C     1 
ATOM   1875 O  O     . GLY B 2 110 ? 19.527  28.501 54.324 1.00 18.14 ? 109  GLY B O     1 
ATOM   1876 H  H     . GLY B 2 110 ? 21.747  30.269 51.386 1.00 0.00  ? 109  GLY B H     1 
ATOM   1877 N  N     . SER B 2 111 ? 19.654  28.468 52.058 1.00 19.53 ? 110  SER B N     1 
ATOM   1878 C  CA    . SER B 2 111 ? 18.365  27.757 51.890 1.00 19.83 ? 110  SER B CA    1 
ATOM   1879 C  C     . SER B 2 111 ? 18.425  26.239 51.853 1.00 20.12 ? 110  SER B C     1 
ATOM   1880 O  O     . SER B 2 111 ? 17.411  25.567 52.094 1.00 15.06 ? 110  SER B O     1 
ATOM   1881 C  CB    . SER B 2 111 ? 17.603  28.255 50.648 1.00 15.01 ? 110  SER B CB    1 
ATOM   1882 O  OG    . SER B 2 111 ? 18.152  27.729 49.451 1.00 15.99 ? 110  SER B OG    1 
ATOM   1883 H  H     . SER B 2 111 ? 20.181  28.688 51.264 1.00 0.00  ? 110  SER B H     1 
ATOM   1884 H  HG    . SER B 2 111 ? 17.757  26.884 49.217 1.00 0.00  ? 110  SER B HG    1 
ATOM   1885 N  N     . ARG B 2 112 ? 19.602  25.718 51.513 1.00 23.63 ? 111  ARG B N     1 
ATOM   1886 C  CA    . ARG B 2 112 ? 19.852  24.282 51.401 1.00 21.18 ? 111  ARG B CA    1 
ATOM   1887 C  C     . ARG B 2 112 ? 20.427  23.695 52.699 1.00 23.79 ? 111  ARG B C     1 
ATOM   1888 O  O     . ARG B 2 112 ? 21.487  23.066 52.702 1.00 28.84 ? 111  ARG B O     1 
ATOM   1889 C  CB    . ARG B 2 112 ? 20.765  24.006 50.190 1.00 19.05 ? 111  ARG B CB    1 
ATOM   1890 C  CG    . ARG B 2 112 ? 20.011  23.636 48.890 1.00 22.38 ? 111  ARG B CG    1 
ATOM   1891 C  CD    . ARG B 2 112 ? 19.973  24.704 47.778 1.00 16.95 ? 111  ARG B CD    1 
ATOM   1892 N  NE    . ARG B 2 112 ? 20.882  24.409 46.665 1.00 20.19 ? 111  ARG B NE    1 
ATOM   1893 C  CZ    . ARG B 2 112 ? 20.532  24.257 45.383 1.00 20.30 ? 111  ARG B CZ    1 
ATOM   1894 N  NH1   . ARG B 2 112 ? 19.266  24.296 44.987 1.00 17.92 ? 111  ARG B NH1   1 
ATOM   1895 N  NH2   . ARG B 2 112 ? 21.472  24.004 44.485 1.00 17.81 ? 111  ARG B NH2   1 
ATOM   1896 H  H     . ARG B 2 112 ? 20.361  26.313 51.320 1.00 0.00  ? 111  ARG B H     1 
ATOM   1897 H  HE    . ARG B 2 112 ? 21.838  24.325 46.863 1.00 0.00  ? 111  ARG B HE    1 
ATOM   1898 H  HH11  . ARG B 2 112 ? 18.543  24.455 45.647 1.00 0.00  ? 111  ARG B HH11  1 
ATOM   1899 H  HH12  . ARG B 2 112 ? 19.037  24.175 44.023 1.00 0.00  ? 111  ARG B HH12  1 
ATOM   1900 H  HH21  . ARG B 2 112 ? 22.424  23.943 44.778 1.00 0.00  ? 111  ARG B HH21  1 
ATOM   1901 H  HH22  . ARG B 2 112 ? 21.230  23.888 43.521 1.00 0.00  ? 111  ARG B HH22  1 
ATOM   1902 N  N     . THR B 2 113 ? 19.696  23.899 53.794 1.00 24.15 ? 112  THR B N     1 
ATOM   1903 C  CA    . THR B 2 113 ? 20.063  23.434 55.136 1.00 24.08 ? 112  THR B CA    1 
ATOM   1904 C  C     . THR B 2 113 ? 18.791  23.005 55.897 1.00 24.11 ? 112  THR B C     1 
ATOM   1905 O  O     . THR B 2 113 ? 17.713  22.886 55.310 1.00 26.01 ? 112  THR B O     1 
ATOM   1906 C  CB    . THR B 2 113 ? 20.727  24.591 55.929 1.00 26.75 ? 112  THR B CB    1 
ATOM   1907 O  OG1   . THR B 2 113 ? 21.060  24.155 57.257 1.00 33.74 ? 112  THR B OG1   1 
ATOM   1908 C  CG2   . THR B 2 113 ? 19.782  25.789 56.022 1.00 26.55 ? 112  THR B CG2   1 
ATOM   1909 H  H     . THR B 2 113 ? 18.825  24.348 53.726 1.00 0.00  ? 112  THR B H     1 
ATOM   1910 H  HG1   . THR B 2 113 ? 21.167  24.900 57.852 1.00 0.00  ? 112  THR B HG1   1 
ATOM   1911 N  N     . GLY B 2 114 ? 18.900  22.822 57.209 1.00 23.21 ? 113  GLY B N     1 
ATOM   1912 C  CA    . GLY B 2 114 ? 17.732  22.466 57.997 1.00 25.37 ? 113  GLY B CA    1 
ATOM   1913 C  C     . GLY B 2 114 ? 16.726  23.604 57.924 1.00 26.53 ? 113  GLY B C     1 
ATOM   1914 O  O     . GLY B 2 114 ? 17.107  24.781 57.974 1.00 31.01 ? 113  GLY B O     1 
ATOM   1915 H  H     . GLY B 2 114 ? 19.766  22.925 57.642 1.00 0.00  ? 113  GLY B H     1 
ATOM   1916 N  N     . TYR B 2 115 ? 15.446  23.265 57.842 1.00 21.42 ? 114  TYR B N     1 
ATOM   1917 C  CA    . TYR B 2 115 ? 14.374  24.254 57.741 1.00 21.72 ? 114  TYR B CA    1 
ATOM   1918 C  C     . TYR B 2 115 ? 14.316  25.302 58.863 1.00 24.88 ? 114  TYR B C     1 
ATOM   1919 O  O     . TYR B 2 115 ? 14.097  26.480 58.604 1.00 24.63 ? 114  TYR B O     1 
ATOM   1920 C  CB    . TYR B 2 115 ? 13.028  23.553 57.602 1.00 20.60 ? 114  TYR B CB    1 
ATOM   1921 C  CG    . TYR B 2 115 ? 11.888  24.499 57.462 1.00 21.39 ? 114  TYR B CG    1 
ATOM   1922 C  CD1   . TYR B 2 115 ? 11.665  25.160 56.255 1.00 22.48 ? 114  TYR B CD1   1 
ATOM   1923 C  CD2   . TYR B 2 115 ? 11.070  24.805 58.562 1.00 21.72 ? 114  TYR B CD2   1 
ATOM   1924 C  CE1   . TYR B 2 115 ? 10.661  26.115 56.143 1.00 23.45 ? 114  TYR B CE1   1 
ATOM   1925 C  CE2   . TYR B 2 115 ? 10.062  25.758 58.461 1.00 20.41 ? 114  TYR B CE2   1 
ATOM   1926 C  CZ    . TYR B 2 115 ? 9.869   26.407 57.243 1.00 18.31 ? 114  TYR B CZ    1 
ATOM   1927 O  OH    . TYR B 2 115 ? 8.890   27.348 57.113 1.00 19.55 ? 114  TYR B OH    1 
ATOM   1928 H  H     . TYR B 2 115 ? 15.226  22.312 57.809 1.00 0.00  ? 114  TYR B H     1 
ATOM   1929 H  HH    . TYR B 2 115 ? 8.986   27.812 56.285 1.00 0.00  ? 114  TYR B HH    1 
ATOM   1930 N  N     . THR B 2 116 ? 14.471  24.879 60.107 1.00 27.12 ? 115  THR B N     1 
ATOM   1931 C  CA    . THR B 2 116 ? 14.467  25.812 61.221 1.00 28.22 ? 115  THR B CA    1 
ATOM   1932 C  C     . THR B 2 116 ? 15.566  26.852 61.025 1.00 28.32 ? 115  THR B C     1 
ATOM   1933 O  O     . THR B 2 116 ? 15.392  28.005 61.380 1.00 30.30 ? 115  THR B O     1 
ATOM   1934 C  CB    . THR B 2 116 ? 14.732  25.087 62.535 1.00 31.48 ? 115  THR B CB    1 
ATOM   1935 O  OG1   . THR B 2 116 ? 14.083  23.809 62.509 1.00 35.18 ? 115  THR B OG1   1 
ATOM   1936 C  CG2   . THR B 2 116 ? 14.193  25.911 63.707 1.00 35.81 ? 115  THR B CG2   1 
ATOM   1937 H  H     . THR B 2 116 ? 14.562  23.924 60.307 1.00 0.00  ? 115  THR B H     1 
ATOM   1938 H  HG1   . THR B 2 116 ? 14.230  23.340 63.337 1.00 0.00  ? 115  THR B HG1   1 
ATOM   1939 N  N     . GLN B 2 117 ? 16.695  26.434 60.444 1.00 33.57 ? 116  GLN B N     1 
ATOM   1940 C  CA    . GLN B 2 117 ? 17.842  27.323 60.165 1.00 32.17 ? 116  GLN B CA    1 
ATOM   1941 C  C     . GLN B 2 117 ? 17.585  28.178 58.919 1.00 30.05 ? 116  GLN B C     1 
ATOM   1942 O  O     . GLN B 2 117 ? 18.109  29.279 58.810 1.00 32.20 ? 116  GLN B O     1 
ATOM   1943 C  CB    . GLN B 2 117 ? 19.126  26.510 59.954 1.00 32.88 ? 116  GLN B CB    1 
ATOM   1944 C  CG    . GLN B 2 117 ? 20.366  27.362 59.793 1.00 36.26 ? 116  GLN B CG    1 
ATOM   1945 C  CD    . GLN B 2 117 ? 20.684  28.155 61.053 1.00 41.17 ? 116  GLN B CD    1 
ATOM   1946 O  OE1   . GLN B 2 117 ? 20.942  27.569 62.114 1.00 41.43 ? 116  GLN B OE1   1 
ATOM   1947 N  NE2   . GLN B 2 117 ? 20.664  29.489 60.950 1.00 36.95 ? 116  GLN B NE2   1 
ATOM   1948 H  H     . GLN B 2 117 ? 16.772  25.503 60.166 1.00 0.00  ? 116  GLN B H     1 
ATOM   1949 H  HE21  . GLN B 2 117 ? 20.844  29.993 61.776 1.00 0.00  ? 116  GLN B HE21  1 
ATOM   1950 H  HE22  . GLN B 2 117 ? 20.462  29.896 60.083 1.00 0.00  ? 116  GLN B HE22  1 
ATOM   1951 N  N     . ALA B 2 118 ? 16.833  27.639 57.957 1.00 30.23 ? 117  ALA B N     1 
ATOM   1952 C  CA    . ALA B 2 118 ? 16.467  28.373 56.738 1.00 26.94 ? 117  ALA B CA    1 
ATOM   1953 C  C     . ALA B 2 118 ? 15.506  29.476 57.135 1.00 25.20 ? 117  ALA B C     1 
ATOM   1954 O  O     . ALA B 2 118 ? 15.600  30.587 56.623 1.00 30.37 ? 117  ALA B O     1 
ATOM   1955 C  CB    . ALA B 2 118 ? 15.790  27.456 55.736 1.00 30.84 ? 117  ALA B CB    1 
ATOM   1956 H  H     . ALA B 2 118 ? 16.524  26.716 58.050 1.00 0.00  ? 117  ALA B H     1 
ATOM   1957 N  N     . SER B 2 119 ? 14.604  29.171 58.071 1.00 26.64 ? 118  SER B N     1 
ATOM   1958 C  CA    . SER B 2 119 ? 13.609  30.132 58.571 1.00 30.06 ? 118  SER B CA    1 
ATOM   1959 C  C     . SER B 2 119 ? 14.276  31.333 59.243 1.00 28.85 ? 118  SER B C     1 
ATOM   1960 O  O     . SER B 2 119 ? 13.760  32.447 59.208 1.00 30.60 ? 118  SER B O     1 
ATOM   1961 C  CB    . SER B 2 119 ? 12.674  29.460 59.575 1.00 30.34 ? 118  SER B CB    1 
ATOM   1962 O  OG    . SER B 2 119 ? 12.042  28.331 59.010 1.00 37.87 ? 118  SER B OG    1 
ATOM   1963 H  H     . SER B 2 119 ? 14.605  28.269 58.433 1.00 0.00  ? 118  SER B H     1 
ATOM   1964 H  HG    . SER B 2 119 ? 12.695  27.664 58.813 1.00 0.00  ? 118  SER B HG    1 
ATOM   1965 N  N     . GLN B 2 120 ? 15.390  31.086 59.918 1.00 25.34 ? 119  GLN B N     1 
ATOM   1966 C  CA    . GLN B 2 120 ? 16.108  32.161 60.563 1.00 23.48 ? 119  GLN B CA    1 
ATOM   1967 C  C     . GLN B 2 120 ? 16.920  32.880 59.483 1.00 22.80 ? 119  GLN B C     1 
ATOM   1968 O  O     . GLN B 2 120 ? 16.926  34.103 59.432 1.00 23.05 ? 119  GLN B O     1 
ATOM   1969 C  CB    . GLN B 2 120 ? 16.998  31.621 61.694 1.00 18.89 ? 119  GLN B CB    1 
ATOM   1970 C  CG    . GLN B 2 120 ? 16.225  31.035 62.896 1.00 18.99 ? 119  GLN B CG    1 
ATOM   1971 C  CD    . GLN B 2 120 ? 15.565  32.089 63.807 1.00 24.10 ? 119  GLN B CD    1 
ATOM   1972 O  OE1   . GLN B 2 120 ? 15.859  33.271 63.718 1.00 27.09 ? 119  GLN B OE1   1 
ATOM   1973 N  NE2   . GLN B 2 120 ? 14.659  31.649 64.678 1.00 27.11 ? 119  GLN B NE2   1 
ATOM   1974 H  H     . GLN B 2 120 ? 15.722  30.165 60.004 1.00 0.00  ? 119  GLN B H     1 
ATOM   1975 H  HE21  . GLN B 2 120 ? 14.230  32.296 65.275 1.00 0.00  ? 119  GLN B HE21  1 
ATOM   1976 H  HE22  . GLN B 2 120 ? 14.435  30.690 64.704 1.00 0.00  ? 119  GLN B HE22  1 
ATOM   1977 N  N     . ASN B 2 121 ? 17.527  32.132 58.561 1.00 22.33 ? 120  ASN B N     1 
ATOM   1978 C  CA    . ASN B 2 121 ? 18.345  32.741 57.504 1.00 23.14 ? 120  ASN B CA    1 
ATOM   1979 C  C     . ASN B 2 121 ? 17.585  33.786 56.694 1.00 24.81 ? 120  ASN B C     1 
ATOM   1980 O  O     . ASN B 2 121 ? 18.169  34.671 56.051 1.00 26.94 ? 120  ASN B O     1 
ATOM   1981 C  CB    . ASN B 2 121 ? 18.930  31.664 56.598 1.00 22.82 ? 120  ASN B CB    1 
ATOM   1982 C  CG    . ASN B 2 121 ? 19.949  30.803 57.311 1.00 22.17 ? 120  ASN B CG    1 
ATOM   1983 O  OD1   . ASN B 2 121 ? 20.415  31.148 58.398 1.00 18.75 ? 120  ASN B OD1   1 
ATOM   1984 N  ND2   . ASN B 2 121 ? 20.293  29.666 56.711 1.00 20.02 ? 120  ASN B ND2   1 
ATOM   1985 H  H     . ASN B 2 121 ? 17.454  31.155 58.590 1.00 0.00  ? 120  ASN B H     1 
ATOM   1986 H  HD21  . ASN B 2 121 ? 20.959  29.096 57.135 1.00 0.00  ? 120  ASN B HD21  1 
ATOM   1987 H  HD22  . ASN B 2 121 ? 19.849  29.454 55.866 1.00 0.00  ? 120  ASN B HD22  1 
ATOM   1988 N  N     . ILE B 2 122 ? 16.267  33.693 56.787 1.00 28.77 ? 121  ILE B N     1 
ATOM   1989 C  CA    . ILE B 2 122 ? 15.314  34.583 56.139 1.00 26.30 ? 121  ILE B CA    1 
ATOM   1990 C  C     . ILE B 2 122 ? 15.554  36.059 56.549 1.00 24.99 ? 121  ILE B C     1 
ATOM   1991 O  O     . ILE B 2 122 ? 15.471  36.971 55.725 1.00 20.96 ? 121  ILE B O     1 
ATOM   1992 C  CB    . ILE B 2 122 ? 13.857  34.042 56.491 1.00 29.53 ? 121  ILE B CB    1 
ATOM   1993 C  CG1   . ILE B 2 122 ? 13.307  33.224 55.329 1.00 32.86 ? 121  ILE B CG1   1 
ATOM   1994 C  CG2   . ILE B 2 122 ? 12.917  35.096 57.023 1.00 25.66 ? 121  ILE B CG2   1 
ATOM   1995 C  CD1   . ILE B 2 122 ? 13.809  33.669 53.973 1.00 35.22 ? 121  ILE B CD1   1 
ATOM   1996 H  H     . ILE B 2 122 ? 15.894  32.954 57.304 1.00 0.00  ? 121  ILE B H     1 
ATOM   1997 N  N     . ARG B 2 123 ? 15.949  36.285 57.800 1.00 28.40 ? 122  ARG B N     1 
ATOM   1998 C  CA    . ARG B 2 123 ? 16.168  37.646 58.276 1.00 26.06 ? 122  ARG B CA    1 
ATOM   1999 C  C     . ARG B 2 123 ? 17.428  38.328 57.774 1.00 26.83 ? 122  ARG B C     1 
ATOM   2000 O  O     . ARG B 2 123 ? 17.509  39.557 57.752 1.00 27.17 ? 122  ARG B O     1 
ATOM   2001 C  CB    . ARG B 2 123 ? 16.023  37.747 59.790 1.00 26.53 ? 122  ARG B CB    1 
ATOM   2002 C  CG    . ARG B 2 123 ? 16.736  36.731 60.620 1.00 21.70 ? 122  ARG B CG    1 
ATOM   2003 C  CD    . ARG B 2 123 ? 15.762  36.297 61.711 1.00 23.41 ? 122  ARG B CD    1 
ATOM   2004 N  NE    . ARG B 2 123 ? 16.175  36.543 63.098 1.00 17.44 ? 122  ARG B NE    1 
ATOM   2005 C  CZ    . ARG B 2 123 ? 16.071  37.706 63.715 1.00 17.60 ? 122  ARG B CZ    1 
ATOM   2006 N  NH1   . ARG B 2 123 ? 15.684  38.761 63.025 1.00 20.33 ? 122  ARG B NH1   1 
ATOM   2007 N  NH2   . ARG B 2 123 ? 16.422  37.837 64.988 1.00 12.69 ? 122  ARG B NH2   1 
ATOM   2008 H  H     . ARG B 2 123 ? 16.091  35.518 58.389 1.00 0.00  ? 122  ARG B H     1 
ATOM   2009 H  HE    . ARG B 2 123 ? 16.594  35.791 63.532 1.00 0.00  ? 122  ARG B HE    1 
ATOM   2010 H  HH11  . ARG B 2 123 ? 15.459  38.693 62.056 1.00 0.00  ? 122  ARG B HH11  1 
ATOM   2011 H  HH12  . ARG B 2 123 ? 15.616  39.639 63.497 1.00 0.00  ? 122  ARG B HH12  1 
ATOM   2012 H  HH21  . ARG B 2 123 ? 16.763  37.057 65.514 1.00 0.00  ? 122  ARG B HH21  1 
ATOM   2013 H  HH22  . ARG B 2 123 ? 16.335  38.742 65.420 1.00 0.00  ? 122  ARG B HH22  1 
ATOM   2014 N  N     . ILE B 2 124 ? 18.404  37.539 57.344 1.00 25.98 ? 123  ILE B N     1 
ATOM   2015 C  CA    . ILE B 2 124 ? 19.633  38.101 56.794 1.00 22.60 ? 123  ILE B CA    1 
ATOM   2016 C  C     . ILE B 2 124 ? 19.272  38.563 55.371 1.00 18.20 ? 123  ILE B C     1 
ATOM   2017 O  O     . ILE B 2 124 ? 19.659  39.645 54.952 1.00 16.44 ? 123  ILE B O     1 
ATOM   2018 C  CB    . ILE B 2 124 ? 20.785  37.030 56.733 1.00 22.56 ? 123  ILE B CB    1 
ATOM   2019 C  CG1   . ILE B 2 124 ? 21.125  36.517 58.140 1.00 19.56 ? 123  ILE B CG1   1 
ATOM   2020 C  CG2   . ILE B 2 124 ? 22.022  37.617 56.008 1.00 16.42 ? 123  ILE B CG2   1 
ATOM   2021 C  CD1   . ILE B 2 124 ? 21.878  37.524 59.012 1.00 20.26 ? 123  ILE B CD1   1 
ATOM   2022 H  H     . ILE B 2 124 ? 18.292  36.565 57.394 1.00 0.00  ? 123  ILE B H     1 
ATOM   2023 N  N     . VAL B 2 125 ? 18.528  37.723 54.654 1.00 16.76 ? 124  VAL B N     1 
ATOM   2024 C  CA    . VAL B 2 125 ? 18.085  37.997 53.293 1.00 15.81 ? 124  VAL B CA    1 
ATOM   2025 C  C     . VAL B 2 125 ? 17.204  39.221 53.253 1.00 23.37 ? 124  VAL B C     1 
ATOM   2026 O  O     . VAL B 2 125 ? 17.359  40.049 52.344 1.00 30.63 ? 124  VAL B O     1 
ATOM   2027 C  CB    . VAL B 2 125 ? 17.295  36.825 52.708 1.00 16.98 ? 124  VAL B CB    1 
ATOM   2028 C  CG1   . VAL B 2 125 ? 16.865  37.132 51.263 1.00 8.27  ? 124  VAL B CG1   1 
ATOM   2029 C  CG2   . VAL B 2 125 ? 18.132  35.549 52.802 1.00 14.41 ? 124  VAL B CG2   1 
ATOM   2030 H  H     . VAL B 2 125 ? 18.291  36.868 55.066 1.00 0.00  ? 124  VAL B H     1 
ATOM   2031 N  N     . GLY B 2 126 ? 16.254  39.330 54.193 1.00 21.68 ? 125  GLY B N     1 
ATOM   2032 C  CA    . GLY B 2 126 ? 15.408  40.513 54.234 1.00 18.45 ? 125  GLY B CA    1 
ATOM   2033 C  C     . GLY B 2 126 ? 16.303  41.730 54.437 1.00 22.81 ? 125  GLY B C     1 
ATOM   2034 O  O     . GLY B 2 126 ? 16.241  42.725 53.707 1.00 24.13 ? 125  GLY B O     1 
ATOM   2035 H  H     . GLY B 2 126 ? 16.122  38.600 54.835 1.00 0.00  ? 125  GLY B H     1 
ATOM   2036 N  N     . ALA B 2 127 ? 17.191  41.609 55.414 1.00 24.15 ? 126  ALA B N     1 
ATOM   2037 C  CA    . ALA B 2 127 ? 18.150  42.641 55.743 1.00 22.11 ? 126  ALA B CA    1 
ATOM   2038 C  C     . ALA B 2 127 ? 18.946  43.012 54.493 1.00 26.99 ? 126  ALA B C     1 
ATOM   2039 O  O     . ALA B 2 127 ? 19.047  44.187 54.147 1.00 35.67 ? 126  ALA B O     1 
ATOM   2040 C  CB    . ALA B 2 127 ? 19.085  42.144 56.854 1.00 17.04 ? 126  ALA B CB    1 
ATOM   2041 H  H     . ALA B 2 127 ? 17.216  40.781 55.943 1.00 0.00  ? 126  ALA B H     1 
ATOM   2042 N  N     . GLU B 2 128 ? 19.468  42.020 53.781 1.00 28.08 ? 127  GLU B N     1 
ATOM   2043 C  CA    . GLU B 2 128 ? 20.243  42.287 52.574 1.00 27.49 ? 127  GLU B CA    1 
ATOM   2044 C  C     . GLU B 2 128 ? 19.443  43.085 51.543 1.00 25.05 ? 127  GLU B C     1 
ATOM   2045 O  O     . GLU B 2 128 ? 19.977  43.986 50.916 1.00 30.14 ? 127  GLU B O     1 
ATOM   2046 C  CB    . GLU B 2 128 ? 20.749  40.976 51.946 1.00 29.46 ? 127  GLU B CB    1 
ATOM   2047 C  CG    . GLU B 2 128 ? 21.816  40.224 52.771 1.00 32.22 ? 127  GLU B CG    1 
ATOM   2048 C  CD    . GLU B 2 128 ? 23.264  40.696 52.540 1.00 31.85 ? 127  GLU B CD    1 
ATOM   2049 O  OE1   . GLU B 2 128 ? 23.523  41.501 51.634 1.00 37.14 ? 127  GLU B OE1   1 
ATOM   2050 O  OE2   . GLU B 2 128 ? 24.163  40.239 53.259 1.00 34.64 ? 127  GLU B OE2   1 
ATOM   2051 H  H     . GLU B 2 128 ? 19.284  41.112 54.046 1.00 0.00  ? 127  GLU B H     1 
ATOM   2052 N  N     . VAL B 2 129 ? 18.159  42.781 51.393 1.00 24.20 ? 128  VAL B N     1 
ATOM   2053 C  CA    . VAL B 2 129 ? 17.302  43.476 50.422 1.00 19.62 ? 128  VAL B CA    1 
ATOM   2054 C  C     . VAL B 2 129 ? 16.918  44.907 50.848 1.00 19.94 ? 128  VAL B C     1 
ATOM   2055 O  O     . VAL B 2 129 ? 16.819  45.789 50.001 1.00 16.45 ? 128  VAL B O     1 
ATOM   2056 C  CB    . VAL B 2 129 ? 16.017  42.646 50.117 1.00 22.55 ? 128  VAL B CB    1 
ATOM   2057 C  CG1   . VAL B 2 129 ? 15.150  43.352 49.081 1.00 19.65 ? 128  VAL B CG1   1 
ATOM   2058 C  CG2   . VAL B 2 129 ? 16.397  41.196 49.655 1.00 20.23 ? 128  VAL B CG2   1 
ATOM   2059 H  H     . VAL B 2 129 ? 17.773  42.070 51.951 1.00 0.00  ? 128  VAL B H     1 
ATOM   2060 N  N     . ALA B 2 130 ? 16.693  45.141 52.144 1.00 20.80 ? 129  ALA B N     1 
ATOM   2061 C  CA    . ALA B 2 130 ? 16.358  46.492 52.639 1.00 21.81 ? 129  ALA B CA    1 
ATOM   2062 C  C     . ALA B 2 130 ? 17.604  47.389 52.542 1.00 23.45 ? 129  ALA B C     1 
ATOM   2063 O  O     . ALA B 2 130 ? 17.514  48.597 52.288 1.00 24.15 ? 129  ALA B O     1 
ATOM   2064 C  CB    . ALA B 2 130 ? 15.822  46.440 54.094 1.00 13.06 ? 129  ALA B CB    1 
ATOM   2065 H  H     . ALA B 2 130 ? 16.746  44.393 52.774 1.00 0.00  ? 129  ALA B H     1 
ATOM   2066 N  N     . TYR B 2 131 ? 18.765  46.776 52.729 1.00 24.30 ? 130  TYR B N     1 
ATOM   2067 C  CA    . TYR B 2 131 ? 20.033  47.465 52.626 1.00 24.11 ? 130  TYR B CA    1 
ATOM   2068 C  C     . TYR B 2 131 ? 20.178  47.955 51.180 1.00 23.79 ? 130  TYR B C     1 
ATOM   2069 O  O     . TYR B 2 131 ? 20.469  49.128 50.942 1.00 22.75 ? 130  TYR B O     1 
ATOM   2070 C  CB    . TYR B 2 131 ? 21.188  46.511 52.995 1.00 28.68 ? 130  TYR B CB    1 
ATOM   2071 C  CG    . TYR B 2 131 ? 22.529  47.212 52.995 1.00 33.99 ? 130  TYR B CG    1 
ATOM   2072 C  CD1   . TYR B 2 131 ? 22.916  48.003 54.085 1.00 33.96 ? 130  TYR B CD1   1 
ATOM   2073 C  CD2   . TYR B 2 131 ? 23.345  47.211 51.854 1.00 34.49 ? 130  TYR B CD2   1 
ATOM   2074 C  CE1   . TYR B 2 131 ? 24.055  48.779 54.041 1.00 33.36 ? 130  TYR B CE1   1 
ATOM   2075 C  CE2   . TYR B 2 131 ? 24.489  47.992 51.799 1.00 36.08 ? 130  TYR B CE2   1 
ATOM   2076 C  CZ    . TYR B 2 131 ? 24.834  48.774 52.901 1.00 35.51 ? 130  TYR B CZ    1 
ATOM   2077 O  OH    . TYR B 2 131 ? 25.959  49.557 52.868 1.00 40.41 ? 130  TYR B OH    1 
ATOM   2078 H  H     . TYR B 2 131 ? 18.756  45.819 52.957 1.00 0.00  ? 130  TYR B H     1 
ATOM   2079 H  HH    . TYR B 2 131 ? 26.354  49.516 51.989 1.00 0.00  ? 130  TYR B HH    1 
ATOM   2080 N  N     . PHE B 2 132 ? 19.968  47.046 50.230 1.00 22.50 ? 131  PHE B N     1 
ATOM   2081 C  CA    . PHE B 2 132 ? 20.037  47.333 48.788 1.00 29.34 ? 131  PHE B CA    1 
ATOM   2082 C  C     . PHE B 2 132 ? 19.008  48.411 48.366 1.00 31.22 ? 131  PHE B C     1 
ATOM   2083 O  O     . PHE B 2 132 ? 19.297  49.211 47.479 1.00 32.78 ? 131  PHE B O     1 
ATOM   2084 C  CB    . PHE B 2 132 ? 19.768  46.027 48.004 1.00 36.71 ? 131  PHE B CB    1 
ATOM   2085 C  CG    . PHE B 2 132 ? 20.149  46.069 46.535 1.00 38.02 ? 131  PHE B CG    1 
ATOM   2086 C  CD1   . PHE B 2 132 ? 19.235  46.477 45.567 1.00 43.14 ? 131  PHE B CD1   1 
ATOM   2087 C  CD2   . PHE B 2 132 ? 21.405  45.634 46.116 1.00 40.36 ? 131  PHE B CD2   1 
ATOM   2088 C  CE1   . PHE B 2 132 ? 19.568  46.445 44.189 1.00 42.50 ? 131  PHE B CE1   1 
ATOM   2089 C  CE2   . PHE B 2 132 ? 21.749  45.598 44.754 1.00 40.41 ? 131  PHE B CE2   1 
ATOM   2090 C  CZ    . PHE B 2 132 ? 20.825  46.006 43.788 1.00 40.96 ? 131  PHE B CZ    1 
ATOM   2091 H  H     . PHE B 2 132 ? 19.748  46.134 50.515 1.00 0.00  ? 131  PHE B H     1 
ATOM   2092 N  N     . VAL B 2 133 ? 17.800  48.380 48.946 1.00 27.05 ? 132  VAL B N     1 
ATOM   2093 C  CA    . VAL B 2 133 ? 16.745  49.358 48.641 1.00 28.59 ? 132  VAL B CA    1 
ATOM   2094 C  C     . VAL B 2 133 ? 17.105  50.745 49.207 1.00 28.02 ? 132  VAL B C     1 
ATOM   2095 O  O     . VAL B 2 133 ? 17.036  51.765 48.511 1.00 20.77 ? 132  VAL B O     1 
ATOM   2096 C  CB    . VAL B 2 133 ? 15.306  48.858 49.155 1.00 31.55 ? 132  VAL B CB    1 
ATOM   2097 C  CG1   . VAL B 2 133 ? 14.468  49.996 49.753 1.00 28.06 ? 132  VAL B CG1   1 
ATOM   2098 C  CG2   . VAL B 2 133 ? 14.508  48.247 47.999 1.00 31.25 ? 132  VAL B CG2   1 
ATOM   2099 H  H     . VAL B 2 133 ? 17.596  47.645 49.566 1.00 0.00  ? 132  VAL B H     1 
ATOM   2100 N  N     . GLU B 2 134 ? 17.510  50.784 50.468 1.00 30.47 ? 133  GLU B N     1 
ATOM   2101 C  CA    . GLU B 2 134 ? 17.884  52.049 51.068 1.00 35.44 ? 133  GLU B CA    1 
ATOM   2102 C  C     . GLU B 2 134 ? 19.076  52.610 50.309 1.00 37.51 ? 133  GLU B C     1 
ATOM   2103 O  O     . GLU B 2 134 ? 19.149  53.822 50.077 1.00 40.34 ? 133  GLU B O     1 
ATOM   2104 C  CB    . GLU B 2 134 ? 18.151  51.891 52.564 1.00 35.34 ? 133  GLU B CB    1 
ATOM   2105 C  CG    . GLU B 2 134 ? 16.857  51.590 53.313 1.00 44.81 ? 133  GLU B CG    1 
ATOM   2106 C  CD    . GLU B 2 134 ? 17.044  51.123 54.752 1.00 51.20 ? 133  GLU B CD    1 
ATOM   2107 O  OE1   . GLU B 2 134 ? 18.126  50.563 55.081 1.00 54.83 ? 133  GLU B OE1   1 
ATOM   2108 O  OE2   . GLU B 2 134 ? 16.082  51.299 55.547 1.00 48.99 ? 133  GLU B OE2   1 
ATOM   2109 H  H     . GLU B 2 134 ? 17.557  49.959 50.986 1.00 0.00  ? 133  GLU B H     1 
ATOM   2110 N  N     . PHE B 2 135 ? 19.940  51.724 49.813 1.00 39.14 ? 134  PHE B N     1 
ATOM   2111 C  CA    . PHE B 2 135 ? 21.111  52.160 49.052 1.00 39.62 ? 134  PHE B CA    1 
ATOM   2112 C  C     . PHE B 2 135 ? 20.670  52.880 47.800 1.00 36.95 ? 134  PHE B C     1 
ATOM   2113 O  O     . PHE B 2 135 ? 21.144  53.982 47.540 1.00 34.74 ? 134  PHE B O     1 
ATOM   2114 C  CB    . PHE B 2 135 ? 22.035  50.986 48.693 1.00 41.95 ? 134  PHE B CB    1 
ATOM   2115 C  CG    . PHE B 2 135 ? 23.057  51.313 47.625 1.00 43.97 ? 134  PHE B CG    1 
ATOM   2116 C  CD1   . PHE B 2 135 ? 24.120  52.177 47.893 1.00 43.28 ? 134  PHE B CD1   1 
ATOM   2117 C  CD2   . PHE B 2 135 ? 22.945  50.760 46.338 1.00 43.20 ? 134  PHE B CD2   1 
ATOM   2118 C  CE1   . PHE B 2 135 ? 25.050  52.485 46.898 1.00 42.78 ? 134  PHE B CE1   1 
ATOM   2119 C  CE2   . PHE B 2 135 ? 23.872  51.067 45.339 1.00 39.96 ? 134  PHE B CE2   1 
ATOM   2120 C  CZ    . PHE B 2 135 ? 24.921  51.926 45.617 1.00 40.29 ? 134  PHE B CZ    1 
ATOM   2121 H  H     . PHE B 2 135 ? 19.822  50.766 49.993 1.00 0.00  ? 134  PHE B H     1 
ATOM   2122 N  N     . LEU B 2 136 ? 19.755  52.265 47.044 1.00 36.89 ? 135  LEU B N     1 
ATOM   2123 C  CA    . LEU B 2 136 ? 19.232  52.859 45.803 1.00 35.90 ? 135  LEU B CA    1 
ATOM   2124 C  C     . LEU B 2 136 ? 18.554  54.198 46.094 1.00 35.08 ? 135  LEU B C     1 
ATOM   2125 O  O     . LEU B 2 136 ? 18.536  55.096 45.253 1.00 37.11 ? 135  LEU B O     1 
ATOM   2126 C  CB    . LEU B 2 136 ? 18.241  51.919 45.093 1.00 33.55 ? 135  LEU B CB    1 
ATOM   2127 C  CG    . LEU B 2 136 ? 18.714  50.567 44.523 1.00 31.47 ? 135  LEU B CG    1 
ATOM   2128 C  CD1   . LEU B 2 136 ? 17.517  49.759 44.121 1.00 33.01 ? 135  LEU B CD1   1 
ATOM   2129 C  CD2   . LEU B 2 136 ? 19.616  50.735 43.331 1.00 32.99 ? 135  LEU B CD2   1 
ATOM   2130 H  H     . LEU B 2 136 ? 19.433  51.373 47.318 1.00 0.00  ? 135  LEU B H     1 
ATOM   2131 N  N     . GLN B 2 137 ? 18.014  54.346 47.294 1.00 34.13 ? 136  GLN B N     1 
ATOM   2132 C  CA    . GLN B 2 137 ? 17.373  55.592 47.649 1.00 37.47 ? 136  GLN B CA    1 
ATOM   2133 C  C     . GLN B 2 137 ? 18.428  56.666 47.884 1.00 42.21 ? 136  GLN B C     1 
ATOM   2134 O  O     . GLN B 2 137 ? 18.418  57.711 47.238 1.00 41.91 ? 136  GLN B O     1 
ATOM   2135 C  CB    . GLN B 2 137 ? 16.515  55.404 48.891 1.00 36.64 ? 136  GLN B CB    1 
ATOM   2136 C  CG    . GLN B 2 137 ? 15.812  56.659 49.357 1.00 35.49 ? 136  GLN B CG    1 
ATOM   2137 C  CD    . GLN B 2 137 ? 14.644  56.347 50.268 1.00 37.69 ? 136  GLN B CD    1 
ATOM   2138 O  OE1   . GLN B 2 137 ? 13.541  56.884 50.101 1.00 37.22 ? 136  GLN B OE1   1 
ATOM   2139 N  NE2   . GLN B 2 137 ? 14.867  55.458 51.229 1.00 40.21 ? 136  GLN B NE2   1 
ATOM   2140 H  H     . GLN B 2 137 ? 18.042  53.611 47.941 1.00 0.00  ? 136  GLN B H     1 
ATOM   2141 H  HE21  . GLN B 2 137 ? 14.092  55.251 51.793 1.00 0.00  ? 136  GLN B HE21  1 
ATOM   2142 H  HE22  . GLN B 2 137 ? 15.746  55.053 51.322 1.00 0.00  ? 136  GLN B HE22  1 
ATOM   2143 N  N     . SER B 2 138 ? 19.368  56.378 48.777 1.00 44.64 ? 137  SER B N     1 
ATOM   2144 C  CA    . SER B 2 138 ? 20.430  57.321 49.114 1.00 48.00 ? 137  SER B CA    1 
ATOM   2145 C  C     . SER B 2 138 ? 21.373  57.658 47.960 1.00 47.61 ? 137  SER B C     1 
ATOM   2146 O  O     . SER B 2 138 ? 21.670  58.823 47.709 1.00 50.25 ? 137  SER B O     1 
ATOM   2147 C  CB    . SER B 2 138 ? 21.256  56.773 50.272 1.00 47.42 ? 137  SER B CB    1 
ATOM   2148 O  OG    . SER B 2 138 ? 20.413  56.244 51.268 1.00 54.86 ? 137  SER B OG    1 
ATOM   2149 H  H     . SER B 2 138 ? 19.346  55.510 49.220 1.00 0.00  ? 137  SER B H     1 
ATOM   2150 H  HG    . SER B 2 138 ? 20.033  55.406 50.978 1.00 0.00  ? 137  SER B HG    1 
ATOM   2151 N  N     . ALA B 2 139 ? 21.859  56.627 47.278 1.00 46.34 ? 138  ALA B N     1 
ATOM   2152 C  CA    . ALA B 2 139 ? 22.799  56.798 46.185 1.00 42.02 ? 138  ALA B CA    1 
ATOM   2153 C  C     . ALA B 2 139 ? 22.243  57.429 44.918 1.00 43.86 ? 138  ALA B C     1 
ATOM   2154 O  O     . ALA B 2 139 ? 22.900  58.284 44.320 1.00 48.05 ? 138  ALA B O     1 
ATOM   2155 C  CB    . ALA B 2 139 ? 23.453  55.480 45.866 1.00 36.59 ? 138  ALA B CB    1 
ATOM   2156 H  H     . ALA B 2 139 ? 21.566  55.736 47.532 1.00 0.00  ? 138  ALA B H     1 
ATOM   2157 N  N     . PHE B 2 140 ? 21.035  57.033 44.522 1.00 41.07 ? 139  PHE B N     1 
ATOM   2158 C  CA    . PHE B 2 140 ? 20.435  57.531 43.288 1.00 39.52 ? 139  PHE B CA    1 
ATOM   2159 C  C     . PHE B 2 140 ? 19.144  58.313 43.442 1.00 38.70 ? 139  PHE B C     1 
ATOM   2160 O  O     . PHE B 2 140 ? 18.519  58.704 42.448 1.00 36.36 ? 139  PHE B O     1 
ATOM   2161 C  CB    . PHE B 2 140 ? 20.188  56.356 42.334 1.00 41.51 ? 139  PHE B CB    1 
ATOM   2162 C  CG    . PHE B 2 140 ? 21.423  55.571 42.023 1.00 43.12 ? 139  PHE B CG    1 
ATOM   2163 C  CD1   . PHE B 2 140 ? 22.245  55.941 40.974 1.00 43.21 ? 139  PHE B CD1   1 
ATOM   2164 C  CD2   . PHE B 2 140 ? 21.797  54.505 42.824 1.00 46.00 ? 139  PHE B CD2   1 
ATOM   2165 C  CE1   . PHE B 2 140 ? 23.425  55.274 40.730 1.00 47.70 ? 139  PHE B CE1   1 
ATOM   2166 C  CE2   . PHE B 2 140 ? 22.979  53.827 42.591 1.00 49.71 ? 139  PHE B CE2   1 
ATOM   2167 C  CZ    . PHE B 2 140 ? 23.798  54.212 41.541 1.00 49.72 ? 139  PHE B CZ    1 
ATOM   2168 H  H     . PHE B 2 140 ? 20.517  56.380 45.039 1.00 0.00  ? 139  PHE B H     1 
ATOM   2169 N  N     . GLY B 2 141 ? 18.724  58.521 44.678 1.00 37.78 ? 140  GLY B N     1 
ATOM   2170 C  CA    . GLY B 2 141 ? 17.481  59.233 44.896 1.00 36.24 ? 140  GLY B CA    1 
ATOM   2171 C  C     . GLY B 2 141 ? 16.315  58.413 44.394 1.00 36.44 ? 140  GLY B C     1 
ATOM   2172 O  O     . GLY B 2 141 ? 15.228  58.944 44.160 1.00 39.85 ? 140  GLY B O     1 
ATOM   2173 H  H     . GLY B 2 141 ? 19.231  58.203 45.451 1.00 0.00  ? 140  GLY B H     1 
ATOM   2174 N  N     . TYR B 2 142 ? 16.540  57.110 44.237 1.00 35.67 ? 141  TYR B N     1 
ATOM   2175 C  CA    . TYR B 2 142 ? 15.513  56.189 43.764 1.00 31.58 ? 141  TYR B CA    1 
ATOM   2176 C  C     . TYR B 2 142 ? 14.523  55.869 44.903 1.00 32.89 ? 141  TYR B C     1 
ATOM   2177 O  O     . TYR B 2 142 ? 14.916  55.463 46.001 1.00 34.89 ? 141  TYR B O     1 
ATOM   2178 C  CB    . TYR B 2 142 ? 16.179  54.925 43.246 1.00 30.61 ? 141  TYR B CB    1 
ATOM   2179 C  CG    . TYR B 2 142 ? 15.292  53.991 42.455 1.00 32.68 ? 141  TYR B CG    1 
ATOM   2180 C  CD1   . TYR B 2 142 ? 14.848  54.324 41.175 1.00 26.51 ? 141  TYR B CD1   1 
ATOM   2181 C  CD2   . TYR B 2 142 ? 14.977  52.723 42.954 1.00 33.63 ? 141  TYR B CD2   1 
ATOM   2182 C  CE1   . TYR B 2 142 ? 14.127  53.416 40.413 1.00 28.87 ? 141  TYR B CE1   1 
ATOM   2183 C  CE2   . TYR B 2 142 ? 14.258  51.809 42.194 1.00 32.51 ? 141  TYR B CE2   1 
ATOM   2184 C  CZ    . TYR B 2 142 ? 13.843  52.164 40.928 1.00 30.73 ? 141  TYR B CZ    1 
ATOM   2185 O  OH    . TYR B 2 142 ? 13.187  51.243 40.175 1.00 30.81 ? 141  TYR B OH    1 
ATOM   2186 H  H     . TYR B 2 142 ? 17.412  56.729 44.470 1.00 0.00  ? 141  TYR B H     1 
ATOM   2187 H  HH    . TYR B 2 142 ? 13.317  51.505 39.272 1.00 0.00  ? 141  TYR B HH    1 
ATOM   2188 N  N     . SER B 2 143 ? 13.240  56.092 44.644 1.00 28.72 ? 142  SER B N     1 
ATOM   2189 C  CA    . SER B 2 143 ? 12.198  55.853 45.625 1.00 26.45 ? 142  SER B CA    1 
ATOM   2190 C  C     . SER B 2 143 ? 11.806  54.389 45.820 1.00 27.14 ? 142  SER B C     1 
ATOM   2191 O  O     . SER B 2 143 ? 11.566  53.644 44.857 1.00 28.71 ? 142  SER B O     1 
ATOM   2192 C  CB    . SER B 2 143 ? 10.953  56.642 45.231 1.00 28.56 ? 142  SER B CB    1 
ATOM   2193 O  OG    . SER B 2 143 ? 9.915   56.514 46.193 1.00 27.77 ? 142  SER B OG    1 
ATOM   2194 H  H     . SER B 2 143 ? 13.003  56.422 43.760 1.00 0.00  ? 142  SER B H     1 
ATOM   2195 H  HG    . SER B 2 143 ? 9.114   56.584 45.646 1.00 0.00  ? 142  SER B HG    1 
ATOM   2196 N  N     . PRO B 2 144 ? 11.715  53.955 47.078 1.00 25.50 ? 143  PRO B N     1 
ATOM   2197 C  CA    . PRO B 2 144 ? 11.330  52.570 47.300 1.00 25.70 ? 143  PRO B CA    1 
ATOM   2198 C  C     . PRO B 2 144 ? 9.879   52.303 46.877 1.00 25.42 ? 143  PRO B C     1 
ATOM   2199 O  O     . PRO B 2 144 ? 9.385   51.179 46.972 1.00 32.37 ? 143  PRO B O     1 
ATOM   2200 C  CB    . PRO B 2 144 ? 11.576  52.380 48.797 1.00 27.53 ? 143  PRO B CB    1 
ATOM   2201 C  CG    . PRO B 2 144 ? 11.462  53.766 49.376 1.00 26.86 ? 143  PRO B CG    1 
ATOM   2202 C  CD    . PRO B 2 144 ? 12.161  54.586 48.330 1.00 28.94 ? 143  PRO B CD    1 
ATOM   2203 N  N     . SER B 2 145 ? 9.178   53.315 46.388 1.00 29.56 ? 144  SER B N     1 
ATOM   2204 C  CA    . SER B 2 145 ? 7.812   53.064 45.932 1.00 32.08 ? 144  SER B CA    1 
ATOM   2205 C  C     . SER B 2 145 ? 7.862   52.447 44.519 1.00 30.19 ? 144  SER B C     1 
ATOM   2206 O  O     . SER B 2 145 ? 6.901   51.856 44.058 1.00 36.84 ? 144  SER B O     1 
ATOM   2207 C  CB    . SER B 2 145 ? 6.925   54.321 46.008 1.00 28.41 ? 144  SER B CB    1 
ATOM   2208 O  OG    . SER B 2 145 ? 7.351   55.331 45.111 1.00 35.01 ? 144  SER B OG    1 
ATOM   2209 H  H     . SER B 2 145 ? 9.527   54.233 46.367 1.00 0.00  ? 144  SER B H     1 
ATOM   2210 H  HG    . SER B 2 145 ? 6.647   55.986 45.096 1.00 0.00  ? 144  SER B HG    1 
ATOM   2211 N  N     . ASN B 2 146 ? 9.020   52.513 43.869 1.00 31.07 ? 145  ASN B N     1 
ATOM   2212 C  CA    . ASN B 2 146 ? 9.205   51.929 42.532 1.00 27.37 ? 145  ASN B CA    1 
ATOM   2213 C  C     . ASN B 2 146 ? 9.568   50.483 42.672 1.00 26.18 ? 145  ASN B C     1 
ATOM   2214 O  O     . ASN B 2 146 ? 9.773   49.767 41.679 1.00 22.59 ? 145  ASN B O     1 
ATOM   2215 C  CB    . ASN B 2 146 ? 10.377  52.590 41.844 1.00 32.59 ? 145  ASN B CB    1 
ATOM   2216 C  CG    . ASN B 2 146 ? 10.089  53.991 41.485 1.00 38.27 ? 145  ASN B CG    1 
ATOM   2217 O  OD1   . ASN B 2 146 ? 9.829   54.827 42.358 1.00 45.00 ? 145  ASN B OD1   1 
ATOM   2218 N  ND2   . ASN B 2 146 ? 10.089  54.273 40.194 1.00 41.48 ? 145  ASN B ND2   1 
ATOM   2219 H  H     . ASN B 2 146 ? 9.779   52.976 44.284 1.00 0.00  ? 145  ASN B H     1 
ATOM   2220 H  HD21  . ASN B 2 146 ? 9.896   55.190 39.916 1.00 0.00  ? 145  ASN B HD21  1 
ATOM   2221 H  HD22  . ASN B 2 146 ? 10.285  53.547 39.574 1.00 0.00  ? 145  ASN B HD22  1 
ATOM   2222 N  N     . VAL B 2 147 ? 9.707   50.080 43.930 1.00 28.43 ? 146  VAL B N     1 
ATOM   2223 C  CA    . VAL B 2 147 ? 10.126  48.749 44.275 1.00 23.07 ? 146  VAL B CA    1 
ATOM   2224 C  C     . VAL B 2 147 ? 9.000   47.810 44.546 1.00 21.23 ? 146  VAL B C     1 
ATOM   2225 O  O     . VAL B 2 147 ? 8.050   48.152 45.240 1.00 14.94 ? 146  VAL B O     1 
ATOM   2226 C  CB    . VAL B 2 147 ? 11.113  48.768 45.491 1.00 21.32 ? 146  VAL B CB    1 
ATOM   2227 C  CG1   . VAL B 2 147 ? 11.321  47.370 46.063 1.00 17.59 ? 146  VAL B CG1   1 
ATOM   2228 C  CG2   . VAL B 2 147 ? 12.461  49.363 45.056 1.00 19.58 ? 146  VAL B CG2   1 
ATOM   2229 H  H     . VAL B 2 147 ? 9.521   50.686 44.670 1.00 0.00  ? 146  VAL B H     1 
ATOM   2230 N  N     . HIS B 2 148 ? 9.144   46.629 43.944 1.00 23.99 ? 147  HIS B N     1 
ATOM   2231 C  CA    . HIS B 2 148 ? 8.234   45.503 44.084 1.00 22.38 ? 147  HIS B CA    1 
ATOM   2232 C  C     . HIS B 2 148 ? 9.078   44.247 44.384 1.00 20.02 ? 147  HIS B C     1 
ATOM   2233 O  O     . HIS B 2 148 ? 9.994   43.885 43.637 1.00 19.85 ? 147  HIS B O     1 
ATOM   2234 C  CB    . HIS B 2 148 ? 7.403   45.283 42.805 1.00 19.50 ? 147  HIS B CB    1 
ATOM   2235 C  CG    . HIS B 2 148 ? 6.398   44.175 42.921 1.00 16.93 ? 147  HIS B CG    1 
ATOM   2236 N  ND1   . HIS B 2 148 ? 5.895   43.511 41.824 1.00 14.07 ? 147  HIS B ND1   1 
ATOM   2237 C  CD2   . HIS B 2 148 ? 5.799   43.621 44.006 1.00 15.37 ? 147  HIS B CD2   1 
ATOM   2238 C  CE1   . HIS B 2 148 ? 5.022   42.601 42.225 1.00 14.81 ? 147  HIS B CE1   1 
ATOM   2239 N  NE2   . HIS B 2 148 ? 4.946   42.647 43.544 1.00 13.13 ? 147  HIS B NE2   1 
ATOM   2240 H  H     . HIS B 2 148 ? 9.924   46.508 43.360 1.00 0.00  ? 147  HIS B H     1 
ATOM   2241 H  HD1   . HIS B 2 148 ? 6.107   43.708 40.886 1.00 0.00  ? 147  HIS B HD1   1 
ATOM   2242 H  HE2   . HIS B 2 148 ? 4.367   42.080 44.104 1.00 0.00  ? 147  HIS B HE2   1 
ATOM   2243 N  N     . VAL B 2 149 ? 8.776   43.628 45.513 1.00 17.32 ? 148  VAL B N     1 
ATOM   2244 C  CA    . VAL B 2 149 ? 9.431   42.406 45.932 1.00 16.84 ? 148  VAL B CA    1 
ATOM   2245 C  C     . VAL B 2 149 ? 8.406   41.263 45.869 1.00 17.34 ? 148  VAL B C     1 
ATOM   2246 O  O     . VAL B 2 149 ? 7.296   41.369 46.419 1.00 14.79 ? 148  VAL B O     1 
ATOM   2247 C  CB    . VAL B 2 149 ? 9.963   42.504 47.378 1.00 19.81 ? 148  VAL B CB    1 
ATOM   2248 C  CG1   . VAL B 2 149 ? 10.636  41.177 47.763 1.00 20.39 ? 148  VAL B CG1   1 
ATOM   2249 C  CG2   . VAL B 2 149 ? 10.932  43.687 47.519 1.00 15.00 ? 148  VAL B CG2   1 
ATOM   2250 H  H     . VAL B 2 149 ? 8.086   44.001 46.101 1.00 0.00  ? 148  VAL B H     1 
ATOM   2251 N  N     . ILE B 2 150 ? 8.764   40.209 45.151 1.00 16.82 ? 149  ILE B N     1 
ATOM   2252 C  CA    . ILE B 2 150 ? 7.923   39.034 44.989 1.00 20.61 ? 149  ILE B CA    1 
ATOM   2253 C  C     . ILE B 2 150 ? 8.686   37.955 45.752 1.00 22.77 ? 149  ILE B C     1 
ATOM   2254 O  O     . ILE B 2 150 ? 9.896   37.816 45.568 1.00 22.85 ? 149  ILE B O     1 
ATOM   2255 C  CB    . ILE B 2 150 ? 7.801   38.653 43.479 1.00 22.82 ? 149  ILE B CB    1 
ATOM   2256 C  CG1   . ILE B 2 150 ? 7.161   39.809 42.697 1.00 19.57 ? 149  ILE B CG1   1 
ATOM   2257 C  CG2   . ILE B 2 150 ? 7.043   37.313 43.294 1.00 15.18 ? 149  ILE B CG2   1 
ATOM   2258 C  CD1   . ILE B 2 150 ? 7.169   39.672 41.189 1.00 21.24 ? 149  ILE B CD1   1 
ATOM   2259 H  H     . ILE B 2 150 ? 9.648   40.176 44.739 1.00 0.00  ? 149  ILE B H     1 
ATOM   2260 N  N     . GLY B 2 151 ? 8.001   37.219 46.624 1.00 24.28 ? 150  GLY B N     1 
ATOM   2261 C  CA    . GLY B 2 151 ? 8.673   36.182 47.400 1.00 24.19 ? 150  GLY B CA    1 
ATOM   2262 C  C     . GLY B 2 151 ? 7.856   34.914 47.524 1.00 25.30 ? 150  GLY B C     1 
ATOM   2263 O  O     . GLY B 2 151 ? 6.680   34.947 47.901 1.00 28.70 ? 150  GLY B O     1 
ATOM   2264 H  H     . GLY B 2 151 ? 7.042   37.369 46.763 1.00 0.00  ? 150  GLY B H     1 
ATOM   2265 N  N     . HIS B 2 152 ? 8.479   33.787 47.218 1.00 19.38 ? 151  HIS B N     1 
ATOM   2266 C  CA    . HIS B 2 152 ? 7.803   32.514 47.273 1.00 18.26 ? 151  HIS B CA    1 
ATOM   2267 C  C     . HIS B 2 152 ? 8.162   31.764 48.536 1.00 16.19 ? 151  HIS B C     1 
ATOM   2268 O  O     . HIS B 2 152 ? 9.331   31.568 48.822 1.00 17.72 ? 151  HIS B O     1 
ATOM   2269 C  CB    . HIS B 2 152 ? 8.185   31.677 46.051 1.00 17.15 ? 151  HIS B CB    1 
ATOM   2270 C  CG    . HIS B 2 152 ? 7.593   30.303 46.055 1.00 19.48 ? 151  HIS B CG    1 
ATOM   2271 N  ND1   . HIS B 2 152 ? 8.364   29.161 46.125 1.00 26.01 ? 151  HIS B ND1   1 
ATOM   2272 C  CD2   . HIS B 2 152 ? 6.306   29.886 46.010 1.00 19.96 ? 151  HIS B CD2   1 
ATOM   2273 C  CE1   . HIS B 2 152 ? 7.577   28.102 46.126 1.00 25.59 ? 151  HIS B CE1   1 
ATOM   2274 N  NE2   . HIS B 2 152 ? 6.323   28.516 46.059 1.00 25.34 ? 151  HIS B NE2   1 
ATOM   2275 H  H     . HIS B 2 152 ? 9.429   33.836 46.968 1.00 0.00  ? 151  HIS B H     1 
ATOM   2276 H  HD1   . HIS B 2 152 ? 9.362   29.162 46.136 1.00 0.00  ? 151  HIS B HD1   1 
ATOM   2277 H  HE2   . HIS B 2 152 ? 5.503   27.965 45.951 1.00 0.00  ? 151  HIS B HE2   1 
ATOM   2278 N  N     . SER B 2 153 ? 7.154   31.291 49.258 1.00 17.63 ? 152  SER B N     1 
ATOM   2279 C  CA    . SER B 2 153 ? 7.352   30.530 50.502 1.00 19.38 ? 152  SER B CA    1 
ATOM   2280 C  C     . SER B 2 153 ? 8.135   31.342 51.533 1.00 23.70 ? 152  SER B C     1 
ATOM   2281 O  O     . SER B 2 153 ? 7.664   32.402 51.995 1.00 26.08 ? 152  SER B O     1 
ATOM   2282 C  CB    . SER B 2 153 ? 8.012   29.162 50.226 1.00 10.47 ? 152  SER B CB    1 
ATOM   2283 O  OG    . SER B 2 153 ? 7.627   28.149 51.136 1.00 21.74 ? 152  SER B OG    1 
ATOM   2284 H  H     . SER B 2 153 ? 6.228   31.459 48.970 1.00 0.00  ? 152  SER B H     1 
ATOM   2285 N  N     . LEU B 2 154 ? 9.323   30.857 51.895 1.00 26.24 ? 153  LEU B N     1 
ATOM   2286 C  CA    . LEU B 2 154 ? 10.178  31.520 52.878 1.00 24.28 ? 153  LEU B CA    1 
ATOM   2287 C  C     . LEU B 2 154 ? 10.511  32.936 52.388 1.00 23.59 ? 153  LEU B C     1 
ATOM   2288 O  O     . LEU B 2 154 ? 10.558  33.895 53.164 1.00 22.63 ? 153  LEU B O     1 
ATOM   2289 C  CB    . LEU B 2 154 ? 11.436  30.683 53.073 1.00 22.31 ? 153  LEU B CB    1 
ATOM   2290 C  CG    . LEU B 2 154 ? 11.725  30.195 54.490 1.00 23.80 ? 153  LEU B CG    1 
ATOM   2291 C  CD1   . LEU B 2 154 ? 10.489  29.690 55.187 1.00 20.89 ? 153  LEU B CD1   1 
ATOM   2292 C  CD2   . LEU B 2 154 ? 12.785  29.115 54.408 1.00 26.48 ? 153  LEU B CD2   1 
ATOM   2293 H  H     . LEU B 2 154 ? 9.689   30.062 51.491 1.00 0.00  ? 153  LEU B H     1 
ATOM   2294 N  N     . GLY B 2 155 ? 10.636  33.055 51.071 1.00 20.62 ? 154  GLY B N     1 
ATOM   2295 C  CA    . GLY B 2 155 ? 10.920  34.331 50.446 1.00 21.99 ? 154  GLY B CA    1 
ATOM   2296 C  C     . GLY B 2 155 ? 9.818   35.345 50.668 1.00 20.76 ? 154  GLY B C     1 
ATOM   2297 O  O     . GLY B 2 155 ? 10.086  36.533 50.578 1.00 24.99 ? 154  GLY B O     1 
ATOM   2298 H  H     . GLY B 2 155 ? 10.545  32.285 50.476 1.00 0.00  ? 154  GLY B H     1 
ATOM   2299 N  N     . ALA B 2 156 ? 8.598   34.896 50.981 1.00 20.00 ? 155  ALA B N     1 
ATOM   2300 C  CA    . ALA B 2 156 ? 7.476   35.809 51.223 1.00 10.26 ? 155  ALA B CA    1 
ATOM   2301 C  C     . ALA B 2 156 ? 7.704   36.509 52.521 1.00 16.56 ? 155  ALA B C     1 
ATOM   2302 O  O     . ALA B 2 156 ? 7.303   37.657 52.699 1.00 18.92 ? 155  ALA B O     1 
ATOM   2303 C  CB    . ALA B 2 156 ? 6.176   35.063 51.289 1.00 14.83 ? 155  ALA B CB    1 
ATOM   2304 H  H     . ALA B 2 156 ? 8.428   33.933 51.038 1.00 0.00  ? 155  ALA B H     1 
ATOM   2305 N  N     . HIS B 2 157 ? 8.340   35.805 53.449 1.00 17.31 ? 156  HIS B N     1 
ATOM   2306 C  CA    . HIS B 2 157 ? 8.627   36.388 54.751 1.00 19.27 ? 156  HIS B CA    1 
ATOM   2307 C  C     . HIS B 2 157 ? 9.925   37.194 54.743 1.00 19.23 ? 156  HIS B C     1 
ATOM   2308 O  O     . HIS B 2 157 ? 10.076  38.126 55.527 1.00 22.86 ? 156  HIS B O     1 
ATOM   2309 C  CB    . HIS B 2 157 ? 8.630   35.310 55.824 1.00 18.75 ? 156  HIS B CB    1 
ATOM   2310 C  CG    . HIS B 2 157 ? 7.321   34.587 55.944 1.00 16.99 ? 156  HIS B CG    1 
ATOM   2311 N  ND1   . HIS B 2 157 ? 6.138   35.234 56.225 1.00 20.12 ? 156  HIS B ND1   1 
ATOM   2312 C  CD2   . HIS B 2 157 ? 7.004   33.282 55.785 1.00 15.27 ? 156  HIS B CD2   1 
ATOM   2313 C  CE1   . HIS B 2 157 ? 5.146   34.362 56.234 1.00 17.93 ? 156  HIS B CE1   1 
ATOM   2314 N  NE2   . HIS B 2 157 ? 5.648   33.169 55.969 1.00 21.21 ? 156  HIS B NE2   1 
ATOM   2315 H  H     . HIS B 2 157 ? 8.631   34.891 53.250 1.00 0.00  ? 156  HIS B H     1 
ATOM   2316 H  HD1   . HIS B 2 157 ? 6.069   36.201 56.336 1.00 0.00  ? 156  HIS B HD1   1 
ATOM   2317 H  HE2   . HIS B 2 157 ? 5.135   32.317 55.974 1.00 0.00  ? 156  HIS B HE2   1 
ATOM   2318 N  N     . ALA B 2 158 ? 10.861  36.824 53.869 1.00 15.18 ? 157  ALA B N     1 
ATOM   2319 C  CA    . ALA B 2 158 ? 12.115  37.551 53.727 1.00 8.81  ? 157  ALA B CA    1 
ATOM   2320 C  C     . ALA B 2 158 ? 11.727  38.920 53.124 1.00 16.96 ? 157  ALA B C     1 
ATOM   2321 O  O     . ALA B 2 158 ? 12.235  39.982 53.539 1.00 12.96 ? 157  ALA B O     1 
ATOM   2322 C  CB    . ALA B 2 158 ? 13.024  36.812 52.827 1.00 3.27  ? 157  ALA B CB    1 
ATOM   2323 H  H     . ALA B 2 158 ? 10.700  36.024 53.325 1.00 0.00  ? 157  ALA B H     1 
ATOM   2324 N  N     . ALA B 2 159 ? 10.761  38.890 52.197 1.00 20.78 ? 158  ALA B N     1 
ATOM   2325 C  CA    . ALA B 2 159 ? 10.219  40.111 51.568 1.00 21.71 ? 158  ALA B CA    1 
ATOM   2326 C  C     . ALA B 2 159 ? 9.519   40.982 52.635 1.00 22.08 ? 158  ALA B C     1 
ATOM   2327 O  O     . ALA B 2 159 ? 9.581   42.214 52.582 1.00 22.31 ? 158  ALA B O     1 
ATOM   2328 C  CB    . ALA B 2 159 ? 9.236   39.748 50.456 1.00 18.64 ? 158  ALA B CB    1 
ATOM   2329 H  H     . ALA B 2 159 ? 10.412  38.028 51.881 1.00 0.00  ? 158  ALA B H     1 
ATOM   2330 N  N     . GLY B 2 160 ? 8.882   40.330 53.609 1.00 19.50 ? 159  GLY B N     1 
ATOM   2331 C  CA    . GLY B 2 160 ? 8.228   41.045 54.682 1.00 16.93 ? 159  GLY B CA    1 
ATOM   2332 C  C     . GLY B 2 160 ? 9.235   41.590 55.684 1.00 24.00 ? 159  GLY B C     1 
ATOM   2333 O  O     . GLY B 2 160 ? 8.953   42.542 56.423 1.00 29.64 ? 159  GLY B O     1 
ATOM   2334 H  H     . GLY B 2 160 ? 8.839   39.354 53.565 1.00 0.00  ? 159  GLY B H     1 
ATOM   2335 N  N     . GLU B 2 161 ? 10.391  40.945 55.777 1.00 26.89 ? 160  GLU B N     1 
ATOM   2336 C  CA    . GLU B 2 161 ? 11.444  41.391 56.693 1.00 27.60 ? 160  GLU B CA    1 
ATOM   2337 C  C     . GLU B 2 161 ? 12.107  42.628 56.070 1.00 29.24 ? 160  GLU B C     1 
ATOM   2338 O  O     . GLU B 2 161 ? 12.399  43.613 56.770 1.00 25.08 ? 160  GLU B O     1 
ATOM   2339 C  CB    . GLU B 2 161 ? 12.462  40.265 56.932 1.00 26.73 ? 160  GLU B CB    1 
ATOM   2340 C  CG    . GLU B 2 161 ? 13.771  40.695 57.607 1.00 27.87 ? 160  GLU B CG    1 
ATOM   2341 C  CD    . GLU B 2 161 ? 13.608  41.308 58.997 1.00 26.86 ? 160  GLU B CD    1 
ATOM   2342 O  OE1   . GLU B 2 161 ? 12.551  41.120 59.625 1.00 29.53 ? 160  GLU B OE1   1 
ATOM   2343 O  OE2   . GLU B 2 161 ? 14.554  41.982 59.468 1.00 23.02 ? 160  GLU B OE2   1 
ATOM   2344 H  H     . GLU B 2 161 ? 10.525  40.133 55.258 1.00 0.00  ? 160  GLU B H     1 
ATOM   2345 N  N     . ALA B 2 162 ? 12.258  42.587 54.742 1.00 27.67 ? 161  ALA B N     1 
ATOM   2346 C  CA    . ALA B 2 162 ? 12.829  43.680 53.965 1.00 25.01 ? 161  ALA B CA    1 
ATOM   2347 C  C     . ALA B 2 162 ? 11.906  44.914 53.985 1.00 26.09 ? 161  ALA B C     1 
ATOM   2348 O  O     . ALA B 2 162 ? 12.366  46.061 53.791 1.00 26.45 ? 161  ALA B O     1 
ATOM   2349 C  CB    . ALA B 2 162 ? 13.082  43.219 52.536 1.00 20.18 ? 161  ALA B CB    1 
ATOM   2350 H  H     . ALA B 2 162 ? 11.971  41.785 54.265 1.00 0.00  ? 161  ALA B H     1 
ATOM   2351 N  N     . GLY B 2 163 ? 10.609  44.684 54.205 1.00 23.57 ? 162  GLY B N     1 
ATOM   2352 C  CA    . GLY B 2 163 ? 9.653   45.787 54.248 1.00 22.37 ? 162  GLY B CA    1 
ATOM   2353 C  C     . GLY B 2 163 ? 9.570   46.397 55.641 1.00 23.57 ? 162  GLY B C     1 
ATOM   2354 O  O     . GLY B 2 163 ? 9.297   47.591 55.814 1.00 25.29 ? 162  GLY B O     1 
ATOM   2355 H  H     . GLY B 2 163 ? 10.301  43.762 54.293 1.00 0.00  ? 162  GLY B H     1 
ATOM   2356 N  N     . ARG B 2 164 ? 9.790   45.569 56.650 1.00 23.47 ? 163  ARG B N     1 
ATOM   2357 C  CA    . ARG B 2 164 ? 9.766   46.029 58.021 1.00 25.83 ? 163  ARG B CA    1 
ATOM   2358 C  C     . ARG B 2 164 ? 10.865  47.088 58.143 1.00 30.04 ? 163  ARG B C     1 
ATOM   2359 O  O     . ARG B 2 164 ? 10.621  48.242 58.517 1.00 31.33 ? 163  ARG B O     1 
ATOM   2360 C  CB    . ARG B 2 164 ? 10.107  44.855 58.939 1.00 26.49 ? 163  ARG B CB    1 
ATOM   2361 C  CG    . ARG B 2 164 ? 9.700   45.037 60.400 1.00 24.78 ? 163  ARG B CG    1 
ATOM   2362 C  CD    . ARG B 2 164 ? 10.506  44.115 61.291 1.00 24.92 ? 163  ARG B CD    1 
ATOM   2363 N  NE    . ARG B 2 164 ? 11.738  44.781 61.701 1.00 27.64 ? 163  ARG B NE    1 
ATOM   2364 C  CZ    . ARG B 2 164 ? 12.920  44.197 61.838 1.00 29.09 ? 163  ARG B CZ    1 
ATOM   2365 N  NH1   . ARG B 2 164 ? 13.073  42.899 61.634 1.00 33.87 ? 163  ARG B NH1   1 
ATOM   2366 N  NH2   . ARG B 2 164 ? 13.954  44.923 62.216 1.00 36.34 ? 163  ARG B NH2   1 
ATOM   2367 H  H     . ARG B 2 164 ? 9.979   44.631 56.453 1.00 0.00  ? 163  ARG B H     1 
ATOM   2368 H  HE    . ARG B 2 164 ? 11.673  45.737 61.896 1.00 0.00  ? 163  ARG B HE    1 
ATOM   2369 H  HH11  . ARG B 2 164 ? 12.282  42.347 61.376 1.00 0.00  ? 163  ARG B HH11  1 
ATOM   2370 H  HH12  . ARG B 2 164 ? 13.972  42.471 61.746 1.00 0.00  ? 163  ARG B HH12  1 
ATOM   2371 H  HH21  . ARG B 2 164 ? 13.837  45.897 62.406 1.00 0.00  ? 163  ARG B HH21  1 
ATOM   2372 H  HH22  . ARG B 2 164 ? 14.850  44.497 62.334 1.00 0.00  ? 163  ARG B HH22  1 
ATOM   2373 N  N     . ARG B 2 165 ? 12.070  46.684 57.754 1.00 29.07 ? 164  ARG B N     1 
ATOM   2374 C  CA    . ARG B 2 165 ? 13.263  47.512 57.807 1.00 26.13 ? 164  ARG B CA    1 
ATOM   2375 C  C     . ARG B 2 165 ? 13.213  48.801 56.938 1.00 30.45 ? 164  ARG B C     1 
ATOM   2376 O  O     . ARG B 2 165 ? 13.992  49.741 57.142 1.00 32.24 ? 164  ARG B O     1 
ATOM   2377 C  CB    . ARG B 2 165 ? 14.468  46.623 57.497 1.00 24.65 ? 164  ARG B CB    1 
ATOM   2378 C  CG    . ARG B 2 165 ? 14.419  45.322 58.326 1.00 29.41 ? 164  ARG B CG    1 
ATOM   2379 C  CD    . ARG B 2 165 ? 15.544  44.343 58.028 1.00 31.12 ? 164  ARG B CD    1 
ATOM   2380 N  NE    . ARG B 2 165 ? 16.781  44.734 58.694 1.00 34.50 ? 164  ARG B NE    1 
ATOM   2381 C  CZ    . ARG B 2 165 ? 17.554  43.916 59.395 1.00 32.98 ? 164  ARG B CZ    1 
ATOM   2382 N  NH1   . ARG B 2 165 ? 17.252  42.635 59.527 1.00 36.37 ? 164  ARG B NH1   1 
ATOM   2383 N  NH2   . ARG B 2 165 ? 18.642  44.386 59.947 1.00 29.06 ? 164  ARG B NH2   1 
ATOM   2384 H  H     . ARG B 2 165 ? 12.148  45.768 57.402 1.00 0.00  ? 164  ARG B H     1 
ATOM   2385 H  HE    . ARG B 2 165 ? 17.055  45.671 58.619 1.00 0.00  ? 164  ARG B HE    1 
ATOM   2386 H  HH11  . ARG B 2 165 ? 16.448  42.256 59.073 1.00 0.00  ? 164  ARG B HH11  1 
ATOM   2387 H  HH12  . ARG B 2 165 ? 17.857  42.035 60.054 1.00 0.00  ? 164  ARG B HH12  1 
ATOM   2388 H  HH21  . ARG B 2 165 ? 18.872  45.352 59.834 1.00 0.00  ? 164  ARG B HH21  1 
ATOM   2389 H  HH22  . ARG B 2 165 ? 19.254  43.790 60.468 1.00 0.00  ? 164  ARG B HH22  1 
ATOM   2390 N  N     . THR B 2 166 ? 12.315  48.853 55.963 1.00 27.18 ? 165  THR B N     1 
ATOM   2391 C  CA    . THR B 2 166 ? 12.191  50.065 55.181 1.00 27.09 ? 165  THR B CA    1 
ATOM   2392 C  C     . THR B 2 166 ? 10.922  50.768 55.618 1.00 28.61 ? 165  THR B C     1 
ATOM   2393 O  O     . THR B 2 166 ? 10.415  51.610 54.902 1.00 32.25 ? 165  THR B O     1 
ATOM   2394 C  CB    . THR B 2 166 ? 12.150  49.826 53.664 1.00 27.22 ? 165  THR B CB    1 
ATOM   2395 O  OG1   . THR B 2 166 ? 11.030  48.996 53.328 1.00 33.56 ? 165  THR B OG1   1 
ATOM   2396 C  CG2   . THR B 2 166 ? 13.432  49.190 53.187 1.00 32.58 ? 165  THR B CG2   1 
ATOM   2397 H  H     . THR B 2 166 ? 11.756  48.088 55.724 1.00 0.00  ? 165  THR B H     1 
ATOM   2398 H  HG1   . THR B 2 166 ? 10.219  49.428 53.588 1.00 0.00  ? 165  THR B HG1   1 
ATOM   2399 N  N     . ASN B 2 167 ? 10.379  50.369 56.769 1.00 32.83 ? 166  ASN B N     1 
ATOM   2400 C  CA    . ASN B 2 167 ? 9.173   50.986 57.325 1.00 35.47 ? 166  ASN B CA    1 
ATOM   2401 C  C     . ASN B 2 167 ? 8.000   51.091 56.370 1.00 31.99 ? 166  ASN B C     1 
ATOM   2402 O  O     . ASN B 2 167 ? 7.439   52.177 56.201 1.00 31.37 ? 166  ASN B O     1 
ATOM   2403 C  CB    . ASN B 2 167 ? 9.481   52.393 57.851 1.00 40.51 ? 166  ASN B CB    1 
ATOM   2404 C  CG    . ASN B 2 167 ? 10.058  52.379 59.232 1.00 45.53 ? 166  ASN B CG    1 
ATOM   2405 O  OD1   . ASN B 2 167 ? 9.341   52.591 60.212 1.00 51.49 ? 166  ASN B OD1   1 
ATOM   2406 N  ND2   . ASN B 2 167 ? 11.361  52.120 59.333 1.00 47.40 ? 166  ASN B ND2   1 
ATOM   2407 H  H     . ASN B 2 167 ? 10.800  49.643 57.266 1.00 0.00  ? 166  ASN B H     1 
ATOM   2408 H  HD21  . ASN B 2 167 ? 11.717  52.075 60.250 1.00 0.00  ? 166  ASN B HD21  1 
ATOM   2409 H  HD22  . ASN B 2 167 ? 11.906  51.968 58.535 1.00 0.00  ? 166  ASN B HD22  1 
ATOM   2410 N  N     . GLY B 2 168 ? 7.680   49.987 55.704 1.00 30.03 ? 167  GLY B N     1 
ATOM   2411 C  CA    . GLY B 2 168 ? 6.549   49.950 54.777 1.00 28.17 ? 167  GLY B CA    1 
ATOM   2412 C  C     . GLY B 2 168 ? 6.525   50.957 53.637 1.00 28.83 ? 167  GLY B C     1 
ATOM   2413 O  O     . GLY B 2 168 ? 5.448   51.280 53.129 1.00 30.04 ? 167  GLY B O     1 
ATOM   2414 H  H     . GLY B 2 168 ? 8.215   49.180 55.843 1.00 0.00  ? 167  GLY B H     1 
ATOM   2415 N  N     . THR B 2 169 ? 7.697   51.451 53.233 1.00 25.98 ? 168  THR B N     1 
ATOM   2416 C  CA    . THR B 2 169 ? 7.788   52.416 52.147 1.00 24.57 ? 168  THR B CA    1 
ATOM   2417 C  C     . THR B 2 169 ? 7.936   51.765 50.761 1.00 23.08 ? 168  THR B C     1 
ATOM   2418 O  O     . THR B 2 169 ? 7.737   52.428 49.735 1.00 24.95 ? 168  THR B O     1 
ATOM   2419 C  CB    . THR B 2 169 ? 8.907   53.432 52.396 1.00 28.87 ? 168  THR B CB    1 
ATOM   2420 O  OG1   . THR B 2 169 ? 10.192  52.782 52.329 1.00 31.92 ? 168  THR B OG1   1 
ATOM   2421 C  CG2   . THR B 2 169 ? 8.723   54.076 53.767 1.00 24.86 ? 168  THR B CG2   1 
ATOM   2422 H  H     . THR B 2 169 ? 8.528   51.187 53.670 1.00 0.00  ? 168  THR B H     1 
ATOM   2423 H  HG1   . THR B 2 169 ? 10.485  52.607 53.234 1.00 0.00  ? 168  THR B HG1   1 
ATOM   2424 N  N     . ILE B 2 170 ? 8.322   50.489 50.718 1.00 18.20 ? 169  ILE B N     1 
ATOM   2425 C  CA    . ILE B 2 170 ? 8.411   49.764 49.449 1.00 17.23 ? 169  ILE B CA    1 
ATOM   2426 C  C     . ILE B 2 170 ? 6.978   49.717 48.790 1.00 21.38 ? 169  ILE B C     1 
ATOM   2427 O  O     . ILE B 2 170 ? 5.947   49.547 49.482 1.00 15.96 ? 169  ILE B O     1 
ATOM   2428 C  CB    . ILE B 2 170 ? 8.953   48.344 49.721 1.00 17.79 ? 169  ILE B CB    1 
ATOM   2429 C  CG1   . ILE B 2 170 ? 10.426  48.433 50.084 1.00 23.31 ? 169  ILE B CG1   1 
ATOM   2430 C  CG2   . ILE B 2 170 ? 8.694   47.379 48.548 1.00 17.86 ? 169  ILE B CG2   1 
ATOM   2431 C  CD1   . ILE B 2 170 ? 11.060  47.110 50.512 1.00 21.36 ? 169  ILE B CD1   1 
ATOM   2432 H  H     . ILE B 2 170 ? 8.557   50.033 51.542 1.00 0.00  ? 169  ILE B H     1 
ATOM   2433 N  N     . GLY B 2 171 ? 6.927   49.870 47.467 1.00 19.06 ? 170  GLY B N     1 
ATOM   2434 C  CA    . GLY B 2 171 ? 5.659   49.860 46.734 1.00 20.32 ? 170  GLY B CA    1 
ATOM   2435 C  C     . GLY B 2 171 ? 4.752   48.690 47.038 1.00 17.40 ? 170  GLY B C     1 
ATOM   2436 O  O     . GLY B 2 171 ? 3.618   48.884 47.412 1.00 17.12 ? 170  GLY B O     1 
ATOM   2437 H  H     . GLY B 2 171 ? 7.767   49.995 46.981 1.00 0.00  ? 170  GLY B H     1 
ATOM   2438 N  N     . ARG B 2 172 ? 5.222   47.476 46.784 1.00 20.86 ? 171  ARG B N     1 
ATOM   2439 C  CA    . ARG B 2 172 ? 4.461   46.290 47.113 1.00 17.18 ? 171  ARG B CA    1 
ATOM   2440 C  C     . ARG B 2 172 ? 5.232   45.008 47.243 1.00 19.38 ? 171  ARG B C     1 
ATOM   2441 O  O     . ARG B 2 172 ? 6.354   44.832 46.736 1.00 17.30 ? 171  ARG B O     1 
ATOM   2442 C  CB    . ARG B 2 172 ? 3.270   46.070 46.183 1.00 21.48 ? 171  ARG B CB    1 
ATOM   2443 C  CG    . ARG B 2 172 ? 3.525   45.506 44.804 1.00 14.71 ? 171  ARG B CG    1 
ATOM   2444 C  CD    . ARG B 2 172 ? 2.318   44.663 44.391 1.00 15.44 ? 171  ARG B CD    1 
ATOM   2445 N  NE    . ARG B 2 172 ? 2.185   44.599 42.945 1.00 22.60 ? 171  ARG B NE    1 
ATOM   2446 C  CZ    . ARG B 2 172 ? 1.579   43.622 42.267 1.00 20.86 ? 171  ARG B CZ    1 
ATOM   2447 N  NH1   . ARG B 2 172 ? 1.051   42.587 42.901 1.00 16.01 ? 171  ARG B NH1   1 
ATOM   2448 N  NH2   . ARG B 2 172 ? 1.520   43.682 40.937 1.00 16.91 ? 171  ARG B NH2   1 
ATOM   2449 H  H     . ARG B 2 172 ? 6.099   47.390 46.359 1.00 0.00  ? 171  ARG B H     1 
ATOM   2450 H  HE    . ARG B 2 172 ? 2.574   45.342 42.437 1.00 0.00  ? 171  ARG B HE    1 
ATOM   2451 H  HH11  . ARG B 2 172 ? 1.106   42.542 43.897 1.00 0.00  ? 171  ARG B HH11  1 
ATOM   2452 H  HH12  . ARG B 2 172 ? 0.592   41.858 42.390 1.00 0.00  ? 171  ARG B HH12  1 
ATOM   2453 H  HH21  . ARG B 2 172 ? 1.919   44.445 40.428 1.00 0.00  ? 171  ARG B HH21  1 
ATOM   2454 H  HH22  . ARG B 2 172 ? 1.063   42.937 40.450 1.00 0.00  ? 171  ARG B HH22  1 
ATOM   2455 N  N     . ILE B 2 173 ? 4.601   44.097 47.954 1.00 21.97 ? 172  ILE B N     1 
ATOM   2456 C  CA    . ILE B 2 173 ? 5.151   42.776 48.168 1.00 21.35 ? 172  ILE B CA    1 
ATOM   2457 C  C     . ILE B 2 173 ? 4.043   41.846 47.731 1.00 20.44 ? 172  ILE B C     1 
ATOM   2458 O  O     . ILE B 2 173 ? 2.845   42.161 47.849 1.00 21.71 ? 172  ILE B O     1 
ATOM   2459 C  CB    . ILE B 2 173 ? 5.483   42.517 49.658 1.00 19.98 ? 172  ILE B CB    1 
ATOM   2460 C  CG1   . ILE B 2 173 ? 6.765   43.251 50.047 1.00 16.30 ? 172  ILE B CG1   1 
ATOM   2461 C  CG2   . ILE B 2 173 ? 5.574   41.008 49.948 1.00 17.76 ? 172  ILE B CG2   1 
ATOM   2462 C  CD1   . ILE B 2 173 ? 6.938   43.423 51.535 1.00 18.25 ? 172  ILE B CD1   1 
ATOM   2463 H  H     . ILE B 2 173 ? 3.710   44.294 48.324 1.00 0.00  ? 172  ILE B H     1 
ATOM   2464 N  N     . THR B 2 174 ? 4.454   40.734 47.151 1.00 20.38 ? 173  THR B N     1 
ATOM   2465 C  CA    . THR B 2 174 ? 3.535   39.722 46.712 1.00 15.99 ? 173  THR B CA    1 
ATOM   2466 C  C     . THR B 2 174 ? 4.023   38.469 47.358 1.00 14.36 ? 173  THR B C     1 
ATOM   2467 O  O     . THR B 2 174 ? 5.152   38.049 47.097 1.00 21.45 ? 173  THR B O     1 
ATOM   2468 C  CB    . THR B 2 174 ? 3.606   39.548 45.217 1.00 17.00 ? 173  THR B CB    1 
ATOM   2469 O  OG1   . THR B 2 174 ? 3.172   40.764 44.605 1.00 16.17 ? 173  THR B OG1   1 
ATOM   2470 C  CG2   . THR B 2 174 ? 2.713   38.382 44.760 1.00 13.76 ? 173  THR B CG2   1 
ATOM   2471 H  H     . THR B 2 174 ? 5.421   40.591 47.030 1.00 0.00  ? 173  THR B H     1 
ATOM   2472 H  HG1   . THR B 2 174 ? 2.246   40.854 44.865 1.00 0.00  ? 173  THR B HG1   1 
ATOM   2473 N  N     . GLY B 2 175 ? 3.229   37.926 48.271 1.00 11.75 ? 174  GLY B N     1 
ATOM   2474 C  CA    . GLY B 2 175 ? 3.617   36.682 48.904 1.00 15.86 ? 174  GLY B CA    1 
ATOM   2475 C  C     . GLY B 2 175 ? 3.020   35.537 48.093 1.00 21.04 ? 174  GLY B C     1 
ATOM   2476 O  O     . GLY B 2 175 ? 1.793   35.512 47.905 1.00 21.54 ? 174  GLY B O     1 
ATOM   2477 H  H     . GLY B 2 175 ? 2.368   38.355 48.476 1.00 0.00  ? 174  GLY B H     1 
ATOM   2478 N  N     . LEU B 2 176 ? 3.869   34.677 47.515 1.00 18.46 ? 175  LEU B N     1 
ATOM   2479 C  CA    . LEU B 2 176 ? 3.418   33.512 46.731 1.00 17.43 ? 175  LEU B CA    1 
ATOM   2480 C  C     . LEU B 2 176 ? 3.481   32.300 47.657 1.00 18.18 ? 175  LEU B C     1 
ATOM   2481 O  O     . LEU B 2 176 ? 4.559   31.787 47.941 1.00 20.71 ? 175  LEU B O     1 
ATOM   2482 C  CB    . LEU B 2 176 ? 4.321   33.307 45.529 1.00 16.84 ? 175  LEU B CB    1 
ATOM   2483 C  CG    . LEU B 2 176 ? 4.347   34.479 44.548 1.00 19.23 ? 175  LEU B CG    1 
ATOM   2484 C  CD1   . LEU B 2 176 ? 5.330   34.146 43.432 1.00 20.82 ? 175  LEU B CD1   1 
ATOM   2485 C  CD2   . LEU B 2 176 ? 2.964   34.735 43.959 1.00 20.33 ? 175  LEU B CD2   1 
ATOM   2486 H  H     . LEU B 2 176 ? 4.830   34.822 47.621 1.00 0.00  ? 175  LEU B H     1 
ATOM   2487 N  N     . ASP B 2 177 ? 2.318   31.905 48.171 1.00 18.04 ? 176  ASP B N     1 
ATOM   2488 C  CA    . ASP B 2 177 ? 2.155   30.829 49.143 1.00 15.90 ? 176  ASP B CA    1 
ATOM   2489 C  C     . ASP B 2 177 ? 3.158   30.896 50.283 1.00 17.79 ? 176  ASP B C     1 
ATOM   2490 O  O     . ASP B 2 177 ? 4.057   30.058 50.388 1.00 21.73 ? 176  ASP B O     1 
ATOM   2491 C  CB    . ASP B 2 177 ? 2.145   29.440 48.505 1.00 17.33 ? 176  ASP B CB    1 
ATOM   2492 C  CG    . ASP B 2 177 ? 1.281   28.447 49.289 1.00 18.54 ? 176  ASP B CG    1 
ATOM   2493 O  OD1   . ASP B 2 177 ? 0.164   28.817 49.717 1.00 18.22 ? 176  ASP B OD1   1 
ATOM   2494 O  OD2   . ASP B 2 177 ? 1.704   27.292 49.471 1.00 14.92 ? 176  ASP B OD2   1 
ATOM   2495 H  H     . ASP B 2 177 ? 1.516   32.383 47.878 1.00 0.00  ? 176  ASP B H     1 
ATOM   2496 N  N     . PRO B 2 178 ? 3.030   31.919 51.144 1.00 20.68 ? 177  PRO B N     1 
ATOM   2497 C  CA    . PRO B 2 178 ? 3.899   32.140 52.301 1.00 16.46 ? 177  PRO B CA    1 
ATOM   2498 C  C     . PRO B 2 178 ? 3.988   30.858 53.081 1.00 17.75 ? 177  PRO B C     1 
ATOM   2499 O  O     . PRO B 2 178 ? 2.978   30.214 53.307 1.00 22.08 ? 177  PRO B O     1 
ATOM   2500 C  CB    . PRO B 2 178 ? 3.120   33.172 53.105 1.00 22.16 ? 177  PRO B CB    1 
ATOM   2501 C  CG    . PRO B 2 178 ? 2.509   34.017 52.047 1.00 24.66 ? 177  PRO B CG    1 
ATOM   2502 C  CD    . PRO B 2 178 ? 2.019   32.992 51.038 1.00 24.06 ? 177  PRO B CD    1 
ATOM   2503 N  N     . ALA B 2 179 ? 5.189   30.473 53.484 1.00 19.52 ? 178  ALA B N     1 
ATOM   2504 C  CA    . ALA B 2 179 ? 5.368   29.248 54.262 1.00 17.23 ? 178  ALA B CA    1 
ATOM   2505 C  C     . ALA B 2 179 ? 4.533   29.345 55.530 1.00 18.15 ? 178  ALA B C     1 
ATOM   2506 O  O     . ALA B 2 179 ? 4.397   30.434 56.079 1.00 26.62 ? 178  ALA B O     1 
ATOM   2507 C  CB    . ALA B 2 179 ? 6.841   29.083 54.636 1.00 13.69 ? 178  ALA B CB    1 
ATOM   2508 H  H     . ALA B 2 179 ? 5.958   31.017 53.230 1.00 0.00  ? 178  ALA B H     1 
ATOM   2509 N  N     . GLU B 2 180 ? 3.981   28.226 55.993 1.00 16.77 ? 179  GLU B N     1 
ATOM   2510 C  CA    . GLU B 2 180 ? 3.200   28.184 57.232 1.00 18.25 ? 179  GLU B CA    1 
ATOM   2511 C  C     . GLU B 2 180 ? 4.010   27.946 58.544 1.00 22.33 ? 179  GLU B C     1 
ATOM   2512 O  O     . GLU B 2 180 ? 3.966   28.785 59.460 1.00 17.78 ? 179  GLU B O     1 
ATOM   2513 C  CB    . GLU B 2 180 ? 2.105   27.110 57.150 1.00 21.79 ? 179  GLU B CB    1 
ATOM   2514 C  CG    . GLU B 2 180 ? 1.436   26.894 58.490 1.00 26.56 ? 179  GLU B CG    1 
ATOM   2515 C  CD    . GLU B 2 180 ? 0.479   25.732 58.539 1.00 31.49 ? 179  GLU B CD    1 
ATOM   2516 O  OE1   . GLU B 2 180 ? -0.635  25.866 57.980 1.00 35.74 ? 179  GLU B OE1   1 
ATOM   2517 O  OE2   . GLU B 2 180 ? 0.817   24.718 59.199 1.00 30.83 ? 179  GLU B OE2   1 
ATOM   2518 H  H     . GLU B 2 180 ? 4.122   27.424 55.447 1.00 0.00  ? 179  GLU B H     1 
ATOM   2519 N  N     . PRO B 2 181 ? 4.757   26.808 58.649 1.00 23.34 ? 180  PRO B N     1 
ATOM   2520 C  CA    . PRO B 2 181 ? 5.542   26.482 59.857 1.00 26.71 ? 180  PRO B CA    1 
ATOM   2521 C  C     . PRO B 2 181 ? 6.471   27.605 60.289 1.00 26.63 ? 180  PRO B C     1 
ATOM   2522 O  O     . PRO B 2 181 ? 7.191   28.164 59.478 1.00 31.12 ? 180  PRO B O     1 
ATOM   2523 C  CB    . PRO B 2 181 ? 6.364   25.250 59.440 1.00 25.21 ? 180  PRO B CB    1 
ATOM   2524 C  CG    . PRO B 2 181 ? 5.692   24.743 58.206 1.00 25.30 ? 180  PRO B CG    1 
ATOM   2525 C  CD    . PRO B 2 181 ? 5.221   25.983 57.518 1.00 22.67 ? 180  PRO B CD    1 
ATOM   2526 N  N     . CYS B 2 182 ? 6.462   27.898 61.582 1.00 30.39 ? 181  CYS B N     1 
ATOM   2527 C  CA    . CYS B 2 182 ? 7.284   28.953 62.157 1.00 29.99 ? 181  CYS B CA    1 
ATOM   2528 C  C     . CYS B 2 182 ? 6.793   30.357 61.810 1.00 27.88 ? 181  CYS B C     1 
ATOM   2529 O  O     . CYS B 2 182 ? 7.475   31.333 62.085 1.00 35.88 ? 181  CYS B O     1 
ATOM   2530 C  CB    . CYS B 2 182 ? 8.752   28.786 61.736 1.00 34.75 ? 181  CYS B CB    1 
ATOM   2531 S  SG    . CYS B 2 182 ? 9.547   27.312 62.355 1.00 31.01 ? 181  CYS B SG    1 
ATOM   2532 H  H     . CYS B 2 182 ? 5.878   27.385 62.182 1.00 0.00  ? 181  CYS B H     1 
ATOM   2533 N  N     . PHE B 2 183 ? 5.625   30.481 61.193 1.00 28.26 ? 182  PHE B N     1 
ATOM   2534 C  CA    . PHE B 2 183 ? 5.106   31.810 60.877 1.00 26.16 ? 182  PHE B CA    1 
ATOM   2535 C  C     . PHE B 2 183 ? 3.617   31.978 61.112 1.00 26.15 ? 182  PHE B C     1 
ATOM   2536 O  O     . PHE B 2 183 ? 3.177   33.046 61.523 1.00 31.97 ? 182  PHE B O     1 
ATOM   2537 C  CB    . PHE B 2 183 ? 5.431   32.220 59.430 1.00 25.57 ? 182  PHE B CB    1 
ATOM   2538 C  CG    . PHE B 2 183 ? 6.892   32.300 59.143 1.00 20.65 ? 182  PHE B CG    1 
ATOM   2539 C  CD1   . PHE B 2 183 ? 7.624   33.422 59.504 1.00 21.84 ? 182  PHE B CD1   1 
ATOM   2540 C  CD2   . PHE B 2 183 ? 7.546   31.243 58.547 1.00 17.54 ? 182  PHE B CD2   1 
ATOM   2541 C  CE1   . PHE B 2 183 ? 8.996   33.483 59.274 1.00 17.10 ? 182  PHE B CE1   1 
ATOM   2542 C  CE2   . PHE B 2 183 ? 8.908   31.300 58.317 1.00 18.01 ? 182  PHE B CE2   1 
ATOM   2543 C  CZ    . PHE B 2 183 ? 9.630   32.427 58.683 1.00 16.35 ? 182  PHE B CZ    1 
ATOM   2544 H  H     . PHE B 2 183 ? 5.115   29.685 60.943 1.00 0.00  ? 182  PHE B H     1 
ATOM   2545 N  N     . GLN B 2 184 ? 2.816   30.958 60.850 1.00 25.50 ? 183  GLN B N     1 
ATOM   2546 C  CA    . GLN B 2 184 ? 1.385   31.162 61.034 1.00 26.06 ? 183  GLN B CA    1 
ATOM   2547 C  C     . GLN B 2 184 ? 1.043   31.356 62.493 1.00 23.28 ? 183  GLN B C     1 
ATOM   2548 O  O     . GLN B 2 184 ? 1.540   30.622 63.348 1.00 23.54 ? 183  GLN B O     1 
ATOM   2549 C  CB    . GLN B 2 184 ? 0.568   30.026 60.423 1.00 27.36 ? 183  GLN B CB    1 
ATOM   2550 C  CG    . GLN B 2 184 ? -0.871  30.428 60.183 1.00 30.66 ? 183  GLN B CG    1 
ATOM   2551 C  CD    . GLN B 2 184 ? -1.591  29.571 59.155 1.00 30.88 ? 183  GLN B CD    1 
ATOM   2552 O  OE1   . GLN B 2 184 ? -1.781  29.983 58.013 1.00 28.96 ? 183  GLN B OE1   1 
ATOM   2553 N  NE2   . GLN B 2 184 ? -2.064  28.411 59.577 1.00 29.34 ? 183  GLN B NE2   1 
ATOM   2554 H  H     . GLN B 2 184 ? 3.163   30.099 60.554 1.00 0.00  ? 183  GLN B H     1 
ATOM   2555 H  HE21  . GLN B 2 184 ? -2.528  27.841 58.939 1.00 0.00  ? 183  GLN B HE21  1 
ATOM   2556 H  HE22  . GLN B 2 184 ? -1.927  28.175 60.516 1.00 0.00  ? 183  GLN B HE22  1 
ATOM   2557 N  N     . GLY B 2 185 ? 0.248   32.387 62.775 1.00 22.20 ? 184  GLY B N     1 
ATOM   2558 C  CA    . GLY B 2 185 ? -0.162  32.679 64.142 1.00 23.66 ? 184  GLY B CA    1 
ATOM   2559 C  C     . GLY B 2 185 ? 0.836   33.468 64.985 1.00 24.53 ? 184  GLY B C     1 
ATOM   2560 O  O     . GLY B 2 185 ? 0.553   33.863 66.117 1.00 30.17 ? 184  GLY B O     1 
ATOM   2561 H  H     . GLY B 2 185 ? -0.061  32.972 62.054 1.00 0.00  ? 184  GLY B H     1 
ATOM   2562 N  N     . THR B 2 186 ? 2.034   33.665 64.470 1.00 22.26 ? 185  THR B N     1 
ATOM   2563 C  CA    . THR B 2 186 ? 3.037   34.415 65.195 1.00 19.43 ? 185  THR B CA    1 
ATOM   2564 C  C     . THR B 2 186 ? 2.797   35.936 64.997 1.00 21.49 ? 185  THR B C     1 
ATOM   2565 O  O     . THR B 2 186 ? 1.824   36.345 64.362 1.00 28.09 ? 185  THR B O     1 
ATOM   2566 C  CB    . THR B 2 186 ? 4.427   33.997 64.706 1.00 15.18 ? 185  THR B CB    1 
ATOM   2567 O  OG1   . THR B 2 186 ? 4.575   34.390 63.336 1.00 16.85 ? 185  THR B OG1   1 
ATOM   2568 C  CG2   . THR B 2 186 ? 4.574   32.496 64.804 1.00 7.73  ? 185  THR B CG2   1 
ATOM   2569 H  H     . THR B 2 186 ? 2.277   33.324 63.578 1.00 0.00  ? 185  THR B H     1 
ATOM   2570 H  HG1   . THR B 2 186 ? 5.411   34.091 62.970 1.00 0.00  ? 185  THR B HG1   1 
ATOM   2571 N  N     . PRO B 2 187 ? 3.595   36.781 65.646 1.00 19.87 ? 186  PRO B N     1 
ATOM   2572 C  CA    . PRO B 2 187 ? 3.410   38.234 65.484 1.00 24.22 ? 186  PRO B CA    1 
ATOM   2573 C  C     . PRO B 2 187 ? 3.913   38.791 64.135 1.00 24.21 ? 186  PRO B C     1 
ATOM   2574 O  O     . PRO B 2 187 ? 4.821   38.258 63.521 1.00 23.37 ? 186  PRO B O     1 
ATOM   2575 C  CB    . PRO B 2 187 ? 4.198   38.823 66.671 1.00 24.70 ? 186  PRO B CB    1 
ATOM   2576 C  CG    . PRO B 2 187 ? 4.096   37.713 67.721 1.00 23.69 ? 186  PRO B CG    1 
ATOM   2577 C  CD    . PRO B 2 187 ? 4.330   36.465 66.893 1.00 20.30 ? 186  PRO B CD    1 
ATOM   2578 N  N     . GLU B 2 188 ? 3.370   39.917 63.716 1.00 28.06 ? 187  GLU B N     1 
ATOM   2579 C  CA    . GLU B 2 188 ? 3.752   40.527 62.443 1.00 30.43 ? 187  GLU B CA    1 
ATOM   2580 C  C     . GLU B 2 188 ? 5.232   40.849 62.266 1.00 31.15 ? 187  GLU B C     1 
ATOM   2581 O  O     . GLU B 2 188 ? 5.715   41.023 61.125 1.00 28.54 ? 187  GLU B O     1 
ATOM   2582 C  CB    . GLU B 2 188 ? 2.945   41.799 62.229 1.00 37.19 ? 187  GLU B CB    1 
ATOM   2583 C  CG    . GLU B 2 188 ? 1.445   41.576 62.189 1.00 43.58 ? 187  GLU B CG    1 
ATOM   2584 C  CD    . GLU B 2 188 ? 0.757   42.117 63.400 1.00 43.26 ? 187  GLU B CD    1 
ATOM   2585 O  OE1   . GLU B 2 188 ? 0.431   43.321 63.385 1.00 46.65 ? 187  GLU B OE1   1 
ATOM   2586 O  OE2   . GLU B 2 188 ? 0.540   41.345 64.358 1.00 42.97 ? 187  GLU B OE2   1 
ATOM   2587 H  H     . GLU B 2 188 ? 2.687   40.324 64.292 1.00 0.00  ? 187  GLU B H     1 
ATOM   2588 N  N     . LEU B 2 189 ? 5.928   41.009 63.392 1.00 28.86 ? 188  LEU B N     1 
ATOM   2589 C  CA    . LEU B 2 189 ? 7.355   41.332 63.387 1.00 22.98 ? 188  LEU B CA    1 
ATOM   2590 C  C     . LEU B 2 189 ? 8.130   40.258 62.665 1.00 18.68 ? 188  LEU B C     1 
ATOM   2591 O  O     . LEU B 2 189 ? 8.993   40.524 61.848 1.00 19.08 ? 188  LEU B O     1 
ATOM   2592 C  CB    . LEU B 2 189 ? 7.878   41.412 64.824 1.00 25.03 ? 188  LEU B CB    1 
ATOM   2593 C  CG    . LEU B 2 189 ? 9.385   41.664 65.015 1.00 30.95 ? 188  LEU B CG    1 
ATOM   2594 C  CD1   . LEU B 2 189 ? 9.709   43.162 64.839 1.00 28.71 ? 188  LEU B CD1   1 
ATOM   2595 C  CD2   . LEU B 2 189 ? 9.815   41.194 66.401 1.00 32.00 ? 188  LEU B CD2   1 
ATOM   2596 H  H     . LEU B 2 189 ? 5.461   40.899 64.244 1.00 0.00  ? 188  LEU B H     1 
ATOM   2597 N  N     . VAL B 2 190 ? 7.698   39.041 62.923 1.00 18.06 ? 189  VAL B N     1 
ATOM   2598 C  CA    . VAL B 2 190 ? 8.276   37.821 62.429 1.00 19.58 ? 189  VAL B CA    1 
ATOM   2599 C  C     . VAL B 2 190 ? 7.797   37.272 61.061 1.00 27.20 ? 189  VAL B C     1 
ATOM   2600 O  O     . VAL B 2 190 ? 8.425   36.380 60.482 1.00 29.21 ? 189  VAL B O     1 
ATOM   2601 C  CB    . VAL B 2 190 ? 8.080   36.818 63.564 1.00 21.76 ? 189  VAL B CB    1 
ATOM   2602 C  CG1   . VAL B 2 190 ? 8.371   35.388 63.126 1.00 24.95 ? 189  VAL B CG1   1 
ATOM   2603 C  CG2   . VAL B 2 190 ? 8.940   37.269 64.770 1.00 13.40 ? 189  VAL B CG2   1 
ATOM   2604 H  H     . VAL B 2 190 ? 6.907   38.938 63.490 1.00 0.00  ? 189  VAL B H     1 
ATOM   2605 N  N     . ARG B 2 191 ? 6.763   37.880 60.482 1.00 30.36 ? 190  ARG B N     1 
ATOM   2606 C  CA    . ARG B 2 191 ? 6.189   37.418 59.204 1.00 20.66 ? 190  ARG B CA    1 
ATOM   2607 C  C     . ARG B 2 191 ? 5.622   38.565 58.360 1.00 20.86 ? 190  ARG B C     1 
ATOM   2608 O  O     . ARG B 2 191 ? 5.540   39.730 58.791 1.00 14.62 ? 190  ARG B O     1 
ATOM   2609 C  CB    . ARG B 2 191 ? 5.023   36.475 59.512 1.00 24.04 ? 190  ARG B CB    1 
ATOM   2610 C  CG    . ARG B 2 191 ? 4.201   36.980 60.690 1.00 26.84 ? 190  ARG B CG    1 
ATOM   2611 C  CD    . ARG B 2 191 ? 2.830   36.371 60.806 1.00 29.85 ? 190  ARG B CD    1 
ATOM   2612 N  NE    . ARG B 2 191 ? 1.906   37.125 59.977 1.00 33.34 ? 190  ARG B NE    1 
ATOM   2613 C  CZ    . ARG B 2 191 ? 0.851   37.802 60.427 1.00 31.66 ? 190  ARG B CZ    1 
ATOM   2614 N  NH1   . ARG B 2 191 ? 0.528   37.783 61.716 1.00 24.11 ? 190  ARG B NH1   1 
ATOM   2615 N  NH2   . ARG B 2 191 ? 0.093   38.467 59.558 1.00 28.67 ? 190  ARG B NH2   1 
ATOM   2616 H  H     . ARG B 2 191 ? 6.375   38.659 60.916 1.00 0.00  ? 190  ARG B H     1 
ATOM   2617 H  HE    . ARG B 2 191 ? 2.067   37.133 59.009 1.00 0.00  ? 190  ARG B HE    1 
ATOM   2618 H  HH11  . ARG B 2 191 ? 1.067   37.261 62.380 1.00 0.00  ? 190  ARG B HH11  1 
ATOM   2619 H  HH12  . ARG B 2 191 ? -0.275  38.293 62.025 1.00 0.00  ? 190  ARG B HH12  1 
ATOM   2620 H  HH21  . ARG B 2 191 ? 0.333   38.448 58.585 1.00 0.00  ? 190  ARG B HH21  1 
ATOM   2621 H  HH22  . ARG B 2 191 ? -0.706  38.974 59.872 1.00 0.00  ? 190  ARG B HH22  1 
ATOM   2622 N  N     . LEU B 2 192 ? 5.185   38.194 57.160 1.00 22.73 ? 191  LEU B N     1 
ATOM   2623 C  CA    . LEU B 2 192 ? 4.560   39.110 56.222 1.00 18.30 ? 191  LEU B CA    1 
ATOM   2624 C  C     . LEU B 2 192 ? 3.232   39.491 56.842 1.00 18.97 ? 191  LEU B C     1 
ATOM   2625 O  O     . LEU B 2 192 ? 2.665   38.692 57.571 1.00 19.61 ? 191  LEU B O     1 
ATOM   2626 C  CB    . LEU B 2 192 ? 4.251   38.386 54.926 1.00 15.91 ? 191  LEU B CB    1 
ATOM   2627 C  CG    . LEU B 2 192 ? 3.618   39.211 53.802 1.00 10.24 ? 191  LEU B CG    1 
ATOM   2628 C  CD1   . LEU B 2 192 ? 4.565   40.299 53.366 1.00 8.00  ? 191  LEU B CD1   1 
ATOM   2629 C  CD2   . LEU B 2 192 ? 3.318   38.304 52.642 1.00 10.92 ? 191  LEU B CD2   1 
ATOM   2630 H  H     . LEU B 2 192 ? 5.193   37.255 56.944 1.00 0.00  ? 191  LEU B H     1 
ATOM   2631 N  N     . ASP B 2 193 ? 2.812   40.740 56.637 1.00 21.96 ? 192  ASP B N     1 
ATOM   2632 C  CA    . ASP B 2 193 ? 1.529   41.284 57.113 1.00 21.66 ? 192  ASP B CA    1 
ATOM   2633 C  C     . ASP B 2 193 ? 1.393   42.533 56.292 1.00 19.77 ? 192  ASP B C     1 
ATOM   2634 O  O     . ASP B 2 193 ? 2.392   43.059 55.822 1.00 20.35 ? 192  ASP B O     1 
ATOM   2635 C  CB    . ASP B 2 193 ? 1.521   41.588 58.611 1.00 24.88 ? 192  ASP B CB    1 
ATOM   2636 C  CG    . ASP B 2 193 ? 2.479   42.671 58.985 1.00 25.32 ? 192  ASP B CG    1 
ATOM   2637 O  OD1   . ASP B 2 193 ? 3.653   42.380 59.272 1.00 24.37 ? 192  ASP B OD1   1 
ATOM   2638 O  OD2   . ASP B 2 193 ? 2.057   43.822 58.973 1.00 26.89 ? 192  ASP B OD2   1 
ATOM   2639 H  H     . ASP B 2 193 ? 3.348   41.339 56.077 1.00 0.00  ? 192  ASP B H     1 
ATOM   2640 N  N     . PRO B 2 194 ? 0.175   43.064 56.156 1.00 23.67 ? 193  PRO B N     1 
ATOM   2641 C  CA    . PRO B 2 194 ? -0.090  44.270 55.359 1.00 19.38 ? 193  PRO B CA    1 
ATOM   2642 C  C     . PRO B 2 194 ? 0.810   45.492 55.604 1.00 26.03 ? 193  PRO B C     1 
ATOM   2643 O  O     . PRO B 2 194 ? 1.062   46.274 54.673 1.00 25.36 ? 193  PRO B O     1 
ATOM   2644 C  CB    . PRO B 2 194 ? -1.533  44.584 55.711 1.00 19.74 ? 193  PRO B CB    1 
ATOM   2645 C  CG    . PRO B 2 194 ? -2.112  43.244 56.059 1.00 19.74 ? 193  PRO B CG    1 
ATOM   2646 C  CD    . PRO B 2 194 ? -1.035  42.634 56.885 1.00 19.90 ? 193  PRO B CD    1 
ATOM   2647 N  N     . SER B 2 195 ? 1.302   45.654 56.836 1.00 24.48 ? 194  SER B N     1 
ATOM   2648 C  CA    . SER B 2 195 ? 2.132   46.808 57.192 1.00 27.01 ? 194  SER B CA    1 
ATOM   2649 C  C     . SER B 2 195 ? 3.563   46.882 56.625 1.00 27.76 ? 194  SER B C     1 
ATOM   2650 O  O     . SER B 2 195 ? 4.197   47.946 56.719 1.00 29.30 ? 194  SER B O     1 
ATOM   2651 C  CB    . SER B 2 195 ? 2.199   46.961 58.708 1.00 26.70 ? 194  SER B CB    1 
ATOM   2652 O  OG    . SER B 2 195 ? 3.100   46.013 59.251 1.00 27.47 ? 194  SER B OG    1 
ATOM   2653 H  H     . SER B 2 195 ? 1.094   44.979 57.520 1.00 0.00  ? 194  SER B H     1 
ATOM   2654 H  HG    . SER B 2 195 ? 3.927   46.376 59.011 1.00 0.00  ? 194  SER B HG    1 
ATOM   2655 N  N     . ASP B 2 196 ? 4.077   45.780 56.066 1.00 23.17 ? 195  ASP B N     1 
ATOM   2656 C  CA    . ASP B 2 196 ? 5.436   45.756 55.517 1.00 21.02 ? 195  ASP B CA    1 
ATOM   2657 C  C     . ASP B 2 196 ? 5.613   46.524 54.212 1.00 21.57 ? 195  ASP B C     1 
ATOM   2658 O  O     . ASP B 2 196 ? 6.730   46.870 53.853 1.00 25.27 ? 195  ASP B O     1 
ATOM   2659 C  CB    . ASP B 2 196 ? 5.909   44.304 55.309 1.00 19.11 ? 195  ASP B CB    1 
ATOM   2660 C  CG    . ASP B 2 196 ? 5.981   43.492 56.603 1.00 19.12 ? 195  ASP B CG    1 
ATOM   2661 O  OD1   . ASP B 2 196 ? 6.246   44.021 57.684 1.00 15.93 ? 195  ASP B OD1   1 
ATOM   2662 O  OD2   . ASP B 2 196 ? 5.817   42.279 56.517 1.00 18.74 ? 195  ASP B OD2   1 
ATOM   2663 H  H     . ASP B 2 196 ? 3.490   44.992 55.991 1.00 0.00  ? 195  ASP B H     1 
ATOM   2664 N  N     . ALA B 2 197 ? 4.532   46.784 53.493 1.00 23.88 ? 196  ALA B N     1 
ATOM   2665 C  CA    . ALA B 2 197 ? 4.642   47.463 52.204 1.00 21.09 ? 196  ALA B CA    1 
ATOM   2666 C  C     . ALA B 2 197 ? 3.450   48.390 52.035 1.00 24.77 ? 196  ALA B C     1 
ATOM   2667 O  O     . ALA B 2 197 ? 2.438   48.238 52.727 1.00 31.95 ? 196  ALA B O     1 
ATOM   2668 C  CB    . ALA B 2 197 ? 4.648   46.440 51.092 1.00 12.92 ? 196  ALA B CB    1 
ATOM   2669 H  H     . ALA B 2 197 ? 3.628   46.563 53.804 1.00 0.00  ? 196  ALA B H     1 
ATOM   2670 N  N     . LYS B 2 198 ? 3.551   49.324 51.099 1.00 21.15 ? 197  LYS B N     1 
ATOM   2671 C  CA    . LYS B 2 198 ? 2.459   50.233 50.828 1.00 22.67 ? 197  LYS B CA    1 
ATOM   2672 C  C     . LYS B 2 198 ? 1.200   49.432 50.408 1.00 26.13 ? 197  LYS B C     1 
ATOM   2673 O  O     . LYS B 2 198 ? 0.059   49.897 50.524 1.00 25.47 ? 197  LYS B O     1 
ATOM   2674 C  CB    . LYS B 2 198 ? 2.846   51.164 49.676 1.00 28.17 ? 197  LYS B CB    1 
ATOM   2675 C  CG    . LYS B 2 198 ? 4.075   51.991 49.888 1.00 30.11 ? 197  LYS B CG    1 
ATOM   2676 C  CD    . LYS B 2 198 ? 3.755   53.460 49.746 1.00 34.24 ? 197  LYS B CD    1 
ATOM   2677 C  CE    . LYS B 2 198 ? 3.277   54.027 51.079 1.00 38.36 ? 197  LYS B CE    1 
ATOM   2678 N  NZ    . LYS B 2 198 ? 4.344   53.927 52.123 1.00 38.72 ? 197  LYS B NZ    1 
ATOM   2679 H  H     . LYS B 2 198 ? 4.373   49.394 50.565 1.00 0.00  ? 197  LYS B H     1 
ATOM   2680 H  HZ1   . LYS B 2 198 ? 5.182   54.432 51.775 1.00 0.00  ? 197  LYS B HZ1   1 
ATOM   2681 H  HZ2   . LYS B 2 198 ? 3.998   54.363 53.000 1.00 0.00  ? 197  LYS B HZ2   1 
ATOM   2682 H  HZ3   . LYS B 2 198 ? 4.586   52.932 52.296 1.00 0.00  ? 197  LYS B HZ3   1 
ATOM   2683 N  N     . PHE B 2 199 ? 1.431   48.248 49.852 1.00 24.25 ? 198  PHE B N     1 
ATOM   2684 C  CA    . PHE B 2 199 ? 0.378   47.373 49.379 1.00 20.59 ? 198  PHE B CA    1 
ATOM   2685 C  C     . PHE B 2 199 ? 0.972   45.951 49.386 1.00 21.30 ? 198  PHE B C     1 
ATOM   2686 O  O     . PHE B 2 199 ? 2.119   45.757 48.985 1.00 21.43 ? 198  PHE B O     1 
ATOM   2687 C  CB    . PHE B 2 199 ? -0.027  47.829 47.962 1.00 16.81 ? 198  PHE B CB    1 
ATOM   2688 C  CG    . PHE B 2 199 ? -0.840  46.820 47.185 1.00 15.94 ? 198  PHE B CG    1 
ATOM   2689 C  CD1   . PHE B 2 199 ? -1.993  46.261 47.718 1.00 17.19 ? 198  PHE B CD1   1 
ATOM   2690 C  CD2   . PHE B 2 199 ? -0.434  46.424 45.915 1.00 15.47 ? 198  PHE B CD2   1 
ATOM   2691 C  CE1   . PHE B 2 199 ? -2.732  45.316 47.002 1.00 13.31 ? 198  PHE B CE1   1 
ATOM   2692 C  CE2   . PHE B 2 199 ? -1.159  45.488 45.195 1.00 16.10 ? 198  PHE B CE2   1 
ATOM   2693 C  CZ    . PHE B 2 199 ? -2.314  44.933 45.746 1.00 17.06 ? 198  PHE B CZ    1 
ATOM   2694 H  H     . PHE B 2 199 ? 2.357   47.961 49.727 1.00 0.00  ? 198  PHE B H     1 
ATOM   2695 N  N     . VAL B 2 200 ? 0.237   44.995 49.948 1.00 13.62 ? 199  VAL B N     1 
ATOM   2696 C  CA    . VAL B 2 200 ? 0.680   43.609 49.996 1.00 18.30 ? 199  VAL B CA    1 
ATOM   2697 C  C     . VAL B 2 200 ? -0.433  42.719 49.447 1.00 18.00 ? 199  VAL B C     1 
ATOM   2698 O  O     . VAL B 2 200 ? -1.536  42.735 49.989 1.00 21.24 ? 199  VAL B O     1 
ATOM   2699 C  CB    . VAL B 2 200 ? 0.948   43.137 51.456 1.00 20.54 ? 199  VAL B CB    1 
ATOM   2700 C  CG1   . VAL B 2 200 ? 1.349   41.668 51.477 1.00 18.36 ? 199  VAL B CG1   1 
ATOM   2701 C  CG2   . VAL B 2 200 ? 2.016   43.981 52.127 1.00 21.45 ? 199  VAL B CG2   1 
ATOM   2702 H  H     . VAL B 2 200 ? -0.628  45.147 50.325 1.00 0.00  ? 199  VAL B H     1 
ATOM   2703 N  N     . ASP B 2 201 ? -0.184  41.995 48.358 1.00 21.63 ? 200  ASP B N     1 
ATOM   2704 C  CA    . ASP B 2 201 ? -1.186  41.068 47.798 1.00 19.70 ? 200  ASP B CA    1 
ATOM   2705 C  C     . ASP B 2 201 ? -0.662  39.627 47.907 1.00 19.31 ? 200  ASP B C     1 
ATOM   2706 O  O     . ASP B 2 201 ? 0.504   39.369 47.619 1.00 21.05 ? 200  ASP B O     1 
ATOM   2707 C  CB    . ASP B 2 201 ? -1.501  41.407 46.350 1.00 17.45 ? 200  ASP B CB    1 
ATOM   2708 C  CG    . ASP B 2 201 ? -0.271  41.416 45.477 1.00 23.02 ? 200  ASP B CG    1 
ATOM   2709 O  OD1   . ASP B 2 201 ? 0.757   41.989 45.916 1.00 20.04 ? 200  ASP B OD1   1 
ATOM   2710 O  OD2   . ASP B 2 201 ? -0.331  40.854 44.352 1.00 25.87 ? 200  ASP B OD2   1 
ATOM   2711 H  H     . ASP B 2 201 ? 0.716   42.042 47.970 1.00 0.00  ? 200  ASP B H     1 
ATOM   2712 N  N     . VAL B 2 202 ? -1.509  38.682 48.303 1.00 23.54 ? 201  VAL B N     1 
ATOM   2713 C  CA    . VAL B 2 202 ? -1.057  37.293 48.459 1.00 24.48 ? 201  VAL B CA    1 
ATOM   2714 C  C     . VAL B 2 202 ? -1.869  36.197 47.742 1.00 21.88 ? 201  VAL B C     1 
ATOM   2715 O  O     . VAL B 2 202 ? -3.084  36.160 47.849 1.00 22.71 ? 201  VAL B O     1 
ATOM   2716 C  CB    . VAL B 2 202 ? -1.039  36.917 49.941 1.00 24.61 ? 201  VAL B CB    1 
ATOM   2717 C  CG1   . VAL B 2 202 ? -0.296  35.603 50.146 1.00 26.88 ? 201  VAL B CG1   1 
ATOM   2718 C  CG2   . VAL B 2 202 ? -0.455  38.034 50.756 1.00 26.74 ? 201  VAL B CG2   1 
ATOM   2719 H  H     . VAL B 2 202 ? -2.443  38.892 48.470 1.00 0.00  ? 201  VAL B H     1 
ATOM   2720 N  N     . ILE B 2 203 ? -1.180  35.266 47.082 1.00 21.07 ? 202  ILE B N     1 
ATOM   2721 C  CA    . ILE B 2 203 ? -1.817  34.128 46.397 1.00 15.25 ? 202  ILE B CA    1 
ATOM   2722 C  C     . ILE B 2 203 ? -1.642  32.848 47.265 1.00 17.48 ? 202  ILE B C     1 
ATOM   2723 O  O     . ILE B 2 203 ? -0.526  32.399 47.516 1.00 13.35 ? 202  ILE B O     1 
ATOM   2724 C  CB    . ILE B 2 203 ? -1.181  33.903 45.010 1.00 16.73 ? 202  ILE B CB    1 
ATOM   2725 C  CG1   . ILE B 2 203 ? -1.412  35.144 44.129 1.00 14.02 ? 202  ILE B CG1   1 
ATOM   2726 C  CG2   . ILE B 2 203 ? -1.754  32.657 44.326 1.00 16.73 ? 202  ILE B CG2   1 
ATOM   2727 C  CD1   . ILE B 2 203 ? -0.698  35.086 42.805 1.00 10.54 ? 202  ILE B CD1   1 
ATOM   2728 H  H     . ILE B 2 203 ? -0.197  35.325 47.083 1.00 0.00  ? 202  ILE B H     1 
ATOM   2729 N  N     . HIS B 2 204 ? -2.755  32.329 47.790 1.00 19.43 ? 203  HIS B N     1 
ATOM   2730 C  CA    . HIS B 2 204 ? -2.794  31.121 48.632 1.00 17.77 ? 203  HIS B CA    1 
ATOM   2731 C  C     . HIS B 2 204 ? -3.095  29.848 47.790 1.00 18.01 ? 203  HIS B C     1 
ATOM   2732 O  O     . HIS B 2 204 ? -4.175  29.732 47.213 1.00 21.46 ? 203  HIS B O     1 
ATOM   2733 C  CB    . HIS B 2 204 ? -3.894  31.288 49.688 1.00 14.88 ? 203  HIS B CB    1 
ATOM   2734 C  CG    . HIS B 2 204 ? -3.612  32.349 50.714 1.00 18.44 ? 203  HIS B CG    1 
ATOM   2735 N  ND1   . HIS B 2 204 ? -3.066  32.064 51.954 1.00 12.99 ? 203  HIS B ND1   1 
ATOM   2736 C  CD2   . HIS B 2 204 ? -3.877  33.679 50.720 1.00 15.16 ? 203  HIS B CD2   1 
ATOM   2737 C  CE1   . HIS B 2 204 ? -3.021  33.163 52.678 1.00 11.65 ? 203  HIS B CE1   1 
ATOM   2738 N  NE2   . HIS B 2 204 ? -3.507  34.157 51.954 1.00 15.17 ? 203  HIS B NE2   1 
ATOM   2739 H  H     . HIS B 2 204 ? -3.597  32.773 47.574 1.00 0.00  ? 203  HIS B H     1 
ATOM   2740 H  HD1   . HIS B 2 204 ? -2.741  31.177 52.211 1.00 0.00  ? 203  HIS B HD1   1 
ATOM   2741 H  HE2   . HIS B 2 204 ? -3.591  35.055 52.265 1.00 0.00  ? 203  HIS B HE2   1 
ATOM   2742 N  N     . THR B 2 205 ? -2.157  28.912 47.686 1.00 16.94 ? 204  THR B N     1 
ATOM   2743 C  CA    . THR B 2 205 ? -2.400  27.700 46.879 1.00 19.84 ? 204  THR B CA    1 
ATOM   2744 C  C     . THR B 2 205 ? -2.192  26.344 47.590 1.00 24.97 ? 204  THR B C     1 
ATOM   2745 O  O     . THR B 2 205 ? -2.490  25.285 47.038 1.00 26.77 ? 204  THR B O     1 
ATOM   2746 C  CB    . THR B 2 205 ? -1.511  27.674 45.627 1.00 17.69 ? 204  THR B CB    1 
ATOM   2747 O  OG1   . THR B 2 205 ? -0.134  27.680 46.032 1.00 23.15 ? 204  THR B OG1   1 
ATOM   2748 C  CG2   . THR B 2 205 ? -1.808  28.864 44.686 1.00 10.43 ? 204  THR B CG2   1 
ATOM   2749 H  H     . THR B 2 205 ? -1.300  29.028 48.132 1.00 0.00  ? 204  THR B H     1 
ATOM   2750 H  HG1   . THR B 2 205 ? 0.159   28.581 46.158 1.00 0.00  ? 204  THR B HG1   1 
ATOM   2751 N  N     . ASP B 2 206 ? -1.706  26.370 48.823 1.00 31.29 ? 205  ASP B N     1 
ATOM   2752 C  CA    . ASP B 2 206 ? -1.452  25.131 49.543 1.00 32.73 ? 205  ASP B CA    1 
ATOM   2753 C  C     . ASP B 2 206 ? -1.667  25.335 51.048 1.00 31.36 ? 205  ASP B C     1 
ATOM   2754 O  O     . ASP B 2 206 ? -0.806  24.997 51.873 1.00 25.60 ? 205  ASP B O     1 
ATOM   2755 C  CB    . ASP B 2 206 ? -0.024  24.680 49.228 1.00 35.45 ? 205  ASP B CB    1 
ATOM   2756 C  CG    . ASP B 2 206 ? 0.329   23.378 49.877 1.00 38.87 ? 205  ASP B CG    1 
ATOM   2757 O  OD1   . ASP B 2 206 ? -0.526  22.469 49.906 1.00 43.40 ? 205  ASP B OD1   1 
ATOM   2758 O  OD2   . ASP B 2 206 ? 1.470   23.265 50.354 1.00 41.74 ? 205  ASP B OD2   1 
ATOM   2759 H  H     . ASP B 2 206 ? -1.543  27.221 49.254 1.00 0.00  ? 205  ASP B H     1 
ATOM   2760 N  N     . GLY B 2 207 ? -2.851  25.851 51.375 1.00 28.69 ? 206  GLY B N     1 
ATOM   2761 C  CA    . GLY B 2 207 ? -3.213  26.155 52.743 1.00 24.96 ? 206  GLY B CA    1 
ATOM   2762 C  C     . GLY B 2 207 ? -3.647  25.048 53.678 1.00 28.54 ? 206  GLY B C     1 
ATOM   2763 O  O     . GLY B 2 207 ? -4.125  25.342 54.769 1.00 34.89 ? 206  GLY B O     1 
ATOM   2764 H  H     . GLY B 2 207 ? -3.512  26.014 50.676 1.00 0.00  ? 206  GLY B H     1 
ATOM   2765 N  N     . ALA B 2 208 ? -3.521  23.786 53.302 1.00 24.07 ? 207  ALA B N     1 
ATOM   2766 C  CA    . ALA B 2 208 ? -3.928  22.734 54.229 1.00 25.37 ? 207  ALA B CA    1 
ATOM   2767 C  C     . ALA B 2 208 ? -2.933  22.694 55.394 1.00 25.39 ? 207  ALA B C     1 
ATOM   2768 O  O     . ALA B 2 208 ? -1.747  22.940 55.198 1.00 23.94 ? 207  ALA B O     1 
ATOM   2769 C  CB    . ALA B 2 208 ? -3.958  21.386 53.513 1.00 22.65 ? 207  ALA B CB    1 
ATOM   2770 H  H     . ALA B 2 208 ? -3.125  23.553 52.445 1.00 0.00  ? 207  ALA B H     1 
ATOM   2771 N  N     . PRO B 2 209 ? -3.399  22.380 56.616 1.00 25.90 ? 208  PRO B N     1 
ATOM   2772 C  CA    . PRO B 2 209 ? -2.491  22.321 57.768 1.00 26.52 ? 208  PRO B CA    1 
ATOM   2773 C  C     . PRO B 2 209 ? -1.214  21.552 57.471 1.00 29.10 ? 208  PRO B C     1 
ATOM   2774 O  O     . PRO B 2 209 ? -1.240  20.556 56.722 1.00 27.83 ? 208  PRO B O     1 
ATOM   2775 C  CB    . PRO B 2 209 ? -3.336  21.626 58.824 1.00 24.47 ? 208  PRO B CB    1 
ATOM   2776 C  CG    . PRO B 2 209 ? -4.686  22.230 58.556 1.00 24.31 ? 208  PRO B CG    1 
ATOM   2777 C  CD    . PRO B 2 209 ? -4.789  22.132 57.044 1.00 26.28 ? 208  PRO B CD    1 
ATOM   2778 N  N     . ILE B 2 210 ? -0.086  22.035 58.006 1.00 32.91 ? 209  ILE B N     1 
ATOM   2779 C  CA    . ILE B 2 210 ? 1.190   21.344 57.778 1.00 35.03 ? 209  ILE B CA    1 
ATOM   2780 C  C     . ILE B 2 210 ? 1.067   19.916 58.364 1.00 33.98 ? 209  ILE B C     1 
ATOM   2781 O  O     . ILE B 2 210 ? 1.532   18.960 57.751 1.00 34.62 ? 209  ILE B O     1 
ATOM   2782 C  CB    . ILE B 2 210 ? 2.446   22.156 58.317 1.00 32.93 ? 209  ILE B CB    1 
ATOM   2783 C  CG1   . ILE B 2 210 ? 3.757   21.567 57.763 1.00 31.63 ? 209  ILE B CG1   1 
ATOM   2784 C  CG2   . ILE B 2 210 ? 2.493   22.186 59.854 1.00 31.00 ? 209  ILE B CG2   1 
ATOM   2785 C  CD1   . ILE B 2 210 ? 4.068   21.890 56.290 1.00 29.99 ? 209  ILE B CD1   1 
ATOM   2786 H  H     . ILE B 2 210 ? -0.114  22.876 58.510 1.00 0.00  ? 209  ILE B H     1 
ATOM   2787 N  N     . VAL B 2 211 ? 0.363   19.777 59.493 1.00 29.33 ? 210  VAL B N     1 
ATOM   2788 C  CA    . VAL B 2 211 ? 0.130   18.477 60.109 1.00 34.03 ? 210  VAL B CA    1 
ATOM   2789 C  C     . VAL B 2 211 ? -1.358  18.256 60.354 1.00 40.88 ? 210  VAL B C     1 
ATOM   2790 O  O     . VAL B 2 211 ? -2.003  19.050 61.042 1.00 44.21 ? 210  VAL B O     1 
ATOM   2791 C  CB    . VAL B 2 211 ? 0.868   18.341 61.418 1.00 35.89 ? 210  VAL B CB    1 
ATOM   2792 C  CG1   . VAL B 2 211 ? 2.377   18.282 61.141 1.00 35.29 ? 210  VAL B CG1   1 
ATOM   2793 C  CG2   . VAL B 2 211 ? 0.501   19.495 62.337 1.00 34.67 ? 210  VAL B CG2   1 
ATOM   2794 H  H     . VAL B 2 211 ? -0.031  20.565 59.914 1.00 0.00  ? 210  VAL B H     1 
ATOM   2795 N  N     . PRO B 2 212 ? -1.908  17.130 59.868 1.00 44.61 ? 211  PRO B N     1 
ATOM   2796 C  CA    . PRO B 2 212 ? -1.211  16.073 59.124 1.00 48.39 ? 211  PRO B CA    1 
ATOM   2797 C  C     . PRO B 2 212 ? -1.141  16.245 57.607 1.00 47.98 ? 211  PRO B C     1 
ATOM   2798 O  O     . PRO B 2 212 ? -0.341  15.575 56.949 1.00 50.13 ? 211  PRO B O     1 
ATOM   2799 C  CB    . PRO B 2 212 ? -2.039  14.844 59.459 1.00 47.83 ? 211  PRO B CB    1 
ATOM   2800 C  CG    . PRO B 2 212 ? -3.442  15.401 59.418 1.00 46.78 ? 211  PRO B CG    1 
ATOM   2801 C  CD    . PRO B 2 212 ? -3.312  16.748 60.129 1.00 46.62 ? 211  PRO B CD    1 
ATOM   2802 N  N     . ASN B 2 213 ? -1.923  17.181 57.077 1.00 44.74 ? 212  ASN B N     1 
ATOM   2803 C  CA    . ASN B 2 213 ? -2.009  17.399 55.636 1.00 41.97 ? 212  ASN B CA    1 
ATOM   2804 C  C     . ASN B 2 213 ? -0.764  17.795 54.888 1.00 42.28 ? 212  ASN B C     1 
ATOM   2805 O  O     . ASN B 2 213 ? -0.713  17.628 53.679 1.00 46.41 ? 212  ASN B O     1 
ATOM   2806 C  CB    . ASN B 2 213 ? -3.112  18.378 55.317 1.00 39.14 ? 212  ASN B CB    1 
ATOM   2807 C  CG    . ASN B 2 213 ? -4.295  18.186 56.192 1.00 41.73 ? 212  ASN B CG    1 
ATOM   2808 O  OD1   . ASN B 2 213 ? -4.270  18.561 57.370 1.00 43.84 ? 212  ASN B OD1   1 
ATOM   2809 N  ND2   . ASN B 2 213 ? -5.326  17.553 55.661 1.00 41.17 ? 212  ASN B ND2   1 
ATOM   2810 H  H     . ASN B 2 213 ? -2.436  17.759 57.681 1.00 0.00  ? 212  ASN B H     1 
ATOM   2811 H  HD21  . ASN B 2 213 ? -6.111  17.433 56.229 1.00 0.00  ? 212  ASN B HD21  1 
ATOM   2812 H  HD22  . ASN B 2 213 ? -5.253  17.247 54.732 1.00 0.00  ? 212  ASN B HD22  1 
ATOM   2813 N  N     . LEU B 2 214 ? 0.238   18.325 55.567 1.00 40.24 ? 213  LEU B N     1 
ATOM   2814 C  CA    . LEU B 2 214 ? 1.456   18.705 54.869 1.00 41.61 ? 213  LEU B CA    1 
ATOM   2815 C  C     . LEU B 2 214 ? 1.266   19.855 53.865 1.00 37.52 ? 213  LEU B C     1 
ATOM   2816 O  O     . LEU B 2 214 ? 1.882   19.877 52.785 1.00 34.98 ? 213  LEU B O     1 
ATOM   2817 C  CB    . LEU B 2 214 ? 2.092   17.489 54.170 1.00 43.07 ? 213  LEU B CB    1 
ATOM   2818 C  CG    . LEU B 2 214 ? 3.118   16.623 54.917 1.00 46.65 ? 213  LEU B CG    1 
ATOM   2819 C  CD1   . LEU B 2 214 ? 4.457   17.322 55.022 1.00 46.07 ? 213  LEU B CD1   1 
ATOM   2820 C  CD2   . LEU B 2 214 ? 2.598   16.234 56.287 1.00 49.96 ? 213  LEU B CD2   1 
ATOM   2821 H  H     . LEU B 2 214 ? 0.161   18.475 56.525 1.00 0.00  ? 213  LEU B H     1 
ATOM   2822 N  N     . GLY B 2 215 ? 0.378   20.781 54.197 1.00 31.01 ? 214  GLY B N     1 
ATOM   2823 C  CA    . GLY B 2 215 ? 0.195   21.935 53.342 1.00 25.42 ? 214  GLY B CA    1 
ATOM   2824 C  C     . GLY B 2 215 ? 1.280   22.925 53.734 1.00 21.01 ? 214  GLY B C     1 
ATOM   2825 O  O     . GLY B 2 215 ? 1.326   23.420 54.857 1.00 17.02 ? 214  GLY B O     1 
ATOM   2826 H  H     . GLY B 2 215 ? -0.161  20.710 55.013 1.00 0.00  ? 214  GLY B H     1 
ATOM   2827 N  N     . PHE B 2 216 ? 2.186   23.180 52.805 1.00 20.01 ? 215  PHE B N     1 
ATOM   2828 C  CA    . PHE B 2 216 ? 3.309   24.077 53.023 1.00 18.36 ? 215  PHE B CA    1 
ATOM   2829 C  C     . PHE B 2 216 ? 3.003   25.533 53.215 1.00 13.67 ? 215  PHE B C     1 
ATOM   2830 O  O     . PHE B 2 216 ? 3.793   26.235 53.806 1.00 17.89 ? 215  PHE B O     1 
ATOM   2831 C  CB    . PHE B 2 216 ? 4.304   23.948 51.867 1.00 19.82 ? 215  PHE B CB    1 
ATOM   2832 C  CG    . PHE B 2 216 ? 4.829   22.555 51.670 1.00 18.23 ? 215  PHE B CG    1 
ATOM   2833 C  CD1   . PHE B 2 216 ? 5.275   21.806 52.750 1.00 23.85 ? 215  PHE B CD1   1 
ATOM   2834 C  CD2   . PHE B 2 216 ? 4.901   22.002 50.405 1.00 24.48 ? 215  PHE B CD2   1 
ATOM   2835 C  CE1   . PHE B 2 216 ? 5.792   20.527 52.574 1.00 24.80 ? 215  PHE B CE1   1 
ATOM   2836 C  CE2   . PHE B 2 216 ? 5.416   20.719 50.209 1.00 24.98 ? 215  PHE B CE2   1 
ATOM   2837 C  CZ    . PHE B 2 216 ? 5.863   19.984 51.300 1.00 27.62 ? 215  PHE B CZ    1 
ATOM   2838 H  H     . PHE B 2 216 ? 2.136   22.620 52.012 1.00 0.00  ? 215  PHE B H     1 
ATOM   2839 N  N     . GLY B 2 217 ? 1.880   25.998 52.686 1.00 21.75 ? 216  GLY B N     1 
ATOM   2840 C  CA    . GLY B 2 217 ? 1.534   27.415 52.770 1.00 18.17 ? 216  GLY B CA    1 
ATOM   2841 C  C     . GLY B 2 217 ? 0.482   27.730 53.795 1.00 18.04 ? 216  GLY B C     1 
ATOM   2842 O  O     . GLY B 2 217 ? -0.204  26.837 54.268 1.00 14.80 ? 216  GLY B O     1 
ATOM   2843 H  H     . GLY B 2 217 ? 1.220   25.374 52.300 1.00 0.00  ? 216  GLY B H     1 
ATOM   2844 N  N     . MET B 2 218 ? 0.331   29.006 54.117 1.00 19.56 ? 217  MET B N     1 
ATOM   2845 C  CA    . MET B 2 218 ? -0.631  29.407 55.125 1.00 22.47 ? 217  MET B CA    1 
ATOM   2846 C  C     . MET B 2 218 ? -2.069  29.691 54.685 1.00 24.96 ? 217  MET B C     1 
ATOM   2847 O  O     . MET B 2 218 ? -2.362  29.961 53.501 1.00 23.90 ? 217  MET B O     1 
ATOM   2848 C  CB    . MET B 2 218 ? -0.053  30.514 56.034 1.00 25.95 ? 217  MET B CB    1 
ATOM   2849 C  CG    . MET B 2 218 ? 0.704   31.661 55.385 1.00 30.51 ? 217  MET B CG    1 
ATOM   2850 S  SD    . MET B 2 218 ? 1.895   32.543 56.488 1.00 32.07 ? 217  MET B SD    1 
ATOM   2851 C  CE    . MET B 2 218 ? 0.928   32.954 57.894 1.00 25.88 ? 217  MET B CE    1 
ATOM   2852 H  H     . MET B 2 218 ? 0.901   29.671 53.674 1.00 0.00  ? 217  MET B H     1 
ATOM   2853 N  N     . SER B 2 219 ? -2.983  29.471 55.623 1.00 23.70 ? 218  SER B N     1 
ATOM   2854 C  CA    . SER B 2 219 ? -4.391  29.707 55.366 1.00 23.65 ? 218  SER B CA    1 
ATOM   2855 C  C     . SER B 2 219 ? -4.718  31.069 55.939 1.00 24.01 ? 218  SER B C     1 
ATOM   2856 O  O     . SER B 2 219 ? -5.672  31.707 55.509 1.00 28.78 ? 218  SER B O     1 
ATOM   2857 C  CB    . SER B 2 219 ? -5.253  28.641 56.039 1.00 23.16 ? 218  SER B CB    1 
ATOM   2858 O  OG    . SER B 2 219 ? -5.020  28.613 57.431 1.00 24.82 ? 218  SER B OG    1 
ATOM   2859 H  H     . SER B 2 219 ? -2.716  29.152 56.509 1.00 0.00  ? 218  SER B H     1 
ATOM   2860 H  HG    . SER B 2 219 ? -4.271  28.026 57.535 1.00 0.00  ? 218  SER B HG    1 
ATOM   2861 N  N     . GLN B 2 220 ? -3.924  31.496 56.918 1.00 23.49 ? 219  GLN B N     1 
ATOM   2862 C  CA    . GLN B 2 220 ? -4.094  32.778 57.565 1.00 24.24 ? 219  GLN B CA    1 
ATOM   2863 C  C     . GLN B 2 220 ? -3.914  33.868 56.535 1.00 28.86 ? 219  GLN B C     1 
ATOM   2864 O  O     . GLN B 2 220 ? -3.015  33.790 55.691 1.00 32.58 ? 219  GLN B O     1 
ATOM   2865 C  CB    . GLN B 2 220 ? -3.060  32.949 58.677 1.00 27.42 ? 219  GLN B CB    1 
ATOM   2866 C  CG    . GLN B 2 220 ? -3.075  34.315 59.349 1.00 27.49 ? 219  GLN B CG    1 
ATOM   2867 C  CD    . GLN B 2 220 ? -2.228  34.347 60.609 1.00 32.14 ? 219  GLN B CD    1 
ATOM   2868 O  OE1   . GLN B 2 220 ? -1.250  33.613 60.741 1.00 31.23 ? 219  GLN B OE1   1 
ATOM   2869 N  NE2   . GLN B 2 220 ? -2.618  35.182 61.557 1.00 36.73 ? 219  GLN B NE2   1 
ATOM   2870 H  H     . GLN B 2 220 ? -3.209  30.923 57.241 1.00 0.00  ? 219  GLN B H     1 
ATOM   2871 H  HE21  . GLN B 2 220 ? -2.103  35.278 62.380 1.00 0.00  ? 219  GLN B HE21  1 
ATOM   2872 H  HE22  . GLN B 2 220 ? -3.434  35.707 61.361 1.00 0.00  ? 219  GLN B HE22  1 
ATOM   2873 N  N     . VAL B 2 221 ? -4.793  34.868 56.608 1.00 31.25 ? 220  VAL B N     1 
ATOM   2874 C  CA    . VAL B 2 221 ? -4.817  36.022 55.712 1.00 28.99 ? 220  VAL B CA    1 
ATOM   2875 C  C     . VAL B 2 221 ? -3.689  36.999 56.138 1.00 30.07 ? 220  VAL B C     1 
ATOM   2876 O  O     . VAL B 2 221 ? -3.625  37.404 57.307 1.00 31.82 ? 220  VAL B O     1 
ATOM   2877 C  CB    . VAL B 2 221 ? -6.260  36.614 55.754 1.00 29.71 ? 220  VAL B CB    1 
ATOM   2878 C  CG1   . VAL B 2 221 ? -6.289  38.056 56.223 1.00 31.57 ? 220  VAL B CG1   1 
ATOM   2879 C  CG2   . VAL B 2 221 ? -6.938  36.413 54.422 1.00 29.70 ? 220  VAL B CG2   1 
ATOM   2880 H  H     . VAL B 2 221 ? -5.461  34.840 57.320 1.00 0.00  ? 220  VAL B H     1 
ATOM   2881 N  N     . VAL B 2 222 ? -2.778  37.319 55.208 1.00 27.23 ? 221  VAL B N     1 
ATOM   2882 C  CA    . VAL B 2 222 ? -1.626  38.178 55.507 1.00 19.80 ? 221  VAL B CA    1 
ATOM   2883 C  C     . VAL B 2 222 ? -1.380  39.433 54.707 1.00 22.67 ? 221  VAL B C     1 
ATOM   2884 O  O     . VAL B 2 222 ? -0.349  40.075 54.875 1.00 26.06 ? 221  VAL B O     1 
ATOM   2885 C  CB    . VAL B 2 222 ? -0.324  37.390 55.496 1.00 19.31 ? 221  VAL B CB    1 
ATOM   2886 C  CG1   . VAL B 2 222 ? -0.282  36.448 56.682 1.00 23.08 ? 221  VAL B CG1   1 
ATOM   2887 C  CG2   . VAL B 2 222 ? -0.190  36.626 54.183 1.00 23.20 ? 221  VAL B CG2   1 
ATOM   2888 H  H     . VAL B 2 222 ? -2.826  36.942 54.319 1.00 0.00  ? 221  VAL B H     1 
ATOM   2889 N  N     . GLY B 2 223 ? -2.302  39.825 53.852 1.00 21.07 ? 222  GLY B N     1 
ATOM   2890 C  CA    . GLY B 2 223 ? -2.061  41.053 53.131 1.00 18.65 ? 222  GLY B CA    1 
ATOM   2891 C  C     . GLY B 2 223 ? -3.300  41.914 53.068 1.00 18.43 ? 222  GLY B C     1 
ATOM   2892 O  O     . GLY B 2 223 ? -4.165  41.832 53.931 1.00 11.35 ? 222  GLY B O     1 
ATOM   2893 H  H     . GLY B 2 223 ? -3.142  39.337 53.760 1.00 0.00  ? 222  GLY B H     1 
ATOM   2894 N  N     . HIS B 2 224 ? -3.336  42.768 52.047 1.00 20.65 ? 223  HIS B N     1 
ATOM   2895 C  CA    . HIS B 2 224 ? -4.454  43.654 51.776 1.00 23.88 ? 223  HIS B CA    1 
ATOM   2896 C  C     . HIS B 2 224 ? -5.405  42.812 50.969 1.00 24.45 ? 223  HIS B C     1 
ATOM   2897 O  O     . HIS B 2 224 ? -6.588  42.710 51.295 1.00 31.80 ? 223  HIS B O     1 
ATOM   2898 C  CB    . HIS B 2 224 ? -4.011  44.867 50.961 1.00 20.86 ? 223  HIS B CB    1 
ATOM   2899 C  CG    . HIS B 2 224 ? -3.201  45.841 51.745 1.00 25.25 ? 223  HIS B CG    1 
ATOM   2900 N  ND1   . HIS B 2 224 ? -1.977  46.311 51.315 1.00 27.65 ? 223  HIS B ND1   1 
ATOM   2901 C  CD2   . HIS B 2 224 ? -3.431  46.431 52.943 1.00 25.55 ? 223  HIS B CD2   1 
ATOM   2902 C  CE1   . HIS B 2 224 ? -1.487  47.147 52.214 1.00 25.15 ? 223  HIS B CE1   1 
ATOM   2903 N  NE2   . HIS B 2 224 ? -2.351  47.239 53.209 1.00 25.64 ? 223  HIS B NE2   1 
ATOM   2904 H  H     . HIS B 2 224 ? -2.568  42.745 51.458 1.00 0.00  ? 223  HIS B H     1 
ATOM   2905 H  HD1   . HIS B 2 224 ? -1.618  46.158 50.426 1.00 0.00  ? 223  HIS B HD1   1 
ATOM   2906 H  HE2   . HIS B 2 224 ? -2.231  47.805 54.003 1.00 0.00  ? 223  HIS B HE2   1 
ATOM   2907 N  N     . LEU B 2 225 ? -4.896  42.205 49.909 1.00 19.94 ? 224  LEU B N     1 
ATOM   2908 C  CA    . LEU B 2 225 ? -5.742  41.338 49.118 1.00 19.13 ? 224  LEU B CA    1 
ATOM   2909 C  C     . LEU B 2 225 ? -5.167  39.931 49.229 1.00 17.08 ? 224  LEU B C     1 
ATOM   2910 O  O     . LEU B 2 225 ? -3.982  39.731 48.949 1.00 17.99 ? 224  LEU B O     1 
ATOM   2911 C  CB    . LEU B 2 225 ? -5.767  41.773 47.647 1.00 17.22 ? 224  LEU B CB    1 
ATOM   2912 C  CG    . LEU B 2 225 ? -6.273  43.151 47.199 1.00 14.03 ? 224  LEU B CG    1 
ATOM   2913 C  CD1   . LEU B 2 225 ? -6.277  43.210 45.671 1.00 7.58  ? 224  LEU B CD1   1 
ATOM   2914 C  CD2   . LEU B 2 225 ? -7.662  43.391 47.719 1.00 17.43 ? 224  LEU B CD2   1 
ATOM   2915 H  H     . LEU B 2 225 ? -3.958  42.297 49.655 1.00 0.00  ? 224  LEU B H     1 
ATOM   2916 N  N     . ASP B 2 226 ? -5.978  38.990 49.709 1.00 17.12 ? 225  ASP B N     1 
ATOM   2917 C  CA    . ASP B 2 226 ? -5.578  37.587 49.825 1.00 16.57 ? 225  ASP B CA    1 
ATOM   2918 C  C     . ASP B 2 226 ? -6.470  36.784 48.870 1.00 19.66 ? 225  ASP B C     1 
ATOM   2919 O  O     . ASP B 2 226 ? -7.700  36.742 49.025 1.00 23.87 ? 225  ASP B O     1 
ATOM   2920 C  CB    . ASP B 2 226 ? -5.772  37.035 51.242 1.00 17.02 ? 225  ASP B CB    1 
ATOM   2921 C  CG    . ASP B 2 226 ? -4.800  37.617 52.270 1.00 18.89 ? 225  ASP B CG    1 
ATOM   2922 O  OD1   . ASP B 2 226 ? -5.025  38.731 52.784 1.00 23.52 ? 225  ASP B OD1   1 
ATOM   2923 O  OD2   . ASP B 2 226 ? -3.853  36.915 52.644 1.00 20.28 ? 225  ASP B OD2   1 
ATOM   2924 H  H     . ASP B 2 226 ? -6.893  39.225 49.962 1.00 0.00  ? 225  ASP B H     1 
ATOM   2925 N  N     . PHE B 2 227 ? -5.837  36.160 47.884 1.00 19.45 ? 226  PHE B N     1 
ATOM   2926 C  CA    . PHE B 2 227 ? -6.495  35.345 46.864 1.00 19.38 ? 226  PHE B CA    1 
ATOM   2927 C  C     . PHE B 2 227 ? -6.405  33.860 47.160 1.00 21.55 ? 226  PHE B C     1 
ATOM   2928 O  O     . PHE B 2 227 ? -5.337  33.353 47.527 1.00 25.52 ? 226  PHE B O     1 
ATOM   2929 C  CB    . PHE B 2 227 ? -5.827  35.599 45.515 1.00 12.08 ? 226  PHE B CB    1 
ATOM   2930 C  CG    . PHE B 2 227 ? -6.068  36.963 44.987 1.00 15.87 ? 226  PHE B CG    1 
ATOM   2931 C  CD1   . PHE B 2 227 ? -5.217  37.995 45.303 1.00 7.88  ? 226  PHE B CD1   1 
ATOM   2932 C  CD2   . PHE B 2 227 ? -7.177  37.221 44.172 1.00 16.54 ? 226  PHE B CD2   1 
ATOM   2933 C  CE1   . PHE B 2 227 ? -5.444  39.242 44.830 1.00 11.80 ? 226  PHE B CE1   1 
ATOM   2934 C  CE2   . PHE B 2 227 ? -7.408  38.476 43.689 1.00 13.91 ? 226  PHE B CE2   1 
ATOM   2935 C  CZ    . PHE B 2 227 ? -6.543  39.493 44.016 1.00 13.10 ? 226  PHE B CZ    1 
ATOM   2936 H  H     . PHE B 2 227 ? -4.878  36.279 47.805 1.00 0.00  ? 226  PHE B H     1 
ATOM   2937 N  N     . PHE B 2 228 ? -7.504  33.147 46.949 1.00 20.86 ? 227  PHE B N     1 
ATOM   2938 C  CA    . PHE B 2 228 ? -7.512  31.700 47.179 1.00 21.45 ? 227  PHE B CA    1 
ATOM   2939 C  C     . PHE B 2 228 ? -8.037  31.013 45.935 1.00 19.50 ? 227  PHE B C     1 
ATOM   2940 O  O     . PHE B 2 228 ? -9.219  30.608 45.884 1.00 22.77 ? 227  PHE B O     1 
ATOM   2941 C  CB    . PHE B 2 228 ? -8.374  31.337 48.393 1.00 17.90 ? 227  PHE B CB    1 
ATOM   2942 C  CG    . PHE B 2 228 ? -7.988  32.066 49.637 1.00 17.96 ? 227  PHE B CG    1 
ATOM   2943 C  CD1   . PHE B 2 228 ? -8.435  33.364 49.861 1.00 18.01 ? 227  PHE B CD1   1 
ATOM   2944 C  CD2   . PHE B 2 228 ? -7.209  31.450 50.606 1.00 19.47 ? 227  PHE B CD2   1 
ATOM   2945 C  CE1   . PHE B 2 228 ? -8.119  34.027 51.030 1.00 19.79 ? 227  PHE B CE1   1 
ATOM   2946 C  CE2   . PHE B 2 228 ? -6.888  32.115 51.795 1.00 16.75 ? 227  PHE B CE2   1 
ATOM   2947 C  CZ    . PHE B 2 228 ? -7.346  33.399 52.007 1.00 17.98 ? 227  PHE B CZ    1 
ATOM   2948 H  H     . PHE B 2 228 ? -8.336  33.588 46.659 1.00 0.00  ? 227  PHE B H     1 
ATOM   2949 N  N     . PRO B 2 229 ? -7.192  30.913 44.893 1.00 12.98 ? 228  PRO B N     1 
ATOM   2950 C  CA    . PRO B 2 229 ? -7.615  30.267 43.653 1.00 16.68 ? 228  PRO B CA    1 
ATOM   2951 C  C     . PRO B 2 229 ? -7.963  28.841 43.986 1.00 18.45 ? 228  PRO B C     1 
ATOM   2952 O  O     . PRO B 2 229 ? -7.396  28.277 44.923 1.00 21.62 ? 228  PRO B O     1 
ATOM   2953 C  CB    . PRO B 2 229 ? -6.377  30.373 42.758 1.00 10.25 ? 228  PRO B CB    1 
ATOM   2954 C  CG    . PRO B 2 229 ? -5.283  30.368 43.712 1.00 17.77 ? 228  PRO B CG    1 
ATOM   2955 C  CD    . PRO B 2 229 ? -5.771  31.264 44.833 1.00 15.62 ? 228  PRO B CD    1 
ATOM   2956 N  N     . ASN B 2 230 ? -8.992  28.325 43.322 1.00 20.61 ? 229  ASN B N     1 
ATOM   2957 C  CA    . ASN B 2 230 ? -9.467  26.958 43.503 1.00 17.28 ? 229  ASN B CA    1 
ATOM   2958 C  C     . ASN B 2 230 ? -9.761  26.609 44.981 1.00 17.44 ? 229  ASN B C     1 
ATOM   2959 O  O     . ASN B 2 230 ? -9.856  25.437 45.366 1.00 22.36 ? 229  ASN B O     1 
ATOM   2960 C  CB    . ASN B 2 230 ? -8.452  25.995 42.852 1.00 15.27 ? 229  ASN B CB    1 
ATOM   2961 C  CG    . ASN B 2 230 ? -8.144  26.373 41.384 1.00 16.32 ? 229  ASN B CG    1 
ATOM   2962 O  OD1   . ASN B 2 230 ? -9.040  26.426 40.564 1.00 18.10 ? 229  ASN B OD1   1 
ATOM   2963 N  ND2   . ASN B 2 230 ? -6.896  26.678 41.078 1.00 9.79  ? 229  ASN B ND2   1 
ATOM   2964 H  H     . ASN B 2 230 ? -9.428  28.863 42.643 1.00 0.00  ? 229  ASN B H     1 
ATOM   2965 H  HD21  . ASN B 2 230 ? -6.689  26.903 40.136 1.00 0.00  ? 229  ASN B HD21  1 
ATOM   2966 H  HD22  . ASN B 2 230 ? -6.209  26.659 41.774 1.00 0.00  ? 229  ASN B HD22  1 
ATOM   2967 N  N     . GLY B 2 231 ? -9.952  27.624 45.811 1.00 14.05 ? 230  GLY B N     1 
ATOM   2968 C  CA    . GLY B 2 231 ? -10.201 27.363 47.219 1.00 14.27 ? 230  GLY B CA    1 
ATOM   2969 C  C     . GLY B 2 231 ? -8.946  27.498 48.072 1.00 20.34 ? 230  GLY B C     1 
ATOM   2970 O  O     . GLY B 2 231 ? -9.028  27.573 49.306 1.00 19.63 ? 230  GLY B O     1 
ATOM   2971 H  H     . GLY B 2 231 ? -9.904  28.560 45.510 1.00 0.00  ? 230  GLY B H     1 
ATOM   2972 N  N     . GLY B 2 232 ? -7.785  27.509 47.412 1.00 21.24 ? 231  GLY B N     1 
ATOM   2973 C  CA    . GLY B 2 232 ? -6.500  27.630 48.087 1.00 23.25 ? 231  GLY B CA    1 
ATOM   2974 C  C     . GLY B 2 232 ? -5.967  26.432 48.875 1.00 25.52 ? 231  GLY B C     1 
ATOM   2975 O  O     . GLY B 2 232 ? -5.046  26.591 49.687 1.00 22.78 ? 231  GLY B O     1 
ATOM   2976 H  H     . GLY B 2 232 ? -7.794  27.409 46.450 1.00 0.00  ? 231  GLY B H     1 
ATOM   2977 N  N     . VAL B 2 233 ? -6.528  25.244 48.640 1.00 26.68 ? 232  VAL B N     1 
ATOM   2978 C  CA    . VAL B 2 233 ? -6.124  24.031 49.350 1.00 23.95 ? 232  VAL B CA    1 
ATOM   2979 C  C     . VAL B 2 233 ? -5.646  22.921 48.419 1.00 26.44 ? 232  VAL B C     1 
ATOM   2980 O  O     . VAL B 2 233 ? -4.585  22.318 48.657 1.00 23.35 ? 232  VAL B O     1 
ATOM   2981 C  CB    . VAL B 2 233 ? -7.266  23.499 50.257 1.00 21.63 ? 232  VAL B CB    1 
ATOM   2982 C  CG1   . VAL B 2 233 ? -6.780  22.332 51.116 1.00 17.95 ? 232  VAL B CG1   1 
ATOM   2983 C  CG2   . VAL B 2 233 ? -7.781  24.607 51.141 1.00 12.05 ? 232  VAL B CG2   1 
ATOM   2984 H  H     . VAL B 2 233 ? -7.264  25.177 47.996 1.00 0.00  ? 232  VAL B H     1 
ATOM   2985 N  N     . GLU B 2 234 ? -6.408  22.654 47.359 1.00 25.71 ? 233  GLU B N     1 
ATOM   2986 C  CA    . GLU B 2 234 ? -6.022  21.618 46.405 1.00 26.72 ? 233  GLU B CA    1 
ATOM   2987 C  C     . GLU B 2 234 ? -6.125  22.209 44.990 1.00 23.82 ? 233  GLU B C     1 
ATOM   2988 O  O     . GLU B 2 234 ? -7.156  22.721 44.602 1.00 25.33 ? 233  GLU B O     1 
ATOM   2989 C  CB    . GLU B 2 234 ? -6.923  20.398 46.616 1.00 34.75 ? 233  GLU B CB    1 
ATOM   2990 C  CG    . GLU B 2 234 ? -6.317  19.021 46.258 1.00 49.71 ? 233  GLU B CG    1 
ATOM   2991 C  CD    . GLU B 2 234 ? -4.979  18.670 46.960 1.00 56.17 ? 233  GLU B CD    1 
ATOM   2992 O  OE1   . GLU B 2 234 ? -4.935  18.585 48.216 1.00 57.98 ? 233  GLU B OE1   1 
ATOM   2993 O  OE2   . GLU B 2 234 ? -3.982  18.419 46.233 1.00 56.56 ? 233  GLU B OE2   1 
ATOM   2994 H  H     . GLU B 2 234 ? -7.244  23.158 47.216 1.00 0.00  ? 233  GLU B H     1 
ATOM   2995 N  N     . MET B 2 235 ? -5.030  22.197 44.241 1.00 22.15 ? 234  MET B N     1 
ATOM   2996 C  CA    . MET B 2 235 ? -5.013  22.783 42.900 1.00 23.24 ? 234  MET B CA    1 
ATOM   2997 C  C     . MET B 2 235 ? -5.277  21.770 41.792 1.00 25.01 ? 234  MET B C     1 
ATOM   2998 O  O     . MET B 2 235 ? -4.681  20.693 41.785 1.00 32.48 ? 234  MET B O     1 
ATOM   2999 C  CB    . MET B 2 235 ? -3.660  23.479 42.637 1.00 20.43 ? 234  MET B CB    1 
ATOM   3000 C  CG    . MET B 2 235 ? -3.300  24.596 43.623 1.00 15.61 ? 234  MET B CG    1 
ATOM   3001 S  SD    . MET B 2 235 ? -4.480  25.982 43.685 1.00 19.77 ? 234  MET B SD    1 
ATOM   3002 C  CE    . MET B 2 235 ? -5.083  25.922 45.336 1.00 2.00  ? 234  MET B CE    1 
ATOM   3003 H  H     . MET B 2 235 ? -4.202  21.806 44.586 1.00 0.00  ? 234  MET B H     1 
ATOM   3004 N  N     . PRO B 2 236 ? -6.197  22.079 40.858 1.00 25.21 ? 235  PRO B N     1 
ATOM   3005 C  CA    . PRO B 2 236 ? -6.485  21.151 39.767 1.00 25.53 ? 235  PRO B CA    1 
ATOM   3006 C  C     . PRO B 2 236 ? -5.248  20.782 38.951 1.00 24.12 ? 235  PRO B C     1 
ATOM   3007 O  O     . PRO B 2 236 ? -4.399  21.613 38.671 1.00 28.24 ? 235  PRO B O     1 
ATOM   3008 C  CB    . PRO B 2 236 ? -7.525  21.902 38.942 1.00 20.44 ? 235  PRO B CB    1 
ATOM   3009 C  CG    . PRO B 2 236 ? -7.329  23.293 39.305 1.00 22.71 ? 235  PRO B CG    1 
ATOM   3010 C  CD    . PRO B 2 236 ? -7.097  23.233 40.774 1.00 23.95 ? 235  PRO B CD    1 
ATOM   3011 N  N     . GLY B 2 237 ? -5.141  19.501 38.628 1.00 26.86 ? 236  GLY B N     1 
ATOM   3012 C  CA    . GLY B 2 237 ? -4.009  19.000 37.872 1.00 26.40 ? 236  GLY B CA    1 
ATOM   3013 C  C     . GLY B 2 237 ? -2.887  18.562 38.788 1.00 26.22 ? 236  GLY B C     1 
ATOM   3014 O  O     . GLY B 2 237 ? -1.857  18.078 38.343 1.00 27.34 ? 236  GLY B O     1 
ATOM   3015 H  H     . GLY B 2 237 ? -5.830  18.863 38.911 1.00 0.00  ? 236  GLY B H     1 
ATOM   3016 N  N     . CYS B 2 238 ? -3.071  18.753 40.078 1.00 25.34 ? 237  CYS B N     1 
ATOM   3017 C  CA    . CYS B 2 238 ? -2.042  18.361 40.987 1.00 30.56 ? 237  CYS B CA    1 
ATOM   3018 C  C     . CYS B 2 238 ? -2.148  16.904 41.376 1.00 34.79 ? 237  CYS B C     1 
ATOM   3019 O  O     . CYS B 2 238 ? -1.149  16.183 41.320 1.00 37.76 ? 237  CYS B O     1 
ATOM   3020 C  CB    . CYS B 2 238 ? -2.002  19.280 42.208 1.00 28.65 ? 237  CYS B CB    1 
ATOM   3021 S  SG    . CYS B 2 238 ? -1.038  20.782 41.878 1.00 29.00 ? 237  CYS B SG    1 
ATOM   3022 H  H     . CYS B 2 238 ? -3.876  19.170 40.431 1.00 0.00  ? 237  CYS B H     1 
ATOM   3023 N  N     . LYS B 2 239 ? -3.352  16.435 41.686 1.00 35.49 ? 238  LYS B N     1 
ATOM   3024 C  CA    . LYS B 2 239 ? -3.485  15.040 42.078 1.00 41.29 ? 238  LYS B CA    1 
ATOM   3025 C  C     . LYS B 2 239 ? -3.417  13.967 40.978 1.00 43.23 ? 238  LYS B C     1 
ATOM   3026 O  O     . LYS B 2 239 ? -4.186  13.006 40.987 1.00 44.26 ? 238  LYS B O     1 
ATOM   3027 C  CB    . LYS B 2 239 ? -4.701  14.833 42.972 1.00 43.82 ? 238  LYS B CB    1 
ATOM   3028 C  CG    . LYS B 2 239 ? -4.403  15.063 44.429 1.00 49.81 ? 238  LYS B CG    1 
ATOM   3029 C  CD    . LYS B 2 239 ? -5.512  14.500 45.299 1.00 59.73 ? 238  LYS B CD    1 
ATOM   3030 C  CE    . LYS B 2 239 ? -5.080  14.428 46.768 1.00 65.37 ? 238  LYS B CE    1 
ATOM   3031 N  NZ    . LYS B 2 239 ? -3.945  13.480 47.015 1.00 66.95 ? 238  LYS B NZ    1 
ATOM   3032 H  H     . LYS B 2 239 ? -4.135  17.016 41.638 1.00 0.00  ? 238  LYS B H     1 
ATOM   3033 H  HZ1   . LYS B 2 239 ? -3.125  13.781 46.451 1.00 0.00  ? 238  LYS B HZ1   1 
ATOM   3034 H  HZ2   . LYS B 2 239 ? -3.702  13.503 48.025 1.00 0.00  ? 238  LYS B HZ2   1 
ATOM   3035 H  HZ3   . LYS B 2 239 ? -4.220  12.517 46.738 1.00 0.00  ? 238  LYS B HZ3   1 
ATOM   3036 N  N     . LYS B 2 240 ? -2.482  14.104 40.043 1.00 44.10 ? 239  LYS B N     1 
ATOM   3037 C  CA    . LYS B 2 240 ? -2.348  13.102 38.993 1.00 41.92 ? 239  LYS B CA    1 
ATOM   3038 C  C     . LYS B 2 240 ? -1.575  11.934 39.635 1.00 40.98 ? 239  LYS B C     1 
ATOM   3039 O  O     . LYS B 2 240 ? -0.975  12.096 40.700 1.00 41.21 ? 239  LYS B O     1 
ATOM   3040 C  CB    . LYS B 2 240 ? -1.531  13.649 37.810 1.00 42.11 ? 239  LYS B CB    1 
ATOM   3041 C  CG    . LYS B 2 240 ? -2.053  14.876 37.087 1.00 35.33 ? 239  LYS B CG    1 
ATOM   3042 C  CD    . LYS B 2 240 ? -0.953  15.352 36.138 1.00 38.31 ? 239  LYS B CD    1 
ATOM   3043 C  CE    . LYS B 2 240 ? -1.411  16.422 35.155 1.00 39.50 ? 239  LYS B CE    1 
ATOM   3044 N  NZ    . LYS B 2 240 ? -1.568  17.769 35.772 1.00 38.20 ? 239  LYS B NZ    1 
ATOM   3045 H  H     . LYS B 2 240 ? -1.834  14.843 40.081 1.00 0.00  ? 239  LYS B H     1 
ATOM   3046 H  HZ1   . LYS B 2 240 ? -0.652  17.995 36.206 1.00 0.00  ? 239  LYS B HZ1   1 
ATOM   3047 H  HZ2   . LYS B 2 240 ? -1.817  18.470 35.046 1.00 0.00  ? 239  LYS B HZ2   1 
ATOM   3048 H  HZ3   . LYS B 2 240 ? -2.307  17.724 36.500 1.00 0.00  ? 239  LYS B HZ3   1 
ATOM   3049 N  N     . ASN B 2 241 ? -1.566  10.769 38.995 1.00 38.55 ? 240  ASN B N     1 
ATOM   3050 C  CA    . ASN B 2 241 ? -0.828  9.652  39.560 1.00 37.76 ? 240  ASN B CA    1 
ATOM   3051 C  C     . ASN B 2 241 ? 0.657   9.920  39.384 1.00 36.21 ? 240  ASN B C     1 
ATOM   3052 O  O     . ASN B 2 241 ? 1.064   10.678 38.506 1.00 34.22 ? 240  ASN B O     1 
ATOM   3053 C  CB    . ASN B 2 241 ? -1.250  8.283  38.992 1.00 39.66 ? 240  ASN B CB    1 
ATOM   3054 C  CG    . ASN B 2 241 ? -1.212  8.228  37.486 1.00 40.60 ? 240  ASN B CG    1 
ATOM   3055 O  OD1   . ASN B 2 241 ? -0.202  8.544  36.862 1.00 42.88 ? 240  ASN B OD1   1 
ATOM   3056 N  ND2   . ASN B 2 241 ? -2.321  7.825  36.890 1.00 42.24 ? 240  ASN B ND2   1 
ATOM   3057 H  H     . ASN B 2 241 ? -1.990  10.675 38.132 1.00 0.00  ? 240  ASN B H     1 
ATOM   3058 H  HD21  . ASN B 2 241 ? -2.285  7.801  35.909 1.00 0.00  ? 240  ASN B HD21  1 
ATOM   3059 H  HD22  . ASN B 2 241 ? -3.105  7.575  37.419 1.00 0.00  ? 240  ASN B HD22  1 
ATOM   3060 N  N     . ILE B 2 242 ? 1.445   9.276  40.235 1.00 36.66 ? 241  ILE B N     1 
ATOM   3061 C  CA    . ILE B 2 242 ? 2.886   9.439  40.316 1.00 37.09 ? 241  ILE B CA    1 
ATOM   3062 C  C     . ILE B 2 242 ? 3.686   9.464  39.015 1.00 36.25 ? 241  ILE B C     1 
ATOM   3063 O  O     . ILE B 2 242 ? 4.520   10.346 38.810 1.00 39.17 ? 241  ILE B O     1 
ATOM   3064 C  CB    . ILE B 2 242 ? 3.446   8.417  41.346 1.00 38.65 ? 241  ILE B CB    1 
ATOM   3065 C  CG1   . ILE B 2 242 ? 4.883   8.758  41.781 1.00 39.69 ? 241  ILE B CG1   1 
ATOM   3066 C  CG2   . ILE B 2 242 ? 3.294   7.017  40.814 1.00 40.88 ? 241  ILE B CG2   1 
ATOM   3067 C  CD1   . ILE B 2 242 ? 5.977   8.301  40.853 1.00 36.97 ? 241  ILE B CD1   1 
ATOM   3068 H  H     . ILE B 2 242 ? 1.023   8.658  40.864 1.00 0.00  ? 241  ILE B H     1 
ATOM   3069 N  N     . LEU B 2 243 ? 3.394   8.540  38.115 1.00 38.40 ? 242  LEU B N     1 
ATOM   3070 C  CA    . LEU B 2 243 ? 4.119   8.450  36.858 1.00 37.82 ? 242  LEU B CA    1 
ATOM   3071 C  C     . LEU B 2 243 ? 3.856   9.653  35.935 1.00 38.90 ? 242  LEU B C     1 
ATOM   3072 O  O     . LEU B 2 243 ? 4.751   10.106 35.215 1.00 36.54 ? 242  LEU B O     1 
ATOM   3073 C  CB    . LEU B 2 243 ? 3.750   7.133  36.165 1.00 38.70 ? 242  LEU B CB    1 
ATOM   3074 C  CG    . LEU B 2 243 ? 4.835   6.219  35.580 1.00 36.68 ? 242  LEU B CG    1 
ATOM   3075 C  CD1   . LEU B 2 243 ? 4.478   5.924  34.144 1.00 38.10 ? 242  LEU B CD1   1 
ATOM   3076 C  CD2   . LEU B 2 243 ? 6.210   6.849  35.671 1.00 37.24 ? 242  LEU B CD2   1 
ATOM   3077 H  H     . LEU B 2 243 ? 2.664   7.914  38.280 1.00 0.00  ? 242  LEU B H     1 
ATOM   3078 N  N     . SER B 2 244 ? 2.630   10.175 36.004 1.00 40.88 ? 243  SER B N     1 
ATOM   3079 C  CA    . SER B 2 244 ? 2.171   11.312 35.202 1.00 37.84 ? 243  SER B CA    1 
ATOM   3080 C  C     . SER B 2 244 ? 2.680   12.646 35.734 1.00 37.51 ? 243  SER B C     1 
ATOM   3081 O  O     . SER B 2 244 ? 2.968   13.539 34.954 1.00 40.35 ? 243  SER B O     1 
ATOM   3082 C  CB    . SER B 2 244 ? 0.641   11.327 35.150 1.00 37.90 ? 243  SER B CB    1 
ATOM   3083 O  OG    . SER B 2 244 ? 0.112   10.064 34.767 1.00 33.12 ? 243  SER B OG    1 
ATOM   3084 H  H     . SER B 2 244 ? 1.981   9.792  36.627 1.00 0.00  ? 243  SER B H     1 
ATOM   3085 H  HG    . SER B 2 244 ? 0.423   9.384  35.365 1.00 0.00  ? 243  SER B HG    1 
ATOM   3086 N  N     . GLN B 2 245 ? 2.771   12.798 37.056 1.00 38.30 ? 244  GLN B N     1 
ATOM   3087 C  CA    . GLN B 2 245 ? 3.284   14.041 37.643 1.00 39.49 ? 244  GLN B CA    1 
ATOM   3088 C  C     . GLN B 2 245 ? 4.733   14.205 37.230 1.00 38.79 ? 244  GLN B C     1 
ATOM   3089 O  O     . GLN B 2 245 ? 5.134   15.254 36.718 1.00 41.45 ? 244  GLN B O     1 
ATOM   3090 C  CB    . GLN B 2 245 ? 3.240   14.017 39.175 1.00 43.80 ? 244  GLN B CB    1 
ATOM   3091 C  CG    . GLN B 2 245 ? 1.853   14.012 39.809 1.00 50.98 ? 244  GLN B CG    1 
ATOM   3092 C  CD    . GLN B 2 245 ? 1.321   15.411 40.112 1.00 53.73 ? 244  GLN B CD    1 
ATOM   3093 O  OE1   . GLN B 2 245 ? 0.903   16.138 39.214 1.00 55.43 ? 244  GLN B OE1   1 
ATOM   3094 N  NE2   . GLN B 2 245 ? 1.312   15.778 41.387 1.00 54.37 ? 244  GLN B NE2   1 
ATOM   3095 H  H     . GLN B 2 245 ? 2.470   12.065 37.630 1.00 0.00  ? 244  GLN B H     1 
ATOM   3096 H  HE21  . GLN B 2 245 ? 0.907   16.657 41.542 1.00 0.00  ? 244  GLN B HE21  1 
ATOM   3097 H  HE22  . GLN B 2 245 ? 1.644   15.219 42.111 1.00 0.00  ? 244  GLN B HE22  1 
ATOM   3098 N  N     . ILE B 2 246 ? 5.502   13.135 37.416 1.00 39.27 ? 245  ILE B N     1 
ATOM   3099 C  CA    . ILE B 2 246 ? 6.930   13.119 37.108 1.00 37.81 ? 245  ILE B CA    1 
ATOM   3100 C  C     . ILE B 2 246 ? 7.281   13.252 35.621 1.00 42.01 ? 245  ILE B C     1 
ATOM   3101 O  O     . ILE B 2 246 ? 8.220   13.985 35.258 1.00 38.39 ? 245  ILE B O     1 
ATOM   3102 C  CB    . ILE B 2 246 ? 7.591   11.889 37.784 1.00 36.37 ? 245  ILE B CB    1 
ATOM   3103 C  CG1   . ILE B 2 246 ? 7.639   12.139 39.293 1.00 34.68 ? 245  ILE B CG1   1 
ATOM   3104 C  CG2   . ILE B 2 246 ? 8.985   11.634 37.243 1.00 35.75 ? 245  ILE B CG2   1 
ATOM   3105 C  CD1   . ILE B 2 246 ? 8.058   10.984 40.105 1.00 33.84 ? 245  ILE B CD1   1 
ATOM   3106 H  H     . ILE B 2 246 ? 5.107   12.315 37.784 1.00 0.00  ? 245  ILE B H     1 
ATOM   3107 N  N     . VAL B 2 247 ? 6.497   12.576 34.773 1.00 46.86 ? 246  VAL B N     1 
ATOM   3108 C  CA    . VAL B 2 247 ? 6.670   12.600 33.312 1.00 48.42 ? 246  VAL B CA    1 
ATOM   3109 C  C     . VAL B 2 247 ? 5.650   13.581 32.706 1.00 51.85 ? 246  VAL B C     1 
ATOM   3110 O  O     . VAL B 2 247 ? 4.827   13.209 31.862 1.00 51.15 ? 246  VAL B O     1 
ATOM   3111 C  CB    . VAL B 2 247 ? 6.439   11.174 32.692 1.00 47.44 ? 246  VAL B CB    1 
ATOM   3112 C  CG1   . VAL B 2 247 ? 6.957   11.117 31.242 1.00 39.36 ? 246  VAL B CG1   1 
ATOM   3113 C  CG2   . VAL B 2 247 ? 7.096   10.091 33.573 1.00 46.17 ? 246  VAL B CG2   1 
ATOM   3114 H  H     . VAL B 2 247 ? 5.753   12.038 35.120 1.00 0.00  ? 246  VAL B H     1 
ATOM   3115 N  N     . ASP B 2 248 ? 5.658   14.821 33.177 1.00 54.31 ? 247  ASP B N     1 
ATOM   3116 C  CA    . ASP B 2 248 ? 4.717   15.797 32.651 1.00 54.89 ? 247  ASP B CA    1 
ATOM   3117 C  C     . ASP B 2 248 ? 5.368   16.577 31.511 1.00 52.56 ? 247  ASP B C     1 
ATOM   3118 O  O     . ASP B 2 248 ? 6.592   16.586 31.358 1.00 48.53 ? 247  ASP B O     1 
ATOM   3119 C  CB    . ASP B 2 248 ? 4.218   16.726 33.765 1.00 60.08 ? 247  ASP B CB    1 
ATOM   3120 C  CG    . ASP B 2 248 ? 2.742   17.090 33.614 1.00 62.66 ? 247  ASP B CG    1 
ATOM   3121 O  OD1   . ASP B 2 248 ? 2.435   18.015 32.832 1.00 65.84 ? 247  ASP B OD1   1 
ATOM   3122 O  OD2   . ASP B 2 248 ? 1.887   16.462 34.286 1.00 61.35 ? 247  ASP B OD2   1 
ATOM   3123 H  H     . ASP B 2 248 ? 6.299   15.085 33.869 1.00 0.00  ? 247  ASP B H     1 
ATOM   3124 N  N     . ILE B 2 249 ? 4.523   17.221 30.714 1.00 53.48 ? 248  ILE B N     1 
ATOM   3125 C  CA    . ILE B 2 249 ? 4.907   18.010 29.539 1.00 53.37 ? 248  ILE B CA    1 
ATOM   3126 C  C     . ILE B 2 249 ? 6.119   18.951 29.602 1.00 55.80 ? 248  ILE B C     1 
ATOM   3127 O  O     . ILE B 2 249 ? 6.600   19.379 28.553 1.00 56.08 ? 248  ILE B O     1 
ATOM   3128 C  CB    . ILE B 2 249 ? 3.688   18.802 29.033 1.00 54.46 ? 248  ILE B CB    1 
ATOM   3129 C  CG1   . ILE B 2 249 ? 3.235   19.811 30.105 1.00 55.45 ? 248  ILE B CG1   1 
ATOM   3130 C  CG2   . ILE B 2 249 ? 2.551   17.826 28.691 1.00 54.57 ? 248  ILE B CG2   1 
ATOM   3131 C  CD1   . ILE B 2 249 ? 1.872   20.449 29.878 1.00 51.81 ? 248  ILE B CD1   1 
ATOM   3132 H  H     . ILE B 2 249 ? 3.570   17.146 30.934 1.00 0.00  ? 248  ILE B H     1 
ATOM   3133 N  N     . ASP B 2 250 ? 6.619   19.256 30.805 1.00 59.78 ? 249  ASP B N     1 
ATOM   3134 C  CA    . ASP B 2 250 ? 7.778   20.155 30.988 1.00 58.32 ? 249  ASP B CA    1 
ATOM   3135 C  C     . ASP B 2 250 ? 9.119   19.502 31.320 1.00 56.23 ? 249  ASP B C     1 
ATOM   3136 O  O     . ASP B 2 250 ? 10.076  20.195 31.658 1.00 52.46 ? 249  ASP B O     1 
ATOM   3137 C  CB    . ASP B 2 250 ? 7.490   21.185 32.078 1.00 59.81 ? 249  ASP B CB    1 
ATOM   3138 C  CG    . ASP B 2 250 ? 6.692   22.345 31.576 1.00 62.11 ? 249  ASP B CG    1 
ATOM   3139 O  OD1   . ASP B 2 250 ? 5.460   22.203 31.485 1.00 65.29 ? 249  ASP B OD1   1 
ATOM   3140 O  OD2   . ASP B 2 250 ? 7.296   23.396 31.272 1.00 63.42 ? 249  ASP B OD2   1 
ATOM   3141 H  H     . ASP B 2 250 ? 6.224   18.850 31.609 1.00 0.00  ? 249  ASP B H     1 
ATOM   3142 N  N     . GLY B 2 251 ? 9.194   18.182 31.248 1.00 57.44 ? 250  GLY B N     1 
ATOM   3143 C  CA    . GLY B 2 251 ? 10.438  17.516 31.572 1.00 59.24 ? 250  GLY B CA    1 
ATOM   3144 C  C     . GLY B 2 251 ? 10.422  16.960 32.985 1.00 60.17 ? 250  GLY B C     1 
ATOM   3145 O  O     . GLY B 2 251 ? 9.601   17.357 33.820 1.00 63.67 ? 250  GLY B O     1 
ATOM   3146 H  H     . GLY B 2 251 ? 8.398   17.658 31.004 1.00 0.00  ? 250  GLY B H     1 
ATOM   3147 N  N     . ILE B 2 252 ? 11.368  16.069 33.258 1.00 59.10 ? 251  ILE B N     1 
ATOM   3148 C  CA    . ILE B 2 252 ? 11.496  15.402 34.550 1.00 53.06 ? 251  ILE B CA    1 
ATOM   3149 C  C     . ILE B 2 252 ? 11.613  16.380 35.714 1.00 49.19 ? 251  ILE B C     1 
ATOM   3150 O  O     . ILE B 2 252 ? 10.776  16.350 36.608 1.00 46.72 ? 251  ILE B O     1 
ATOM   3151 C  CB    . ILE B 2 252 ? 12.703  14.392 34.537 1.00 54.16 ? 251  ILE B CB    1 
ATOM   3152 C  CG1   . ILE B 2 252 ? 12.356  13.169 33.686 1.00 50.92 ? 251  ILE B CG1   1 
ATOM   3153 C  CG2   . ILE B 2 252 ? 13.074  13.928 35.949 1.00 54.37 ? 251  ILE B CG2   1 
ATOM   3154 C  CD1   . ILE B 2 252 ? 12.284  13.440 32.213 1.00 50.21 ? 251  ILE B CD1   1 
ATOM   3155 H  H     . ILE B 2 252 ? 12.019  15.874 32.558 1.00 0.00  ? 251  ILE B H     1 
ATOM   3156 N  N     . TRP B 2 253 ? 12.606  17.270 35.669 1.00 44.15 ? 252  TRP B N     1 
ATOM   3157 C  CA    . TRP B 2 253 ? 12.824  18.244 36.745 1.00 40.84 ? 252  TRP B CA    1 
ATOM   3158 C  C     . TRP B 2 253 ? 11.558  18.990 37.189 1.00 36.62 ? 252  TRP B C     1 
ATOM   3159 O  O     . TRP B 2 253 ? 11.303  19.120 38.384 1.00 35.44 ? 252  TRP B O     1 
ATOM   3160 C  CB    . TRP B 2 253 ? 13.916  19.246 36.363 1.00 39.54 ? 252  TRP B CB    1 
ATOM   3161 C  CG    . TRP B 2 253 ? 14.335  20.180 37.491 1.00 36.59 ? 252  TRP B CG    1 
ATOM   3162 C  CD1   . TRP B 2 253 ? 14.470  21.537 37.421 1.00 37.65 ? 252  TRP B CD1   1 
ATOM   3163 C  CD2   . TRP B 2 253 ? 14.702  19.811 38.827 1.00 35.57 ? 252  TRP B CD2   1 
ATOM   3164 N  NE1   . TRP B 2 253 ? 14.900  22.037 38.629 1.00 36.73 ? 252  TRP B NE1   1 
ATOM   3165 C  CE2   . TRP B 2 253 ? 15.052  21.000 39.509 1.00 35.28 ? 252  TRP B CE2   1 
ATOM   3166 C  CE3   . TRP B 2 253 ? 14.768  18.595 39.516 1.00 34.96 ? 252  TRP B CE3   1 
ATOM   3167 C  CZ2   . TRP B 2 253 ? 15.465  21.006 40.841 1.00 36.34 ? 252  TRP B CZ2   1 
ATOM   3168 C  CZ3   . TRP B 2 253 ? 15.179  18.604 40.849 1.00 36.44 ? 252  TRP B CZ3   1 
ATOM   3169 C  CH2   . TRP B 2 253 ? 15.522  19.804 41.494 1.00 34.83 ? 252  TRP B CH2   1 
ATOM   3170 H  H     . TRP B 2 253 ? 13.194  17.280 34.895 1.00 0.00  ? 252  TRP B H     1 
ATOM   3171 H  HE1   . TRP B 2 253 ? 15.046  22.986 38.815 1.00 0.00  ? 252  TRP B HE1   1 
ATOM   3172 N  N     . GLU B 2 254 ? 10.778  19.495 36.242 1.00 31.23 ? 253  GLU B N     1 
ATOM   3173 C  CA    . GLU B 2 254 ? 9.554   20.188 36.600 1.00 30.11 ? 253  GLU B CA    1 
ATOM   3174 C  C     . GLU B 2 254 ? 8.604   19.190 37.261 1.00 31.37 ? 253  GLU B C     1 
ATOM   3175 O  O     . GLU B 2 254 ? 8.038   19.462 38.347 1.00 25.53 ? 253  GLU B O     1 
ATOM   3176 C  CB    . GLU B 2 254 ? 8.913   20.778 35.355 1.00 33.63 ? 253  GLU B CB    1 
ATOM   3177 C  CG    . GLU B 2 254 ? 9.518   22.066 34.918 1.00 33.78 ? 253  GLU B CG    1 
ATOM   3178 C  CD    . GLU B 2 254 ? 9.129   23.211 35.826 1.00 39.48 ? 253  GLU B CD    1 
ATOM   3179 O  OE1   . GLU B 2 254 ? 7.983   23.727 35.731 1.00 44.55 ? 253  GLU B OE1   1 
ATOM   3180 O  OE2   . GLU B 2 254 ? 9.982   23.601 36.638 1.00 44.08 ? 253  GLU B OE2   1 
ATOM   3181 H  H     . GLU B 2 254 ? 11.044  19.401 35.307 1.00 0.00  ? 253  GLU B H     1 
ATOM   3182 N  N     . GLY B 2 255 ? 8.506   18.010 36.634 1.00 28.34 ? 254  GLY B N     1 
ATOM   3183 C  CA    . GLY B 2 255 ? 7.655   16.930 37.121 1.00 26.94 ? 254  GLY B CA    1 
ATOM   3184 C  C     . GLY B 2 255 ? 7.969   16.502 38.545 1.00 24.99 ? 254  GLY B C     1 
ATOM   3185 O  O     . GLY B 2 255 ? 7.078   16.347 39.387 1.00 26.47 ? 254  GLY B O     1 
ATOM   3186 H  H     . GLY B 2 255 ? 9.043   17.843 35.831 1.00 0.00  ? 254  GLY B H     1 
ATOM   3187 N  N     . THR B 2 256 ? 9.250   16.338 38.821 1.00 22.67 ? 255  THR B N     1 
ATOM   3188 C  CA    . THR B 2 256 ? 9.739   15.943 40.133 1.00 28.08 ? 255  THR B CA    1 
ATOM   3189 C  C     . THR B 2 256 ? 9.412   16.990 41.213 1.00 27.70 ? 255  THR B C     1 
ATOM   3190 O  O     . THR B 2 256 ? 8.953   16.661 42.315 1.00 26.64 ? 255  THR B O     1 
ATOM   3191 C  CB    . THR B 2 256 ? 11.245  15.712 40.022 1.00 30.78 ? 255  THR B CB    1 
ATOM   3192 O  OG1   . THR B 2 256 ? 11.472  14.644 39.080 1.00 28.90 ? 255  THR B OG1   1 
ATOM   3193 C  CG2   . THR B 2 256 ? 11.855  15.395 41.374 1.00 31.13 ? 255  THR B CG2   1 
ATOM   3194 H  H     . THR B 2 256 ? 9.910   16.491 38.134 1.00 0.00  ? 255  THR B H     1 
ATOM   3195 H  HG1   . THR B 2 256 ? 11.021  13.849 39.374 1.00 0.00  ? 255  THR B HG1   1 
ATOM   3196 N  N     . ARG B 2 257 ? 9.639   18.254 40.883 1.00 28.65 ? 256  ARG B N     1 
ATOM   3197 C  CA    . ARG B 2 257 ? 9.329   19.348 41.789 1.00 26.86 ? 256  ARG B CA    1 
ATOM   3198 C  C     . ARG B 2 257 ? 7.835   19.244 42.089 1.00 25.48 ? 256  ARG B C     1 
ATOM   3199 O  O     . ARG B 2 257 ? 7.435   19.320 43.244 1.00 26.91 ? 256  ARG B O     1 
ATOM   3200 C  CB    . ARG B 2 257 ? 9.642   20.707 41.121 1.00 26.42 ? 256  ARG B CB    1 
ATOM   3201 C  CG    . ARG B 2 257 ? 11.117  20.957 40.904 1.00 25.07 ? 256  ARG B CG    1 
ATOM   3202 C  CD    . ARG B 2 257 ? 11.399  22.129 39.991 1.00 24.88 ? 256  ARG B CD    1 
ATOM   3203 N  NE    . ARG B 2 257 ? 11.063  23.431 40.562 1.00 25.93 ? 256  ARG B NE    1 
ATOM   3204 C  CZ    . ARG B 2 257 ? 11.695  24.023 41.576 1.00 24.11 ? 256  ARG B CZ    1 
ATOM   3205 N  NH1   . ARG B 2 257 ? 12.685  23.423 42.210 1.00 20.32 ? 256  ARG B NH1   1 
ATOM   3206 N  NH2   . ARG B 2 257 ? 11.295  25.222 41.989 1.00 28.55 ? 256  ARG B NH2   1 
ATOM   3207 H  H     . ARG B 2 257 ? 10.010  18.481 40.000 1.00 0.00  ? 256  ARG B H     1 
ATOM   3208 H  HE    . ARG B 2 257 ? 10.307  23.900 40.157 1.00 0.00  ? 256  ARG B HE    1 
ATOM   3209 H  HH11  . ARG B 2 257 ? 12.969  22.506 41.935 1.00 0.00  ? 256  ARG B HH11  1 
ATOM   3210 H  HH12  . ARG B 2 257 ? 13.146  23.875 42.972 1.00 0.00  ? 256  ARG B HH12  1 
ATOM   3211 H  HH21  . ARG B 2 257 ? 10.521  25.661 41.531 1.00 0.00  ? 256  ARG B HH21  1 
ATOM   3212 H  HH22  . ARG B 2 257 ? 11.758  25.676 42.747 1.00 0.00  ? 256  ARG B HH22  1 
ATOM   3213 N  N     . ASP B 2 258 ? 7.024   19.029 41.050 1.00 25.18 ? 257  ASP B N     1 
ATOM   3214 C  CA    . ASP B 2 258 ? 5.568   18.919 41.204 1.00 27.45 ? 257  ASP B CA    1 
ATOM   3215 C  C     . ASP B 2 258 ? 5.161   17.692 41.993 1.00 28.32 ? 257  ASP B C     1 
ATOM   3216 O  O     . ASP B 2 258 ? 4.142   17.712 42.704 1.00 27.90 ? 257  ASP B O     1 
ATOM   3217 C  CB    . ASP B 2 258 ? 4.845   18.922 39.848 1.00 30.73 ? 257  ASP B CB    1 
ATOM   3218 C  CG    . ASP B 2 258 ? 4.386   20.313 39.424 1.00 32.74 ? 257  ASP B CG    1 
ATOM   3219 O  OD1   . ASP B 2 258 ? 4.870   21.323 39.982 1.00 33.50 ? 257  ASP B OD1   1 
ATOM   3220 O  OD2   . ASP B 2 258 ? 3.537   20.405 38.516 1.00 36.80 ? 257  ASP B OD2   1 
ATOM   3221 H  H     . ASP B 2 258 ? 7.417   18.952 40.153 1.00 0.00  ? 257  ASP B H     1 
ATOM   3222 N  N     . PHE B 2 259 ? 5.933   16.614 41.877 1.00 27.41 ? 258  PHE B N     1 
ATOM   3223 C  CA    . PHE B 2 259 ? 5.601   15.425 42.645 1.00 27.88 ? 258  PHE B CA    1 
ATOM   3224 C  C     . PHE B 2 259 ? 5.756   15.802 44.117 1.00 26.71 ? 258  PHE B C     1 
ATOM   3225 O  O     . PHE B 2 259 ? 4.932   15.466 44.958 1.00 19.74 ? 258  PHE B O     1 
ATOM   3226 C  CB    . PHE B 2 259 ? 6.533   14.258 42.312 1.00 34.81 ? 258  PHE B CB    1 
ATOM   3227 C  CG    . PHE B 2 259 ? 6.348   13.070 43.219 1.00 43.62 ? 258  PHE B CG    1 
ATOM   3228 C  CD1   . PHE B 2 259 ? 5.186   12.308 43.164 1.00 47.03 ? 258  PHE B CD1   1 
ATOM   3229 C  CD2   . PHE B 2 259 ? 7.294   12.767 44.188 1.00 47.08 ? 258  PHE B CD2   1 
ATOM   3230 C  CE1   . PHE B 2 259 ? 4.972   11.282 44.063 1.00 48.62 ? 258  PHE B CE1   1 
ATOM   3231 C  CE2   . PHE B 2 259 ? 7.084   11.737 45.093 1.00 47.09 ? 258  PHE B CE2   1 
ATOM   3232 C  CZ    . PHE B 2 259 ? 5.922   10.998 45.030 1.00 47.79 ? 258  PHE B CZ    1 
ATOM   3233 H  H     . PHE B 2 259 ? 6.686   16.630 41.254 1.00 0.00  ? 258  PHE B H     1 
ATOM   3234 N  N     . ALA B 2 260 ? 6.785   16.587 44.389 1.00 22.55 ? 259  ALA B N     1 
ATOM   3235 C  CA    . ALA B 2 260 ? 7.083   17.012 45.737 1.00 26.42 ? 259  ALA B CA    1 
ATOM   3236 C  C     . ALA B 2 260 ? 6.167   18.076 46.341 1.00 29.74 ? 259  ALA B C     1 
ATOM   3237 O  O     . ALA B 2 260 ? 5.915   18.053 47.563 1.00 30.87 ? 259  ALA B O     1 
ATOM   3238 C  CB    . ALA B 2 260 ? 8.534   17.499 45.795 1.00 25.43 ? 259  ALA B CB    1 
ATOM   3239 H  H     . ALA B 2 260 ? 7.381   16.882 43.671 1.00 0.00  ? 259  ALA B H     1 
ATOM   3240 N  N     . ALA B 2 261 ? 5.709   19.026 45.518 1.00 25.96 ? 260  ALA B N     1 
ATOM   3241 C  CA    . ALA B 2 261 ? 4.909   20.139 46.038 1.00 27.81 ? 260  ALA B CA    1 
ATOM   3242 C  C     . ALA B 2 261 ? 4.167   20.922 44.962 1.00 25.16 ? 260  ALA B C     1 
ATOM   3243 O  O     . ALA B 2 261 ? 4.278   22.156 44.879 1.00 22.00 ? 260  ALA B O     1 
ATOM   3244 C  CB    . ALA B 2 261 ? 5.826   21.105 46.839 1.00 31.05 ? 260  ALA B CB    1 
ATOM   3245 H  H     . ALA B 2 261 ? 5.931   18.966 44.559 1.00 0.00  ? 260  ALA B H     1 
ATOM   3246 N  N     . CYS B 2 262 ? 3.319   20.211 44.228 1.00 23.64 ? 261  CYS B N     1 
ATOM   3247 C  CA    . CYS B 2 262 ? 2.544   20.770 43.132 1.00 18.12 ? 261  CYS B CA    1 
ATOM   3248 C  C     . CYS B 2 262 ? 1.709   21.993 43.502 1.00 17.02 ? 261  CYS B C     1 
ATOM   3249 O  O     . CYS B 2 262 ? 1.853   23.042 42.881 1.00 13.62 ? 261  CYS B O     1 
ATOM   3250 C  CB    . CYS B 2 262 ? 1.679   19.657 42.553 1.00 23.55 ? 261  CYS B CB    1 
ATOM   3251 S  SG    . CYS B 2 262 ? 0.720   20.104 41.095 1.00 27.83 ? 261  CYS B SG    1 
ATOM   3252 H  H     . CYS B 2 262 ? 3.196   19.247 44.412 1.00 0.00  ? 261  CYS B H     1 
ATOM   3253 N  N     . ASN B 2 263 ? 0.849   21.854 44.514 1.00 12.84 ? 262  ASN B N     1 
ATOM   3254 C  CA    . ASN B 2 263 ? -0.009  22.942 44.956 1.00 11.88 ? 262  ASN B CA    1 
ATOM   3255 C  C     . ASN B 2 263 ? 0.818   24.175 45.268 1.00 18.99 ? 262  ASN B C     1 
ATOM   3256 O  O     . ASN B 2 263 ? 0.556   25.262 44.774 1.00 23.22 ? 262  ASN B O     1 
ATOM   3257 C  CB    . ASN B 2 263 ? -0.775  22.572 46.230 1.00 11.86 ? 262  ASN B CB    1 
ATOM   3258 C  CG    . ASN B 2 263 ? -1.861  21.547 46.001 1.00 16.62 ? 262  ASN B CG    1 
ATOM   3259 O  OD1   . ASN B 2 263 ? -2.409  21.409 44.890 1.00 15.79 ? 262  ASN B OD1   1 
ATOM   3260 N  ND2   . ASN B 2 263 ? -2.218  20.835 47.069 1.00 15.57 ? 262  ASN B ND2   1 
ATOM   3261 H  H     . ASN B 2 263 ? 0.809   20.978 44.966 1.00 0.00  ? 262  ASN B H     1 
ATOM   3262 H  HD21  . ASN B 2 263 ? -2.905  20.152 46.975 1.00 0.00  ? 262  ASN B HD21  1 
ATOM   3263 H  HD22  . ASN B 2 263 ? -1.753  21.035 47.909 1.00 0.00  ? 262  ASN B HD22  1 
ATOM   3264 N  N     . HIS B 2 264 ? 1.831   23.980 46.104 1.00 24.20 ? 263  HIS B N     1 
ATOM   3265 C  CA    . HIS B 2 264 ? 2.728   25.037 46.564 1.00 19.33 ? 263  HIS B CA    1 
ATOM   3266 C  C     . HIS B 2 264 ? 3.377   25.807 45.392 1.00 19.14 ? 263  HIS B C     1 
ATOM   3267 O  O     . HIS B 2 264 ? 3.488   27.041 45.391 1.00 16.09 ? 263  HIS B O     1 
ATOM   3268 C  CB    . HIS B 2 264 ? 3.799   24.395 47.462 1.00 12.65 ? 263  HIS B CB    1 
ATOM   3269 C  CG    . HIS B 2 264 ? 4.734   25.379 48.095 1.00 16.29 ? 263  HIS B CG    1 
ATOM   3270 N  ND1   . HIS B 2 264 ? 4.297   26.407 48.899 1.00 15.92 ? 263  HIS B ND1   1 
ATOM   3271 C  CD2   . HIS B 2 264 ? 6.082   25.491 48.044 1.00 13.33 ? 263  HIS B CD2   1 
ATOM   3272 C  CE1   . HIS B 2 264 ? 5.331   27.113 49.314 1.00 18.78 ? 263  HIS B CE1   1 
ATOM   3273 N  NE2   . HIS B 2 264 ? 6.428   26.578 48.809 1.00 15.97 ? 263  HIS B NE2   1 
ATOM   3274 H  H     . HIS B 2 264 ? 1.973   23.065 46.422 1.00 0.00  ? 263  HIS B H     1 
ATOM   3275 H  HD1   . HIS B 2 264 ? 3.393   26.604 49.157 1.00 0.00  ? 263  HIS B HD1   1 
ATOM   3276 H  HE2   . HIS B 2 264 ? 7.306   26.922 49.006 1.00 0.00  ? 263  HIS B HE2   1 
ATOM   3277 N  N     . LEU B 2 265 ? 3.826   25.074 44.397 1.00 13.73 ? 264  LEU B N     1 
ATOM   3278 C  CA    . LEU B 2 265 ? 4.467   25.718 43.282 1.00 12.78 ? 264  LEU B CA    1 
ATOM   3279 C  C     . LEU B 2 265 ? 3.473   26.329 42.302 1.00 13.16 ? 264  LEU B C     1 
ATOM   3280 O  O     . LEU B 2 265 ? 3.879   27.058 41.415 1.00 15.16 ? 264  LEU B O     1 
ATOM   3281 C  CB    . LEU B 2 265 ? 5.390   24.722 42.589 1.00 12.31 ? 264  LEU B CB    1 
ATOM   3282 C  CG    . LEU B 2 265 ? 6.366   24.055 43.576 1.00 14.81 ? 264  LEU B CG    1 
ATOM   3283 C  CD1   . LEU B 2 265 ? 7.168   22.895 42.935 1.00 12.19 ? 264  LEU B CD1   1 
ATOM   3284 C  CD2   . LEU B 2 265 ? 7.308   25.121 44.121 1.00 19.89 ? 264  LEU B CD2   1 
ATOM   3285 H  H     . LEU B 2 265 ? 3.716   24.094 44.382 1.00 0.00  ? 264  LEU B H     1 
ATOM   3286 N  N     . ARG B 2 266 ? 2.178   26.082 42.478 1.00 14.32 ? 265  ARG B N     1 
ATOM   3287 C  CA    . ARG B 2 266 ? 1.192   26.621 41.555 1.00 18.92 ? 265  ARG B CA    1 
ATOM   3288 C  C     . ARG B 2 266 ? 1.103   28.132 41.655 1.00 25.98 ? 265  ARG B C     1 
ATOM   3289 O  O     . ARG B 2 266 ? 0.794   28.812 40.658 1.00 26.37 ? 265  ARG B O     1 
ATOM   3290 C  CB    . ARG B 2 266 ? -0.199  26.011 41.774 1.00 24.99 ? 265  ARG B CB    1 
ATOM   3291 C  CG    . ARG B 2 266 ? -0.441  24.641 41.109 1.00 28.64 ? 265  ARG B CG    1 
ATOM   3292 C  CD    . ARG B 2 266 ? -0.046  24.596 39.626 1.00 31.25 ? 265  ARG B CD    1 
ATOM   3293 N  NE    . ARG B 2 266 ? -0.764  23.562 38.857 1.00 32.57 ? 265  ARG B NE    1 
ATOM   3294 C  CZ    . ARG B 2 266 ? -0.191  22.529 38.243 1.00 28.34 ? 265  ARG B CZ    1 
ATOM   3295 N  NH1   . ARG B 2 266 ? 1.121   22.345 38.320 1.00 28.07 ? 265  ARG B NH1   1 
ATOM   3296 N  NH2   . ARG B 2 266 ? -0.938  21.664 37.568 1.00 26.52 ? 265  ARG B NH2   1 
ATOM   3297 H  H     . ARG B 2 266 ? 1.885   25.516 43.221 1.00 0.00  ? 265  ARG B H     1 
ATOM   3298 H  HE    . ARG B 2 266 ? -1.737  23.613 38.783 1.00 0.00  ? 265  ARG B HE    1 
ATOM   3299 H  HH11  . ARG B 2 266 ? 1.685   22.984 38.818 1.00 0.00  ? 265  ARG B HH11  1 
ATOM   3300 H  HH12  . ARG B 2 266 ? 1.538   21.558 37.861 1.00 0.00  ? 265  ARG B HH12  1 
ATOM   3301 H  HH21  . ARG B 2 266 ? -1.930  21.785 37.521 1.00 0.00  ? 265  ARG B HH21  1 
ATOM   3302 H  HH22  . ARG B 2 266 ? -0.519  20.883 37.109 1.00 0.00  ? 265  ARG B HH22  1 
ATOM   3303 N  N     . SER B 2 267 ? 1.397   28.652 42.848 1.00 25.37 ? 266  SER B N     1 
ATOM   3304 C  CA    . SER B 2 267 ? 1.369   30.085 43.129 1.00 21.48 ? 266  SER B CA    1 
ATOM   3305 C  C     . SER B 2 267 ? 2.271   30.907 42.186 1.00 23.20 ? 266  SER B C     1 
ATOM   3306 O  O     . SER B 2 267 ? 1.874   31.970 41.712 1.00 22.28 ? 266  SER B O     1 
ATOM   3307 C  CB    . SER B 2 267 ? 1.804   30.309 44.553 1.00 22.01 ? 266  SER B CB    1 
ATOM   3308 O  OG    . SER B 2 267 ? 3.155   29.916 44.681 1.00 26.26 ? 266  SER B OG    1 
ATOM   3309 H  H     . SER B 2 267 ? 1.661   28.050 43.578 1.00 0.00  ? 266  SER B H     1 
ATOM   3310 H  HG    . SER B 2 267 ? 3.681   30.682 44.454 1.00 0.00  ? 266  SER B HG    1 
ATOM   3311 N  N     . TYR B 2 268 ? 3.493   30.456 41.927 1.00 23.07 ? 267  TYR B N     1 
ATOM   3312 C  CA    . TYR B 2 268 ? 4.315   31.221 41.003 1.00 22.74 ? 267  TYR B CA    1 
ATOM   3313 C  C     . TYR B 2 268 ? 3.957   30.888 39.569 1.00 24.28 ? 267  TYR B C     1 
ATOM   3314 O  O     . TYR B 2 268 ? 4.149   31.707 38.674 1.00 26.71 ? 267  TYR B O     1 
ATOM   3315 C  CB    . TYR B 2 268 ? 5.830   31.102 41.280 1.00 22.93 ? 267  TYR B CB    1 
ATOM   3316 C  CG    . TYR B 2 268 ? 6.454   29.726 41.191 1.00 15.84 ? 267  TYR B CG    1 
ATOM   3317 C  CD1   . TYR B 2 268 ? 6.671   29.130 39.959 1.00 15.20 ? 267  TYR B CD1   1 
ATOM   3318 C  CD2   . TYR B 2 268 ? 6.916   29.066 42.345 1.00 16.20 ? 267  TYR B CD2   1 
ATOM   3319 C  CE1   . TYR B 2 268 ? 7.325   27.932 39.854 1.00 16.70 ? 267  TYR B CE1   1 
ATOM   3320 C  CE2   . TYR B 2 268 ? 7.588   27.849 42.260 1.00 11.48 ? 267  TYR B CE2   1 
ATOM   3321 C  CZ    . TYR B 2 268 ? 7.791   27.288 40.998 1.00 19.49 ? 267  TYR B CZ    1 
ATOM   3322 O  OH    . TYR B 2 268 ? 8.489   26.102 40.840 1.00 21.29 ? 267  TYR B OH    1 
ATOM   3323 H  H     . TYR B 2 268 ? 3.810   29.616 42.324 1.00 0.00  ? 267  TYR B H     1 
ATOM   3324 H  HH    . TYR B 2 268 ? 8.591   25.666 41.687 1.00 0.00  ? 267  TYR B HH    1 
ATOM   3325 N  N     . LYS B 2 269 ? 3.392   29.705 39.355 1.00 23.26 ? 268  LYS B N     1 
ATOM   3326 C  CA    . LYS B 2 269 ? 2.991   29.312 38.006 1.00 25.60 ? 268  LYS B CA    1 
ATOM   3327 C  C     . LYS B 2 269 ? 1.790   30.158 37.589 1.00 26.72 ? 268  LYS B C     1 
ATOM   3328 O  O     . LYS B 2 269 ? 1.642   30.513 36.414 1.00 28.92 ? 268  LYS B O     1 
ATOM   3329 C  CB    . LYS B 2 269 ? 2.619   27.832 37.954 1.00 28.01 ? 268  LYS B CB    1 
ATOM   3330 C  CG    . LYS B 2 269 ? 3.780   26.862 37.961 1.00 28.09 ? 268  LYS B CG    1 
ATOM   3331 C  CD    . LYS B 2 269 ? 3.223   25.453 37.889 1.00 32.89 ? 268  LYS B CD    1 
ATOM   3332 C  CE    . LYS B 2 269 ? 4.264   24.439 37.474 1.00 34.41 ? 268  LYS B CE    1 
ATOM   3333 N  NZ    . LYS B 2 269 ? 5.427   24.435 38.376 1.00 40.18 ? 268  LYS B NZ    1 
ATOM   3334 H  H     . LYS B 2 269 ? 3.251   29.079 40.097 1.00 0.00  ? 268  LYS B H     1 
ATOM   3335 H  HZ1   . LYS B 2 269 ? 5.870   25.372 38.444 1.00 0.00  ? 268  LYS B HZ1   1 
ATOM   3336 H  HZ2   . LYS B 2 269 ? 5.127   24.121 39.322 1.00 0.00  ? 268  LYS B HZ2   1 
ATOM   3337 H  HZ3   . LYS B 2 269 ? 6.114   23.759 37.990 1.00 0.00  ? 268  LYS B HZ3   1 
ATOM   3338 N  N     . TYR B 2 270 ? 0.913   30.446 38.552 1.00 24.38 ? 269  TYR B N     1 
ATOM   3339 C  CA    . TYR B 2 270 ? -0.258  31.275 38.300 1.00 20.78 ? 269  TYR B CA    1 
ATOM   3340 C  C     . TYR B 2 270 ? 0.185   32.686 37.989 1.00 19.96 ? 269  TYR B C     1 
ATOM   3341 O  O     . TYR B 2 270 ? -0.162  33.240 36.940 1.00 22.33 ? 269  TYR B O     1 
ATOM   3342 C  CB    . TYR B 2 270 ? -1.186  31.321 39.509 1.00 19.14 ? 269  TYR B CB    1 
ATOM   3343 C  CG    . TYR B 2 270 ? -1.925  30.021 39.781 1.00 19.75 ? 269  TYR B CG    1 
ATOM   3344 C  CD1   . TYR B 2 270 ? -2.006  29.019 38.823 1.00 19.63 ? 269  TYR B CD1   1 
ATOM   3345 C  CD2   . TYR B 2 270 ? -2.483  29.773 41.034 1.00 20.42 ? 269  TYR B CD2   1 
ATOM   3346 C  CE1   . TYR B 2 270 ? -2.617  27.801 39.115 1.00 20.12 ? 269  TYR B CE1   1 
ATOM   3347 C  CE2   . TYR B 2 270 ? -3.086  28.574 41.328 1.00 18.44 ? 269  TYR B CE2   1 
ATOM   3348 C  CZ    . TYR B 2 270 ? -3.152  27.592 40.376 1.00 16.66 ? 269  TYR B CZ    1 
ATOM   3349 O  OH    . TYR B 2 270 ? -3.752  26.403 40.711 1.00 17.09 ? 269  TYR B OH    1 
ATOM   3350 H  H     . TYR B 2 270 ? 1.084   30.107 39.445 1.00 0.00  ? 269  TYR B H     1 
ATOM   3351 H  HH    . TYR B 2 270 ? -3.801  26.315 41.661 1.00 0.00  ? 269  TYR B HH    1 
ATOM   3352 N  N     . TYR B 2 271 ? 0.998   33.242 38.889 1.00 20.79 ? 270  TYR B N     1 
ATOM   3353 C  CA    . TYR B 2 271 ? 1.521   34.595 38.751 1.00 12.55 ? 270  TYR B CA    1 
ATOM   3354 C  C     . TYR B 2 271 ? 2.204   34.830 37.425 1.00 16.18 ? 270  TYR B C     1 
ATOM   3355 O  O     . TYR B 2 271 ? 2.026   35.880 36.822 1.00 21.87 ? 270  TYR B O     1 
ATOM   3356 C  CB    . TYR B 2 271 ? 2.476   34.901 39.875 1.00 14.74 ? 270  TYR B CB    1 
ATOM   3357 C  CG    . TYR B 2 271 ? 2.857   36.352 39.939 1.00 18.85 ? 270  TYR B CG    1 
ATOM   3358 C  CD1   . TYR B 2 271 ? 3.786   36.882 39.051 1.00 17.39 ? 270  TYR B CD1   1 
ATOM   3359 C  CD2   . TYR B 2 271 ? 2.256   37.207 40.858 1.00 15.75 ? 270  TYR B CD2   1 
ATOM   3360 C  CE1   . TYR B 2 271 ? 4.106   38.236 39.070 1.00 21.90 ? 270  TYR B CE1   1 
ATOM   3361 C  CE2   . TYR B 2 271 ? 2.568   38.560 40.888 1.00 21.02 ? 270  TYR B CE2   1 
ATOM   3362 C  CZ    . TYR B 2 271 ? 3.498   39.073 39.990 1.00 21.98 ? 270  TYR B CZ    1 
ATOM   3363 O  OH    . TYR B 2 271 ? 3.829   40.420 40.011 1.00 24.86 ? 270  TYR B OH    1 
ATOM   3364 H  H     . TYR B 2 271 ? 1.271   32.710 39.670 1.00 0.00  ? 270  TYR B H     1 
ATOM   3365 H  HH    . TYR B 2 271 ? 3.304   40.831 40.712 1.00 0.00  ? 270  TYR B HH    1 
ATOM   3366 N  N     . THR B 2 272 ? 3.002   33.872 36.974 1.00 18.93 ? 271  THR B N     1 
ATOM   3367 C  CA    . THR B 2 272 ? 3.695   34.000 35.690 1.00 16.04 ? 271  THR B CA    1 
ATOM   3368 C  C     . THR B 2 272 ? 2.664   34.148 34.555 1.00 14.35 ? 271  THR B C     1 
ATOM   3369 O  O     . THR B 2 272 ? 2.808   35.017 33.710 1.00 22.31 ? 271  THR B O     1 
ATOM   3370 C  CB    . THR B 2 272 ? 4.687   32.788 35.465 1.00 15.36 ? 271  THR B CB    1 
ATOM   3371 O  OG1   . THR B 2 272 ? 5.569   32.697 36.590 1.00 15.10 ? 271  THR B OG1   1 
ATOM   3372 C  CG2   . THR B 2 272 ? 5.555   32.973 34.221 1.00 11.46 ? 271  THR B CG2   1 
ATOM   3373 H  H     . THR B 2 272 ? 3.206   33.064 37.499 1.00 0.00  ? 271  THR B H     1 
ATOM   3374 H  HG1   . THR B 2 272 ? 6.281   32.057 36.440 1.00 0.00  ? 271  THR B HG1   1 
ATOM   3375 N  N     . ASP B 2 273 ? 1.619   33.330 34.531 1.00 16.03 ? 272  ASP B N     1 
ATOM   3376 C  CA    . ASP B 2 273 ? 0.603   33.463 33.468 1.00 23.40 ? 272  ASP B CA    1 
ATOM   3377 C  C     . ASP B 2 273 ? -0.183  34.775 33.490 1.00 25.64 ? 272  ASP B C     1 
ATOM   3378 O  O     . ASP B 2 273 ? -0.444  35.338 32.427 1.00 26.73 ? 272  ASP B O     1 
ATOM   3379 C  CB    . ASP B 2 273 ? -0.405  32.304 33.455 1.00 21.79 ? 272  ASP B CB    1 
ATOM   3380 C  CG    . ASP B 2 273 ? 0.044   31.137 32.584 1.00 29.80 ? 272  ASP B CG    1 
ATOM   3381 O  OD1   . ASP B 2 273 ? 1.136   31.199 31.980 1.00 35.06 ? 272  ASP B OD1   1 
ATOM   3382 O  OD2   . ASP B 2 273 ? -0.681  30.132 32.504 1.00 27.28 ? 272  ASP B OD2   1 
ATOM   3383 H  H     . ASP B 2 273 ? 1.504   32.637 35.220 1.00 0.00  ? 272  ASP B H     1 
ATOM   3384 N  N     . SER B 2 274 ? -0.589  35.235 34.679 1.00 22.48 ? 273  SER B N     1 
ATOM   3385 C  CA    . SER B 2 274 ? -1.343  36.478 34.801 1.00 19.25 ? 273  SER B CA    1 
ATOM   3386 C  C     . SER B 2 274 ? -0.636  37.633 34.093 1.00 22.80 ? 273  SER B C     1 
ATOM   3387 O  O     . SER B 2 274 ? -1.270  38.431 33.412 1.00 24.14 ? 273  SER B O     1 
ATOM   3388 C  CB    . SER B 2 274 ? -1.586  36.825 36.261 1.00 17.28 ? 273  SER B CB    1 
ATOM   3389 O  OG    . SER B 2 274 ? -0.383  37.223 36.906 1.00 14.32 ? 273  SER B OG    1 
ATOM   3390 H  H     . SER B 2 274 ? -0.353  34.732 35.487 1.00 0.00  ? 273  SER B H     1 
ATOM   3391 H  HG    . SER B 2 274 ? -0.294  36.789 37.753 1.00 0.00  ? 273  SER B HG    1 
ATOM   3392 N  N     . ILE B 2 275 ? 0.688   37.675 34.200 1.00 24.70 ? 274  ILE B N     1 
ATOM   3393 C  CA    . ILE B 2 275 ? 1.486   38.716 33.560 1.00 20.21 ? 274  ILE B CA    1 
ATOM   3394 C  C     . ILE B 2 275 ? 1.054   38.932 32.106 1.00 19.51 ? 274  ILE B C     1 
ATOM   3395 O  O     . ILE B 2 275 ? 0.870   40.071 31.676 1.00 18.37 ? 274  ILE B O     1 
ATOM   3396 C  CB    . ILE B 2 275 ? 3.024   38.368 33.598 1.00 17.73 ? 274  ILE B CB    1 
ATOM   3397 C  CG1   . ILE B 2 275 ? 3.502   38.198 35.060 1.00 12.97 ? 274  ILE B CG1   1 
ATOM   3398 C  CG2   . ILE B 2 275 ? 3.838   39.451 32.827 1.00 7.60  ? 274  ILE B CG2   1 
ATOM   3399 C  CD1   . ILE B 2 275 ? 5.017   37.963 35.226 1.00 4.43  ? 274  ILE B CD1   1 
ATOM   3400 H  H     . ILE B 2 275 ? 1.117   36.985 34.752 1.00 0.00  ? 274  ILE B H     1 
ATOM   3401 N  N     . VAL B 2 276 ? 0.853   37.844 31.367 1.00 19.34 ? 275  VAL B N     1 
ATOM   3402 C  CA    . VAL B 2 276 ? 0.485   37.941 29.953 1.00 20.88 ? 275  VAL B CA    1 
ATOM   3403 C  C     . VAL B 2 276 ? -0.983  37.667 29.660 1.00 22.46 ? 275  VAL B C     1 
ATOM   3404 O  O     . VAL B 2 276 ? -1.381  37.509 28.505 1.00 23.96 ? 275  VAL B O     1 
ATOM   3405 C  CB    . VAL B 2 276 ? 1.389   37.044 29.068 1.00 20.61 ? 275  VAL B CB    1 
ATOM   3406 C  CG1   . VAL B 2 276 ? 2.820   37.592 29.055 1.00 17.33 ? 275  VAL B CG1   1 
ATOM   3407 C  CG2   . VAL B 2 276 ? 1.384   35.620 29.593 1.00 21.20 ? 275  VAL B CG2   1 
ATOM   3408 H  H     . VAL B 2 276 ? 0.947   36.962 31.779 1.00 0.00  ? 275  VAL B H     1 
ATOM   3409 N  N     . ASN B 2 277 ? -1.782  37.628 30.725 1.00 25.08 ? 276  ASN B N     1 
ATOM   3410 C  CA    . ASN B 2 277 ? -3.223  37.412 30.647 1.00 25.52 ? 276  ASN B CA    1 
ATOM   3411 C  C     . ASN B 2 277 ? -3.826  38.367 31.668 1.00 25.42 ? 276  ASN B C     1 
ATOM   3412 O  O     . ASN B 2 277 ? -4.320  37.930 32.699 1.00 32.38 ? 276  ASN B O     1 
ATOM   3413 C  CB    . ASN B 2 277 ? -3.613  35.975 31.034 1.00 22.54 ? 276  ASN B CB    1 
ATOM   3414 C  CG    . ASN B 2 277 ? -3.124  34.936 30.034 1.00 24.24 ? 276  ASN B CG    1 
ATOM   3415 O  OD1   . ASN B 2 277 ? -3.771  34.700 29.013 1.00 26.21 ? 276  ASN B OD1   1 
ATOM   3416 N  ND2   . ASN B 2 277 ? -1.997  34.281 30.340 1.00 16.71 ? 276  ASN B ND2   1 
ATOM   3417 H  H     . ASN B 2 277 ? -1.378  37.778 31.604 1.00 0.00  ? 276  ASN B H     1 
ATOM   3418 H  HD21  . ASN B 2 277 ? -1.728  33.622 29.678 1.00 0.00  ? 276  ASN B HD21  1 
ATOM   3419 H  HD22  . ASN B 2 277 ? -1.499  34.461 31.153 1.00 0.00  ? 276  ASN B HD22  1 
ATOM   3420 N  N     . PRO B 2 278 ? -3.803  39.683 31.387 1.00 23.63 ? 277  PRO B N     1 
ATOM   3421 C  CA    . PRO B 2 278 ? -4.323  40.777 32.224 1.00 23.23 ? 277  PRO B CA    1 
ATOM   3422 C  C     . PRO B 2 278 ? -5.786  40.756 32.689 1.00 22.10 ? 277  PRO B C     1 
ATOM   3423 O  O     . PRO B 2 278 ? -6.147  41.490 33.618 1.00 18.28 ? 277  PRO B O     1 
ATOM   3424 C  CB    . PRO B 2 278 ? -3.997  42.022 31.410 1.00 25.72 ? 277  PRO B CB    1 
ATOM   3425 C  CG    . PRO B 2 278 ? -3.863  41.503 30.014 1.00 26.84 ? 277  PRO B CG    1 
ATOM   3426 C  CD    . PRO B 2 278 ? -3.143  40.221 30.191 1.00 21.92 ? 277  PRO B CD    1 
ATOM   3427 N  N     . ASP B 2 279 ? -6.650  39.998 32.016 1.00 22.16 ? 278  ASP B N     1 
ATOM   3428 C  CA    . ASP B 2 279 ? -8.035  39.889 32.491 1.00 24.10 ? 278  ASP B CA    1 
ATOM   3429 C  C     . ASP B 2 279 ? -8.426  38.443 32.846 1.00 23.56 ? 278  ASP B C     1 
ATOM   3430 O  O     . ASP B 2 279 ? -9.491  38.198 33.410 1.00 23.94 ? 278  ASP B O     1 
ATOM   3431 C  CB    . ASP B 2 279 ? -9.037  40.516 31.520 1.00 23.81 ? 278  ASP B CB    1 
ATOM   3432 C  CG    . ASP B 2 279 ? -9.092  39.817 30.188 1.00 33.36 ? 278  ASP B CG    1 
ATOM   3433 O  OD1   . ASP B 2 279 ? -8.416  38.776 30.013 1.00 35.54 ? 278  ASP B OD1   1 
ATOM   3434 O  OD2   . ASP B 2 279 ? -9.815  40.329 29.299 1.00 37.99 ? 278  ASP B OD2   1 
ATOM   3435 H  H     . ASP B 2 279 ? -6.386  39.555 31.184 1.00 0.00  ? 278  ASP B H     1 
ATOM   3436 N  N     . GLY B 2 280 ? -7.488  37.518 32.634 1.00 24.24 ? 279  GLY B N     1 
ATOM   3437 C  CA    . GLY B 2 280 ? -7.715  36.102 32.890 1.00 20.08 ? 279  GLY B CA    1 
ATOM   3438 C  C     . GLY B 2 280 ? -7.798  35.594 34.316 1.00 14.76 ? 279  GLY B C     1 
ATOM   3439 O  O     . GLY B 2 280 ? -8.038  34.403 34.535 1.00 12.52 ? 279  GLY B O     1 
ATOM   3440 H  H     . GLY B 2 280 ? -6.610  37.803 32.326 1.00 0.00  ? 279  GLY B H     1 
ATOM   3441 N  N     . PHE B 2 281 ? -7.680  36.472 35.295 1.00 11.82 ? 280  PHE B N     1 
ATOM   3442 C  CA    . PHE B 2 281 ? -7.729  35.995 36.672 1.00 17.25 ? 280  PHE B CA    1 
ATOM   3443 C  C     . PHE B 2 281 ? -8.610  36.793 37.611 1.00 15.00 ? 280  PHE B C     1 
ATOM   3444 O  O     . PHE B 2 281 ? -8.217  37.048 38.743 1.00 14.71 ? 280  PHE B O     1 
ATOM   3445 C  CB    . PHE B 2 281 ? -6.307  35.868 37.248 1.00 17.92 ? 280  PHE B CB    1 
ATOM   3446 C  CG    . PHE B 2 281 ? -5.488  34.783 36.596 1.00 23.35 ? 280  PHE B CG    1 
ATOM   3447 C  CD1   . PHE B 2 281 ? -5.592  33.457 37.019 1.00 23.28 ? 280  PHE B CD1   1 
ATOM   3448 C  CD2   . PHE B 2 281 ? -4.640  35.073 35.542 1.00 22.97 ? 280  PHE B CD2   1 
ATOM   3449 C  CE1   . PHE B 2 281 ? -4.870  32.449 36.401 1.00 22.07 ? 280  PHE B CE1   1 
ATOM   3450 C  CE2   . PHE B 2 281 ? -3.912  34.059 34.922 1.00 21.51 ? 280  PHE B CE2   1 
ATOM   3451 C  CZ    . PHE B 2 281 ? -4.034  32.753 35.353 1.00 23.57 ? 280  PHE B CZ    1 
ATOM   3452 H  H     . PHE B 2 281 ? -7.553  37.418 35.113 1.00 0.00  ? 280  PHE B H     1 
ATOM   3453 N  N     . ALA B 2 282 ? -9.811  37.154 37.151 1.00 16.85 ? 281  ALA B N     1 
ATOM   3454 C  CA    . ALA B 2 282 ? -10.759 37.931 37.956 1.00 14.54 ? 281  ALA B CA    1 
ATOM   3455 C  C     . ALA B 2 282 ? -11.084 37.176 39.209 1.00 16.97 ? 281  ALA B C     1 
ATOM   3456 O  O     . ALA B 2 282 ? -11.600 36.049 39.115 1.00 17.85 ? 281  ALA B O     1 
ATOM   3457 C  CB    . ALA B 2 282 ? -12.033 38.194 37.191 1.00 7.20  ? 281  ALA B CB    1 
ATOM   3458 H  H     . ALA B 2 282 ? -10.090 36.893 36.251 1.00 0.00  ? 281  ALA B H     1 
ATOM   3459 N  N     . GLY B 2 283 ? -10.778 37.796 40.359 1.00 15.84 ? 282  GLY B N     1 
ATOM   3460 C  CA    . GLY B 2 283 ? -11.048 37.200 41.660 1.00 14.21 ? 282  GLY B CA    1 
ATOM   3461 C  C     . GLY B 2 283 ? -12.318 37.807 42.201 1.00 14.34 ? 282  GLY B C     1 
ATOM   3462 O  O     . GLY B 2 283 ? -12.514 39.012 42.094 1.00 14.68 ? 282  GLY B O     1 
ATOM   3463 H  H     . GLY B 2 283 ? -10.362 38.678 40.349 1.00 0.00  ? 282  GLY B H     1 
ATOM   3464 N  N     . PHE B 2 284 ? -13.159 36.998 42.835 1.00 16.95 ? 283  PHE B N     1 
ATOM   3465 C  CA    . PHE B 2 284 ? -14.448 37.473 43.354 1.00 15.69 ? 283  PHE B CA    1 
ATOM   3466 C  C     . PHE B 2 284 ? -14.525 37.565 44.873 1.00 13.34 ? 283  PHE B C     1 
ATOM   3467 O  O     . PHE B 2 284 ? -14.237 36.603 45.580 1.00 17.47 ? 283  PHE B O     1 
ATOM   3468 C  CB    . PHE B 2 284 ? -15.583 36.555 42.853 1.00 17.08 ? 283  PHE B CB    1 
ATOM   3469 C  CG    . PHE B 2 284 ? -15.703 36.474 41.344 1.00 14.39 ? 283  PHE B CG    1 
ATOM   3470 C  CD1   . PHE B 2 284 ? -14.927 35.585 40.624 1.00 15.25 ? 283  PHE B CD1   1 
ATOM   3471 C  CD2   . PHE B 2 284 ? -16.611 37.262 40.664 1.00 18.50 ? 283  PHE B CD2   1 
ATOM   3472 C  CE1   . PHE B 2 284 ? -15.050 35.475 39.240 1.00 16.83 ? 283  PHE B CE1   1 
ATOM   3473 C  CE2   . PHE B 2 284 ? -16.751 37.167 39.282 1.00 20.08 ? 283  PHE B CE2   1 
ATOM   3474 C  CZ    . PHE B 2 284 ? -15.965 36.267 38.563 1.00 19.32 ? 283  PHE B CZ    1 
ATOM   3475 H  H     . PHE B 2 284 ? -12.920 36.077 42.978 1.00 0.00  ? 283  PHE B H     1 
ATOM   3476 N  N     . PRO B 2 285 ? -14.954 38.714 45.401 1.00 15.48 ? 284  PRO B N     1 
ATOM   3477 C  CA    . PRO B 2 285 ? -15.055 38.864 46.863 1.00 14.39 ? 284  PRO B CA    1 
ATOM   3478 C  C     . PRO B 2 285 ? -16.201 37.971 47.299 1.00 19.54 ? 284  PRO B C     1 
ATOM   3479 O  O     . PRO B 2 285 ? -17.258 37.997 46.673 1.00 25.44 ? 284  PRO B O     1 
ATOM   3480 C  CB    . PRO B 2 285 ? -15.387 40.341 47.026 1.00 15.14 ? 284  PRO B CB    1 
ATOM   3481 C  CG    . PRO B 2 285 ? -16.184 40.654 45.753 1.00 15.63 ? 284  PRO B CG    1 
ATOM   3482 C  CD    . PRO B 2 285 ? -15.431 39.912 44.683 1.00 14.59 ? 284  PRO B CD    1 
ATOM   3483 N  N     . CYS B 2 286 ? -16.037 37.245 48.399 1.00 20.25 ? 285  CYS B N     1 
ATOM   3484 C  CA    . CYS B 2 286 ? -17.052 36.295 48.808 1.00 20.36 ? 285  CYS B CA    1 
ATOM   3485 C  C     . CYS B 2 286 ? -16.770 35.792 50.213 1.00 21.81 ? 285  CYS B C     1 
ATOM   3486 O  O     . CYS B 2 286 ? -15.613 35.635 50.582 1.00 31.62 ? 285  CYS B O     1 
ATOM   3487 C  CB    . CYS B 2 286 ? -16.979 35.131 47.811 1.00 20.82 ? 285  CYS B CB    1 
ATOM   3488 S  SG    . CYS B 2 286 ? -18.383 33.989 47.722 1.00 24.92 ? 285  CYS B SG    1 
ATOM   3489 H  H     . CYS B 2 286 ? -15.224 37.336 48.950 1.00 0.00  ? 285  CYS B H     1 
ATOM   3490 N  N     . ALA B 2 287 ? -17.829 35.505 50.973 1.00 24.02 ? 286  ALA B N     1 
ATOM   3491 C  CA    . ALA B 2 287 ? -17.759 35.001 52.356 1.00 21.47 ? 286  ALA B CA    1 
ATOM   3492 C  C     . ALA B 2 287 ? -16.767 33.866 52.550 1.00 24.70 ? 286  ALA B C     1 
ATOM   3493 O  O     . ALA B 2 287 ? -16.015 33.827 53.538 1.00 24.44 ? 286  ALA B O     1 
ATOM   3494 C  CB    . ALA B 2 287 ? -19.130 34.540 52.809 1.00 17.73 ? 286  ALA B CB    1 
ATOM   3495 H  H     . ALA B 2 287 ? -18.726 35.653 50.590 1.00 0.00  ? 286  ALA B H     1 
ATOM   3496 N  N     . SER B 2 288 ? -16.833 32.906 51.635 1.00 25.64 ? 287  SER B N     1 
ATOM   3497 C  CA    . SER B 2 288 ? -15.962 31.761 51.643 1.00 19.58 ? 287  SER B CA    1 
ATOM   3498 C  C     . SER B 2 288 ? -16.017 31.203 50.233 1.00 19.19 ? 287  SER B C     1 
ATOM   3499 O  O     . SER B 2 288 ? -16.792 31.703 49.396 1.00 17.57 ? 287  SER B O     1 
ATOM   3500 C  CB    . SER B 2 288 ? -16.474 30.721 52.644 1.00 27.16 ? 287  SER B CB    1 
ATOM   3501 O  OG    . SER B 2 288 ? -17.607 30.029 52.157 1.00 28.82 ? 287  SER B OG    1 
ATOM   3502 H  H     . SER B 2 288 ? -17.494 32.937 50.910 1.00 0.00  ? 287  SER B H     1 
ATOM   3503 H  HG    . SER B 2 288 ? -17.789 29.360 52.833 1.00 0.00  ? 287  SER B HG    1 
ATOM   3504 N  N     . TYR B 2 289 ? -15.258 30.129 50.000 1.00 18.59 ? 288  TYR B N     1 
ATOM   3505 C  CA    . TYR B 2 289 ? -15.169 29.465 48.702 1.00 19.22 ? 288  TYR B CA    1 
ATOM   3506 C  C     . TYR B 2 289 ? -16.371 28.559 48.404 1.00 22.43 ? 288  TYR B C     1 
ATOM   3507 O  O     . TYR B 2 289 ? -16.685 28.284 47.247 1.00 26.30 ? 288  TYR B O     1 
ATOM   3508 C  CB    . TYR B 2 289 ? -13.868 28.664 48.626 1.00 18.09 ? 288  TYR B CB    1 
ATOM   3509 C  CG    . TYR B 2 289 ? -13.619 27.967 47.299 1.00 18.07 ? 288  TYR B CG    1 
ATOM   3510 C  CD1   . TYR B 2 289 ? -13.391 28.701 46.143 1.00 16.76 ? 288  TYR B CD1   1 
ATOM   3511 C  CD2   . TYR B 2 289 ? -13.620 26.570 47.207 1.00 18.84 ? 288  TYR B CD2   1 
ATOM   3512 C  CE1   . TYR B 2 289 ? -13.172 28.084 44.933 1.00 17.69 ? 288  TYR B CE1   1 
ATOM   3513 C  CE2   . TYR B 2 289 ? -13.406 25.937 45.996 1.00 21.25 ? 288  TYR B CE2   1 
ATOM   3514 C  CZ    . TYR B 2 289 ? -13.182 26.707 44.858 1.00 24.70 ? 288  TYR B CZ    1 
ATOM   3515 O  OH    . TYR B 2 289 ? -12.991 26.106 43.631 1.00 28.69 ? 288  TYR B OH    1 
ATOM   3516 H  H     . TYR B 2 289 ? -14.742 29.758 50.749 1.00 0.00  ? 288  TYR B H     1 
ATOM   3517 H  HH    . TYR B 2 289 ? -13.097 25.153 43.729 1.00 0.00  ? 288  TYR B HH    1 
ATOM   3518 N  N     . ASN B 2 290 ? -17.034 28.065 49.439 1.00 24.93 ? 289  ASN B N     1 
ATOM   3519 C  CA    . ASN B 2 290 ? -18.183 27.225 49.215 1.00 23.61 ? 289  ASN B CA    1 
ATOM   3520 C  C     . ASN B 2 290 ? -19.319 28.084 48.719 1.00 23.60 ? 289  ASN B C     1 
ATOM   3521 O  O     . ASN B 2 290 ? -20.014 27.712 47.790 1.00 36.07 ? 289  ASN B O     1 
ATOM   3522 C  CB    . ASN B 2 290 ? -18.547 26.465 50.469 1.00 30.46 ? 289  ASN B CB    1 
ATOM   3523 C  CG    . ASN B 2 290 ? -17.570 25.363 50.764 1.00 37.41 ? 289  ASN B CG    1 
ATOM   3524 O  OD1   . ASN B 2 290 ? -17.727 24.628 51.733 1.00 47.31 ? 289  ASN B OD1   1 
ATOM   3525 N  ND2   . ASN B 2 290 ? -16.550 25.231 49.929 1.00 42.64 ? 289  ASN B ND2   1 
ATOM   3526 H  H     . ASN B 2 290 ? -16.754 28.267 50.359 1.00 0.00  ? 289  ASN B H     1 
ATOM   3527 H  HD21  . ASN B 2 290 ? -15.934 24.516 50.193 1.00 0.00  ? 289  ASN B HD21  1 
ATOM   3528 H  HD22  . ASN B 2 290 ? -16.403 25.776 49.133 1.00 0.00  ? 289  ASN B HD22  1 
ATOM   3529 N  N     . VAL B 2 291 ? -19.489 29.256 49.299 1.00 21.32 ? 290  VAL B N     1 
ATOM   3530 C  CA    . VAL B 2 291 ? -20.519 30.187 48.837 1.00 22.90 ? 290  VAL B CA    1 
ATOM   3531 C  C     . VAL B 2 291 ? -20.251 30.545 47.344 1.00 22.07 ? 290  VAL B C     1 
ATOM   3532 O  O     . VAL B 2 291 ? -21.187 30.732 46.562 1.00 27.05 ? 290  VAL B O     1 
ATOM   3533 C  CB    . VAL B 2 291 ? -20.510 31.473 49.735 1.00 22.23 ? 290  VAL B CB    1 
ATOM   3534 C  CG1   . VAL B 2 291 ? -21.454 32.531 49.222 1.00 23.70 ? 290  VAL B CG1   1 
ATOM   3535 C  CG2   . VAL B 2 291 ? -20.909 31.110 51.120 1.00 23.30 ? 290  VAL B CG2   1 
ATOM   3536 H  H     . VAL B 2 291 ? -18.940 29.504 50.070 1.00 0.00  ? 290  VAL B H     1 
ATOM   3537 N  N     . PHE B 2 292 ? -18.974 30.614 46.957 1.00 23.25 ? 291  PHE B N     1 
ATOM   3538 C  CA    . PHE B 2 292 ? -18.556 30.933 45.580 1.00 20.94 ? 291  PHE B CA    1 
ATOM   3539 C  C     . PHE B 2 292 ? -18.994 29.831 44.606 1.00 24.83 ? 291  PHE B C     1 
ATOM   3540 O  O     . PHE B 2 292 ? -19.644 30.096 43.582 1.00 25.87 ? 291  PHE B O     1 
ATOM   3541 C  CB    . PHE B 2 292 ? -17.025 31.086 45.513 1.00 16.46 ? 291  PHE B CB    1 
ATOM   3542 C  CG    . PHE B 2 292 ? -16.499 31.379 44.126 1.00 13.77 ? 291  PHE B CG    1 
ATOM   3543 C  CD1   . PHE B 2 292 ? -16.850 32.551 43.464 1.00 11.51 ? 291  PHE B CD1   1 
ATOM   3544 C  CD2   . PHE B 2 292 ? -15.661 30.477 43.480 1.00 10.81 ? 291  PHE B CD2   1 
ATOM   3545 C  CE1   . PHE B 2 292 ? -16.375 32.816 42.191 1.00 12.42 ? 291  PHE B CE1   1 
ATOM   3546 C  CE2   . PHE B 2 292 ? -15.183 30.740 42.204 1.00 9.60  ? 291  PHE B CE2   1 
ATOM   3547 C  CZ    . PHE B 2 292 ? -15.538 31.904 41.560 1.00 9.90  ? 291  PHE B CZ    1 
ATOM   3548 H  H     . PHE B 2 292 ? -18.270 30.470 47.625 1.00 0.00  ? 291  PHE B H     1 
ATOM   3549 N  N     . THR B 2 293 ? -18.646 28.591 44.937 1.00 21.97 ? 292  THR B N     1 
ATOM   3550 C  CA    . THR B 2 293 ? -19.001 27.458 44.099 1.00 25.70 ? 292  THR B CA    1 
ATOM   3551 C  C     . THR B 2 293 ? -20.501 27.149 44.167 1.00 26.17 ? 292  THR B C     1 
ATOM   3552 O  O     . THR B 2 293 ? -20.997 26.298 43.420 1.00 23.91 ? 292  THR B O     1 
ATOM   3553 C  CB    . THR B 2 293 ? -18.233 26.248 44.518 1.00 26.60 ? 292  THR B CB    1 
ATOM   3554 O  OG1   . THR B 2 293 ? -18.668 25.866 45.830 1.00 32.70 ? 292  THR B OG1   1 
ATOM   3555 C  CG2   . THR B 2 293 ? -16.743 26.575 44.551 1.00 27.47 ? 292  THR B CG2   1 
ATOM   3556 H  H     . THR B 2 293 ? -18.130 28.438 45.757 1.00 0.00  ? 292  THR B H     1 
ATOM   3557 H  HG1   . THR B 2 293 ? -18.721 26.628 46.409 1.00 0.00  ? 292  THR B HG1   1 
ATOM   3558 N  N     . ALA B 2 294 ? -21.185 27.793 45.121 1.00 21.58 ? 293  ALA B N     1 
ATOM   3559 C  CA    . ALA B 2 294 ? -22.622 27.655 45.310 1.00 20.95 ? 293  ALA B CA    1 
ATOM   3560 C  C     . ALA B 2 294 ? -23.315 28.706 44.426 1.00 26.00 ? 293  ALA B C     1 
ATOM   3561 O  O     . ALA B 2 294 ? -24.529 28.912 44.511 1.00 21.87 ? 293  ALA B O     1 
ATOM   3562 C  CB    . ALA B 2 294 ? -22.997 27.858 46.766 1.00 14.39 ? 293  ALA B CB    1 
ATOM   3563 H  H     . ALA B 2 294 ? -20.710 28.357 45.761 1.00 0.00  ? 293  ALA B H     1 
ATOM   3564 N  N     . ASN B 2 295 ? -22.516 29.389 43.602 1.00 27.12 ? 294  ASN B N     1 
ATOM   3565 C  CA    . ASN B 2 295 ? -23.027 30.385 42.681 1.00 25.63 ? 294  ASN B CA    1 
ATOM   3566 C  C     . ASN B 2 295 ? -23.715 31.514 43.437 1.00 27.68 ? 294  ASN B C     1 
ATOM   3567 O  O     . ASN B 2 295 ? -24.892 31.786 43.208 1.00 26.81 ? 294  ASN B O     1 
ATOM   3568 C  CB    . ASN B 2 295 ? -24.012 29.732 41.727 1.00 26.61 ? 294  ASN B CB    1 
ATOM   3569 C  CG    . ASN B 2 295 ? -23.384 28.635 40.881 1.00 30.76 ? 294  ASN B CG    1 
ATOM   3570 O  OD1   . ASN B 2 295 ? -23.930 28.272 39.846 1.00 38.93 ? 294  ASN B OD1   1 
ATOM   3571 N  ND2   . ASN B 2 295 ? -22.237 28.128 41.288 1.00 30.73 ? 294  ASN B ND2   1 
ATOM   3572 H  H     . ASN B 2 295 ? -21.547 29.263 43.645 1.00 0.00  ? 294  ASN B H     1 
ATOM   3573 H  HD21  . ASN B 2 295 ? -21.858 27.447 40.683 1.00 0.00  ? 294  ASN B HD21  1 
ATOM   3574 H  HD22  . ASN B 2 295 ? -21.780 28.384 42.095 1.00 0.00  ? 294  ASN B HD22  1 
ATOM   3575 N  N     . LYS B 2 296 ? -22.968 32.174 44.326 1.00 27.71 ? 295  LYS B N     1 
ATOM   3576 C  CA    . LYS B 2 296 ? -23.493 33.277 45.126 1.00 21.97 ? 295  LYS B CA    1 
ATOM   3577 C  C     . LYS B 2 296 ? -22.569 34.490 45.177 1.00 23.26 ? 295  LYS B C     1 
ATOM   3578 O  O     . LYS B 2 296 ? -22.817 35.427 45.928 1.00 23.74 ? 295  LYS B O     1 
ATOM   3579 C  CB    . LYS B 2 296 ? -23.794 32.786 46.538 1.00 25.20 ? 295  LYS B CB    1 
ATOM   3580 C  CG    . LYS B 2 296 ? -25.142 32.115 46.642 1.00 31.55 ? 295  LYS B CG    1 
ATOM   3581 C  CD    . LYS B 2 296 ? -25.301 31.386 47.945 1.00 37.83 ? 295  LYS B CD    1 
ATOM   3582 C  CE    . LYS B 2 296 ? -26.754 30.959 48.166 1.00 40.69 ? 295  LYS B CE    1 
ATOM   3583 N  NZ    . LYS B 2 296 ? -27.192 29.885 47.225 1.00 44.96 ? 295  LYS B NZ    1 
ATOM   3584 H  H     . LYS B 2 296 ? -22.031 31.916 44.451 1.00 0.00  ? 295  LYS B H     1 
ATOM   3585 H  HZ1   . LYS B 2 296 ? -26.595 29.043 47.342 1.00 0.00  ? 295  LYS B HZ1   1 
ATOM   3586 H  HZ2   . LYS B 2 296 ? -28.178 29.632 47.426 1.00 0.00  ? 295  LYS B HZ2   1 
ATOM   3587 H  HZ3   . LYS B 2 296 ? -27.128 30.211 46.240 1.00 0.00  ? 295  LYS B HZ3   1 
ATOM   3588 N  N     . CYS B 2 297 ? -21.541 34.508 44.332 1.00 21.54 ? 296  CYS B N     1 
ATOM   3589 C  CA    . CYS B 2 297 ? -20.606 35.618 44.323 1.00 17.46 ? 296  CYS B CA    1 
ATOM   3590 C  C     . CYS B 2 297 ? -20.254 36.083 42.920 1.00 19.83 ? 296  CYS B C     1 
ATOM   3591 O  O     . CYS B 2 297 ? -19.100 36.428 42.609 1.00 16.62 ? 296  CYS B O     1 
ATOM   3592 C  CB    . CYS B 2 297 ? -19.382 35.220 45.108 1.00 18.30 ? 296  CYS B CB    1 
ATOM   3593 S  SG    . CYS B 2 297 ? -19.845 35.092 46.846 1.00 23.66 ? 296  CYS B SG    1 
ATOM   3594 H  H     . CYS B 2 297 ? -21.405 33.771 43.699 1.00 0.00  ? 296  CYS B H     1 
ATOM   3595 N  N     . PHE B 2 298 ? -21.288 36.157 42.091 1.00 17.39 ? 297  PHE B N     1 
ATOM   3596 C  CA    . PHE B 2 298 ? -21.149 36.557 40.694 1.00 18.43 ? 297  PHE B CA    1 
ATOM   3597 C  C     . PHE B 2 298 ? -22.271 37.537 40.357 1.00 18.27 ? 297  PHE B C     1 
ATOM   3598 O  O     . PHE B 2 298 ? -23.370 37.429 40.892 1.00 23.32 ? 297  PHE B O     1 
ATOM   3599 C  CB    . PHE B 2 298 ? -21.267 35.304 39.829 1.00 12.69 ? 297  PHE B CB    1 
ATOM   3600 C  CG    . PHE B 2 298 ? -20.962 35.518 38.400 1.00 17.25 ? 297  PHE B CG    1 
ATOM   3601 C  CD1   . PHE B 2 298 ? -21.971 35.885 37.510 1.00 13.86 ? 297  PHE B CD1   1 
ATOM   3602 C  CD2   . PHE B 2 298 ? -19.652 35.375 37.924 1.00 18.26 ? 297  PHE B CD2   1 
ATOM   3603 C  CE1   . PHE B 2 298 ? -21.685 36.112 36.167 1.00 15.93 ? 297  PHE B CE1   1 
ATOM   3604 C  CE2   . PHE B 2 298 ? -19.354 35.600 36.579 1.00 18.97 ? 297  PHE B CE2   1 
ATOM   3605 C  CZ    . PHE B 2 298 ? -20.376 35.972 35.693 1.00 17.31 ? 297  PHE B CZ    1 
ATOM   3606 H  H     . PHE B 2 298 ? -22.195 35.954 42.412 1.00 0.00  ? 297  PHE B H     1 
ATOM   3607 N  N     . PRO B 2 299 ? -21.990 38.553 39.526 1.00 19.40 ? 298  PRO B N     1 
ATOM   3608 C  CA    . PRO B 2 299 ? -20.716 38.864 38.857 1.00 15.90 ? 298  PRO B CA    1 
ATOM   3609 C  C     . PRO B 2 299 ? -19.804 39.759 39.723 1.00 11.92 ? 298  PRO B C     1 
ATOM   3610 O  O     . PRO B 2 299 ? -19.951 39.815 40.941 1.00 12.75 ? 298  PRO B O     1 
ATOM   3611 C  CB    . PRO B 2 299 ? -21.198 39.544 37.574 1.00 15.86 ? 298  PRO B CB    1 
ATOM   3612 C  CG    . PRO B 2 299 ? -22.335 40.343 38.045 1.00 11.55 ? 298  PRO B CG    1 
ATOM   3613 C  CD    . PRO B 2 299 ? -23.051 39.452 39.046 1.00 16.47 ? 298  PRO B CD    1 
ATOM   3614 N  N     . CYS B 2 300 ? -18.825 40.407 39.111 1.00 17.91 ? 299  CYS B N     1 
ATOM   3615 C  CA    . CYS B 2 300 ? -17.924 41.296 39.851 1.00 23.48 ? 299  CYS B CA    1 
ATOM   3616 C  C     . CYS B 2 300 ? -18.730 42.448 40.460 1.00 30.23 ? 299  CYS B C     1 
ATOM   3617 O  O     . CYS B 2 300 ? -19.779 42.837 39.929 1.00 37.74 ? 299  CYS B O     1 
ATOM   3618 C  CB    . CYS B 2 300 ? -16.834 41.850 38.921 1.00 19.91 ? 299  CYS B CB    1 
ATOM   3619 S  SG    . CYS B 2 300 ? -15.610 40.597 38.402 1.00 21.59 ? 299  CYS B SG    1 
ATOM   3620 H  H     . CYS B 2 300 ? -18.697 40.305 38.167 1.00 0.00  ? 299  CYS B H     1 
ATOM   3621 N  N     . PRO B 2 301 ? -18.280 42.987 41.598 1.00 31.64 ? 300  PRO B N     1 
ATOM   3622 C  CA    . PRO B 2 301 ? -19.016 44.090 42.216 1.00 33.34 ? 300  PRO B CA    1 
ATOM   3623 C  C     . PRO B 2 301 ? -18.799 45.371 41.427 1.00 36.39 ? 300  PRO B C     1 
ATOM   3624 O  O     . PRO B 2 301 ? -18.023 45.389 40.465 1.00 34.58 ? 300  PRO B O     1 
ATOM   3625 C  CB    . PRO B 2 301 ? -18.374 44.182 43.593 1.00 37.73 ? 300  PRO B CB    1 
ATOM   3626 C  CG    . PRO B 2 301 ? -16.926 43.832 43.303 1.00 36.30 ? 300  PRO B CG    1 
ATOM   3627 C  CD    . PRO B 2 301 ? -17.070 42.652 42.369 1.00 35.74 ? 300  PRO B CD    1 
ATOM   3628 N  N     . SER B 2 302 ? -19.490 46.435 41.822 1.00 41.63 ? 301  SER B N     1 
ATOM   3629 C  CA    . SER B 2 302 ? -19.338 47.716 41.148 1.00 49.40 ? 301  SER B CA    1 
ATOM   3630 C  C     . SER B 2 302 ? -17.888 48.150 41.324 1.00 49.38 ? 301  SER B C     1 
ATOM   3631 O  O     . SER B 2 302 ? -17.300 48.000 42.406 1.00 46.21 ? 301  SER B O     1 
ATOM   3632 C  CB    . SER B 2 302 ? -20.301 48.762 41.727 1.00 54.81 ? 301  SER B CB    1 
ATOM   3633 O  OG    . SER B 2 302 ? -20.391 48.679 43.150 1.00 62.06 ? 301  SER B OG    1 
ATOM   3634 H  H     . SER B 2 302 ? -20.080 46.394 42.600 1.00 0.00  ? 301  SER B H     1 
ATOM   3635 H  HG    . SER B 2 302 ? -20.975 49.368 43.494 1.00 0.00  ? 301  SER B HG    1 
ATOM   3636 N  N     . GLY B 2 303 ? -17.291 48.634 40.246 1.00 49.63 ? 302  GLY B N     1 
ATOM   3637 C  CA    . GLY B 2 303 ? -15.900 49.040 40.333 1.00 55.09 ? 302  GLY B CA    1 
ATOM   3638 C  C     . GLY B 2 303 ? -14.983 47.918 39.882 1.00 52.94 ? 302  GLY B C     1 
ATOM   3639 O  O     . GLY B 2 303 ? -13.816 48.158 39.524 1.00 51.83 ? 302  GLY B O     1 
ATOM   3640 H  H     . GLY B 2 303 ? -17.751 48.718 39.389 1.00 0.00  ? 302  GLY B H     1 
ATOM   3641 N  N     . GLY B 2 304 ? -15.519 46.694 39.912 1.00 52.92 ? 303  GLY B N     1 
ATOM   3642 C  CA    . GLY B 2 304 ? -14.788 45.517 39.472 1.00 41.49 ? 303  GLY B CA    1 
ATOM   3643 C  C     . GLY B 2 304 ? -14.295 44.527 40.503 1.00 29.40 ? 303  GLY B C     1 
ATOM   3644 O  O     . GLY B 2 304 ? -14.592 44.629 41.693 1.00 28.65 ? 303  GLY B O     1 
ATOM   3645 H  H     . GLY B 2 304 ? -16.428 46.559 40.238 1.00 0.00  ? 303  GLY B H     1 
ATOM   3646 N  N     . CYS B 2 305 ? -13.549 43.552 39.982 1.00 26.79 ? 304  CYS B N     1 
ATOM   3647 C  CA    . CYS B 2 305 ? -12.912 42.456 40.714 1.00 19.30 ? 304  CYS B CA    1 
ATOM   3648 C  C     . CYS B 2 305 ? -11.432 42.677 40.571 1.00 20.15 ? 304  CYS B C     1 
ATOM   3649 O  O     . CYS B 2 305 ? -10.986 43.225 39.553 1.00 16.58 ? 304  CYS B O     1 
ATOM   3650 C  CB    . CYS B 2 305 ? -13.085 41.115 39.986 1.00 17.31 ? 304  CYS B CB    1 
ATOM   3651 S  SG    . CYS B 2 305 ? -14.616 40.162 40.135 1.00 20.73 ? 304  CYS B SG    1 
ATOM   3652 H  H     . CYS B 2 305 ? -13.382 43.583 39.012 1.00 0.00  ? 304  CYS B H     1 
ATOM   3653 N  N     . PRO B 2 306 ? -10.649 42.292 41.586 1.00 14.92 ? 305  PRO B N     1 
ATOM   3654 C  CA    . PRO B 2 306 ? -9.210  42.476 41.421 1.00 20.19 ? 305  PRO B CA    1 
ATOM   3655 C  C     . PRO B 2 306 ? -8.686  41.280 40.597 1.00 24.33 ? 305  PRO B C     1 
ATOM   3656 O  O     . PRO B 2 306 ? -9.317  40.204 40.569 1.00 23.94 ? 305  PRO B O     1 
ATOM   3657 C  CB    . PRO B 2 306 ? -8.677  42.441 42.858 1.00 16.98 ? 305  PRO B CB    1 
ATOM   3658 C  CG    . PRO B 2 306 ? -9.696  41.671 43.583 1.00 10.56 ? 305  PRO B CG    1 
ATOM   3659 C  CD    . PRO B 2 306 ? -10.993 42.126 43.001 1.00 14.58 ? 305  PRO B CD    1 
ATOM   3660 N  N     . GLN B 2 307 ? -7.640  41.522 39.811 1.00 21.87 ? 306  GLN B N     1 
ATOM   3661 C  CA    . GLN B 2 307 ? -7.032  40.468 39.046 1.00 20.60 ? 306  GLN B CA    1 
ATOM   3662 C  C     . GLN B 2 307 ? -5.992  39.914 39.988 1.00 23.08 ? 306  GLN B C     1 
ATOM   3663 O  O     . GLN B 2 307 ? -5.309  40.667 40.685 1.00 19.51 ? 306  GLN B O     1 
ATOM   3664 C  CB    . GLN B 2 307 ? -6.366  40.998 37.788 1.00 17.58 ? 306  GLN B CB    1 
ATOM   3665 C  CG    . GLN B 2 307 ? -7.364  41.358 36.699 1.00 16.31 ? 306  GLN B CG    1 
ATOM   3666 C  CD    . GLN B 2 307 ? -7.934  40.154 35.965 1.00 16.39 ? 306  GLN B CD    1 
ATOM   3667 O  OE1   . GLN B 2 307 ? -7.277  39.143 35.801 1.00 19.79 ? 306  GLN B OE1   1 
ATOM   3668 N  NE2   . GLN B 2 307 ? -9.153  40.278 35.490 1.00 16.18 ? 306  GLN B NE2   1 
ATOM   3669 H  H     . GLN B 2 307 ? -7.295  42.434 39.738 1.00 0.00  ? 306  GLN B H     1 
ATOM   3670 H  HE21  . GLN B 2 307 ? -9.554  39.559 34.962 1.00 0.00  ? 306  GLN B HE21  1 
ATOM   3671 H  HE22  . GLN B 2 307 ? -9.613  41.128 35.691 1.00 0.00  ? 306  GLN B HE22  1 
ATOM   3672 N  N     . MET B 2 308 ? -6.004  38.597 40.132 1.00 22.67 ? 307  MET B N     1 
ATOM   3673 C  CA    . MET B 2 308 ? -5.042  37.929 40.973 1.00 21.99 ? 307  MET B CA    1 
ATOM   3674 C  C     . MET B 2 308 ? -3.724  37.958 40.202 1.00 20.54 ? 307  MET B C     1 
ATOM   3675 O  O     . MET B 2 308 ? -3.690  37.858 38.976 1.00 17.46 ? 307  MET B O     1 
ATOM   3676 C  CB    . MET B 2 308 ? -5.469  36.481 41.238 1.00 21.93 ? 307  MET B CB    1 
ATOM   3677 C  CG    . MET B 2 308 ? -4.531  35.711 42.156 1.00 22.85 ? 307  MET B CG    1 
ATOM   3678 S  SD    . MET B 2 308 ? -4.526  33.970 41.785 1.00 24.73 ? 307  MET B SD    1 
ATOM   3679 C  CE    . MET B 2 308 ? -5.883  33.617 42.499 1.00 22.00 ? 307  MET B CE    1 
ATOM   3680 H  H     . MET B 2 308 ? -6.683  38.070 39.659 1.00 0.00  ? 307  MET B H     1 
ATOM   3681 N  N     . GLY B 2 309 ? -2.632  38.173 40.911 1.00 22.27 ? 308  GLY B N     1 
ATOM   3682 C  CA    . GLY B 2 309 ? -1.364  38.187 40.229 1.00 19.26 ? 308  GLY B CA    1 
ATOM   3683 C  C     . GLY B 2 309 ? -0.713  39.525 40.027 1.00 18.47 ? 308  GLY B C     1 
ATOM   3684 O  O     . GLY B 2 309 ? -0.683  40.406 40.900 1.00 22.85 ? 308  GLY B O     1 
ATOM   3685 H  H     . GLY B 2 309 ? -2.687  38.330 41.868 1.00 0.00  ? 308  GLY B H     1 
ATOM   3686 N  N     . HIS B 2 310 ? -0.196  39.664 38.820 1.00 17.29 ? 309  HIS B N     1 
ATOM   3687 C  CA    . HIS B 2 310 ? 0.547   40.832 38.417 1.00 15.59 ? 309  HIS B CA    1 
ATOM   3688 C  C     . HIS B 2 310 ? -0.202  42.143 38.402 1.00 16.32 ? 309  HIS B C     1 
ATOM   3689 O  O     . HIS B 2 310 ? 0.358   43.177 38.745 1.00 19.83 ? 309  HIS B O     1 
ATOM   3690 C  CB    . HIS B 2 310 ? 1.155   40.587 37.036 1.00 13.52 ? 309  HIS B CB    1 
ATOM   3691 C  CG    . HIS B 2 310 ? 2.171   41.610 36.652 1.00 13.63 ? 309  HIS B CG    1 
ATOM   3692 N  ND1   . HIS B 2 310 ? 3.387   41.719 37.290 1.00 16.03 ? 309  HIS B ND1   1 
ATOM   3693 C  CD2   . HIS B 2 310 ? 2.171   42.544 35.674 1.00 13.00 ? 309  HIS B CD2   1 
ATOM   3694 C  CE1   . HIS B 2 310 ? 4.098   42.671 36.714 1.00 12.94 ? 309  HIS B CE1   1 
ATOM   3695 N  NE2   . HIS B 2 310 ? 3.384   43.183 35.731 1.00 14.31 ? 309  HIS B NE2   1 
ATOM   3696 H  H     . HIS B 2 310 ? -0.354  38.952 38.168 1.00 0.00  ? 309  HIS B H     1 
ATOM   3697 H  HD1   . HIS B 2 310 ? 3.683   41.193 38.077 1.00 0.00  ? 309  HIS B HD1   1 
ATOM   3698 H  HE2   . HIS B 2 310 ? 3.680   43.887 35.100 1.00 0.00  ? 309  HIS B HE2   1 
ATOM   3699 N  N     . TYR B 2 311 ? -1.447  42.100 37.946 1.00 18.68 ? 310  TYR B N     1 
ATOM   3700 C  CA    . TYR B 2 311 ? -2.296  43.277 37.805 1.00 15.91 ? 310  TYR B CA    1 
ATOM   3701 C  C     . TYR B 2 311 ? -3.178  43.652 38.972 1.00 17.70 ? 310  TYR B C     1 
ATOM   3702 O  O     . TYR B 2 311 ? -4.033  44.534 38.858 1.00 14.66 ? 310  TYR B O     1 
ATOM   3703 C  CB    . TYR B 2 311 ? -3.115  43.095 36.556 1.00 15.79 ? 310  TYR B CB    1 
ATOM   3704 C  CG    . TYR B 2 311 ? -2.215  42.998 35.346 1.00 17.33 ? 310  TYR B CG    1 
ATOM   3705 C  CD1   . TYR B 2 311 ? -1.523  44.118 34.898 1.00 16.12 ? 310  TYR B CD1   1 
ATOM   3706 C  CD2   . TYR B 2 311 ? -2.037  41.791 34.667 1.00 14.81 ? 310  TYR B CD2   1 
ATOM   3707 C  CE1   . TYR B 2 311 ? -0.674  44.041 33.819 1.00 17.83 ? 310  TYR B CE1   1 
ATOM   3708 C  CE2   . TYR B 2 311 ? -1.201  41.706 33.582 1.00 13.95 ? 310  TYR B CE2   1 
ATOM   3709 C  CZ    . TYR B 2 311 ? -0.519  42.841 33.168 1.00 19.23 ? 310  TYR B CZ    1 
ATOM   3710 O  OH    . TYR B 2 311 ? 0.350   42.792 32.115 1.00 25.06 ? 310  TYR B OH    1 
ATOM   3711 H  H     . TYR B 2 311 ? -1.841  41.241 37.688 1.00 0.00  ? 310  TYR B H     1 
ATOM   3712 H  HH    . TYR B 2 311 ? 0.394   41.891 31.764 1.00 0.00  ? 310  TYR B HH    1 
ATOM   3713 N  N     . ALA B 2 312 ? -2.906  43.031 40.116 1.00 18.39 ? 311  ALA B N     1 
ATOM   3714 C  CA    . ALA B 2 312 ? -3.665  43.261 41.331 1.00 21.76 ? 311  ALA B CA    1 
ATOM   3715 C  C     . ALA B 2 312 ? -3.493  44.683 41.854 1.00 24.02 ? 311  ALA B C     1 
ATOM   3716 O  O     . ALA B 2 312 ? -4.310  45.179 42.632 1.00 26.75 ? 311  ALA B O     1 
ATOM   3717 C  CB    . ALA B 2 312 ? -3.248  42.237 42.395 1.00 21.56 ? 311  ALA B CB    1 
ATOM   3718 H  H     . ALA B 2 312 ? -2.181  42.369 40.152 1.00 0.00  ? 311  ALA B H     1 
ATOM   3719 N  N     . ASP B 2 313 ? -2.443  45.353 41.406 1.00 24.77 ? 312  ASP B N     1 
ATOM   3720 C  CA    . ASP B 2 313 ? -2.192  46.695 41.876 1.00 27.25 ? 312  ASP B CA    1 
ATOM   3721 C  C     . ASP B 2 313 ? -3.007  47.725 41.118 1.00 25.85 ? 312  ASP B C     1 
ATOM   3722 O  O     . ASP B 2 313 ? -3.019  48.896 41.474 1.00 28.93 ? 312  ASP B O     1 
ATOM   3723 C  CB    . ASP B 2 313 ? -0.706  47.012 41.798 1.00 28.89 ? 312  ASP B CB    1 
ATOM   3724 C  CG    . ASP B 2 313 ? -0.182  47.034 40.381 1.00 32.12 ? 312  ASP B CG    1 
ATOM   3725 O  OD1   . ASP B 2 313 ? -0.767  46.373 39.494 1.00 30.35 ? 312  ASP B OD1   1 
ATOM   3726 O  OD2   . ASP B 2 313 ? 0.837   47.723 40.161 1.00 37.69 ? 312  ASP B OD2   1 
ATOM   3727 H  H     . ASP B 2 313 ? -1.833  44.939 40.766 1.00 0.00  ? 312  ASP B H     1 
ATOM   3728 N  N     . ARG B 2 314 ? -3.698  47.280 40.078 1.00 25.19 ? 313  ARG B N     1 
ATOM   3729 C  CA    . ARG B 2 314 ? -4.524  48.171 39.256 1.00 27.89 ? 313  ARG B CA    1 
ATOM   3730 C  C     . ARG B 2 314 ? -5.912  48.305 39.871 1.00 23.80 ? 313  ARG B C     1 
ATOM   3731 O  O     . ARG B 2 314 ? -6.730  49.115 39.445 1.00 25.25 ? 313  ARG B O     1 
ATOM   3732 C  CB    . ARG B 2 314 ? -4.596  47.631 37.815 1.00 28.68 ? 313  ARG B CB    1 
ATOM   3733 C  CG    . ARG B 2 314 ? -3.204  47.296 37.287 1.00 34.95 ? 313  ARG B CG    1 
ATOM   3734 C  CD    . ARG B 2 314 ? -2.910  47.889 35.948 1.00 40.33 ? 313  ARG B CD    1 
ATOM   3735 N  NE    . ARG B 2 314 ? -3.495  47.085 34.882 1.00 52.57 ? 313  ARG B NE    1 
ATOM   3736 C  CZ    . ARG B 2 314 ? -2.981  46.968 33.659 1.00 53.45 ? 313  ARG B CZ    1 
ATOM   3737 N  NH1   . ARG B 2 314 ? -1.860  47.609 33.332 1.00 51.66 ? 313  ARG B NH1   1 
ATOM   3738 N  NH2   . ARG B 2 314 ? -3.594  46.203 32.762 1.00 55.49 ? 313  ARG B NH2   1 
ATOM   3739 H  H     . ARG B 2 314 ? -3.647  46.335 39.834 1.00 0.00  ? 313  ARG B H     1 
ATOM   3740 H  HE    . ARG B 2 314 ? -4.320  46.587 35.064 1.00 0.00  ? 313  ARG B HE    1 
ATOM   3741 H  HH11  . ARG B 2 314 ? -1.392  48.183 34.005 1.00 0.00  ? 313  ARG B HH11  1 
ATOM   3742 H  HH12  . ARG B 2 314 ? -1.479  47.509 32.412 1.00 0.00  ? 313  ARG B HH12  1 
ATOM   3743 H  HH21  . ARG B 2 314 ? -4.438  45.723 33.000 1.00 0.00  ? 313  ARG B HH21  1 
ATOM   3744 H  HH22  . ARG B 2 314 ? -3.209  46.115 31.845 1.00 0.00  ? 313  ARG B HH22  1 
ATOM   3745 N  N     . TYR B 2 315 ? -6.141  47.536 40.921 1.00 19.09 ? 314  TYR B N     1 
ATOM   3746 C  CA    . TYR B 2 315 ? -7.406  47.530 41.597 1.00 18.75 ? 314  TYR B CA    1 
ATOM   3747 C  C     . TYR B 2 315 ? -7.579  48.781 42.459 1.00 27.35 ? 314  TYR B C     1 
ATOM   3748 O  O     . TYR B 2 315 ? -6.779  49.060 43.354 1.00 29.69 ? 314  TYR B O     1 
ATOM   3749 C  CB    . TYR B 2 315 ? -7.518  46.260 42.437 1.00 15.72 ? 314  TYR B CB    1 
ATOM   3750 C  CG    . TYR B 2 315 ? -8.806  46.094 43.212 1.00 14.85 ? 314  TYR B CG    1 
ATOM   3751 C  CD1   . TYR B 2 315 ? -10.058 46.230 42.596 1.00 17.67 ? 314  TYR B CD1   1 
ATOM   3752 C  CD2   . TYR B 2 315 ? -8.773  45.775 44.560 1.00 16.56 ? 314  TYR B CD2   1 
ATOM   3753 C  CE1   . TYR B 2 315 ? -11.250 46.049 43.319 1.00 13.30 ? 314  TYR B CE1   1 
ATOM   3754 C  CE2   . TYR B 2 315 ? -9.935  45.592 45.283 1.00 20.38 ? 314  TYR B CE2   1 
ATOM   3755 C  CZ    . TYR B 2 315 ? -11.173 45.729 44.662 1.00 19.52 ? 314  TYR B CZ    1 
ATOM   3756 O  OH    . TYR B 2 315 ? -12.311 45.519 45.412 1.00 23.52 ? 314  TYR B OH    1 
ATOM   3757 H  H     . TYR B 2 315 ? -5.418  46.991 41.286 1.00 0.00  ? 314  TYR B H     1 
ATOM   3758 H  HH    . TYR B 2 315 ? -12.082 45.401 46.339 1.00 0.00  ? 314  TYR B HH    1 
ATOM   3759 N  N     . PRO B 2 316 ? -8.628  49.569 42.172 1.00 29.90 ? 315  PRO B N     1 
ATOM   3760 C  CA    . PRO B 2 316 ? -8.985  50.796 42.871 1.00 27.11 ? 315  PRO B CA    1 
ATOM   3761 C  C     . PRO B 2 316 ? -8.998  50.694 44.396 1.00 28.20 ? 315  PRO B C     1 
ATOM   3762 O  O     . PRO B 2 316 ? -8.366  51.502 45.073 1.00 32.47 ? 315  PRO B O     1 
ATOM   3763 C  CB    . PRO B 2 316 ? -10.376 51.071 42.323 1.00 28.38 ? 315  PRO B CB    1 
ATOM   3764 C  CG    . PRO B 2 316 ? -10.183 50.729 40.887 1.00 29.09 ? 315  PRO B CG    1 
ATOM   3765 C  CD    . PRO B 2 316 ? -9.457  49.414 40.959 1.00 29.09 ? 315  PRO B CD    1 
ATOM   3766 N  N     . GLY B 2 317 ? -9.695  49.712 44.953 1.00 26.89 ? 316  GLY B N     1 
ATOM   3767 C  CA    . GLY B 2 317 ? -9.749  49.624 46.403 1.00 26.60 ? 316  GLY B CA    1 
ATOM   3768 C  C     . GLY B 2 317 ? -8.769  48.680 47.071 1.00 28.18 ? 316  GLY B C     1 
ATOM   3769 O  O     . GLY B 2 317 ? -9.050  48.158 48.156 1.00 30.94 ? 316  GLY B O     1 
ATOM   3770 H  H     . GLY B 2 317 ? -10.181 49.056 44.414 1.00 0.00  ? 316  GLY B H     1 
ATOM   3771 N  N     . LYS B 2 318 ? -7.583  48.537 46.494 1.00 25.49 ? 317  LYS B N     1 
ATOM   3772 C  CA    . LYS B 2 318 ? -6.601  47.621 47.037 1.00 28.20 ? 317  LYS B CA    1 
ATOM   3773 C  C     . LYS B 2 318 ? -6.215  47.765 48.490 1.00 30.26 ? 317  LYS B C     1 
ATOM   3774 O  O     . LYS B 2 318 ? -5.966  46.769 49.169 1.00 37.31 ? 317  LYS B O     1 
ATOM   3775 C  CB    . LYS B 2 318 ? -5.352  47.541 46.152 1.00 29.37 ? 317  LYS B CB    1 
ATOM   3776 C  CG    . LYS B 2 318 ? -4.768  48.845 45.723 1.00 28.72 ? 317  LYS B CG    1 
ATOM   3777 C  CD    . LYS B 2 318 ? -3.575  48.578 44.843 1.00 32.04 ? 317  LYS B CD    1 
ATOM   3778 C  CE    . LYS B 2 318 ? -2.964  49.849 44.326 1.00 33.23 ? 317  LYS B CE    1 
ATOM   3779 N  NZ    . LYS B 2 318 ? -3.946  50.554 43.448 1.00 43.29 ? 317  LYS B NZ    1 
ATOM   3780 H  H     . LYS B 2 318 ? -7.370  49.053 45.682 1.00 0.00  ? 317  LYS B H     1 
ATOM   3781 H  HZ1   . LYS B 2 318 ? -4.206  49.917 42.669 1.00 0.00  ? 317  LYS B HZ1   1 
ATOM   3782 H  HZ2   . LYS B 2 318 ? -4.791  50.794 44.004 1.00 0.00  ? 317  LYS B HZ2   1 
ATOM   3783 H  HZ3   . LYS B 2 318 ? -3.521  51.424 43.070 1.00 0.00  ? 317  LYS B HZ3   1 
ATOM   3784 N  N     . THR B 2 319 ? -6.194  48.983 48.999 1.00 34.59 ? 318  THR B N     1 
ATOM   3785 C  CA    . THR B 2 319 ? -5.810  49.169 50.389 1.00 32.71 ? 318  THR B CA    1 
ATOM   3786 C  C     . THR B 2 319 ? -6.914  49.708 51.292 1.00 34.33 ? 318  THR B C     1 
ATOM   3787 O  O     . THR B 2 319 ? -6.657  50.094 52.427 1.00 28.92 ? 318  THR B O     1 
ATOM   3788 C  CB    . THR B 2 319 ? -4.500  49.981 50.491 1.00 31.20 ? 318  THR B CB    1 
ATOM   3789 O  OG1   . THR B 2 319 ? -4.480  51.011 49.486 1.00 35.77 ? 318  THR B OG1   1 
ATOM   3790 C  CG2   . THR B 2 319 ? -3.317  49.062 50.241 1.00 27.49 ? 318  THR B CG2   1 
ATOM   3791 H  H     . THR B 2 319 ? -6.412  49.770 48.461 1.00 0.00  ? 318  THR B H     1 
ATOM   3792 H  HG1   . THR B 2 319 ? -3.669  51.516 49.620 1.00 0.00  ? 318  THR B HG1   1 
ATOM   3793 N  N     . ASN B 2 320 ? -8.153  49.650 50.793 1.00 42.24 ? 319  ASN B N     1 
ATOM   3794 C  CA    . ASN B 2 320 ? -9.346  50.108 51.521 1.00 45.36 ? 319  ASN B CA    1 
ATOM   3795 C  C     . ASN B 2 320 ? -9.484  49.389 52.832 1.00 44.67 ? 319  ASN B C     1 
ATOM   3796 O  O     . ASN B 2 320 ? -10.075 49.908 53.766 1.00 50.90 ? 319  ASN B O     1 
ATOM   3797 C  CB    . ASN B 2 320 ? -10.618 49.791 50.740 1.00 52.35 ? 319  ASN B CB    1 
ATOM   3798 C  CG    . ASN B 2 320 ? -10.843 50.717 49.572 1.00 59.39 ? 319  ASN B CG    1 
ATOM   3799 O  OD1   . ASN B 2 320 ? -11.762 50.499 48.782 1.00 64.38 ? 319  ASN B OD1   1 
ATOM   3800 N  ND2   . ASN B 2 320 ? -10.020 51.759 49.449 1.00 62.65 ? 319  ASN B ND2   1 
ATOM   3801 H  H     . ASN B 2 320 ? -8.286  49.269 49.898 1.00 0.00  ? 319  ASN B H     1 
ATOM   3802 H  HD21  . ASN B 2 320 ? -10.198 52.316 48.652 1.00 0.00  ? 319  ASN B HD21  1 
ATOM   3803 H  HD22  . ASN B 2 320 ? -9.310  51.978 50.079 1.00 0.00  ? 319  ASN B HD22  1 
ATOM   3804 N  N     . ASP B 2 321 ? -9.024  48.145 52.859 1.00 42.93 ? 320  ASP B N     1 
ATOM   3805 C  CA    . ASP B 2 321 ? -9.100  47.322 54.048 1.00 37.23 ? 320  ASP B CA    1 
ATOM   3806 C  C     . ASP B 2 321 ? -8.015  46.290 53.894 1.00 32.93 ? 320  ASP B C     1 
ATOM   3807 O  O     . ASP B 2 321 ? -7.471  46.137 52.807 1.00 26.97 ? 320  ASP B O     1 
ATOM   3808 C  CB    . ASP B 2 321 ? -10.464 46.636 54.117 1.00 41.12 ? 320  ASP B CB    1 
ATOM   3809 C  CG    . ASP B 2 321 ? -10.805 46.145 55.508 1.00 45.56 ? 320  ASP B CG    1 
ATOM   3810 O  OD1   . ASP B 2 321 ? -10.008 46.384 56.445 1.00 50.29 ? 320  ASP B OD1   1 
ATOM   3811 O  OD2   . ASP B 2 321 ? -11.876 45.521 55.673 1.00 49.01 ? 320  ASP B OD2   1 
ATOM   3812 H  H     . ASP B 2 321 ? -8.629  47.743 52.055 1.00 0.00  ? 320  ASP B H     1 
ATOM   3813 N  N     . VAL B 2 322 ? -7.685  45.603 54.978 1.00 29.19 ? 321  VAL B N     1 
ATOM   3814 C  CA    . VAL B 2 322 ? -6.654  44.582 54.931 1.00 34.38 ? 321  VAL B CA    1 
ATOM   3815 C  C     . VAL B 2 322 ? -7.286  43.201 55.034 1.00 32.95 ? 321  VAL B C     1 
ATOM   3816 O  O     . VAL B 2 322 ? -8.321  43.062 55.676 1.00 37.94 ? 321  VAL B O     1 
ATOM   3817 C  CB    . VAL B 2 322 ? -5.616  44.768 56.085 1.00 34.41 ? 321  VAL B CB    1 
ATOM   3818 C  CG1   . VAL B 2 322 ? -5.085  46.191 56.089 1.00 36.24 ? 321  VAL B CG1   1 
ATOM   3819 C  CG2   . VAL B 2 322 ? -6.220  44.434 57.427 1.00 32.27 ? 321  VAL B CG2   1 
ATOM   3820 H  H     . VAL B 2 322 ? -8.132  45.767 55.829 1.00 0.00  ? 321  VAL B H     1 
ATOM   3821 N  N     . GLY B 2 323 ? -6.705  42.216 54.345 1.00 29.64 ? 322  GLY B N     1 
ATOM   3822 C  CA    . GLY B 2 323 ? -7.182  40.846 54.410 1.00 24.70 ? 322  GLY B CA    1 
ATOM   3823 C  C     . GLY B 2 323 ? -8.457  40.534 53.660 1.00 26.59 ? 322  GLY B C     1 
ATOM   3824 O  O     . GLY B 2 323 ? -9.202  39.609 53.999 1.00 27.38 ? 322  GLY B O     1 
ATOM   3825 H  H     . GLY B 2 323 ? -5.947  42.415 53.767 1.00 0.00  ? 322  GLY B H     1 
ATOM   3826 N  N     . GLN B 2 324 ? -8.706  41.311 52.622 1.00 27.18 ? 323  GLN B N     1 
ATOM   3827 C  CA    . GLN B 2 324 ? -9.885  41.125 51.794 1.00 26.23 ? 323  GLN B CA    1 
ATOM   3828 C  C     . GLN B 2 324 ? -9.678  39.817 51.019 1.00 24.40 ? 323  GLN B C     1 
ATOM   3829 O  O     . GLN B 2 324 ? -8.671  39.636 50.318 1.00 24.17 ? 323  GLN B O     1 
ATOM   3830 C  CB    . GLN B 2 324 ? -10.046 42.328 50.850 1.00 24.65 ? 323  GLN B CB    1 
ATOM   3831 C  CG    . GLN B 2 324 ? -9.897  43.673 51.546 1.00 27.07 ? 323  GLN B CG    1 
ATOM   3832 C  CD    . GLN B 2 324 ? -9.733  44.850 50.591 1.00 34.18 ? 323  GLN B CD    1 
ATOM   3833 O  OE1   . GLN B 2 324 ? -10.679 45.231 49.905 1.00 39.51 ? 323  GLN B OE1   1 
ATOM   3834 N  NE2   . GLN B 2 324 ? -8.547  45.459 50.573 1.00 32.88 ? 323  GLN B NE2   1 
ATOM   3835 H  H     . GLN B 2 324 ? -8.054  41.988 52.359 1.00 0.00  ? 323  GLN B H     1 
ATOM   3836 H  HE21  . GLN B 2 324 ? -8.416  46.187 49.928 1.00 0.00  ? 323  GLN B HE21  1 
ATOM   3837 H  HE22  . GLN B 2 324 ? -7.850  45.146 51.179 1.00 0.00  ? 323  GLN B HE22  1 
ATOM   3838 N  N     . LYS B 2 325 ? -10.624 38.899 51.176 1.00 23.42 ? 324  LYS B N     1 
ATOM   3839 C  CA    . LYS B 2 325 ? -10.579 37.598 50.518 1.00 22.61 ? 324  LYS B CA    1 
ATOM   3840 C  C     . LYS B 2 325 ? -11.289 37.529 49.168 1.00 24.72 ? 324  LYS B C     1 
ATOM   3841 O  O     . LYS B 2 325 ? -12.464 37.923 49.051 1.00 22.28 ? 324  LYS B O     1 
ATOM   3842 C  CB    . LYS B 2 325 ? -11.146 36.528 51.458 1.00 24.90 ? 324  LYS B CB    1 
ATOM   3843 C  CG    . LYS B 2 325 ? -10.169 36.125 52.563 1.00 26.31 ? 324  LYS B CG    1 
ATOM   3844 C  CD    . LYS B 2 325 ? -10.719 35.034 53.460 1.00 26.34 ? 324  LYS B CD    1 
ATOM   3845 C  CE    . LYS B 2 325 ? -11.697 35.588 54.449 1.00 26.67 ? 324  LYS B CE    1 
ATOM   3846 N  NZ    . LYS B 2 325 ? -12.031 34.565 55.470 1.00 31.37 ? 324  LYS B NZ    1 
ATOM   3847 H  H     . LYS B 2 325 ? -11.402 39.109 51.740 1.00 0.00  ? 324  LYS B H     1 
ATOM   3848 H  HZ1   . LYS B 2 325 ? -12.440 33.747 54.990 1.00 0.00  ? 324  LYS B HZ1   1 
ATOM   3849 H  HZ2   . LYS B 2 325 ? -11.181 34.268 55.989 1.00 0.00  ? 324  LYS B HZ2   1 
ATOM   3850 H  HZ3   . LYS B 2 325 ? -12.724 34.964 56.139 1.00 0.00  ? 324  LYS B HZ3   1 
ATOM   3851 N  N     . PHE B 2 326 ? -10.572 37.012 48.161 1.00 24.73 ? 325  PHE B N     1 
ATOM   3852 C  CA    . PHE B 2 326 ? -11.109 36.836 46.802 1.00 21.24 ? 325  PHE B CA    1 
ATOM   3853 C  C     . PHE B 2 326 ? -10.951 35.388 46.351 1.00 19.83 ? 325  PHE B C     1 
ATOM   3854 O  O     . PHE B 2 326 ? -9.982  34.725 46.717 1.00 21.22 ? 325  PHE B O     1 
ATOM   3855 C  CB    . PHE B 2 326 ? -10.445 37.798 45.821 1.00 17.17 ? 325  PHE B CB    1 
ATOM   3856 C  CG    . PHE B 2 326 ? -10.538 39.203 46.256 1.00 19.45 ? 325  PHE B CG    1 
ATOM   3857 C  CD1   . PHE B 2 326 ? -9.696  39.682 47.267 1.00 22.21 ? 325  PHE B CD1   1 
ATOM   3858 C  CD2   . PHE B 2 326 ? -11.536 40.027 45.763 1.00 21.56 ? 325  PHE B CD2   1 
ATOM   3859 C  CE1   . PHE B 2 326 ? -9.862  40.964 47.789 1.00 23.77 ? 325  PHE B CE1   1 
ATOM   3860 C  CE2   . PHE B 2 326 ? -11.713 41.326 46.281 1.00 25.22 ? 325  PHE B CE2   1 
ATOM   3861 C  CZ    . PHE B 2 326 ? -10.875 41.795 47.300 1.00 22.04 ? 325  PHE B CZ    1 
ATOM   3862 H  H     . PHE B 2 326 ? -9.647  36.725 48.338 1.00 0.00  ? 325  PHE B H     1 
ATOM   3863 N  N     . TYR B 2 327 ? -11.907 34.913 45.554 1.00 21.78 ? 326  TYR B N     1 
ATOM   3864 C  CA    . TYR B 2 327 ? -11.932 33.538 45.063 1.00 19.09 ? 326  TYR B CA    1 
ATOM   3865 C  C     . TYR B 2 327 ? -12.043 33.458 43.558 1.00 16.55 ? 326  TYR B C     1 
ATOM   3866 O  O     . TYR B 2 327 ? -12.603 34.348 42.929 1.00 25.32 ? 326  TYR B O     1 
ATOM   3867 C  CB    . TYR B 2 327 ? -13.088 32.806 45.716 1.00 22.89 ? 326  TYR B CB    1 
ATOM   3868 C  CG    . TYR B 2 327 ? -12.923 32.722 47.201 1.00 20.97 ? 326  TYR B CG    1 
ATOM   3869 C  CD1   . TYR B 2 327 ? -12.028 31.812 47.757 1.00 21.18 ? 326  TYR B CD1   1 
ATOM   3870 C  CD2   . TYR B 2 327 ? -13.577 33.621 48.053 1.00 23.74 ? 326  TYR B CD2   1 
ATOM   3871 C  CE1   . TYR B 2 327 ? -11.779 31.800 49.126 1.00 21.41 ? 326  TYR B CE1   1 
ATOM   3872 C  CE2   . TYR B 2 327 ? -13.322 33.620 49.445 1.00 20.27 ? 326  TYR B CE2   1 
ATOM   3873 C  CZ    . TYR B 2 327 ? -12.423 32.705 49.952 1.00 17.70 ? 326  TYR B CZ    1 
ATOM   3874 O  OH    . TYR B 2 327 ? -12.117 32.697 51.270 1.00 25.48 ? 326  TYR B OH    1 
ATOM   3875 H  H     . TYR B 2 327 ? -12.644 35.501 45.281 1.00 0.00  ? 326  TYR B H     1 
ATOM   3876 H  HH    . TYR B 2 327 ? -11.453 32.022 51.446 1.00 0.00  ? 326  TYR B HH    1 
ATOM   3877 N  N     . LEU B 2 328 ? -11.556 32.373 42.982 1.00 11.30 ? 327  LEU B N     1 
ATOM   3878 C  CA    . LEU B 2 328 ? -11.566 32.205 41.542 1.00 9.27  ? 327  LEU B CA    1 
ATOM   3879 C  C     . LEU B 2 328 ? -10.995 30.843 41.209 1.00 12.80 ? 327  LEU B C     1 
ATOM   3880 O  O     . LEU B 2 328 ? -10.233 30.293 41.992 1.00 16.99 ? 327  LEU B O     1 
ATOM   3881 C  CB    . LEU B 2 328 ? -10.674 33.269 40.890 1.00 9.64  ? 327  LEU B CB    1 
ATOM   3882 C  CG    . LEU B 2 328 ? -9.151  33.290 41.215 1.00 15.88 ? 327  LEU B CG    1 
ATOM   3883 C  CD1   . LEU B 2 328 ? -8.323  33.806 40.003 1.00 11.25 ? 327  LEU B CD1   1 
ATOM   3884 C  CD2   . LEU B 2 328 ? -8.873  34.148 42.466 1.00 8.20  ? 327  LEU B CD2   1 
ATOM   3885 H  H     . LEU B 2 328 ? -11.185 31.647 43.521 1.00 0.00  ? 327  LEU B H     1 
ATOM   3886 N  N     . ASP B 2 329 ? -11.320 30.309 40.040 1.00 14.12 ? 328  ASP B N     1 
ATOM   3887 C  CA    . ASP B 2 329 ? -10.800 29.014 39.629 1.00 12.11 ? 328  ASP B CA    1 
ATOM   3888 C  C     . ASP B 2 329 ? -9.849  29.215 38.466 1.00 14.02 ? 328  ASP B C     1 
ATOM   3889 O  O     . ASP B 2 329 ? -10.021 30.146 37.676 1.00 14.43 ? 328  ASP B O     1 
ATOM   3890 C  CB    . ASP B 2 329 ? -11.940 28.100 39.189 1.00 16.04 ? 328  ASP B CB    1 
ATOM   3891 C  CG    . ASP B 2 329 ? -12.937 27.838 40.294 1.00 12.36 ? 328  ASP B CG    1 
ATOM   3892 O  OD1   . ASP B 2 329 ? -12.531 27.705 41.453 1.00 15.48 ? 328  ASP B OD1   1 
ATOM   3893 O  OD2   . ASP B 2 329 ? -14.135 27.751 40.011 1.00 18.88 ? 328  ASP B OD2   1 
ATOM   3894 H  H     . ASP B 2 329 ? -11.896 30.785 39.398 1.00 0.00  ? 328  ASP B H     1 
ATOM   3895 N  N     . THR B 2 330 ? -8.843  28.356 38.342 1.00 16.65 ? 329  THR B N     1 
ATOM   3896 C  CA    . THR B 2 330 ? -7.904  28.494 37.235 1.00 15.63 ? 329  THR B CA    1 
ATOM   3897 C  C     . THR B 2 330 ? -7.915  27.190 36.487 1.00 19.19 ? 329  THR B C     1 
ATOM   3898 O  O     . THR B 2 330 ? -8.729  26.313 36.769 1.00 16.30 ? 329  THR B O     1 
ATOM   3899 C  CB    . THR B 2 330 ? -6.471  28.735 37.702 1.00 13.79 ? 329  THR B CB    1 
ATOM   3900 O  OG1   . THR B 2 330 ? -5.992  27.546 38.340 1.00 17.86 ? 329  THR B OG1   1 
ATOM   3901 C  CG2   . THR B 2 330 ? -6.397  29.911 38.685 1.00 13.21 ? 329  THR B CG2   1 
ATOM   3902 H  H     . THR B 2 330 ? -8.719  27.581 38.937 1.00 0.00  ? 329  THR B H     1 
ATOM   3903 H  HG1   . THR B 2 330 ? -5.029  27.526 38.363 1.00 0.00  ? 329  THR B HG1   1 
ATOM   3904 N  N     . GLY B 2 331 ? -6.999  27.068 35.536 1.00 25.82 ? 330  GLY B N     1 
ATOM   3905 C  CA    . GLY B 2 331 ? -6.890  25.841 34.773 1.00 30.73 ? 330  GLY B CA    1 
ATOM   3906 C  C     . GLY B 2 331 ? -6.022  24.850 35.518 1.00 31.79 ? 330  GLY B C     1 
ATOM   3907 O  O     . GLY B 2 331 ? -5.480  25.169 36.581 1.00 30.98 ? 330  GLY B O     1 
ATOM   3908 H  H     . GLY B 2 331 ? -6.407  27.814 35.331 1.00 0.00  ? 330  GLY B H     1 
ATOM   3909 N  N     . ASP B 2 332 ? -5.886  23.651 34.959 1.00 36.07 ? 331  ASP B N     1 
ATOM   3910 C  CA    . ASP B 2 332 ? -5.069  22.599 35.565 1.00 38.83 ? 331  ASP B CA    1 
ATOM   3911 C  C     . ASP B 2 332 ? -3.699  22.480 34.882 1.00 35.92 ? 331  ASP B C     1 
ATOM   3912 O  O     . ASP B 2 332 ? -2.879  21.640 35.253 1.00 38.77 ? 331  ASP B O     1 
ATOM   3913 C  CB    . ASP B 2 332 ? -5.790  21.259 35.470 1.00 42.58 ? 331  ASP B CB    1 
ATOM   3914 C  CG    . ASP B 2 332 ? -5.724  20.674 34.080 1.00 47.30 ? 331  ASP B CG    1 
ATOM   3915 O  OD1   . ASP B 2 332 ? -6.292  21.306 33.165 1.00 49.03 ? 331  ASP B OD1   1 
ATOM   3916 O  OD2   . ASP B 2 332 ? -5.068  19.617 33.892 1.00 53.27 ? 331  ASP B OD2   1 
ATOM   3917 H  H     . ASP B 2 332 ? -6.352  23.488 34.111 1.00 0.00  ? 331  ASP B H     1 
ATOM   3918 N  N     . ALA B 2 333 ? -3.474  23.291 33.854 1.00 28.17 ? 332  ALA B N     1 
ATOM   3919 C  CA    . ALA B 2 333 ? -2.213  23.263 33.123 1.00 29.92 ? 332  ALA B CA    1 
ATOM   3920 C  C     . ALA B 2 333 ? -2.035  24.633 32.498 1.00 28.76 ? 332  ALA B C     1 
ATOM   3921 O  O     . ALA B 2 333 ? -3.023  25.362 32.371 1.00 28.24 ? 332  ALA B O     1 
ATOM   3922 C  CB    . ALA B 2 333 ? -2.230  22.170 32.039 1.00 22.08 ? 332  ALA B CB    1 
ATOM   3923 H  H     . ALA B 2 333 ? -4.138  23.942 33.554 1.00 0.00  ? 332  ALA B H     1 
ATOM   3924 N  N     . SER B 2 334 ? -0.799  24.981 32.108 1.00 32.51 ? 333  SER B N     1 
ATOM   3925 C  CA    . SER B 2 334 ? -0.523  26.279 31.536 1.00 30.39 ? 333  SER B CA    1 
ATOM   3926 C  C     . SER B 2 334 ? -1.521  26.830 30.578 1.00 35.81 ? 333  SER B C     1 
ATOM   3927 O  O     . SER B 2 334 ? -1.903  26.253 29.562 1.00 38.40 ? 333  SER B O     1 
ATOM   3928 C  CB    . SER B 2 334 ? 0.877   26.504 31.036 1.00 32.86 ? 333  SER B CB    1 
ATOM   3929 O  OG    . SER B 2 334 ? 1.033   27.909 30.828 1.00 26.65 ? 333  SER B OG    1 
ATOM   3930 H  H     . SER B 2 334 ? -0.054  24.375 32.277 1.00 0.00  ? 333  SER B H     1 
ATOM   3931 H  HG    . SER B 2 334 ? 1.962   27.851 30.541 1.00 0.00  ? 333  SER B HG    1 
ATOM   3932 N  N     . ASN B 2 335 ? -1.703  28.091 30.910 1.00 39.62 ? 334  ASN B N     1 
ATOM   3933 C  CA    . ASN B 2 335 ? -2.647  29.079 30.467 1.00 32.81 ? 334  ASN B CA    1 
ATOM   3934 C  C     . ASN B 2 335 ? -3.788  28.724 31.363 1.00 27.60 ? 334  ASN B C     1 
ATOM   3935 O  O     . ASN B 2 335 ? -4.721  27.998 31.010 1.00 22.10 ? 334  ASN B O     1 
ATOM   3936 C  CB    . ASN B 2 335 ? -3.047  29.155 29.040 1.00 33.47 ? 334  ASN B CB    1 
ATOM   3937 C  CG    . ASN B 2 335 ? -3.677  30.485 28.782 1.00 37.32 ? 334  ASN B CG    1 
ATOM   3938 O  OD1   . ASN B 2 335 ? -3.604  31.354 29.648 1.00 31.05 ? 334  ASN B OD1   1 
ATOM   3939 N  ND2   . ASN B 2 335 ? -4.328  30.658 27.649 1.00 47.99 ? 334  ASN B ND2   1 
ATOM   3940 H  H     . ASN B 2 335 ? -1.028  28.358 31.559 1.00 0.00  ? 334  ASN B H     1 
ATOM   3941 H  HD21  . ASN B 2 335 ? -4.728  31.533 27.555 1.00 0.00  ? 334  ASN B HD21  1 
ATOM   3942 H  HD22  . ASN B 2 335 ? -4.391  29.928 27.005 1.00 0.00  ? 334  ASN B HD22  1 
ATOM   3943 N  N     . PHE B 2 336 ? -3.458  29.007 32.615 1.00 20.11 ? 335  PHE B N     1 
ATOM   3944 C  CA    . PHE B 2 336 ? -4.279  28.802 33.766 1.00 20.51 ? 335  PHE B CA    1 
ATOM   3945 C  C     . PHE B 2 336 ? -5.430  29.798 33.770 1.00 19.86 ? 335  PHE B C     1 
ATOM   3946 O  O     . PHE B 2 336 ? -6.231  29.803 34.700 1.00 23.01 ? 335  PHE B O     1 
ATOM   3947 C  CB    . PHE B 2 336 ? -3.403  29.021 35.006 1.00 20.26 ? 335  PHE B CB    1 
ATOM   3948 C  CG    . PHE B 2 336 ? -2.342  27.969 35.204 1.00 21.33 ? 335  PHE B CG    1 
ATOM   3949 C  CD1   . PHE B 2 336 ? -2.680  26.699 35.661 1.00 23.22 ? 335  PHE B CD1   1 
ATOM   3950 C  CD2   . PHE B 2 336 ? -1.007  28.256 34.974 1.00 20.98 ? 335  PHE B CD2   1 
ATOM   3951 C  CE1   . PHE B 2 336 ? -1.697  25.734 35.887 1.00 24.63 ? 335  PHE B CE1   1 
ATOM   3952 C  CE2   . PHE B 2 336 ? -0.017  27.298 35.195 1.00 20.82 ? 335  PHE B CE2   1 
ATOM   3953 C  CZ    . PHE B 2 336 ? -0.361  26.042 35.652 1.00 21.68 ? 335  PHE B CZ    1 
ATOM   3954 H  H     . PHE B 2 336 ? -2.584  29.399 32.763 1.00 0.00  ? 335  PHE B H     1 
ATOM   3955 N  N     . ALA B 2 337 ? -5.442  30.697 32.788 1.00 18.96 ? 336  ALA B N     1 
ATOM   3956 C  CA    . ALA B 2 337 ? -6.468  31.718 32.672 1.00 21.02 ? 336  ALA B CA    1 
ATOM   3957 C  C     . ALA B 2 337 ? -7.831  31.095 32.349 1.00 19.11 ? 336  ALA B C     1 
ATOM   3958 O  O     . ALA B 2 337 ? -7.919  30.205 31.511 1.00 18.59 ? 336  ALA B O     1 
ATOM   3959 C  CB    . ALA B 2 337 ? -6.073  32.745 31.614 1.00 22.40 ? 336  ALA B CB    1 
ATOM   3960 H  H     . ALA B 2 337 ? -4.774  30.682 32.083 1.00 0.00  ? 336  ALA B H     1 
ATOM   3961 N  N     . ARG B 2 338 ? -8.868  31.599 33.019 1.00 18.44 ? 337  ARG B N     1 
ATOM   3962 C  CA    . ARG B 2 338 ? -10.253 31.142 32.898 1.00 18.33 ? 337  ARG B CA    1 
ATOM   3963 C  C     . ARG B 2 338 ? -11.154 32.368 32.982 1.00 19.12 ? 337  ARG B C     1 
ATOM   3964 O  O     . ARG B 2 338 ? -10.873 33.288 33.767 1.00 21.61 ? 337  ARG B O     1 
ATOM   3965 C  CB    . ARG B 2 338 ? -10.640 30.282 34.112 1.00 16.26 ? 337  ARG B CB    1 
ATOM   3966 C  CG    . ARG B 2 338 ? -10.009 28.924 34.238 1.00 17.76 ? 337  ARG B CG    1 
ATOM   3967 C  CD    . ARG B 2 338 ? -10.326 28.008 33.061 1.00 16.01 ? 337  ARG B CD    1 
ATOM   3968 N  NE    . ARG B 2 338 ? -9.170  27.985 32.194 1.00 20.53 ? 337  ARG B NE    1 
ATOM   3969 C  CZ    . ARG B 2 338 ? -8.500  26.898 31.839 1.00 17.96 ? 337  ARG B CZ    1 
ATOM   3970 N  NH1   . ARG B 2 338 ? -8.956  25.681 32.143 1.00 18.12 ? 337  ARG B NH1   1 
ATOM   3971 N  NH2   . ARG B 2 338 ? -7.417  27.039 31.088 1.00 17.88 ? 337  ARG B NH2   1 
ATOM   3972 H  H     . ARG B 2 338 ? -8.713  32.347 33.640 1.00 0.00  ? 337  ARG B H     1 
ATOM   3973 H  HE    . ARG B 2 338 ? -8.932  28.817 31.784 1.00 0.00  ? 337  ARG B HE    1 
ATOM   3974 H  HH11  . ARG B 2 338 ? -9.810  25.552 32.644 1.00 0.00  ? 337  ARG B HH11  1 
ATOM   3975 H  HH12  . ARG B 2 338 ? -8.422  24.890 31.851 1.00 0.00  ? 337  ARG B HH12  1 
ATOM   3976 H  HH21  . ARG B 2 338 ? -7.140  27.962 30.805 1.00 0.00  ? 337  ARG B HH21  1 
ATOM   3977 H  HH22  . ARG B 2 338 ? -6.902  26.241 30.792 1.00 0.00  ? 337  ARG B HH22  1 
ATOM   3978 N  N     . TRP B 2 339 ? -12.230 32.386 32.197 1.00 16.66 ? 338  TRP B N     1 
ATOM   3979 C  CA    . TRP B 2 339 ? -13.205 33.478 32.253 1.00 12.60 ? 338  TRP B CA    1 
ATOM   3980 C  C     . TRP B 2 339 ? -14.537 32.893 32.666 1.00 11.97 ? 338  TRP B C     1 
ATOM   3981 O  O     . TRP B 2 339 ? -15.073 32.019 31.987 1.00 17.15 ? 338  TRP B O     1 
ATOM   3982 C  CB    . TRP B 2 339 ? -13.289 34.209 30.932 1.00 8.47  ? 338  TRP B CB    1 
ATOM   3983 C  CG    . TRP B 2 339 ? -11.993 34.943 30.626 1.00 14.05 ? 338  TRP B CG    1 
ATOM   3984 C  CD1   . TRP B 2 339 ? -11.700 36.249 30.919 1.00 7.41  ? 338  TRP B CD1   1 
ATOM   3985 C  CD2   . TRP B 2 339 ? -10.814 34.394 29.997 1.00 13.57 ? 338  TRP B CD2   1 
ATOM   3986 N  NE1   . TRP B 2 339 ? -10.424 36.538 30.514 1.00 11.51 ? 338  TRP B NE1   1 
ATOM   3987 C  CE2   . TRP B 2 339 ? -9.851  35.426 29.951 1.00 14.38 ? 338  TRP B CE2   1 
ATOM   3988 C  CE3   . TRP B 2 339 ? -10.479 33.122 29.469 1.00 17.94 ? 338  TRP B CE3   1 
ATOM   3989 C  CZ2   . TRP B 2 339 ? -8.555  35.234 29.395 1.00 12.46 ? 338  TRP B CZ2   1 
ATOM   3990 C  CZ3   . TRP B 2 339 ? -9.191  32.928 28.911 1.00 9.18  ? 338  TRP B CZ3   1 
ATOM   3991 C  CH2   . TRP B 2 339 ? -8.249  33.986 28.885 1.00 9.05  ? 338  TRP B CH2   1 
ATOM   3992 H  H     . TRP B 2 339 ? -12.378 31.655 31.559 1.00 0.00  ? 338  TRP B H     1 
ATOM   3993 H  HE1   . TRP B 2 339 ? -10.016 37.417 30.582 1.00 0.00  ? 338  TRP B HE1   1 
ATOM   3994 N  N     . ARG B 2 340 ? -15.036 33.337 33.814 1.00 7.03  ? 339  ARG B N     1 
ATOM   3995 C  CA    . ARG B 2 340 ? -16.285 32.844 34.383 1.00 11.97 ? 339  ARG B CA    1 
ATOM   3996 C  C     . ARG B 2 340 ? -17.575 33.423 33.774 1.00 15.26 ? 339  ARG B C     1 
ATOM   3997 O  O     . ARG B 2 340 ? -17.691 34.638 33.592 1.00 18.24 ? 339  ARG B O     1 
ATOM   3998 C  CB    . ARG B 2 340 ? -16.264 33.073 35.906 1.00 8.71  ? 339  ARG B CB    1 
ATOM   3999 C  CG    . ARG B 2 340 ? -17.292 32.261 36.702 1.00 7.16  ? 339  ARG B CG    1 
ATOM   4000 C  CD    . ARG B 2 340 ? -16.851 32.087 38.142 1.00 10.35 ? 339  ARG B CD    1 
ATOM   4001 N  NE    . ARG B 2 340 ? -17.007 30.720 38.679 1.00 16.71 ? 339  ARG B NE    1 
ATOM   4002 C  CZ    . ARG B 2 340 ? -18.032 30.385 39.452 1.00 16.15 ? 339  ARG B CZ    1 
ATOM   4003 N  NH1   . ARG B 2 340 ? -18.926 31.307 39.728 1.00 21.92 ? 339  ARG B NH1   1 
ATOM   4004 N  NH2   . ARG B 2 340 ? -18.180 29.177 39.956 1.00 13.54 ? 339  ARG B NH2   1 
ATOM   4005 H  H     . ARG B 2 340 ? -14.578 34.051 34.268 1.00 0.00  ? 339  ARG B H     1 
ATOM   4006 H  HE    . ARG B 2 340 ? -16.328 30.048 38.459 1.00 0.00  ? 339  ARG B HE    1 
ATOM   4007 H  HH11  . ARG B 2 340 ? -18.845 32.234 39.362 1.00 0.00  ? 339  ARG B HH11  1 
ATOM   4008 H  HH12  . ARG B 2 340 ? -19.699 31.072 40.317 1.00 0.00  ? 339  ARG B HH12  1 
ATOM   4009 H  HH21  . ARG B 2 340 ? -17.500 28.473 39.755 1.00 0.00  ? 339  ARG B HH21  1 
ATOM   4010 H  HH22  . ARG B 2 340 ? -18.966 28.979 40.537 1.00 0.00  ? 339  ARG B HH22  1 
ATOM   4011 N  N     . TYR B 2 341 ? -18.512 32.554 33.399 1.00 14.40 ? 340  TYR B N     1 
ATOM   4012 C  CA    . TYR B 2 341 ? -19.800 32.999 32.858 1.00 17.46 ? 340  TYR B CA    1 
ATOM   4013 C  C     . TYR B 2 341 ? -20.900 32.425 33.752 1.00 19.82 ? 340  TYR B C     1 
ATOM   4014 O  O     . TYR B 2 341 ? -20.616 31.716 34.705 1.00 25.98 ? 340  TYR B O     1 
ATOM   4015 C  CB    . TYR B 2 341 ? -20.025 32.493 31.425 1.00 20.30 ? 340  TYR B CB    1 
ATOM   4016 C  CG    . TYR B 2 341 ? -19.124 33.113 30.395 1.00 22.28 ? 340  TYR B CG    1 
ATOM   4017 C  CD1   . TYR B 2 341 ? -19.483 34.300 29.745 1.00 22.30 ? 340  TYR B CD1   1 
ATOM   4018 C  CD2   . TYR B 2 341 ? -17.889 32.539 30.088 1.00 20.75 ? 340  TYR B CD2   1 
ATOM   4019 C  CE1   . TYR B 2 341 ? -18.619 34.904 28.817 1.00 19.85 ? 340  TYR B CE1   1 
ATOM   4020 C  CE2   . TYR B 2 341 ? -17.024 33.136 29.163 1.00 20.16 ? 340  TYR B CE2   1 
ATOM   4021 C  CZ    . TYR B 2 341 ? -17.396 34.314 28.536 1.00 15.69 ? 340  TYR B CZ    1 
ATOM   4022 O  OH    . TYR B 2 341 ? -16.535 34.882 27.630 1.00 17.48 ? 340  TYR B OH    1 
ATOM   4023 H  H     . TYR B 2 341 ? -18.350 31.596 33.541 1.00 0.00  ? 340  TYR B H     1 
ATOM   4024 H  HH    . TYR B 2 341 ? -15.716 34.367 27.714 1.00 0.00  ? 340  TYR B HH    1 
ATOM   4025 N  N     . LYS B 2 342 ? -22.149 32.712 33.410 1.00 21.85 ? 341  LYS B N     1 
ATOM   4026 C  CA    . LYS B 2 342 ? -23.331 32.241 34.121 1.00 18.06 ? 341  LYS B CA    1 
ATOM   4027 C  C     . LYS B 2 342 ? -24.398 32.144 33.045 1.00 20.24 ? 341  LYS B C     1 
ATOM   4028 O  O     . LYS B 2 342 ? -24.511 33.020 32.198 1.00 24.71 ? 341  LYS B O     1 
ATOM   4029 C  CB    . LYS B 2 342 ? -23.754 33.254 35.165 1.00 19.29 ? 341  LYS B CB    1 
ATOM   4030 C  CG    . LYS B 2 342 ? -24.831 32.788 36.086 1.00 19.01 ? 341  LYS B CG    1 
ATOM   4031 C  CD    . LYS B 2 342 ? -25.225 33.934 36.975 1.00 24.10 ? 341  LYS B CD    1 
ATOM   4032 C  CE    . LYS B 2 342 ? -26.352 33.547 37.927 1.00 33.02 ? 341  LYS B CE    1 
ATOM   4033 N  NZ    . LYS B 2 342 ? -25.948 32.529 38.969 1.00 36.33 ? 341  LYS B NZ    1 
ATOM   4034 H  H     . LYS B 2 342 ? -22.308 33.306 32.645 1.00 0.00  ? 341  LYS B H     1 
ATOM   4035 H  HZ1   . LYS B 2 342 ? -25.622 31.662 38.494 1.00 0.00  ? 341  LYS B HZ1   1 
ATOM   4036 H  HZ2   . LYS B 2 342 ? -25.180 32.914 39.552 1.00 0.00  ? 341  LYS B HZ2   1 
ATOM   4037 H  HZ3   . LYS B 2 342 ? -26.767 32.309 39.568 1.00 0.00  ? 341  LYS B HZ3   1 
ATOM   4038 N  N     . VAL B 2 343 ? -25.111 31.030 33.017 1.00 23.44 ? 342  VAL B N     1 
ATOM   4039 C  CA    . VAL B 2 343 ? -26.142 30.796 32.024 1.00 21.21 ? 342  VAL B CA    1 
ATOM   4040 C  C     . VAL B 2 343 ? -27.400 30.300 32.717 1.00 22.92 ? 342  VAL B C     1 
ATOM   4041 O  O     . VAL B 2 343 ? -27.334 29.582 33.714 1.00 28.84 ? 342  VAL B O     1 
ATOM   4042 C  CB    . VAL B 2 343 ? -25.649 29.780 30.994 1.00 24.07 ? 342  VAL B CB    1 
ATOM   4043 C  CG1   . VAL B 2 343 ? -26.669 29.613 29.866 1.00 25.22 ? 342  VAL B CG1   1 
ATOM   4044 C  CG2   . VAL B 2 343 ? -24.301 30.237 30.423 1.00 19.09 ? 342  VAL B CG2   1 
ATOM   4045 H  H     . VAL B 2 343 ? -24.952 30.338 33.692 1.00 0.00  ? 342  VAL B H     1 
ATOM   4046 N  N     . SER B 2 344 ? -28.548 30.787 32.280 1.00 26.24 ? 343  SER B N     1 
ATOM   4047 C  CA    . SER B 2 344 ? -29.805 30.371 32.894 1.00 28.40 ? 343  SER B CA    1 
ATOM   4048 C  C     . SER B 2 344 ? -30.623 29.793 31.777 1.00 27.16 ? 343  SER B C     1 
ATOM   4049 O  O     . SER B 2 344 ? -30.971 30.505 30.850 1.00 29.05 ? 343  SER B O     1 
ATOM   4050 C  CB    . SER B 2 344 ? -30.546 31.565 33.504 1.00 26.35 ? 343  SER B CB    1 
ATOM   4051 O  OG    . SER B 2 344 ? -29.706 32.351 34.352 1.00 25.37 ? 343  SER B OG    1 
ATOM   4052 H  H     . SER B 2 344 ? -28.547 31.446 31.561 1.00 0.00  ? 343  SER B H     1 
ATOM   4053 H  HG    . SER B 2 344 ? -28.784 32.075 34.355 1.00 0.00  ? 343  SER B HG    1 
ATOM   4054 N  N     . VAL B 2 345 ? -30.866 28.491 31.822 1.00 27.23 ? 344  VAL B N     1 
ATOM   4055 C  CA    . VAL B 2 345 ? -31.655 27.849 30.786 1.00 26.48 ? 344  VAL B CA    1 
ATOM   4056 C  C     . VAL B 2 345 ? -33.081 27.549 31.253 1.00 28.24 ? 344  VAL B C     1 
ATOM   4057 O  O     . VAL B 2 345 ? -33.293 27.027 32.366 1.00 27.65 ? 344  VAL B O     1 
ATOM   4058 C  CB    . VAL B 2 345 ? -31.031 26.540 30.354 1.00 27.81 ? 344  VAL B CB    1 
ATOM   4059 C  CG1   . VAL B 2 345 ? -31.785 25.967 29.172 1.00 29.75 ? 344  VAL B CG1   1 
ATOM   4060 C  CG2   . VAL B 2 345 ? -29.580 26.734 30.040 1.00 26.44 ? 344  VAL B CG2   1 
ATOM   4061 H  H     . VAL B 2 345 ? -30.550 27.967 32.583 1.00 0.00  ? 344  VAL B H     1 
ATOM   4062 N  N     . THR B 2 346 ? -34.058 27.976 30.451 1.00 26.72 ? 345  THR B N     1 
ATOM   4063 C  CA    . THR B 2 346 ? -35.443 27.688 30.754 1.00 23.20 ? 345  THR B CA    1 
ATOM   4064 C  C     . THR B 2 346 ? -35.829 26.626 29.759 1.00 21.66 ? 345  THR B C     1 
ATOM   4065 O  O     . THR B 2 346 ? -35.589 26.756 28.552 1.00 20.69 ? 345  THR B O     1 
ATOM   4066 C  CB    . THR B 2 346 ? -36.315 28.917 30.714 1.00 26.82 ? 345  THR B CB    1 
ATOM   4067 O  OG1   . THR B 2 346 ? -36.013 29.708 31.872 1.00 30.25 ? 345  THR B OG1   1 
ATOM   4068 C  CG2   . THR B 2 346 ? -37.795 28.522 30.751 1.00 26.79 ? 345  THR B CG2   1 
ATOM   4069 H  H     . THR B 2 346 ? -33.870 28.484 29.643 1.00 0.00  ? 345  THR B H     1 
ATOM   4070 H  HG1   . THR B 2 346 ? -36.337 30.582 31.645 1.00 0.00  ? 345  THR B HG1   1 
ATOM   4071 N  N     . LEU B 2 347 ? -36.250 25.493 30.309 1.00 24.39 ? 346  LEU B N     1 
ATOM   4072 C  CA    . LEU B 2 347 ? -36.595 24.332 29.520 1.00 24.38 ? 346  LEU B CA    1 
ATOM   4073 C  C     . LEU B 2 347 ? -37.961 24.343 28.821 1.00 22.09 ? 346  LEU B C     1 
ATOM   4074 O  O     . LEU B 2 347 ? -38.892 25.052 29.207 1.00 21.26 ? 346  LEU B O     1 
ATOM   4075 C  CB    . LEU B 2 347 ? -36.418 23.080 30.390 1.00 27.80 ? 346  LEU B CB    1 
ATOM   4076 C  CG    . LEU B 2 347 ? -35.019 22.769 30.946 1.00 26.90 ? 346  LEU B CG    1 
ATOM   4077 C  CD1   . LEU B 2 347 ? -35.106 21.710 32.017 1.00 24.35 ? 346  LEU B CD1   1 
ATOM   4078 C  CD2   . LEU B 2 347 ? -34.103 22.296 29.843 1.00 26.72 ? 346  LEU B CD2   1 
ATOM   4079 H  H     . LEU B 2 347 ? -36.298 25.430 31.281 1.00 0.00  ? 346  LEU B H     1 
ATOM   4080 N  N     . SER B 2 348 ? -38.046 23.564 27.755 1.00 23.53 ? 347  SER B N     1 
ATOM   4081 C  CA    . SER B 2 348 ? -39.261 23.430 26.975 1.00 20.87 ? 347  SER B CA    1 
ATOM   4082 C  C     . SER B 2 348 ? -39.313 22.000 26.447 1.00 26.76 ? 347  SER B C     1 
ATOM   4083 O  O     . SER B 2 348 ? -38.295 21.291 26.428 1.00 26.82 ? 347  SER B O     1 
ATOM   4084 C  CB    . SER B 2 348 ? -39.239 24.413 25.804 1.00 21.54 ? 347  SER B CB    1 
ATOM   4085 O  OG    . SER B 2 348 ? -38.248 24.087 24.851 1.00 18.80 ? 347  SER B OG    1 
ATOM   4086 H  H     . SER B 2 348 ? -37.267 23.045 27.458 1.00 0.00  ? 347  SER B H     1 
ATOM   4087 H  HG    . SER B 2 348 ? -38.647 23.513 24.190 1.00 0.00  ? 347  SER B HG    1 
ATOM   4088 N  N     . GLY B 2 349 ? -40.484 21.569 25.997 1.00 30.78 ? 348  GLY B N     1 
ATOM   4089 C  CA    . GLY B 2 349 ? -40.571 20.223 25.475 1.00 34.16 ? 348  GLY B CA    1 
ATOM   4090 C  C     . GLY B 2 349 ? -41.051 19.213 26.489 1.00 32.79 ? 348  GLY B C     1 
ATOM   4091 O  O     . GLY B 2 349 ? -41.909 19.537 27.287 1.00 34.43 ? 348  GLY B O     1 
ATOM   4092 H  H     . GLY B 2 349 ? -41.293 22.111 26.046 1.00 0.00  ? 348  GLY B H     1 
ATOM   4093 N  N     . LYS B 2 350 ? -40.476 18.018 26.492 1.00 36.04 ? 349  LYS B N     1 
ATOM   4094 C  CA    . LYS B 2 350 ? -40.935 16.971 27.398 1.00 42.58 ? 349  LYS B CA    1 
ATOM   4095 C  C     . LYS B 2 350 ? -40.144 16.814 28.690 1.00 40.49 ? 349  LYS B C     1 
ATOM   4096 O  O     . LYS B 2 350 ? -38.971 17.181 28.731 1.00 41.82 ? 349  LYS B O     1 
ATOM   4097 C  CB    . LYS B 2 350 ? -40.967 15.622 26.656 1.00 47.82 ? 349  LYS B CB    1 
ATOM   4098 C  CG    . LYS B 2 350 ? -41.566 14.472 27.487 1.00 55.08 ? 349  LYS B CG    1 
ATOM   4099 C  CD    . LYS B 2 350 ? -41.116 13.100 26.993 1.00 57.98 ? 349  LYS B CD    1 
ATOM   4100 C  CE    . LYS B 2 350 ? -41.088 12.082 28.126 1.00 57.31 ? 349  LYS B CE    1 
ATOM   4101 N  NZ    . LYS B 2 350 ? -40.426 10.818 27.699 1.00 55.76 ? 349  LYS B NZ    1 
ATOM   4102 H  H     . LYS B 2 350 ? -39.716 17.858 25.889 1.00 0.00  ? 349  LYS B H     1 
ATOM   4103 H  HZ1   . LYS B 2 350 ? -40.894 10.420 26.869 1.00 0.00  ? 349  LYS B HZ1   1 
ATOM   4104 H  HZ2   . LYS B 2 350 ? -39.439 11.033 27.464 1.00 0.00  ? 349  LYS B HZ2   1 
ATOM   4105 H  HZ3   . LYS B 2 350 ? -40.447 10.145 28.487 1.00 0.00  ? 349  LYS B HZ3   1 
ATOM   4106 N  N     . LYS B 2 351 ? -40.805 16.317 29.750 1.00 35.91 ? 350  LYS B N     1 
ATOM   4107 C  CA    . LYS B 2 351 ? -40.132 16.048 31.018 1.00 31.09 ? 350  LYS B CA    1 
ATOM   4108 C  C     . LYS B 2 351 ? -39.373 14.746 30.802 1.00 32.78 ? 350  LYS B C     1 
ATOM   4109 O  O     . LYS B 2 351 ? -39.961 13.707 30.496 1.00 33.06 ? 350  LYS B O     1 
ATOM   4110 C  CB    . LYS B 2 351 ? -41.102 15.875 32.164 1.00 35.96 ? 350  LYS B CB    1 
ATOM   4111 C  CG    . LYS B 2 351 ? -40.442 15.166 33.363 1.00 40.57 ? 350  LYS B CG    1 
ATOM   4112 C  CD    . LYS B 2 351 ? -41.354 15.048 34.561 1.00 42.19 ? 350  LYS B CD    1 
ATOM   4113 C  CE    . LYS B 2 351 ? -41.010 13.782 35.335 1.00 47.75 ? 350  LYS B CE    1 
ATOM   4114 N  NZ    . LYS B 2 351 ? -41.671 13.736 36.680 1.00 50.70 ? 350  LYS B NZ    1 
ATOM   4115 H  H     . LYS B 2 351 ? -41.761 16.132 29.659 1.00 0.00  ? 350  LYS B H     1 
ATOM   4116 H  HZ1   . LYS B 2 351 ? -42.701 13.798 36.546 1.00 0.00  ? 350  LYS B HZ1   1 
ATOM   4117 H  HZ2   . LYS B 2 351 ? -41.431 12.848 37.168 1.00 0.00  ? 350  LYS B HZ2   1 
ATOM   4118 H  HZ3   . LYS B 2 351 ? -41.342 14.547 37.243 1.00 0.00  ? 350  LYS B HZ3   1 
ATOM   4119 N  N     . VAL B 2 352 ? -38.074 14.794 31.038 1.00 32.24 ? 351  VAL B N     1 
ATOM   4120 C  CA    . VAL B 2 352 ? -37.210 13.663 30.780 1.00 32.05 ? 351  VAL B CA    1 
ATOM   4121 C  C     . VAL B 2 352 ? -36.117 13.675 31.849 1.00 34.47 ? 351  VAL B C     1 
ATOM   4122 O  O     . VAL B 2 352 ? -36.149 14.510 32.757 1.00 41.42 ? 351  VAL B O     1 
ATOM   4123 C  CB    . VAL B 2 352 ? -36.587 13.873 29.356 1.00 33.18 ? 351  VAL B CB    1 
ATOM   4124 C  CG1   . VAL B 2 352 ? -35.343 14.812 29.410 1.00 29.99 ? 351  VAL B CG1   1 
ATOM   4125 C  CG2   . VAL B 2 352 ? -36.316 12.567 28.674 1.00 33.43 ? 351  VAL B CG2   1 
ATOM   4126 H  H     . VAL B 2 352 ? -37.687 15.618 31.405 1.00 0.00  ? 351  VAL B H     1 
ATOM   4127 N  N     . THR B 2 353 ? -35.196 12.725 31.792 1.00 27.84 ? 352  THR B N     1 
ATOM   4128 C  CA    . THR B 2 353 ? -34.096 12.696 32.734 1.00 28.57 ? 352  THR B CA    1 
ATOM   4129 C  C     . THR B 2 353 ? -32.836 12.791 31.883 1.00 29.30 ? 352  THR B C     1 
ATOM   4130 O  O     . THR B 2 353 ? -32.689 12.043 30.911 1.00 27.89 ? 352  THR B O     1 
ATOM   4131 C  CB    . THR B 2 353 ? -34.109 11.411 33.598 1.00 29.20 ? 352  THR B CB    1 
ATOM   4132 O  OG1   . THR B 2 353 ? -35.243 11.445 34.473 1.00 33.46 ? 352  THR B OG1   1 
ATOM   4133 C  CG2   . THR B 2 353 ? -32.859 11.318 34.450 1.00 26.63 ? 352  THR B CG2   1 
ATOM   4134 H  H     . THR B 2 353 ? -35.257 12.012 31.123 1.00 0.00  ? 352  THR B H     1 
ATOM   4135 H  HG1   . THR B 2 353 ? -35.302 12.341 34.842 1.00 0.00  ? 352  THR B HG1   1 
ATOM   4136 N  N     . GLY B 2 354 ? -31.982 13.767 32.181 1.00 26.15 ? 353  GLY B N     1 
ATOM   4137 C  CA    . GLY B 2 354 ? -30.776 13.925 31.392 1.00 29.05 ? 353  GLY B CA    1 
ATOM   4138 C  C     . GLY B 2 354 ? -29.893 15.095 31.773 1.00 30.04 ? 353  GLY B C     1 
ATOM   4139 O  O     . GLY B 2 354 ? -30.215 15.824 32.731 1.00 27.32 ? 353  GLY B O     1 
ATOM   4140 H  H     . GLY B 2 354 ? -32.147 14.392 32.921 1.00 0.00  ? 353  GLY B H     1 
ATOM   4141 N  N     . HIS B 2 355 ? -28.776 15.237 31.036 1.00 29.14 ? 354  HIS B N     1 
ATOM   4142 C  CA    . HIS B 2 355 ? -27.765 16.294 31.228 1.00 25.79 ? 354  HIS B CA    1 
ATOM   4143 C  C     . HIS B 2 355 ? -27.927 17.371 30.198 1.00 21.66 ? 354  HIS B C     1 
ATOM   4144 O  O     . HIS B 2 355 ? -28.025 17.059 29.037 1.00 25.73 ? 354  HIS B O     1 
ATOM   4145 C  CB    . HIS B 2 355 ? -26.361 15.758 30.988 1.00 26.30 ? 354  HIS B CB    1 
ATOM   4146 C  CG    . HIS B 2 355 ? -26.068 14.497 31.719 1.00 29.26 ? 354  HIS B CG    1 
ATOM   4147 N  ND1   . HIS B 2 355 ? -25.089 14.405 32.681 1.00 29.47 ? 354  HIS B ND1   1 
ATOM   4148 C  CD2   . HIS B 2 355 ? -26.685 13.297 31.688 1.00 32.95 ? 354  HIS B CD2   1 
ATOM   4149 C  CE1   . HIS B 2 355 ? -25.122 13.203 33.225 1.00 31.42 ? 354  HIS B CE1   1 
ATOM   4150 N  NE2   . HIS B 2 355 ? -26.080 12.513 32.639 1.00 34.89 ? 354  HIS B NE2   1 
ATOM   4151 H  H     . HIS B 2 355 ? -28.683 14.603 30.296 1.00 0.00  ? 354  HIS B H     1 
ATOM   4152 H  HD1   . HIS B 2 355 ? -24.429 15.061 32.981 1.00 0.00  ? 354  HIS B HD1   1 
ATOM   4153 H  HE2   . HIS B 2 355 ? -26.307 11.575 32.839 1.00 0.00  ? 354  HIS B HE2   1 
ATOM   4154 N  N     . ILE B 2 356 ? -27.899 18.635 30.603 1.00 24.91 ? 355  ILE B N     1 
ATOM   4155 C  CA    . ILE B 2 356 ? -28.003 19.727 29.643 1.00 22.06 ? 355  ILE B CA    1 
ATOM   4156 C  C     . ILE B 2 356 ? -26.694 20.509 29.568 1.00 22.18 ? 355  ILE B C     1 
ATOM   4157 O  O     . ILE B 2 356 ? -26.078 20.846 30.598 1.00 18.46 ? 355  ILE B O     1 
ATOM   4158 C  CB    . ILE B 2 356 ? -29.194 20.669 29.890 1.00 20.74 ? 355  ILE B CB    1 
ATOM   4159 C  CG1   . ILE B 2 356 ? -29.080 21.366 31.241 1.00 19.74 ? 355  ILE B CG1   1 
ATOM   4160 C  CG2   . ILE B 2 356 ? -30.493 19.912 29.734 1.00 20.08 ? 355  ILE B CG2   1 
ATOM   4161 C  CD1   . ILE B 2 356 ? -30.188 22.399 31.472 1.00 22.35 ? 355  ILE B CD1   1 
ATOM   4162 H  H     . ILE B 2 356 ? -27.807 18.852 31.552 1.00 0.00  ? 355  ILE B H     1 
ATOM   4163 N  N     . LEU B 2 357 ? -26.262 20.718 28.322 1.00 22.45 ? 356  LEU B N     1 
ATOM   4164 C  CA    . LEU B 2 357 ? -25.024 21.408 27.975 1.00 20.97 ? 356  LEU B CA    1 
ATOM   4165 C  C     . LEU B 2 357 ? -25.277 22.606 27.091 1.00 19.63 ? 356  LEU B C     1 
ATOM   4166 O  O     . LEU B 2 357 ? -26.219 22.647 26.298 1.00 20.76 ? 356  LEU B O     1 
ATOM   4167 C  CB    . LEU B 2 357 ? -24.057 20.461 27.264 1.00 19.14 ? 356  LEU B CB    1 
ATOM   4168 C  CG    . LEU B 2 357 ? -23.841 19.148 28.006 1.00 17.11 ? 356  LEU B CG    1 
ATOM   4169 C  CD1   . LEU B 2 357 ? -24.890 18.160 27.552 1.00 21.75 ? 356  LEU B CD1   1 
ATOM   4170 C  CD2   . LEU B 2 357 ? -22.476 18.614 27.733 1.00 19.05 ? 356  LEU B CD2   1 
ATOM   4171 H  H     . LEU B 2 357 ? -26.821 20.410 27.591 1.00 0.00  ? 356  LEU B H     1 
ATOM   4172 N  N     . VAL B 2 358 ? -24.358 23.548 27.179 1.00 22.96 ? 357  VAL B N     1 
ATOM   4173 C  CA    . VAL B 2 358 ? -24.440 24.792 26.438 1.00 20.78 ? 357  VAL B CA    1 
ATOM   4174 C  C     . VAL B 2 358 ? -23.014 25.166 25.989 1.00 22.41 ? 357  VAL B C     1 
ATOM   4175 O  O     . VAL B 2 358 ? -22.031 24.752 26.610 1.00 21.04 ? 357  VAL B O     1 
ATOM   4176 C  CB    . VAL B 2 358 ? -25.064 25.890 27.388 1.00 21.51 ? 357  VAL B CB    1 
ATOM   4177 C  CG1   . VAL B 2 358 ? -24.605 27.257 27.025 1.00 25.58 ? 357  VAL B CG1   1 
ATOM   4178 C  CG2   . VAL B 2 358 ? -26.613 25.831 27.365 1.00 18.03 ? 357  VAL B CG2   1 
ATOM   4179 H  H     . VAL B 2 358 ? -23.588 23.421 27.772 1.00 0.00  ? 357  VAL B H     1 
ATOM   4180 N  N     . SER B 2 359 ? -22.898 25.787 24.818 1.00 22.20 ? 358  SER B N     1 
ATOM   4181 C  CA    . SER B 2 359 ? -21.604 26.271 24.341 1.00 20.61 ? 358  SER B CA    1 
ATOM   4182 C  C     . SER B 2 359 ? -21.878 27.710 23.875 1.00 22.05 ? 358  SER B C     1 
ATOM   4183 O  O     . SER B 2 359 ? -22.993 28.022 23.430 1.00 14.47 ? 358  SER B O     1 
ATOM   4184 C  CB    . SER B 2 359 ? -21.001 25.390 23.250 1.00 16.12 ? 358  SER B CB    1 
ATOM   4185 O  OG    . SER B 2 359 ? -21.982 25.011 22.306 1.00 21.48 ? 358  SER B OG    1 
ATOM   4186 H  H     . SER B 2 359 ? -23.681 25.918 24.240 1.00 0.00  ? 358  SER B H     1 
ATOM   4187 H  HG    . SER B 2 359 ? -21.610 24.452 21.605 1.00 0.00  ? 358  SER B HG    1 
ATOM   4188 N  N     . LEU B 2 360 ? -20.884 28.584 24.054 1.00 19.29 ? 359  LEU B N     1 
ATOM   4189 C  CA    . LEU B 2 360 ? -21.013 29.993 23.726 1.00 18.21 ? 359  LEU B CA    1 
ATOM   4190 C  C     . LEU B 2 360 ? -20.245 30.367 22.480 1.00 21.64 ? 359  LEU B C     1 
ATOM   4191 O  O     . LEU B 2 360 ? -19.134 29.864 22.247 1.00 17.93 ? 359  LEU B O     1 
ATOM   4192 C  CB    . LEU B 2 360 ? -20.541 30.848 24.911 1.00 19.76 ? 359  LEU B CB    1 
ATOM   4193 C  CG    . LEU B 2 360 ? -20.817 30.311 26.333 1.00 19.63 ? 359  LEU B CG    1 
ATOM   4194 C  CD1   . LEU B 2 360 ? -20.299 31.300 27.371 1.00 20.28 ? 359  LEU B CD1   1 
ATOM   4195 C  CD2   . LEU B 2 360 ? -22.280 30.064 26.542 1.00 18.26 ? 359  LEU B CD2   1 
ATOM   4196 H  H     . LEU B 2 360 ? -20.057 28.250 24.437 1.00 0.00  ? 359  LEU B H     1 
ATOM   4197 N  N     . PHE B 2 361 ? -20.852 31.259 21.691 1.00 22.82 ? 360  PHE B N     1 
ATOM   4198 C  CA    . PHE B 2 361 ? -20.286 31.750 20.430 1.00 17.44 ? 360  PHE B CA    1 
ATOM   4199 C  C     . PHE B 2 361 ? -20.264 33.275 20.442 1.00 15.69 ? 360  PHE B C     1 
ATOM   4200 O  O     . PHE B 2 361 ? -21.284 33.910 20.654 1.00 22.53 ? 360  PHE B O     1 
ATOM   4201 C  CB    . PHE B 2 361 ? -21.111 31.220 19.262 1.00 16.73 ? 360  PHE B CB    1 
ATOM   4202 C  CG    . PHE B 2 361 ? -20.996 29.731 19.076 1.00 18.16 ? 360  PHE B CG    1 
ATOM   4203 C  CD1   . PHE B 2 361 ? -21.735 28.856 19.860 1.00 16.79 ? 360  PHE B CD1   1 
ATOM   4204 C  CD2   . PHE B 2 361 ? -20.101 29.206 18.156 1.00 16.43 ? 360  PHE B CD2   1 
ATOM   4205 C  CE1   . PHE B 2 361 ? -21.576 27.479 19.735 1.00 18.51 ? 360  PHE B CE1   1 
ATOM   4206 C  CE2   . PHE B 2 361 ? -19.936 27.821 18.029 1.00 20.23 ? 360  PHE B CE2   1 
ATOM   4207 C  CZ    . PHE B 2 361 ? -20.672 26.959 18.819 1.00 16.02 ? 360  PHE B CZ    1 
ATOM   4208 H  H     . PHE B 2 361 ? -21.734 31.611 21.934 1.00 0.00  ? 360  PHE B H     1 
ATOM   4209 N  N     . GLY B 2 362 ? -19.086 33.855 20.280 1.00 14.92 ? 361  GLY B N     1 
ATOM   4210 C  CA    . GLY B 2 362 ? -18.950 35.297 20.319 1.00 16.66 ? 361  GLY B CA    1 
ATOM   4211 C  C     . GLY B 2 362 ? -17.977 35.787 19.269 1.00 22.51 ? 361  GLY B C     1 
ATOM   4212 O  O     . GLY B 2 362 ? -17.413 34.986 18.509 1.00 24.58 ? 361  GLY B O     1 
ATOM   4213 H  H     . GLY B 2 362 ? -18.290 33.314 20.101 1.00 0.00  ? 361  GLY B H     1 
ATOM   4214 N  N     . ASN B 2 363 ? -17.738 37.093 19.249 1.00 26.23 ? 362  ASN B N     1 
ATOM   4215 C  CA    . ASN B 2 363 ? -16.840 37.678 18.259 1.00 26.84 ? 362  ASN B CA    1 
ATOM   4216 C  C     . ASN B 2 363 ? -15.436 37.139 18.315 1.00 25.45 ? 362  ASN B C     1 
ATOM   4217 O  O     . ASN B 2 363 ? -14.817 36.965 17.283 1.00 28.26 ? 362  ASN B O     1 
ATOM   4218 C  CB    . ASN B 2 363 ? -16.866 39.222 18.282 1.00 28.21 ? 362  ASN B CB    1 
ATOM   4219 C  CG    . ASN B 2 363 ? -16.420 39.821 19.606 1.00 30.55 ? 362  ASN B CG    1 
ATOM   4220 O  OD1   . ASN B 2 363 ? -16.417 39.174 20.654 1.00 36.66 ? 362  ASN B OD1   1 
ATOM   4221 N  ND2   . ASN B 2 363 ? -16.072 41.086 19.566 1.00 34.11 ? 362  ASN B ND2   1 
ATOM   4222 H  H     . ASN B 2 363 ? -18.175 37.648 19.928 1.00 0.00  ? 362  ASN B H     1 
ATOM   4223 H  HD21  . ASN B 2 363 ? -15.772 41.504 20.395 1.00 0.00  ? 362  ASN B HD21  1 
ATOM   4224 H  HD22  . ASN B 2 363 ? -16.122 41.548 18.703 1.00 0.00  ? 362  ASN B HD22  1 
ATOM   4225 N  N     . LYS B 2 364 ? -14.946 36.815 19.505 1.00 31.73 ? 363  LYS B N     1 
ATOM   4226 C  CA    . LYS B 2 364 ? -13.584 36.276 19.652 1.00 32.52 ? 363  LYS B CA    1 
ATOM   4227 C  C     . LYS B 2 364 ? -13.502 34.739 19.573 1.00 31.61 ? 363  LYS B C     1 
ATOM   4228 O  O     . LYS B 2 364 ? -12.419 34.166 19.691 1.00 33.98 ? 363  LYS B O     1 
ATOM   4229 C  CB    . LYS B 2 364 ? -12.953 36.781 20.952 1.00 32.43 ? 363  LYS B CB    1 
ATOM   4230 C  CG    . LYS B 2 364 ? -12.895 38.291 21.023 1.00 34.70 ? 363  LYS B CG    1 
ATOM   4231 C  CD    . LYS B 2 364 ? -12.968 38.804 22.438 1.00 38.08 ? 363  LYS B CD    1 
ATOM   4232 C  CE    . LYS B 2 364 ? -11.607 38.838 23.087 1.00 46.53 ? 363  LYS B CE    1 
ATOM   4233 N  NZ    . LYS B 2 364 ? -10.661 39.698 22.315 1.00 52.76 ? 363  LYS B NZ    1 
ATOM   4234 H  H     . LYS B 2 364 ? -15.504 36.933 20.304 1.00 0.00  ? 363  LYS B H     1 
ATOM   4235 H  HZ1   . LYS B 2 364 ? -11.025 40.668 22.239 1.00 0.00  ? 363  LYS B HZ1   1 
ATOM   4236 H  HZ2   . LYS B 2 364 ? -9.753  39.703 22.822 1.00 0.00  ? 363  LYS B HZ2   1 
ATOM   4237 H  HZ3   . LYS B 2 364 ? -10.514 39.290 21.369 1.00 0.00  ? 363  LYS B HZ3   1 
ATOM   4238 N  N     . GLY B 2 365 ? -14.627 34.078 19.327 1.00 28.00 ? 364  GLY B N     1 
ATOM   4239 C  CA    . GLY B 2 365 ? -14.606 32.629 19.233 1.00 28.22 ? 364  GLY B CA    1 
ATOM   4240 C  C     . GLY B 2 365 ? -15.674 31.908 20.039 1.00 25.76 ? 364  GLY B C     1 
ATOM   4241 O  O     . GLY B 2 365 ? -16.570 32.528 20.606 1.00 24.90 ? 364  GLY B O     1 
ATOM   4242 H  H     . GLY B 2 365 ? -15.478 34.546 19.213 1.00 0.00  ? 364  GLY B H     1 
ATOM   4243 N  N     . ASN B 2 366 ? -15.559 30.593 20.100 1.00 21.46 ? 365  ASN B N     1 
ATOM   4244 C  CA    . ASN B 2 366 ? -16.519 29.772 20.801 1.00 23.35 ? 365  ASN B CA    1 
ATOM   4245 C  C     . ASN B 2 366 ? -15.850 28.891 21.839 1.00 22.31 ? 365  ASN B C     1 
ATOM   4246 O  O     . ASN B 2 366 ? -14.631 28.807 21.905 1.00 28.83 ? 365  ASN B O     1 
ATOM   4247 C  CB    . ASN B 2 366 ? -17.330 28.929 19.793 1.00 26.13 ? 365  ASN B CB    1 
ATOM   4248 C  CG    . ASN B 2 366 ? -16.476 27.940 18.984 1.00 26.80 ? 365  ASN B CG    1 
ATOM   4249 O  OD1   . ASN B 2 366 ? -15.781 28.322 18.032 1.00 33.96 ? 365  ASN B OD1   1 
ATOM   4250 N  ND2   . ASN B 2 366 ? -16.571 26.661 19.325 1.00 26.07 ? 365  ASN B ND2   1 
ATOM   4251 H  H     . ASN B 2 366 ? -14.802 30.152 19.655 1.00 0.00  ? 365  ASN B H     1 
ATOM   4252 H  HD21  . ASN B 2 366 ? -15.996 26.042 18.818 1.00 0.00  ? 365  ASN B HD21  1 
ATOM   4253 H  HD22  . ASN B 2 366 ? -17.165 26.388 20.048 1.00 0.00  ? 365  ASN B HD22  1 
ATOM   4254 N  N     . SER B 2 367 ? -16.636 28.225 22.655 1.00 20.71 ? 366  SER B N     1 
ATOM   4255 C  CA    . SER B 2 367 ? -16.051 27.387 23.677 1.00 24.85 ? 366  SER B CA    1 
ATOM   4256 C  C     . SER B 2 367 ? -16.513 25.940 23.587 1.00 28.25 ? 366  SER B C     1 
ATOM   4257 O  O     . SER B 2 367 ? -17.238 25.558 22.647 1.00 28.75 ? 366  SER B O     1 
ATOM   4258 C  CB    . SER B 2 367 ? -16.479 27.927 25.035 1.00 27.37 ? 366  SER B CB    1 
ATOM   4259 O  OG    . SER B 2 367 ? -17.862 27.665 25.252 1.00 24.13 ? 366  SER B OG    1 
ATOM   4260 H  H     . SER B 2 367 ? -17.603 28.318 22.566 1.00 0.00  ? 366  SER B H     1 
ATOM   4261 H  HG    . SER B 2 367 ? -18.326 28.108 24.540 1.00 0.00  ? 366  SER B HG    1 
ATOM   4262 N  N     . LYS B 2 368 ? -16.088 25.169 24.598 1.00 31.97 ? 367  LYS B N     1 
ATOM   4263 C  CA    . LYS B 2 368 ? -16.458 23.767 24.836 1.00 27.52 ? 367  LYS B CA    1 
ATOM   4264 C  C     . LYS B 2 368 ? -17.920 23.788 25.316 1.00 25.54 ? 367  LYS B C     1 
ATOM   4265 O  O     . LYS B 2 368 ? -18.482 24.856 25.611 1.00 29.68 ? 367  LYS B O     1 
ATOM   4266 C  CB    . LYS B 2 368 ? -15.644 23.195 26.007 1.00 31.70 ? 367  LYS B CB    1 
ATOM   4267 C  CG    . LYS B 2 368 ? -14.139 23.327 25.899 1.00 42.80 ? 367  LYS B CG    1 
ATOM   4268 C  CD    . LYS B 2 368 ? -13.436 22.882 27.188 1.00 48.78 ? 367  LYS B CD    1 
ATOM   4269 C  CE    . LYS B 2 368 ? -11.903 23.023 27.079 1.00 53.66 ? 367  LYS B CE    1 
ATOM   4270 N  NZ    . LYS B 2 368 ? -11.133 22.942 28.386 1.00 54.18 ? 367  LYS B NZ    1 
ATOM   4271 H  H     . LYS B 2 368 ? -15.479 25.601 25.223 1.00 0.00  ? 367  LYS B H     1 
ATOM   4272 H  HZ1   . LYS B 2 368 ? -11.366 22.048 28.855 1.00 0.00  ? 367  LYS B HZ1   1 
ATOM   4273 H  HZ2   . LYS B 2 368 ? -10.108 22.987 28.207 1.00 0.00  ? 367  LYS B HZ2   1 
ATOM   4274 H  HZ3   . LYS B 2 368 ? -11.413 23.728 29.005 1.00 0.00  ? 367  LYS B HZ3   1 
ATOM   4275 N  N     . GLN B 2 369 ? -18.542 22.620 25.390 1.00 26.19 ? 368  GLN B N     1 
ATOM   4276 C  CA    . GLN B 2 369 ? -19.910 22.521 25.888 1.00 23.09 ? 368  GLN B CA    1 
ATOM   4277 C  C     . GLN B 2 369 ? -19.688 22.323 27.381 1.00 22.54 ? 368  GLN B C     1 
ATOM   4278 O  O     . GLN B 2 369 ? -18.786 21.584 27.773 1.00 24.36 ? 368  GLN B O     1 
ATOM   4279 C  CB    . GLN B 2 369 ? -20.622 21.315 25.280 1.00 21.59 ? 368  GLN B CB    1 
ATOM   4280 C  CG    . GLN B 2 369 ? -20.953 21.462 23.790 1.00 18.08 ? 368  GLN B CG    1 
ATOM   4281 C  CD    . GLN B 2 369 ? -21.215 20.110 23.108 1.00 20.08 ? 368  GLN B CD    1 
ATOM   4282 O  OE1   . GLN B 2 369 ? -21.131 19.049 23.729 1.00 21.81 ? 368  GLN B OE1   1 
ATOM   4283 N  NE2   . GLN B 2 369 ? -21.503 20.152 21.818 1.00 20.57 ? 368  GLN B NE2   1 
ATOM   4284 H  H     . GLN B 2 369 ? -18.067 21.804 25.156 1.00 0.00  ? 368  GLN B H     1 
ATOM   4285 H  HE21  . GLN B 2 369 ? -21.672 19.301 21.353 1.00 0.00  ? 368  GLN B HE21  1 
ATOM   4286 H  HE22  . GLN B 2 369 ? -21.543 21.026 21.366 1.00 0.00  ? 368  GLN B HE22  1 
ATOM   4287 N  N     . TYR B 2 370 ? -20.450 23.039 28.203 1.00 23.39 ? 369  TYR B N     1 
ATOM   4288 C  CA    . TYR B 2 370 ? -20.316 22.982 29.659 1.00 19.96 ? 369  TYR B CA    1 
ATOM   4289 C  C     . TYR B 2 370 ? -21.578 22.438 30.226 1.00 17.77 ? 369  TYR B C     1 
ATOM   4290 O  O     . TYR B 2 370 ? -22.651 22.851 29.823 1.00 22.27 ? 369  TYR B O     1 
ATOM   4291 C  CB    . TYR B 2 370 ? -20.072 24.391 30.223 1.00 15.35 ? 369  TYR B CB    1 
ATOM   4292 C  CG    . TYR B 2 370 ? -18.665 24.852 29.963 1.00 15.49 ? 369  TYR B CG    1 
ATOM   4293 C  CD1   . TYR B 2 370 ? -17.618 24.365 30.729 1.00 12.01 ? 369  TYR B CD1   1 
ATOM   4294 C  CD2   . TYR B 2 370 ? -18.358 25.701 28.889 1.00 15.29 ? 369  TYR B CD2   1 
ATOM   4295 C  CE1   . TYR B 2 370 ? -16.299 24.697 30.441 1.00 13.06 ? 369  TYR B CE1   1 
ATOM   4296 C  CE2   . TYR B 2 370 ? -17.028 26.029 28.588 1.00 10.85 ? 369  TYR B CE2   1 
ATOM   4297 C  CZ    . TYR B 2 370 ? -16.019 25.513 29.378 1.00 13.33 ? 369  TYR B CZ    1 
ATOM   4298 O  OH    . TYR B 2 370 ? -14.705 25.789 29.117 1.00 19.62 ? 369  TYR B OH    1 
ATOM   4299 H  H     . TYR B 2 370 ? -21.113 23.647 27.824 1.00 0.00  ? 369  TYR B H     1 
ATOM   4300 H  HH    . TYR B 2 370 ? -14.591 26.551 28.540 1.00 0.00  ? 369  TYR B HH    1 
ATOM   4301 N  N     . GLU B 2 371 ? -21.479 21.512 31.162 1.00 21.89 ? 370  GLU B N     1 
ATOM   4302 C  CA    . GLU B 2 371 ? -22.707 20.969 31.718 1.00 28.55 ? 370  GLU B CA    1 
ATOM   4303 C  C     . GLU B 2 371 ? -23.339 22.001 32.630 1.00 26.59 ? 370  GLU B C     1 
ATOM   4304 O  O     . GLU B 2 371 ? -22.670 22.534 33.526 1.00 23.52 ? 370  GLU B O     1 
ATOM   4305 C  CB    . GLU B 2 371 ? -22.467 19.652 32.464 1.00 28.56 ? 370  GLU B CB    1 
ATOM   4306 C  CG    . GLU B 2 371 ? -23.782 18.995 32.904 1.00 34.61 ? 370  GLU B CG    1 
ATOM   4307 C  CD    . GLU B 2 371 ? -23.607 17.608 33.487 1.00 33.18 ? 370  GLU B CD    1 
ATOM   4308 O  OE1   . GLU B 2 371 ? -23.388 16.671 32.701 1.00 33.97 ? 370  GLU B OE1   1 
ATOM   4309 O  OE2   . GLU B 2 371 ? -23.691 17.463 34.725 1.00 29.46 ? 370  GLU B OE2   1 
ATOM   4310 H  H     . GLU B 2 371 ? -20.604 21.199 31.480 1.00 0.00  ? 370  GLU B H     1 
ATOM   4311 N  N     . ILE B 2 372 ? -24.616 22.298 32.390 1.00 23.11 ? 371  ILE B N     1 
ATOM   4312 C  CA    . ILE B 2 372 ? -25.325 23.288 33.211 1.00 25.07 ? 371  ILE B CA    1 
ATOM   4313 C  C     . ILE B 2 372 ? -26.168 22.625 34.304 1.00 25.69 ? 371  ILE B C     1 
ATOM   4314 O  O     . ILE B 2 372 ? -26.287 23.153 35.410 1.00 18.08 ? 371  ILE B O     1 
ATOM   4315 C  CB    . ILE B 2 372 ? -26.244 24.221 32.335 1.00 25.54 ? 371  ILE B CB    1 
ATOM   4316 C  CG1   . ILE B 2 372 ? -25.403 25.104 31.392 1.00 21.61 ? 371  ILE B CG1   1 
ATOM   4317 C  CG2   . ILE B 2 372 ? -27.150 25.085 33.221 1.00 23.43 ? 371  ILE B CG2   1 
ATOM   4318 C  CD1   . ILE B 2 372 ? -24.619 26.224 32.075 1.00 22.25 ? 371  ILE B CD1   1 
ATOM   4319 H  H     . ILE B 2 372 ? -25.072 21.876 31.646 1.00 0.00  ? 371  ILE B H     1 
ATOM   4320 N  N     . PHE B 2 373 ? -26.664 21.422 34.014 1.00 28.92 ? 372  PHE B N     1 
ATOM   4321 C  CA    . PHE B 2 373 ? -27.539 20.700 34.923 1.00 24.93 ? 372  PHE B CA    1 
ATOM   4322 C  C     . PHE B 2 373 ? -27.699 19.239 34.530 1.00 27.48 ? 372  PHE B C     1 
ATOM   4323 O  O     . PHE B 2 373 ? -27.514 18.879 33.377 1.00 27.49 ? 372  PHE B O     1 
ATOM   4324 C  CB    . PHE B 2 373 ? -28.925 21.357 34.874 1.00 25.88 ? 372  PHE B CB    1 
ATOM   4325 C  CG    . PHE B 2 373 ? -29.944 20.705 35.768 1.00 33.36 ? 372  PHE B CG    1 
ATOM   4326 C  CD1   . PHE B 2 373 ? -29.794 20.720 37.155 1.00 32.09 ? 372  PHE B CD1   1 
ATOM   4327 C  CD2   . PHE B 2 373 ? -31.043 20.046 35.226 1.00 35.25 ? 372  PHE B CD2   1 
ATOM   4328 C  CE1   . PHE B 2 373 ? -30.718 20.088 37.979 1.00 34.16 ? 372  PHE B CE1   1 
ATOM   4329 C  CE2   . PHE B 2 373 ? -31.979 19.406 36.057 1.00 34.69 ? 372  PHE B CE2   1 
ATOM   4330 C  CZ    . PHE B 2 373 ? -31.813 19.427 37.429 1.00 32.97 ? 372  PHE B CZ    1 
ATOM   4331 H  H     . PHE B 2 373 ? -26.437 21.006 33.154 1.00 0.00  ? 372  PHE B H     1 
ATOM   4332 N  N     . LYS B 2 374 ? -27.978 18.387 35.510 1.00 29.07 ? 373  LYS B N     1 
ATOM   4333 C  CA    . LYS B 2 374 ? -28.268 16.975 35.246 1.00 31.39 ? 373  LYS B CA    1 
ATOM   4334 C  C     . LYS B 2 374 ? -29.236 16.445 36.313 1.00 33.81 ? 373  LYS B C     1 
ATOM   4335 O  O     . LYS B 2 374 ? -29.138 16.805 37.502 1.00 34.78 ? 373  LYS B O     1 
ATOM   4336 C  CB    . LYS B 2 374 ? -27.013 16.108 35.040 1.00 26.78 ? 373  LYS B CB    1 
ATOM   4337 C  CG    . LYS B 2 374 ? -26.541 15.233 36.169 1.00 23.53 ? 373  LYS B CG    1 
ATOM   4338 C  CD    . LYS B 2 374 ? -25.718 16.044 37.136 1.00 30.52 ? 373  LYS B CD    1 
ATOM   4339 C  CE    . LYS B 2 374 ? -24.759 15.184 37.942 1.00 33.08 ? 373  LYS B CE    1 
ATOM   4340 N  NZ    . LYS B 2 374 ? -23.680 14.621 37.078 1.00 39.02 ? 373  LYS B NZ    1 
ATOM   4341 H  H     . LYS B 2 374 ? -28.036 18.690 36.436 1.00 0.00  ? 373  LYS B H     1 
ATOM   4342 H  HZ1   . LYS B 2 374 ? -23.153 15.402 36.636 1.00 0.00  ? 373  LYS B HZ1   1 
ATOM   4343 H  HZ2   . LYS B 2 374 ? -23.034 14.062 37.672 1.00 0.00  ? 373  LYS B HZ2   1 
ATOM   4344 H  HZ3   . LYS B 2 374 ? -24.097 14.010 36.347 1.00 0.00  ? 373  LYS B HZ3   1 
ATOM   4345 N  N     . GLY B 2 375 ? -30.279 15.764 35.837 1.00 30.43 ? 374  GLY B N     1 
ATOM   4346 C  CA    . GLY B 2 375 ? -31.289 15.212 36.717 1.00 21.88 ? 374  GLY B CA    1 
ATOM   4347 C  C     . GLY B 2 375 ? -32.587 15.276 35.971 1.00 21.32 ? 374  GLY B C     1 
ATOM   4348 O  O     . GLY B 2 375 ? -32.611 15.105 34.764 1.00 25.65 ? 374  GLY B O     1 
ATOM   4349 H  H     . GLY B 2 375 ? -30.385 15.653 34.864 1.00 0.00  ? 374  GLY B H     1 
ATOM   4350 N  N     . THR B 2 376 ? -33.673 15.512 36.678 1.00 23.07 ? 375  THR B N     1 
ATOM   4351 C  CA    . THR B 2 376 ? -34.982 15.630 36.053 1.00 28.07 ? 375  THR B CA    1 
ATOM   4352 C  C     . THR B 2 376 ? -35.107 16.925 35.229 1.00 30.96 ? 375  THR B C     1 
ATOM   4353 O  O     . THR B 2 376 ? -34.982 18.039 35.776 1.00 34.97 ? 375  THR B O     1 
ATOM   4354 C  CB    . THR B 2 376 ? -36.036 15.676 37.146 1.00 29.24 ? 375  THR B CB    1 
ATOM   4355 O  OG1   . THR B 2 376 ? -35.901 14.496 37.946 1.00 31.98 ? 375  THR B OG1   1 
ATOM   4356 C  CG2   . THR B 2 376 ? -37.451 15.781 36.543 1.00 30.85 ? 375  THR B CG2   1 
ATOM   4357 H  H     . THR B 2 376 ? -33.610 15.599 37.659 1.00 0.00  ? 375  THR B H     1 
ATOM   4358 H  HG1   . THR B 2 376 ? -36.448 14.700 38.687 1.00 0.00  ? 375  THR B HG1   1 
ATOM   4359 N  N     . LEU B 2 377 ? -35.348 16.804 33.928 1.00 27.74 ? 376  LEU B N     1 
ATOM   4360 C  CA    . LEU B 2 377 ? -35.495 17.996 33.096 1.00 25.87 ? 376  LEU B CA    1 
ATOM   4361 C  C     . LEU B 2 377 ? -36.990 18.252 32.837 1.00 30.21 ? 376  LEU B C     1 
ATOM   4362 O  O     . LEU B 2 377 ? -37.568 17.740 31.883 1.00 27.58 ? 376  LEU B O     1 
ATOM   4363 C  CB    . LEU B 2 377 ? -34.693 17.854 31.788 1.00 19.95 ? 376  LEU B CB    1 
ATOM   4364 C  CG    . LEU B 2 377 ? -33.208 17.430 31.913 1.00 22.45 ? 376  LEU B CG    1 
ATOM   4365 C  CD1   . LEU B 2 377 ? -32.576 17.307 30.552 1.00 21.76 ? 376  LEU B CD1   1 
ATOM   4366 C  CD2   . LEU B 2 377 ? -32.376 18.377 32.782 1.00 21.93 ? 376  LEU B CD2   1 
ATOM   4367 H  H     . LEU B 2 377 ? -35.373 15.922 33.534 1.00 0.00  ? 376  LEU B H     1 
ATOM   4368 N  N     . LYS B 2 378 ? -37.621 18.995 33.742 1.00 33.99 ? 377  LYS B N     1 
ATOM   4369 C  CA    . LYS B 2 378 ? -39.038 19.312 33.634 1.00 38.45 ? 377  LYS B CA    1 
ATOM   4370 C  C     . LYS B 2 378 ? -39.263 20.679 32.941 1.00 40.65 ? 377  LYS B C     1 
ATOM   4371 O  O     . LYS B 2 378 ? -38.591 21.650 33.249 1.00 44.58 ? 377  LYS B O     1 
ATOM   4372 C  CB    . LYS B 2 378 ? -39.657 19.315 35.029 1.00 38.83 ? 377  LYS B CB    1 
ATOM   4373 C  CG    . LYS B 2 378 ? -41.164 19.396 35.033 1.00 42.44 ? 377  LYS B CG    1 
ATOM   4374 C  CD    . LYS B 2 378 ? -41.708 19.972 36.348 1.00 49.32 ? 377  LYS B CD    1 
ATOM   4375 C  CE    . LYS B 2 378 ? -43.227 20.240 36.249 1.00 53.61 ? 377  LYS B CE    1 
ATOM   4376 N  NZ    . LYS B 2 378 ? -43.644 21.057 35.037 1.00 54.51 ? 377  LYS B NZ    1 
ATOM   4377 H  H     . LYS B 2 378 ? -37.106 19.351 34.501 1.00 0.00  ? 377  LYS B H     1 
ATOM   4378 H  HZ1   . LYS B 2 378 ? -43.344 20.557 34.177 1.00 0.00  ? 377  LYS B HZ1   1 
ATOM   4379 H  HZ2   . LYS B 2 378 ? -44.677 21.195 35.024 1.00 0.00  ? 377  LYS B HZ2   1 
ATOM   4380 H  HZ3   . LYS B 2 378 ? -43.170 21.981 35.079 1.00 0.00  ? 377  LYS B HZ3   1 
ATOM   4381 N  N     . PRO B 2 379 ? -40.226 20.764 32.009 1.00 37.12 ? 378  PRO B N     1 
ATOM   4382 C  CA    . PRO B 2 379 ? -40.587 21.959 31.245 1.00 32.41 ? 378  PRO B CA    1 
ATOM   4383 C  C     . PRO B 2 379 ? -40.934 23.237 31.990 1.00 34.95 ? 378  PRO B C     1 
ATOM   4384 O  O     . PRO B 2 379 ? -41.667 23.242 32.985 1.00 34.13 ? 378  PRO B O     1 
ATOM   4385 C  CB    . PRO B 2 379 ? -41.738 21.475 30.402 1.00 31.37 ? 378  PRO B CB    1 
ATOM   4386 C  CG    . PRO B 2 379 ? -41.320 20.087 30.109 1.00 37.31 ? 378  PRO B CG    1 
ATOM   4387 C  CD    . PRO B 2 379 ? -40.887 19.581 31.441 1.00 36.99 ? 378  PRO B CD    1 
ATOM   4388 N  N     . ASP B 2 380 ? -40.445 24.336 31.421 1.00 37.71 ? 379  ASP B N     1 
ATOM   4389 C  CA    . ASP B 2 380 ? -40.611 25.686 31.948 1.00 40.26 ? 379  ASP B CA    1 
ATOM   4390 C  C     . ASP B 2 380 ? -39.823 25.966 33.203 1.00 36.72 ? 379  ASP B C     1 
ATOM   4391 O  O     . ASP B 2 380 ? -39.872 27.072 33.739 1.00 38.01 ? 379  ASP B O     1 
ATOM   4392 C  CB    . ASP B 2 380 ? -42.079 26.067 32.081 1.00 44.63 ? 379  ASP B CB    1 
ATOM   4393 C  CG    . ASP B 2 380 ? -42.707 26.322 30.740 1.00 49.73 ? 379  ASP B CG    1 
ATOM   4394 O  OD1   . ASP B 2 380 ? -42.293 27.302 30.075 1.00 50.34 ? 379  ASP B OD1   1 
ATOM   4395 O  OD2   . ASP B 2 380 ? -43.569 25.519 30.324 1.00 53.67 ? 379  ASP B OD2   1 
ATOM   4396 H  H     . ASP B 2 380 ? -39.946 24.257 30.583 1.00 0.00  ? 379  ASP B H     1 
ATOM   4397 N  N     . SER B 2 381 ? -39.052 24.974 33.634 1.00 35.35 ? 380  SER B N     1 
ATOM   4398 C  CA    . SER B 2 381 ? -38.201 25.142 34.801 1.00 34.75 ? 380  SER B CA    1 
ATOM   4399 C  C     . SER B 2 381 ? -36.887 25.750 34.291 1.00 34.48 ? 380  SER B C     1 
ATOM   4400 O  O     . SER B 2 381 ? -36.457 25.516 33.151 1.00 33.87 ? 380  SER B O     1 
ATOM   4401 C  CB    . SER B 2 381 ? -37.978 23.816 35.549 1.00 32.01 ? 380  SER B CB    1 
ATOM   4402 O  OG    . SER B 2 381 ? -37.164 22.921 34.826 1.00 31.00 ? 380  SER B OG    1 
ATOM   4403 H  H     . SER B 2 381 ? -39.039 24.129 33.155 1.00 0.00  ? 380  SER B H     1 
ATOM   4404 H  HG    . SER B 2 381 ? -37.565 22.770 33.977 1.00 0.00  ? 380  SER B HG    1 
ATOM   4405 N  N     . THR B 2 382 ? -36.277 26.552 35.146 1.00 33.43 ? 381  THR B N     1 
ATOM   4406 C  CA    . THR B 2 382 ? -35.064 27.252 34.814 1.00 31.10 ? 381  THR B CA    1 
ATOM   4407 C  C     . THR B 2 382 ? -33.951 26.755 35.707 1.00 27.56 ? 381  THR B C     1 
ATOM   4408 O  O     . THR B 2 382 ? -34.162 26.523 36.887 1.00 24.47 ? 381  THR B O     1 
ATOM   4409 C  CB    . THR B 2 382 ? -35.288 28.765 35.061 1.00 33.59 ? 381  THR B CB    1 
ATOM   4410 O  OG1   . THR B 2 382 ? -36.484 29.177 34.379 1.00 27.88 ? 381  THR B OG1   1 
ATOM   4411 C  CG2   . THR B 2 382 ? -34.085 29.589 34.599 1.00 29.03 ? 381  THR B CG2   1 
ATOM   4412 H  H     . THR B 2 382 ? -36.655 26.690 36.031 1.00 0.00  ? 381  THR B H     1 
ATOM   4413 H  HG1   . THR B 2 382 ? -36.345 30.021 33.942 1.00 0.00  ? 381  THR B HG1   1 
ATOM   4414 N  N     . HIS B 2 383 ? -32.776 26.553 35.136 1.00 26.54 ? 382  HIS B N     1 
ATOM   4415 C  CA    . HIS B 2 383 ? -31.620 26.098 35.898 1.00 28.47 ? 382  HIS B CA    1 
ATOM   4416 C  C     . HIS B 2 383 ? -30.470 27.050 35.547 1.00 27.96 ? 382  HIS B C     1 
ATOM   4417 O  O     . HIS B 2 383 ? -30.391 27.532 34.422 1.00 28.55 ? 382  HIS B O     1 
ATOM   4418 C  CB    . HIS B 2 383 ? -31.268 24.640 35.539 1.00 29.32 ? 382  HIS B CB    1 
ATOM   4419 C  CG    . HIS B 2 383 ? -32.348 23.660 35.873 1.00 30.89 ? 382  HIS B CG    1 
ATOM   4420 N  ND1   . HIS B 2 383 ? -32.660 23.311 37.167 1.00 34.72 ? 382  HIS B ND1   1 
ATOM   4421 C  CD2   . HIS B 2 383 ? -33.242 23.009 35.089 1.00 34.97 ? 382  HIS B CD2   1 
ATOM   4422 C  CE1   . HIS B 2 383 ? -33.698 22.492 37.173 1.00 34.52 ? 382  HIS B CE1   1 
ATOM   4423 N  NE2   . HIS B 2 383 ? -34.071 22.293 35.925 1.00 32.85 ? 382  HIS B NE2   1 
ATOM   4424 H  H     . HIS B 2 383 ? -32.677 26.755 34.179 1.00 0.00  ? 382  HIS B H     1 
ATOM   4425 H  HD1   . HIS B 2 383 ? -32.172 23.644 37.969 1.00 0.00  ? 382  HIS B HD1   1 
ATOM   4426 H  HE2   . HIS B 2 383 ? -34.849 21.758 35.652 1.00 0.00  ? 382  HIS B HE2   1 
ATOM   4427 N  N     . SER B 2 384 ? -29.666 27.416 36.536 1.00 25.13 ? 383  SER B N     1 
ATOM   4428 C  CA    . SER B 2 384 ? -28.528 28.294 36.306 1.00 25.00 ? 383  SER B CA    1 
ATOM   4429 C  C     . SER B 2 384 ? -27.265 27.603 36.816 1.00 30.96 ? 383  SER B C     1 
ATOM   4430 O  O     . SER B 2 384 ? -27.324 26.643 37.612 1.00 29.98 ? 383  SER B O     1 
ATOM   4431 C  CB    . SER B 2 384 ? -28.696 29.613 37.042 1.00 19.39 ? 383  SER B CB    1 
ATOM   4432 O  OG    . SER B 2 384 ? -29.858 30.259 36.593 1.00 33.18 ? 383  SER B OG    1 
ATOM   4433 H  H     . SER B 2 384 ? -29.806 27.050 37.440 1.00 0.00  ? 383  SER B H     1 
ATOM   4434 H  HG    . SER B 2 384 ? -30.586 29.970 37.162 1.00 0.00  ? 383  SER B HG    1 
ATOM   4435 N  N     . ASN B 2 385 ? -26.127 28.096 36.347 1.00 25.50 ? 384  ASN B N     1 
ATOM   4436 C  CA    . ASN B 2 385 ? -24.860 27.566 36.762 1.00 19.68 ? 384  ASN B CA    1 
ATOM   4437 C  C     . ASN B 2 385 ? -23.829 28.527 36.235 1.00 19.52 ? 384  ASN B C     1 
ATOM   4438 O  O     . ASN B 2 385 ? -24.076 29.192 35.229 1.00 16.00 ? 384  ASN B O     1 
ATOM   4439 C  CB    . ASN B 2 385 ? -24.640 26.189 36.155 1.00 18.62 ? 384  ASN B CB    1 
ATOM   4440 C  CG    . ASN B 2 385 ? -23.711 25.347 36.978 1.00 17.84 ? 384  ASN B CG    1 
ATOM   4441 O  OD1   . ASN B 2 385 ? -23.796 25.336 38.195 1.00 18.03 ? 384  ASN B OD1   1 
ATOM   4442 N  ND2   . ASN B 2 385 ? -22.811 24.639 36.327 1.00 20.98 ? 384  ASN B ND2   1 
ATOM   4443 H  H     . ASN B 2 385 ? -26.139 28.845 35.702 1.00 0.00  ? 384  ASN B H     1 
ATOM   4444 H  HD21  . ASN B 2 385 ? -22.221 24.095 36.880 1.00 0.00  ? 384  ASN B HD21  1 
ATOM   4445 H  HD22  . ASN B 2 385 ? -22.764 24.673 35.352 1.00 0.00  ? 384  ASN B HD22  1 
ATOM   4446 N  N     . GLU B 2 386 ? -22.717 28.660 36.951 1.00 20.57 ? 385  GLU B N     1 
ATOM   4447 C  CA    . GLU B 2 386 ? -21.611 29.529 36.541 1.00 18.72 ? 385  GLU B CA    1 
ATOM   4448 C  C     . GLU B 2 386 ? -20.520 28.563 36.180 1.00 14.89 ? 385  GLU B C     1 
ATOM   4449 O  O     . GLU B 2 386 ? -20.509 27.453 36.689 1.00 20.92 ? 385  GLU B O     1 
ATOM   4450 C  CB    . GLU B 2 386 ? -21.146 30.425 37.687 1.00 19.12 ? 385  GLU B CB    1 
ATOM   4451 C  CG    . GLU B 2 386 ? -22.198 30.632 38.725 1.00 27.40 ? 385  GLU B CG    1 
ATOM   4452 C  CD    . GLU B 2 386 ? -22.142 31.975 39.407 1.00 29.43 ? 385  GLU B CD    1 
ATOM   4453 O  OE1   . GLU B 2 386 ? -21.145 32.297 40.071 1.00 31.52 ? 385  GLU B OE1   1 
ATOM   4454 O  OE2   . GLU B 2 386 ? -23.139 32.710 39.323 1.00 37.36 ? 385  GLU B OE2   1 
ATOM   4455 H  H     . GLU B 2 386 ? -22.629 28.150 37.788 1.00 0.00  ? 385  GLU B H     1 
ATOM   4456 N  N     . PHE B 2 387 ? -19.653 28.915 35.251 1.00 13.60 ? 386  PHE B N     1 
ATOM   4457 C  CA    . PHE B 2 387 ? -18.588 27.990 34.905 1.00 17.41 ? 386  PHE B CA    1 
ATOM   4458 C  C     . PHE B 2 387 ? -17.389 28.754 34.433 1.00 15.32 ? 386  PHE B C     1 
ATOM   4459 O  O     . PHE B 2 387 ? -17.537 29.916 34.037 1.00 20.32 ? 386  PHE B O     1 
ATOM   4460 C  CB    . PHE B 2 387 ? -19.040 26.946 33.858 1.00 20.77 ? 386  PHE B CB    1 
ATOM   4461 C  CG    . PHE B 2 387 ? -19.644 27.534 32.614 1.00 22.54 ? 386  PHE B CG    1 
ATOM   4462 C  CD1   . PHE B 2 387 ? -18.833 28.045 31.598 1.00 23.43 ? 386  PHE B CD1   1 
ATOM   4463 C  CD2   . PHE B 2 387 ? -21.021 27.537 32.435 1.00 24.15 ? 386  PHE B CD2   1 
ATOM   4464 C  CE1   . PHE B 2 387 ? -19.380 28.543 30.423 1.00 21.46 ? 386  PHE B CE1   1 
ATOM   4465 C  CE2   . PHE B 2 387 ? -21.589 28.039 31.250 1.00 25.44 ? 386  PHE B CE2   1 
ATOM   4466 C  CZ    . PHE B 2 387 ? -20.771 28.539 30.246 1.00 22.36 ? 386  PHE B CZ    1 
ATOM   4467 H  H     . PHE B 2 387 ? -19.697 29.805 34.843 1.00 0.00  ? 386  PHE B H     1 
ATOM   4468 N  N     . ASP B 2 388 ? -16.212 28.126 34.493 1.00 15.58 ? 387  ASP B N     1 
ATOM   4469 C  CA    . ASP B 2 388 ? -14.978 28.787 34.071 1.00 19.94 ? 387  ASP B CA    1 
ATOM   4470 C  C     . ASP B 2 388 ? -14.541 28.341 32.705 1.00 22.45 ? 387  ASP B C     1 
ATOM   4471 O  O     . ASP B 2 388 ? -13.985 27.252 32.543 1.00 25.38 ? 387  ASP B O     1 
ATOM   4472 C  CB    . ASP B 2 388 ? -13.846 28.565 35.069 1.00 13.47 ? 387  ASP B CB    1 
ATOM   4473 C  CG    . ASP B 2 388 ? -14.268 28.866 36.490 1.00 19.43 ? 387  ASP B CG    1 
ATOM   4474 O  OD1   . ASP B 2 388 ? -14.550 30.034 36.826 1.00 16.88 ? 387  ASP B OD1   1 
ATOM   4475 O  OD2   . ASP B 2 388 ? -14.357 27.911 37.276 1.00 26.74 ? 387  ASP B OD2   1 
ATOM   4476 H  H     . ASP B 2 388 ? -16.186 27.208 34.828 1.00 0.00  ? 387  ASP B H     1 
ATOM   4477 N  N     . SER B 2 389 ? -14.759 29.218 31.735 1.00 21.90 ? 388  SER B N     1 
ATOM   4478 C  CA    . SER B 2 389 ? -14.411 28.978 30.337 1.00 23.12 ? 388  SER B CA    1 
ATOM   4479 C  C     . SER B 2 389 ? -12.894 29.162 30.080 1.00 21.36 ? 388  SER B C     1 
ATOM   4480 O  O     . SER B 2 389 ? -12.239 30.025 30.685 1.00 25.56 ? 388  SER B O     1 
ATOM   4481 C  CB    . SER B 2 389 ? -15.249 29.957 29.470 1.00 22.73 ? 388  SER B CB    1 
ATOM   4482 O  OG    . SER B 2 389 ? -15.087 29.783 28.070 1.00 27.00 ? 388  SER B OG    1 
ATOM   4483 H  H     . SER B 2 389 ? -15.174 30.074 31.956 1.00 0.00  ? 388  SER B H     1 
ATOM   4484 H  HG    . SER B 2 389 ? -15.745 29.160 27.758 1.00 0.00  ? 388  SER B HG    1 
ATOM   4485 N  N     . ASP B 2 390 ? -12.322 28.328 29.217 1.00 21.77 ? 389  ASP B N     1 
ATOM   4486 C  CA    . ASP B 2 390 ? -10.905 28.461 28.861 1.00 24.22 ? 389  ASP B CA    1 
ATOM   4487 C  C     . ASP B 2 390 ? -10.686 29.522 27.741 1.00 25.33 ? 389  ASP B C     1 
ATOM   4488 O  O     . ASP B 2 390 ? -9.558  29.815 27.343 1.00 27.25 ? 389  ASP B O     1 
ATOM   4489 C  CB    . ASP B 2 390 ? -10.246 27.091 28.551 1.00 23.60 ? 389  ASP B CB    1 
ATOM   4490 C  CG    . ASP B 2 390 ? -10.673 26.476 27.204 1.00 20.01 ? 389  ASP B CG    1 
ATOM   4491 O  OD1   . ASP B 2 390 ? -11.821 26.606 26.742 1.00 14.25 ? 389  ASP B OD1   1 
ATOM   4492 O  OD2   . ASP B 2 390 ? -9.822  25.795 26.618 1.00 26.15 ? 389  ASP B OD2   1 
ATOM   4493 H  H     . ASP B 2 390 ? -12.854 27.619 28.819 1.00 0.00  ? 389  ASP B H     1 
ATOM   4494 N  N     . VAL B 2 391 ? -11.781 30.104 27.254 1.00 26.49 ? 390  VAL B N     1 
ATOM   4495 C  CA    . VAL B 2 391 ? -11.717 31.177 26.268 1.00 23.36 ? 390  VAL B CA    1 
ATOM   4496 C  C     . VAL B 2 391 ? -12.658 32.325 26.617 1.00 22.28 ? 390  VAL B C     1 
ATOM   4497 O  O     . VAL B 2 391 ? -13.699 32.142 27.256 1.00 21.22 ? 390  VAL B O     1 
ATOM   4498 C  CB    . VAL B 2 391 ? -12.113 30.739 24.857 1.00 23.17 ? 390  VAL B CB    1 
ATOM   4499 C  CG1   . VAL B 2 391 ? -11.043 29.913 24.241 1.00 28.36 ? 390  VAL B CG1   1 
ATOM   4500 C  CG2   . VAL B 2 391 ? -13.416 30.016 24.886 1.00 23.48 ? 390  VAL B CG2   1 
ATOM   4501 H  H     . VAL B 2 391 ? -12.675 29.846 27.565 1.00 0.00  ? 390  VAL B H     1 
ATOM   4502 N  N     . ASP B 2 392 ? -12.266 33.518 26.197 1.00 22.39 ? 391  ASP B N     1 
ATOM   4503 C  CA    . ASP B 2 392 ? -13.093 34.707 26.358 1.00 26.19 ? 391  ASP B CA    1 
ATOM   4504 C  C     . ASP B 2 392 ? -13.783 34.767 24.990 1.00 25.39 ? 391  ASP B C     1 
ATOM   4505 O  O     . ASP B 2 392 ? -13.108 34.759 23.952 1.00 29.84 ? 391  ASP B O     1 
ATOM   4506 C  CB    . ASP B 2 392 ? -12.192 35.940 26.568 1.00 27.53 ? 391  ASP B CB    1 
ATOM   4507 C  CG    . ASP B 2 392 ? -12.947 37.248 26.480 1.00 24.63 ? 391  ASP B CG    1 
ATOM   4508 O  OD1   . ASP B 2 392 ? -14.193 37.267 26.592 1.00 26.31 ? 391  ASP B OD1   1 
ATOM   4509 O  OD2   . ASP B 2 392 ? -12.270 38.273 26.295 1.00 28.59 ? 391  ASP B OD2   1 
ATOM   4510 H  H     . ASP B 2 392 ? -11.404 33.617 25.729 1.00 0.00  ? 391  ASP B H     1 
ATOM   4511 N  N     . VAL B 2 393 ? -15.106 34.778 24.951 1.00 21.15 ? 392  VAL B N     1 
ATOM   4512 C  CA    . VAL B 2 393 ? -15.743 34.798 23.634 1.00 21.70 ? 392  VAL B CA    1 
ATOM   4513 C  C     . VAL B 2 393 ? -16.142 36.195 23.166 1.00 19.58 ? 392  VAL B C     1 
ATOM   4514 O  O     . VAL B 2 393 ? -16.480 36.406 22.003 1.00 22.07 ? 392  VAL B O     1 
ATOM   4515 C  CB    . VAL B 2 393 ? -16.903 33.759 23.535 1.00 16.67 ? 392  VAL B CB    1 
ATOM   4516 C  CG1   . VAL B 2 393 ? -16.331 32.385 23.667 1.00 18.16 ? 392  VAL B CG1   1 
ATOM   4517 C  CG2   . VAL B 2 393 ? -17.935 33.959 24.644 1.00 16.30 ? 392  VAL B CG2   1 
ATOM   4518 H  H     . VAL B 2 393 ? -15.650 34.788 25.766 1.00 0.00  ? 392  VAL B H     1 
ATOM   4519 N  N     . GLY B 2 394 ? -16.044 37.160 24.061 1.00 18.72 ? 393  GLY B N     1 
ATOM   4520 C  CA    . GLY B 2 394 ? -16.388 38.515 23.693 1.00 22.82 ? 393  GLY B CA    1 
ATOM   4521 C  C     . GLY B 2 394 ? -17.883 38.704 23.742 1.00 22.26 ? 393  GLY B C     1 
ATOM   4522 O  O     . GLY B 2 394 ? -18.560 38.216 24.651 1.00 23.63 ? 393  GLY B O     1 
ATOM   4523 H  H     . GLY B 2 394 ? -15.816 36.975 24.988 1.00 0.00  ? 393  GLY B H     1 
ATOM   4524 N  N     . ASP B 2 395 ? -18.397 39.436 22.764 1.00 24.47 ? 394  ASP B N     1 
ATOM   4525 C  CA    . ASP B 2 395 ? -19.823 39.705 22.668 1.00 23.25 ? 394  ASP B CA    1 
ATOM   4526 C  C     . ASP B 2 395 ? -20.486 38.477 22.089 1.00 21.62 ? 394  ASP B C     1 
ATOM   4527 O  O     . ASP B 2 395 ? -20.130 37.998 21.016 1.00 21.61 ? 394  ASP B O     1 
ATOM   4528 C  CB    . ASP B 2 395 ? -20.080 40.912 21.775 1.00 25.43 ? 394  ASP B CB    1 
ATOM   4529 C  CG    . ASP B 2 395 ? -19.462 42.162 22.322 1.00 26.94 ? 394  ASP B CG    1 
ATOM   4530 O  OD1   . ASP B 2 395 ? -19.754 42.515 23.506 1.00 17.91 ? 394  ASP B OD1   1 
ATOM   4531 O  OD2   . ASP B 2 395 ? -18.682 42.770 21.550 1.00 28.04 ? 394  ASP B OD2   1 
ATOM   4532 H  H     . ASP B 2 395 ? -17.783 39.759 22.073 1.00 0.00  ? 394  ASP B H     1 
ATOM   4533 N  N     . LEU B 2 396 ? -21.463 37.977 22.812 1.00 21.41 ? 395  LEU B N     1 
ATOM   4534 C  CA    . LEU B 2 396 ? -22.145 36.779 22.399 1.00 23.19 ? 395  LEU B CA    1 
ATOM   4535 C  C     . LEU B 2 396 ? -23.103 36.981 21.238 1.00 24.04 ? 395  LEU B C     1 
ATOM   4536 O  O     . LEU B 2 396 ? -23.927 37.895 21.235 1.00 21.50 ? 395  LEU B O     1 
ATOM   4537 C  CB    . LEU B 2 396 ? -22.840 36.148 23.610 1.00 23.27 ? 395  LEU B CB    1 
ATOM   4538 C  CG    . LEU B 2 396 ? -21.827 35.515 24.563 1.00 21.54 ? 395  LEU B CG    1 
ATOM   4539 C  CD1   . LEU B 2 396 ? -21.408 36.425 25.704 1.00 20.71 ? 395  LEU B CD1   1 
ATOM   4540 C  CD2   . LEU B 2 396 ? -22.444 34.269 25.092 1.00 29.89 ? 395  LEU B CD2   1 
ATOM   4541 H  H     . LEU B 2 396 ? -21.727 38.430 23.631 1.00 0.00  ? 395  LEU B H     1 
ATOM   4542 N  N     . GLN B 2 397 ? -22.996 36.092 20.261 1.00 22.38 ? 396  GLN B N     1 
ATOM   4543 C  CA    . GLN B 2 397 ? -23.837 36.140 19.079 1.00 22.21 ? 396  GLN B CA    1 
ATOM   4544 C  C     . GLN B 2 397 ? -24.685 34.887 18.952 1.00 24.70 ? 396  GLN B C     1 
ATOM   4545 O  O     . GLN B 2 397 ? -25.663 34.870 18.193 1.00 27.48 ? 396  GLN B O     1 
ATOM   4546 C  CB    . GLN B 2 397 ? -22.969 36.250 17.833 1.00 19.35 ? 396  GLN B CB    1 
ATOM   4547 C  CG    . GLN B 2 397 ? -21.995 37.396 17.862 1.00 25.11 ? 396  GLN B CG    1 
ATOM   4548 C  CD    . GLN B 2 397 ? -20.801 37.131 16.981 1.00 27.72 ? 396  GLN B CD    1 
ATOM   4549 O  OE1   . GLN B 2 397 ? -20.585 36.002 16.514 1.00 26.18 ? 396  GLN B OE1   1 
ATOM   4550 N  NE2   . GLN B 2 397 ? -20.003 38.163 16.755 1.00 24.08 ? 396  GLN B NE2   1 
ATOM   4551 H  H     . GLN B 2 397 ? -22.317 35.399 20.334 1.00 0.00  ? 396  GLN B H     1 
ATOM   4552 H  HE21  . GLN B 2 397 ? -19.229 38.021 16.172 1.00 0.00  ? 396  GLN B HE21  1 
ATOM   4553 H  HE22  . GLN B 2 397 ? -20.236 39.008 17.187 1.00 0.00  ? 396  GLN B HE22  1 
ATOM   4554 N  N     . MET B 2 398 ? -24.357 33.859 19.727 1.00 23.43 ? 397  MET B N     1 
ATOM   4555 C  CA    . MET B 2 398 ? -25.085 32.605 19.608 1.00 26.94 ? 397  MET B CA    1 
ATOM   4556 C  C     . MET B 2 398 ? -24.755 31.626 20.739 1.00 29.11 ? 397  MET B C     1 
ATOM   4557 O  O     . MET B 2 398 ? -23.640 31.618 21.273 1.00 26.08 ? 397  MET B O     1 
ATOM   4558 C  CB    . MET B 2 398 ? -24.705 32.006 18.256 1.00 27.71 ? 397  MET B CB    1 
ATOM   4559 C  CG    . MET B 2 398 ? -25.458 30.824 17.776 1.00 26.49 ? 397  MET B CG    1 
ATOM   4560 S  SD    . MET B 2 398 ? -24.559 30.335 16.311 1.00 33.64 ? 397  MET B SD    1 
ATOM   4561 C  CE    . MET B 2 398 ? -24.994 31.755 15.243 1.00 32.37 ? 397  MET B CE    1 
ATOM   4562 H  H     . MET B 2 398 ? -23.626 33.907 20.380 1.00 0.00  ? 397  MET B H     1 
ATOM   4563 N  N     . VAL B 2 399 ? -25.751 30.820 21.097 1.00 30.72 ? 398  VAL B N     1 
ATOM   4564 C  CA    . VAL B 2 399 ? -25.639 29.810 22.145 1.00 33.87 ? 398  VAL B CA    1 
ATOM   4565 C  C     . VAL B 2 399 ? -26.332 28.541 21.620 1.00 32.26 ? 398  VAL B C     1 
ATOM   4566 O  O     . VAL B 2 399 ? -27.453 28.613 21.115 1.00 30.88 ? 398  VAL B O     1 
ATOM   4567 C  CB    . VAL B 2 399 ? -26.356 30.261 23.481 1.00 36.31 ? 398  VAL B CB    1 
ATOM   4568 C  CG1   . VAL B 2 399 ? -26.305 29.140 24.507 1.00 41.64 ? 398  VAL B CG1   1 
ATOM   4569 C  CG2   . VAL B 2 399 ? -25.697 31.505 24.080 1.00 35.91 ? 398  VAL B CG2   1 
ATOM   4570 H  H     . VAL B 2 399 ? -26.607 30.872 20.619 1.00 0.00  ? 398  VAL B H     1 
ATOM   4571 N  N     . LYS B 2 400 ? -25.641 27.405 21.713 1.00 30.34 ? 399  LYS B N     1 
ATOM   4572 C  CA    . LYS B 2 400 ? -26.163 26.107 21.280 1.00 31.27 ? 399  LYS B CA    1 
ATOM   4573 C  C     . LYS B 2 400 ? -26.447 25.193 22.479 1.00 31.45 ? 399  LYS B C     1 
ATOM   4574 O  O     . LYS B 2 400 ? -25.550 24.871 23.268 1.00 34.32 ? 399  LYS B O     1 
ATOM   4575 C  CB    . LYS B 2 400 ? -25.189 25.416 20.314 1.00 27.11 ? 399  LYS B CB    1 
ATOM   4576 C  CG    . LYS B 2 400 ? -24.941 26.213 19.081 1.00 24.45 ? 399  LYS B CG    1 
ATOM   4577 C  CD    . LYS B 2 400 ? -24.365 25.391 17.978 1.00 23.04 ? 399  LYS B CD    1 
ATOM   4578 C  CE    . LYS B 2 400 ? -24.086 26.302 16.783 1.00 23.94 ? 399  LYS B CE    1 
ATOM   4579 N  NZ    . LYS B 2 400 ? -23.551 25.539 15.621 1.00 25.89 ? 399  LYS B NZ    1 
ATOM   4580 H  H     . LYS B 2 400 ? -24.729 27.428 22.088 1.00 0.00  ? 399  LYS B H     1 
ATOM   4581 H  HZ1   . LYS B 2 400 ? -22.685 25.033 15.887 1.00 0.00  ? 399  LYS B HZ1   1 
ATOM   4582 H  HZ2   . LYS B 2 400 ? -24.264 24.859 15.291 1.00 0.00  ? 399  LYS B HZ2   1 
ATOM   4583 H  HZ3   . LYS B 2 400 ? -23.346 26.208 14.850 1.00 0.00  ? 399  LYS B HZ3   1 
ATOM   4584 N  N     . PHE B 2 401 ? -27.713 24.816 22.613 1.00 26.94 ? 400  PHE B N     1 
ATOM   4585 C  CA    . PHE B 2 401 ? -28.196 23.957 23.681 1.00 23.79 ? 400  PHE B CA    1 
ATOM   4586 C  C     . PHE B 2 401 ? -28.083 22.516 23.211 1.00 27.35 ? 400  PHE B C     1 
ATOM   4587 O  O     . PHE B 2 401 ? -28.129 22.250 22.000 1.00 25.07 ? 400  PHE B O     1 
ATOM   4588 C  CB    . PHE B 2 401 ? -29.656 24.311 23.972 1.00 19.09 ? 400  PHE B CB    1 
ATOM   4589 C  CG    . PHE B 2 401 ? -30.377 23.304 24.811 1.00 21.95 ? 400  PHE B CG    1 
ATOM   4590 C  CD1   . PHE B 2 401 ? -30.392 23.420 26.205 1.00 22.36 ? 400  PHE B CD1   1 
ATOM   4591 C  CD2   . PHE B 2 401 ? -31.095 22.257 24.208 1.00 18.90 ? 400  PHE B CD2   1 
ATOM   4592 C  CE1   . PHE B 2 401 ? -31.119 22.511 26.994 1.00 22.34 ? 400  PHE B CE1   1 
ATOM   4593 C  CE2   . PHE B 2 401 ? -31.822 21.355 24.979 1.00 18.92 ? 400  PHE B CE2   1 
ATOM   4594 C  CZ    . PHE B 2 401 ? -31.833 21.484 26.376 1.00 21.52 ? 400  PHE B CZ    1 
ATOM   4595 H  H     . PHE B 2 401 ? -28.370 25.131 21.960 1.00 0.00  ? 400  PHE B H     1 
ATOM   4596 N  N     . ILE B 2 402 ? -27.930 21.592 24.161 1.00 28.01 ? 401  ILE B N     1 
ATOM   4597 C  CA    . ILE B 2 402 ? -27.825 20.161 23.844 1.00 25.67 ? 401  ILE B CA    1 
ATOM   4598 C  C     . ILE B 2 402 ? -28.014 19.296 25.094 1.00 27.99 ? 401  ILE B C     1 
ATOM   4599 O  O     . ILE B 2 402 ? -27.534 19.640 26.175 1.00 32.41 ? 401  ILE B O     1 
ATOM   4600 C  CB    . ILE B 2 402 ? -26.455 19.809 23.124 1.00 18.74 ? 401  ILE B CB    1 
ATOM   4601 C  CG1   . ILE B 2 402 ? -26.491 18.377 22.611 1.00 19.14 ? 401  ILE B CG1   1 
ATOM   4602 C  CG2   . ILE B 2 402 ? -25.271 19.929 24.088 1.00 17.95 ? 401  ILE B CG2   1 
ATOM   4603 C  CD1   . ILE B 2 402 ? -25.353 18.038 21.734 1.00 23.86 ? 401  ILE B CD1   1 
ATOM   4604 H  H     . ILE B 2 402 ? -27.826 21.875 25.097 1.00 0.00  ? 401  ILE B H     1 
ATOM   4605 N  N     . TRP B 2 403 ? -28.725 18.183 24.954 1.00 31.68 ? 402  TRP B N     1 
ATOM   4606 C  CA    . TRP B 2 403 ? -28.940 17.264 26.077 1.00 27.50 ? 402  TRP B CA    1 
ATOM   4607 C  C     . TRP B 2 403 ? -28.739 15.815 25.661 1.00 23.22 ? 402  TRP B C     1 
ATOM   4608 O  O     . TRP B 2 403 ? -28.533 15.513 24.489 1.00 22.08 ? 402  TRP B O     1 
ATOM   4609 C  CB    . TRP B 2 403 ? -30.342 17.431 26.668 1.00 30.28 ? 402  TRP B CB    1 
ATOM   4610 C  CG    . TRP B 2 403 ? -31.440 16.997 25.764 1.00 34.79 ? 402  TRP B CG    1 
ATOM   4611 C  CD1   . TRP B 2 403 ? -31.967 17.700 24.714 1.00 34.18 ? 402  TRP B CD1   1 
ATOM   4612 C  CD2   . TRP B 2 403 ? -32.190 15.774 25.848 1.00 37.33 ? 402  TRP B CD2   1 
ATOM   4613 N  NE1   . TRP B 2 403 ? -33.006 16.991 24.148 1.00 39.35 ? 402  TRP B NE1   1 
ATOM   4614 C  CE2   . TRP B 2 403 ? -33.159 15.805 24.822 1.00 37.53 ? 402  TRP B CE2   1 
ATOM   4615 C  CE3   . TRP B 2 403 ? -32.136 14.654 26.694 1.00 39.01 ? 402  TRP B CE3   1 
ATOM   4616 C  CZ2   . TRP B 2 403 ? -34.070 14.761 24.619 1.00 33.97 ? 402  TRP B CZ2   1 
ATOM   4617 C  CZ3   . TRP B 2 403 ? -33.044 13.616 26.493 1.00 36.10 ? 402  TRP B CZ3   1 
ATOM   4618 C  CH2   . TRP B 2 403 ? -33.996 13.681 25.461 1.00 34.93 ? 402  TRP B CH2   1 
ATOM   4619 H  H     . TRP B 2 403 ? -29.106 17.951 24.077 1.00 0.00  ? 402  TRP B H     1 
ATOM   4620 H  HE1   . TRP B 2 403 ? -33.545 17.296 23.378 1.00 0.00  ? 402  TRP B HE1   1 
ATOM   4621 N  N     . TYR B 2 404 ? -28.788 14.921 26.635 1.00 25.83 ? 403  TYR B N     1 
ATOM   4622 C  CA    . TYR B 2 404 ? -28.632 13.502 26.400 1.00 28.92 ? 403  TYR B CA    1 
ATOM   4623 C  C     . TYR B 2 404 ? -28.815 12.788 27.732 1.00 33.11 ? 403  TYR B C     1 
ATOM   4624 O  O     . TYR B 2 404 ? -28.894 13.426 28.790 1.00 33.00 ? 403  TYR B O     1 
ATOM   4625 C  CB    . TYR B 2 404 ? -27.238 13.199 25.821 1.00 33.91 ? 403  TYR B CB    1 
ATOM   4626 C  CG    . TYR B 2 404 ? -26.117 13.299 26.832 1.00 38.70 ? 403  TYR B CG    1 
ATOM   4627 C  CD1   . TYR B 2 404 ? -25.544 14.525 27.143 1.00 41.07 ? 403  TYR B CD1   1 
ATOM   4628 C  CD2   . TYR B 2 404 ? -25.691 12.173 27.554 1.00 39.68 ? 403  TYR B CD2   1 
ATOM   4629 C  CE1   . TYR B 2 404 ? -24.584 14.636 28.162 1.00 42.96 ? 403  TYR B CE1   1 
ATOM   4630 C  CE2   . TYR B 2 404 ? -24.738 12.275 28.570 1.00 40.47 ? 403  TYR B CE2   1 
ATOM   4631 C  CZ    . TYR B 2 404 ? -24.193 13.511 28.869 1.00 43.22 ? 403  TYR B CZ    1 
ATOM   4632 O  OH    . TYR B 2 404 ? -23.295 13.645 29.899 1.00 45.32 ? 403  TYR B OH    1 
ATOM   4633 H  H     . TYR B 2 404 ? -28.936 15.237 27.556 1.00 0.00  ? 403  TYR B H     1 
ATOM   4634 H  HH    . TYR B 2 404 ? -22.889 14.517 29.807 1.00 0.00  ? 403  TYR B HH    1 
ATOM   4635 N  N     . ASN B 2 405 ? -28.872 11.461 27.683 1.00 38.40 ? 404  ASN B N     1 
ATOM   4636 C  CA    . ASN B 2 405 ? -29.005 10.652 28.886 1.00 40.71 ? 404  ASN B CA    1 
ATOM   4637 C  C     . ASN B 2 405 ? -28.556 9.233  28.580 1.00 42.68 ? 404  ASN B C     1 
ATOM   4638 O  O     . ASN B 2 405 ? -28.650 8.782  27.431 1.00 43.49 ? 404  ASN B O     1 
ATOM   4639 C  CB    . ASN B 2 405 ? -30.443 10.641 29.377 1.00 45.41 ? 404  ASN B CB    1 
ATOM   4640 C  CG    . ASN B 2 405 ? -30.590 9.941  30.713 1.00 50.51 ? 404  ASN B CG    1 
ATOM   4641 O  OD1   . ASN B 2 405 ? -29.639 9.871  31.493 1.00 56.46 ? 404  ASN B OD1   1 
ATOM   4642 N  ND2   . ASN B 2 405 ? -31.777 9.421  30.988 1.00 51.69 ? 404  ASN B ND2   1 
ATOM   4643 H  H     . ASN B 2 405 ? -28.808 10.981 26.829 1.00 0.00  ? 404  ASN B H     1 
ATOM   4644 H  HD21  . ASN B 2 405 ? -31.933 8.963  31.834 1.00 0.00  ? 404  ASN B HD21  1 
ATOM   4645 H  HD22  . ASN B 2 405 ? -32.464 9.551  30.303 1.00 0.00  ? 404  ASN B HD22  1 
ATOM   4646 N  N     . ASN B 2 406 ? -28.044 8.541  29.594 1.00 40.66 ? 406  ASN B N     1 
ATOM   4647 C  CA    . ASN B 2 406 ? -27.592 7.166  29.423 1.00 46.04 ? 406  ASN B CA    1 
ATOM   4648 C  C     . ASN B 2 406 ? -28.752 6.216  29.064 1.00 45.24 ? 406  ASN B C     1 
ATOM   4649 O  O     . ASN B 2 406 ? -28.544 5.152  28.492 1.00 42.35 ? 406  ASN B O     1 
ATOM   4650 C  CB    . ASN B 2 406 ? -26.873 6.679  30.678 1.00 50.85 ? 406  ASN B CB    1 
ATOM   4651 C  CG    . ASN B 2 406 ? -27.707 6.855  31.924 1.00 56.77 ? 406  ASN B CG    1 
ATOM   4652 O  OD1   . ASN B 2 406 ? -27.943 7.982  32.371 1.00 60.76 ? 406  ASN B OD1   1 
ATOM   4653 N  ND2   . ASN B 2 406 ? -28.173 5.745  32.488 1.00 60.00 ? 406  ASN B ND2   1 
ATOM   4654 H  H     . ASN B 2 406 ? -28.009 8.961  30.483 1.00 0.00  ? 406  ASN B H     1 
ATOM   4655 H  HD21  . ASN B 2 406 ? -28.696 5.838  33.314 1.00 0.00  ? 406  ASN B HD21  1 
ATOM   4656 H  HD22  . ASN B 2 406 ? -27.985 4.873  32.096 1.00 0.00  ? 406  ASN B HD22  1 
ATOM   4657 N  N     . VAL B 2 407 ? -29.968 6.559  29.455 1.00 44.46 ? 407  VAL B N     1 
ATOM   4658 C  CA    . VAL B 2 407 ? -31.087 5.720  29.093 1.00 50.91 ? 407  VAL B CA    1 
ATOM   4659 C  C     . VAL B 2 407 ? -32.007 6.461  28.123 1.00 56.36 ? 407  VAL B C     1 
ATOM   4660 O  O     . VAL B 2 407 ? -32.564 7.531  28.427 1.00 57.51 ? 407  VAL B O     1 
ATOM   4661 C  CB    . VAL B 2 407 ? -31.855 5.143  30.317 1.00 51.34 ? 407  VAL B CB    1 
ATOM   4662 C  CG1   . VAL B 2 407 ? -30.966 4.163  31.075 1.00 50.53 ? 407  VAL B CG1   1 
ATOM   4663 C  CG2   . VAL B 2 407 ? -32.343 6.252  31.224 1.00 51.39 ? 407  VAL B CG2   1 
ATOM   4664 H  H     . VAL B 2 407 ? -30.126 7.371  29.985 1.00 0.00  ? 407  VAL B H     1 
ATOM   4665 N  N     . ILE B 2 408 ? -32.059 5.915  26.912 1.00 61.68 ? 408  ILE B N     1 
ATOM   4666 C  CA    . ILE B 2 408 ? -32.861 6.424  25.805 1.00 64.01 ? 408  ILE B CA    1 
ATOM   4667 C  C     . ILE B 2 408 ? -34.301 5.903  25.947 1.00 64.80 ? 408  ILE B C     1 
ATOM   4668 O  O     . ILE B 2 408 ? -34.542 4.698  26.064 1.00 62.66 ? 408  ILE B O     1 
ATOM   4669 C  CB    . ILE B 2 408 ? -32.256 5.960  24.445 1.00 64.88 ? 408  ILE B CB    1 
ATOM   4670 C  CG1   . ILE B 2 408 ? -32.272 4.424  24.361 1.00 67.01 ? 408  ILE B CG1   1 
ATOM   4671 C  CG2   . ILE B 2 408 ? -30.801 6.450  24.312 1.00 61.35 ? 408  ILE B CG2   1 
ATOM   4672 C  CD1   . ILE B 2 408 ? -31.767 3.853  23.056 1.00 69.51 ? 408  ILE B CD1   1 
ATOM   4673 H  H     . ILE B 2 408 ? -31.525 5.109  26.772 1.00 0.00  ? 408  ILE B H     1 
ATOM   4674 N  N     . ASN B 2 409 ? -35.248 6.824  26.014 1.00 66.90 ? 409  ASN B N     1 
ATOM   4675 C  CA    . ASN B 2 409 ? -36.646 6.453  26.148 1.00 70.58 ? 409  ASN B CA    1 
ATOM   4676 C  C     . ASN B 2 409 ? -37.206 6.039  24.775 1.00 73.69 ? 409  ASN B C     1 
ATOM   4677 O  O     . ASN B 2 409 ? -36.915 6.688  23.753 1.00 73.20 ? 409  ASN B O     1 
ATOM   4678 C  CB    . ASN B 2 409 ? -37.438 7.630  26.732 1.00 70.62 ? 409  ASN B CB    1 
ATOM   4679 C  CG    . ASN B 2 409 ? -38.928 7.354  26.807 1.00 72.68 ? 409  ASN B CG    1 
ATOM   4680 O  OD1   . ASN B 2 409 ? -39.353 6.254  27.157 1.00 72.25 ? 409  ASN B OD1   1 
ATOM   4681 N  ND2   . ASN B 2 409 ? -39.730 8.354  26.472 1.00 74.90 ? 409  ASN B ND2   1 
ATOM   4682 H  H     . ASN B 2 409 ? -34.988 7.765  25.951 1.00 0.00  ? 409  ASN B H     1 
ATOM   4683 H  HD21  . ASN B 2 409 ? -40.698 8.176  26.517 1.00 0.00  ? 409  ASN B HD21  1 
ATOM   4684 H  HD22  . ASN B 2 409 ? -39.393 9.229  26.212 1.00 0.00  ? 409  ASN B HD22  1 
ATOM   4685 N  N     . PRO B 2 410 ? -38.010 4.949  24.730 1.00 73.48 ? 410  PRO B N     1 
ATOM   4686 C  CA    . PRO B 2 410 ? -38.626 4.428  23.497 1.00 71.33 ? 410  PRO B CA    1 
ATOM   4687 C  C     . PRO B 2 410 ? -39.693 5.331  22.850 1.00 68.19 ? 410  PRO B C     1 
ATOM   4688 O  O     . PRO B 2 410 ? -40.361 4.949  21.896 1.00 64.73 ? 410  PRO B O     1 
ATOM   4689 C  CB    . PRO B 2 410 ? -39.214 3.098  23.960 1.00 70.58 ? 410  PRO B CB    1 
ATOM   4690 C  CG    . PRO B 2 410 ? -39.527 3.358  25.409 1.00 70.87 ? 410  PRO B CG    1 
ATOM   4691 C  CD    . PRO B 2 410 ? -38.269 4.028  25.851 1.00 71.05 ? 410  PRO B CD    1 
ATOM   4692 N  N     . THR B 2 411 ? -39.841 6.536  23.367 1.00 65.76 ? 411  THR B N     1 
ATOM   4693 C  CA    . THR B 2 411 ? -40.812 7.462  22.828 1.00 67.13 ? 411  THR B CA    1 
ATOM   4694 C  C     . THR B 2 411 ? -40.144 8.520  21.938 1.00 65.75 ? 411  THR B C     1 
ATOM   4695 O  O     . THR B 2 411 ? -40.810 9.163  21.131 1.00 66.81 ? 411  THR B O     1 
ATOM   4696 C  CB    . THR B 2 411 ? -41.550 8.164  23.981 1.00 69.49 ? 411  THR B CB    1 
ATOM   4697 O  OG1   . THR B 2 411 ? -41.990 7.180  24.930 1.00 71.72 ? 411  THR B OG1   1 
ATOM   4698 C  CG2   . THR B 2 411 ? -42.753 8.950  23.465 1.00 69.79 ? 411  THR B CG2   1 
ATOM   4699 H  H     . THR B 2 411 ? -39.304 6.821  24.123 1.00 0.00  ? 411  THR B H     1 
ATOM   4700 H  HG1   . THR B 2 411 ? -41.348 6.476  25.062 1.00 0.00  ? 411  THR B HG1   1 
ATOM   4701 N  N     . LEU B 2 412 ? -38.820 8.646  22.038 1.00 64.20 ? 412  LEU B N     1 
ATOM   4702 C  CA    . LEU B 2 412 ? -38.060 9.648  21.278 1.00 60.87 ? 412  LEU B CA    1 
ATOM   4703 C  C     . LEU B 2 412 ? -38.490 11.071 21.661 1.00 58.14 ? 412  LEU B C     1 
ATOM   4704 O  O     . LEU B 2 412 ? -39.043 11.810 20.841 1.00 55.94 ? 412  LEU B O     1 
ATOM   4705 C  CB    . LEU B 2 412 ? -38.224 9.451  19.770 1.00 61.66 ? 412  LEU B CB    1 
ATOM   4706 C  CG    . LEU B 2 412 ? -37.781 8.128  19.159 1.00 64.36 ? 412  LEU B CG    1 
ATOM   4707 C  CD1   . LEU B 2 412 ? -38.996 7.203  19.096 1.00 65.78 ? 412  LEU B CD1   1 
ATOM   4708 C  CD2   . LEU B 2 412 ? -37.201 8.353  17.751 1.00 64.19 ? 412  LEU B CD2   1 
ATOM   4709 H  H     . LEU B 2 412 ? -38.306 8.032  22.598 1.00 0.00  ? 412  LEU B H     1 
ATOM   4710 N  N     . PRO B 2 413 ? -38.267 11.460 22.929 1.00 55.88 ? 413  PRO B N     1 
ATOM   4711 C  CA    . PRO B 2 413 ? -38.638 12.793 23.415 1.00 55.59 ? 413  PRO B CA    1 
ATOM   4712 C  C     . PRO B 2 413 ? -37.806 13.913 22.787 1.00 54.86 ? 413  PRO B C     1 
ATOM   4713 O  O     . PRO B 2 413 ? -36.731 13.672 22.200 1.00 56.26 ? 413  PRO B O     1 
ATOM   4714 C  CB    . PRO B 2 413 ? -38.372 12.702 24.926 1.00 54.19 ? 413  PRO B CB    1 
ATOM   4715 C  CG    . PRO B 2 413 ? -38.420 11.229 25.210 1.00 55.68 ? 413  PRO B CG    1 
ATOM   4716 C  CD    . PRO B 2 413 ? -37.697 10.662 24.023 1.00 55.39 ? 413  PRO B CD    1 
ATOM   4717 N  N     . ARG B 2 414 ? -38.307 15.136 22.926 1.00 49.12 ? 414  ARG B N     1 
ATOM   4718 C  CA    . ARG B 2 414 ? -37.633 16.311 22.404 1.00 44.61 ? 414  ARG B CA    1 
ATOM   4719 C  C     . ARG B 2 414 ? -37.648 17.384 23.495 1.00 45.43 ? 414  ARG B C     1 
ATOM   4720 O  O     . ARG B 2 414 ? -38.701 17.650 24.116 1.00 41.03 ? 414  ARG B O     1 
ATOM   4721 C  CB    . ARG B 2 414 ? -38.301 16.771 21.114 1.00 42.71 ? 414  ARG B CB    1 
ATOM   4722 C  CG    . ARG B 2 414 ? -38.021 15.828 19.943 1.00 38.57 ? 414  ARG B CG    1 
ATOM   4723 C  CD    . ARG B 2 414 ? -38.924 16.127 18.758 1.00 45.47 ? 414  ARG B CD    1 
ATOM   4724 N  NE    . ARG B 2 414 ? -38.656 17.443 18.185 1.00 51.40 ? 414  ARG B NE    1 
ATOM   4725 C  CZ    . ARG B 2 414 ? -37.856 17.655 17.143 1.00 53.27 ? 414  ARG B CZ    1 
ATOM   4726 N  NH1   . ARG B 2 414 ? -37.277 16.628 16.527 1.00 52.43 ? 414  ARG B NH1   1 
ATOM   4727 N  NH2   . ARG B 2 414 ? -37.659 18.893 16.698 1.00 54.69 ? 414  ARG B NH2   1 
ATOM   4728 H  H     . ARG B 2 414 ? -39.152 15.263 23.401 1.00 0.00  ? 414  ARG B H     1 
ATOM   4729 H  HE    . ARG B 2 414 ? -39.087 18.220 18.597 1.00 0.00  ? 414  ARG B HE    1 
ATOM   4730 H  HH11  . ARG B 2 414 ? -37.435 15.691 16.840 1.00 0.00  ? 414  ARG B HH11  1 
ATOM   4731 H  HH12  . ARG B 2 414 ? -36.672 16.795 15.749 1.00 0.00  ? 414  ARG B HH12  1 
ATOM   4732 H  HH21  . ARG B 2 414 ? -38.103 19.671 17.141 1.00 0.00  ? 414  ARG B HH21  1 
ATOM   4733 H  HH22  . ARG B 2 414 ? -37.050 19.058 15.922 1.00 0.00  ? 414  ARG B HH22  1 
ATOM   4734 N  N     . VAL B 2 415 ? -36.448 17.871 23.831 1.00 38.63 ? 415  VAL B N     1 
ATOM   4735 C  CA    . VAL B 2 415 ? -36.277 18.879 24.875 1.00 34.75 ? 415  VAL B CA    1 
ATOM   4736 C  C     . VAL B 2 415 ? -35.705 20.134 24.239 1.00 36.02 ? 415  VAL B C     1 
ATOM   4737 O  O     . VAL B 2 415 ? -34.839 20.054 23.349 1.00 38.30 ? 415  VAL B O     1 
ATOM   4738 C  CB    . VAL B 2 415 ? -35.308 18.400 26.005 1.00 34.18 ? 415  VAL B CB    1 
ATOM   4739 C  CG1   . VAL B 2 415 ? -35.268 19.409 27.150 1.00 30.38 ? 415  VAL B CG1   1 
ATOM   4740 C  CG2   . VAL B 2 415 ? -35.736 17.057 26.543 1.00 35.52 ? 415  VAL B CG2   1 
ATOM   4741 H  H     . VAL B 2 415 ? -35.653 17.541 23.357 1.00 0.00  ? 415  VAL B H     1 
ATOM   4742 N  N     . GLY B 2 416 ? -36.192 21.289 24.681 1.00 28.73 ? 416  GLY B N     1 
ATOM   4743 C  CA    . GLY B 2 416 ? -35.703 22.527 24.128 1.00 25.20 ? 416  GLY B CA    1 
ATOM   4744 C  C     . GLY B 2 416 ? -35.327 23.533 25.183 1.00 25.43 ? 416  GLY B C     1 
ATOM   4745 O  O     . GLY B 2 416 ? -35.453 23.288 26.373 1.00 26.50 ? 416  GLY B O     1 
ATOM   4746 H  H     . GLY B 2 416 ? -36.831 21.304 25.409 1.00 0.00  ? 416  GLY B H     1 
ATOM   4747 N  N     . ALA B 2 417 ? -34.839 24.670 24.722 1.00 27.63 ? 417  ALA B N     1 
ATOM   4748 C  CA    . ALA B 2 417 ? -34.462 25.766 25.585 1.00 30.12 ? 417  ALA B CA    1 
ATOM   4749 C  C     . ALA B 2 417 ? -35.220 26.927 24.967 1.00 31.85 ? 417  ALA B C     1 
ATOM   4750 O  O     . ALA B 2 417 ? -34.946 27.325 23.836 1.00 33.02 ? 417  ALA B O     1 
ATOM   4751 C  CB    . ALA B 2 417 ? -32.974 26.017 25.505 1.00 31.94 ? 417  ALA B CB    1 
ATOM   4752 H  H     . ALA B 2 417 ? -34.759 24.813 23.759 1.00 0.00  ? 417  ALA B H     1 
ATOM   4753 N  N     . SER B 2 418 ? -36.224 27.421 25.668 1.00 30.97 ? 418  SER B N     1 
ATOM   4754 C  CA    . SER B 2 418 ? -36.992 28.527 25.130 1.00 32.86 ? 418  SER B CA    1 
ATOM   4755 C  C     . SER B 2 418 ? -36.185 29.820 25.319 1.00 32.40 ? 418  SER B C     1 
ATOM   4756 O  O     . SER B 2 418 ? -36.240 30.746 24.492 1.00 28.58 ? 418  SER B O     1 
ATOM   4757 C  CB    . SER B 2 418 ? -38.391 28.599 25.780 1.00 31.12 ? 418  SER B CB    1 
ATOM   4758 O  OG    . SER B 2 418 ? -38.358 28.526 27.200 1.00 28.33 ? 418  SER B OG    1 
ATOM   4759 H  H     . SER B 2 418 ? -36.420 27.054 26.551 1.00 0.00  ? 418  SER B H     1 
ATOM   4760 H  HG    . SER B 2 418 ? -38.234 27.599 27.413 1.00 0.00  ? 418  SER B HG    1 
ATOM   4761 N  N     . LYS B 2 419 ? -35.345 29.823 26.345 1.00 25.63 ? 419  LYS B N     1 
ATOM   4762 C  CA    . LYS B 2 419 ? -34.552 30.985 26.622 1.00 25.93 ? 419  LYS B CA    1 
ATOM   4763 C  C     . LYS B 2 419 ? -33.368 30.603 27.444 1.00 26.38 ? 419  LYS B C     1 
ATOM   4764 O  O     . LYS B 2 419 ? -33.482 29.795 28.383 1.00 20.46 ? 419  LYS B O     1 
ATOM   4765 C  CB    . LYS B 2 419 ? -35.357 31.999 27.430 1.00 32.76 ? 419  LYS B CB    1 
ATOM   4766 C  CG    . LYS B 2 419 ? -34.760 33.391 27.442 1.00 32.89 ? 419  LYS B CG    1 
ATOM   4767 C  CD    . LYS B 2 419 ? -35.384 34.227 28.536 1.00 35.54 ? 419  LYS B CD    1 
ATOM   4768 C  CE    . LYS B 2 419 ? -35.349 35.703 28.179 1.00 31.64 ? 419  LYS B CE    1 
ATOM   4769 N  NZ    . LYS B 2 419 ? -35.986 36.502 29.271 1.00 34.46 ? 419  LYS B NZ    1 
ATOM   4770 H  H     . LYS B 2 419 ? -35.252 29.040 26.919 1.00 0.00  ? 419  LYS B H     1 
ATOM   4771 H  HZ1   . LYS B 2 419 ? -36.973 36.207 29.405 1.00 0.00  ? 419  LYS B HZ1   1 
ATOM   4772 H  HZ2   . LYS B 2 419 ? -35.447 36.365 30.148 1.00 0.00  ? 419  LYS B HZ2   1 
ATOM   4773 H  HZ3   . LYS B 2 419 ? -35.949 37.505 28.996 1.00 0.00  ? 419  LYS B HZ3   1 
ATOM   4774 N  N     . ILE B 2 420 ? -32.248 31.227 27.075 1.00 24.18 ? 420  ILE B N     1 
ATOM   4775 C  CA    . ILE B 2 420 ? -30.946 31.101 27.712 1.00 18.82 ? 420  ILE B CA    1 
ATOM   4776 C  C     . ILE B 2 420 ? -30.413 32.527 27.912 1.00 18.29 ? 420  ILE B C     1 
ATOM   4777 O  O     . ILE B 2 420 ? -30.445 33.361 27.015 1.00 19.42 ? 420  ILE B O     1 
ATOM   4778 C  CB    . ILE B 2 420 ? -29.938 30.340 26.826 1.00 18.47 ? 420  ILE B CB    1 
ATOM   4779 C  CG1   . ILE B 2 420 ? -30.323 28.864 26.725 1.00 19.25 ? 420  ILE B CG1   1 
ATOM   4780 C  CG2   . ILE B 2 420 ? -28.520 30.495 27.368 1.00 15.14 ? 420  ILE B CG2   1 
ATOM   4781 C  CD1   . ILE B 2 420 ? -29.525 28.109 25.658 1.00 19.46 ? 420  ILE B CD1   1 
ATOM   4782 H  H     . ILE B 2 420 ? -32.312 31.839 26.311 1.00 0.00  ? 420  ILE B H     1 
ATOM   4783 N  N     . ILE B 2 421 ? -29.984 32.816 29.120 1.00 21.94 ? 421  ILE B N     1 
ATOM   4784 C  CA    . ILE B 2 421 ? -29.424 34.111 29.428 1.00 22.47 ? 421  ILE B CA    1 
ATOM   4785 C  C     . ILE B 2 421 ? -27.978 33.899 29.870 1.00 19.54 ? 421  ILE B C     1 
ATOM   4786 O  O     . ILE B 2 421 ? -27.720 33.148 30.814 1.00 15.19 ? 421  ILE B O     1 
ATOM   4787 C  CB    . ILE B 2 421 ? -30.171 34.811 30.583 1.00 23.86 ? 421  ILE B CB    1 
ATOM   4788 C  CG1   . ILE B 2 421 ? -31.650 34.967 30.259 1.00 27.24 ? 421  ILE B CG1   1 
ATOM   4789 C  CG2   . ILE B 2 421 ? -29.609 36.188 30.780 1.00 27.57 ? 421  ILE B CG2   1 
ATOM   4790 C  CD1   . ILE B 2 421 ? -32.407 35.685 31.328 1.00 27.13 ? 421  ILE B CD1   1 
ATOM   4791 H  H     . ILE B 2 421 ? -30.057 32.144 29.827 1.00 0.00  ? 421  ILE B H     1 
ATOM   4792 N  N     . VAL B 2 422 ? -27.049 34.484 29.119 1.00 19.63 ? 422  VAL B N     1 
ATOM   4793 C  CA    . VAL B 2 422 ? -25.630 34.440 29.440 1.00 21.16 ? 422  VAL B CA    1 
ATOM   4794 C  C     . VAL B 2 422 ? -25.295 35.771 30.153 1.00 24.96 ? 422  VAL B C     1 
ATOM   4795 O  O     . VAL B 2 422 ? -25.704 36.849 29.702 1.00 24.79 ? 422  VAL B O     1 
ATOM   4796 C  CB    . VAL B 2 422 ? -24.763 34.364 28.175 1.00 15.72 ? 422  VAL B CB    1 
ATOM   4797 C  CG1   . VAL B 2 422 ? -23.334 34.174 28.545 1.00 14.05 ? 422  VAL B CG1   1 
ATOM   4798 C  CG2   . VAL B 2 422 ? -25.192 33.248 27.315 1.00 17.30 ? 422  VAL B CG2   1 
ATOM   4799 H  H     . VAL B 2 422 ? -27.338 35.008 28.343 1.00 0.00  ? 422  VAL B H     1 
ATOM   4800 N  N     . GLU B 2 423 ? -24.613 35.689 31.288 1.00 25.76 ? 423  GLU B N     1 
ATOM   4801 C  CA    . GLU B 2 423 ? -24.190 36.880 32.019 1.00 28.06 ? 423  GLU B CA    1 
ATOM   4802 C  C     . GLU B 2 423 ? -22.656 36.820 32.220 1.00 26.92 ? 423  GLU B C     1 
ATOM   4803 O  O     . GLU B 2 423 ? -22.113 35.875 32.811 1.00 23.36 ? 423  GLU B O     1 
ATOM   4804 C  CB    . GLU B 2 423 ? -24.918 36.992 33.367 1.00 27.11 ? 423  GLU B CB    1 
ATOM   4805 C  CG    . GLU B 2 423 ? -24.745 38.350 34.026 1.00 27.63 ? 423  GLU B CG    1 
ATOM   4806 C  CD    . GLU B 2 423 ? -25.233 38.409 35.465 1.00 32.66 ? 423  GLU B CD    1 
ATOM   4807 O  OE1   . GLU B 2 423 ? -25.115 37.409 36.210 1.00 34.07 ? 423  GLU B OE1   1 
ATOM   4808 O  OE2   . GLU B 2 423 ? -25.713 39.485 35.868 1.00 38.82 ? 423  GLU B OE2   1 
ATOM   4809 H  H     . GLU B 2 423 ? -24.370 34.813 31.638 1.00 0.00  ? 423  GLU B H     1 
ATOM   4810 N  N     . THR B 2 424 ? -21.957 37.821 31.703 1.00 26.49 ? 424  THR B N     1 
ATOM   4811 C  CA    . THR B 2 424 ? -20.503 37.876 31.805 1.00 25.09 ? 424  THR B CA    1 
ATOM   4812 C  C     . THR B 2 424 ? -20.049 38.386 33.186 1.00 25.69 ? 424  THR B C     1 
ATOM   4813 O  O     . THR B 2 424 ? -20.851 38.950 33.927 1.00 28.00 ? 424  THR B O     1 
ATOM   4814 C  CB    . THR B 2 424 ? -19.934 38.707 30.635 1.00 23.83 ? 424  THR B CB    1 
ATOM   4815 O  OG1   . THR B 2 424 ? -20.434 40.039 30.711 1.00 27.35 ? 424  THR B OG1   1 
ATOM   4816 C  CG2   . THR B 2 424 ? -20.405 38.120 29.301 1.00 19.44 ? 424  THR B CG2   1 
ATOM   4817 H  H     . THR B 2 424 ? -22.419 38.542 31.244 1.00 0.00  ? 424  THR B H     1 
ATOM   4818 H  HG1   . THR B 2 424 ? -20.105 40.495 31.477 1.00 0.00  ? 424  THR B HG1   1 
ATOM   4819 N  N     . ASN B 2 425 ? -18.775 38.197 33.539 1.00 26.29 ? 425  ASN B N     1 
ATOM   4820 C  CA    . ASN B 2 425 ? -18.277 38.617 34.863 1.00 23.46 ? 425  ASN B CA    1 
ATOM   4821 C  C     . ASN B 2 425 ? -18.451 40.076 35.249 1.00 23.27 ? 425  ASN B C     1 
ATOM   4822 O  O     . ASN B 2 425 ? -18.597 40.390 36.425 1.00 17.99 ? 425  ASN B O     1 
ATOM   4823 C  CB    . ASN B 2 425 ? -16.839 38.127 35.144 1.00 25.38 ? 425  ASN B CB    1 
ATOM   4824 C  CG    . ASN B 2 425 ? -15.819 38.554 34.086 1.00 26.74 ? 425  ASN B CG    1 
ATOM   4825 O  OD1   . ASN B 2 425 ? -14.607 38.403 34.280 1.00 24.30 ? 425  ASN B OD1   1 
ATOM   4826 N  ND2   . ASN B 2 425 ? -16.293 39.064 32.964 1.00 29.15 ? 425  ASN B ND2   1 
ATOM   4827 H  H     . ASN B 2 425 ? -18.183 37.715 32.926 1.00 0.00  ? 425  ASN B H     1 
ATOM   4828 H  HD21  . ASN B 2 425 ? -15.578 39.316 32.345 1.00 0.00  ? 425  ASN B HD21  1 
ATOM   4829 H  HD22  . ASN B 2 425 ? -17.228 39.163 32.752 1.00 0.00  ? 425  ASN B HD22  1 
ATOM   4830 N  N     . VAL B 2 426 ? -18.486 40.965 34.261 1.00 23.95 ? 426  VAL B N     1 
ATOM   4831 C  CA    . VAL B 2 426 ? -18.683 42.386 34.535 1.00 23.34 ? 426  VAL B CA    1 
ATOM   4832 C  C     . VAL B 2 426 ? -20.187 42.738 34.561 1.00 28.30 ? 426  VAL B C     1 
ATOM   4833 O  O     . VAL B 2 426 ? -20.534 43.914 34.570 1.00 31.36 ? 426  VAL B O     1 
ATOM   4834 C  CB    . VAL B 2 426 ? -17.963 43.295 33.503 1.00 19.08 ? 426  VAL B CB    1 
ATOM   4835 C  CG1   . VAL B 2 426 ? -16.504 43.049 33.520 1.00 20.43 ? 426  VAL B CG1   1 
ATOM   4836 C  CG2   . VAL B 2 426 ? -18.504 43.058 32.106 1.00 22.77 ? 426  VAL B CG2   1 
ATOM   4837 H  H     . VAL B 2 426 ? -18.370 40.671 33.344 1.00 0.00  ? 426  VAL B H     1 
ATOM   4838 N  N     . GLY B 2 427 ? -21.062 41.728 34.523 1.00 22.54 ? 427  GLY B N     1 
ATOM   4839 C  CA    . GLY B 2 427 ? -22.490 41.968 34.583 1.00 22.59 ? 427  GLY B CA    1 
ATOM   4840 C  C     . GLY B 2 427 ? -23.258 42.206 33.290 1.00 28.49 ? 427  GLY B C     1 
ATOM   4841 O  O     . GLY B 2 427 ? -24.395 42.687 33.319 1.00 25.48 ? 427  GLY B O     1 
ATOM   4842 H  H     . GLY B 2 427 ? -20.764 40.802 34.497 1.00 0.00  ? 427  GLY B H     1 
ATOM   4843 N  N     . LYS B 2 428 ? -22.670 41.876 32.146 1.00 29.55 ? 428  LYS B N     1 
ATOM   4844 C  CA    . LYS B 2 428 ? -23.360 42.071 30.876 1.00 26.93 ? 428  LYS B CA    1 
ATOM   4845 C  C     . LYS B 2 428 ? -24.212 40.833 30.573 1.00 26.91 ? 428  LYS B C     1 
ATOM   4846 O  O     . LYS B 2 428 ? -23.714 39.718 30.660 1.00 29.88 ? 428  LYS B O     1 
ATOM   4847 C  CB    . LYS B 2 428 ? -22.325 42.273 29.795 1.00 30.68 ? 428  LYS B CB    1 
ATOM   4848 C  CG    . LYS B 2 428 ? -22.517 43.468 28.897 1.00 35.27 ? 428  LYS B CG    1 
ATOM   4849 C  CD    . LYS B 2 428 ? -21.197 43.704 28.176 1.00 38.96 ? 428  LYS B CD    1 
ATOM   4850 C  CE    . LYS B 2 428 ? -21.356 44.306 26.791 1.00 43.96 ? 428  LYS B CE    1 
ATOM   4851 N  NZ    . LYS B 2 428 ? -20.152 43.966 25.940 1.00 44.79 ? 428  LYS B NZ    1 
ATOM   4852 H  H     . LYS B 2 428 ? -21.779 41.485 32.141 1.00 0.00  ? 428  LYS B H     1 
ATOM   4853 H  HZ1   . LYS B 2 428 ? -20.073 42.931 25.884 1.00 0.00  ? 428  LYS B HZ1   1 
ATOM   4854 H  HZ2   . LYS B 2 428 ? -20.267 44.358 24.985 1.00 0.00  ? 428  LYS B HZ2   1 
ATOM   4855 H  HZ3   . LYS B 2 428 ? -19.294 44.367 26.373 1.00 0.00  ? 428  LYS B HZ3   1 
ATOM   4856 N  N     . GLN B 2 429 ? -25.489 41.037 30.234 1.00 27.33 ? 429  GLN B N     1 
ATOM   4857 C  CA    . GLN B 2 429 ? -26.449 39.959 29.921 1.00 20.27 ? 429  GLN B CA    1 
ATOM   4858 C  C     . GLN B 2 429 ? -26.889 39.909 28.483 1.00 17.73 ? 429  GLN B C     1 
ATOM   4859 O  O     . GLN B 2 429 ? -27.141 40.942 27.879 1.00 26.05 ? 429  GLN B O     1 
ATOM   4860 C  CB    . GLN B 2 429 ? -27.680 40.107 30.785 1.00 16.96 ? 429  GLN B CB    1 
ATOM   4861 C  CG    . GLN B 2 429 ? -27.327 39.824 32.184 1.00 28.86 ? 429  GLN B CG    1 
ATOM   4862 C  CD    . GLN B 2 429 ? -28.411 40.150 33.147 1.00 36.37 ? 429  GLN B CD    1 
ATOM   4863 O  OE1   . GLN B 2 429 ? -28.163 40.819 34.157 1.00 40.36 ? 429  GLN B OE1   1 
ATOM   4864 N  NE2   . GLN B 2 429 ? -29.619 39.645 32.888 1.00 38.06 ? 429  GLN B NE2   1 
ATOM   4865 H  H     . GLN B 2 429 ? -25.794 41.966 30.154 1.00 0.00  ? 429  GLN B H     1 
ATOM   4866 H  HE21  . GLN B 2 429 ? -30.335 39.874 33.512 1.00 0.00  ? 429  GLN B HE21  1 
ATOM   4867 H  HE22  . GLN B 2 429 ? -29.751 39.072 32.104 1.00 0.00  ? 429  GLN B HE22  1 
ATOM   4868 N  N     . PHE B 2 430 ? -26.973 38.716 27.922 1.00 16.27 ? 430  PHE B N     1 
ATOM   4869 C  CA    . PHE B 2 430 ? -27.400 38.560 26.531 1.00 18.89 ? 430  PHE B CA    1 
ATOM   4870 C  C     . PHE B 2 430 ? -28.507 37.559 26.634 1.00 24.20 ? 430  PHE B C     1 
ATOM   4871 O  O     . PHE B 2 430 ? -28.465 36.706 27.528 1.00 28.03 ? 430  PHE B O     1 
ATOM   4872 C  CB    . PHE B 2 430 ? -26.270 38.012 25.664 1.00 20.98 ? 430  PHE B CB    1 
ATOM   4873 C  CG    . PHE B 2 430 ? -25.049 38.883 25.640 1.00 20.01 ? 430  PHE B CG    1 
ATOM   4874 C  CD1   . PHE B 2 430 ? -24.073 38.761 26.626 1.00 23.40 ? 430  PHE B CD1   1 
ATOM   4875 C  CD2   . PHE B 2 430 ? -24.890 39.850 24.656 1.00 20.02 ? 430  PHE B CD2   1 
ATOM   4876 C  CE1   . PHE B 2 430 ? -22.943 39.601 26.637 1.00 24.61 ? 430  PHE B CE1   1 
ATOM   4877 C  CE2   . PHE B 2 430 ? -23.774 40.696 24.648 1.00 23.12 ? 430  PHE B CE2   1 
ATOM   4878 C  CZ    . PHE B 2 430 ? -22.791 40.574 25.646 1.00 24.73 ? 430  PHE B CZ    1 
ATOM   4879 H  H     . PHE B 2 430 ? -26.751 37.902 28.433 1.00 0.00  ? 430  PHE B H     1 
ATOM   4880 N  N     . ASN B 2 431 ? -29.545 37.703 25.813 1.00 27.51 ? 431  ASN B N     1 
ATOM   4881 C  CA    . ASN B 2 431 ? -30.677 36.773 25.881 1.00 24.45 ? 431  ASN B CA    1 
ATOM   4882 C  C     . ASN B 2 431 ? -30.804 36.038 24.584 1.00 25.12 ? 431  ASN B C     1 
ATOM   4883 O  O     . ASN B 2 431 ? -30.544 36.608 23.519 1.00 26.72 ? 431  ASN B O     1 
ATOM   4884 C  CB    . ASN B 2 431 ? -31.987 37.497 26.182 1.00 26.80 ? 431  ASN B CB    1 
ATOM   4885 C  CG    . ASN B 2 431 ? -32.017 38.102 27.570 1.00 30.22 ? 431  ASN B CG    1 
ATOM   4886 O  OD1   . ASN B 2 431 ? -31.003 38.195 28.260 1.00 34.50 ? 431  ASN B OD1   1 
ATOM   4887 N  ND2   . ASN B 2 431 ? -33.183 38.526 27.985 1.00 32.51 ? 431  ASN B ND2   1 
ATOM   4888 H  H     . ASN B 2 431 ? -29.571 38.412 25.134 1.00 0.00  ? 431  ASN B H     1 
ATOM   4889 H  HD21  . ASN B 2 431 ? -33.256 38.899 28.881 1.00 0.00  ? 431  ASN B HD21  1 
ATOM   4890 H  HD22  . ASN B 2 431 ? -33.928 38.436 27.348 1.00 0.00  ? 431  ASN B HD22  1 
ATOM   4891 N  N     . PHE B 2 432 ? -31.118 34.750 24.670 1.00 23.75 ? 432  PHE B N     1 
ATOM   4892 C  CA    . PHE B 2 432 ? -31.292 33.936 23.475 1.00 23.27 ? 432  PHE B CA    1 
ATOM   4893 C  C     . PHE B 2 432 ? -32.614 33.221 23.535 1.00 24.03 ? 432  PHE B C     1 
ATOM   4894 O  O     . PHE B 2 432 ? -33.117 32.899 24.617 1.00 25.69 ? 432  PHE B O     1 
ATOM   4895 C  CB    . PHE B 2 432 ? -30.111 33.009 23.274 1.00 18.47 ? 432  PHE B CB    1 
ATOM   4896 C  CG    . PHE B 2 432 ? -28.829 33.753 23.146 1.00 20.88 ? 432  PHE B CG    1 
ATOM   4897 C  CD1   . PHE B 2 432 ? -28.139 34.173 24.290 1.00 19.53 ? 432  PHE B CD1   1 
ATOM   4898 C  CD2   . PHE B 2 432 ? -28.372 34.167 21.888 1.00 20.03 ? 432  PHE B CD2   1 
ATOM   4899 C  CE1   . PHE B 2 432 ? -27.011 35.011 24.178 1.00 20.40 ? 432  PHE B CE1   1 
ATOM   4900 C  CE2   . PHE B 2 432 ? -27.254 35.005 21.763 1.00 17.16 ? 432  PHE B CE2   1 
ATOM   4901 C  CZ    . PHE B 2 432 ? -26.574 35.428 22.908 1.00 17.87 ? 432  PHE B CZ    1 
ATOM   4902 H  H     . PHE B 2 432 ? -31.251 34.334 25.544 1.00 0.00  ? 432  PHE B H     1 
ATOM   4903 N  N     . CYS B 2 433 ? -33.220 33.040 22.372 1.00 26.92 ? 433  CYS B N     1 
ATOM   4904 C  CA    . CYS B 2 433 ? -34.520 32.405 22.328 1.00 24.93 ? 433  CYS B CA    1 
ATOM   4905 C  C     . CYS B 2 433 ? -34.594 31.323 21.293 1.00 23.33 ? 433  CYS B C     1 
ATOM   4906 O  O     . CYS B 2 433 ? -33.827 31.347 20.336 1.00 24.20 ? 433  CYS B O     1 
ATOM   4907 C  CB    . CYS B 2 433 ? -35.572 33.453 21.965 1.00 29.86 ? 433  CYS B CB    1 
ATOM   4908 S  SG    . CYS B 2 433 ? -35.893 34.741 23.199 1.00 30.50 ? 433  CYS B SG    1 
ATOM   4909 H  H     . CYS B 2 433 ? -32.788 33.345 21.544 1.00 0.00  ? 433  CYS B H     1 
ATOM   4910 N  N     . SER B 2 434 ? -35.483 30.357 21.525 1.00 26.33 ? 434  SER B N     1 
ATOM   4911 C  CA    . SER B 2 434 ? -35.784 29.290 20.566 1.00 29.04 ? 434  SER B CA    1 
ATOM   4912 C  C     . SER B 2 434 ? -37.153 28.715 20.881 1.00 30.34 ? 434  SER B C     1 
ATOM   4913 O  O     . SER B 2 434 ? -37.578 28.738 22.041 1.00 28.78 ? 434  SER B O     1 
ATOM   4914 C  CB    . SER B 2 434 ? -34.776 28.151 20.562 1.00 31.16 ? 434  SER B CB    1 
ATOM   4915 O  OG    . SER B 2 434 ? -35.178 27.183 19.591 1.00 28.23 ? 434  SER B OG    1 
ATOM   4916 H  H     . SER B 2 434 ? -35.976 30.310 22.375 1.00 0.00  ? 434  SER B H     1 
ATOM   4917 H  HG    . SER B 2 434 ? -34.613 27.255 18.803 1.00 0.00  ? 434  SER B HG    1 
ATOM   4918 N  N     . PRO B 2 435 ? -37.928 28.361 19.830 1.00 33.16 ? 435  PRO B N     1 
ATOM   4919 C  CA    . PRO B 2 435 ? -39.274 27.776 19.953 1.00 30.06 ? 435  PRO B CA    1 
ATOM   4920 C  C     . PRO B 2 435 ? -39.203 26.302 19.566 1.00 32.19 ? 435  PRO B C     1 
ATOM   4921 O  O     . PRO B 2 435 ? -40.175 25.561 19.679 1.00 37.10 ? 435  PRO B O     1 
ATOM   4922 C  CB    . PRO B 2 435 ? -40.061 28.549 18.912 1.00 26.65 ? 435  PRO B CB    1 
ATOM   4923 C  CG    . PRO B 2 435 ? -39.082 28.646 17.782 1.00 29.21 ? 435  PRO B CG    1 
ATOM   4924 C  CD    . PRO B 2 435 ? -37.721 28.890 18.461 1.00 30.28 ? 435  PRO B CD    1 
ATOM   4925 N  N     . GLU B 2 436 ? -38.045 25.913 19.056 1.00 34.75 ? 436  GLU B N     1 
ATOM   4926 C  CA    . GLU B 2 436 ? -37.789 24.570 18.591 1.00 37.45 ? 436  GLU B CA    1 
ATOM   4927 C  C     . GLU B 2 436 ? -37.464 23.613 19.755 1.00 36.82 ? 436  GLU B C     1 
ATOM   4928 O  O     . GLU B 2 436 ? -37.367 24.040 20.910 1.00 38.23 ? 436  GLU B O     1 
ATOM   4929 C  CB    . GLU B 2 436 ? -36.619 24.655 17.611 1.00 39.41 ? 436  GLU B CB    1 
ATOM   4930 C  CG    . GLU B 2 436 ? -36.879 24.038 16.261 1.00 54.57 ? 436  GLU B CG    1 
ATOM   4931 C  CD    . GLU B 2 436 ? -36.076 22.756 16.027 1.00 62.14 ? 436  GLU B CD    1 
ATOM   4932 O  OE1   . GLU B 2 436 ? -34.824 22.801 16.125 1.00 65.65 ? 436  GLU B OE1   1 
ATOM   4933 O  OE2   . GLU B 2 436 ? -36.698 21.705 15.732 1.00 66.44 ? 436  GLU B OE2   1 
ATOM   4934 H  H     . GLU B 2 436 ? -37.293 26.536 19.019 1.00 0.00  ? 436  GLU B H     1 
ATOM   4935 N  N     . THR B 2 437 ? -37.425 22.315 19.461 1.00 33.55 ? 437  THR B N     1 
ATOM   4936 C  CA    . THR B 2 437 ? -37.045 21.288 20.429 1.00 34.60 ? 437  THR B CA    1 
ATOM   4937 C  C     . THR B 2 437 ? -36.189 20.337 19.652 1.00 37.55 ? 437  THR B C     1 
ATOM   4938 O  O     . THR B 2 437 ? -36.299 20.257 18.425 1.00 37.22 ? 437  THR B O     1 
ATOM   4939 C  CB    . THR B 2 437 ? -38.195 20.443 20.955 1.00 31.41 ? 437  THR B CB    1 
ATOM   4940 O  OG1   . THR B 2 437 ? -39.052 20.098 19.868 1.00 35.34 ? 437  THR B OG1   1 
ATOM   4941 C  CG2   . THR B 2 437 ? -38.946 21.158 22.052 1.00 32.50 ? 437  THR B CG2   1 
ATOM   4942 H  H     . THR B 2 437 ? -37.693 22.012 18.563 1.00 0.00  ? 437  THR B H     1 
ATOM   4943 H  HG1   . THR B 2 437 ? -39.454 20.890 19.480 1.00 0.00  ? 437  THR B HG1   1 
ATOM   4944 N  N     . VAL B 2 438 ? -35.379 19.570 20.369 1.00 40.33 ? 438  VAL B N     1 
ATOM   4945 C  CA    . VAL B 2 438 ? -34.493 18.622 19.718 1.00 41.03 ? 438  VAL B CA    1 
ATOM   4946 C  C     . VAL B 2 438 ? -34.396 17.243 20.387 1.00 42.81 ? 438  VAL B C     1 
ATOM   4947 O  O     . VAL B 2 438 ? -34.692 17.069 21.585 1.00 41.16 ? 438  VAL B O     1 
ATOM   4948 C  CB    . VAL B 2 438 ? -33.046 19.235 19.530 1.00 38.96 ? 438  VAL B CB    1 
ATOM   4949 C  CG1   . VAL B 2 438 ? -33.081 20.362 18.508 1.00 32.12 ? 438  VAL B CG1   1 
ATOM   4950 C  CG2   . VAL B 2 438 ? -32.493 19.750 20.868 1.00 35.05 ? 438  VAL B CG2   1 
ATOM   4951 H  H     . VAL B 2 438 ? -35.367 19.610 21.349 1.00 0.00  ? 438  VAL B H     1 
ATOM   4952 N  N     . ARG B 2 439 ? -34.070 16.256 19.558 1.00 43.47 ? 439  ARG B N     1 
ATOM   4953 C  CA    . ARG B 2 439 ? -33.860 14.892 20.001 1.00 44.98 ? 439  ARG B CA    1 
ATOM   4954 C  C     . ARG B 2 439 ? -32.541 14.999 20.758 1.00 45.33 ? 439  ARG B C     1 
ATOM   4955 O  O     . ARG B 2 439 ? -31.818 15.998 20.610 1.00 41.89 ? 439  ARG B O     1 
ATOM   4956 C  CB    . ARG B 2 439 ? -33.667 13.989 18.790 1.00 48.88 ? 439  ARG B CB    1 
ATOM   4957 C  CG    . ARG B 2 439 ? -34.873 13.905 17.880 1.00 59.81 ? 439  ARG B CG    1 
ATOM   4958 C  CD    . ARG B 2 439 ? -35.947 12.962 18.435 1.00 68.23 ? 439  ARG B CD    1 
ATOM   4959 N  NE    . ARG B 2 439 ? -35.513 11.566 18.394 1.00 74.17 ? 439  ARG B NE    1 
ATOM   4960 C  CZ    . ARG B 2 439 ? -35.235 10.834 19.470 1.00 78.65 ? 439  ARG B CZ    1 
ATOM   4961 N  NH1   . ARG B 2 439 ? -35.381 11.344 20.695 1.00 79.29 ? 439  ARG B NH1   1 
ATOM   4962 N  NH2   . ARG B 2 439 ? -34.835 9.576  19.318 1.00 80.13 ? 439  ARG B NH2   1 
ATOM   4963 H  H     . ARG B 2 439 ? -33.999 16.475 18.605 1.00 0.00  ? 439  ARG B H     1 
ATOM   4964 H  HE    . ARG B 2 439 ? -35.412 11.140 17.516 1.00 0.00  ? 439  ARG B HE    1 
ATOM   4965 H  HH11  . ARG B 2 439 ? -35.697 12.286 20.820 1.00 0.00  ? 439  ARG B HH11  1 
ATOM   4966 H  HH12  . ARG B 2 439 ? -35.172 10.783 21.497 1.00 0.00  ? 439  ARG B HH12  1 
ATOM   4967 H  HH21  . ARG B 2 439 ? -34.744 9.186  18.403 1.00 0.00  ? 439  ARG B HH21  1 
ATOM   4968 H  HH22  . ARG B 2 439 ? -34.631 9.021  20.125 1.00 0.00  ? 439  ARG B HH22  1 
ATOM   4969 N  N     . GLU B 2 440 ? -32.220 14.001 21.574 1.00 44.61 ? 440  GLU B N     1 
ATOM   4970 C  CA    . GLU B 2 440 ? -30.974 14.053 22.316 1.00 43.56 ? 440  GLU B CA    1 
ATOM   4971 C  C     . GLU B 2 440 ? -29.816 13.974 21.334 1.00 42.39 ? 440  GLU B C     1 
ATOM   4972 O  O     . GLU B 2 440 ? -29.944 13.373 20.266 1.00 38.17 ? 440  GLU B O     1 
ATOM   4973 C  CB    . GLU B 2 440 ? -30.884 12.921 23.335 1.00 48.18 ? 440  GLU B CB    1 
ATOM   4974 C  CG    . GLU B 2 440 ? -30.437 11.577 22.788 1.00 54.08 ? 440  GLU B CG    1 
ATOM   4975 C  CD    . GLU B 2 440 ? -29.413 10.896 23.700 1.00 60.03 ? 440  GLU B CD    1 
ATOM   4976 O  OE1   . GLU B 2 440 ? -29.771 10.512 24.841 1.00 64.69 ? 440  GLU B OE1   1 
ATOM   4977 O  OE2   . GLU B 2 440 ? -28.245 10.741 23.279 1.00 59.36 ? 440  GLU B OE2   1 
ATOM   4978 H  H     . GLU B 2 440 ? -32.815 13.234 21.663 1.00 0.00  ? 440  GLU B H     1 
ATOM   4979 N  N     . GLU B 2 441 ? -28.723 14.650 21.684 1.00 42.76 ? 441  GLU B N     1 
ATOM   4980 C  CA    . GLU B 2 441 ? -27.483 14.699 20.904 1.00 40.26 ? 441  GLU B CA    1 
ATOM   4981 C  C     . GLU B 2 441 ? -27.492 15.476 19.592 1.00 37.05 ? 441  GLU B C     1 
ATOM   4982 O  O     . GLU B 2 441 ? -26.673 15.244 18.705 1.00 40.45 ? 441  GLU B O     1 
ATOM   4983 C  CB    . GLU B 2 441 ? -26.887 13.300 20.763 1.00 37.97 ? 441  GLU B CB    1 
ATOM   4984 C  CG    . GLU B 2 441 ? -26.539 12.776 22.130 1.00 45.75 ? 441  GLU B CG    1 
ATOM   4985 C  CD    . GLU B 2 441 ? -25.597 11.606 22.131 1.00 51.03 ? 441  GLU B CD    1 
ATOM   4986 O  OE1   . GLU B 2 441 ? -25.524 10.903 21.102 1.00 57.89 ? 441  GLU B OE1   1 
ATOM   4987 O  OE2   . GLU B 2 441 ? -24.936 11.384 23.177 1.00 51.42 ? 441  GLU B OE2   1 
ATOM   4988 H  H     . GLU B 2 441 ? -28.747 15.167 22.517 1.00 0.00  ? 441  GLU B H     1 
ATOM   4989 N  N     . VAL B 2 442 ? -28.377 16.463 19.522 1.00 35.29 ? 442  VAL B N     1 
ATOM   4990 C  CA    . VAL B 2 442 ? -28.523 17.336 18.359 1.00 29.37 ? 442  VAL B CA    1 
ATOM   4991 C  C     . VAL B 2 442 ? -28.400 18.730 18.959 1.00 24.73 ? 442  VAL B C     1 
ATOM   4992 O  O     . VAL B 2 442 ? -29.029 19.012 19.988 1.00 24.91 ? 442  VAL B O     1 
ATOM   4993 C  CB    . VAL B 2 442 ? -29.955 17.196 17.750 1.00 31.57 ? 442  VAL B CB    1 
ATOM   4994 C  CG1   . VAL B 2 442 ? -30.182 18.212 16.649 1.00 31.02 ? 442  VAL B CG1   1 
ATOM   4995 C  CG2   . VAL B 2 442 ? -30.168 15.790 17.219 1.00 32.97 ? 442  VAL B CG2   1 
ATOM   4996 H  H     . VAL B 2 442 ? -28.963 16.632 20.291 1.00 0.00  ? 442  VAL B H     1 
ATOM   4997 N  N     . LEU B 2 443 ? -27.532 19.563 18.393 1.00 21.99 ? 443  LEU B N     1 
ATOM   4998 C  CA    . LEU B 2 443 ? -27.375 20.937 18.866 1.00 21.30 ? 443  LEU B CA    1 
ATOM   4999 C  C     . LEU B 2 443 ? -28.586 21.779 18.475 1.00 22.04 ? 443  LEU B C     1 
ATOM   5000 O  O     . LEU B 2 443 ? -29.016 21.776 17.311 1.00 21.37 ? 443  LEU B O     1 
ATOM   5001 C  CB    . LEU B 2 443 ? -26.150 21.619 18.264 1.00 22.50 ? 443  LEU B CB    1 
ATOM   5002 C  CG    . LEU B 2 443 ? -24.717 21.456 18.775 1.00 26.19 ? 443  LEU B CG    1 
ATOM   5003 C  CD1   . LEU B 2 443 ? -24.672 21.454 20.300 1.00 26.87 ? 443  LEU B CD1   1 
ATOM   5004 C  CD2   . LEU B 2 443 ? -24.118 20.195 18.201 1.00 29.13 ? 443  LEU B CD2   1 
ATOM   5005 H  H     . LEU B 2 443 ? -27.003 19.267 17.649 1.00 0.00  ? 443  LEU B H     1 
ATOM   5006 N  N     . LEU B 2 444 ? -29.136 22.489 19.451 1.00 22.51 ? 444  LEU B N     1 
ATOM   5007 C  CA    . LEU B 2 444 ? -30.270 23.389 19.232 1.00 24.50 ? 444  LEU B CA    1 
ATOM   5008 C  C     . LEU B 2 444 ? -29.605 24.753 19.185 1.00 24.85 ? 444  LEU B C     1 
ATOM   5009 O  O     . LEU B 2 444 ? -28.959 25.162 20.158 1.00 28.05 ? 444  LEU B O     1 
ATOM   5010 C  CB    . LEU B 2 444 ? -31.229 23.335 20.432 1.00 25.99 ? 444  LEU B CB    1 
ATOM   5011 C  CG    . LEU B 2 444 ? -32.675 23.846 20.342 1.00 28.53 ? 444  LEU B CG    1 
ATOM   5012 C  CD1   . LEU B 2 444 ? -32.889 24.938 21.360 1.00 25.87 ? 444  LEU B CD1   1 
ATOM   5013 C  CD2   . LEU B 2 444 ? -33.047 24.296 18.919 1.00 25.58 ? 444  LEU B CD2   1 
ATOM   5014 H  H     . LEU B 2 444 ? -28.766 22.424 20.344 1.00 0.00  ? 444  LEU B H     1 
ATOM   5015 N  N     . THR B 2 445 ? -29.674 25.429 18.050 1.00 25.11 ? 445  THR B N     1 
ATOM   5016 C  CA    . THR B 2 445 ? -29.056 26.747 17.954 1.00 25.90 ? 445  THR B CA    1 
ATOM   5017 C  C     . THR B 2 445 ? -30.033 27.850 18.332 1.00 24.14 ? 445  THR B C     1 
ATOM   5018 O  O     . THR B 2 445 ? -31.120 27.919 17.768 1.00 24.06 ? 445  THR B O     1 
ATOM   5019 C  CB    . THR B 2 445 ? -28.494 26.996 16.558 1.00 25.36 ? 445  THR B CB    1 
ATOM   5020 O  OG1   . THR B 2 445 ? -27.517 25.989 16.268 1.00 31.27 ? 445  THR B OG1   1 
ATOM   5021 C  CG2   . THR B 2 445 ? -27.857 28.365 16.464 1.00 24.40 ? 445  THR B CG2   1 
ATOM   5022 H  H     . THR B 2 445 ? -30.125 25.067 17.266 1.00 0.00  ? 445  THR B H     1 
ATOM   5023 H  HG1   . THR B 2 445 ? -26.831 25.958 16.937 1.00 0.00  ? 445  THR B HG1   1 
ATOM   5024 N  N     . LEU B 2 446 ? -29.676 28.634 19.355 1.00 28.77 ? 446  LEU B N     1 
ATOM   5025 C  CA    . LEU B 2 446 ? -30.495 29.758 19.814 1.00 29.55 ? 446  LEU B CA    1 
ATOM   5026 C  C     . LEU B 2 446 ? -29.894 31.066 19.299 1.00 32.85 ? 446  LEU B C     1 
ATOM   5027 O  O     . LEU B 2 446 ? -28.674 31.233 19.256 1.00 33.51 ? 446  LEU B O     1 
ATOM   5028 C  CB    . LEU B 2 446 ? -30.630 29.787 21.329 1.00 28.16 ? 446  LEU B CB    1 
ATOM   5029 C  CG    . LEU B 2 446 ? -31.536 28.684 21.886 1.00 31.93 ? 446  LEU B CG    1 
ATOM   5030 C  CD1   . LEU B 2 446 ? -30.682 27.442 22.200 1.00 28.15 ? 446  LEU B CD1   1 
ATOM   5031 C  CD2   . LEU B 2 446 ? -32.269 29.185 23.134 1.00 26.11 ? 446  LEU B CD2   1 
ATOM   5032 H  H     . LEU B 2 446 ? -28.824 28.488 19.821 1.00 0.00  ? 446  LEU B H     1 
ATOM   5033 N  N     . THR B 2 447 ? -30.775 31.973 18.891 1.00 30.94 ? 447  THR B N     1 
ATOM   5034 C  CA    . THR B 2 447 ? -30.396 33.247 18.319 1.00 27.53 ? 447  THR B CA    1 
ATOM   5035 C  C     . THR B 2 447 ? -30.717 34.378 19.269 1.00 29.20 ? 447  THR B C     1 
ATOM   5036 O  O     . THR B 2 447 ? -31.611 34.254 20.123 1.00 32.01 ? 447  THR B O     1 
ATOM   5037 C  CB    . THR B 2 447 ? -31.139 33.457 16.994 1.00 28.19 ? 447  THR B CB    1 
ATOM   5038 O  OG1   . THR B 2 447 ? -32.536 33.682 17.259 1.00 30.41 ? 447  THR B OG1   1 
ATOM   5039 C  CG2   . THR B 2 447 ? -30.990 32.192 16.120 1.00 27.30 ? 447  THR B CG2   1 
ATOM   5040 H  H     . THR B 2 447 ? -31.738 31.790 18.957 1.00 0.00  ? 447  THR B H     1 
ATOM   5041 H  HG1   . THR B 2 447 ? -32.684 34.603 17.524 1.00 0.00  ? 447  THR B HG1   1 
ATOM   5042 N  N     . PRO B 2 448 ? -30.069 35.537 19.063 1.00 28.01 ? 448  PRO B N     1 
ATOM   5043 C  CA    . PRO B 2 448 ? -30.246 36.728 19.891 1.00 26.23 ? 448  PRO B CA    1 
ATOM   5044 C  C     . PRO B 2 448 ? -31.672 37.234 20.009 1.00 23.46 ? 448  PRO B C     1 
ATOM   5045 O  O     . PRO B 2 448 ? -32.373 37.396 19.020 1.00 26.36 ? 448  PRO B O     1 
ATOM   5046 C  CB    . PRO B 2 448 ? -29.349 37.761 19.192 1.00 30.07 ? 448  PRO B CB    1 
ATOM   5047 C  CG    . PRO B 2 448 ? -28.342 36.945 18.452 1.00 29.81 ? 448  PRO B CG    1 
ATOM   5048 C  CD    . PRO B 2 448 ? -29.212 35.850 17.903 1.00 27.85 ? 448  PRO B CD    1 
ATOM   5049 N  N     . CYS B 2 449 ? -32.106 37.477 21.227 1.00 21.67 ? 449  CYS B N     1 
ATOM   5050 C  CA    . CYS B 2 449 ? -33.429 37.999 21.431 1.00 28.78 ? 449  CYS B CA    1 
ATOM   5051 C  C     . CYS B 2 449 ? -33.407 38.901 22.678 1.00 35.99 ? 449  CYS B C     1 
ATOM   5052 O  O     . CYS B 2 449 ? -34.489 39.367 23.116 1.00 36.49 ? 449  CYS B O     1 
ATOM   5053 C  CB    . CYS B 2 449 ? -34.434 36.849 21.564 1.00 31.08 ? 449  CYS B CB    1 
ATOM   5054 S  SG    . CYS B 2 449 ? -34.248 35.884 23.081 1.00 32.57 ? 449  CYS B SG    1 
ATOM   5055 O  OXT   . CYS B 2 449 ? -32.290 39.141 23.198 1.00 38.41 ? 449  CYS B OXT   1 
ATOM   5056 H  H     . CYS B 2 449 ? -31.554 37.340 22.023 1.00 0.00  ? 449  CYS B H     1 
HETATM 5057 C  C1    . BOG C 3 .   ? 4.243   5.224  24.537 0.50 60.21 ? 96   BOG A C1    1 
HETATM 5058 O  O1    . BOG C 3 .   ? 4.326   4.998  25.929 0.50 59.05 ? 96   BOG A O1    1 
HETATM 5059 C  C2    . BOG C 3 .   ? 3.161   6.232  24.239 0.50 60.61 ? 96   BOG A C2    1 
HETATM 5060 O  O2    . BOG C 3 .   ? 2.019   6.019  25.018 0.50 61.35 ? 96   BOG A O2    1 
HETATM 5061 C  C3    . BOG C 3 .   ? 2.931   6.082  22.785 0.50 60.71 ? 96   BOG A C3    1 
HETATM 5062 O  O3    . BOG C 3 .   ? 1.730   6.693  22.423 0.50 61.02 ? 96   BOG A O3    1 
HETATM 5063 C  C4    . BOG C 3 .   ? 4.123   6.683  22.090 0.50 61.66 ? 96   BOG A C4    1 
HETATM 5064 O  O4    . BOG C 3 .   ? 3.809   6.565  20.720 0.50 62.68 ? 96   BOG A O4    1 
HETATM 5065 C  C5    . BOG C 3 .   ? 5.405   5.880  22.529 0.50 61.36 ? 96   BOG A C5    1 
HETATM 5066 O  O5    . BOG C 3 .   ? 5.450   5.715  23.972 0.50 60.46 ? 96   BOG A O5    1 
HETATM 5067 C  C6    . BOG C 3 .   ? 6.683   6.646  22.143 0.50 61.82 ? 96   BOG A C6    1 
HETATM 5068 O  O6    . BOG C 3 .   ? 7.129   7.436  23.237 0.50 61.65 ? 96   BOG A O6    1 
HETATM 5069 C  "C1'" . BOG C 3 .   ? 4.927   3.791  26.353 0.50 56.45 ? 96   BOG A "C1'" 1 
HETATM 5070 C  "C2'" . BOG C 3 .   ? 3.988   2.606  26.046 0.50 53.63 ? 96   BOG A "C2'" 1 
HETATM 5071 C  "C3'" . BOG C 3 .   ? 4.701   1.259  26.129 0.50 52.27 ? 96   BOG A "C3'" 1 
HETATM 5072 C  "C4'" . BOG C 3 .   ? 5.651   1.192  27.323 0.50 51.66 ? 96   BOG A "C4'" 1 
HETATM 5073 C  "C5'" . BOG C 3 .   ? 6.301   -0.163 27.485 0.50 49.25 ? 96   BOG A "C5'" 1 
HETATM 5074 C  "C6'" . BOG C 3 .   ? 7.758   -0.040 27.910 0.50 50.16 ? 96   BOG A "C6'" 1 
HETATM 5075 C  "C7'" . BOG C 3 .   ? 7.960   0.787  29.181 0.50 50.94 ? 96   BOG A "C7'" 1 
HETATM 5076 C  "C8'" . BOG C 3 .   ? 9.139   0.277  29.999 0.50 48.84 ? 96   BOG A "C8'" 1 
HETATM 5077 H  HO2   . BOG C 3 .   ? 2.374   5.498  25.759 0.00 0.00  ? 96   BOG A HO2   1 
HETATM 5078 H  HO3   . BOG C 3 .   ? 1.173   6.583  23.213 0.00 0.00  ? 96   BOG A HO3   1 
HETATM 5079 H  HO4   . BOG C 3 .   ? 2.905   6.240  20.690 0.00 0.00  ? 96   BOG A HO4   1 
HETATM 5080 H  HO6   . BOG C 3 .   ? 6.904   6.937  24.034 0.00 0.00  ? 96   BOG A HO6   1 
HETATM 5081 C  C1    . BOG D 3 .   ? -1.967  17.579 28.074 0.50 41.46 ? 97   BOG A C1    1 
HETATM 5082 O  O1    . BOG D 3 .   ? -1.570  16.623 27.140 0.50 39.80 ? 97   BOG A O1    1 
HETATM 5083 C  C2    . BOG D 3 .   ? -3.389  17.245 28.484 0.50 41.86 ? 97   BOG A C2    1 
HETATM 5084 O  O2    . BOG D 3 .   ? -4.193  16.910 27.390 0.50 42.46 ? 97   BOG A O2    1 
HETATM 5085 C  C3    . BOG D 3 .   ? -3.819  18.473 29.257 0.50 41.61 ? 97   BOG A C3    1 
HETATM 5086 O  O3    . BOG D 3 .   ? -5.234  18.532 29.322 0.50 42.34 ? 97   BOG A O3    1 
HETATM 5087 C  C4    . BOG D 3 .   ? -3.133  18.296 30.568 0.50 40.71 ? 97   BOG A C4    1 
HETATM 5088 O  O4    . BOG D 3 .   ? -3.628  19.296 31.405 0.50 42.03 ? 97   BOG A O4    1 
HETATM 5089 C  C5    . BOG D 3 .   ? -1.571  18.354 30.327 0.50 40.40 ? 97   BOG A C5    1 
HETATM 5090 O  O5    . BOG D 3 .   ? -1.188  17.491 29.245 0.50 41.83 ? 97   BOG A O5    1 
HETATM 5091 C  C6    . BOG D 3 .   ? -0.695  17.883 31.520 0.50 40.04 ? 97   BOG A C6    1 
HETATM 5092 O  O6    . BOG D 3 .   ? 0.319   16.967 31.118 0.50 39.12 ? 97   BOG A O6    1 
HETATM 5093 C  "C1'" . BOG D 3 .   ? -0.339  16.667 26.451 0.50 39.11 ? 97   BOG A "C1'" 1 
HETATM 5094 C  "C2'" . BOG D 3 .   ? -0.160  15.313 25.705 0.50 37.84 ? 97   BOG A "C2'" 1 
HETATM 5095 C  "C3'" . BOG D 3 .   ? 0.910   15.479 24.668 0.50 36.53 ? 97   BOG A "C3'" 1 
HETATM 5096 C  "C4'" . BOG D 3 .   ? 1.210   14.150 24.018 0.50 36.05 ? 97   BOG A "C4'" 1 
HETATM 5097 C  "C5'" . BOG D 3 .   ? 2.538   14.171 23.233 0.50 32.90 ? 97   BOG A "C5'" 1 
HETATM 5098 C  "C6'" . BOG D 3 .   ? 2.589   15.332 22.265 0.50 32.45 ? 97   BOG A "C6'" 1 
HETATM 5099 C  "C7'" . BOG D 3 .   ? 3.980   15.888 21.952 0.50 31.42 ? 97   BOG A "C7'" 1 
HETATM 5100 C  "C8'" . BOG D 3 .   ? 4.675   15.075 20.861 0.50 30.39 ? 97   BOG A "C8'" 1 
HETATM 5101 H  HO2   . BOG D 3 .   ? -3.528  16.637 26.732 0.00 0.00  ? 97   BOG A HO2   1 
HETATM 5102 H  HO3   . BOG D 3 .   ? -5.521  17.712 28.900 0.00 0.00  ? 97   BOG A HO3   1 
HETATM 5103 H  HO4   . BOG D 3 .   ? -3.133  19.295 32.231 0.00 0.00  ? 97   BOG A HO4   1 
HETATM 5104 H  HO6   . BOG D 3 .   ? 0.053   16.597 30.264 0.00 0.00  ? 97   BOG A HO6   1 
HETATM 5105 C  C1    . BOG E 3 .   ? 18.814  20.918 37.636 0.50 26.88 ? 450  BOG B C1    1 
HETATM 5106 O  O1    . BOG E 3 .   ? 19.415  20.116 38.593 0.50 23.86 ? 450  BOG B O1    1 
HETATM 5107 C  C2    . BOG E 3 .   ? 19.375  22.324 37.660 0.50 27.63 ? 450  BOG B C2    1 
HETATM 5108 O  O2    . BOG E 3 .   ? 19.546  22.737 38.981 0.50 28.25 ? 450  BOG B O2    1 
HETATM 5109 C  C3    . BOG E 3 .   ? 18.391  23.152 36.926 0.50 29.77 ? 450  BOG B C3    1 
HETATM 5110 O  O3    . BOG E 3 .   ? 18.764  24.519 36.939 0.50 31.37 ? 450  BOG B O3    1 
HETATM 5111 C  C4    . BOG E 3 .   ? 18.260  22.617 35.502 0.50 28.85 ? 450  BOG B C4    1 
HETATM 5112 O  O4    . BOG E 3 .   ? 17.023  23.016 35.017 0.50 26.75 ? 450  BOG B O4    1 
HETATM 5113 C  C5    . BOG E 3 .   ? 18.240  21.108 35.345 0.50 30.20 ? 450  BOG B C5    1 
HETATM 5114 O  O5    . BOG E 3 .   ? 19.027  20.429 36.353 0.50 29.55 ? 450  BOG B O5    1 
HETATM 5115 C  C6    . BOG E 3 .   ? 18.916  20.824 33.990 0.50 32.81 ? 450  BOG B C6    1 
HETATM 5116 O  O6    . BOG E 3 .   ? 20.222  21.404 33.879 0.50 33.05 ? 450  BOG B O6    1 
HETATM 5117 C  "C1'" . BOG E 3 .   ? 18.787  18.913 38.936 0.50 22.33 ? 450  BOG B "C1'" 1 
HETATM 5118 C  "C2'" . BOG E 3 .   ? 19.824  17.986 39.544 0.50 20.47 ? 450  BOG B "C2'" 1 
HETATM 5119 C  "C3'" . BOG E 3 .   ? 20.559  18.673 40.690 0.50 19.74 ? 450  BOG B "C3'" 1 
HETATM 5120 C  "C4'" . BOG E 3 .   ? 19.545  19.270 41.650 0.50 21.70 ? 450  BOG B "C4'" 1 
HETATM 5121 C  "C5'" . BOG E 3 .   ? 20.137  19.977 42.861 0.50 17.49 ? 450  BOG B "C5'" 1 
HETATM 5122 C  "C6'" . BOG E 3 .   ? 20.505  18.916 43.871 0.50 19.17 ? 450  BOG B "C6'" 1 
HETATM 5123 C  "C7'" . BOG E 3 .   ? 20.780  19.501 45.218 0.50 18.01 ? 450  BOG B "C7'" 1 
HETATM 5124 C  "C8'" . BOG E 3 .   ? 19.799  20.641 45.402 0.50 21.87 ? 450  BOG B "C8'" 1 
HETATM 5125 H  HO2   . BOG E 3 .   ? 19.582  21.881 39.450 0.00 0.00  ? 450  BOG B HO2   1 
HETATM 5126 H  HO3   . BOG E 3 .   ? 18.369  24.885 37.734 0.00 0.00  ? 450  BOG B HO3   1 
HETATM 5127 H  HO4   . BOG E 3 .   ? 16.402  22.334 35.263 0.00 0.00  ? 450  BOG B HO4   1 
HETATM 5128 H  HO6   . BOG E 3 .   ? 20.838  20.731 33.594 0.00 0.00  ? 450  BOG B HO6   1 
HETATM 5129 C  C1    A BOG F 3 .   ? 4.158   15.662 48.518 0.50 63.24 ? 451  BOG B C1    1 
HETATM 5130 C  C1    B BOG F 3 .   ? 3.137   14.544 46.720 0.50 57.95 ? 451  BOG B C1    1 
HETATM 5131 O  O1    A BOG F 3 .   ? 4.435   15.492 49.907 0.50 63.09 ? 451  BOG B O1    1 
HETATM 5132 O  O1    B BOG F 3 .   ? 3.906   13.964 47.811 0.50 56.00 ? 451  BOG B O1    1 
HETATM 5133 C  C2    A BOG F 3 .   ? 3.243   16.925 48.216 0.50 63.17 ? 451  BOG B C2    1 
HETATM 5134 C  C2    B BOG F 3 .   ? 3.233   16.113 46.451 0.50 59.09 ? 451  BOG B C2    1 
HETATM 5135 O  O2    A BOG F 3 .   ? 3.456   17.800 49.300 0.50 60.77 ? 451  BOG B O2    1 
HETATM 5136 O  O2    B BOG F 3 .   ? 3.449   16.909 47.579 0.50 58.33 ? 451  BOG B O2    1 
HETATM 5137 C  C3    A BOG F 3 .   ? 1.720   16.559 48.148 0.50 63.34 ? 451  BOG B C3    1 
HETATM 5138 C  C3    B BOG F 3 .   ? 1.984   16.587 45.771 0.50 59.53 ? 451  BOG B C3    1 
HETATM 5139 O  O3    A BOG F 3 .   ? 0.922   17.514 47.464 0.50 65.07 ? 451  BOG B O3    1 
HETATM 5140 O  O3    B BOG F 3 .   ? 2.133   17.923 45.333 0.50 60.31 ? 451  BOG B O3    1 
HETATM 5141 C  C4    A BOG F 3 .   ? 1.451   15.251 47.424 0.50 64.36 ? 451  BOG B C4    1 
HETATM 5142 C  C4    B BOG F 3 .   ? 1.643   15.670 44.593 0.50 59.01 ? 451  BOG B C4    1 
HETATM 5143 O  O4    A BOG F 3 .   ? 0.068   14.932 47.415 0.50 64.00 ? 451  BOG B O4    1 
HETATM 5144 O  O4    B BOG F 3 .   ? 0.259   15.820 44.657 0.50 60.97 ? 451  BOG B O4    1 
HETATM 5145 C  C5    A BOG F 3 .   ? 2.282   14.112 48.074 0.50 64.25 ? 451  BOG B C5    1 
HETATM 5146 C  C5    B BOG F 3 .   ? 1.860   14.091 44.709 0.50 58.38 ? 451  BOG B C5    1 
HETATM 5147 O  O5    A BOG F 3 .   ? 3.691   14.408 47.967 0.50 63.73 ? 451  BOG B O5    1 
HETATM 5148 O  O5    B BOG F 3 .   ? 3.029   13.762 45.511 0.50 58.08 ? 451  BOG B O5    1 
HETATM 5149 C  C6    A BOG F 3 .   ? 1.982   12.932 47.138 0.50 64.25 ? 451  BOG B C6    1 
HETATM 5150 C  C6    B BOG F 3 .   ? 2.099   13.491 43.290 0.50 56.52 ? 451  BOG B C6    1 
HETATM 5151 O  O6    A BOG F 3 .   ? 2.864   12.954 46.024 0.50 65.08 ? 451  BOG B O6    1 
HETATM 5152 O  O6    B BOG F 3 .   ? 2.030   12.085 43.224 0.50 54.74 ? 451  BOG B O6    1 
HETATM 5153 C  "C1'" A BOG F 3 .   ? 5.307   14.453 50.330 0.50 60.44 ? 451  BOG B "C1'" 1 
HETATM 5154 C  "C1'" B BOG F 3 .   ? 5.284   13.582 47.829 0.50 54.54 ? 451  BOG B "C1'" 1 
HETATM 5155 C  "C2'" A BOG F 3 .   ? 6.482   15.062 51.121 0.50 57.61 ? 451  BOG B "C2'" 1 
HETATM 5156 C  "C2'" B BOG F 3 .   ? 6.091   14.855 48.090 0.50 53.18 ? 451  BOG B "C2'" 1 
HETATM 5157 C  "C3'" A BOG F 3 .   ? 7.416   15.966 50.304 0.50 53.00 ? 451  BOG B "C3'" 1 
HETATM 5158 C  "C3'" B BOG F 3 .   ? 7.561   14.767 48.466 0.50 49.61 ? 451  BOG B "C3'" 1 
HETATM 5159 C  "C4'" A BOG F 3 .   ? 8.143   16.885 51.265 0.50 50.31 ? 451  BOG B "C4'" 1 
HETATM 5160 C  "C4'" B BOG F 3 .   ? 8.347   14.067 47.380 0.50 46.66 ? 451  BOG B "C4'" 1 
HETATM 5161 C  "C5'" A BOG F 3 .   ? 9.010   17.800 50.454 0.50 48.21 ? 451  BOG B "C5'" 1 
HETATM 5162 C  "C5'" B BOG F 3 .   ? 9.827   14.396 47.585 0.50 44.50 ? 451  BOG B "C5'" 1 
HETATM 5163 C  "C6'" A BOG F 3 .   ? 9.840   18.709 51.338 0.50 47.15 ? 451  BOG B "C6'" 1 
HETATM 5164 C  "C6'" B BOG F 3 .   ? 10.760  13.286 47.051 0.50 42.32 ? 451  BOG B "C6'" 1 
HETATM 5165 C  "C7'" A BOG F 3 .   ? 10.625  19.774 50.552 0.50 45.77 ? 451  BOG B "C7'" 1 
HETATM 5166 C  "C7'" B BOG F 3 .   ? 11.808  13.865 46.121 0.50 39.51 ? 451  BOG B "C7'" 1 
HETATM 5167 C  "C8'" A BOG F 3 .   ? 9.805   20.786 49.732 0.50 43.85 ? 451  BOG B "C8'" 1 
HETATM 5168 C  "C8'" B BOG F 3 .   ? 11.101  14.281 44.828 0.50 37.87 ? 451  BOG B "C8'" 1 
HETATM 5169 H  HO2   A BOG F 3 .   ? 4.018   17.238 49.871 0.00 0.00  ? 451  BOG B HO2   1 
HETATM 5170 H  HO2   B BOG F 3 .   ? 4.126   16.364 48.025 0.00 0.00  ? 451  BOG B HO2   1 
HETATM 5171 H  HO3   A BOG F 3 .   ? 0.199   16.963 47.123 0.00 0.00  ? 451  BOG B HO3   1 
HETATM 5172 H  HO3   B BOG F 3 .   ? 2.815   18.255 45.934 0.00 0.00  ? 451  BOG B HO3   1 
HETATM 5173 H  HO4   A BOG F 3 .   ? 0.016   13.969 47.483 0.00 0.00  ? 451  BOG B HO4   1 
HETATM 5174 H  HO4   B BOG F 3 .   ? 0.030   15.597 45.574 0.00 0.00  ? 451  BOG B HO4   1 
HETATM 5175 H  HO6   A BOG F 3 .   ? 3.585   13.574 46.254 0.00 0.00  ? 451  BOG B HO6   1 
HETATM 5176 H  HO6   B BOG F 3 .   ? 1.312   11.835 42.629 0.00 0.00  ? 451  BOG B HO6   1 
HETATM 5177 C  C1    A BOG G 3 .   ? 3.183   24.301 32.348 0.50 65.34 ? 452  BOG B C1    1 
HETATM 5178 C  C1    B BOG G 3 .   ? 3.672   24.526 30.866 0.50 73.59 ? 452  BOG B C1    1 
HETATM 5179 O  O1    A BOG G 3 .   ? 3.425   24.564 30.951 0.50 64.43 ? 452  BOG B O1    1 
HETATM 5180 O  O1    B BOG G 3 .   ? 3.450   25.292 29.693 0.50 71.65 ? 452  BOG B O1    1 
HETATM 5181 C  C2    A BOG G 3 .   ? 2.147   23.227 32.588 0.50 65.49 ? 452  BOG B C2    1 
HETATM 5182 C  C2    B BOG G 3 .   ? 4.162   25.415 32.028 0.50 74.49 ? 452  BOG B C2    1 
HETATM 5183 O  O2    A BOG G 3 .   ? 1.059   23.171 31.740 0.50 65.20 ? 452  BOG B O2    1 
HETATM 5184 O  O2    B BOG G 3 .   ? 5.347   26.092 31.674 0.50 75.99 ? 452  BOG B O2    1 
HETATM 5185 C  C3    A BOG G 3 .   ? 1.798   23.431 34.028 0.50 65.60 ? 452  BOG B C3    1 
HETATM 5186 C  C3    B BOG G 3 .   ? 4.383   24.516 33.249 0.50 75.11 ? 452  BOG B C3    1 
HETATM 5187 O  O3    A BOG G 3 .   ? 0.503   23.017 34.415 0.50 66.11 ? 452  BOG B O3    1 
HETATM 5188 O  O3    B BOG G 3 .   ? 4.939   25.167 34.386 0.50 75.74 ? 452  BOG B O3    1 
HETATM 5189 C  C4    A BOG G 3 .   ? 2.893   22.705 34.726 0.50 66.16 ? 452  BOG B C4    1 
HETATM 5190 C  C4    B BOG G 3 .   ? 3.081   23.885 33.644 0.50 74.79 ? 452  BOG B C4    1 
HETATM 5191 O  O4    A BOG G 3 .   ? 2.447   22.670 36.051 0.50 65.03 ? 452  BOG B O4    1 
HETATM 5192 O  O4    B BOG G 3 .   ? 3.354   23.052 34.761 0.50 75.04 ? 452  BOG B O4    1 
HETATM 5193 C  C5    A BOG G 3 .   ? 4.210   23.502 34.496 0.50 66.53 ? 452  BOG B C5    1 
HETATM 5194 C  C5    B BOG G 3 .   ? 2.550   23.083 32.466 0.50 74.01 ? 452  BOG B C5    1 
HETATM 5195 O  O5    A BOG G 3 .   ? 4.372   23.908 33.099 0.50 66.20 ? 452  BOG B O5    1 
HETATM 5196 O  O5    B BOG G 3 .   ? 2.449   23.901 31.297 0.50 73.54 ? 452  BOG B O5    1 
HETATM 5197 C  C6    A BOG G 3 .   ? 5.492   22.709 34.821 0.50 67.21 ? 452  BOG B C6    1 
HETATM 5198 C  C6    B BOG G 3 .   ? 1.153   22.566 32.741 0.50 73.56 ? 452  BOG B C6    1 
HETATM 5199 O  O6    A BOG G 3 .   ? 5.500   22.023 36.065 0.50 68.03 ? 452  BOG B O6    1 
HETATM 5200 O  O6    B BOG G 3 .   ? 0.650   22.843 34.032 0.50 73.93 ? 452  BOG B O6    1 
HETATM 5201 C  "C1'" A BOG G 3 .   ? 3.544   23.557 29.953 0.50 61.33 ? 452  BOG B "C1'" 1 
HETATM 5202 C  "C1'" B BOG G 3 .   ? 4.413   26.047 28.988 0.50 70.93 ? 452  BOG B "C1'" 1 
HETATM 5203 C  "C2'" A BOG G 3 .   ? 2.519   23.734 28.826 0.50 60.19 ? 452  BOG B "C2'" 1 
HETATM 5204 C  "C2'" B BOG G 3 .   ? 3.801   27.431 28.721 0.50 71.28 ? 452  BOG B "C2'" 1 
HETATM 5205 C  "C3'" A BOG G 3 .   ? 1.078   23.943 29.298 0.50 58.15 ? 452  BOG B "C3'" 1 
HETATM 5206 C  "C3'" B BOG G 3 .   ? 4.704   28.410 27.927 0.50 71.04 ? 452  BOG B "C3'" 1 
HETATM 5207 C  "C4'" A BOG G 3 .   ? 0.046   23.803 28.203 0.50 58.99 ? 452  BOG B "C4'" 1 
HETATM 5208 C  "C4'" B BOG G 3 .   ? 3.920   29.266 26.894 0.50 69.90 ? 452  BOG B "C4'" 1 
HETATM 5209 C  "C5'" A BOG G 3 .   ? -0.011  25.008 27.244 0.50 59.52 ? 452  BOG B "C5'" 1 
HETATM 5210 C  "C5'" B BOG G 3 .   ? 3.853   28.547 25.536 0.50 68.36 ? 452  BOG B "C5'" 1 
HETATM 5211 C  "C6'" A BOG G 3 .   ? -0.762  24.642 25.949 0.50 57.56 ? 452  BOG B "C6'" 1 
HETATM 5212 C  "C6'" B BOG G 3 .   ? 2.899   29.162 24.515 0.50 67.62 ? 452  BOG B "C6'" 1 
HETATM 5213 C  "C7'" A BOG G 3 .   ? -1.054  25.874 25.085 0.50 57.48 ? 452  BOG B "C7'" 1 
HETATM 5214 C  "C7'" B BOG G 3 .   ? 3.521   30.157 23.526 0.50 67.53 ? 452  BOG B "C7'" 1 
HETATM 5215 C  "C8'" A BOG G 3 .   ? -1.784  25.512 23.783 0.50 56.00 ? 452  BOG B "C8'" 1 
HETATM 5216 C  "C8'" B BOG G 3 .   ? 2.470   30.582 22.483 0.50 66.65 ? 452  BOG B "C8'" 1 
HETATM 5217 H  HO2   A BOG G 3 .   ? 0.871   22.244 31.589 0.00 0.00  ? 452  BOG B HO2   1 
HETATM 5218 H  HO2   B BOG G 3 .   ? 5.227   26.283 30.743 0.00 0.00  ? 452  BOG B HO2   1 
HETATM 5219 H  HO3   A BOG G 3 .   ? 0.456   22.050 34.309 0.00 0.00  ? 452  BOG B HO3   1 
HETATM 5220 H  HO3   B BOG G 3 .   ? 5.069   24.503 35.081 0.00 0.00  ? 452  BOG B HO3   1 
HETATM 5221 H  HO4   A BOG G 3 .   ? 1.504   22.473 35.980 0.00 0.00  ? 452  BOG B HO4   1 
HETATM 5222 H  HO4   B BOG G 3 .   ? 2.493   22.817 35.131 0.00 0.00  ? 452  BOG B HO4   1 
HETATM 5223 H  HO6   A BOG G 3 .   ? 6.178   22.344 36.677 0.00 0.00  ? 452  BOG B HO6   1 
HETATM 5224 H  HO6   B BOG G 3 .   ? 0.166   22.015 34.285 0.00 0.00  ? 452  BOG B HO6   1 
HETATM 5225 CA CA    . CA  H 4 .   ? 5.857   41.956 59.040 1.00 25.95 ? 453  CA  B CA    1 
HETATM 5226 C  C1    A MUP I 5 .   ? 8.674   26.290 52.682 0.67 20.47 ? 901  MUP B C1    1 
HETATM 5227 C  C1    B MUP I 5 .   ? 9.272   26.125 50.124 0.40 17.39 ? 901  MUP B C1    1 
HETATM 5228 C  C2    A MUP I 5 .   ? 7.227   26.063 53.139 0.67 16.73 ? 901  MUP B C2    1 
HETATM 5229 C  C2    B MUP I 5 .   ? 10.240  26.363 48.968 0.40 16.10 ? 901  MUP B C2    1 
HETATM 5230 C  C3    A MUP I 5 .   ? 7.122   25.122 54.313 0.67 11.45 ? 901  MUP B C3    1 
HETATM 5231 C  C3    B MUP I 5 .   ? 9.712   25.807 47.662 0.40 14.44 ? 901  MUP B C3    1 
HETATM 5232 C  C4    A MUP I 5 .   ? 7.871   23.854 54.059 0.67 11.02 ? 901  MUP B C4    1 
HETATM 5233 C  C4    B MUP I 5 .   ? 10.813  25.115 46.868 0.40 14.09 ? 901  MUP B C4    1 
HETATM 5234 C  C5    A MUP I 5 .   ? 8.120   23.142 55.352 0.67 17.16 ? 901  MUP B C5    1 
HETATM 5235 C  C5    B MUP I 5 .   ? 10.694  23.596 46.926 0.40 14.12 ? 901  MUP B C5    1 
HETATM 5236 C  C6    A MUP I 5 .   ? 8.476   21.701 55.086 0.67 21.58 ? 901  MUP B C6    1 
HETATM 5237 C  C6    B MUP I 5 .   ? 11.826  22.919 46.157 0.40 15.38 ? 901  MUP B C6    1 
HETATM 5238 C  C7    A MUP I 5 .   ? 9.930   21.402 55.341 0.67 23.09 ? 901  MUP B C7    1 
HETATM 5239 C  C7    B MUP I 5 .   ? 11.354  21.634 45.498 0.40 15.23 ? 901  MUP B C7    1 
HETATM 5240 C  C8    A MUP I 5 .   ? 10.080  20.372 56.464 0.67 26.18 ? 901  MUP B C8    1 
HETATM 5241 C  C8    B MUP I 5 .   ? 12.459  20.596 45.444 0.40 16.69 ? 901  MUP B C8    1 
HETATM 5242 C  C9    A MUP I 5 .   ? 10.152  18.950 55.930 0.67 27.51 ? 901  MUP B C9    1 
HETATM 5243 C  C9    B MUP I 5 .   ? 11.894  19.179 45.468 0.40 18.22 ? 901  MUP B C9    1 
HETATM 5244 C  C10   A MUP I 5 .   ? 8.760   18.341 55.793 0.67 30.41 ? 901  MUP B C10   1 
HETATM 5245 C  C10   B MUP I 5 .   ? 12.857  18.170 44.834 0.40 19.80 ? 901  MUP B C10   1 
HETATM 5246 C  C11   A MUP I 5 .   ? 8.420   17.940 54.363 0.67 30.00 ? 901  MUP B C11   1 
HETATM 5247 C  C11   B MUP I 5 .   ? 13.558  17.294 45.862 0.40 18.73 ? 901  MUP B C11   1 
HETATM 5248 C  CM    A MUP I 5 .   ? 9.745   26.333 48.783 0.67 22.82 ? 901  MUP B CM    1 
HETATM 5249 C  CM    B MUP I 5 .   ? 8.450   25.341 53.129 0.40 13.02 ? 901  MUP B CM    1 
HETATM 5250 O  O1P   A MUP I 5 .   ? 10.263  27.945 51.352 0.67 22.03 ? 901  MUP B O1P   1 
HETATM 5251 O  O1P   B MUP I 5 .   ? 10.294  28.176 51.058 0.40 16.98 ? 901  MUP B O1P   1 
HETATM 5252 O  O2P   A MUP I 5 .   ? 9.170   26.039 50.092 0.67 23.99 ? 901  MUP B O2P   1 
HETATM 5253 O  O2P   B MUP I 5 .   ? 9.246   26.465 52.698 0.40 16.07 ? 901  MUP B O2P   1 
HETATM 5254 P  P     A MUP I 5 .   ? 8.881   27.163 51.294 0.67 24.19 ? 901  MUP B P     1 
HETATM 5255 P  P     B MUP I 5 .   ? 9.010   27.258 51.281 0.40 18.36 ? 901  MUP B P     1 
HETATM 5256 O  O     . HOH J 6 .   ? -17.983 23.087 21.030 1.00 17.95 ? 98   HOH A O     1 
HETATM 5257 H  H1    . HOH J 6 .   ? -17.821 23.719 21.752 1.00 0.00  ? 98   HOH A H1    1 
HETATM 5258 H  H2    . HOH J 6 .   ? -18.291 22.287 21.454 1.00 0.00  ? 98   HOH A H2    1 
HETATM 5259 O  O     . HOH J 6 .   ? -1.991  17.348 16.959 1.00 55.34 ? 99   HOH A O     1 
HETATM 5260 H  H1    . HOH J 6 .   ? -1.140  17.209 16.549 1.00 0.00  ? 99   HOH A H1    1 
HETATM 5261 H  H2    . HOH J 6 .   ? -2.285  16.449 17.133 1.00 0.00  ? 99   HOH A H2    1 
HETATM 5262 O  O     . HOH J 6 .   ? -22.718 12.857 19.442 1.00 38.87 ? 100  HOH A O     1 
HETATM 5263 H  H1    . HOH J 6 .   ? -23.129 12.194 18.875 1.00 0.00  ? 100  HOH A H1    1 
HETATM 5264 H  H2    . HOH J 6 .   ? -21.876 12.454 19.660 1.00 0.00  ? 100  HOH A H2    1 
HETATM 5265 O  O     . HOH J 6 .   ? -27.731 20.902 14.905 1.00 63.33 ? 101  HOH A O     1 
HETATM 5266 H  H1    . HOH J 6 .   ? -28.098 21.369 15.681 1.00 0.00  ? 101  HOH A H1    1 
HETATM 5267 H  H2    . HOH J 6 .   ? -28.262 21.265 14.183 1.00 0.00  ? 101  HOH A H2    1 
HETATM 5268 O  O     . HOH J 6 .   ? -19.567 28.113 15.011 1.00 34.84 ? 102  HOH A O     1 
HETATM 5269 H  H1    . HOH J 6 .   ? -20.288 27.727 14.474 1.00 0.00  ? 102  HOH A H1    1 
HETATM 5270 H  H2    . HOH J 6 .   ? -19.554 29.024 14.726 1.00 0.00  ? 102  HOH A H2    1 
HETATM 5271 O  O     . HOH J 6 .   ? -14.229 19.124 25.030 1.00 39.55 ? 103  HOH A O     1 
HETATM 5272 H  H1    . HOH J 6 .   ? -15.129 19.404 24.883 1.00 0.00  ? 103  HOH A H1    1 
HETATM 5273 H  H2    . HOH J 6 .   ? -13.875 19.056 24.136 1.00 0.00  ? 103  HOH A H2    1 
HETATM 5274 O  O     . HOH J 6 .   ? -12.636 5.224  31.613 1.00 37.49 ? 104  HOH A O     1 
HETATM 5275 H  H1    . HOH J 6 .   ? -12.751 6.142  31.381 1.00 0.00  ? 104  HOH A H1    1 
HETATM 5276 H  H2    . HOH J 6 .   ? -12.409 4.795  30.772 1.00 0.00  ? 104  HOH A H2    1 
HETATM 5277 O  O     . HOH J 6 .   ? -10.230 12.683 30.747 1.00 25.95 ? 105  HOH A O     1 
HETATM 5278 H  H1    . HOH J 6 .   ? -9.917  13.175 29.975 1.00 0.00  ? 105  HOH A H1    1 
HETATM 5279 H  H2    . HOH J 6 .   ? -10.086 13.251 31.507 1.00 0.00  ? 105  HOH A H2    1 
HETATM 5280 O  O     . HOH J 6 .   ? -15.309 26.205 10.143 1.00 34.19 ? 106  HOH A O     1 
HETATM 5281 H  H1    . HOH J 6 .   ? -15.115 27.008 9.651  1.00 0.00  ? 106  HOH A H1    1 
HETATM 5282 H  H2    . HOH J 6 .   ? -14.502 26.134 10.705 1.00 0.00  ? 106  HOH A H2    1 
HETATM 5283 O  O     . HOH J 6 .   ? -13.728 14.739 30.645 1.00 35.47 ? 107  HOH A O     1 
HETATM 5284 H  H1    . HOH J 6 .   ? -12.940 14.220 30.820 1.00 0.00  ? 107  HOH A H1    1 
HETATM 5285 H  H2    . HOH J 6 .   ? -14.446 14.106 30.628 1.00 0.00  ? 107  HOH A H2    1 
HETATM 5286 O  O     . HOH J 6 .   ? -11.567 5.773  20.411 1.00 38.71 ? 108  HOH A O     1 
HETATM 5287 H  H1    . HOH J 6 .   ? -11.932 4.876  20.406 1.00 0.00  ? 108  HOH A H1    1 
HETATM 5288 H  H2    . HOH J 6 .   ? -10.620 5.637  20.438 1.00 0.00  ? 108  HOH A H2    1 
HETATM 5289 O  O     . HOH J 6 .   ? -13.466 13.181 8.402  1.00 41.07 ? 109  HOH A O     1 
HETATM 5290 H  H1    . HOH J 6 .   ? -13.919 13.339 9.232  1.00 0.00  ? 109  HOH A H1    1 
HETATM 5291 H  H2    . HOH J 6 .   ? -12.795 12.530 8.607  1.00 0.00  ? 109  HOH A H2    1 
HETATM 5292 O  O     . HOH J 6 .   ? -17.403 12.611 13.400 1.00 52.39 ? 110  HOH A O     1 
HETATM 5293 H  H1    . HOH J 6 .   ? -18.205 12.685 13.931 1.00 0.00  ? 110  HOH A H1    1 
HETATM 5294 H  H2    . HOH J 6 .   ? -17.518 11.770 12.938 1.00 0.00  ? 110  HOH A H2    1 
HETATM 5295 O  O     . HOH J 6 .   ? -18.832 15.678 24.622 1.00 46.91 ? 111  HOH A O     1 
HETATM 5296 H  H1    . HOH J 6 .   ? -18.958 14.729 24.702 1.00 0.00  ? 111  HOH A H1    1 
HETATM 5297 H  H2    . HOH J 6 .   ? -17.953 15.811 25.005 1.00 0.00  ? 111  HOH A H2    1 
HETATM 5298 O  O     . HOH J 6 .   ? -13.360 16.049 26.643 1.00 35.83 ? 112  HOH A O     1 
HETATM 5299 H  H1    . HOH J 6 .   ? -13.525 16.950 26.326 1.00 0.00  ? 112  HOH A H1    1 
HETATM 5300 H  H2    . HOH J 6 .   ? -13.540 16.159 27.589 1.00 0.00  ? 112  HOH A H2    1 
HETATM 5301 O  O     . HOH J 6 .   ? 0.323   10.461 11.230 1.00 48.37 ? 113  HOH A O     1 
HETATM 5302 H  H1    . HOH J 6 .   ? 0.144   9.746  11.848 1.00 0.00  ? 113  HOH A H1    1 
HETATM 5303 H  H2    . HOH J 6 .   ? -0.111  10.183 10.418 1.00 0.00  ? 113  HOH A H2    1 
HETATM 5304 O  O     . HOH J 6 .   ? -15.167 5.822  29.080 1.00 50.66 ? 114  HOH A O     1 
HETATM 5305 H  H1    . HOH J 6 .   ? -14.367 6.195  29.459 1.00 0.00  ? 114  HOH A H1    1 
HETATM 5306 H  H2    . HOH J 6 .   ? -15.534 5.309  29.802 1.00 0.00  ? 114  HOH A H2    1 
HETATM 5307 O  O     . HOH J 6 .   ? -6.642  14.304 6.939  1.00 28.50 ? 115  HOH A O     1 
HETATM 5308 H  H1    . HOH J 6 .   ? -7.575  14.093 7.086  1.00 0.00  ? 115  HOH A H1    1 
HETATM 5309 H  H2    . HOH J 6 .   ? -6.159  13.478 7.080  1.00 0.00  ? 115  HOH A H2    1 
HETATM 5310 O  O     . HOH J 6 .   ? -8.326  9.263  12.055 1.00 36.65 ? 116  HOH A O     1 
HETATM 5311 H  H1    . HOH J 6 .   ? -9.156  8.966  12.449 1.00 0.00  ? 116  HOH A H1    1 
HETATM 5312 H  H2    . HOH J 6 .   ? -8.196  10.055 12.581 1.00 0.00  ? 116  HOH A H2    1 
HETATM 5313 O  O     . HOH J 6 .   ? -5.790  10.660 15.351 1.00 38.02 ? 117  HOH A O     1 
HETATM 5314 H  H1    . HOH J 6 .   ? -5.539  9.816  15.769 1.00 0.00  ? 117  HOH A H1    1 
HETATM 5315 H  H2    . HOH J 6 .   ? -5.484  10.475 14.470 1.00 0.00  ? 117  HOH A H2    1 
HETATM 5316 O  O     . HOH J 6 .   ? -21.779 27.198 14.120 1.00 36.12 ? 118  HOH A O     1 
HETATM 5317 H  H1    . HOH J 6 .   ? -22.591 27.441 13.654 1.00 0.00  ? 118  HOH A H1    1 
HETATM 5318 H  H2    . HOH J 6 .   ? -22.104 26.772 14.921 1.00 0.00  ? 118  HOH A H2    1 
HETATM 5319 O  O     . HOH J 6 .   ? 1.844   13.119 32.418 1.00 28.17 ? 119  HOH A O     1 
HETATM 5320 H  H1    . HOH J 6 .   ? 1.053   13.665 32.303 1.00 0.00  ? 119  HOH A H1    1 
HETATM 5321 H  H2    . HOH J 6 .   ? 2.599   13.694 32.257 1.00 0.00  ? 119  HOH A H2    1 
HETATM 5322 O  O     . HOH J 6 .   ? -23.585 16.902 13.667 1.00 41.67 ? 120  HOH A O     1 
HETATM 5323 H  H1    . HOH J 6 .   ? -23.570 16.754 12.711 1.00 0.00  ? 120  HOH A H1    1 
HETATM 5324 H  H2    . HOH J 6 .   ? -23.065 16.162 13.970 1.00 0.00  ? 120  HOH A H2    1 
HETATM 5325 O  O     . HOH J 6 .   ? -7.829  22.887 16.500 1.00 33.81 ? 121  HOH A O     1 
HETATM 5326 H  H1    . HOH J 6 .   ? -7.780  22.572 17.405 1.00 0.00  ? 121  HOH A H1    1 
HETATM 5327 H  H2    . HOH J 6 .   ? -7.095  23.518 16.449 1.00 0.00  ? 121  HOH A H2    1 
HETATM 5328 O  O     . HOH J 6 .   ? -20.348 24.906 12.720 1.00 38.52 ? 122  HOH A O     1 
HETATM 5329 H  H1    . HOH J 6 .   ? -19.741 25.361 12.128 1.00 0.00  ? 122  HOH A H1    1 
HETATM 5330 H  H2    . HOH J 6 .   ? -20.646 25.619 13.302 1.00 0.00  ? 122  HOH A H2    1 
HETATM 5331 O  O     . HOH J 6 .   ? -10.412 6.929  10.701 1.00 52.78 ? 123  HOH A O     1 
HETATM 5332 H  H1    . HOH J 6 .   ? -10.132 7.524  11.402 1.00 0.00  ? 123  HOH A H1    1 
HETATM 5333 H  H2    . HOH J 6 .   ? -11.155 6.483  11.119 1.00 0.00  ? 123  HOH A H2    1 
HETATM 5334 O  O     . HOH J 6 .   ? -2.511  7.843  16.804 1.00 41.50 ? 124  HOH A O     1 
HETATM 5335 H  H1    . HOH J 6 .   ? -2.793  8.651  16.353 1.00 0.00  ? 124  HOH A H1    1 
HETATM 5336 H  H2    . HOH J 6 .   ? -3.225  7.235  16.547 1.00 0.00  ? 124  HOH A H2    1 
HETATM 5337 O  O     . HOH J 6 .   ? -12.903 26.173 11.202 1.00 30.20 ? 125  HOH A O     1 
HETATM 5338 H  H1    . HOH J 6 .   ? -12.813 25.961 12.149 1.00 0.00  ? 125  HOH A H1    1 
HETATM 5339 H  H2    . HOH J 6 .   ? -11.992 26.269 10.910 1.00 0.00  ? 125  HOH A H2    1 
HETATM 5340 O  O     . HOH J 6 .   ? -7.779  17.832 22.419 1.00 52.01 ? 126  HOH A O     1 
HETATM 5341 H  H1    . HOH J 6 .   ? -7.463  17.042 22.866 1.00 0.00  ? 126  HOH A H1    1 
HETATM 5342 H  H2    . HOH J 6 .   ? -8.639  17.943 22.843 1.00 0.00  ? 126  HOH A H2    1 
HETATM 5343 O  O     . HOH J 6 .   ? -4.858  18.005 20.469 1.00 44.25 ? 127  HOH A O     1 
HETATM 5344 H  H1    . HOH J 6 .   ? -5.096  17.749 19.574 1.00 0.00  ? 127  HOH A H1    1 
HETATM 5345 H  H2    . HOH J 6 .   ? -5.591  17.590 20.933 1.00 0.00  ? 127  HOH A H2    1 
HETATM 5346 O  O     . HOH J 6 .   ? -7.261  17.190 19.949 1.00 40.00 ? 128  HOH A O     1 
HETATM 5347 H  H1    . HOH J 6 .   ? -7.683  17.891 19.381 1.00 0.00  ? 128  HOH A H1    1 
HETATM 5348 H  H2    . HOH J 6 .   ? -7.377  17.556 20.857 1.00 0.00  ? 128  HOH A H2    1 
HETATM 5349 O  O     . HOH J 6 .   ? -5.515  7.198  -0.295 1.00 44.50 ? 129  HOH A O     1 
HETATM 5350 H  H1    . HOH J 6 .   ? -4.709  7.159  0.225  1.00 0.00  ? 129  HOH A H1    1 
HETATM 5351 H  H2    . HOH J 6 .   ? -6.117  7.661  0.306  1.00 0.00  ? 129  HOH A H2    1 
HETATM 5352 O  O     . HOH J 6 .   ? -6.807  18.867 26.491 1.00 49.67 ? 130  HOH A O     1 
HETATM 5353 H  H1    . HOH J 6 .   ? -6.119  18.674 27.150 1.00 0.00  ? 130  HOH A H1    1 
HETATM 5354 H  H2    . HOH J 6 .   ? -6.444  19.652 26.075 1.00 0.00  ? 130  HOH A H2    1 
HETATM 5355 O  O     . HOH J 6 .   ? -17.298 18.272 26.351 1.00 54.28 ? 131  HOH A O     1 
HETATM 5356 H  H1    . HOH J 6 .   ? -17.443 18.940 27.038 1.00 0.00  ? 131  HOH A H1    1 
HETATM 5357 H  H2    . HOH J 6 .   ? -18.072 18.341 25.785 1.00 0.00  ? 131  HOH A H2    1 
HETATM 5358 O  O     . HOH J 6 .   ? -11.189 14.708 33.861 1.00 56.87 ? 132  HOH A O     1 
HETATM 5359 H  H1    . HOH J 6 .   ? -11.643 14.146 34.495 1.00 0.00  ? 132  HOH A H1    1 
HETATM 5360 H  H2    . HOH J 6 .   ? -11.812 15.430 33.716 1.00 0.00  ? 132  HOH A H2    1 
HETATM 5361 O  O     . HOH J 6 .   ? -15.936 12.970 16.101 1.00 73.79 ? 133  HOH A O     1 
HETATM 5362 H  H1    . HOH J 6 .   ? -16.377 12.430 15.440 1.00 0.00  ? 133  HOH A H1    1 
HETATM 5363 H  H2    . HOH J 6 .   ? -16.091 12.514 16.939 1.00 0.00  ? 133  HOH A H2    1 
HETATM 5364 O  O     . HOH J 6 .   ? -17.301 13.464 -3.249 1.00 36.98 ? 134  HOH A O     1 
HETATM 5365 H  H1    . HOH J 6 .   ? -16.697 13.781 -2.578 1.00 0.00  ? 134  HOH A H1    1 
HETATM 5366 H  H2    . HOH J 6 .   ? -18.022 13.084 -2.740 1.00 0.00  ? 134  HOH A H2    1 
HETATM 5367 O  O     . HOH J 6 .   ? -7.360  13.117 4.557  1.00 47.49 ? 135  HOH A O     1 
HETATM 5368 H  H1    . HOH J 6 .   ? -6.975  13.641 5.279  1.00 0.00  ? 135  HOH A H1    1 
HETATM 5369 H  H2    . HOH J 6 .   ? -8.098  12.648 4.975  1.00 0.00  ? 135  HOH A H2    1 
HETATM 5370 O  O     . HOH J 6 .   ? -8.895  16.128 4.502  1.00 60.28 ? 136  HOH A O     1 
HETATM 5371 H  H1    . HOH J 6 .   ? -8.333  16.793 4.909  1.00 0.00  ? 136  HOH A H1    1 
HETATM 5372 H  H2    . HOH J 6 .   ? -8.345  15.331 4.485  1.00 0.00  ? 136  HOH A H2    1 
HETATM 5373 O  O     . HOH J 6 .   ? 10.767  11.681 19.969 1.00 73.12 ? 137  HOH A O     1 
HETATM 5374 H  H1    . HOH J 6 .   ? 10.558  12.393 19.366 1.00 0.00  ? 137  HOH A H1    1 
HETATM 5375 H  H2    . HOH J 6 .   ? 9.898   11.428 20.295 1.00 0.00  ? 137  HOH A H2    1 
HETATM 5376 O  O     . HOH J 6 .   ? -8.478  19.188 18.649 1.00 49.74 ? 138  HOH A O     1 
HETATM 5377 H  H1    . HOH J 6 .   ? -8.573  19.705 17.828 1.00 0.00  ? 138  HOH A H1    1 
HETATM 5378 H  H2    . HOH J 6 .   ? -8.439  19.858 19.332 1.00 0.00  ? 138  HOH A H2    1 
HETATM 5379 O  O     . HOH J 6 .   ? -14.484 8.817  21.386 1.00 56.34 ? 139  HOH A O     1 
HETATM 5380 H  H1    . HOH J 6 .   ? -14.346 8.175  20.689 1.00 0.00  ? 139  HOH A H1    1 
HETATM 5381 H  H2    . HOH J 6 .   ? -13.607 8.925  21.772 1.00 0.00  ? 139  HOH A H2    1 
HETATM 5382 O  O     . HOH J 6 .   ? 4.926   17.941 19.069 1.00 78.92 ? 140  HOH A O     1 
HETATM 5383 H  H1    . HOH J 6 .   ? 5.556   18.662 19.051 1.00 0.00  ? 140  HOH A H1    1 
HETATM 5384 H  H2    . HOH J 6 .   ? 4.080   18.371 19.199 1.00 0.00  ? 140  HOH A H2    1 
HETATM 5385 O  O     . HOH J 6 .   ? -14.664 17.365 29.475 1.00 68.33 ? 141  HOH A O     1 
HETATM 5386 H  H1    . HOH J 6 .   ? -15.585 17.141 29.331 1.00 0.00  ? 141  HOH A H1    1 
HETATM 5387 H  H2    . HOH J 6 .   ? -14.698 18.302 29.671 1.00 0.00  ? 141  HOH A H2    1 
HETATM 5388 O  O     . HOH K 6 .   ? -26.189 18.722 16.240 1.00 27.22 ? 902  HOH B O     1 
HETATM 5389 H  H1    . HOH K 6 .   ? -26.341 19.183 15.411 1.00 0.00  ? 902  HOH B H1    1 
HETATM 5390 H  H2    . HOH K 6 .   ? -25.491 18.073 16.045 1.00 0.00  ? 902  HOH B H2    1 
HETATM 5391 O  O     . HOH K 6 .   ? 21.868  52.087 32.554 1.00 47.05 ? 903  HOH B O     1 
HETATM 5392 H  H1    . HOH K 6 .   ? 22.103  51.227 32.212 1.00 0.00  ? 903  HOH B H1    1 
HETATM 5393 H  H2    . HOH K 6 .   ? 22.319  52.098 33.417 1.00 0.00  ? 903  HOH B H2    1 
HETATM 5394 O  O     . HOH K 6 .   ? 22.879  44.250 50.221 1.00 26.30 ? 904  HOH B O     1 
HETATM 5395 H  H1    . HOH K 6 .   ? 22.959  43.532 50.854 1.00 0.00  ? 904  HOH B H1    1 
HETATM 5396 H  H2    . HOH K 6 .   ? 21.922  44.405 50.199 1.00 0.00  ? 904  HOH B H2    1 
HETATM 5397 O  O     . HOH K 6 .   ? 3.760   47.704 42.178 1.00 58.15 ? 905  HOH B O     1 
HETATM 5398 H  H1    . HOH K 6 .   ? 4.437   47.946 42.841 1.00 0.00  ? 905  HOH B H1    1 
HETATM 5399 H  H2    . HOH K 6 .   ? 3.386   48.565 41.968 1.00 0.00  ? 905  HOH B H2    1 
HETATM 5400 O  O     . HOH K 6 .   ? 6.020   49.122 43.433 1.00 24.24 ? 906  HOH B O     1 
HETATM 5401 H  H1    . HOH K 6 .   ? 6.773   48.945 42.880 1.00 0.00  ? 906  HOH B H1    1 
HETATM 5402 H  H2    . HOH K 6 .   ? 6.297   49.926 43.899 1.00 0.00  ? 906  HOH B H2    1 
HETATM 5403 O  O     . HOH K 6 .   ? -2.199  38.905 43.484 1.00 22.92 ? 907  HOH B O     1 
HETATM 5404 H  H1    . HOH K 6 .   ? -1.804  39.695 43.839 1.00 0.00  ? 907  HOH B H1    1 
HETATM 5405 H  H2    . HOH K 6 .   ? -2.826  38.639 44.160 1.00 0.00  ? 907  HOH B H2    1 
HETATM 5406 O  O     . HOH K 6 .   ? -2.995  22.296 50.854 1.00 13.72 ? 908  HOH B O     1 
HETATM 5407 H  H1    . HOH K 6 .   ? -3.614  22.100 50.149 1.00 0.00  ? 908  HOH B H1    1 
HETATM 5408 H  H2    . HOH K 6 .   ? -2.507  21.473 50.924 1.00 0.00  ? 908  HOH B H2    1 
HETATM 5409 O  O     . HOH K 6 .   ? 2.344   20.103 47.988 1.00 44.38 ? 909  HOH B O     1 
HETATM 5410 H  H1    . HOH K 6 .   ? 2.003   19.177 48.056 1.00 0.00  ? 909  HOH B H1    1 
HETATM 5411 H  H2    . HOH K 6 .   ? 3.085   19.935 48.599 1.00 0.00  ? 909  HOH B H2    1 
HETATM 5412 O  O     . HOH K 6 .   ? 3.279   45.778 39.842 1.00 44.12 ? 910  HOH B O     1 
HETATM 5413 H  H1    . HOH K 6 .   ? 2.612   46.096 39.213 1.00 0.00  ? 910  HOH B H1    1 
HETATM 5414 H  H2    . HOH K 6 .   ? 3.302   46.491 40.498 1.00 0.00  ? 910  HOH B H2    1 
HETATM 5415 O  O     . HOH K 6 .   ? -9.067  24.272 47.697 1.00 26.39 ? 911  HOH B O     1 
HETATM 5416 H  H1    . HOH K 6 .   ? -9.346  24.583 46.837 1.00 0.00  ? 911  HOH B H1    1 
HETATM 5417 H  H2    . HOH K 6 .   ? -9.893  24.149 48.180 1.00 0.00  ? 911  HOH B H2    1 
HETATM 5418 O  O     . HOH K 6 .   ? -30.110 40.065 24.426 1.00 21.43 ? 912  HOH B O     1 
HETATM 5419 H  H1    . HOH K 6 .   ? -31.027 40.202 24.133 1.00 0.00  ? 912  HOH B H1    1 
HETATM 5420 H  H2    . HOH K 6 .   ? -29.819 40.945 24.716 1.00 0.00  ? 912  HOH B H2    1 
HETATM 5421 O  O     . HOH K 6 .   ? -14.351 26.625 26.575 1.00 13.95 ? 913  HOH B O     1 
HETATM 5422 H  H1    . HOH K 6 .   ? -15.125 26.269 27.032 1.00 0.00  ? 913  HOH B H1    1 
HETATM 5423 H  H2    . HOH K 6 .   ? -13.725 25.900 26.661 1.00 0.00  ? 913  HOH B H2    1 
HETATM 5424 O  O     . HOH K 6 .   ? -15.971 20.807 28.651 1.00 42.46 ? 914  HOH B O     1 
HETATM 5425 H  H1    . HOH K 6 .   ? -15.661 21.289 29.425 1.00 0.00  ? 914  HOH B H1    1 
HETATM 5426 H  H2    . HOH K 6 .   ? -15.150 20.461 28.288 1.00 0.00  ? 914  HOH B H2    1 
HETATM 5427 O  O     . HOH K 6 .   ? 7.478   31.814 28.374 1.00 51.94 ? 915  HOH B O     1 
HETATM 5428 H  H1    . HOH K 6 .   ? 7.321   31.522 29.286 1.00 0.00  ? 915  HOH B H1    1 
HETATM 5429 H  H2    . HOH K 6 .   ? 7.047   32.674 28.374 1.00 0.00  ? 915  HOH B H2    1 
HETATM 5430 O  O     . HOH K 6 .   ? 3.631   31.340 31.338 1.00 45.47 ? 916  HOH B O     1 
HETATM 5431 H  H1    . HOH K 6 .   ? 3.090   31.778 31.998 1.00 0.00  ? 916  HOH B H1    1 
HETATM 5432 H  H2    . HOH K 6 .   ? 3.204   30.479 31.272 1.00 0.00  ? 916  HOH B H2    1 
HETATM 5433 O  O     . HOH K 6 .   ? -34.365 17.156 16.727 1.00 31.76 ? 917  HOH B O     1 
HETATM 5434 H  H1    . HOH K 6 .   ? -33.511 17.009 16.316 1.00 0.00  ? 917  HOH B H1    1 
HETATM 5435 H  H2    . HOH K 6 .   ? -34.699 17.889 16.189 1.00 0.00  ? 917  HOH B H2    1 
HETATM 5436 O  O     . HOH K 6 .   ? -37.982 25.776 22.764 1.00 22.70 ? 918  HOH B O     1 
HETATM 5437 H  H1    . HOH K 6 .   ? -37.873 24.856 22.994 1.00 0.00  ? 918  HOH B H1    1 
HETATM 5438 H  H2    . HOH K 6 .   ? -37.445 25.839 21.974 1.00 0.00  ? 918  HOH B H2    1 
HETATM 5439 O  O     . HOH K 6 .   ? -30.344 17.949 22.236 1.00 19.90 ? 919  HOH B O     1 
HETATM 5440 H  H1    . HOH K 6 .   ? -31.094 17.449 21.885 1.00 0.00  ? 919  HOH B H1    1 
HETATM 5441 H  H2    . HOH K 6 .   ? -30.146 18.556 21.509 1.00 0.00  ? 919  HOH B H2    1 
HETATM 5442 O  O     . HOH K 6 .   ? -17.359 37.181 26.848 1.00 35.34 ? 920  HOH B O     1 
HETATM 5443 H  H1    . HOH K 6 .   ? -17.810 36.334 26.844 1.00 0.00  ? 920  HOH B H1    1 
HETATM 5444 H  H2    . HOH K 6 .   ? -16.784 37.078 27.617 1.00 0.00  ? 920  HOH B H2    1 
HETATM 5445 O  O     . HOH K 6 .   ? -9.498  38.129 27.764 1.00 10.85 ? 921  HOH B O     1 
HETATM 5446 H  H1    . HOH K 6 .   ? -9.077  37.544 27.104 1.00 0.00  ? 921  HOH B H1    1 
HETATM 5447 H  H2    . HOH K 6 .   ? -10.417 38.097 27.498 1.00 0.00  ? 921  HOH B H2    1 
HETATM 5448 O  O     . HOH K 6 .   ? -8.349  36.550 25.900 1.00 33.09 ? 922  HOH B O     1 
HETATM 5449 H  H1    . HOH K 6 .   ? -8.652  36.455 24.987 1.00 0.00  ? 922  HOH B H1    1 
HETATM 5450 H  H2    . HOH K 6 .   ? -7.505  36.070 25.891 1.00 0.00  ? 922  HOH B H2    1 
HETATM 5451 O  O     . HOH K 6 .   ? -6.043  38.544 28.837 1.00 34.00 ? 923  HOH B O     1 
HETATM 5452 H  H1    . HOH K 6 .   ? -5.530  37.730 28.677 1.00 0.00  ? 923  HOH B H1    1 
HETATM 5453 H  H2    . HOH K 6 .   ? -6.857  38.419 28.341 1.00 0.00  ? 923  HOH B H2    1 
HETATM 5454 O  O     . HOH K 6 .   ? -5.650  36.338 27.379 1.00 34.16 ? 924  HOH B O     1 
HETATM 5455 H  H1    . HOH K 6 .   ? -6.427  36.880 27.510 1.00 0.00  ? 924  HOH B H1    1 
HETATM 5456 H  H2    . HOH K 6 .   ? -4.980  36.867 26.917 1.00 0.00  ? 924  HOH B H2    1 
HETATM 5457 O  O     . HOH K 6 .   ? -20.410 26.877 39.516 1.00 22.36 ? 925  HOH B O     1 
HETATM 5458 H  H1    . HOH K 6 .   ? -20.455 26.573 38.604 1.00 0.00  ? 925  HOH B H1    1 
HETATM 5459 H  H2    . HOH K 6 .   ? -19.720 26.352 39.923 1.00 0.00  ? 925  HOH B H2    1 
HETATM 5460 O  O     . HOH K 6 .   ? 8.547   24.492 39.060 1.00 25.26 ? 926  HOH B O     1 
HETATM 5461 H  H1    . HOH K 6 .   ? 9.127   24.244 38.342 1.00 0.00  ? 926  HOH B H1    1 
HETATM 5462 H  H2    . HOH K 6 .   ? 8.779   25.410 39.220 1.00 0.00  ? 926  HOH B H2    1 
HETATM 5463 O  O     . HOH K 6 .   ? 7.175   22.324 38.577 1.00 31.28 ? 927  HOH B O     1 
HETATM 5464 H  H1    . HOH K 6 .   ? 6.254   22.517 38.786 1.00 0.00  ? 927  HOH B H1    1 
HETATM 5465 H  H2    . HOH K 6 .   ? 7.647   23.062 38.998 1.00 0.00  ? 927  HOH B H2    1 
HETATM 5466 O  O     . HOH K 6 .   ? 24.903  44.615 48.361 1.00 36.48 ? 928  HOH B O     1 
HETATM 5467 H  H1    . HOH K 6 .   ? 24.441  43.770 48.381 1.00 0.00  ? 928  HOH B H1    1 
HETATM 5468 H  H2    . HOH K 6 .   ? 24.512  45.005 49.159 1.00 0.00  ? 928  HOH B H2    1 
HETATM 5469 O  O     . HOH K 6 .   ? -2.855  39.737 37.255 1.00 27.46 ? 929  HOH B O     1 
HETATM 5470 H  H1    . HOH K 6 .   ? -2.938  38.915 37.728 1.00 0.00  ? 929  HOH B H1    1 
HETATM 5471 H  H2    . HOH K 6 .   ? -3.431  39.555 36.478 1.00 0.00  ? 929  HOH B H2    1 
HETATM 5472 O  O     . HOH K 6 .   ? -4.380  38.810 35.271 1.00 12.98 ? 930  HOH B O     1 
HETATM 5473 H  H1    . HOH K 6 .   ? -5.331  38.795 35.441 1.00 0.00  ? 930  HOH B H1    1 
HETATM 5474 H  H2    . HOH K 6 .   ? -4.268  38.232 34.510 1.00 0.00  ? 930  HOH B H2    1 
HETATM 5475 O  O     . HOH K 6 .   ? -6.727  44.239 39.166 1.00 27.51 ? 931  HOH B O     1 
HETATM 5476 H  H1    . HOH K 6 .   ? -7.045  44.961 39.721 1.00 0.00  ? 931  HOH B H1    1 
HETATM 5477 H  H2    . HOH K 6 .   ? -5.773  44.354 39.195 1.00 0.00  ? 931  HOH B H2    1 
HETATM 5478 O  O     . HOH K 6 .   ? -8.444  47.401 37.044 1.00 46.32 ? 932  HOH B O     1 
HETATM 5479 H  H1    . HOH K 6 .   ? -8.734  46.609 36.581 1.00 0.00  ? 932  HOH B H1    1 
HETATM 5480 H  H2    . HOH K 6 .   ? -7.592  47.110 37.364 1.00 0.00  ? 932  HOH B H2    1 
HETATM 5481 O  O     . HOH K 6 .   ? -10.444 22.829 43.910 1.00 37.00 ? 933  HOH B O     1 
HETATM 5482 H  H1    . HOH K 6 .   ? -9.818  23.526 44.147 1.00 0.00  ? 933  HOH B H1    1 
HETATM 5483 H  H2    . HOH K 6 .   ? -11.179 22.997 44.520 1.00 0.00  ? 933  HOH B H2    1 
HETATM 5484 O  O     . HOH K 6 .   ? -5.321  15.660 38.858 1.00 37.77 ? 934  HOH B O     1 
HETATM 5485 H  H1    . HOH K 6 .   ? -5.473  15.019 39.566 1.00 0.00  ? 934  HOH B H1    1 
HETATM 5486 H  H2    . HOH K 6 .   ? -6.033  15.469 38.245 1.00 0.00  ? 934  HOH B H2    1 
HETATM 5487 O  O     . HOH K 6 .   ? -28.998 41.784 26.137 1.00 23.24 ? 935  HOH B O     1 
HETATM 5488 H  H1    . HOH K 6 .   ? -29.683 41.424 26.722 1.00 0.00  ? 935  HOH B H1    1 
HETATM 5489 H  H2    . HOH K 6 .   ? -28.221 41.676 26.690 1.00 0.00  ? 935  HOH B H2    1 
HETATM 5490 O  O     . HOH K 6 .   ? -17.587 32.319 17.672 1.00 49.96 ? 936  HOH B O     1 
HETATM 5491 H  H1    . HOH K 6 .   ? -17.461 33.210 18.014 1.00 0.00  ? 936  HOH B H1    1 
HETATM 5492 H  H2    . HOH K 6 .   ? -17.672 32.481 16.733 1.00 0.00  ? 936  HOH B H2    1 
HETATM 5493 O  O     . HOH K 6 .   ? -12.885 25.018 30.481 1.00 21.95 ? 937  HOH B O     1 
HETATM 5494 H  H1    . HOH K 6 .   ? -13.396 24.452 29.902 1.00 0.00  ? 937  HOH B H1    1 
HETATM 5495 H  H2    . HOH K 6 .   ? -12.191 24.454 30.821 1.00 0.00  ? 937  HOH B H2    1 
HETATM 5496 O  O     . HOH K 6 .   ? -28.045 23.747 37.908 1.00 38.51 ? 938  HOH B O     1 
HETATM 5497 H  H1    . HOH K 6 .   ? -27.787 24.633 37.606 1.00 0.00  ? 938  HOH B H1    1 
HETATM 5498 H  H2    . HOH K 6 .   ? -27.283 23.228 37.608 1.00 0.00  ? 938  HOH B H2    1 
HETATM 5499 O  O     . HOH K 6 .   ? -27.956 36.352 34.723 1.00 29.75 ? 939  HOH B O     1 
HETATM 5500 H  H1    . HOH K 6 .   ? -27.648 36.970 35.392 1.00 0.00  ? 939  HOH B H1    1 
HETATM 5501 H  H2    . HOH K 6 .   ? -27.306 35.633 34.799 1.00 0.00  ? 939  HOH B H2    1 
HETATM 5502 O  O     . HOH K 6 .   ? -27.512 33.932 33.483 1.00 25.98 ? 940  HOH B O     1 
HETATM 5503 H  H1    . HOH K 6 .   ? -28.186 34.578 33.762 1.00 0.00  ? 940  HOH B H1    1 
HETATM 5504 H  H2    . HOH K 6 .   ? -27.777 33.763 32.571 1.00 0.00  ? 940  HOH B H2    1 
HETATM 5505 O  O     . HOH K 6 .   ? -41.552 24.505 17.193 1.00 53.45 ? 941  HOH B O     1 
HETATM 5506 H  H1    . HOH K 6 .   ? -41.223 24.829 18.049 1.00 0.00  ? 941  HOH B H1    1 
HETATM 5507 H  H2    . HOH K 6 .   ? -42.235 25.140 16.965 1.00 0.00  ? 941  HOH B H2    1 
HETATM 5508 O  O     . HOH K 6 .   ? -26.759 9.433  25.146 1.00 49.17 ? 942  HOH B O     1 
HETATM 5509 H  H1    . HOH K 6 .   ? -26.107 8.816  24.807 1.00 0.00  ? 942  HOH B H1    1 
HETATM 5510 H  H2    . HOH K 6 .   ? -27.436 8.856  25.522 1.00 0.00  ? 942  HOH B H2    1 
HETATM 5511 O  O     . HOH K 6 .   ? 2.248   46.802 32.016 1.00 40.08 ? 943  HOH B O     1 
HETATM 5512 H  H1    . HOH K 6 .   ? 2.400   46.568 31.091 1.00 0.00  ? 943  HOH B H1    1 
HETATM 5513 H  H2    . HOH K 6 .   ? 1.497   47.391 31.976 1.00 0.00  ? 943  HOH B H2    1 
HETATM 5514 O  O     . HOH K 6 .   ? 13.813  41.802 25.775 1.00 39.79 ? 944  HOH B O     1 
HETATM 5515 H  H1    . HOH K 6 .   ? 13.421  41.402 24.996 1.00 0.00  ? 944  HOH B H1    1 
HETATM 5516 H  H2    . HOH K 6 .   ? 14.222  41.069 26.231 1.00 0.00  ? 944  HOH B H2    1 
HETATM 5517 O  O     . HOH K 6 .   ? 9.992   41.485 24.671 1.00 36.44 ? 945  HOH B O     1 
HETATM 5518 H  H1    . HOH K 6 .   ? 9.039   41.574 24.588 1.00 0.00  ? 945  HOH B H1    1 
HETATM 5519 H  H2    . HOH K 6 .   ? 10.174  42.016 25.457 1.00 0.00  ? 945  HOH B H2    1 
HETATM 5520 O  O     . HOH K 6 .   ? -0.888  36.619 64.362 1.00 76.59 ? 946  HOH B O     1 
HETATM 5521 H  H1    . HOH K 6 .   ? -1.318  36.102 65.053 1.00 0.00  ? 946  HOH B H1    1 
HETATM 5522 H  H2    . HOH K 6 .   ? 0.003   36.245 64.304 1.00 0.00  ? 946  HOH B H2    1 
HETATM 5523 O  O     . HOH K 6 .   ? -0.173  44.966 60.884 1.00 58.13 ? 947  HOH B O     1 
HETATM 5524 H  H1    . HOH K 6 .   ? 0.121   45.868 60.751 1.00 0.00  ? 947  HOH B H1    1 
HETATM 5525 H  H2    . HOH K 6 .   ? 0.094   44.809 61.790 1.00 0.00  ? 947  HOH B H2    1 
HETATM 5526 O  O     . HOH K 6 .   ? -6.856  50.815 55.823 1.00 67.65 ? 948  HOH B O     1 
HETATM 5527 H  H1    . HOH K 6 .   ? -6.549  50.123 56.414 1.00 0.00  ? 948  HOH B H1    1 
HETATM 5528 H  H2    . HOH K 6 .   ? -7.518  50.383 55.285 1.00 0.00  ? 948  HOH B H2    1 
HETATM 5529 O  O     . HOH K 6 .   ? -5.401  18.733 43.428 1.00 48.32 ? 949  HOH B O     1 
HETATM 5530 H  H1    . HOH K 6 .   ? -5.135  19.660 43.456 1.00 0.00  ? 949  HOH B H1    1 
HETATM 5531 H  H2    . HOH K 6 .   ? -6.182  18.713 43.977 1.00 0.00  ? 949  HOH B H2    1 
HETATM 5532 O  O     . HOH K 6 .   ? -7.191  17.541 41.300 1.00 61.61 ? 950  HOH B O     1 
HETATM 5533 H  H1    . HOH K 6 .   ? -6.556  17.790 41.989 1.00 0.00  ? 950  HOH B H1    1 
HETATM 5534 H  H2    . HOH K 6 .   ? -8.036  17.783 41.685 1.00 0.00  ? 950  HOH B H2    1 
HETATM 5535 O  O     . HOH K 6 .   ? -19.142 40.593 26.450 1.00 24.44 ? 951  HOH B O     1 
HETATM 5536 H  H1    . HOH K 6 .   ? -19.322 40.763 25.528 1.00 0.00  ? 951  HOH B H1    1 
HETATM 5537 H  H2    . HOH K 6 .   ? -18.907 39.648 26.445 1.00 0.00  ? 951  HOH B H2    1 
HETATM 5538 O  O     . HOH K 6 .   ? -30.547 23.684 39.117 1.00 55.60 ? 952  HOH B O     1 
HETATM 5539 H  H1    . HOH K 6 .   ? -30.474 24.395 39.758 1.00 0.00  ? 952  HOH B H1    1 
HETATM 5540 H  H2    . HOH K 6 .   ? -29.607 23.621 38.809 1.00 0.00  ? 952  HOH B H2    1 
HETATM 5541 O  O     . HOH K 6 .   ? -30.630 26.924 39.416 1.00 39.93 ? 953  HOH B O     1 
HETATM 5542 H  H1    . HOH K 6 .   ? -31.420 27.341 39.771 1.00 0.00  ? 953  HOH B H1    1 
HETATM 5543 H  H2    . HOH K 6 .   ? -30.136 27.712 39.148 1.00 0.00  ? 953  HOH B H2    1 
HETATM 5544 O  O     . HOH K 6 .   ? -31.665 30.172 38.945 1.00 44.57 ? 954  HOH B O     1 
HETATM 5545 H  H1    . HOH K 6 .   ? -31.127 30.976 38.964 1.00 0.00  ? 954  HOH B H1    1 
HETATM 5546 H  H2    . HOH K 6 .   ? -32.423 30.405 39.486 1.00 0.00  ? 954  HOH B H2    1 
HETATM 5547 O  O     . HOH K 6 .   ? -33.793 31.355 30.777 1.00 58.35 ? 955  HOH B O     1 
HETATM 5548 H  H1    . HOH K 6 .   ? -33.259 31.779 31.446 1.00 0.00  ? 955  HOH B H1    1 
HETATM 5549 H  H2    . HOH K 6 .   ? -33.173 30.729 30.386 1.00 0.00  ? 955  HOH B H2    1 
HETATM 5550 O  O     . HOH K 6 .   ? -44.643 27.333 19.155 1.00 54.80 ? 956  HOH B O     1 
HETATM 5551 H  H1    . HOH K 6 .   ? -44.414 26.597 19.741 1.00 0.00  ? 956  HOH B H1    1 
HETATM 5552 H  H2    . HOH K 6 .   ? -44.121 28.064 19.507 1.00 0.00  ? 956  HOH B H2    1 
HETATM 5553 O  O     . HOH K 6 .   ? -33.818 27.785 17.239 1.00 40.00 ? 957  HOH B O     1 
HETATM 5554 H  H1    . HOH K 6 .   ? -33.595 27.319 16.427 1.00 0.00  ? 957  HOH B H1    1 
HETATM 5555 H  H2    . HOH K 6 .   ? -32.949 28.102 17.515 1.00 0.00  ? 957  HOH B H2    1 
HETATM 5556 O  O     . HOH K 6 .   ? 17.058  24.190 42.632 1.00 41.96 ? 958  HOH B O     1 
HETATM 5557 H  H1    . HOH K 6 .   ? 16.236  23.714 42.775 1.00 0.00  ? 958  HOH B H1    1 
HETATM 5558 H  H2    . HOH K 6 .   ? 17.505  23.673 41.951 1.00 0.00  ? 958  HOH B H2    1 
HETATM 5559 O  O     . HOH K 6 .   ? -20.668 36.016 8.539  1.00 56.71 ? 959  HOH B O     1 
HETATM 5560 H  H1    . HOH K 6 .   ? -20.632 36.960 8.411  1.00 0.00  ? 959  HOH B H1    1 
HETATM 5561 H  H2    . HOH K 6 .   ? -20.473 35.648 7.677  1.00 0.00  ? 959  HOH B H2    1 
HETATM 5562 O  O     . HOH K 6 .   ? -24.723 39.012 10.132 1.00 22.25 ? 960  HOH B O     1 
HETATM 5563 H  H1    . HOH K 6 .   ? -23.942 39.471 10.443 1.00 0.00  ? 960  HOH B H1    1 
HETATM 5564 H  H2    . HOH K 6 .   ? -24.525 38.844 9.208  1.00 0.00  ? 960  HOH B H2    1 
HETATM 5565 O  O     . HOH K 6 .   ? -20.737 15.928 30.271 1.00 59.25 ? 961  HOH B O     1 
HETATM 5566 H  H1    . HOH K 6 .   ? -20.738 15.709 31.204 1.00 0.00  ? 961  HOH B H1    1 
HETATM 5567 H  H2    . HOH K 6 .   ? -20.512 15.096 29.845 1.00 0.00  ? 961  HOH B H2    1 
HETATM 5568 O  O     . HOH K 6 .   ? -37.401 21.291 38.043 1.00 44.91 ? 962  HOH B O     1 
HETATM 5569 H  H1    . HOH K 6 .   ? -37.878 21.265 37.206 1.00 0.00  ? 962  HOH B H1    1 
HETATM 5570 H  H2    . HOH K 6 .   ? -37.973 20.815 38.648 1.00 0.00  ? 962  HOH B H2    1 
HETATM 5571 O  O     . HOH K 6 .   ? -36.089 20.693 43.161 1.00 28.64 ? 963  HOH B O     1 
HETATM 5572 H  H1    . HOH K 6 .   ? -35.969 20.768 44.120 1.00 0.00  ? 963  HOH B H1    1 
HETATM 5573 H  H2    . HOH K 6 .   ? -36.336 21.610 42.972 1.00 0.00  ? 963  HOH B H2    1 
HETATM 5574 O  O     . HOH K 6 .   ? -38.493 32.613 24.706 1.00 44.62 ? 964  HOH B O     1 
HETATM 5575 H  H1    . HOH K 6 .   ? -37.815 31.938 24.590 1.00 0.00  ? 964  HOH B H1    1 
HETATM 5576 H  H2    . HOH K 6 .   ? -37.996 33.431 24.620 1.00 0.00  ? 964  HOH B H2    1 
HETATM 5577 O  O     . HOH K 6 .   ? 32.545  16.896 55.886 1.00 33.78 ? 965  HOH B O     1 
HETATM 5578 H  H1    . HOH K 6 .   ? 32.604  17.816 56.147 1.00 0.00  ? 965  HOH B H1    1 
HETATM 5579 H  H2    . HOH K 6 .   ? 32.592  16.929 54.929 1.00 0.00  ? 965  HOH B H2    1 
HETATM 5580 O  O     . HOH K 6 .   ? 25.807  22.692 40.502 1.00 34.65 ? 966  HOH B O     1 
HETATM 5581 H  H1    . HOH K 6 .   ? 25.078  23.275 40.257 1.00 0.00  ? 966  HOH B H1    1 
HETATM 5582 H  H2    . HOH K 6 .   ? 26.591  23.235 40.324 1.00 0.00  ? 966  HOH B H2    1 
HETATM 5583 O  O     . HOH K 6 .   ? 23.942  24.457 42.270 1.00 20.15 ? 967  HOH B O     1 
HETATM 5584 H  H1    . HOH K 6 .   ? 24.118  23.528 42.085 1.00 0.00  ? 967  HOH B H1    1 
HETATM 5585 H  H2    . HOH K 6 .   ? 24.714  24.701 42.786 1.00 0.00  ? 967  HOH B H2    1 
HETATM 5586 O  O     . HOH K 6 .   ? 14.992  37.674 77.151 1.00 74.48 ? 968  HOH B O     1 
HETATM 5587 H  H1    . HOH K 6 .   ? 15.687  37.053 76.927 1.00 0.00  ? 968  HOH B H1    1 
HETATM 5588 H  H2    . HOH K 6 .   ? 14.929  37.605 78.106 1.00 0.00  ? 968  HOH B H2    1 
HETATM 5589 O  O     . HOH K 6 .   ? 20.719  46.427 64.993 1.00 24.41 ? 969  HOH B O     1 
HETATM 5590 H  H1    . HOH K 6 .   ? 21.014  47.340 65.116 1.00 0.00  ? 969  HOH B H1    1 
HETATM 5591 H  H2    . HOH K 6 .   ? 19.808  46.492 64.696 1.00 0.00  ? 969  HOH B H2    1 
HETATM 5592 O  O     . HOH K 6 .   ? 15.750  33.517 67.232 1.00 22.84 ? 970  HOH B O     1 
HETATM 5593 H  H1    . HOH K 6 .   ? 16.132  34.029 66.496 1.00 0.00  ? 970  HOH B H1    1 
HETATM 5594 H  H2    . HOH K 6 .   ? 16.297  32.747 67.145 1.00 0.00  ? 970  HOH B H2    1 
HETATM 5595 O  O     . HOH K 6 .   ? 28.250  40.510 37.247 1.00 39.12 ? 971  HOH B O     1 
HETATM 5596 H  H1    . HOH K 6 .   ? 28.042  41.129 37.970 1.00 0.00  ? 971  HOH B H1    1 
HETATM 5597 H  H2    . HOH K 6 .   ? 29.207  40.475 37.262 1.00 0.00  ? 971  HOH B H2    1 
HETATM 5598 O  O     . HOH K 6 .   ? 27.029  56.960 44.920 1.00 72.13 ? 972  HOH B O     1 
HETATM 5599 H  H1    . HOH K 6 .   ? 27.542  57.649 45.352 1.00 0.00  ? 972  HOH B H1    1 
HETATM 5600 H  H2    . HOH K 6 .   ? 26.197  57.411 44.735 1.00 0.00  ? 972  HOH B H2    1 
HETATM 5601 O  O     . HOH K 6 .   ? 26.624  51.212 31.794 1.00 61.38 ? 973  HOH B O     1 
HETATM 5602 H  H1    . HOH K 6 .   ? 26.707  50.481 32.411 1.00 0.00  ? 973  HOH B H1    1 
HETATM 5603 H  H2    . HOH K 6 .   ? 26.234  51.901 32.352 1.00 0.00  ? 973  HOH B H2    1 
HETATM 5604 O  O     . HOH K 6 .   ? 7.639   50.338 31.414 1.00 45.09 ? 974  HOH B O     1 
HETATM 5605 H  H1    . HOH K 6 .   ? 7.411   50.032 32.294 1.00 0.00  ? 974  HOH B H1    1 
HETATM 5606 H  H2    . HOH K 6 .   ? 8.056   51.191 31.583 1.00 0.00  ? 974  HOH B H2    1 
HETATM 5607 O  O     . HOH K 6 .   ? 20.933  34.487 75.740 1.00 51.30 ? 975  HOH B O     1 
HETATM 5608 H  H1    . HOH K 6 .   ? 20.664  34.591 76.662 1.00 0.00  ? 975  HOH B H1    1 
HETATM 5609 H  H2    . HOH K 6 .   ? 21.246  33.568 75.740 1.00 0.00  ? 975  HOH B H2    1 
HETATM 5610 O  O     . HOH K 6 .   ? 6.862   31.107 31.391 1.00 45.83 ? 976  HOH B O     1 
HETATM 5611 H  H1    . HOH K 6 .   ? 7.082   30.952 32.316 1.00 0.00  ? 976  HOH B H1    1 
HETATM 5612 H  H2    . HOH K 6 .   ? 6.013   30.669 31.285 1.00 0.00  ? 976  HOH B H2    1 
HETATM 5613 O  O     . HOH K 6 .   ? -7.785  44.669 36.908 1.00 50.69 ? 977  HOH B O     1 
HETATM 5614 H  H1    . HOH K 6 .   ? -8.495  44.059 37.117 1.00 0.00  ? 977  HOH B H1    1 
HETATM 5615 H  H2    . HOH K 6 .   ? -7.133  44.406 37.589 1.00 0.00  ? 977  HOH B H2    1 
HETATM 5616 O  O     . HOH K 6 .   ? -20.346 32.461 42.800 1.00 22.04 ? 978  HOH B O     1 
HETATM 5617 H  H1    . HOH K 6 .   ? -20.179 31.921 42.020 1.00 0.00  ? 978  HOH B H1    1 
HETATM 5618 H  H2    . HOH K 6 .   ? -19.518 32.363 43.275 1.00 0.00  ? 978  HOH B H2    1 
HETATM 5619 O  O     . HOH K 6 .   ? 7.333   25.167 33.313 1.00 38.21 ? 979  HOH B O     1 
HETATM 5620 H  H1    . HOH K 6 .   ? 6.477   24.823 33.605 1.00 0.00  ? 979  HOH B H1    1 
HETATM 5621 H  H2    . HOH K 6 .   ? 6.965   25.620 32.538 1.00 0.00  ? 979  HOH B H2    1 
HETATM 5622 O  O     . HOH K 6 .   ? -5.579  24.852 30.892 1.00 47.72 ? 980  HOH B O     1 
HETATM 5623 H  H1    . HOH K 6 .   ? -5.390  24.256 30.161 1.00 0.00  ? 980  HOH B H1    1 
HETATM 5624 H  H2    . HOH K 6 .   ? -5.449  25.744 30.527 1.00 0.00  ? 980  HOH B H2    1 
HETATM 5625 O  O     . HOH K 6 .   ? 25.145  39.894 44.417 1.00 32.14 ? 981  HOH B O     1 
HETATM 5626 H  H1    . HOH K 6 .   ? 26.041  39.911 44.757 1.00 0.00  ? 981  HOH B H1    1 
HETATM 5627 H  H2    . HOH K 6 .   ? 25.076  40.728 43.926 1.00 0.00  ? 981  HOH B H2    1 
HETATM 5628 O  O     . HOH K 6 .   ? 28.044  38.467 69.456 1.00 31.13 ? 982  HOH B O     1 
HETATM 5629 H  H1    . HOH K 6 .   ? 27.273  38.148 69.970 1.00 0.00  ? 982  HOH B H1    1 
HETATM 5630 H  H2    . HOH K 6 .   ? 28.652  37.734 69.628 1.00 0.00  ? 982  HOH B H2    1 
HETATM 5631 O  O     . HOH K 6 .   ? -10.481 24.245 37.320 1.00 31.66 ? 983  HOH B O     1 
HETATM 5632 H  H1    . HOH K 6 .   ? -10.591 24.086 38.284 1.00 0.00  ? 983  HOH B H1    1 
HETATM 5633 H  H2    . HOH K 6 .   ? -9.767  24.896 37.324 1.00 0.00  ? 983  HOH B H2    1 
HETATM 5634 O  O     . HOH K 6 .   ? -3.661  24.459 38.846 1.00 27.23 ? 984  HOH B O     1 
HETATM 5635 H  H1    . HOH K 6 .   ? -4.252  24.994 38.306 1.00 0.00  ? 984  HOH B H1    1 
HETATM 5636 H  H2    . HOH K 6 .   ? -3.957  23.562 38.654 1.00 0.00  ? 984  HOH B H2    1 
HETATM 5637 O  O     . HOH K 6 .   ? -5.891  48.110 58.590 1.00 55.49 ? 985  HOH B O     1 
HETATM 5638 H  H1    . HOH K 6 .   ? -6.686  47.546 58.627 1.00 0.00  ? 985  HOH B H1    1 
HETATM 5639 H  H2    . HOH K 6 .   ? -5.573  48.072 59.492 1.00 0.00  ? 985  HOH B H2    1 
HETATM 5640 O  O     . HOH K 6 .   ? -23.019 14.788 34.604 1.00 47.76 ? 986  HOH B O     1 
HETATM 5641 H  H1    . HOH K 6 .   ? -22.318 14.203 34.924 1.00 0.00  ? 986  HOH B H1    1 
HETATM 5642 H  H2    . HOH K 6 .   ? -22.822 15.605 35.077 1.00 0.00  ? 986  HOH B H2    1 
HETATM 5643 O  O     . HOH K 6 .   ? 19.189  26.838 35.700 1.00 56.80 ? 987  HOH B O     1 
HETATM 5644 H  H1    . HOH K 6 .   ? 19.112  27.176 36.595 1.00 0.00  ? 987  HOH B H1    1 
HETATM 5645 H  H2    . HOH K 6 .   ? 19.201  25.877 35.795 1.00 0.00  ? 987  HOH B H2    1 
HETATM 5646 O  O     . HOH K 6 .   ? 25.305  33.990 63.854 1.00 24.54 ? 988  HOH B O     1 
HETATM 5647 H  H1    . HOH K 6 .   ? 24.522  34.049 63.293 1.00 0.00  ? 988  HOH B H1    1 
HETATM 5648 H  H2    . HOH K 6 .   ? 25.760  34.820 63.666 1.00 0.00  ? 988  HOH B H2    1 
HETATM 5649 O  O     . HOH K 6 .   ? 7.988   41.502 58.966 1.00 23.97 ? 989  HOH B O     1 
HETATM 5650 H  H1    . HOH K 6 .   ? 8.693   41.647 58.299 1.00 0.00  ? 989  HOH B H1    1 
HETATM 5651 H  H2    . HOH K 6 .   ? 8.567   40.985 59.548 1.00 0.00  ? 989  HOH B H2    1 
HETATM 5652 O  O     . HOH K 6 .   ? 9.992   39.980 59.759 1.00 40.58 ? 990  HOH B O     1 
HETATM 5653 H  H1    . HOH K 6 .   ? 10.330  40.324 60.611 1.00 0.00  ? 990  HOH B H1    1 
HETATM 5654 H  H2    . HOH K 6 .   ? 10.504  39.153 59.708 1.00 0.00  ? 990  HOH B H2    1 
HETATM 5655 O  O     . HOH K 6 .   ? 8.560   38.676 57.677 1.00 41.51 ? 991  HOH B O     1 
HETATM 5656 H  H1    . HOH K 6 .   ? 9.169   39.090 58.327 1.00 0.00  ? 991  HOH B H1    1 
HETATM 5657 H  H2    . HOH K 6 .   ? 9.217   38.141 57.200 1.00 0.00  ? 991  HOH B H2    1 
HETATM 5658 O  O     . HOH K 6 .   ? 12.652  33.994 61.016 1.00 17.71 ? 992  HOH B O     1 
HETATM 5659 H  H1    . HOH K 6 .   ? 13.293  34.102 61.726 1.00 0.00  ? 992  HOH B H1    1 
HETATM 5660 H  H2    . HOH K 6 .   ? 13.177  33.726 60.261 1.00 0.00  ? 992  HOH B H2    1 
HETATM 5661 O  O     . HOH K 6 .   ? 11.114  35.931 60.344 1.00 32.16 ? 993  HOH B O     1 
HETATM 5662 H  H1    . HOH K 6 .   ? 11.634  35.131 60.581 1.00 0.00  ? 993  HOH B H1    1 
HETATM 5663 H  H2    . HOH K 6 .   ? 10.219  35.613 60.516 1.00 0.00  ? 993  HOH B H2    1 
HETATM 5664 O  O     . HOH K 6 .   ? 15.277  40.645 61.782 1.00 26.02 ? 994  HOH B O     1 
HETATM 5665 H  H1    . HOH K 6 .   ? 14.598  40.188 61.279 1.00 0.00  ? 994  HOH B H1    1 
HETATM 5666 H  H2    . HOH K 6 .   ? 16.052  40.609 61.208 1.00 0.00  ? 994  HOH B H2    1 
HETATM 5667 O  O     . HOH K 6 .   ? 10.620  37.177 58.164 1.00 53.58 ? 995  HOH B O     1 
HETATM 5668 H  H1    . HOH K 6 .   ? 11.210  36.615 58.721 1.00 0.00  ? 995  HOH B H1    1 
HETATM 5669 H  H2    . HOH K 6 .   ? 9.851   37.174 58.758 1.00 0.00  ? 995  HOH B H2    1 
HETATM 5670 O  O     . HOH K 6 .   ? -2.345  40.025 58.863 1.00 22.04 ? 996  HOH B O     1 
HETATM 5671 H  H1    . HOH K 6 .   ? -2.138  39.994 59.802 1.00 0.00  ? 996  HOH B H1    1 
HETATM 5672 H  H2    . HOH K 6 .   ? -1.666  39.450 58.487 1.00 0.00  ? 996  HOH B H2    1 
HETATM 5673 O  O     . HOH K 6 .   ? -4.074  40.393 56.571 1.00 38.57 ? 997  HOH B O     1 
HETATM 5674 H  H1    . HOH K 6 .   ? -4.376  41.234 56.911 1.00 0.00  ? 997  HOH B H1    1 
HETATM 5675 H  H2    . HOH K 6 .   ? -3.549  40.072 57.328 1.00 0.00  ? 997  HOH B H2    1 
HETATM 5676 O  O     . HOH K 6 .   ? -5.440  28.591 52.054 1.00 34.27 ? 998  HOH B O     1 
HETATM 5677 H  H1    . HOH K 6 .   ? -5.229  27.850 51.475 1.00 0.00  ? 998  HOH B H1    1 
HETATM 5678 H  H2    . HOH K 6 .   ? -6.396  28.510 52.132 1.00 0.00  ? 998  HOH B H2    1 
HETATM 5679 O  O     . HOH K 6 .   ? -10.594 42.305 37.117 1.00 35.26 ? 999  HOH B O     1 
HETATM 5680 H  H1    . HOH K 6 .   ? -11.222 43.039 37.050 1.00 0.00  ? 999  HOH B H1    1 
HETATM 5681 H  H2    . HOH K 6 .   ? -11.143 41.643 37.548 1.00 0.00  ? 999  HOH B H2    1 
HETATM 5682 O  O     . HOH K 6 .   ? -18.100 41.703 28.790 1.00 49.45 ? 1000 HOH B O     1 
HETATM 5683 H  H1    . HOH K 6 .   ? -18.053 41.510 27.837 1.00 0.00  ? 1000 HOH B H1    1 
HETATM 5684 H  H2    . HOH K 6 .   ? -18.988 41.381 28.964 1.00 0.00  ? 1000 HOH B H2    1 
HETATM 5685 O  O     . HOH K 6 .   ? -17.242 36.526 31.886 1.00 11.83 ? 1001 HOH B O     1 
HETATM 5686 H  H1    . HOH K 6 .   ? -16.997 35.900 32.577 1.00 0.00  ? 1001 HOH B H1    1 
HETATM 5687 H  H2    . HOH K 6 .   ? -17.074 36.017 31.085 1.00 0.00  ? 1001 HOH B H2    1 
HETATM 5688 O  O     . HOH K 6 .   ? -12.117 33.982 37.402 1.00 13.23 ? 1002 HOH B O     1 
HETATM 5689 H  H1    . HOH K 6 .   ? -11.235 33.855 36.985 1.00 0.00  ? 1002 HOH B H1    1 
HETATM 5690 H  H2    . HOH K 6 .   ? -11.904 34.499 38.193 1.00 0.00  ? 1002 HOH B H2    1 
HETATM 5691 O  O     . HOH K 6 .   ? -13.371 31.867 38.231 1.00 19.36 ? 1003 HOH B O     1 
HETATM 5692 H  H1    . HOH K 6 .   ? -12.742 32.594 38.066 1.00 0.00  ? 1003 HOH B H1    1 
HETATM 5693 H  H2    . HOH K 6 .   ? -14.220 32.301 38.241 1.00 0.00  ? 1003 HOH B H2    1 
HETATM 5694 O  O     . HOH K 6 .   ? -9.790  32.790 36.582 1.00 21.13 ? 1004 HOH B O     1 
HETATM 5695 H  H1    . HOH K 6 .   ? -10.084 32.885 35.660 1.00 0.00  ? 1004 HOH B H1    1 
HETATM 5696 H  H2    . HOH K 6 .   ? -9.945  31.850 36.771 1.00 0.00  ? 1004 HOH B H2    1 
HETATM 5697 O  O     . HOH K 6 .   ? -11.147 36.282 34.481 1.00 18.08 ? 1005 HOH B O     1 
HETATM 5698 H  H1    . HOH K 6 .   ? -11.050 35.318 34.386 1.00 0.00  ? 1005 HOH B H1    1 
HETATM 5699 H  H2    . HOH K 6 .   ? -10.698 36.614 33.696 1.00 0.00  ? 1005 HOH B H2    1 
HETATM 5700 O  O     . HOH K 6 .   ? -15.128 36.877 29.434 1.00 48.13 ? 1006 HOH B O     1 
HETATM 5701 H  H1    . HOH K 6 .   ? -14.665 37.624 29.039 1.00 0.00  ? 1006 HOH B H1    1 
HETATM 5702 H  H2    . HOH K 6 .   ? -14.738 36.837 30.315 1.00 0.00  ? 1006 HOH B H2    1 
HETATM 5703 O  O     . HOH K 6 .   ? -16.231 25.472 35.604 1.00 40.47 ? 1007 HOH B O     1 
HETATM 5704 H  H1    . HOH K 6 .   ? -15.323 25.166 35.513 1.00 0.00  ? 1007 HOH B H1    1 
HETATM 5705 H  H2    . HOH K 6 .   ? -16.558 24.953 36.347 1.00 0.00  ? 1007 HOH B H2    1 
HETATM 5706 O  O     . HOH K 6 .   ? -20.772 23.000 20.594 1.00 27.08 ? 1008 HOH B O     1 
HETATM 5707 H  H1    . HOH K 6 .   ? -20.063 23.252 21.189 1.00 0.00  ? 1008 HOH B H1    1 
HETATM 5708 H  H2    . HOH K 6 .   ? -20.268 22.750 19.812 1.00 0.00  ? 1008 HOH B H2    1 
HETATM 5709 O  O     . HOH K 6 .   ? 7.389   27.845 36.180 1.00 42.04 ? 1009 HOH B O     1 
HETATM 5710 H  H1    . HOH K 6 .   ? 7.483   27.658 35.237 1.00 0.00  ? 1009 HOH B H1    1 
HETATM 5711 H  H2    . HOH K 6 .   ? 8.191   27.463 36.554 1.00 0.00  ? 1009 HOH B H2    1 
HETATM 5712 O  O     . HOH K 6 .   ? 12.347  24.155 36.081 1.00 35.13 ? 1010 HOH B O     1 
HETATM 5713 H  H1    . HOH K 6 .   ? 13.198  23.891 35.722 1.00 0.00  ? 1010 HOH B H1    1 
HETATM 5714 H  H2    . HOH K 6 .   ? 12.589  24.641 36.880 1.00 0.00  ? 1010 HOH B H2    1 
HETATM 5715 O  O     . HOH K 6 .   ? 11.154  28.868 45.538 1.00 46.96 ? 1011 HOH B O     1 
HETATM 5716 H  H1    . HOH K 6 .   ? 11.596  28.029 45.728 1.00 0.00  ? 1011 HOH B H1    1 
HETATM 5717 H  H2    . HOH K 6 .   ? 11.531  29.135 44.688 1.00 0.00  ? 1011 HOH B H2    1 
HETATM 5718 O  O     . HOH K 6 .   ? 7.816   31.101 36.490 1.00 22.94 ? 1012 HOH B O     1 
HETATM 5719 H  H1    . HOH K 6 .   ? 7.660   30.155 36.542 1.00 0.00  ? 1012 HOH B H1    1 
HETATM 5720 H  H2    . HOH K 6 .   ? 8.769   31.206 36.357 1.00 0.00  ? 1012 HOH B H2    1 
HETATM 5721 O  O     . HOH K 6 .   ? 6.792   17.998 33.991 1.00 40.22 ? 1013 HOH B O     1 
HETATM 5722 H  H1    . HOH K 6 .   ? 7.611   17.478 34.073 1.00 0.00  ? 1013 HOH B H1    1 
HETATM 5723 H  H2    . HOH K 6 .   ? 6.747   18.484 34.818 1.00 0.00  ? 1013 HOH B H2    1 
HETATM 5724 O  O     . HOH K 6 .   ? 2.677   17.459 37.894 1.00 45.62 ? 1014 HOH B O     1 
HETATM 5725 H  H1    . HOH K 6 .   ? 2.974   16.730 37.351 1.00 0.00  ? 1014 HOH B H1    1 
HETATM 5726 H  H2    . HOH K 6 .   ? 3.429   18.052 37.890 1.00 0.00  ? 1014 HOH B H2    1 
HETATM 5727 O  O     . HOH K 6 .   ? -36.476 18.368 14.083 1.00 59.01 ? 1015 HOH B O     1 
HETATM 5728 H  H1    . HOH K 6 .   ? -37.347 18.253 13.688 1.00 0.00  ? 1015 HOH B H1    1 
HETATM 5729 H  H2    . HOH K 6 .   ? -36.710 18.320 15.009 1.00 0.00  ? 1015 HOH B H2    1 
HETATM 5730 O  O     . HOH K 6 .   ? -0.806  30.827 51.431 1.00 49.83 ? 1016 HOH B O     1 
HETATM 5731 H  H1    . HOH K 6 .   ? 0.144   30.860 51.579 1.00 0.00  ? 1016 HOH B H1    1 
HETATM 5732 H  H2    . HOH K 6 .   ? -1.107  30.246 52.141 1.00 0.00  ? 1016 HOH B H2    1 
HETATM 5733 O  O     . HOH K 6 .   ? 11.838  26.056 38.223 1.00 54.05 ? 1017 HOH B O     1 
HETATM 5734 H  H1    . HOH K 6 .   ? 11.463  25.885 39.098 1.00 0.00  ? 1017 HOH B H1    1 
HETATM 5735 H  H2    . HOH K 6 .   ? 11.049  26.101 37.647 1.00 0.00  ? 1017 HOH B H2    1 
HETATM 5736 O  O     . HOH K 6 .   ? 23.614  41.113 73.565 1.00 48.69 ? 1018 HOH B O     1 
HETATM 5737 H  H1    . HOH K 6 .   ? 24.313  40.591 73.156 1.00 0.00  ? 1018 HOH B H1    1 
HETATM 5738 H  H2    . HOH K 6 .   ? 22.973  41.207 72.864 1.00 0.00  ? 1018 HOH B H2    1 
HETATM 5739 O  O     . HOH K 6 .   ? 19.912  40.152 72.616 1.00 66.64 ? 1019 HOH B O     1 
HETATM 5740 H  H1    . HOH K 6 .   ? 19.259  40.685 73.076 1.00 0.00  ? 1019 HOH B H1    1 
HETATM 5741 H  H2    . HOH K 6 .   ? 19.939  40.628 71.782 1.00 0.00  ? 1019 HOH B H2    1 
HETATM 5742 O  O     . HOH K 6 .   ? 19.155  42.967 68.959 1.00 51.76 ? 1020 HOH B O     1 
HETATM 5743 H  H1    . HOH K 6 .   ? 18.349  42.818 69.451 1.00 0.00  ? 1020 HOH B H1    1 
HETATM 5744 H  H2    . HOH K 6 .   ? 19.164  43.938 68.876 1.00 0.00  ? 1020 HOH B H2    1 
HETATM 5745 O  O     . HOH K 6 .   ? 16.692  40.753 66.424 1.00 45.28 ? 1021 HOH B O     1 
HETATM 5746 H  H1    . HOH K 6 .   ? 16.227  41.499 66.808 1.00 0.00  ? 1021 HOH B H1    1 
HETATM 5747 H  H2    . HOH K 6 .   ? 16.797  41.068 65.501 1.00 0.00  ? 1021 HOH B H2    1 
HETATM 5748 O  O     . HOH K 6 .   ? 26.927  31.267 60.269 1.00 42.74 ? 1022 HOH B O     1 
HETATM 5749 H  H1    . HOH K 6 .   ? 27.538  30.542 60.490 1.00 0.00  ? 1022 HOH B H1    1 
HETATM 5750 H  H2    . HOH K 6 .   ? 26.519  31.442 61.127 1.00 0.00  ? 1022 HOH B H2    1 
HETATM 5751 O  O     . HOH K 6 .   ? 27.460  28.672 59.493 1.00 46.22 ? 1023 HOH B O     1 
HETATM 5752 H  H1    . HOH K 6 .   ? 27.900  28.416 58.658 1.00 0.00  ? 1023 HOH B H1    1 
HETATM 5753 H  H2    . HOH K 6 .   ? 27.041  29.512 59.266 1.00 0.00  ? 1023 HOH B H2    1 
HETATM 5754 O  O     . HOH K 6 .   ? 23.639  31.761 47.939 1.00 19.55 ? 1024 HOH B O     1 
HETATM 5755 H  H1    . HOH K 6 .   ? 24.489  32.038 47.551 1.00 0.00  ? 1024 HOH B H1    1 
HETATM 5756 H  H2    . HOH K 6 .   ? 23.609  32.379 48.681 1.00 0.00  ? 1024 HOH B H2    1 
HETATM 5757 O  O     . HOH K 6 .   ? 28.130  40.196 67.500 1.00 27.62 ? 1025 HOH B O     1 
HETATM 5758 H  H1    . HOH K 6 .   ? 28.180  41.021 67.989 1.00 0.00  ? 1025 HOH B H1    1 
HETATM 5759 H  H2    . HOH K 6 .   ? 28.210  39.525 68.219 1.00 0.00  ? 1025 HOH B H2    1 
HETATM 5760 O  O     . HOH K 6 .   ? 30.276  40.978 62.597 1.00 29.75 ? 1026 HOH B O     1 
HETATM 5761 H  H1    . HOH K 6 .   ? 29.559  41.034 63.252 1.00 0.00  ? 1026 HOH B H1    1 
HETATM 5762 H  H2    . HOH K 6 .   ? 31.047  40.822 63.156 1.00 0.00  ? 1026 HOH B H2    1 
HETATM 5763 O  O     . HOH K 6 .   ? 29.549  38.042 57.205 1.00 34.80 ? 1027 HOH B O     1 
HETATM 5764 H  H1    . HOH K 6 .   ? 29.365  38.007 58.148 1.00 0.00  ? 1027 HOH B H1    1 
HETATM 5765 H  H2    . HOH K 6 .   ? 30.039  38.869 57.119 1.00 0.00  ? 1027 HOH B H2    1 
HETATM 5766 O  O     . HOH K 6 .   ? 29.833  36.371 50.441 1.00 66.82 ? 1028 HOH B O     1 
HETATM 5767 H  H1    . HOH K 6 .   ? 30.093  35.508 50.091 1.00 0.00  ? 1028 HOH B H1    1 
HETATM 5768 H  H2    . HOH K 6 .   ? 29.937  36.253 51.393 1.00 0.00  ? 1028 HOH B H2    1 
HETATM 5769 O  O     . HOH K 6 .   ? 13.466  52.436 30.603 1.00 42.96 ? 1029 HOH B O     1 
HETATM 5770 H  H1    . HOH K 6 .   ? 13.439  51.560 31.002 1.00 0.00  ? 1029 HOH B H1    1 
HETATM 5771 H  H2    . HOH K 6 .   ? 13.054  52.270 29.754 1.00 0.00  ? 1029 HOH B H2    1 
HETATM 5772 O  O     . HOH K 6 .   ? 21.237  49.217 28.904 1.00 37.98 ? 1030 HOH B O     1 
HETATM 5773 H  H1    . HOH K 6 .   ? 21.940  48.653 29.219 1.00 0.00  ? 1030 HOH B H1    1 
HETATM 5774 H  H2    . HOH K 6 .   ? 21.517  49.493 28.017 1.00 0.00  ? 1030 HOH B H2    1 
HETATM 5775 O  O     . HOH K 6 .   ? 21.467  50.320 26.341 1.00 50.93 ? 1031 HOH B O     1 
HETATM 5776 H  H1    . HOH K 6 .   ? 21.910  50.713 25.587 1.00 0.00  ? 1031 HOH B H1    1 
HETATM 5777 H  H2    . HOH K 6 .   ? 20.548  50.561 26.210 1.00 0.00  ? 1031 HOH B H2    1 
HETATM 5778 O  O     . HOH K 6 .   ? -20.624 17.249 25.889 1.00 29.82 ? 1032 HOH B O     1 
HETATM 5779 H  H1    . HOH K 6 .   ? -20.092 16.963 25.131 1.00 0.00  ? 1032 HOH B H1    1 
HETATM 5780 H  H2    . HOH K 6 .   ? -19.993 17.627 26.491 1.00 0.00  ? 1032 HOH B H2    1 
HETATM 5781 O  O     . HOH K 6 .   ? -18.255 35.486 14.578 1.00 30.12 ? 1033 HOH B O     1 
HETATM 5782 H  H1    . HOH K 6 .   ? -18.895 35.301 15.277 1.00 0.00  ? 1033 HOH B H1    1 
HETATM 5783 H  H2    . HOH K 6 .   ? -18.633 35.056 13.810 1.00 0.00  ? 1033 HOH B H2    1 
HETATM 5784 O  O     . HOH K 6 .   ? 3.120   34.905 70.413 1.00 43.69 ? 1034 HOH B O     1 
HETATM 5785 H  H1    . HOH K 6 .   ? 2.956   34.448 69.581 1.00 0.00  ? 1034 HOH B H1    1 
HETATM 5786 H  H2    . HOH K 6 .   ? 3.571   34.227 70.920 1.00 0.00  ? 1034 HOH B H2    1 
HETATM 5787 O  O     . HOH K 6 .   ? -34.983 34.625 18.720 1.00 39.28 ? 1035 HOH B O     1 
HETATM 5788 H  H1    . HOH K 6 .   ? -34.264 34.076 19.044 1.00 0.00  ? 1035 HOH B H1    1 
HETATM 5789 H  H2    . HOH K 6 .   ? -35.070 34.327 17.810 1.00 0.00  ? 1035 HOH B H2    1 
HETATM 5790 O  O     . HOH K 6 .   ? -38.317 19.958 29.639 1.00 45.26 ? 1036 HOH B O     1 
HETATM 5791 H  H1    . HOH K 6 .   ? -38.211 19.021 29.875 1.00 0.00  ? 1036 HOH B H1    1 
HETATM 5792 H  H2    . HOH K 6 .   ? -38.089 19.927 28.705 1.00 0.00  ? 1036 HOH B H2    1 
HETATM 5793 O  O     . HOH K 6 .   ? -41.340 18.236 21.506 1.00 44.21 ? 1037 HOH B O     1 
HETATM 5794 H  H1    . HOH K 6 .   ? -42.111 18.195 20.934 1.00 0.00  ? 1037 HOH B H1    1 
HETATM 5795 H  H2    . HOH K 6 .   ? -41.695 18.168 22.391 1.00 0.00  ? 1037 HOH B H2    1 
HETATM 5796 O  O     . HOH K 6 .   ? -42.420 10.243 26.012 1.00 53.42 ? 1038 HOH B O     1 
HETATM 5797 H  H1    . HOH K 6 .   ? -42.930 9.427  26.092 1.00 0.00  ? 1038 HOH B H1    1 
HETATM 5798 H  H2    . HOH K 6 .   ? -43.072 10.926 26.180 1.00 0.00  ? 1038 HOH B H2    1 
HETATM 5799 O  O     . HOH K 6 .   ? -40.641 10.979 31.122 1.00 35.38 ? 1039 HOH B O     1 
HETATM 5800 H  H1    . HOH K 6 .   ? -41.417 10.956 31.672 1.00 0.00  ? 1039 HOH B H1    1 
HETATM 5801 H  H2    . HOH K 6 .   ? -40.679 11.865 30.723 1.00 0.00  ? 1039 HOH B H2    1 
HETATM 5802 O  O     . HOH K 6 .   ? -33.472 10.188 28.853 1.00 41.02 ? 1040 HOH B O     1 
HETATM 5803 H  H1    . HOH K 6 .   ? -34.103 10.354 29.573 1.00 0.00  ? 1040 HOH B H1    1 
HETATM 5804 H  H2    . HOH K 6 .   ? -33.465 9.228  28.776 1.00 0.00  ? 1040 HOH B H2    1 
HETATM 5805 O  O     . HOH K 6 .   ? -32.862 7.579  33.739 1.00 33.58 ? 1041 HOH B O     1 
HETATM 5806 H  H1    . HOH K 6 .   ? -33.115 7.001  34.465 1.00 0.00  ? 1041 HOH B H1    1 
HETATM 5807 H  H2    . HOH K 6 .   ? -33.643 8.155  33.763 1.00 0.00  ? 1041 HOH B H2    1 
HETATM 5808 O  O     . HOH K 6 .   ? 2.478   32.611 69.081 1.00 57.52 ? 1042 HOH B O     1 
HETATM 5809 H  H1    . HOH K 6 .   ? 2.073   33.084 68.338 1.00 0.00  ? 1042 HOH B H1    1 
HETATM 5810 H  H2    . HOH K 6 .   ? 1.715   32.148 69.464 1.00 0.00  ? 1042 HOH B H2    1 
HETATM 5811 O  O     . HOH K 6 .   ? -26.283 29.738 39.463 1.00 39.99 ? 1043 HOH B O     1 
HETATM 5812 H  H1    . HOH K 6 .   ? -26.700 29.170 40.132 1.00 0.00  ? 1043 HOH B H1    1 
HETATM 5813 H  H2    . HOH K 6 .   ? -25.541 29.186 39.186 1.00 0.00  ? 1043 HOH B H2    1 
HETATM 5814 O  O     . HOH K 6 .   ? -13.793 35.176 35.350 1.00 18.88 ? 1044 HOH B O     1 
HETATM 5815 H  H1    . HOH K 6 .   ? -12.972 35.550 35.000 1.00 0.00  ? 1044 HOH B H1    1 
HETATM 5816 H  H2    . HOH K 6 .   ? -13.560 35.044 36.282 1.00 0.00  ? 1044 HOH B H2    1 
HETATM 5817 O  O     . HOH K 6 .   ? -13.012 24.881 36.830 1.00 51.11 ? 1045 HOH B O     1 
HETATM 5818 H  H1    . HOH K 6 .   ? -12.311 25.349 36.353 1.00 0.00  ? 1045 HOH B H1    1 
HETATM 5819 H  H2    . HOH K 6 .   ? -12.448 24.286 37.355 1.00 0.00  ? 1045 HOH B H2    1 
HETATM 5820 O  O     . HOH K 6 .   ? -9.180  33.945 25.547 1.00 33.38 ? 1046 HOH B O     1 
HETATM 5821 H  H1    . HOH K 6 .   ? -8.988  34.556 26.261 1.00 0.00  ? 1046 HOH B H1    1 
HETATM 5822 H  H2    . HOH K 6 .   ? -8.537  33.217 25.660 1.00 0.00  ? 1046 HOH B H2    1 
HETATM 5823 O  O     . HOH K 6 .   ? -7.875  23.756 27.443 1.00 53.09 ? 1047 HOH B O     1 
HETATM 5824 H  H1    . HOH K 6 .   ? -7.042  23.860 26.984 1.00 0.00  ? 1047 HOH B H1    1 
HETATM 5825 H  H2    . HOH K 6 .   ? -7.758  22.957 27.967 1.00 0.00  ? 1047 HOH B H2    1 
HETATM 5826 O  O     . HOH K 6 .   ? -19.106 39.052 43.426 1.00 34.20 ? 1048 HOH B O     1 
HETATM 5827 H  H1    . HOH K 6 .   ? -19.116 38.528 42.617 1.00 0.00  ? 1048 HOH B H1    1 
HETATM 5828 H  H2    . HOH K 6 .   ? -19.481 39.883 43.110 1.00 0.00  ? 1048 HOH B H2    1 
HETATM 5829 O  O     . HOH K 6 .   ? -19.583 38.946 45.990 1.00 25.75 ? 1049 HOH B O     1 
HETATM 5830 H  H1    . HOH K 6 .   ? -20.263 38.371 45.664 1.00 0.00  ? 1049 HOH B H1    1 
HETATM 5831 H  H2    . HOH K 6 .   ? -18.923 38.867 45.279 1.00 0.00  ? 1049 HOH B H2    1 
HETATM 5832 O  O     . HOH K 6 .   ? 10.542  22.886 31.474 1.00 43.17 ? 1050 HOH B O     1 
HETATM 5833 H  H1    . HOH K 6 .   ? 9.714   23.358 31.603 1.00 0.00  ? 1050 HOH B H1    1 
HETATM 5834 H  H2    . HOH K 6 .   ? 10.326  21.986 31.702 1.00 0.00  ? 1050 HOH B H2    1 
HETATM 5835 O  O     . HOH K 6 .   ? -6.304  44.299 34.261 1.00 35.88 ? 1051 HOH B O     1 
HETATM 5836 H  H1    . HOH K 6 .   ? -6.288  43.597 34.914 1.00 0.00  ? 1051 HOH B H1    1 
HETATM 5837 H  H2    . HOH K 6 .   ? -6.743  43.873 33.528 1.00 0.00  ? 1051 HOH B H2    1 
HETATM 5838 O  O     . HOH K 6 .   ? -12.586 39.755 29.390 1.00 39.38 ? 1052 HOH B O     1 
HETATM 5839 H  H1    . HOH K 6 .   ? -11.922 39.612 30.075 1.00 0.00  ? 1052 HOH B H1    1 
HETATM 5840 H  H2    . HOH K 6 .   ? -13.289 40.180 29.889 1.00 0.00  ? 1052 HOH B H2    1 
HETATM 5841 O  O     . HOH K 6 .   ? -12.372 39.596 32.370 1.00 51.91 ? 1053 HOH B O     1 
HETATM 5842 H  H1    . HOH K 6 .   ? -12.989 39.849 33.071 1.00 0.00  ? 1053 HOH B H1    1 
HETATM 5843 H  H2    . HOH K 6 .   ? -11.996 38.790 32.747 1.00 0.00  ? 1053 HOH B H2    1 
HETATM 5844 O  O     . HOH K 6 .   ? -6.786  42.922 29.196 1.00 43.85 ? 1054 HOH B O     1 
HETATM 5845 H  H1    . HOH K 6 .   ? -5.939  42.966 28.754 1.00 0.00  ? 1054 HOH B H1    1 
HETATM 5846 H  H2    . HOH K 6 .   ? -7.236  42.200 28.755 1.00 0.00  ? 1054 HOH B H2    1 
HETATM 5847 O  O     . HOH K 6 .   ? -17.799 27.200 41.417 1.00 51.18 ? 1055 HOH B O     1 
HETATM 5848 H  H1    . HOH K 6 .   ? -17.193 27.040 40.690 1.00 0.00  ? 1055 HOH B H1    1 
HETATM 5849 H  H2    . HOH K 6 .   ? -17.535 28.067 41.730 1.00 0.00  ? 1055 HOH B H2    1 
HETATM 5850 O  O     . HOH K 6 .   ? -19.886 43.953 37.378 1.00 42.92 ? 1056 HOH B O     1 
HETATM 5851 H  H1    . HOH K 6 .   ? -20.221 43.874 38.284 1.00 0.00  ? 1056 HOH B H1    1 
HETATM 5852 H  H2    . HOH K 6 .   ? -20.647 44.172 36.837 1.00 0.00  ? 1056 HOH B H2    1 
HETATM 5853 O  O     . HOH K 6 .   ? 1.086   45.745 37.523 1.00 32.93 ? 1057 HOH B O     1 
HETATM 5854 H  H1    . HOH K 6 .   ? 1.725   45.484 36.858 1.00 0.00  ? 1057 HOH B H1    1 
HETATM 5855 H  H2    . HOH K 6 .   ? 0.980   44.992 38.124 1.00 0.00  ? 1057 HOH B H2    1 
HETATM 5856 O  O     . HOH K 6 .   ? 21.114  23.346 41.561 1.00 44.20 ? 1058 HOH B O     1 
HETATM 5857 H  H1    . HOH K 6 .   ? 22.052  23.164 41.666 1.00 0.00  ? 1058 HOH B H1    1 
HETATM 5858 H  H2    . HOH K 6 .   ? 21.011  23.279 40.601 1.00 0.00  ? 1058 HOH B H2    1 
HETATM 5859 O  O     . HOH K 6 .   ? -6.674  53.509 44.900 1.00 62.22 ? 1059 HOH B O     1 
HETATM 5860 H  H1    . HOH K 6 .   ? -6.840  53.426 45.839 1.00 0.00  ? 1059 HOH B H1    1 
HETATM 5861 H  H2    . HOH K 6 .   ? -5.937  52.915 44.755 1.00 0.00  ? 1059 HOH B H2    1 
HETATM 5862 O  O     . HOH K 6 .   ? 0.671   19.364 36.459 1.00 56.00 ? 1060 HOH B O     1 
HETATM 5863 H  H1    . HOH K 6 .   ? 0.781   18.505 36.908 1.00 0.00  ? 1060 HOH B H1    1 
HETATM 5864 H  H2    . HOH K 6 .   ? 0.407   19.900 37.215 1.00 0.00  ? 1060 HOH B H2    1 
HETATM 5865 O  O     . HOH K 6 .   ? -11.142 24.309 39.918 1.00 31.64 ? 1061 HOH B O     1 
HETATM 5866 H  H1    . HOH K 6 .   ? -11.887 24.386 40.518 1.00 0.00  ? 1061 HOH B H1    1 
HETATM 5867 H  H2    . HOH K 6 .   ? -10.534 24.982 40.261 1.00 0.00  ? 1061 HOH B H2    1 
HETATM 5868 O  O     . HOH K 6 .   ? -31.150 24.763 15.749 1.00 48.41 ? 1062 HOH B O     1 
HETATM 5869 H  H1    . HOH K 6 .   ? -32.060 25.115 15.665 1.00 0.00  ? 1062 HOH B H1    1 
HETATM 5870 H  H2    . HOH K 6 .   ? -31.246 23.869 15.416 1.00 0.00  ? 1062 HOH B H2    1 
HETATM 5871 O  O     . HOH K 6 .   ? 18.985  43.921 62.311 1.00 27.25 ? 1063 HOH B O     1 
HETATM 5872 H  H1    . HOH K 6 .   ? 19.707  43.652 61.750 1.00 0.00  ? 1063 HOH B H1    1 
HETATM 5873 H  H2    . HOH K 6 .   ? 18.937  43.258 63.008 1.00 0.00  ? 1063 HOH B H2    1 
HETATM 5874 O  O     . HOH K 6 .   ? 26.282  46.189 64.613 1.00 45.28 ? 1064 HOH B O     1 
HETATM 5875 H  H1    . HOH K 6 .   ? 25.942  45.592 65.289 1.00 0.00  ? 1064 HOH B H1    1 
HETATM 5876 H  H2    . HOH K 6 .   ? 25.582  46.189 63.950 1.00 0.00  ? 1064 HOH B H2    1 
HETATM 5877 O  O     . HOH K 6 .   ? 16.310  35.195 65.176 1.00 32.69 ? 1065 HOH B O     1 
HETATM 5878 H  H1    . HOH K 6 .   ? 15.922  35.925 65.682 1.00 0.00  ? 1065 HOH B H1    1 
HETATM 5879 H  H2    . HOH K 6 .   ? 15.621  34.960 64.536 1.00 0.00  ? 1065 HOH B H2    1 
HETATM 5880 O  O     . HOH K 6 .   ? 13.087  29.235 65.845 1.00 59.09 ? 1066 HOH B O     1 
HETATM 5881 H  H1    . HOH K 6 .   ? 13.129  29.584 66.749 1.00 0.00  ? 1066 HOH B H1    1 
HETATM 5882 H  H2    . HOH K 6 .   ? 12.730  28.359 65.947 1.00 0.00  ? 1066 HOH B H2    1 
HETATM 5883 O  O     . HOH K 6 .   ? 5.820   24.430 70.690 1.00 73.94 ? 1067 HOH B O     1 
HETATM 5884 H  H1    . HOH K 6 .   ? 6.230   25.227 70.339 1.00 0.00  ? 1067 HOH B H1    1 
HETATM 5885 H  H2    . HOH K 6 .   ? 5.233   24.197 69.969 1.00 0.00  ? 1067 HOH B H2    1 
HETATM 5886 O  O     . HOH K 6 .   ? 4.437   27.510 63.557 1.00 62.21 ? 1068 HOH B O     1 
HETATM 5887 H  H1    . HOH K 6 .   ? 4.853   27.241 64.386 1.00 0.00  ? 1068 HOH B H1    1 
HETATM 5888 H  H2    . HOH K 6 .   ? 3.507   27.613 63.798 1.00 0.00  ? 1068 HOH B H2    1 
HETATM 5889 O  O     . HOH K 6 .   ? 14.783  52.684 46.458 1.00 31.04 ? 1069 HOH B O     1 
HETATM 5890 H  H1    . HOH K 6 .   ? 14.880  51.920 45.887 1.00 0.00  ? 1069 HOH B H1    1 
HETATM 5891 H  H2    . HOH K 6 .   ? 15.623  52.716 46.931 1.00 0.00  ? 1069 HOH B H2    1 
HETATM 5892 O  O     . HOH K 6 .   ? -0.542  39.153 66.110 1.00 47.42 ? 1070 HOH B O     1 
HETATM 5893 H  H1    . HOH K 6 .   ? -0.362  38.287 65.703 1.00 0.00  ? 1070 HOH B H1    1 
HETATM 5894 H  H2    . HOH K 6 .   ? -1.218  39.486 65.506 1.00 0.00  ? 1070 HOH B H2    1 
HETATM 5895 O  O     . HOH K 6 .   ? 6.098   45.828 59.198 1.00 29.02 ? 1071 HOH B O     1 
HETATM 5896 H  H1    . HOH K 6 .   ? 6.428   46.473 58.550 1.00 0.00  ? 1071 HOH B H1    1 
HETATM 5897 H  H2    . HOH K 6 .   ? 5.465   46.329 59.747 1.00 0.00  ? 1071 HOH B H2    1 
HETATM 5898 O  O     . HOH K 6 .   ? 6.341   43.493 60.584 1.00 30.00 ? 1072 HOH B O     1 
HETATM 5899 H  H1    . HOH K 6 .   ? 6.401   43.513 61.550 1.00 0.00  ? 1072 HOH B H1    1 
HETATM 5900 H  H2    . HOH K 6 .   ? 6.752   44.350 60.365 1.00 0.00  ? 1072 HOH B H2    1 
HETATM 5901 O  O     . HOH K 6 .   ? 0.451   41.327 67.240 1.00 48.29 ? 1073 HOH B O     1 
HETATM 5902 H  H1    . HOH K 6 .   ? 0.051   40.540 66.833 1.00 0.00  ? 1073 HOH B H1    1 
HETATM 5903 H  H2    . HOH K 6 .   ? 0.217   41.197 68.152 1.00 0.00  ? 1073 HOH B H2    1 
HETATM 5904 O  O     . HOH K 6 .   ? 3.066   52.870 54.388 1.00 59.23 ? 1074 HOH B O     1 
HETATM 5905 H  H1    . HOH K 6 .   ? 2.427   52.176 54.232 1.00 0.00  ? 1074 HOH B H1    1 
HETATM 5906 H  H2    . HOH K 6 .   ? 3.756   52.423 54.881 1.00 0.00  ? 1074 HOH B H2    1 
HETATM 5907 O  O     . HOH K 6 .   ? 10.442  56.224 37.262 1.00 56.08 ? 1075 HOH B O     1 
HETATM 5908 H  H1    . HOH K 6 .   ? 10.945  56.994 37.543 1.00 0.00  ? 1075 HOH B H1    1 
HETATM 5909 H  H2    . HOH K 6 .   ? 10.559  56.222 36.306 1.00 0.00  ? 1075 HOH B H2    1 
HETATM 5910 O  O     . HOH K 6 .   ? -35.658 9.920  30.921 1.00 34.96 ? 1076 HOH B O     1 
HETATM 5911 H  H1    . HOH K 6 .   ? -36.509 9.723  30.512 1.00 0.00  ? 1076 HOH B H1    1 
HETATM 5912 H  H2    . HOH K 6 .   ? -35.968 9.997  31.837 1.00 0.00  ? 1076 HOH B H2    1 
HETATM 5913 O  O     . HOH K 6 .   ? -37.158 4.534  33.007 1.00 71.92 ? 1077 HOH B O     1 
HETATM 5914 H  H1    . HOH K 6 .   ? -37.072 5.382  33.447 1.00 0.00  ? 1077 HOH B H1    1 
HETATM 5915 H  H2    . HOH K 6 .   ? -37.977 4.202  33.385 1.00 0.00  ? 1077 HOH B H2    1 
HETATM 5916 O  O     . HOH K 6 .   ? -32.560 8.013  36.531 1.00 25.62 ? 1078 HOH B O     1 
HETATM 5917 H  H1    . HOH K 6 .   ? -32.330 7.396  37.239 1.00 0.00  ? 1078 HOH B H1    1 
HETATM 5918 H  H2    . HOH K 6 .   ? -31.849 7.849  35.894 1.00 0.00  ? 1078 HOH B H2    1 
HETATM 5919 O  O     . HOH K 6 .   ? -37.091 14.248 40.236 1.00 47.65 ? 1079 HOH B O     1 
HETATM 5920 H  H1    . HOH K 6 .   ? -36.613 14.924 40.746 1.00 0.00  ? 1079 HOH B H1    1 
HETATM 5921 H  H2    . HOH K 6 .   ? -36.647 13.465 40.553 1.00 0.00  ? 1079 HOH B H2    1 
HETATM 5922 O  O     . HOH K 6 .   ? 2.660   23.403 40.178 1.00 25.98 ? 1080 HOH B O     1 
HETATM 5923 H  H1    . HOH K 6 .   ? 2.035   23.701 40.849 1.00 0.00  ? 1080 HOH B H1    1 
HETATM 5924 H  H2    . HOH K 6 .   ? 2.369   23.815 39.367 1.00 0.00  ? 1080 HOH B H2    1 
HETATM 5925 O  O     . HOH K 6 .   ? 0.137   20.028 34.063 1.00 41.63 ? 1081 HOH B O     1 
HETATM 5926 H  H1    . HOH K 6 .   ? 0.177   19.140 33.694 1.00 0.00  ? 1081 HOH B H1    1 
HETATM 5927 H  H2    . HOH K 6 .   ? 0.365   19.795 35.004 1.00 0.00  ? 1081 HOH B H2    1 
HETATM 5928 O  O     . HOH K 6 .   ? -13.877 21.138 31.035 1.00 44.90 ? 1082 HOH B O     1 
HETATM 5929 H  H1    . HOH K 6 .   ? -13.454 20.555 31.670 1.00 0.00  ? 1082 HOH B H1    1 
HETATM 5930 H  H2    . HOH K 6 .   ? -14.011 21.941 31.571 1.00 0.00  ? 1082 HOH B H2    1 
HETATM 5931 O  O     . HOH K 6 .   ? -18.946 20.244 31.921 1.00 55.53 ? 1083 HOH B O     1 
HETATM 5932 H  H1    . HOH K 6 .   ? -18.478 20.248 31.077 1.00 0.00  ? 1083 HOH B H1    1 
HETATM 5933 H  H2    . HOH K 6 .   ? -18.494 19.573 32.437 1.00 0.00  ? 1083 HOH B H2    1 
HETATM 5934 O  O     . HOH K 6 .   ? -10.204 21.621 35.989 1.00 39.63 ? 1084 HOH B O     1 
HETATM 5935 H  H1    . HOH K 6 .   ? -10.312 22.518 36.358 1.00 0.00  ? 1084 HOH B H1    1 
HETATM 5936 H  H2    . HOH K 6 .   ? -9.574  21.747 35.287 1.00 0.00  ? 1084 HOH B H2    1 
HETATM 5937 O  O     . HOH K 6 .   ? -13.897 23.784 33.667 1.00 47.12 ? 1085 HOH B O     1 
HETATM 5938 H  H1    . HOH K 6 .   ? -13.861 24.585 33.120 1.00 0.00  ? 1085 HOH B H1    1 
HETATM 5939 H  H2    . HOH K 6 .   ? -13.703 24.117 34.550 1.00 0.00  ? 1085 HOH B H2    1 
HETATM 5940 O  O     . HOH K 6 .   ? -4.504  22.304 29.398 1.00 81.92 ? 1086 HOH B O     1 
HETATM 5941 H  H1    . HOH K 6 .   ? -3.864  22.486 30.096 1.00 0.00  ? 1086 HOH B H1    1 
HETATM 5942 H  H2    . HOH K 6 .   ? -4.024  22.465 28.585 1.00 0.00  ? 1086 HOH B H2    1 
HETATM 5943 O  O     . HOH K 6 .   ? -0.421  24.843 55.796 1.00 20.64 ? 1087 HOH B O     1 
HETATM 5944 H  H1    . HOH K 6 .   ? -0.499  24.189 55.104 1.00 0.00  ? 1087 HOH B H1    1 
HETATM 5945 H  H2    . HOH K 6 .   ? 0.399   25.274 55.570 1.00 0.00  ? 1087 HOH B H2    1 
HETATM 5946 O  O     . HOH K 6 .   ? -6.760  30.146 59.428 1.00 35.13 ? 1088 HOH B O     1 
HETATM 5947 H  H1    . HOH K 6 .   ? -7.219  30.801 59.974 1.00 0.00  ? 1088 HOH B H1    1 
HETATM 5948 H  H2    . HOH K 6 .   ? -7.489  29.645 59.047 1.00 0.00  ? 1088 HOH B H2    1 
HETATM 5949 O  O     . HOH K 6 .   ? -8.144  34.894 58.124 1.00 40.83 ? 1089 HOH B O     1 
HETATM 5950 H  H1    . HOH K 6 .   ? -8.277  34.173 57.471 1.00 0.00  ? 1089 HOH B H1    1 
HETATM 5951 H  H2    . HOH K 6 .   ? -8.961  35.410 58.068 1.00 0.00  ? 1089 HOH B H2    1 
HETATM 5952 O  O     . HOH K 6 .   ? -13.178 32.310 54.150 1.00 46.93 ? 1090 HOH B O     1 
HETATM 5953 H  H1    . HOH K 6 .   ? -13.468 33.041 53.591 1.00 0.00  ? 1090 HOH B H1    1 
HETATM 5954 H  H2    . HOH K 6 .   ? -12.312 32.604 54.450 1.00 0.00  ? 1090 HOH B H2    1 
HETATM 5955 O  O     . HOH K 6 .   ? -17.851 45.722 37.097 1.00 45.75 ? 1091 HOH B O     1 
HETATM 5956 H  H1    . HOH K 6 .   ? -18.200 45.840 36.211 1.00 0.00  ? 1091 HOH B H1    1 
HETATM 5957 H  H2    . HOH K 6 .   ? -18.522 45.081 37.436 1.00 0.00  ? 1091 HOH B H2    1 
HETATM 5958 O  O     . HOH K 6 .   ? -26.171 36.394 38.833 1.00 55.11 ? 1092 HOH B O     1 
HETATM 5959 H  H1    . HOH K 6 .   ? -26.656 35.890 39.493 1.00 0.00  ? 1092 HOH B H1    1 
HETATM 5960 H  H2    . HOH K 6 .   ? -25.473 36.806 39.353 1.00 0.00  ? 1092 HOH B H2    1 
HETATM 5961 O  O     . HOH K 6 .   ? -26.232 42.034 35.988 1.00 58.12 ? 1093 HOH B O     1 
HETATM 5962 H  H1    . HOH K 6 .   ? -26.095 42.829 35.462 1.00 0.00  ? 1093 HOH B H1    1 
HETATM 5963 H  H2    . HOH K 6 .   ? -26.921 41.560 35.501 1.00 0.00  ? 1093 HOH B H2    1 
HETATM 5964 O  O     . HOH K 6 .   ? -29.289 32.946 43.438 1.00 43.21 ? 1094 HOH B O     1 
HETATM 5965 H  H1    . HOH K 6 .   ? -28.818 32.896 44.278 1.00 0.00  ? 1094 HOH B H1    1 
HETATM 5966 H  H2    . HOH K 6 .   ? -29.471 33.880 43.325 1.00 0.00  ? 1094 HOH B H2    1 
HETATM 5967 O  O     . HOH K 6 .   ? -26.823 27.958 44.923 1.00 49.93 ? 1095 HOH B O     1 
HETATM 5968 H  H1    . HOH K 6 .   ? -27.566 28.298 45.419 1.00 0.00  ? 1095 HOH B H1    1 
HETATM 5969 H  H2    . HOH K 6 .   ? -26.248 28.725 44.949 1.00 0.00  ? 1095 HOH B H2    1 
HETATM 5970 O  O     . HOH K 6 .   ? -27.837 30.575 43.999 1.00 49.34 ? 1096 HOH B O     1 
HETATM 5971 H  H1    . HOH K 6 .   ? -27.029 30.434 43.491 1.00 0.00  ? 1096 HOH B H1    1 
HETATM 5972 H  H2    . HOH K 6 .   ? -28.264 31.260 43.461 1.00 0.00  ? 1096 HOH B H2    1 
HETATM 5973 O  O     . HOH K 6 .   ? -27.363 27.609 41.168 1.00 45.86 ? 1097 HOH B O     1 
HETATM 5974 H  H1    . HOH K 6 .   ? -27.976 27.314 41.846 1.00 0.00  ? 1097 HOH B H1    1 
HETATM 5975 H  H2    . HOH K 6 .   ? -26.514 27.427 41.589 1.00 0.00  ? 1097 HOH B H2    1 
HETATM 5976 O  O     . HOH K 6 .   ? -6.976  31.503 26.022 1.00 56.49 ? 1098 HOH B O     1 
HETATM 5977 H  H1    . HOH K 6 .   ? -6.116  31.833 26.273 1.00 0.00  ? 1098 HOH B H1    1 
HETATM 5978 H  H2    . HOH K 6 .   ? -7.130  30.783 26.654 1.00 0.00  ? 1098 HOH B H2    1 
HETATM 5979 O  O     . HOH K 6 .   ? -40.675 29.848 32.792 1.00 48.55 ? 1099 HOH B O     1 
HETATM 5980 H  H1    . HOH K 6 .   ? -40.396 29.051 33.265 1.00 0.00  ? 1099 HOH B H1    1 
HETATM 5981 H  H2    . HOH K 6 .   ? -41.628 29.802 32.890 1.00 0.00  ? 1099 HOH B H2    1 
HETATM 5982 O  O     . HOH K 6 .   ? 25.049  53.704 33.833 1.00 45.17 ? 1100 HOH B O     1 
HETATM 5983 H  H1    . HOH K 6 .   ? 25.075  54.379 34.501 1.00 0.00  ? 1100 HOH B H1    1 
HETATM 5984 H  H2    . HOH K 6 .   ? 24.451  53.056 34.253 1.00 0.00  ? 1100 HOH B H2    1 
HETATM 5985 O  O     . HOH K 6 .   ? -10.900 52.819 52.849 1.00 67.66 ? 1101 HOH B O     1 
HETATM 5986 H  H1    . HOH K 6 .   ? -10.771 52.016 53.376 1.00 0.00  ? 1101 HOH B H1    1 
HETATM 5987 H  H2    . HOH K 6 .   ? -10.864 53.510 53.510 1.00 0.00  ? 1101 HOH B H2    1 
HETATM 5988 O  O     . HOH K 6 .   ? -9.922  53.209 46.829 1.00 93.71 ? 1102 HOH B O     1 
HETATM 5989 H  H1    . HOH K 6 .   ? -9.315  52.685 46.286 1.00 0.00  ? 1102 HOH B H1    1 
HETATM 5990 H  H2    . HOH K 6 .   ? -10.087 53.972 46.266 1.00 0.00  ? 1102 HOH B H2    1 
HETATM 5991 O  O     . HOH K 6 .   ? -11.845 46.182 47.932 1.00 53.75 ? 1103 HOH B O     1 
HETATM 5992 H  H1    . HOH K 6 .   ? -11.485 45.367 48.283 1.00 0.00  ? 1103 HOH B H1    1 
HETATM 5993 H  H2    . HOH K 6 .   ? -11.729 46.777 48.682 1.00 0.00  ? 1103 HOH B H2    1 
HETATM 5994 O  O     . HOH K 6 .   ? 15.856  25.182 36.326 1.00 27.83 ? 1104 HOH B O     1 
HETATM 5995 H  H1    . HOH K 6 .   ? 16.671  24.706 36.073 1.00 0.00  ? 1104 HOH B H1    1 
HETATM 5996 H  H2    . HOH K 6 .   ? 15.440  25.107 35.462 1.00 0.00  ? 1104 HOH B H2    1 
HETATM 5997 O  O     . HOH K 6 .   ? -39.397 21.835 17.265 1.00 34.87 ? 1105 HOH B O     1 
HETATM 5998 H  H1    . HOH K 6 .   ? -39.423 20.937 16.922 1.00 0.00  ? 1105 HOH B H1    1 
HETATM 5999 H  H2    . HOH K 6 .   ? -40.325 22.119 17.269 1.00 0.00  ? 1105 HOH B H2    1 
HETATM 6000 O  O     . HOH K 6 .   ? -8.207  46.753 58.683 1.00 49.60 ? 1106 HOH B O     1 
HETATM 6001 H  H1    . HOH K 6 .   ? -8.390  45.826 58.908 1.00 0.00  ? 1106 HOH B H1    1 
HETATM 6002 H  H2    . HOH K 6 .   ? -9.089  47.122 58.622 1.00 0.00  ? 1106 HOH B H2    1 
HETATM 6003 O  O     . HOH K 6 .   ? 9.900   26.401 36.135 1.00 75.92 ? 1107 HOH B O     1 
HETATM 6004 H  H1    . HOH K 6 .   ? 9.110   26.089 35.671 1.00 0.00  ? 1107 HOH B H1    1 
HETATM 6005 H  H2    . HOH K 6 .   ? 10.568  25.908 35.629 1.00 0.00  ? 1107 HOH B H2    1 
HETATM 6006 O  O     . HOH K 6 .   ? -10.568 38.159 61.200 1.00 37.61 ? 1108 HOH B O     1 
HETATM 6007 H  H1    . HOH K 6 .   ? -10.752 39.053 61.591 1.00 0.00  ? 1108 HOH B H1    1 
HETATM 6008 H  H2    . HOH K 6 .   ? -10.235 38.417 60.331 1.00 0.00  ? 1108 HOH B H2    1 
HETATM 6009 O  O     . HOH K 6 .   ? -8.608  40.809 58.805 1.00 96.83 ? 1109 HOH B O     1 
HETATM 6010 H  H1    . HOH K 6 .   ? -8.354  39.896 58.969 1.00 0.00  ? 1109 HOH B H1    1 
HETATM 6011 H  H2    . HOH K 6 .   ? -8.895  40.798 57.885 1.00 0.00  ? 1109 HOH B H2    1 
HETATM 6012 O  O     . HOH K 6 .   ? -13.164 39.491 53.111 1.00 37.89 ? 1110 HOH B O     1 
HETATM 6013 H  H1    . HOH K 6 .   ? -13.426 39.900 53.938 1.00 0.00  ? 1110 HOH B H1    1 
HETATM 6014 H  H2    . HOH K 6 .   ? -13.705 38.682 53.061 1.00 0.00  ? 1110 HOH B H2    1 
HETATM 6015 O  O     . HOH K 6 .   ? -17.910 48.589 44.857 1.00 62.30 ? 1111 HOH B O     1 
HETATM 6016 H  H1    . HOH K 6 .   ? -18.531 48.585 44.122 1.00 0.00  ? 1111 HOH B H1    1 
HETATM 6017 H  H2    . HOH K 6 .   ? -17.108 48.248 44.448 1.00 0.00  ? 1111 HOH B H2    1 
HETATM 6018 O  O     . HOH K 6 .   ? -0.883  12.539 44.786 1.00 75.67 ? 1112 HOH B O     1 
HETATM 6019 H  H1    . HOH K 6 .   ? -0.204  13.225 44.647 1.00 0.00  ? 1112 HOH B H1    1 
HETATM 6020 H  H2    . HOH K 6 .   ? -0.445  11.759 44.445 1.00 0.00  ? 1112 HOH B H2    1 
HETATM 6021 O  O     . HOH K 6 .   ? -33.807 25.255 14.999 1.00 73.84 ? 1113 HOH B O     1 
HETATM 6022 H  H1    . HOH K 6 .   ? -34.524 24.618 14.927 1.00 0.00  ? 1113 HOH B H1    1 
HETATM 6023 H  H2    . HOH K 6 .   ? -33.807 25.690 14.140 1.00 0.00  ? 1113 HOH B H2    1 
HETATM 6024 O  O     . HOH K 6 .   ? -7.103  28.962 28.204 1.00 56.84 ? 1114 HOH B O     1 
HETATM 6025 H  H1    . HOH K 6 .   ? -7.822  29.515 28.534 1.00 0.00  ? 1114 HOH B H1    1 
HETATM 6026 H  H2    . HOH K 6 .   ? -7.494  28.090 28.291 1.00 0.00  ? 1114 HOH B H2    1 
HETATM 6027 O  O     . HOH K 6 .   ? 26.393  30.602 47.879 1.00 41.41 ? 1115 HOH B O     1 
HETATM 6028 H  H1    . HOH K 6 .   ? 27.241  30.182 48.051 1.00 0.00  ? 1115 HOH B H1    1 
HETATM 6029 H  H2    . HOH K 6 .   ? 26.136  30.809 48.781 1.00 0.00  ? 1115 HOH B H2    1 
HETATM 6030 O  O     . HOH K 6 .   ? 27.398  30.003 51.078 1.00 56.58 ? 1116 HOH B O     1 
HETATM 6031 H  H1    . HOH K 6 .   ? 27.793  30.882 51.140 1.00 0.00  ? 1116 HOH B H1    1 
HETATM 6032 H  H2    . HOH K 6 .   ? 27.002  29.914 51.955 1.00 0.00  ? 1116 HOH B H2    1 
HETATM 6033 O  O     . HOH K 6 .   ? 26.974  27.116 57.575 1.00 33.21 ? 1117 HOH B O     1 
HETATM 6034 H  H1    . HOH K 6 .   ? 26.669  27.358 58.466 1.00 0.00  ? 1117 HOH B H1    1 
HETATM 6035 H  H2    . HOH K 6 .   ? 26.451  26.343 57.366 1.00 0.00  ? 1117 HOH B H2    1 
HETATM 6036 O  O     . HOH K 6 .   ? 16.894  42.088 63.863 1.00 46.31 ? 1118 HOH B O     1 
HETATM 6037 H  H1    . HOH K 6 .   ? 16.602  42.978 64.103 1.00 0.00  ? 1118 HOH B H1    1 
HETATM 6038 H  H2    . HOH K 6 .   ? 16.169  41.756 63.293 1.00 0.00  ? 1118 HOH B H2    1 
HETATM 6039 O  O     . HOH K 6 .   ? 15.317  44.558 64.411 1.00 49.60 ? 1119 HOH B O     1 
HETATM 6040 H  H1    . HOH K 6 .   ? 14.509  45.066 64.513 1.00 0.00  ? 1119 HOH B H1    1 
HETATM 6041 H  H2    . HOH K 6 .   ? 15.662  44.898 63.573 1.00 0.00  ? 1119 HOH B H2    1 
HETATM 6042 O  O     . HOH K 6 .   ? 18.120  46.317 62.242 1.00 50.21 ? 1120 HOH B O     1 
HETATM 6043 H  H1    . HOH K 6 .   ? 18.178  46.480 61.307 1.00 0.00  ? 1120 HOH B H1    1 
HETATM 6044 H  H2    . HOH K 6 .   ? 18.539  45.408 62.277 1.00 0.00  ? 1120 HOH B H2    1 
HETATM 6045 O  O     . HOH K 6 .   ? 10.256  49.489 60.784 1.00 51.78 ? 1121 HOH B O     1 
HETATM 6046 H  H1    . HOH K 6 .   ? 9.696   50.095 60.297 1.00 0.00  ? 1121 HOH B H1    1 
HETATM 6047 H  H2    . HOH K 6 .   ? 10.761  49.027 60.122 1.00 0.00  ? 1121 HOH B H2    1 
HETATM 6048 O  O     . HOH K 6 .   ? 9.121   33.663 24.869 1.00 54.46 ? 1122 HOH B O     1 
HETATM 6049 H  H1    . HOH K 6 .   ? 9.648   34.363 25.258 1.00 0.00  ? 1122 HOH B H1    1 
HETATM 6050 H  H2    . HOH K 6 .   ? 8.565   33.369 25.597 1.00 0.00  ? 1122 HOH B H2    1 
HETATM 6051 O  O     . HOH K 6 .   ? 3.861   45.214 33.907 1.00 37.99 ? 1123 HOH B O     1 
HETATM 6052 H  H1    . HOH K 6 .   ? 4.253   46.086 33.781 1.00 0.00  ? 1123 HOH B H1    1 
HETATM 6053 H  H2    . HOH K 6 .   ? 3.277   45.194 33.127 1.00 0.00  ? 1123 HOH B H2    1 
HETATM 6054 O  O     . HOH K 6 .   ? 23.470  51.790 35.060 1.00 47.00 ? 1124 HOH B O     1 
HETATM 6055 H  H1    . HOH K 6 .   ? 24.040  51.230 34.508 1.00 0.00  ? 1124 HOH B H1    1 
HETATM 6056 H  H2    . HOH K 6 .   ? 23.395  51.247 35.853 1.00 0.00  ? 1124 HOH B H2    1 
HETATM 6057 O  O     . HOH K 6 .   ? -41.358 29.880 30.027 1.00 68.56 ? 1125 HOH B O     1 
HETATM 6058 H  H1    . HOH K 6 .   ? -40.788 30.411 30.596 1.00 0.00  ? 1125 HOH B H1    1 
HETATM 6059 H  H2    . HOH K 6 .   ? -40.786 29.156 29.774 1.00 0.00  ? 1125 HOH B H2    1 
HETATM 6060 O  O     . HOH K 6 .   ? 11.989  19.723 33.673 1.00 59.06 ? 1126 HOH B O     1 
HETATM 6061 H  H1    . HOH K 6 .   ? 11.245  19.873 33.068 1.00 0.00  ? 1126 HOH B H1    1 
HETATM 6062 H  H2    . HOH K 6 .   ? 12.514  20.500 33.453 1.00 0.00  ? 1126 HOH B H2    1 
HETATM 6063 O  O     . HOH K 6 .   ? 1.351   35.550 68.021 1.00 49.49 ? 1127 HOH B O     1 
HETATM 6064 H  H1    . HOH K 6 .   ? 0.604   35.131 67.577 1.00 0.00  ? 1127 HOH B H1    1 
HETATM 6065 H  H2    . HOH K 6 .   ? 1.026   35.766 68.898 1.00 0.00  ? 1127 HOH B H2    1 
HETATM 6066 O  O     . HOH K 6 .   ? 22.296  33.352 28.587 1.00 57.12 ? 1128 HOH B O     1 
HETATM 6067 H  H1    . HOH K 6 .   ? 22.141  34.101 28.009 1.00 0.00  ? 1128 HOH B H1    1 
HETATM 6068 H  H2    . HOH K 6 .   ? 21.523  33.343 29.165 1.00 0.00  ? 1128 HOH B H2    1 
HETATM 6069 O  O     . HOH K 6 .   ? 19.831  45.861 69.502 1.00 43.93 ? 1129 HOH B O     1 
HETATM 6070 H  H1    . HOH K 6 .   ? 20.733  45.936 69.173 1.00 0.00  ? 1129 HOH B H1    1 
HETATM 6071 H  H2    . HOH K 6 .   ? 19.445  46.717 69.293 1.00 0.00  ? 1129 HOH B H2    1 
HETATM 6072 O  O     . HOH K 6 .   ? -13.791 44.200 36.986 1.00 58.59 ? 1130 HOH B O     1 
HETATM 6073 H  H1    . HOH K 6 .   ? -14.706 44.483 36.833 1.00 0.00  ? 1130 HOH B H1    1 
HETATM 6074 H  H2    . HOH K 6 .   ? -13.296 45.022 36.886 1.00 0.00  ? 1130 HOH B H2    1 
HETATM 6075 O  O     . HOH K 6 .   ? -6.077  17.216 35.061 1.00 65.95 ? 1131 HOH B O     1 
HETATM 6076 H  H1    . HOH K 6 .   ? -5.886  16.478 35.637 1.00 0.00  ? 1131 HOH B H1    1 
HETATM 6077 H  H2    . HOH K 6 .   ? -5.643  16.960 34.237 1.00 0.00  ? 1131 HOH B H2    1 
HETATM 6078 O  O     . HOH K 6 .   ? -37.417 9.895  34.846 1.00 58.48 ? 1132 HOH B O     1 
HETATM 6079 H  H1    . HOH K 6 .   ? -36.901 10.704 34.710 1.00 0.00  ? 1132 HOH B H1    1 
HETATM 6080 H  H2    . HOH K 6 .   ? -37.362 9.740  35.796 1.00 0.00  ? 1132 HOH B H2    1 
HETATM 6081 O  O     . HOH K 6 .   ? -18.955 42.806 18.792 1.00 56.80 ? 1133 HOH B O     1 
HETATM 6082 H  H1    . HOH K 6 .   ? -19.605 42.226 19.201 1.00 0.00  ? 1133 HOH B H1    1 
HETATM 6083 H  H2    . HOH K 6 .   ? -18.130 42.546 19.207 1.00 0.00  ? 1133 HOH B H2    1 
HETATM 6084 O  O     . HOH K 6 .   ? -12.664 29.745 20.022 1.00 54.95 ? 1134 HOH B O     1 
HETATM 6085 H  H1    . HOH K 6 .   ? -13.125 29.241 20.705 1.00 0.00  ? 1134 HOH B H1    1 
HETATM 6086 H  H2    . HOH K 6 .   ? -11.988 30.215 20.518 1.00 0.00  ? 1134 HOH B H2    1 
HETATM 6087 O  O     . HOH K 6 .   ? -27.593 16.407 40.249 1.00 54.94 ? 1135 HOH B O     1 
HETATM 6088 H  H1    . HOH K 6 .   ? -27.011 16.805 39.592 1.00 0.00  ? 1135 HOH B H1    1 
HETATM 6089 H  H2    . HOH K 6 .   ? -27.981 15.688 39.735 1.00 0.00  ? 1135 HOH B H2    1 
HETATM 6090 O  O     . HOH K 6 .   ? -30.943 41.405 28.138 1.00 42.19 ? 1136 HOH B O     1 
HETATM 6091 H  H1    . HOH K 6 .   ? -30.585 40.518 28.315 1.00 0.00  ? 1136 HOH B H1    1 
HETATM 6092 H  H2    . HOH K 6 .   ? -31.890 41.247 28.161 1.00 0.00  ? 1136 HOH B H2    1 
HETATM 6093 O  O     . HOH K 6 .   ? 16.486  34.935 74.494 1.00 40.49 ? 1137 HOH B O     1 
HETATM 6094 H  H1    . HOH K 6 .   ? 15.995  34.960 73.662 1.00 0.00  ? 1137 HOH B H1    1 
HETATM 6095 H  H2    . HOH K 6 .   ? 15.823  35.207 75.136 1.00 0.00  ? 1137 HOH B H2    1 
HETATM 6096 O  O     . HOH K 6 .   ? -12.066 22.140 45.818 1.00 67.54 ? 1138 HOH B O     1 
HETATM 6097 H  H1    . HOH K 6 .   ? -11.230 21.690 45.617 1.00 0.00  ? 1138 HOH B H1    1 
HETATM 6098 H  H2    . HOH K 6 .   ? -12.701 21.419 45.821 1.00 0.00  ? 1138 HOH B H2    1 
HETATM 6099 O  O     . HOH K 6 .   ? -36.232 23.420 44.133 1.00 64.34 ? 1139 HOH B O     1 
HETATM 6100 H  H1    . HOH K 6 .   ? -36.116 23.548 45.084 1.00 0.00  ? 1139 HOH B H1    1 
HETATM 6101 H  H2    . HOH K 6 .   ? -36.298 24.312 43.786 1.00 0.00  ? 1139 HOH B H2    1 
HETATM 6102 O  O     . HOH K 6 .   ? 31.666  37.992 61.507 1.00 44.13 ? 1140 HOH B O     1 
HETATM 6103 H  H1    . HOH K 6 .   ? 32.120  38.841 61.568 1.00 0.00  ? 1140 HOH B H1    1 
HETATM 6104 H  H2    . HOH K 6 .   ? 30.742  38.264 61.542 1.00 0.00  ? 1140 HOH B H2    1 
HETATM 6105 O  O     . HOH K 6 .   ? 28.898  37.578 47.703 1.00 70.79 ? 1141 HOH B O     1 
HETATM 6106 H  H1    . HOH K 6 .   ? 29.201  37.476 48.619 1.00 0.00  ? 1141 HOH B H1    1 
HETATM 6107 H  H2    . HOH K 6 .   ? 29.080  38.494 47.492 1.00 0.00  ? 1141 HOH B H2    1 
HETATM 6108 O  O     . HOH K 6 .   ? 29.070  54.422 47.202 1.00 67.83 ? 1142 HOH B O     1 
HETATM 6109 H  H1    . HOH K 6 .   ? 28.505  54.384 46.420 1.00 0.00  ? 1142 HOH B H1    1 
HETATM 6110 H  H2    . HOH K 6 .   ? 29.474  55.283 47.124 1.00 0.00  ? 1142 HOH B H2    1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'BOG B 451 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   ?   ?   ?   A . n 
A 1 5   ARG 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  CYS 27  27  27  CYS CYS A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  CYS 39  39  39  CYS CYS A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  CYS 49  49  49  CYS CYS A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  CYS 61  61  61  CYS CYS A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  CYS 87  87  87  CYS CYS A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  ?   ?   ?   A . n 
A 1 92  ARG 92  92  ?   ?   ?   A . n 
A 1 93  SER 93  93  ?   ?   ?   A . n 
A 1 94  ASP 94  94  ?   ?   ?   A . n 
A 1 95  SER 95  95  ?   ?   ?   A . n 
B 2 1   LYS 1   1   1   LYS LYS B . n 
B 2 2   GLU 2   2   2   GLU GLU B . n 
B 2 3   VAL 3   3   3   VAL VAL B . n 
B 2 4   CYS 4   4   4   CYS CYS B . n 
B 2 5   TYR 5   5   5   TYR TYR B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   ARG 7   7   7   ARG ARG B . n 
B 2 8   LEU 8   8   8   LEU LEU B . n 
B 2 9   GLY 9   9   9   GLY GLY B . n 
B 2 10  CYS 10  10  10  CYS CYS B . n 
B 2 11  PHE 11  11  11  PHE PHE B . n 
B 2 12  SER 12  12  12  SER SER B . n 
B 2 13  ASP 13  13  13  ASP ASP B . n 
B 2 14  ASP 14  14  14  ASP ASP B . n 
B 2 15  SER 15  15  15  SER SER B . n 
B 2 16  PRO 16  16  16  PRO PRO B . n 
B 2 17  TRP 17  17  17  TRP TRP B . n 
B 2 18  SER 18  18  18  SER SER B . n 
B 2 19  GLY 19  19  19  GLY GLY B . n 
B 2 20  ILE 20  20  20  ILE ILE B . n 
B 2 21  THR 21  21  21  THR THR B . n 
B 2 22  GLU 22  22  22  GLU GLU B . n 
B 2 23  ARG 23  23  23  ARG ARG B . n 
B 2 24  PRO 24  24  24  PRO PRO B . n 
B 2 25  LEU 25  25  25  LEU LEU B . n 
B 2 26  HIS 26  26  26  HIS HIS B . n 
B 2 27  ILE 27  27  27  ILE ILE B . n 
B 2 28  LEU 28  28  28  LEU LEU B . n 
B 2 29  PRO 29  29  29  PRO PRO B . n 
B 2 30  TRP 30  30  30  TRP TRP B . n 
B 2 31  SER 31  30  30  SER SER B A n 
B 2 32  PRO 32  31  31  PRO PRO B . n 
B 2 33  LYS 33  32  32  LYS LYS B . n 
B 2 34  ASP 34  33  33  ASP ASP B . n 
B 2 35  VAL 35  34  34  VAL VAL B . n 
B 2 36  ASN 36  35  35  ASN ASN B . n 
B 2 37  THR 37  36  36  THR THR B . n 
B 2 38  ARG 38  37  37  ARG ARG B . n 
B 2 39  PHE 39  38  38  PHE PHE B . n 
B 2 40  LEU 40  39  39  LEU LEU B . n 
B 2 41  LEU 41  40  40  LEU LEU B . n 
B 2 42  TYR 42  41  41  TYR TYR B . n 
B 2 43  THR 43  42  42  THR THR B . n 
B 2 44  ASN 44  43  43  ASN ASN B . n 
B 2 45  GLU 45  44  44  GLU GLU B . n 
B 2 46  ASN 46  45  45  ASN ASN B . n 
B 2 47  PRO 47  46  46  PRO PRO B . n 
B 2 48  ASN 48  47  47  ASN ASN B . n 
B 2 49  ASN 49  48  48  ASN ASN B . n 
B 2 50  PHE 50  49  49  PHE PHE B . n 
B 2 51  GLN 51  50  50  GLN GLN B . n 
B 2 52  GLU 52  51  51  GLU GLU B . n 
B 2 53  VAL 53  52  52  VAL VAL B . n 
B 2 54  ALA 54  53  53  ALA ALA B . n 
B 2 55  ALA 55  54  54  ALA ALA B . n 
B 2 56  ASP 56  55  55  ASP ASP B . n 
B 2 57  SER 57  56  56  SER SER B . n 
B 2 58  SER 58  57  57  SER SER B . n 
B 2 59  SER 59  58  58  SER SER B . n 
B 2 60  ILE 60  59  59  ILE ILE B . n 
B 2 61  SER 61  60  60  SER SER B . n 
B 2 62  GLY 62  61  61  GLY GLY B . n 
B 2 63  SER 63  62  62  SER SER B . n 
B 2 64  ASN 64  63  63  ASN ASN B . n 
B 2 65  PHE 65  64  64  PHE PHE B . n 
B 2 66  LYS 66  65  65  LYS LYS B . n 
B 2 67  THR 67  66  66  THR THR B . n 
B 2 68  ASN 68  67  67  ASN ASN B . n 
B 2 69  ARG 69  68  68  ARG ARG B . n 
B 2 70  LYS 70  69  69  LYS LYS B . n 
B 2 71  THR 71  70  70  THR THR B . n 
B 2 72  ARG 72  71  71  ARG ARG B . n 
B 2 73  PHE 73  72  72  PHE PHE B . n 
B 2 74  ILE 74  73  73  ILE ILE B . n 
B 2 75  ILE 75  74  74  ILE ILE B . n 
B 2 76  HIS 76  75  75  HIS HIS B . n 
B 2 77  GLY 77  76  76  GLY GLY B . n 
B 2 78  PHE 78  77  77  PHE PHE B . n 
B 2 79  ILE 79  78  78  ILE ILE B . n 
B 2 80  ASP 80  79  79  ASP ASP B . n 
B 2 81  LYS 81  80  80  LYS LYS B . n 
B 2 82  GLY 82  81  81  GLY GLY B . n 
B 2 83  GLU 83  82  82  GLU GLU B . n 
B 2 84  GLU 84  83  83  GLU GLU B . n 
B 2 85  ASN 85  84  84  ASN ASN B . n 
B 2 86  TRP 86  85  85  TRP TRP B . n 
B 2 87  LEU 87  86  86  LEU LEU B . n 
B 2 88  ALA 88  87  87  ALA ALA B . n 
B 2 89  ASN 89  88  88  ASN ASN B . n 
B 2 90  VAL 90  89  89  VAL VAL B . n 
B 2 91  CYS 91  90  90  CYS CYS B . n 
B 2 92  LYS 92  91  91  LYS LYS B . n 
B 2 93  ASN 93  92  92  ASN ASN B . n 
B 2 94  LEU 94  93  93  LEU LEU B . n 
B 2 95  PHE 95  94  94  PHE PHE B . n 
B 2 96  LYS 96  95  95  LYS LYS B . n 
B 2 97  VAL 97  96  96  VAL VAL B . n 
B 2 98  GLU 98  97  97  GLU GLU B . n 
B 2 99  SER 99  98  98  SER SER B . n 
B 2 100 VAL 100 99  99  VAL VAL B . n 
B 2 101 ASN 101 100 100 ASN ASN B . n 
B 2 102 CYS 102 101 101 CYS CYS B . n 
B 2 103 ILE 103 102 102 ILE ILE B . n 
B 2 104 CYS 104 103 103 CYS CYS B . n 
B 2 105 VAL 105 104 104 VAL VAL B . n 
B 2 106 ASP 106 105 105 ASP ASP B . n 
B 2 107 TRP 107 106 106 TRP TRP B . n 
B 2 108 LYS 108 107 107 LYS LYS B . n 
B 2 109 GLY 109 108 108 GLY GLY B . n 
B 2 110 GLY 110 109 109 GLY GLY B . n 
B 2 111 SER 111 110 110 SER SER B . n 
B 2 112 ARG 112 111 111 ARG ARG B . n 
B 2 113 THR 113 112 112 THR THR B . n 
B 2 114 GLY 114 113 113 GLY GLY B . n 
B 2 115 TYR 115 114 114 TYR TYR B . n 
B 2 116 THR 116 115 115 THR THR B . n 
B 2 117 GLN 117 116 116 GLN GLN B . n 
B 2 118 ALA 118 117 117 ALA ALA B . n 
B 2 119 SER 119 118 118 SER SER B . n 
B 2 120 GLN 120 119 119 GLN GLN B . n 
B 2 121 ASN 121 120 120 ASN ASN B . n 
B 2 122 ILE 122 121 121 ILE ILE B . n 
B 2 123 ARG 123 122 122 ARG ARG B . n 
B 2 124 ILE 124 123 123 ILE ILE B . n 
B 2 125 VAL 125 124 124 VAL VAL B . n 
B 2 126 GLY 126 125 125 GLY GLY B . n 
B 2 127 ALA 127 126 126 ALA ALA B . n 
B 2 128 GLU 128 127 127 GLU GLU B . n 
B 2 129 VAL 129 128 128 VAL VAL B . n 
B 2 130 ALA 130 129 129 ALA ALA B . n 
B 2 131 TYR 131 130 130 TYR TYR B . n 
B 2 132 PHE 132 131 131 PHE PHE B . n 
B 2 133 VAL 133 132 132 VAL VAL B . n 
B 2 134 GLU 134 133 133 GLU GLU B . n 
B 2 135 PHE 135 134 134 PHE PHE B . n 
B 2 136 LEU 136 135 135 LEU LEU B . n 
B 2 137 GLN 137 136 136 GLN GLN B . n 
B 2 138 SER 138 137 137 SER SER B . n 
B 2 139 ALA 139 138 138 ALA ALA B . n 
B 2 140 PHE 140 139 139 PHE PHE B . n 
B 2 141 GLY 141 140 140 GLY GLY B . n 
B 2 142 TYR 142 141 141 TYR TYR B . n 
B 2 143 SER 143 142 142 SER SER B . n 
B 2 144 PRO 144 143 143 PRO PRO B . n 
B 2 145 SER 145 144 144 SER SER B . n 
B 2 146 ASN 146 145 145 ASN ASN B . n 
B 2 147 VAL 147 146 146 VAL VAL B . n 
B 2 148 HIS 148 147 147 HIS HIS B . n 
B 2 149 VAL 149 148 148 VAL VAL B . n 
B 2 150 ILE 150 149 149 ILE ILE B . n 
B 2 151 GLY 151 150 150 GLY GLY B . n 
B 2 152 HIS 152 151 151 HIS HIS B . n 
B 2 153 SER 153 152 152 SER SER B . n 
B 2 154 LEU 154 153 153 LEU LEU B . n 
B 2 155 GLY 155 154 154 GLY GLY B . n 
B 2 156 ALA 156 155 155 ALA ALA B . n 
B 2 157 HIS 157 156 156 HIS HIS B . n 
B 2 158 ALA 158 157 157 ALA ALA B . n 
B 2 159 ALA 159 158 158 ALA ALA B . n 
B 2 160 GLY 160 159 159 GLY GLY B . n 
B 2 161 GLU 161 160 160 GLU GLU B . n 
B 2 162 ALA 162 161 161 ALA ALA B . n 
B 2 163 GLY 163 162 162 GLY GLY B . n 
B 2 164 ARG 164 163 163 ARG ARG B . n 
B 2 165 ARG 165 164 164 ARG ARG B . n 
B 2 166 THR 166 165 165 THR THR B . n 
B 2 167 ASN 167 166 166 ASN ASN B . n 
B 2 168 GLY 168 167 167 GLY GLY B . n 
B 2 169 THR 169 168 168 THR THR B . n 
B 2 170 ILE 170 169 169 ILE ILE B . n 
B 2 171 GLY 171 170 170 GLY GLY B . n 
B 2 172 ARG 172 171 171 ARG ARG B . n 
B 2 173 ILE 173 172 172 ILE ILE B . n 
B 2 174 THR 174 173 173 THR THR B . n 
B 2 175 GLY 175 174 174 GLY GLY B . n 
B 2 176 LEU 176 175 175 LEU LEU B . n 
B 2 177 ASP 177 176 176 ASP ASP B . n 
B 2 178 PRO 178 177 177 PRO PRO B . n 
B 2 179 ALA 179 178 178 ALA ALA B . n 
B 2 180 GLU 180 179 179 GLU GLU B . n 
B 2 181 PRO 181 180 180 PRO PRO B . n 
B 2 182 CYS 182 181 181 CYS CYS B . n 
B 2 183 PHE 183 182 182 PHE PHE B . n 
B 2 184 GLN 184 183 183 GLN GLN B . n 
B 2 185 GLY 185 184 184 GLY GLY B . n 
B 2 186 THR 186 185 185 THR THR B . n 
B 2 187 PRO 187 186 186 PRO PRO B . n 
B 2 188 GLU 188 187 187 GLU GLU B . n 
B 2 189 LEU 189 188 188 LEU LEU B . n 
B 2 190 VAL 190 189 189 VAL VAL B . n 
B 2 191 ARG 191 190 190 ARG ARG B . n 
B 2 192 LEU 192 191 191 LEU LEU B . n 
B 2 193 ASP 193 192 192 ASP ASP B . n 
B 2 194 PRO 194 193 193 PRO PRO B . n 
B 2 195 SER 195 194 194 SER SER B . n 
B 2 196 ASP 196 195 195 ASP ASP B . n 
B 2 197 ALA 197 196 196 ALA ALA B . n 
B 2 198 LYS 198 197 197 LYS LYS B . n 
B 2 199 PHE 199 198 198 PHE PHE B . n 
B 2 200 VAL 200 199 199 VAL VAL B . n 
B 2 201 ASP 201 200 200 ASP ASP B . n 
B 2 202 VAL 202 201 201 VAL VAL B . n 
B 2 203 ILE 203 202 202 ILE ILE B . n 
B 2 204 HIS 204 203 203 HIS HIS B . n 
B 2 205 THR 205 204 204 THR THR B . n 
B 2 206 ASP 206 205 205 ASP ASP B . n 
B 2 207 GLY 207 206 206 GLY GLY B . n 
B 2 208 ALA 208 207 207 ALA ALA B . n 
B 2 209 PRO 209 208 208 PRO PRO B . n 
B 2 210 ILE 210 209 209 ILE ILE B . n 
B 2 211 VAL 211 210 210 VAL VAL B . n 
B 2 212 PRO 212 211 211 PRO PRO B . n 
B 2 213 ASN 213 212 212 ASN ASN B . n 
B 2 214 LEU 214 213 213 LEU LEU B . n 
B 2 215 GLY 215 214 214 GLY GLY B . n 
B 2 216 PHE 216 215 215 PHE PHE B . n 
B 2 217 GLY 217 216 216 GLY GLY B . n 
B 2 218 MET 218 217 217 MET MET B . n 
B 2 219 SER 219 218 218 SER SER B . n 
B 2 220 GLN 220 219 219 GLN GLN B . n 
B 2 221 VAL 221 220 220 VAL VAL B . n 
B 2 222 VAL 222 221 221 VAL VAL B . n 
B 2 223 GLY 223 222 222 GLY GLY B . n 
B 2 224 HIS 224 223 223 HIS HIS B . n 
B 2 225 LEU 225 224 224 LEU LEU B . n 
B 2 226 ASP 226 225 225 ASP ASP B . n 
B 2 227 PHE 227 226 226 PHE PHE B . n 
B 2 228 PHE 228 227 227 PHE PHE B . n 
B 2 229 PRO 229 228 228 PRO PRO B . n 
B 2 230 ASN 230 229 229 ASN ASN B . n 
B 2 231 GLY 231 230 230 GLY GLY B . n 
B 2 232 GLY 232 231 231 GLY GLY B . n 
B 2 233 VAL 233 232 232 VAL VAL B . n 
B 2 234 GLU 234 233 233 GLU GLU B . n 
B 2 235 MET 235 234 234 MET MET B . n 
B 2 236 PRO 236 235 235 PRO PRO B . n 
B 2 237 GLY 237 236 236 GLY GLY B . n 
B 2 238 CYS 238 237 237 CYS CYS B . n 
B 2 239 LYS 239 238 238 LYS LYS B . n 
B 2 240 LYS 240 239 239 LYS LYS B . n 
B 2 241 ASN 241 240 240 ASN ASN B . n 
B 2 242 ILE 242 241 241 ILE ILE B . n 
B 2 243 LEU 243 242 242 LEU LEU B . n 
B 2 244 SER 244 243 243 SER SER B . n 
B 2 245 GLN 245 244 244 GLN GLN B . n 
B 2 246 ILE 246 245 245 ILE ILE B . n 
B 2 247 VAL 247 246 246 VAL VAL B . n 
B 2 248 ASP 248 247 247 ASP ASP B . n 
B 2 249 ILE 249 248 248 ILE ILE B . n 
B 2 250 ASP 250 249 249 ASP ASP B . n 
B 2 251 GLY 251 250 250 GLY GLY B . n 
B 2 252 ILE 252 251 251 ILE ILE B . n 
B 2 253 TRP 253 252 252 TRP TRP B . n 
B 2 254 GLU 254 253 253 GLU GLU B . n 
B 2 255 GLY 255 254 254 GLY GLY B . n 
B 2 256 THR 256 255 255 THR THR B . n 
B 2 257 ARG 257 256 256 ARG ARG B . n 
B 2 258 ASP 258 257 257 ASP ASP B . n 
B 2 259 PHE 259 258 258 PHE PHE B . n 
B 2 260 ALA 260 259 259 ALA ALA B . n 
B 2 261 ALA 261 260 260 ALA ALA B . n 
B 2 262 CYS 262 261 261 CYS CYS B . n 
B 2 263 ASN 263 262 262 ASN ASN B . n 
B 2 264 HIS 264 263 263 HIS HIS B . n 
B 2 265 LEU 265 264 264 LEU LEU B . n 
B 2 266 ARG 266 265 265 ARG ARG B . n 
B 2 267 SER 267 266 266 SER SER B . n 
B 2 268 TYR 268 267 267 TYR TYR B . n 
B 2 269 LYS 269 268 268 LYS LYS B . n 
B 2 270 TYR 270 269 269 TYR TYR B . n 
B 2 271 TYR 271 270 270 TYR TYR B . n 
B 2 272 THR 272 271 271 THR THR B . n 
B 2 273 ASP 273 272 272 ASP ASP B . n 
B 2 274 SER 274 273 273 SER SER B . n 
B 2 275 ILE 275 274 274 ILE ILE B . n 
B 2 276 VAL 276 275 275 VAL VAL B . n 
B 2 277 ASN 277 276 276 ASN ASN B . n 
B 2 278 PRO 278 277 277 PRO PRO B . n 
B 2 279 ASP 279 278 278 ASP ASP B . n 
B 2 280 GLY 280 279 279 GLY GLY B . n 
B 2 281 PHE 281 280 280 PHE PHE B . n 
B 2 282 ALA 282 281 281 ALA ALA B . n 
B 2 283 GLY 283 282 282 GLY GLY B . n 
B 2 284 PHE 284 283 283 PHE PHE B . n 
B 2 285 PRO 285 284 284 PRO PRO B . n 
B 2 286 CYS 286 285 285 CYS CYS B . n 
B 2 287 ALA 287 286 286 ALA ALA B . n 
B 2 288 SER 288 287 287 SER SER B . n 
B 2 289 TYR 289 288 288 TYR TYR B . n 
B 2 290 ASN 290 289 289 ASN ASN B . n 
B 2 291 VAL 291 290 290 VAL VAL B . n 
B 2 292 PHE 292 291 291 PHE PHE B . n 
B 2 293 THR 293 292 292 THR THR B . n 
B 2 294 ALA 294 293 293 ALA ALA B . n 
B 2 295 ASN 295 294 294 ASN ASN B . n 
B 2 296 LYS 296 295 295 LYS LYS B . n 
B 2 297 CYS 297 296 296 CYS CYS B . n 
B 2 298 PHE 298 297 297 PHE PHE B . n 
B 2 299 PRO 299 298 298 PRO PRO B . n 
B 2 300 CYS 300 299 299 CYS CYS B . n 
B 2 301 PRO 301 300 300 PRO PRO B . n 
B 2 302 SER 302 301 301 SER SER B . n 
B 2 303 GLY 303 302 302 GLY GLY B . n 
B 2 304 GLY 304 303 303 GLY GLY B . n 
B 2 305 CYS 305 304 304 CYS CYS B . n 
B 2 306 PRO 306 305 305 PRO PRO B . n 
B 2 307 GLN 307 306 306 GLN GLN B . n 
B 2 308 MET 308 307 307 MET MET B . n 
B 2 309 GLY 309 308 308 GLY GLY B . n 
B 2 310 HIS 310 309 309 HIS HIS B . n 
B 2 311 TYR 311 310 310 TYR TYR B . n 
B 2 312 ALA 312 311 311 ALA ALA B . n 
B 2 313 ASP 313 312 312 ASP ASP B . n 
B 2 314 ARG 314 313 313 ARG ARG B . n 
B 2 315 TYR 315 314 314 TYR TYR B . n 
B 2 316 PRO 316 315 315 PRO PRO B . n 
B 2 317 GLY 317 316 316 GLY GLY B . n 
B 2 318 LYS 318 317 317 LYS LYS B . n 
B 2 319 THR 319 318 318 THR THR B . n 
B 2 320 ASN 320 319 319 ASN ASN B . n 
B 2 321 ASP 321 320 320 ASP ASP B . n 
B 2 322 VAL 322 321 321 VAL VAL B . n 
B 2 323 GLY 323 322 322 GLY GLY B . n 
B 2 324 GLN 324 323 323 GLN GLN B . n 
B 2 325 LYS 325 324 324 LYS LYS B . n 
B 2 326 PHE 326 325 325 PHE PHE B . n 
B 2 327 TYR 327 326 326 TYR TYR B . n 
B 2 328 LEU 328 327 327 LEU LEU B . n 
B 2 329 ASP 329 328 328 ASP ASP B . n 
B 2 330 THR 330 329 329 THR THR B . n 
B 2 331 GLY 331 330 330 GLY GLY B . n 
B 2 332 ASP 332 331 331 ASP ASP B . n 
B 2 333 ALA 333 332 332 ALA ALA B . n 
B 2 334 SER 334 333 333 SER SER B . n 
B 2 335 ASN 335 334 334 ASN ASN B . n 
B 2 336 PHE 336 335 335 PHE PHE B . n 
B 2 337 ALA 337 336 336 ALA ALA B . n 
B 2 338 ARG 338 337 337 ARG ARG B . n 
B 2 339 TRP 339 338 338 TRP TRP B . n 
B 2 340 ARG 340 339 339 ARG ARG B . n 
B 2 341 TYR 341 340 340 TYR TYR B . n 
B 2 342 LYS 342 341 341 LYS LYS B . n 
B 2 343 VAL 343 342 342 VAL VAL B . n 
B 2 344 SER 344 343 343 SER SER B . n 
B 2 345 VAL 345 344 344 VAL VAL B . n 
B 2 346 THR 346 345 345 THR THR B . n 
B 2 347 LEU 347 346 346 LEU LEU B . n 
B 2 348 SER 348 347 347 SER SER B . n 
B 2 349 GLY 349 348 348 GLY GLY B . n 
B 2 350 LYS 350 349 349 LYS LYS B . n 
B 2 351 LYS 351 350 350 LYS LYS B . n 
B 2 352 VAL 352 351 351 VAL VAL B . n 
B 2 353 THR 353 352 352 THR THR B . n 
B 2 354 GLY 354 353 353 GLY GLY B . n 
B 2 355 HIS 355 354 354 HIS HIS B . n 
B 2 356 ILE 356 355 355 ILE ILE B . n 
B 2 357 LEU 357 356 356 LEU LEU B . n 
B 2 358 VAL 358 357 357 VAL VAL B . n 
B 2 359 SER 359 358 358 SER SER B . n 
B 2 360 LEU 360 359 359 LEU LEU B . n 
B 2 361 PHE 361 360 360 PHE PHE B . n 
B 2 362 GLY 362 361 361 GLY GLY B . n 
B 2 363 ASN 363 362 362 ASN ASN B . n 
B 2 364 LYS 364 363 363 LYS LYS B . n 
B 2 365 GLY 365 364 364 GLY GLY B . n 
B 2 366 ASN 366 365 365 ASN ASN B . n 
B 2 367 SER 367 366 366 SER SER B . n 
B 2 368 LYS 368 367 367 LYS LYS B . n 
B 2 369 GLN 369 368 368 GLN GLN B . n 
B 2 370 TYR 370 369 369 TYR TYR B . n 
B 2 371 GLU 371 370 370 GLU GLU B . n 
B 2 372 ILE 372 371 371 ILE ILE B . n 
B 2 373 PHE 373 372 372 PHE PHE B . n 
B 2 374 LYS 374 373 373 LYS LYS B . n 
B 2 375 GLY 375 374 374 GLY GLY B . n 
B 2 376 THR 376 375 375 THR THR B . n 
B 2 377 LEU 377 376 376 LEU LEU B . n 
B 2 378 LYS 378 377 377 LYS LYS B . n 
B 2 379 PRO 379 378 378 PRO PRO B . n 
B 2 380 ASP 380 379 379 ASP ASP B . n 
B 2 381 SER 381 380 380 SER SER B . n 
B 2 382 THR 382 381 381 THR THR B . n 
B 2 383 HIS 383 382 382 HIS HIS B . n 
B 2 384 SER 384 383 383 SER SER B . n 
B 2 385 ASN 385 384 384 ASN ASN B . n 
B 2 386 GLU 386 385 385 GLU GLU B . n 
B 2 387 PHE 387 386 386 PHE PHE B . n 
B 2 388 ASP 388 387 387 ASP ASP B . n 
B 2 389 SER 389 388 388 SER SER B . n 
B 2 390 ASP 390 389 389 ASP ASP B . n 
B 2 391 VAL 391 390 390 VAL VAL B . n 
B 2 392 ASP 392 391 391 ASP ASP B . n 
B 2 393 VAL 393 392 392 VAL VAL B . n 
B 2 394 GLY 394 393 393 GLY GLY B . n 
B 2 395 ASP 395 394 394 ASP ASP B . n 
B 2 396 LEU 396 395 395 LEU LEU B . n 
B 2 397 GLN 397 396 396 GLN GLN B . n 
B 2 398 MET 398 397 397 MET MET B . n 
B 2 399 VAL 399 398 398 VAL VAL B . n 
B 2 400 LYS 400 399 399 LYS LYS B . n 
B 2 401 PHE 401 400 400 PHE PHE B . n 
B 2 402 ILE 402 401 401 ILE ILE B . n 
B 2 403 TRP 403 402 402 TRP TRP B . n 
B 2 404 TYR 404 403 403 TYR TYR B . n 
B 2 405 ASN 405 404 404 ASN ASN B . n 
B 2 406 ASN 406 406 406 ASN ASN B . n 
B 2 407 VAL 407 407 407 VAL VAL B . n 
B 2 408 ILE 408 408 408 ILE ILE B . n 
B 2 409 ASN 409 409 409 ASN ASN B . n 
B 2 410 PRO 410 410 410 PRO PRO B . n 
B 2 411 THR 411 411 411 THR THR B . n 
B 2 412 LEU 412 412 412 LEU LEU B . n 
B 2 413 PRO 413 413 413 PRO PRO B . n 
B 2 414 ARG 414 414 414 ARG ARG B . n 
B 2 415 VAL 415 415 415 VAL VAL B . n 
B 2 416 GLY 416 416 416 GLY GLY B . n 
B 2 417 ALA 417 417 417 ALA ALA B . n 
B 2 418 SER 418 418 418 SER SER B . n 
B 2 419 LYS 419 419 419 LYS LYS B . n 
B 2 420 ILE 420 420 420 ILE ILE B . n 
B 2 421 ILE 421 421 421 ILE ILE B . n 
B 2 422 VAL 422 422 422 VAL VAL B . n 
B 2 423 GLU 423 423 423 GLU GLU B . n 
B 2 424 THR 424 424 424 THR THR B . n 
B 2 425 ASN 425 425 425 ASN ASN B . n 
B 2 426 VAL 426 426 426 VAL VAL B . n 
B 2 427 GLY 427 427 427 GLY GLY B . n 
B 2 428 LYS 428 428 428 LYS LYS B . n 
B 2 429 GLN 429 429 429 GLN GLN B . n 
B 2 430 PHE 430 430 430 PHE PHE B . n 
B 2 431 ASN 431 431 431 ASN ASN B . n 
B 2 432 PHE 432 432 432 PHE PHE B . n 
B 2 433 CYS 433 433 433 CYS CYS B . n 
B 2 434 SER 434 434 434 SER SER B . n 
B 2 435 PRO 435 435 435 PRO PRO B . n 
B 2 436 GLU 436 436 436 GLU GLU B . n 
B 2 437 THR 437 437 437 THR THR B . n 
B 2 438 VAL 438 438 438 VAL VAL B . n 
B 2 439 ARG 439 439 439 ARG ARG B . n 
B 2 440 GLU 440 440 440 GLU GLU B . n 
B 2 441 GLU 441 441 441 GLU GLU B . n 
B 2 442 VAL 442 442 442 VAL VAL B . n 
B 2 443 LEU 443 443 443 LEU LEU B . n 
B 2 444 LEU 444 444 444 LEU LEU B . n 
B 2 445 THR 445 445 445 THR THR B . n 
B 2 446 LEU 446 446 446 LEU LEU B . n 
B 2 447 THR 447 447 447 THR THR B . n 
B 2 448 PRO 448 448 448 PRO PRO B . n 
B 2 449 CYS 449 449 449 CYS CYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 BOG 1   96   2   BOG BOG A . 
D 3 BOG 1   97   3   BOG BOG A . 
E 3 BOG 1   450  1   BOG BOG B . 
F 3 BOG 1   451  4   BOG BOG B . 
G 3 BOG 1   452  5   BOG BOG B . 
H 4 CA  1   453  450 CA  CA  B . 
I 5 MUP 1   901  901 MUP MUP B . 
J 6 HOH 1   98   13  HOH HOH A . 
J 6 HOH 2   99   18  HOH HOH A . 
J 6 HOH 3   100  21  HOH HOH A . 
J 6 HOH 4   101  30  HOH HOH A . 
J 6 HOH 5   102  40  HOH HOH A . 
J 6 HOH 6   103  41  HOH HOH A . 
J 6 HOH 7   104  54  HOH HOH A . 
J 6 HOH 8   105  55  HOH HOH A . 
J 6 HOH 9   106  56  HOH HOH A . 
J 6 HOH 10  107  60  HOH HOH A . 
J 6 HOH 11  108  67  HOH HOH A . 
J 6 HOH 12  109  75  HOH HOH A . 
J 6 HOH 13  110  76  HOH HOH A . 
J 6 HOH 14  111  80  HOH HOH A . 
J 6 HOH 15  112  81  HOH HOH A . 
J 6 HOH 16  113  82  HOH HOH A . 
J 6 HOH 17  114  98  HOH HOH A . 
J 6 HOH 18  115  131 HOH HOH A . 
J 6 HOH 19  116  132 HOH HOH A . 
J 6 HOH 20  117  133 HOH HOH A . 
J 6 HOH 21  118  136 HOH HOH A . 
J 6 HOH 22  119  138 HOH HOH A . 
J 6 HOH 23  120  154 HOH HOH A . 
J 6 HOH 24  121  173 HOH HOH A . 
J 6 HOH 25  122  174 HOH HOH A . 
J 6 HOH 26  123  177 HOH HOH A . 
J 6 HOH 27  124  178 HOH HOH A . 
J 6 HOH 28  125  179 HOH HOH A . 
J 6 HOH 29  126  180 HOH HOH A . 
J 6 HOH 30  127  211 HOH HOH A . 
J 6 HOH 31  128  212 HOH HOH A . 
J 6 HOH 32  129  213 HOH HOH A . 
J 6 HOH 33  130  216 HOH HOH A . 
J 6 HOH 34  131  217 HOH HOH A . 
J 6 HOH 35  132  222 HOH HOH A . 
J 6 HOH 36  133  228 HOH HOH A . 
J 6 HOH 37  134  255 HOH HOH A . 
J 6 HOH 38  135  256 HOH HOH A . 
J 6 HOH 39  136  257 HOH HOH A . 
J 6 HOH 40  137  272 HOH HOH A . 
J 6 HOH 41  138  275 HOH HOH A . 
J 6 HOH 42  139  277 HOH HOH A . 
J 6 HOH 43  140  278 HOH HOH A . 
J 6 HOH 44  141  289 HOH HOH A . 
K 6 HOH 1   902  1   HOH HOH B . 
K 6 HOH 2   903  2   HOH HOH B . 
K 6 HOH 3   904  3   HOH HOH B . 
K 6 HOH 4   905  4   HOH HOH B . 
K 6 HOH 5   906  5   HOH HOH B . 
K 6 HOH 6   907  6   HOH HOH B . 
K 6 HOH 7   908  7   HOH HOH B . 
K 6 HOH 8   909  8   HOH HOH B . 
K 6 HOH 9   910  9   HOH HOH B . 
K 6 HOH 10  911  10  HOH HOH B . 
K 6 HOH 11  912  11  HOH HOH B . 
K 6 HOH 12  913  12  HOH HOH B . 
K 6 HOH 13  914  14  HOH HOH B . 
K 6 HOH 14  915  15  HOH HOH B . 
K 6 HOH 15  916  16  HOH HOH B . 
K 6 HOH 16  917  17  HOH HOH B . 
K 6 HOH 17  918  19  HOH HOH B . 
K 6 HOH 18  919  20  HOH HOH B . 
K 6 HOH 19  920  22  HOH HOH B . 
K 6 HOH 20  921  23  HOH HOH B . 
K 6 HOH 21  922  24  HOH HOH B . 
K 6 HOH 22  923  25  HOH HOH B . 
K 6 HOH 23  924  26  HOH HOH B . 
K 6 HOH 24  925  27  HOH HOH B . 
K 6 HOH 25  926  28  HOH HOH B . 
K 6 HOH 26  927  29  HOH HOH B . 
K 6 HOH 27  928  31  HOH HOH B . 
K 6 HOH 28  929  32  HOH HOH B . 
K 6 HOH 29  930  33  HOH HOH B . 
K 6 HOH 30  931  34  HOH HOH B . 
K 6 HOH 31  932  35  HOH HOH B . 
K 6 HOH 32  933  36  HOH HOH B . 
K 6 HOH 33  934  37  HOH HOH B . 
K 6 HOH 34  935  38  HOH HOH B . 
K 6 HOH 35  936  39  HOH HOH B . 
K 6 HOH 36  937  42  HOH HOH B . 
K 6 HOH 37  938  43  HOH HOH B . 
K 6 HOH 38  939  44  HOH HOH B . 
K 6 HOH 39  940  45  HOH HOH B . 
K 6 HOH 40  941  46  HOH HOH B . 
K 6 HOH 41  942  47  HOH HOH B . 
K 6 HOH 42  943  48  HOH HOH B . 
K 6 HOH 43  944  49  HOH HOH B . 
K 6 HOH 44  945  50  HOH HOH B . 
K 6 HOH 45  946  51  HOH HOH B . 
K 6 HOH 46  947  52  HOH HOH B . 
K 6 HOH 47  948  53  HOH HOH B . 
K 6 HOH 48  949  57  HOH HOH B . 
K 6 HOH 49  950  58  HOH HOH B . 
K 6 HOH 50  951  59  HOH HOH B . 
K 6 HOH 51  952  61  HOH HOH B . 
K 6 HOH 52  953  62  HOH HOH B . 
K 6 HOH 53  954  63  HOH HOH B . 
K 6 HOH 54  955  64  HOH HOH B . 
K 6 HOH 55  956  65  HOH HOH B . 
K 6 HOH 56  957  66  HOH HOH B . 
K 6 HOH 57  958  68  HOH HOH B . 
K 6 HOH 58  959  69  HOH HOH B . 
K 6 HOH 59  960  70  HOH HOH B . 
K 6 HOH 60  961  71  HOH HOH B . 
K 6 HOH 61  962  72  HOH HOH B . 
K 6 HOH 62  963  73  HOH HOH B . 
K 6 HOH 63  964  74  HOH HOH B . 
K 6 HOH 64  965  77  HOH HOH B . 
K 6 HOH 65  966  78  HOH HOH B . 
K 6 HOH 66  967  79  HOH HOH B . 
K 6 HOH 67  968  83  HOH HOH B . 
K 6 HOH 68  969  84  HOH HOH B . 
K 6 HOH 69  970  85  HOH HOH B . 
K 6 HOH 70  971  86  HOH HOH B . 
K 6 HOH 71  972  87  HOH HOH B . 
K 6 HOH 72  973  88  HOH HOH B . 
K 6 HOH 73  974  89  HOH HOH B . 
K 6 HOH 74  975  90  HOH HOH B . 
K 6 HOH 75  976  91  HOH HOH B . 
K 6 HOH 76  977  92  HOH HOH B . 
K 6 HOH 77  978  93  HOH HOH B . 
K 6 HOH 78  979  94  HOH HOH B . 
K 6 HOH 79  980  95  HOH HOH B . 
K 6 HOH 80  981  96  HOH HOH B . 
K 6 HOH 81  982  97  HOH HOH B . 
K 6 HOH 82  983  99  HOH HOH B . 
K 6 HOH 83  984  100 HOH HOH B . 
K 6 HOH 84  985  101 HOH HOH B . 
K 6 HOH 85  986  102 HOH HOH B . 
K 6 HOH 86  987  103 HOH HOH B . 
K 6 HOH 87  988  104 HOH HOH B . 
K 6 HOH 88  989  105 HOH HOH B . 
K 6 HOH 89  990  106 HOH HOH B . 
K 6 HOH 90  991  107 HOH HOH B . 
K 6 HOH 91  992  108 HOH HOH B . 
K 6 HOH 92  993  109 HOH HOH B . 
K 6 HOH 93  994  110 HOH HOH B . 
K 6 HOH 94  995  111 HOH HOH B . 
K 6 HOH 95  996  112 HOH HOH B . 
K 6 HOH 96  997  113 HOH HOH B . 
K 6 HOH 97  998  114 HOH HOH B . 
K 6 HOH 98  999  115 HOH HOH B . 
K 6 HOH 99  1000 116 HOH HOH B . 
K 6 HOH 100 1001 117 HOH HOH B . 
K 6 HOH 101 1002 118 HOH HOH B . 
K 6 HOH 102 1003 119 HOH HOH B . 
K 6 HOH 103 1004 120 HOH HOH B . 
K 6 HOH 104 1005 121 HOH HOH B . 
K 6 HOH 105 1006 122 HOH HOH B . 
K 6 HOH 106 1007 123 HOH HOH B . 
K 6 HOH 107 1008 124 HOH HOH B . 
K 6 HOH 108 1009 125 HOH HOH B . 
K 6 HOH 109 1010 126 HOH HOH B . 
K 6 HOH 110 1011 127 HOH HOH B . 
K 6 HOH 111 1012 128 HOH HOH B . 
K 6 HOH 112 1013 129 HOH HOH B . 
K 6 HOH 113 1014 130 HOH HOH B . 
K 6 HOH 114 1015 134 HOH HOH B . 
K 6 HOH 115 1016 135 HOH HOH B . 
K 6 HOH 116 1017 137 HOH HOH B . 
K 6 HOH 117 1018 139 HOH HOH B . 
K 6 HOH 118 1019 140 HOH HOH B . 
K 6 HOH 119 1020 141 HOH HOH B . 
K 6 HOH 120 1021 142 HOH HOH B . 
K 6 HOH 121 1022 143 HOH HOH B . 
K 6 HOH 122 1023 144 HOH HOH B . 
K 6 HOH 123 1024 145 HOH HOH B . 
K 6 HOH 124 1025 146 HOH HOH B . 
K 6 HOH 125 1026 147 HOH HOH B . 
K 6 HOH 126 1027 148 HOH HOH B . 
K 6 HOH 127 1028 149 HOH HOH B . 
K 6 HOH 128 1029 151 HOH HOH B . 
K 6 HOH 129 1030 152 HOH HOH B . 
K 6 HOH 130 1031 153 HOH HOH B . 
K 6 HOH 131 1032 156 HOH HOH B . 
K 6 HOH 132 1033 157 HOH HOH B . 
K 6 HOH 133 1034 158 HOH HOH B . 
K 6 HOH 134 1035 159 HOH HOH B . 
K 6 HOH 135 1036 160 HOH HOH B . 
K 6 HOH 136 1037 161 HOH HOH B . 
K 6 HOH 137 1038 162 HOH HOH B . 
K 6 HOH 138 1039 163 HOH HOH B . 
K 6 HOH 139 1040 164 HOH HOH B . 
K 6 HOH 140 1041 165 HOH HOH B . 
K 6 HOH 141 1042 166 HOH HOH B . 
K 6 HOH 142 1043 167 HOH HOH B . 
K 6 HOH 143 1044 169 HOH HOH B . 
K 6 HOH 144 1045 170 HOH HOH B . 
K 6 HOH 145 1046 171 HOH HOH B . 
K 6 HOH 146 1047 172 HOH HOH B . 
K 6 HOH 147 1048 175 HOH HOH B . 
K 6 HOH 148 1049 176 HOH HOH B . 
K 6 HOH 149 1050 181 HOH HOH B . 
K 6 HOH 150 1051 182 HOH HOH B . 
K 6 HOH 151 1052 183 HOH HOH B . 
K 6 HOH 152 1053 184 HOH HOH B . 
K 6 HOH 153 1054 185 HOH HOH B . 
K 6 HOH 154 1055 186 HOH HOH B . 
K 6 HOH 155 1056 187 HOH HOH B . 
K 6 HOH 156 1057 188 HOH HOH B . 
K 6 HOH 157 1058 189 HOH HOH B . 
K 6 HOH 158 1059 190 HOH HOH B . 
K 6 HOH 159 1060 191 HOH HOH B . 
K 6 HOH 160 1061 192 HOH HOH B . 
K 6 HOH 161 1062 193 HOH HOH B . 
K 6 HOH 162 1063 194 HOH HOH B . 
K 6 HOH 163 1064 195 HOH HOH B . 
K 6 HOH 164 1065 196 HOH HOH B . 
K 6 HOH 165 1066 197 HOH HOH B . 
K 6 HOH 166 1067 198 HOH HOH B . 
K 6 HOH 167 1068 199 HOH HOH B . 
K 6 HOH 168 1069 200 HOH HOH B . 
K 6 HOH 169 1070 201 HOH HOH B . 
K 6 HOH 170 1071 202 HOH HOH B . 
K 6 HOH 171 1072 203 HOH HOH B . 
K 6 HOH 172 1073 204 HOH HOH B . 
K 6 HOH 173 1074 205 HOH HOH B . 
K 6 HOH 174 1075 206 HOH HOH B . 
K 6 HOH 175 1076 207 HOH HOH B . 
K 6 HOH 176 1077 208 HOH HOH B . 
K 6 HOH 177 1078 209 HOH HOH B . 
K 6 HOH 178 1079 210 HOH HOH B . 
K 6 HOH 179 1080 214 HOH HOH B . 
K 6 HOH 180 1081 215 HOH HOH B . 
K 6 HOH 181 1082 218 HOH HOH B . 
K 6 HOH 182 1083 219 HOH HOH B . 
K 6 HOH 183 1084 220 HOH HOH B . 
K 6 HOH 184 1085 221 HOH HOH B . 
K 6 HOH 185 1086 223 HOH HOH B . 
K 6 HOH 186 1087 224 HOH HOH B . 
K 6 HOH 187 1088 225 HOH HOH B . 
K 6 HOH 188 1089 226 HOH HOH B . 
K 6 HOH 189 1090 227 HOH HOH B . 
K 6 HOH 190 1091 229 HOH HOH B . 
K 6 HOH 191 1092 230 HOH HOH B . 
K 6 HOH 192 1093 231 HOH HOH B . 
K 6 HOH 193 1094 232 HOH HOH B . 
K 6 HOH 194 1095 233 HOH HOH B . 
K 6 HOH 195 1096 234 HOH HOH B . 
K 6 HOH 196 1097 235 HOH HOH B . 
K 6 HOH 197 1098 236 HOH HOH B . 
K 6 HOH 198 1099 237 HOH HOH B . 
K 6 HOH 199 1100 240 HOH HOH B . 
K 6 HOH 200 1101 242 HOH HOH B . 
K 6 HOH 201 1102 243 HOH HOH B . 
K 6 HOH 202 1103 244 HOH HOH B . 
K 6 HOH 203 1104 245 HOH HOH B . 
K 6 HOH 204 1105 246 HOH HOH B . 
K 6 HOH 205 1106 247 HOH HOH B . 
K 6 HOH 206 1107 248 HOH HOH B . 
K 6 HOH 207 1108 249 HOH HOH B . 
K 6 HOH 208 1109 250 HOH HOH B . 
K 6 HOH 209 1110 251 HOH HOH B . 
K 6 HOH 210 1111 252 HOH HOH B . 
K 6 HOH 211 1112 254 HOH HOH B . 
K 6 HOH 212 1113 258 HOH HOH B . 
K 6 HOH 213 1114 259 HOH HOH B . 
K 6 HOH 214 1115 260 HOH HOH B . 
K 6 HOH 215 1116 261 HOH HOH B . 
K 6 HOH 216 1117 262 HOH HOH B . 
K 6 HOH 217 1118 263 HOH HOH B . 
K 6 HOH 218 1119 264 HOH HOH B . 
K 6 HOH 219 1120 265 HOH HOH B . 
K 6 HOH 220 1121 266 HOH HOH B . 
K 6 HOH 221 1122 267 HOH HOH B . 
K 6 HOH 222 1123 268 HOH HOH B . 
K 6 HOH 223 1124 269 HOH HOH B . 
K 6 HOH 224 1125 270 HOH HOH B . 
K 6 HOH 225 1126 271 HOH HOH B . 
K 6 HOH 226 1127 273 HOH HOH B . 
K 6 HOH 227 1128 274 HOH HOH B . 
K 6 HOH 228 1129 276 HOH HOH B . 
K 6 HOH 229 1130 279 HOH HOH B . 
K 6 HOH 230 1131 280 HOH HOH B . 
K 6 HOH 231 1132 281 HOH HOH B . 
K 6 HOH 232 1133 282 HOH HOH B . 
K 6 HOH 233 1134 283 HOH HOH B . 
K 6 HOH 234 1135 284 HOH HOH B . 
K 6 HOH 235 1136 286 HOH HOH B . 
K 6 HOH 236 1137 287 HOH HOH B . 
K 6 HOH 237 1138 288 HOH HOH B . 
K 6 HOH 238 1139 290 HOH HOH B . 
K 6 HOH 239 1140 291 HOH HOH B . 
K 6 HOH 240 1141 292 HOH HOH B . 
K 6 HOH 241 1142 293 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? B ARG 191 ? B ARG 190  ? 1_555 72.0  ? 
2  O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD1 ? B ASP 193 ? B ASP 192  ? 1_555 85.5  ? 
3  O   ? B ARG 191 ? B ARG 190 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD1 ? B ASP 193 ? B ASP 192  ? 1_555 93.4  ? 
4  O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD1 ? B ASP 196 ? B ASP 195  ? 1_555 147.2 ? 
5  O   ? B ARG 191 ? B ARG 190 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD1 ? B ASP 196 ? B ASP 195  ? 1_555 140.8 ? 
6  OD1 ? B ASP 193 ? B ASP 192 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD1 ? B ASP 196 ? B ASP 195  ? 1_555 93.0  ? 
7  O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD2 ? B ASP 196 ? B ASP 195  ? 1_555 162.6 ? 
8  O   ? B ARG 191 ? B ARG 190 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD2 ? B ASP 196 ? B ASP 195  ? 1_555 90.8  ? 
9  OD1 ? B ASP 193 ? B ASP 192 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD2 ? B ASP 196 ? B ASP 195  ? 1_555 93.6  ? 
10 OD1 ? B ASP 196 ? B ASP 195 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 OD2 ? B ASP 196 ? B ASP 195  ? 1_555 50.2  ? 
11 O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 989  ? 1_555 90.4  ? 
12 O   ? B ARG 191 ? B ARG 190 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 989  ? 1_555 85.9  ? 
13 OD1 ? B ASP 193 ? B ASP 192 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 989  ? 1_555 175.9 ? 
14 OD1 ? B ASP 196 ? B ASP 195 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 989  ? 1_555 90.1  ? 
15 OD2 ? B ASP 196 ? B ASP 195 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 989  ? 1_555 90.5  ? 
16 O   ? B GLU 188 ? B GLU 187 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 70.4  ? 
17 O   ? B ARG 191 ? B ARG 190 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 141.6 ? 
18 OD1 ? B ASP 193 ? B ASP 192 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 90.6  ? 
19 OD1 ? B ASP 196 ? B ASP 195 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 76.9  ? 
20 OD2 ? B ASP 196 ? B ASP 195 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 127.0 ? 
21 O   ? K HOH .   ? B HOH 989 ? 1_555 CA ? H CA . ? B CA 453 ? 1_555 O   ? K HOH .   ? B HOH 1072 ? 1_555 87.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-11-01 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
5 5 'Structure model' Advisory                    
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_database_status      
2  4 'Structure model' struct_conf               
3  4 'Structure model' struct_conf_type          
4  5 'Structure model' chem_comp                 
5  5 'Structure model' database_PDB_caveat       
6  5 'Structure model' entity                    
7  5 'Structure model' pdbx_chem_comp_identifier 
8  5 'Structure model' pdbx_entity_nonpoly       
9  5 'Structure model' pdbx_struct_conn_angle    
10 5 'Structure model' struct_conn               
11 5 'Structure model' struct_site               
12 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_database_status.process_site'          
2  5 'Structure model' '_chem_comp.mon_nstd_flag'                    
3  5 'Structure model' '_chem_comp.name'                             
4  5 'Structure model' '_chem_comp.type'                             
5  5 'Structure model' '_entity.pdbx_description'                    
6  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
19 5 'Structure model' '_pdbx_struct_conn_angle.value'               
20 5 'Structure model' '_struct_conn.pdbx_dist_value'                
21 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
22 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
24 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
26 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
27 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
33 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_pdbx_entry_details.entry_id                 1LPB 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;USE OF PARTIAL OCCUPANCY FOR THE INHIBITOR (REFINED
OCCUPANCY) AND FOR BETA-OCTYLGLUCOSIDE MOLECULES.
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HH11 B ARG 265  ? ? H2 B HOH 1080 ? ? 1.21 
2 1 HH22 B ARG 414  ? ? H2 B HOH 1015 ? ? 1.22 
3 1 HZ1  B LYS 324  ? ? H2 B HOH 1090 ? ? 1.27 
4 1 O    B HOH 1060 ? ? H2 B HOH 1081 ? ? 1.55 
5 1 O    B HOH 1063 ? ? H2 B HOH 1120 ? ? 1.55 
6 1 O    B HOH 992  ? ? H1 B HOH 993  ? ? 1.59 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              304 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              304 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              304 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                121.08 
_pdbx_validate_rmsd_angle.angle_target_value         114.20 
_pdbx_validate_rmsd_angle.angle_deviation            6.88 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 7   ? ? 30.95   73.51   
2  1 ILE A 8   ? ? -176.77 116.64  
3  1 ARG B 7   ? ? 72.85   -47.29  
4  1 ASP B 13  ? ? -96.08  30.72   
5  1 ALA B 54  ? ? -68.93  68.60   
6  1 ILE B 78  ? ? 66.55   -23.54  
7  1 TRP B 106 ? ? -147.92 38.25   
8  1 ARG B 111 ? ? -94.22  55.95   
9  1 SER B 152 ? ? 58.49   -116.73 
10 1 PHE B 182 ? ? -139.03 -36.48  
11 1 ASP B 205 ? ? -148.30 53.38   
12 1 ASN B 229 ? ? 53.10   19.95   
13 1 LYS B 238 ? ? -75.80  43.11   
14 1 VAL B 246 ? ? -100.01 55.12   
15 1 ILE B 248 ? ? -42.74  -14.63  
16 1 ALA B 260 ? ? -164.89 58.92   
17 1 ASN B 334 ? ? 84.20   67.46   
18 1 PRO B 410 ? ? -67.17  7.51    
19 1 LEU B 412 ? ? 62.35   63.68   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    A 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    BOG 
_pdbx_validate_chiral.auth_seq_id     451 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1  ? A VAL 1  
2  1 Y 1 A PRO 2  ? A PRO 2  
3  1 Y 1 A ASP 3  ? A ASP 3  
4  1 Y 1 A PRO 4  ? A PRO 4  
5  1 Y 1 A ARG 5  ? A ARG 5  
6  1 Y 1 A GLY 91 ? A GLY 91 
7  1 Y 1 A ARG 92 ? A ARG 92 
8  1 Y 1 A SER 93 ? A SER 93 
9  1 Y 1 A ASP 94 ? A ASP 94 
10 1 Y 1 A SER 95 ? A SER 95 
# 
_pdbx_chem_comp_identifier.comp_id           BOG 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        b-octylglucoside 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'octyl beta-D-glucopyranoside'  BOG 
4 'CALCIUM ION'                   CA  
5 'METHOXYUNDECYLPHOSPHINIC ACID' MUP 
6 water                           HOH 
#