data_1LU9
# 
_entry.id   1LU9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LU9         
RCSB  RCSB016275   
WWPDB D_1000016275 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1LUA 
_pdbx_database_related.details        '1LUA contains the same protein complexed with NADP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LU9 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ermler, U.'      1 
'Hagemeier, C.H.' 2 
'Roth, A.'        3 
'Demmer, U.'      4 
'Grabarse, W.'    5 
'Warkentin, E.'   6 
'Vorholt, J.A.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of methylene-tetrahydromethanopterin dehydrogenase from methylobacterium extorquens AM1.'    Structure    10  
1127 1137 2002 STRUE6 UK 0969-2126 2005 ? 12176390 '10.1016/S0969-2126(02)00802-X' 
1       'The NADP-Dependent Methylene Tetrahydromethanopterin Dehydrogenase in Methylobacterium extorquens AM1' J.BACTERIOL. 180 
5351 5356 1998 JOBAAY US 0021-9193 0767 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ermler, U.'        1  
primary 'Hagemeier, C.H.'   2  
primary 'Roth, A.'          3  
primary 'Demmer, U.'        4  
primary 'Grabarse, W.'      5  
primary 'Warkentin, E.'     6  
primary 'Vorholt, J.A.'     7  
1       'Vorholt, J.A.'     8  
1       'Chistoserdova, L.' 9  
1       'Lidstrom, M.E.'    10 
1       'Thauer, R.K.'      11 
# 
_cell.entry_id           1LU9 
_cell.length_a           133.130 
_cell.length_b           85.240 
_cell.length_c           92.370 
_cell.angle_alpha        90.00 
_cell.angle_beta         113.81 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LU9 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Methylene Tetrahydromethanopterin Dehydrogenase' 29640.609 3   1.5.1.5 ? ? ? 
2 water   nat water                                             18.015    558 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Methylenetetrahydrofolate dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   LYS n 
1 4   LEU n 
1 5   LEU n 
1 6   PHE n 
1 7   GLN n 
1 8   PHE n 
1 9   ASP n 
1 10  THR n 
1 11  ASP n 
1 12  ALA n 
1 13  THR n 
1 14  PRO n 
1 15  SER n 
1 16  VAL n 
1 17  PHE n 
1 18  ASP n 
1 19  VAL n 
1 20  VAL n 
1 21  VAL n 
1 22  GLY n 
1 23  TYR n 
1 24  ASP n 
1 25  GLY n 
1 26  GLY n 
1 27  ALA n 
1 28  ASP n 
1 29  HIS n 
1 30  ILE n 
1 31  THR n 
1 32  GLY n 
1 33  TYR n 
1 34  GLY n 
1 35  ASN n 
1 36  VAL n 
1 37  THR n 
1 38  PRO n 
1 39  ASP n 
1 40  ASN n 
1 41  VAL n 
1 42  GLY n 
1 43  ALA n 
1 44  TYR n 
1 45  VAL n 
1 46  ASP n 
1 47  GLY n 
1 48  THR n 
1 49  ILE n 
1 50  TYR n 
1 51  THR n 
1 52  ARG n 
1 53  GLY n 
1 54  GLY n 
1 55  LYS n 
1 56  GLU n 
1 57  LYS n 
1 58  GLN n 
1 59  SER n 
1 60  THR n 
1 61  ALA n 
1 62  ILE n 
1 63  PHE n 
1 64  VAL n 
1 65  GLY n 
1 66  GLY n 
1 67  GLY n 
1 68  ASP n 
1 69  MET n 
1 70  ALA n 
1 71  ALA n 
1 72  GLY n 
1 73  GLU n 
1 74  ARG n 
1 75  VAL n 
1 76  PHE n 
1 77  GLU n 
1 78  ALA n 
1 79  VAL n 
1 80  LYS n 
1 81  LYS n 
1 82  ARG n 
1 83  PHE n 
1 84  PHE n 
1 85  GLY n 
1 86  PRO n 
1 87  PHE n 
1 88  ARG n 
1 89  VAL n 
1 90  SER n 
1 91  CYS n 
1 92  MET n 
1 93  LEU n 
1 94  ASP n 
1 95  SER n 
1 96  ASN n 
1 97  GLY n 
1 98  SER n 
1 99  ASN n 
1 100 THR n 
1 101 THR n 
1 102 ALA n 
1 103 ALA n 
1 104 ALA n 
1 105 GLY n 
1 106 VAL n 
1 107 ALA n 
1 108 LEU n 
1 109 VAL n 
1 110 VAL n 
1 111 LYS n 
1 112 ALA n 
1 113 ALA n 
1 114 GLY n 
1 115 GLY n 
1 116 SER n 
1 117 VAL n 
1 118 LYS n 
1 119 GLY n 
1 120 LYS n 
1 121 LYS n 
1 122 ALA n 
1 123 VAL n 
1 124 VAL n 
1 125 LEU n 
1 126 ALA n 
1 127 GLY n 
1 128 THR n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 GLY n 
1 133 MET n 
1 134 ARG n 
1 135 SER n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 GLY n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 GLU n 
1 146 VAL n 
1 147 VAL n 
1 148 LEU n 
1 149 CYS n 
1 150 GLY n 
1 151 ARG n 
1 152 LYS n 
1 153 LEU n 
1 154 ASP n 
1 155 LYS n 
1 156 ALA n 
1 157 GLN n 
1 158 ALA n 
1 159 ALA n 
1 160 ALA n 
1 161 ASP n 
1 162 SER n 
1 163 VAL n 
1 164 ASN n 
1 165 LYS n 
1 166 ARG n 
1 167 PHE n 
1 168 LYS n 
1 169 VAL n 
1 170 ASN n 
1 171 VAL n 
1 172 THR n 
1 173 ALA n 
1 174 ALA n 
1 175 GLU n 
1 176 THR n 
1 177 ALA n 
1 178 ASP n 
1 179 ASP n 
1 180 ALA n 
1 181 SER n 
1 182 ARG n 
1 183 ALA n 
1 184 GLU n 
1 185 ALA n 
1 186 VAL n 
1 187 LYS n 
1 188 GLY n 
1 189 ALA n 
1 190 HIS n 
1 191 PHE n 
1 192 VAL n 
1 193 PHE n 
1 194 THR n 
1 195 ALA n 
1 196 GLY n 
1 197 ALA n 
1 198 ILE n 
1 199 GLY n 
1 200 LEU n 
1 201 GLU n 
1 202 LEU n 
1 203 LEU n 
1 204 PRO n 
1 205 GLN n 
1 206 ALA n 
1 207 ALA n 
1 208 TRP n 
1 209 GLN n 
1 210 ASN n 
1 211 GLU n 
1 212 SER n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 ILE n 
1 217 VAL n 
1 218 ALA n 
1 219 ASP n 
1 220 TYR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLN n 
1 224 PRO n 
1 225 PRO n 
1 226 LEU n 
1 227 GLY n 
1 228 ILE n 
1 229 GLY n 
1 230 GLY n 
1 231 ILE n 
1 232 ASP n 
1 233 ALA n 
1 234 THR n 
1 235 ASP n 
1 236 LYS n 
1 237 GLY n 
1 238 LYS n 
1 239 GLU n 
1 240 TYR n 
1 241 GLY n 
1 242 GLY n 
1 243 LYS n 
1 244 ARG n 
1 245 ALA n 
1 246 PHE n 
1 247 GLY n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 ILE n 
1 252 GLY n 
1 253 GLY n 
1 254 LEU n 
1 255 LYS n 
1 256 LEU n 
1 257 LYS n 
1 258 LEU n 
1 259 HIS n 
1 260 ARG n 
1 261 ALA n 
1 262 CYS n 
1 263 ILE n 
1 264 ALA n 
1 265 LYS n 
1 266 LEU n 
1 267 PHE n 
1 268 GLU n 
1 269 SER n 
1 270 SER n 
1 271 GLU n 
1 272 GLY n 
1 273 VAL n 
1 274 PHE n 
1 275 ASP n 
1 276 ALA n 
1 277 GLU n 
1 278 GLU n 
1 279 ILE n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ALA n 
1 284 LYS n 
1 285 GLU n 
1 286 MET n 
1 287 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Methylobacterium 
_entity_src_gen.pdbx_gene_src_gene                 mtdA 
_entity_src_gen.gene_src_species                   'Methylobacterium extorquens' 
_entity_src_gen.gene_src_strain                    AM1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Methylobacterium extorquens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 17b CH1' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MTDA_METEX 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P55818 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LU9 A 1 ? 287 ? P55818 1 ? 287 ? 2 288 
2 1 1LU9 B 1 ? 287 ? P55818 1 ? 287 ? 2 288 
3 1 1LU9 C 1 ? 287 ? P55818 1 ? 287 ? 2 288 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LU9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.37 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'Hepes, PEG1500, Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-05-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     1LU9 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   69818 
_reflns.number_all                   69818 
_reflns.percent_possible_obs         93.8 
_reflns.pdbx_Rmerge_I_obs            0.0640000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.3 
_reflns.B_iso_Wilson_estimate        15.7 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.99 
_reflns_shell.percent_possible_all   84 
_reflns_shell.Rmerge_I_obs           0.2200000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8261 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1LU9 
_refine.ls_number_reflns_obs                     65187 
_refine.ls_number_reflns_all                     65187 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             29.89 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    87.5 
_refine.ls_R_factor_obs                          0.1890000 
_refine.ls_R_factor_all                          0.1890000 
_refine.ls_R_factor_R_work                       0.1890000 
_refine.ls_R_factor_R_free                       0.2290000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3331 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.3 
_refine.aniso_B[1][1]                            -5.25 
_refine.aniso_B[2][2]                            2.38 
_refine.aniso_B[3][3]                            2.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.48 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.317233 
_refine.solvent_model_param_bsol                 38.9865 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LU9 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6252 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             558 
_refine_hist.number_atoms_total               6810 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.97  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.60  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.16  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.53  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.56  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             8501 
_refine_ls_shell.R_factor_R_work                  0.2370000 
_refine_ls_shell.percent_reflns_obs               72.6 
_refine_ls_shell.R_factor_R_free                  0.2940000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             457 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 MTDAP21_CIS.PARAM ION.TOP     'X-RAY DIFFRACTION' 
5 ION.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LU9 
_struct.title                     
'Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1' 
_struct.pdbx_descriptor           'Methylene Tetrahydromethanopterin Dehydrogenase(E.C.1.5.1.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LU9 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'alpha/beta twisted open sheet structure, Oxidoreductase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 15  ? GLY A 25  ? SER A 16  GLY A 26  1 ? 11 
HELX_P HELX_P2  2  ASN A 40  ? TYR A 50  ? ASN A 41  TYR A 51  1 ? 11 
HELX_P HELX_P3  3  GLY A 53  ? GLN A 58  ? GLY A 54  GLN A 59  5 ? 6  
HELX_P HELX_P4  4  ASP A 68  ? PHE A 83  ? ASP A 69  PHE A 84  1 ? 16 
HELX_P HELX_P5  5  GLY A 97  ? ALA A 113 ? GLY A 98  ALA A 114 1 ? 17 
HELX_P HELX_P6  6  GLY A 129 ? GLU A 142 ? GLY A 130 GLU A 143 1 ? 14 
HELX_P HELX_P7  7  LYS A 152 ? LYS A 168 ? LYS A 153 LYS A 169 1 ? 17 
HELX_P HELX_P8  8  ASP A 178 ? VAL A 186 ? ASP A 179 VAL A 187 1 ? 9  
HELX_P HELX_P9  9  PRO A 204 ? GLN A 209 ? PRO A 205 GLN A 210 1 ? 6  
HELX_P HELX_P10 10 GLY A 247 ? PHE A 267 ? GLY A 248 PHE A 268 1 ? 21 
HELX_P HELX_P11 11 ASP A 275 ? ALA A 287 ? ASP A 276 ALA A 288 1 ? 13 
HELX_P HELX_P12 12 SER B 15  ? GLY B 25  ? SER B 16  GLY B 26  1 ? 11 
HELX_P HELX_P13 13 ASN B 40  ? TYR B 50  ? ASN B 41  TYR B 51  1 ? 11 
HELX_P HELX_P14 14 GLY B 53  ? GLN B 58  ? GLY B 54  GLN B 59  5 ? 6  
HELX_P HELX_P15 15 ASP B 68  ? PHE B 83  ? ASP B 69  PHE B 84  1 ? 16 
HELX_P HELX_P16 16 ASN B 99  ? ALA B 113 ? ASN B 100 ALA B 114 1 ? 15 
HELX_P HELX_P17 17 GLY B 129 ? GLU B 142 ? GLY B 130 GLU B 143 1 ? 14 
HELX_P HELX_P18 18 LYS B 152 ? LYS B 168 ? LYS B 153 LYS B 169 1 ? 17 
HELX_P HELX_P19 19 ASP B 178 ? VAL B 186 ? ASP B 179 VAL B 187 1 ? 9  
HELX_P HELX_P20 20 PRO B 204 ? TRP B 208 ? PRO B 205 TRP B 209 5 ? 5  
HELX_P HELX_P21 21 GLY B 247 ? PHE B 267 ? GLY B 248 PHE B 268 1 ? 21 
HELX_P HELX_P22 22 ASP B 275 ? ALA B 287 ? ASP B 276 ALA B 288 1 ? 13 
HELX_P HELX_P23 23 SER C 15  ? GLY C 25  ? SER C 16  GLY C 26  1 ? 11 
HELX_P HELX_P24 24 ASN C 40  ? TYR C 50  ? ASN C 41  TYR C 51  1 ? 11 
HELX_P HELX_P25 25 GLY C 53  ? GLN C 58  ? GLY C 54  GLN C 59  5 ? 6  
HELX_P HELX_P26 26 ASP C 68  ? PHE C 83  ? ASP C 69  PHE C 84  1 ? 16 
HELX_P HELX_P27 27 GLY C 97  ? ALA C 113 ? GLY C 98  ALA C 114 1 ? 17 
HELX_P HELX_P28 28 GLY C 129 ? GLU C 142 ? GLY C 130 GLU C 143 1 ? 14 
HELX_P HELX_P29 29 LYS C 152 ? LYS C 168 ? LYS C 153 LYS C 169 1 ? 17 
HELX_P HELX_P30 30 ASP C 178 ? VAL C 186 ? ASP C 179 VAL C 187 1 ? 9  
HELX_P HELX_P31 31 PRO C 204 ? TRP C 208 ? PRO C 205 TRP C 209 5 ? 5  
HELX_P HELX_P32 32 GLY C 247 ? PHE C 267 ? GLY C 248 PHE C 268 1 ? 21 
HELX_P HELX_P33 33 ASP C 275 ? ALA C 287 ? ASP C 276 ALA C 288 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 224 A . ? PRO 225 A PRO 225 A ? PRO 226 A 1 -0.99 
2 PRO 224 B . ? PRO 225 B PRO 225 B ? PRO 226 B 1 -0.18 
3 PRO 224 B . ? PRO 225 B PRO 225 B ? PRO 226 B 1 -0.26 
4 PRO 224 C . ? PRO 225 C PRO 225 C ? PRO 226 C 1 -1.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 5 ? 
D ? 7 ? 
E ? 5 ? 
F ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 29  ? TYR A 33  ? HIS A 30  TYR A 34  
A 2 LEU A 4   ? ASP A 9   ? LEU A 5   ASP A 10  
A 3 THR A 60  ? GLY A 65  ? THR A 61  GLY A 66  
A 4 SER A 90  ? LEU A 93  ? SER A 91  LEU A 94  
A 5 VAL A 273 ? PHE A 274 ? VAL A 274 PHE A 275 
B 1 THR A 172 ? GLU A 175 ? THR A 173 GLU A 176 
B 2 GLU A 145 ? GLY A 150 ? GLU A 146 GLY A 151 
B 3 LYS A 121 ? LEU A 125 ? LYS A 122 LEU A 126 
B 4 PHE A 191 ? THR A 194 ? PHE A 192 THR A 195 
B 5 ILE A 216 ? ASP A 219 ? ILE A 217 ASP A 220 
B 6 LYS A 243 ? PHE A 246 ? LYS A 244 PHE A 247 
B 7 LYS A 236 ? TYR A 240 ? LYS A 237 TYR A 241 
C 1 HIS B 29  ? TYR B 33  ? HIS B 30  TYR B 34  
C 2 LEU B 4   ? ASP B 9   ? LEU B 5   ASP B 10  
C 3 THR B 60  ? GLY B 65  ? THR B 61  GLY B 66  
C 4 SER B 90  ? LEU B 93  ? SER B 91  LEU B 94  
C 5 VAL B 273 ? PHE B 274 ? VAL B 274 PHE B 275 
D 1 THR B 172 ? GLU B 175 ? THR B 173 GLU B 176 
D 2 GLU B 145 ? GLY B 150 ? GLU B 146 GLY B 151 
D 3 LYS B 121 ? LEU B 125 ? LYS B 122 LEU B 126 
D 4 PHE B 191 ? THR B 194 ? PHE B 192 THR B 195 
D 5 ILE B 216 ? ASP B 219 ? ILE B 217 ASP B 220 
D 6 ARG B 244 ? PHE B 246 ? ARG B 245 PHE B 247 
D 7 LYS B 236 ? GLU B 239 ? LYS B 237 GLU B 240 
E 1 HIS C 29  ? TYR C 33  ? HIS C 30  TYR C 34  
E 2 LEU C 4   ? ASP C 9   ? LEU C 5   ASP C 10  
E 3 THR C 60  ? GLY C 65  ? THR C 61  GLY C 66  
E 4 SER C 90  ? LEU C 93  ? SER C 91  LEU C 94  
E 5 VAL C 273 ? PHE C 274 ? VAL C 274 PHE C 275 
F 1 THR C 172 ? GLU C 175 ? THR C 173 GLU C 176 
F 2 GLU C 145 ? GLY C 150 ? GLU C 146 GLY C 151 
F 3 LYS C 121 ? LEU C 125 ? LYS C 122 LEU C 126 
F 4 PHE C 191 ? THR C 194 ? PHE C 192 THR C 195 
F 5 ILE C 216 ? ASP C 219 ? ILE C 217 ASP C 220 
F 6 LYS C 243 ? PHE C 246 ? LYS C 244 PHE C 247 
F 7 LYS C 236 ? TYR C 240 ? LYS C 237 TYR C 241 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 29  ? O HIS A 30  N LEU A 5   ? N LEU A 6   
A 2 3 N PHE A 8   ? N PHE A 9   O PHE A 63  ? O PHE A 64  
A 3 4 N VAL A 64  ? N VAL A 65  O MET A 92  ? O MET A 93  
A 4 5 N CYS A 91  ? N CYS A 92  O PHE A 274 ? O PHE A 275 
B 1 2 O THR A 172 ? O THR A 173 N LEU A 148 ? N LEU A 149 
B 2 3 O GLU A 145 ? O GLU A 146 N ALA A 122 ? N ALA A 123 
B 3 4 N LEU A 125 ? N LEU A 126 O PHE A 193 ? O PHE A 194 
B 4 5 N VAL A 192 ? N VAL A 193 O ALA A 218 ? O ALA A 219 
B 5 6 N VAL A 217 ? N VAL A 218 O ARG A 244 ? O ARG A 245 
B 6 7 O LYS A 243 ? O LYS A 244 N TYR A 240 ? N TYR A 241 
C 1 2 O HIS B 29  ? O HIS B 30  N LEU B 5   ? N LEU B 6   
C 2 3 N PHE B 8   ? N PHE B 9   O PHE B 63  ? O PHE B 64  
C 3 4 N VAL B 64  ? N VAL B 65  O MET B 92  ? O MET B 93  
C 4 5 N CYS B 91  ? N CYS B 92  O PHE B 274 ? O PHE B 275 
D 1 2 O THR B 172 ? O THR B 173 N LEU B 148 ? N LEU B 149 
D 2 3 O VAL B 147 ? O VAL B 148 N VAL B 124 ? N VAL B 125 
D 3 4 N LEU B 125 ? N LEU B 126 O PHE B 193 ? O PHE B 194 
D 4 5 N VAL B 192 ? N VAL B 193 O ALA B 218 ? O ALA B 219 
D 5 6 N VAL B 217 ? N VAL B 218 O PHE B 246 ? O PHE B 247 
D 6 7 O ALA B 245 ? O ALA B 246 N LYS B 238 ? N LYS B 239 
E 1 2 O HIS C 29  ? O HIS C 30  N LEU C 5   ? N LEU C 6   
E 2 3 N PHE C 8   ? N PHE C 9   O PHE C 63  ? O PHE C 64  
E 3 4 N VAL C 64  ? N VAL C 65  O MET C 92  ? O MET C 93  
E 4 5 N CYS C 91  ? N CYS C 92  O PHE C 274 ? O PHE C 275 
F 1 2 O THR C 172 ? O THR C 173 N LEU C 148 ? N LEU C 149 
F 2 3 O VAL C 147 ? O VAL C 148 N VAL C 124 ? N VAL C 125 
F 3 4 N LEU C 125 ? N LEU C 126 O PHE C 193 ? O PHE C 194 
F 4 5 N VAL C 192 ? N VAL C 193 O ALA C 218 ? O ALA C 219 
F 5 6 N VAL C 217 ? N VAL C 218 O ARG C 244 ? O ARG C 245 
F 6 7 O LYS C 243 ? O LYS C 244 N TYR C 240 ? N TYR C 241 
# 
_database_PDB_matrix.entry_id          1LU9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LU9 
_atom_sites.fract_transf_matrix[1][1]   0.007511 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003315 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011732 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011833 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 58.054  74.076  44.497  1.00 30.91 ? 2    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 57.904  74.693  43.148  1.00 28.21 ? 2    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 56.826  73.983  42.311  1.00 28.22 ? 2    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 56.562  72.799  42.514  1.00 27.84 ? 2    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 59.234  74.608  42.415  1.00 31.24 ? 2    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 60.288  75.030  43.260  1.00 33.83 ? 2    SER A OG  1 
ATOM   7    N N   . LYS A 1 2   ? 56.208  74.691  41.364  1.00 21.68 ? 3    LYS A N   1 
ATOM   8    C CA  . LYS A 1 2   ? 55.199  74.032  40.539  1.00 21.99 ? 3    LYS A CA  1 
ATOM   9    C C   . LYS A 1 2   ? 55.837  72.900  39.755  1.00 18.48 ? 3    LYS A C   1 
ATOM   10   O O   . LYS A 1 2   ? 56.963  73.004  39.323  1.00 18.95 ? 3    LYS A O   1 
ATOM   11   C CB  . LYS A 1 2   ? 54.590  74.991  39.538  1.00 24.40 ? 3    LYS A CB  1 
ATOM   12   C CG  . LYS A 1 2   ? 53.953  76.215  40.132  1.00 31.65 ? 3    LYS A CG  1 
ATOM   13   C CD  . LYS A 1 2   ? 52.826  75.855  41.110  1.00 39.86 ? 3    LYS A CD  1 
ATOM   14   C CE  . LYS A 1 2   ? 51.649  75.186  40.420  1.00 43.22 ? 3    LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 2   ? 50.345  75.774  40.864  1.00 46.94 ? 3    LYS A NZ  1 
ATOM   16   N N   . LYS A 1 3   ? 55.089  71.840  39.547  1.00 19.97 ? 4    LYS A N   1 
ATOM   17   C CA  . LYS A 1 3   ? 55.593  70.707  38.748  1.00 21.14 ? 4    LYS A CA  1 
ATOM   18   C C   . LYS A 1 3   ? 55.465  71.062  37.270  1.00 20.78 ? 4    LYS A C   1 
ATOM   19   O O   . LYS A 1 3   ? 54.341  71.119  36.723  1.00 20.56 ? 4    LYS A O   1 
ATOM   20   C CB  . LYS A 1 3   ? 54.775  69.475  39.060  1.00 18.37 ? 4    LYS A CB  1 
ATOM   21   C CG  . LYS A 1 3   ? 55.136  68.892  40.444  1.00 19.80 ? 4    LYS A CG  1 
ATOM   22   C CD  . LYS A 1 3   ? 54.224  67.694  40.776  1.00 19.75 ? 4    LYS A CD  1 
ATOM   23   C CE  . LYS A 1 3   ? 52.818  68.176  41.116  1.00 17.76 ? 4    LYS A CE  1 
ATOM   24   N NZ  . LYS A 1 3   ? 51.860  67.068  41.404  1.00 19.26 ? 4    LYS A NZ  1 
ATOM   25   N N   . LEU A 1 4   ? 56.614  71.279  36.631  1.00 20.28 ? 5    LEU A N   1 
ATOM   26   C CA  . LEU A 1 4   ? 56.630  71.697  35.234  1.00 18.33 ? 5    LEU A CA  1 
ATOM   27   C C   . LEU A 1 4   ? 57.058  70.576  34.288  1.00 18.40 ? 5    LEU A C   1 
ATOM   28   O O   . LEU A 1 4   ? 58.186  70.054  34.396  1.00 18.34 ? 5    LEU A O   1 
ATOM   29   C CB  . LEU A 1 4   ? 57.599  72.870  35.061  1.00 18.18 ? 5    LEU A CB  1 
ATOM   30   C CG  . LEU A 1 4   ? 57.402  74.059  35.995  1.00 14.13 ? 5    LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 4   ? 58.468  75.076  35.621  1.00 17.42 ? 5    LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 4   ? 55.992  74.669  35.830  1.00 17.78 ? 5    LEU A CD2 1 
ATOM   33   N N   . LEU A 1 5   ? 56.165  70.195  33.385  1.00 17.49 ? 6    LEU A N   1 
ATOM   34   C CA  . LEU A 1 5   ? 56.504  69.151  32.408  1.00 18.25 ? 6    LEU A CA  1 
ATOM   35   C C   . LEU A 1 5   ? 56.831  69.797  31.065  1.00 18.91 ? 6    LEU A C   1 
ATOM   36   O O   . LEU A 1 5   ? 56.034  70.605  30.561  1.00 18.64 ? 6    LEU A O   1 
ATOM   37   C CB  . LEU A 1 5   ? 55.338  68.169  32.211  1.00 18.83 ? 6    LEU A CB  1 
ATOM   38   C CG  . LEU A 1 5   ? 55.671  66.972  31.296  1.00 20.17 ? 6    LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 5   ? 56.757  66.039  31.890  1.00 18.45 ? 6    LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 5   ? 54.352  66.192  31.057  1.00 18.45 ? 6    LEU A CD2 1 
ATOM   41   N N   . PHE A 1 6   ? 57.998  69.457  30.500  1.00 16.76 ? 7    PHE A N   1 
ATOM   42   C CA  . PHE A 1 6   ? 58.372  69.969  29.202  1.00 17.60 ? 7    PHE A CA  1 
ATOM   43   C C   . PHE A 1 6   ? 58.216  68.834  28.215  1.00 20.06 ? 7    PHE A C   1 
ATOM   44   O O   . PHE A 1 6   ? 58.827  67.761  28.340  1.00 18.75 ? 7    PHE A O   1 
ATOM   45   C CB  . PHE A 1 6   ? 59.785  70.576  29.197  1.00 18.25 ? 7    PHE A CB  1 
ATOM   46   C CG  . PHE A 1 6   ? 59.836  71.915  29.888  1.00 18.25 ? 7    PHE A CG  1 
ATOM   47   C CD1 . PHE A 1 6   ? 60.089  71.996  31.283  1.00 16.81 ? 7    PHE A CD1 1 
ATOM   48   C CD2 . PHE A 1 6   ? 59.482  73.082  29.194  1.00 17.18 ? 7    PHE A CD2 1 
ATOM   49   C CE1 . PHE A 1 6   ? 59.991  73.214  31.978  1.00 18.61 ? 7    PHE A CE1 1 
ATOM   50   C CE2 . PHE A 1 6   ? 59.369  74.318  29.880  1.00 19.00 ? 7    PHE A CE2 1 
ATOM   51   C CZ  . PHE A 1 6   ? 59.629  74.384  31.280  1.00 15.62 ? 7    PHE A CZ  1 
ATOM   52   N N   . GLN A 1 7   ? 57.333  69.076  27.263  1.00 18.31 ? 8    GLN A N   1 
ATOM   53   C CA  . GLN A 1 7   ? 56.986  68.074  26.260  1.00 20.44 ? 8    GLN A CA  1 
ATOM   54   C C   . GLN A 1 7   ? 57.720  68.392  24.976  1.00 18.88 ? 8    GLN A C   1 
ATOM   55   O O   . GLN A 1 7   ? 57.507  69.450  24.375  1.00 17.92 ? 8    GLN A O   1 
ATOM   56   C CB  . GLN A 1 7   ? 55.463  68.128  26.006  1.00 21.65 ? 8    GLN A CB  1 
ATOM   57   C CG  . GLN A 1 7   ? 54.927  67.173  24.903  1.00 22.37 ? 8    GLN A CG  1 
ATOM   58   C CD  . GLN A 1 7   ? 53.410  67.367  24.617  1.00 22.37 ? 8    GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 7   ? 52.772  66.513  23.988  1.00 22.51 ? 8    GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 7   ? 52.858  68.490  25.048  1.00 19.10 ? 8    GLN A NE2 1 
ATOM   61   N N   . PHE A 1 8   ? 58.581  67.470  24.576  1.00 19.36 ? 9    PHE A N   1 
ATOM   62   C CA  . PHE A 1 8   ? 59.374  67.587  23.343  1.00 19.69 ? 9    PHE A CA  1 
ATOM   63   C C   . PHE A 1 8   ? 58.811  66.537  22.365  1.00 20.65 ? 9    PHE A C   1 
ATOM   64   O O   . PHE A 1 8   ? 58.996  65.317  22.552  1.00 20.39 ? 9    PHE A O   1 
ATOM   65   C CB  . PHE A 1 8   ? 60.842  67.305  23.655  1.00 20.82 ? 9    PHE A CB  1 
ATOM   66   C CG  . PHE A 1 8   ? 61.452  68.225  24.686  1.00 22.53 ? 9    PHE A CG  1 
ATOM   67   C CD1 . PHE A 1 8   ? 62.498  67.771  25.500  1.00 25.34 ? 9    PHE A CD1 1 
ATOM   68   C CD2 . PHE A 1 8   ? 61.024  69.545  24.824  1.00 20.75 ? 9    PHE A CD2 1 
ATOM   69   C CE1 . PHE A 1 8   ? 63.106  68.622  26.446  1.00 24.70 ? 9    PHE A CE1 1 
ATOM   70   C CE2 . PHE A 1 8   ? 61.632  70.408  25.762  1.00 21.79 ? 9    PHE A CE2 1 
ATOM   71   C CZ  . PHE A 1 8   ? 62.670  69.940  26.573  1.00 24.06 ? 9    PHE A CZ  1 
ATOM   72   N N   . ASP A 1 9   ? 58.131  67.014  21.315  1.00 20.62 ? 10   ASP A N   1 
ATOM   73   C CA  . ASP A 1 9   ? 57.495  66.120  20.352  1.00 21.70 ? 10   ASP A CA  1 
ATOM   74   C C   . ASP A 1 9   ? 58.247  66.223  19.011  1.00 23.46 ? 10   ASP A C   1 
ATOM   75   O O   . ASP A 1 9   ? 58.605  67.311  18.559  1.00 20.93 ? 10   ASP A O   1 
ATOM   76   C CB  . ASP A 1 9   ? 56.013  66.542  20.195  1.00 23.38 ? 10   ASP A CB  1 
ATOM   77   C CG  . ASP A 1 9   ? 55.134  65.473  19.528  1.00 24.88 ? 10   ASP A CG  1 
ATOM   78   O OD1 . ASP A 1 9   ? 55.461  65.018  18.400  1.00 23.40 ? 10   ASP A OD1 1 
ATOM   79   O OD2 . ASP A 1 9   ? 54.082  65.116  20.138  1.00 22.59 ? 10   ASP A OD2 1 
ATOM   80   N N   . THR A 1 10  ? 58.472  65.077  18.383  1.00 23.28 ? 11   THR A N   1 
ATOM   81   C CA  . THR A 1 10  ? 59.195  65.032  17.122  1.00 23.39 ? 11   THR A CA  1 
ATOM   82   C C   . THR A 1 10  ? 58.298  65.389  15.925  1.00 23.42 ? 11   THR A C   1 
ATOM   83   O O   . THR A 1 10  ? 58.810  65.621  14.836  1.00 21.82 ? 11   THR A O   1 
ATOM   84   C CB  . THR A 1 10  ? 59.823  63.620  16.891  1.00 25.78 ? 11   THR A CB  1 
ATOM   85   O OG1 . THR A 1 10  ? 58.830  62.600  17.064  1.00 22.79 ? 11   THR A OG1 1 
ATOM   86   C CG2 . THR A 1 10  ? 60.964  63.384  17.872  1.00 23.51 ? 11   THR A CG2 1 
ATOM   87   N N   . ASP A 1 11  ? 56.976  65.410  16.133  1.00 22.31 ? 12   ASP A N   1 
ATOM   88   C CA  . ASP A 1 11  ? 55.999  65.787  15.084  1.00 21.01 ? 12   ASP A CA  1 
ATOM   89   C C   . ASP A 1 11  ? 55.947  67.324  15.036  1.00 21.60 ? 12   ASP A C   1 
ATOM   90   O O   . ASP A 1 11  ? 56.484  67.972  15.911  1.00 18.30 ? 12   ASP A O   1 
ATOM   91   C CB  . ASP A 1 11  ? 54.574  65.266  15.406  1.00 21.80 ? 12   ASP A CB  1 
ATOM   92   C CG  . ASP A 1 11  ? 54.482  63.741  15.352  1.00 25.10 ? 12   ASP A CG  1 
ATOM   93   O OD1 . ASP A 1 11  ? 55.265  63.133  14.605  1.00 30.51 ? 12   ASP A OD1 1 
ATOM   94   O OD2 . ASP A 1 11  ? 53.635  63.150  16.035  1.00 26.44 ? 12   ASP A OD2 1 
ATOM   95   N N   . ALA A 1 12  ? 55.274  67.892  14.036  1.00 20.02 ? 13   ALA A N   1 
ATOM   96   C CA  . ALA A 1 12  ? 55.198  69.347  13.882  1.00 22.04 ? 13   ALA A CA  1 
ATOM   97   C C   . ALA A 1 12  ? 54.585  70.107  15.063  1.00 22.52 ? 13   ALA A C   1 
ATOM   98   O O   . ALA A 1 12  ? 54.935  71.254  15.301  1.00 23.53 ? 13   ALA A O   1 
ATOM   99   C CB  . ALA A 1 12  ? 54.424  69.682  12.604  1.00 23.91 ? 13   ALA A CB  1 
ATOM   100  N N   . THR A 1 13  ? 53.643  69.498  15.767  1.00 20.37 ? 14   THR A N   1 
ATOM   101  C CA  . THR A 1 13  ? 53.040  70.131  16.935  1.00 21.68 ? 14   THR A CA  1 
ATOM   102  C C   . THR A 1 13  ? 52.917  69.053  18.042  1.00 20.68 ? 14   THR A C   1 
ATOM   103  O O   . THR A 1 13  ? 52.903  67.849  17.752  1.00 18.54 ? 14   THR A O   1 
ATOM   104  C CB  . THR A 1 13  ? 51.654  70.723  16.618  1.00 23.01 ? 14   THR A CB  1 
ATOM   105  O OG1 . THR A 1 13  ? 50.764  69.664  16.264  1.00 22.30 ? 14   THR A OG1 1 
ATOM   106  C CG2 . THR A 1 13  ? 51.742  71.734  15.458  1.00 22.01 ? 14   THR A CG2 1 
ATOM   107  N N   . PRO A 1 14  ? 52.865  69.472  19.328  1.00 20.06 ? 15   PRO A N   1 
ATOM   108  C CA  . PRO A 1 14  ? 52.762  68.488  20.414  1.00 17.87 ? 15   PRO A CA  1 
ATOM   109  C C   . PRO A 1 14  ? 51.447  67.705  20.457  1.00 20.19 ? 15   PRO A C   1 
ATOM   110  O O   . PRO A 1 14  ? 50.364  68.260  20.258  1.00 20.11 ? 15   PRO A O   1 
ATOM   111  C CB  . PRO A 1 14  ? 52.941  69.324  21.704  1.00 18.94 ? 15   PRO A CB  1 
ATOM   112  C CG  . PRO A 1 14  ? 53.519  70.684  21.225  1.00 18.99 ? 15   PRO A CG  1 
ATOM   113  C CD  . PRO A 1 14  ? 52.858  70.851  19.841  1.00 19.14 ? 15   PRO A CD  1 
ATOM   114  N N   . SER A 1 15  ? 51.565  66.402  20.728  1.00 19.27 ? 16   SER A N   1 
ATOM   115  C CA  . SER A 1 15  ? 50.401  65.523  20.849  1.00 19.79 ? 16   SER A CA  1 
ATOM   116  C C   . SER A 1 15  ? 49.380  65.999  21.879  1.00 19.20 ? 16   SER A C   1 
ATOM   117  O O   . SER A 1 15  ? 49.729  66.195  23.070  1.00 17.30 ? 16   SER A O   1 
ATOM   118  C CB  . SER A 1 15  ? 50.838  64.113  21.285  1.00 23.24 ? 16   SER A CB  1 
ATOM   119  O OG  . SER A 1 15  ? 49.721  63.409  21.807  1.00 21.79 ? 16   SER A OG  1 
ATOM   120  N N   . VAL A 1 16  ? 48.128  66.141  21.450  1.00 17.78 ? 17   VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? 47.064  66.558  22.388  1.00 17.50 ? 17   VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? 46.888  65.432  23.399  1.00 19.64 ? 17   VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? 46.692  65.660  24.596  1.00 16.14 ? 17   VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? 45.676  66.744  21.697  1.00 16.76 ? 17   VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? 44.540  66.845  22.776  1.00 17.06 ? 17   VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? 45.684  68.033  20.818  1.00 17.70 ? 17   VAL A CG2 1 
ATOM   127  N N   . PHE A 1 17  ? 46.952  64.208  22.895  1.00 16.58 ? 18   PHE A N   1 
ATOM   128  C CA  . PHE A 1 17  ? 46.748  63.054  23.739  1.00 17.90 ? 18   PHE A CA  1 
ATOM   129  C C   . PHE A 1 17  ? 47.689  63.103  24.970  1.00 20.02 ? 18   PHE A C   1 
ATOM   130  O O   . PHE A 1 17  ? 47.226  62.967  26.116  1.00 16.89 ? 18   PHE A O   1 
ATOM   131  C CB  . PHE A 1 17  ? 47.041  61.792  22.938  1.00 21.34 ? 18   PHE A CB  1 
ATOM   132  C CG  . PHE A 1 17  ? 46.684  60.521  23.650  1.00 21.35 ? 18   PHE A CG  1 
ATOM   133  C CD1 . PHE A 1 17  ? 45.508  59.834  23.308  1.00 25.97 ? 18   PHE A CD1 1 
ATOM   134  C CD2 . PHE A 1 17  ? 47.485  60.018  24.651  1.00 22.78 ? 18   PHE A CD2 1 
ATOM   135  C CE1 . PHE A 1 17  ? 45.144  58.676  23.958  1.00 24.41 ? 18   PHE A CE1 1 
ATOM   136  C CE2 . PHE A 1 17  ? 47.131  58.845  25.316  1.00 26.83 ? 18   PHE A CE2 1 
ATOM   137  C CZ  . PHE A 1 17  ? 45.950  58.175  24.964  1.00 24.87 ? 18   PHE A CZ  1 
ATOM   138  N N   . ASP A 1 18  ? 49.002  63.259  24.699  1.00 18.57 ? 19   ASP A N   1 
ATOM   139  C CA  . ASP A 1 18  ? 50.020  63.316  25.750  1.00 19.16 ? 19   ASP A CA  1 
ATOM   140  C C   . ASP A 1 18  ? 49.795  64.489  26.719  1.00 20.14 ? 19   ASP A C   1 
ATOM   141  O O   . ASP A 1 18  ? 50.124  64.424  27.933  1.00 18.18 ? 19   ASP A O   1 
ATOM   142  C CB  . ASP A 1 18  ? 51.418  63.397  25.134  1.00 21.96 ? 19   ASP A CB  1 
ATOM   143  C CG  . ASP A 1 18  ? 51.754  62.162  24.278  1.00 22.92 ? 19   ASP A CG  1 
ATOM   144  O OD1 . ASP A 1 18  ? 51.175  61.077  24.505  1.00 24.02 ? 19   ASP A OD1 1 
ATOM   145  O OD2 . ASP A 1 18  ? 52.598  62.283  23.387  1.00 22.69 ? 19   ASP A OD2 1 
ATOM   146  N N   . VAL A 1 19  ? 49.262  65.580  26.196  1.00 16.27 ? 20   VAL A N   1 
ATOM   147  C CA  . VAL A 1 19  ? 48.978  66.712  27.095  1.00 15.39 ? 20   VAL A CA  1 
ATOM   148  C C   . VAL A 1 19  ? 47.915  66.376  28.168  1.00 16.37 ? 20   VAL A C   1 
ATOM   149  O O   . VAL A 1 19  ? 48.132  66.629  29.383  1.00 14.84 ? 20   VAL A O   1 
ATOM   150  C CB  . VAL A 1 19  ? 48.508  67.931  26.306  1.00 17.17 ? 20   VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 19  ? 47.917  68.974  27.263  1.00 14.41 ? 20   VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 19  ? 49.729  68.560  25.559  1.00 20.39 ? 20   VAL A CG2 1 
ATOM   153  N N   . VAL A 1 20  ? 46.781  65.817  27.738  1.00 13.32 ? 21   VAL A N   1 
ATOM   154  C CA  . VAL A 1 20  ? 45.706  65.498  28.709  1.00 15.41 ? 21   VAL A CA  1 
ATOM   155  C C   . VAL A 1 20  ? 46.243  64.496  29.768  1.00 17.92 ? 21   VAL A C   1 
ATOM   156  O O   . VAL A 1 20  ? 46.092  64.681  31.009  1.00 13.57 ? 21   VAL A O   1 
ATOM   157  C CB  . VAL A 1 20  ? 44.442  64.841  28.024  1.00 16.07 ? 21   VAL A CB  1 
ATOM   158  C CG1 . VAL A 1 20  ? 43.359  64.522  29.100  1.00 13.46 ? 21   VAL A CG1 1 
ATOM   159  C CG2 . VAL A 1 20  ? 43.821  65.805  26.848  1.00 14.68 ? 21   VAL A CG2 1 
ATOM   160  N N   . VAL A 1 21  ? 46.839  63.400  29.288  1.00 20.44 ? 22   VAL A N   1 
ATOM   161  C CA  . VAL A 1 21  ? 47.356  62.401  30.226  1.00 18.21 ? 22   VAL A CA  1 
ATOM   162  C C   . VAL A 1 21  ? 48.395  63.018  31.167  1.00 19.59 ? 22   VAL A C   1 
ATOM   163  O O   . VAL A 1 21  ? 48.430  62.708  32.365  1.00 18.25 ? 22   VAL A O   1 
ATOM   164  C CB  . VAL A 1 21  ? 47.951  61.193  29.465  1.00 21.67 ? 22   VAL A CB  1 
ATOM   165  C CG1 . VAL A 1 21  ? 48.363  60.077  30.458  1.00 20.80 ? 22   VAL A CG1 1 
ATOM   166  C CG2 . VAL A 1 21  ? 46.901  60.650  28.494  1.00 17.91 ? 22   VAL A CG2 1 
ATOM   167  N N   . GLY A 1 22  ? 49.236  63.916  30.632  1.00 19.05 ? 23   GLY A N   1 
ATOM   168  C CA  . GLY A 1 22  ? 50.230  64.569  31.463  1.00 17.79 ? 23   GLY A CA  1 
ATOM   169  C C   . GLY A 1 22  ? 49.572  65.334  32.604  1.00 20.45 ? 23   GLY A C   1 
ATOM   170  O O   . GLY A 1 22  ? 50.015  65.249  33.775  1.00 20.70 ? 23   GLY A O   1 
ATOM   171  N N   . TYR A 1 23  ? 48.537  66.108  32.292  1.00 19.89 ? 24   TYR A N   1 
ATOM   172  C CA  . TYR A 1 23  ? 47.862  66.839  33.341  1.00 18.53 ? 24   TYR A CA  1 
ATOM   173  C C   . TYR A 1 23  ? 47.149  65.884  34.292  1.00 21.48 ? 24   TYR A C   1 
ATOM   174  O O   . TYR A 1 23  ? 47.108  66.118  35.510  1.00 19.90 ? 24   TYR A O   1 
ATOM   175  C CB  . TYR A 1 23  ? 46.868  67.830  32.780  1.00 17.58 ? 24   TYR A CB  1 
ATOM   176  C CG  . TYR A 1 23  ? 47.514  69.118  32.294  1.00 17.59 ? 24   TYR A CG  1 
ATOM   177  C CD1 . TYR A 1 23  ? 47.378  69.542  30.954  1.00 18.31 ? 24   TYR A CD1 1 
ATOM   178  C CD2 . TYR A 1 23  ? 48.235  69.909  33.165  1.00 17.40 ? 24   TYR A CD2 1 
ATOM   179  C CE1 . TYR A 1 23  ? 47.958  70.738  30.531  1.00 17.77 ? 24   TYR A CE1 1 
ATOM   180  C CE2 . TYR A 1 23  ? 48.831  71.113  32.752  1.00 20.24 ? 24   TYR A CE2 1 
ATOM   181  C CZ  . TYR A 1 23  ? 48.683  71.515  31.430  1.00 21.00 ? 24   TYR A CZ  1 
ATOM   182  O OH  . TYR A 1 23  ? 49.243  72.708  31.031  1.00 21.65 ? 24   TYR A OH  1 
ATOM   183  N N   . ASP A 1 24  ? 46.571  64.820  33.770  1.00 18.30 ? 25   ASP A N   1 
ATOM   184  C CA  . ASP A 1 24  ? 45.916  63.919  34.715  1.00 21.23 ? 25   ASP A CA  1 
ATOM   185  C C   . ASP A 1 24  ? 46.948  63.129  35.544  1.00 21.63 ? 25   ASP A C   1 
ATOM   186  O O   . ASP A 1 24  ? 46.582  62.448  36.519  1.00 20.43 ? 25   ASP A O   1 
ATOM   187  C CB  . ASP A 1 24  ? 44.949  62.979  33.994  1.00 20.75 ? 25   ASP A CB  1 
ATOM   188  C CG  . ASP A 1 24  ? 43.647  63.711  33.559  1.00 22.92 ? 25   ASP A CG  1 
ATOM   189  O OD1 . ASP A 1 24  ? 43.259  64.694  34.220  1.00 21.91 ? 25   ASP A OD1 1 
ATOM   190  O OD2 . ASP A 1 24  ? 43.037  63.305  32.563  1.00 21.56 ? 25   ASP A OD2 1 
ATOM   191  N N   . GLY A 1 25  ? 48.218  63.213  35.129  1.00 21.24 ? 26   GLY A N   1 
ATOM   192  C CA  . GLY A 1 25  ? 49.298  62.536  35.821  1.00 23.56 ? 26   GLY A CA  1 
ATOM   193  C C   . GLY A 1 25  ? 49.886  63.439  36.912  1.00 26.51 ? 26   GLY A C   1 
ATOM   194  O O   . GLY A 1 25  ? 50.816  63.042  37.620  1.00 29.60 ? 26   GLY A O   1 
ATOM   195  N N   . GLY A 1 26  ? 49.372  64.662  37.030  1.00 23.21 ? 27   GLY A N   1 
ATOM   196  C CA  . GLY A 1 26  ? 49.840  65.551  38.080  1.00 22.58 ? 27   GLY A CA  1 
ATOM   197  C C   . GLY A 1 26  ? 50.698  66.734  37.681  1.00 22.85 ? 27   GLY A C   1 
ATOM   198  O O   . GLY A 1 26  ? 51.044  67.531  38.547  1.00 26.25 ? 27   GLY A O   1 
ATOM   199  N N   . ALA A 1 27  ? 51.074  66.859  36.414  1.00 18.51 ? 28   ALA A N   1 
ATOM   200  C CA  . ALA A 1 27  ? 51.878  68.032  36.032  1.00 20.63 ? 28   ALA A CA  1 
ATOM   201  C C   . ALA A 1 27  ? 51.030  69.259  36.372  1.00 18.95 ? 28   ALA A C   1 
ATOM   202  O O   . ALA A 1 27  ? 49.812  69.211  36.208  1.00 22.77 ? 28   ALA A O   1 
ATOM   203  C CB  . ALA A 1 27  ? 52.177  68.033  34.512  1.00 19.25 ? 28   ALA A CB  1 
ATOM   204  N N   . ASP A 1 28  ? 51.658  70.325  36.871  1.00 20.73 ? 29   ASP A N   1 
ATOM   205  C CA  . ASP A 1 28  ? 50.941  71.567  37.173  1.00 19.44 ? 29   ASP A CA  1 
ATOM   206  C C   . ASP A 1 28  ? 50.898  72.413  35.882  1.00 20.24 ? 29   ASP A C   1 
ATOM   207  O O   . ASP A 1 28  ? 49.943  73.188  35.659  1.00 20.25 ? 29   ASP A O   1 
ATOM   208  C CB  . ASP A 1 28  ? 51.648  72.379  38.264  1.00 19.74 ? 29   ASP A CB  1 
ATOM   209  C CG  . ASP A 1 28  ? 51.510  71.752  39.653  1.00 23.79 ? 29   ASP A CG  1 
ATOM   210  O OD1 . ASP A 1 28  ? 50.381  71.350  40.034  1.00 26.42 ? 29   ASP A OD1 1 
ATOM   211  O OD2 . ASP A 1 28  ? 52.526  71.687  40.366  1.00 21.15 ? 29   ASP A OD2 1 
ATOM   212  N N   . HIS A 1 29  ? 51.931  72.285  35.054  1.00 18.17 ? 30   HIS A N   1 
ATOM   213  C CA  . HIS A 1 29  ? 51.997  73.011  33.789  1.00 18.71 ? 30   HIS A CA  1 
ATOM   214  C C   . HIS A 1 29  ? 52.735  72.185  32.765  1.00 19.76 ? 30   HIS A C   1 
ATOM   215  O O   . HIS A 1 29  ? 53.753  71.577  33.086  1.00 22.17 ? 30   HIS A O   1 
ATOM   216  C CB  . HIS A 1 29  ? 52.765  74.319  33.915  1.00 18.69 ? 30   HIS A CB  1 
ATOM   217  C CG  . HIS A 1 29  ? 52.096  75.315  34.787  1.00 22.70 ? 30   HIS A CG  1 
ATOM   218  N ND1 . HIS A 1 29  ? 50.883  75.891  34.457  1.00 23.26 ? 30   HIS A ND1 1 
ATOM   219  C CD2 . HIS A 1 29  ? 52.409  75.771  36.026  1.00 25.43 ? 30   HIS A CD2 1 
ATOM   220  C CE1 . HIS A 1 29  ? 50.474  76.652  35.461  1.00 25.16 ? 30   HIS A CE1 1 
ATOM   221  N NE2 . HIS A 1 29  ? 51.378  76.596  36.426  1.00 27.05 ? 30   HIS A NE2 1 
ATOM   222  N N   . ILE A 1 30  ? 52.225  72.167  31.538  1.00 17.67 ? 31   ILE A N   1 
ATOM   223  C CA  . ILE A 1 30  ? 52.900  71.453  30.466  1.00 18.21 ? 31   ILE A CA  1 
ATOM   224  C C   . ILE A 1 30  ? 53.214  72.480  29.372  1.00 19.39 ? 31   ILE A C   1 
ATOM   225  O O   . ILE A 1 30  ? 52.345  73.237  28.949  1.00 20.07 ? 31   ILE A O   1 
ATOM   226  C CB  . ILE A 1 30  ? 52.035  70.362  29.893  1.00 17.57 ? 31   ILE A CB  1 
ATOM   227  C CG1 . ILE A 1 30  ? 51.701  69.347  31.014  1.00 17.73 ? 31   ILE A CG1 1 
ATOM   228  C CG2 . ILE A 1 30  ? 52.773  69.685  28.740  1.00 15.53 ? 31   ILE A CG2 1 
ATOM   229  C CD1 . ILE A 1 30  ? 50.780  68.210  30.553  1.00 21.59 ? 31   ILE A CD1 1 
ATOM   230  N N   . THR A 1 31  ? 54.472  72.521  28.969  1.00 19.46 ? 32   THR A N   1 
ATOM   231  C CA  . THR A 1 31  ? 54.916  73.448  27.921  1.00 19.81 ? 32   THR A CA  1 
ATOM   232  C C   . THR A 1 31  ? 55.451  72.574  26.780  1.00 18.68 ? 32   THR A C   1 
ATOM   233  O O   . THR A 1 31  ? 56.436  71.860  26.942  1.00 15.14 ? 32   THR A O   1 
ATOM   234  C CB  . THR A 1 31  ? 56.028  74.351  28.456  1.00 20.47 ? 32   THR A CB  1 
ATOM   235  O OG1 . THR A 1 31  ? 55.536  75.031  29.630  1.00 20.92 ? 32   THR A OG1 1 
ATOM   236  C CG2 . THR A 1 31  ? 56.451  75.346  27.374  1.00 17.74 ? 32   THR A CG2 1 
ATOM   237  N N   . GLY A 1 32  ? 54.782  72.630  25.633  1.00 17.74 ? 33   GLY A N   1 
ATOM   238  C CA  . GLY A 1 32  ? 55.190  71.776  24.541  1.00 18.39 ? 33   GLY A CA  1 
ATOM   239  C C   . GLY A 1 32  ? 55.823  72.413  23.338  1.00 19.25 ? 33   GLY A C   1 
ATOM   240  O O   . GLY A 1 32  ? 55.493  73.544  22.961  1.00 19.03 ? 33   GLY A O   1 
ATOM   241  N N   . TYR A 1 33  ? 56.738  71.653  22.748  1.00 18.40 ? 34   TYR A N   1 
ATOM   242  C CA  . TYR A 1 33  ? 57.493  72.053  21.559  1.00 19.95 ? 34   TYR A CA  1 
ATOM   243  C C   . TYR A 1 33  ? 57.354  70.941  20.511  1.00 21.22 ? 34   TYR A C   1 
ATOM   244  O O   . TYR A 1 33  ? 57.391  69.761  20.851  1.00 19.68 ? 34   TYR A O   1 
ATOM   245  C CB  . TYR A 1 33  ? 58.981  72.190  21.885  1.00 20.78 ? 34   TYR A CB  1 
ATOM   246  C CG  . TYR A 1 33  ? 59.307  73.252  22.901  1.00 17.90 ? 34   TYR A CG  1 
ATOM   247  C CD1 . TYR A 1 33  ? 59.071  73.039  24.259  1.00 18.75 ? 34   TYR A CD1 1 
ATOM   248  C CD2 . TYR A 1 33  ? 59.769  74.521  22.487  1.00 19.94 ? 34   TYR A CD2 1 
ATOM   249  C CE1 . TYR A 1 33  ? 59.270  74.076  25.210  1.00 18.28 ? 34   TYR A CE1 1 
ATOM   250  C CE2 . TYR A 1 33  ? 59.967  75.553  23.406  1.00 20.93 ? 34   TYR A CE2 1 
ATOM   251  C CZ  . TYR A 1 33  ? 59.713  75.323  24.764  1.00 20.25 ? 34   TYR A CZ  1 
ATOM   252  O OH  . TYR A 1 33  ? 59.866  76.338  25.660  1.00 20.72 ? 34   TYR A OH  1 
ATOM   253  N N   . GLY A 1 34  ? 57.172  71.334  19.244  1.00 21.38 ? 35   GLY A N   1 
ATOM   254  C CA  . GLY A 1 34  ? 57.087  70.379  18.158  1.00 20.81 ? 35   GLY A CA  1 
ATOM   255  C C   . GLY A 1 34  ? 58.419  70.541  17.402  1.00 23.96 ? 35   GLY A C   1 
ATOM   256  O O   . GLY A 1 34  ? 59.249  71.385  17.752  1.00 21.14 ? 35   GLY A O   1 
ATOM   257  N N   . ASN A 1 35  ? 58.605  69.735  16.361  1.00 22.45 ? 36   ASN A N   1 
ATOM   258  C CA  . ASN A 1 35  ? 59.814  69.768  15.566  1.00 23.79 ? 36   ASN A CA  1 
ATOM   259  C C   . ASN A 1 35  ? 61.108  69.567  16.365  1.00 23.45 ? 36   ASN A C   1 
ATOM   260  O O   . ASN A 1 35  ? 62.149  70.078  15.966  1.00 21.59 ? 36   ASN A O   1 
ATOM   261  C CB  . ASN A 1 35  ? 59.853  71.097  14.819  1.00 26.00 ? 36   ASN A CB  1 
ATOM   262  C CG  . ASN A 1 35  ? 58.624  71.293  13.943  1.00 29.54 ? 36   ASN A CG  1 
ATOM   263  O OD1 . ASN A 1 35  ? 58.330  70.442  13.099  1.00 26.82 ? 36   ASN A OD1 1 
ATOM   264  N ND2 . ASN A 1 35  ? 57.896  72.410  14.141  1.00 27.39 ? 36   ASN A ND2 1 
ATOM   265  N N   . VAL A 1 36  ? 61.066  68.841  17.485  1.00 22.32 ? 37   VAL A N   1 
ATOM   266  C CA  . VAL A 1 36  ? 62.288  68.646  18.254  1.00 20.51 ? 37   VAL A CA  1 
ATOM   267  C C   . VAL A 1 36  ? 63.209  67.612  17.581  1.00 22.75 ? 37   VAL A C   1 
ATOM   268  O O   . VAL A 1 36  ? 62.754  66.561  17.116  1.00 22.72 ? 37   VAL A O   1 
ATOM   269  C CB  . VAL A 1 36  ? 61.991  68.181  19.723  1.00 19.14 ? 37   VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 36  ? 63.280  68.065  20.498  1.00 22.47 ? 37   VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 36  ? 61.043  69.177  20.446  1.00 18.32 ? 37   VAL A CG2 1 
ATOM   272  N N   . THR A 1 37  ? 64.502  67.913  17.542  1.00 23.72 ? 38   THR A N   1 
ATOM   273  C CA  . THR A 1 37  ? 65.491  67.005  16.957  1.00 26.33 ? 38   THR A CA  1 
ATOM   274  C C   . THR A 1 37  ? 66.673  66.874  17.914  1.00 26.09 ? 38   THR A C   1 
ATOM   275  O O   . THR A 1 37  ? 66.762  67.615  18.879  1.00 25.52 ? 38   THR A O   1 
ATOM   276  C CB  . THR A 1 37  ? 66.059  67.558  15.678  1.00 27.30 ? 38   THR A CB  1 
ATOM   277  O OG1 . THR A 1 37  ? 66.834  68.721  15.995  1.00 26.71 ? 38   THR A OG1 1 
ATOM   278  C CG2 . THR A 1 37  ? 64.930  67.922  14.715  1.00 27.05 ? 38   THR A CG2 1 
ATOM   279  N N   . PRO A 1 38  ? 67.587  65.922  17.655  1.00 26.99 ? 39   PRO A N   1 
ATOM   280  C CA  . PRO A 1 38  ? 68.765  65.752  18.524  1.00 30.01 ? 39   PRO A CA  1 
ATOM   281  C C   . PRO A 1 38  ? 69.624  67.042  18.532  1.00 30.14 ? 39   PRO A C   1 
ATOM   282  O O   . PRO A 1 38  ? 70.314  67.345  19.517  1.00 29.25 ? 39   PRO A O   1 
ATOM   283  C CB  . PRO A 1 38  ? 69.508  64.565  17.887  1.00 29.92 ? 39   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 38  ? 68.372  63.698  17.413  1.00 29.39 ? 39   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 38  ? 67.386  64.730  16.799  1.00 29.36 ? 39   PRO A CD  1 
ATOM   286  N N   . ASP A 1 39  ? 69.566  67.815  17.452  1.00 30.84 ? 40   ASP A N   1 
ATOM   287  C CA  . ASP A 1 39  ? 70.352  69.045  17.397  1.00 33.30 ? 40   ASP A CA  1 
ATOM   288  C C   . ASP A 1 39  ? 69.770  70.164  18.255  1.00 33.43 ? 40   ASP A C   1 
ATOM   289  O O   . ASP A 1 39  ? 70.513  70.815  18.995  1.00 35.97 ? 40   ASP A O   1 
ATOM   290  C CB  . ASP A 1 39  ? 70.496  69.537  15.952  1.00 37.71 ? 40   ASP A CB  1 
ATOM   291  C CG  . ASP A 1 39  ? 71.346  68.593  15.082  1.00 44.35 ? 40   ASP A CG  1 
ATOM   292  O OD1 . ASP A 1 39  ? 71.168  68.609  13.836  1.00 48.68 ? 40   ASP A OD1 1 
ATOM   293  O OD2 . ASP A 1 39  ? 72.188  67.845  15.640  1.00 44.52 ? 40   ASP A OD2 1 
ATOM   294  N N   . ASN A 1 40  ? 68.454  70.387  18.200  1.00 31.33 ? 41   ASN A N   1 
ATOM   295  C CA  . ASN A 1 40  ? 67.892  71.492  18.981  1.00 26.82 ? 41   ASN A CA  1 
ATOM   296  C C   . ASN A 1 40  ? 67.430  71.222  20.392  1.00 27.06 ? 41   ASN A C   1 
ATOM   297  O O   . ASN A 1 40  ? 67.204  72.169  21.158  1.00 24.53 ? 41   ASN A O   1 
ATOM   298  C CB  . ASN A 1 40  ? 66.763  72.212  18.235  1.00 25.84 ? 41   ASN A CB  1 
ATOM   299  C CG  . ASN A 1 40  ? 65.533  71.319  17.967  1.00 27.54 ? 41   ASN A CG  1 
ATOM   300  O OD1 . ASN A 1 40  ? 65.249  70.372  18.693  1.00 24.99 ? 41   ASN A OD1 1 
ATOM   301  N ND2 . ASN A 1 40  ? 64.801  71.648  16.916  1.00 22.41 ? 41   ASN A ND2 1 
ATOM   302  N N   . VAL A 1 41  ? 67.331  69.955  20.773  1.00 23.57 ? 42   VAL A N   1 
ATOM   303  C CA  . VAL A 1 41  ? 66.834  69.680  22.099  1.00 21.70 ? 42   VAL A CA  1 
ATOM   304  C C   . VAL A 1 41  ? 67.806  70.068  23.177  1.00 23.24 ? 42   VAL A C   1 
ATOM   305  O O   . VAL A 1 41  ? 67.404  70.335  24.309  1.00 22.66 ? 42   VAL A O   1 
ATOM   306  C CB  . VAL A 1 41  ? 66.442  68.221  22.224  1.00 21.34 ? 42   VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 41  ? 67.696  67.339  22.317  1.00 21.62 ? 42   VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 41  ? 65.485  68.056  23.409  1.00 17.70 ? 42   VAL A CG2 1 
ATOM   309  N N   . GLY A 1 42  ? 69.096  70.127  22.828  1.00 22.19 ? 43   GLY A N   1 
ATOM   310  C CA  . GLY A 1 42  ? 70.080  70.478  23.824  1.00 22.76 ? 43   GLY A CA  1 
ATOM   311  C C   . GLY A 1 42  ? 69.789  71.774  24.563  1.00 22.28 ? 43   GLY A C   1 
ATOM   312  O O   . GLY A 1 42  ? 69.862  71.822  25.788  1.00 22.23 ? 43   GLY A O   1 
ATOM   313  N N   . ALA A 1 43  ? 69.520  72.835  23.819  1.00 20.99 ? 44   ALA A N   1 
ATOM   314  C CA  . ALA A 1 43  ? 69.237  74.113  24.425  1.00 22.42 ? 44   ALA A CA  1 
ATOM   315  C C   . ALA A 1 43  ? 68.002  74.023  25.311  1.00 22.94 ? 44   ALA A C   1 
ATOM   316  O O   . ALA A 1 43  ? 67.947  74.656  26.391  1.00 22.37 ? 44   ALA A O   1 
ATOM   317  C CB  . ALA A 1 43  ? 69.058  75.177  23.345  1.00 25.80 ? 44   ALA A CB  1 
ATOM   318  N N   . TYR A 1 44  ? 67.031  73.200  24.917  1.00 21.41 ? 45   TYR A N   1 
ATOM   319  C CA  . TYR A 1 44  ? 65.808  73.073  25.713  1.00 20.92 ? 45   TYR A CA  1 
ATOM   320  C C   . TYR A 1 44  ? 66.135  72.417  27.056  1.00 22.78 ? 45   TYR A C   1 
ATOM   321  O O   . TYR A 1 44  ? 65.652  72.859  28.115  1.00 23.91 ? 45   TYR A O   1 
ATOM   322  C CB  . TYR A 1 44  ? 64.749  72.213  25.002  1.00 20.65 ? 45   TYR A CB  1 
ATOM   323  C CG  . TYR A 1 44  ? 64.223  72.773  23.709  1.00 21.19 ? 45   TYR A CG  1 
ATOM   324  C CD1 . TYR A 1 44  ? 63.777  71.916  22.693  1.00 23.23 ? 45   TYR A CD1 1 
ATOM   325  C CD2 . TYR A 1 44  ? 64.124  74.148  23.502  1.00 20.08 ? 45   TYR A CD2 1 
ATOM   326  C CE1 . TYR A 1 44  ? 63.233  72.425  21.499  1.00 22.86 ? 45   TYR A CE1 1 
ATOM   327  C CE2 . TYR A 1 44  ? 63.596  74.665  22.300  1.00 23.07 ? 45   TYR A CE2 1 
ATOM   328  C CZ  . TYR A 1 44  ? 63.150  73.787  21.306  1.00 22.18 ? 45   TYR A CZ  1 
ATOM   329  O OH  . TYR A 1 44  ? 62.626  74.299  20.116  1.00 25.40 ? 45   TYR A OH  1 
ATOM   330  N N   . VAL A 1 45  ? 66.956  71.363  27.007  1.00 20.78 ? 46   VAL A N   1 
ATOM   331  C CA  . VAL A 1 45  ? 67.341  70.650  28.210  1.00 22.68 ? 46   VAL A CA  1 
ATOM   332  C C   . VAL A 1 45  ? 68.128  71.556  29.171  1.00 22.43 ? 46   VAL A C   1 
ATOM   333  O O   . VAL A 1 45  ? 68.062  71.396  30.387  1.00 22.91 ? 46   VAL A O   1 
ATOM   334  C CB  . VAL A 1 45  ? 68.218  69.423  27.842  1.00 21.68 ? 46   VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 45  ? 68.791  68.819  29.087  1.00 24.74 ? 46   VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 45  ? 67.342  68.375  27.046  1.00 19.63 ? 46   VAL A CG2 1 
ATOM   337  N N   . ASP A 1 46  ? 68.949  72.432  28.599  1.00 23.54 ? 47   ASP A N   1 
ATOM   338  C CA  . ASP A 1 46  ? 69.709  73.366  29.400  1.00 24.52 ? 47   ASP A CA  1 
ATOM   339  C C   . ASP A 1 46  ? 68.741  74.185  30.265  1.00 26.76 ? 47   ASP A C   1 
ATOM   340  O O   . ASP A 1 46  ? 68.986  74.404  31.487  1.00 26.17 ? 47   ASP A O   1 
ATOM   341  C CB  . ASP A 1 46  ? 70.522  74.305  28.514  1.00 25.94 ? 47   ASP A CB  1 
ATOM   342  C CG  . ASP A 1 46  ? 71.757  73.642  27.930  1.00 27.79 ? 47   ASP A CG  1 
ATOM   343  O OD1 . ASP A 1 46  ? 72.164  72.576  28.440  1.00 28.09 ? 47   ASP A OD1 1 
ATOM   344  O OD2 . ASP A 1 46  ? 72.332  74.206  26.958  1.00 30.34 ? 47   ASP A OD2 1 
ATOM   345  N N   . GLY A 1 47  ? 67.654  74.636  29.646  1.00 24.10 ? 48   GLY A N   1 
ATOM   346  C CA  . GLY A 1 47  ? 66.633  75.397  30.374  1.00 24.98 ? 48   GLY A CA  1 
ATOM   347  C C   . GLY A 1 47  ? 66.044  74.627  31.559  1.00 23.23 ? 48   GLY A C   1 
ATOM   348  O O   . GLY A 1 47  ? 65.586  75.226  32.542  1.00 24.53 ? 48   GLY A O   1 
ATOM   349  N N   . THR A 1 48  ? 66.012  73.300  31.477  1.00 21.80 ? 49   THR A N   1 
ATOM   350  C CA  . THR A 1 48  ? 65.469  72.514  32.604  1.00 21.16 ? 49   THR A CA  1 
ATOM   351  C C   . THR A 1 48  ? 66.495  72.207  33.715  1.00 23.45 ? 49   THR A C   1 
ATOM   352  O O   . THR A 1 48  ? 66.100  71.947  34.858  1.00 21.62 ? 49   THR A O   1 
ATOM   353  C CB  . THR A 1 48  ? 64.866  71.136  32.153  1.00 20.75 ? 49   THR A CB  1 
ATOM   354  O OG1 . THR A 1 48  ? 65.925  70.221  31.806  1.00 22.74 ? 49   THR A OG1 1 
ATOM   355  C CG2 . THR A 1 48  ? 63.973  71.332  30.929  1.00 23.25 ? 49   THR A CG2 1 
ATOM   356  N N   . ILE A 1 49  ? 67.790  72.205  33.384  1.00 24.33 ? 50   ILE A N   1 
ATOM   357  C CA  . ILE A 1 49  ? 68.806  71.898  34.396  1.00 25.75 ? 50   ILE A CA  1 
ATOM   358  C C   . ILE A 1 49  ? 69.581  73.084  34.986  1.00 25.28 ? 50   ILE A C   1 
ATOM   359  O O   . ILE A 1 49  ? 70.379  72.897  35.878  1.00 25.81 ? 50   ILE A O   1 
ATOM   360  C CB  . ILE A 1 49  ? 69.858  70.848  33.873  1.00 28.08 ? 50   ILE A CB  1 
ATOM   361  C CG1 . ILE A 1 49  ? 70.644  71.415  32.683  1.00 28.63 ? 50   ILE A CG1 1 
ATOM   362  C CG2 . ILE A 1 49  ? 69.135  69.550  33.503  1.00 28.34 ? 50   ILE A CG2 1 
ATOM   363  C CD1 . ILE A 1 49  ? 71.731  70.436  32.057  1.00 27.92 ? 50   ILE A CD1 1 
ATOM   364  N N   . TYR A 1 50  ? 69.357  74.302  34.510  1.00 25.58 ? 51   TYR A N   1 
ATOM   365  C CA  . TYR A 1 50  ? 70.084  75.437  35.072  1.00 25.79 ? 51   TYR A CA  1 
ATOM   366  C C   . TYR A 1 50  ? 69.164  76.495  35.670  1.00 24.19 ? 51   TYR A C   1 
ATOM   367  O O   . TYR A 1 50  ? 69.568  77.628  35.900  1.00 26.41 ? 51   TYR A O   1 
ATOM   368  C CB  . TYR A 1 50  ? 70.964  76.074  33.986  1.00 28.66 ? 51   TYR A CB  1 
ATOM   369  C CG  . TYR A 1 50  ? 71.999  75.125  33.412  1.00 34.86 ? 51   TYR A CG  1 
ATOM   370  C CD1 . TYR A 1 50  ? 72.155  74.996  32.044  1.00 37.48 ? 51   TYR A CD1 1 
ATOM   371  C CD2 . TYR A 1 50  ? 72.830  74.362  34.244  1.00 38.33 ? 51   TYR A CD2 1 
ATOM   372  C CE1 . TYR A 1 50  ? 73.096  74.146  31.502  1.00 38.12 ? 51   TYR A CE1 1 
ATOM   373  C CE2 . TYR A 1 50  ? 73.793  73.498  33.705  1.00 39.35 ? 51   TYR A CE2 1 
ATOM   374  C CZ  . TYR A 1 50  ? 73.911  73.405  32.321  1.00 41.39 ? 51   TYR A CZ  1 
ATOM   375  O OH  . TYR A 1 50  ? 74.849  72.588  31.722  1.00 41.73 ? 51   TYR A OH  1 
ATOM   376  N N   . THR A 1 51  ? 67.923  76.138  35.939  1.00 24.16 ? 52   THR A N   1 
ATOM   377  C CA  . THR A 1 51  ? 66.977  77.120  36.482  1.00 22.97 ? 52   THR A CA  1 
ATOM   378  C C   . THR A 1 51  ? 66.496  76.848  37.875  1.00 20.96 ? 52   THR A C   1 
ATOM   379  O O   . THR A 1 51  ? 65.896  77.728  38.519  1.00 22.24 ? 52   THR A O   1 
ATOM   380  C CB  . THR A 1 51  ? 65.737  77.197  35.575  1.00 22.03 ? 52   THR A CB  1 
ATOM   381  O OG1 . THR A 1 51  ? 65.315  75.860  35.280  1.00 22.66 ? 52   THR A OG1 1 
ATOM   382  C CG2 . THR A 1 51  ? 66.097  77.915  34.251  1.00 20.63 ? 52   THR A CG2 1 
ATOM   383  N N   . ARG A 1 52  ? 66.695  75.616  38.329  1.00 21.54 ? 53   ARG A N   1 
ATOM   384  C CA  . ARG A 1 52  ? 66.245  75.213  39.663  1.00 22.40 ? 53   ARG A CA  1 
ATOM   385  C C   . ARG A 1 52  ? 67.345  74.439  40.366  1.00 25.52 ? 53   ARG A C   1 
ATOM   386  O O   . ARG A 1 52  ? 68.040  73.661  39.739  1.00 25.14 ? 53   ARG A O   1 
ATOM   387  C CB  . ARG A 1 52  ? 64.992  74.355  39.561  1.00 21.34 ? 53   ARG A CB  1 
ATOM   388  C CG  . ARG A 1 52  ? 63.749  75.156  39.247  1.00 22.25 ? 53   ARG A CG  1 
ATOM   389  C CD  . ARG A 1 52  ? 62.567  74.237  38.979  1.00 21.02 ? 53   ARG A CD  1 
ATOM   390  N NE  . ARG A 1 52  ? 61.320  74.982  39.095  1.00 19.50 ? 53   ARG A NE  1 
ATOM   391  C CZ  . ARG A 1 52  ? 60.111  74.432  39.001  1.00 16.55 ? 53   ARG A CZ  1 
ATOM   392  N NH1 . ARG A 1 52  ? 59.959  73.131  38.749  1.00 17.70 ? 53   ARG A NH1 1 
ATOM   393  N NH2 . ARG A 1 52  ? 59.052  75.174  39.267  1.00 19.67 ? 53   ARG A NH2 1 
ATOM   394  N N   . GLY A 1 53  ? 67.500  74.658  41.668  1.00 29.63 ? 54   GLY A N   1 
ATOM   395  C CA  . GLY A 1 53  ? 68.560  73.967  42.383  1.00 33.59 ? 54   GLY A CA  1 
ATOM   396  C C   . GLY A 1 53  ? 68.072  73.166  43.562  1.00 35.60 ? 54   GLY A C   1 
ATOM   397  O O   . GLY A 1 53  ? 66.930  73.317  44.020  1.00 34.67 ? 54   GLY A O   1 
ATOM   398  N N   . GLY A 1 54  ? 68.941  72.299  44.070  1.00 39.80 ? 55   GLY A N   1 
ATOM   399  C CA  . GLY A 1 54  ? 68.550  71.504  45.227  1.00 42.25 ? 55   GLY A CA  1 
ATOM   400  C C   . GLY A 1 54  ? 67.439  70.514  44.943  1.00 43.24 ? 55   GLY A C   1 
ATOM   401  O O   . GLY A 1 54  ? 67.389  69.900  43.863  1.00 45.38 ? 55   GLY A O   1 
ATOM   402  N N   . LYS A 1 55  ? 66.535  70.359  45.905  1.00 43.75 ? 56   LYS A N   1 
ATOM   403  C CA  . LYS A 1 55  ? 65.440  69.411  45.749  1.00 43.03 ? 56   LYS A CA  1 
ATOM   404  C C   . LYS A 1 55  ? 64.401  69.951  44.784  1.00 40.93 ? 56   LYS A C   1 
ATOM   405  O O   . LYS A 1 55  ? 63.520  69.204  44.360  1.00 42.76 ? 56   LYS A O   1 
ATOM   406  C CB  . LYS A 1 55  ? 64.794  69.065  47.111  1.00 44.73 ? 56   LYS A CB  1 
ATOM   407  C CG  . LYS A 1 55  ? 63.682  67.992  47.011  1.00 46.85 ? 56   LYS A CG  1 
ATOM   408  C CD  . LYS A 1 55  ? 63.131  67.506  48.350  1.00 45.51 ? 56   LYS A CD  1 
ATOM   409  C CE  . LYS A 1 55  ? 61.994  66.475  48.126  1.00 48.71 ? 56   LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 55  ? 61.413  65.921  49.402  1.00 45.85 ? 56   LYS A NZ  1 
ATOM   411  N N   . GLU A 1 56  ? 64.519  71.231  44.420  1.00 37.51 ? 57   GLU A N   1 
ATOM   412  C CA  . GLU A 1 56  ? 63.584  71.844  43.477  1.00 34.67 ? 57   GLU A CA  1 
ATOM   413  C C   . GLU A 1 56  ? 63.723  71.249  42.075  1.00 31.80 ? 57   GLU A C   1 
ATOM   414  O O   . GLU A 1 56  ? 62.815  71.345  41.274  1.00 28.87 ? 57   GLU A O   1 
ATOM   415  C CB  . GLU A 1 56  ? 63.778  73.366  43.427  1.00 36.02 ? 57   GLU A CB  1 
ATOM   416  C CG  . GLU A 1 56  ? 63.437  74.053  44.754  1.00 42.23 ? 57   GLU A CG  1 
ATOM   417  C CD  . GLU A 1 56  ? 61.982  73.850  45.199  1.00 46.51 ? 57   GLU A CD  1 
ATOM   418  O OE1 . GLU A 1 56  ? 61.327  72.889  44.730  1.00 50.91 ? 57   GLU A OE1 1 
ATOM   419  O OE2 . GLU A 1 56  ? 61.483  74.652  46.035  1.00 51.51 ? 57   GLU A OE2 1 
ATOM   420  N N   . LYS A 1 57  ? 64.855  70.627  41.785  1.00 28.16 ? 58   LYS A N   1 
ATOM   421  C CA  . LYS A 1 57  ? 65.075  70.020  40.475  1.00 30.93 ? 58   LYS A CA  1 
ATOM   422  C C   . LYS A 1 57  ? 64.031  68.971  40.115  1.00 29.33 ? 58   LYS A C   1 
ATOM   423  O O   . LYS A 1 57  ? 63.583  68.882  38.966  1.00 30.13 ? 58   LYS A O   1 
ATOM   424  C CB  . LYS A 1 57  ? 66.458  69.365  40.418  1.00 35.00 ? 58   LYS A CB  1 
ATOM   425  C CG  . LYS A 1 57  ? 67.606  70.332  40.329  1.00 44.67 ? 58   LYS A CG  1 
ATOM   426  C CD  . LYS A 1 57  ? 68.974  69.613  40.363  1.00 47.81 ? 58   LYS A CD  1 
ATOM   427  C CE  . LYS A 1 57  ? 70.096  70.648  40.150  1.00 51.18 ? 58   LYS A CE  1 
ATOM   428  N NZ  . LYS A 1 57  ? 71.501  70.099  40.254  1.00 51.89 ? 58   LYS A NZ  1 
ATOM   429  N N   . GLN A 1 58  ? 63.634  68.159  41.080  1.00 27.63 ? 59   GLN A N   1 
ATOM   430  C CA  . GLN A 1 58  ? 62.661  67.127  40.787  1.00 28.42 ? 59   GLN A CA  1 
ATOM   431  C C   . GLN A 1 58  ? 61.301  67.684  40.366  1.00 28.42 ? 59   GLN A C   1 
ATOM   432  O O   . GLN A 1 58  ? 60.437  66.920  39.955  1.00 26.03 ? 59   GLN A O   1 
ATOM   433  C CB  . GLN A 1 58  ? 62.471  66.213  41.997  1.00 31.55 ? 59   GLN A CB  1 
ATOM   434  C CG  . GLN A 1 58  ? 61.800  66.837  43.156  1.00 34.48 ? 59   GLN A CG  1 
ATOM   435  C CD  . GLN A 1 58  ? 61.718  65.887  44.354  1.00 41.12 ? 59   GLN A CD  1 
ATOM   436  O OE1 . GLN A 1 58  ? 62.738  65.461  44.900  1.00 41.48 ? 59   GLN A OE1 1 
ATOM   437  N NE2 . GLN A 1 58  ? 60.501  65.551  44.760  1.00 42.43 ? 59   GLN A NE2 1 
ATOM   438  N N   . SER A 1 59  ? 61.085  68.996  40.497  1.00 24.01 ? 60   SER A N   1 
ATOM   439  C CA  . SER A 1 59  ? 59.809  69.558  40.095  1.00 22.63 ? 60   SER A CA  1 
ATOM   440  C C   . SER A 1 59  ? 59.719  70.000  38.615  1.00 19.08 ? 60   SER A C   1 
ATOM   441  O O   . SER A 1 59  ? 58.794  70.671  38.214  1.00 18.29 ? 60   SER A O   1 
ATOM   442  C CB  . SER A 1 59  ? 59.410  70.708  41.014  1.00 24.26 ? 60   SER A CB  1 
ATOM   443  O OG  . SER A 1 59  ? 59.048  70.201  42.287  1.00 24.52 ? 60   SER A OG  1 
ATOM   444  N N   . THR A 1 60  ? 60.720  69.655  37.838  1.00 21.88 ? 61   THR A N   1 
ATOM   445  C CA  . THR A 1 60  ? 60.709  69.914  36.415  1.00 21.89 ? 61   THR A CA  1 
ATOM   446  C C   . THR A 1 60  ? 61.047  68.541  35.844  1.00 22.98 ? 61   THR A C   1 
ATOM   447  O O   . THR A 1 60  ? 61.914  67.828  36.397  1.00 22.09 ? 61   THR A O   1 
ATOM   448  C CB  . THR A 1 60  ? 61.805  70.884  35.981  1.00 21.13 ? 61   THR A CB  1 
ATOM   449  O OG1 . THR A 1 60  ? 61.651  72.131  36.683  1.00 22.53 ? 61   THR A OG1 1 
ATOM   450  C CG2 . THR A 1 60  ? 61.723  71.103  34.454  1.00 20.41 ? 61   THR A CG2 1 
ATOM   451  N N   . ALA A 1 61  ? 60.378  68.170  34.754  1.00 20.05 ? 62   ALA A N   1 
ATOM   452  C CA  . ALA A 1 61  ? 60.603  66.873  34.120  1.00 20.95 ? 62   ALA A CA  1 
ATOM   453  C C   . ALA A 1 61  ? 60.439  67.004  32.589  1.00 19.93 ? 62   ALA A C   1 
ATOM   454  O O   . ALA A 1 61  ? 59.906  67.990  32.102  1.00 18.43 ? 62   ALA A O   1 
ATOM   455  C CB  . ALA A 1 61  ? 59.622  65.843  34.664  1.00 22.46 ? 62   ALA A CB  1 
ATOM   456  N N   . ILE A 1 62  ? 60.911  65.999  31.865  1.00 18.79 ? 63   ILE A N   1 
ATOM   457  C CA  . ILE A 1 62  ? 60.877  65.986  30.424  1.00 19.32 ? 63   ILE A CA  1 
ATOM   458  C C   . ILE A 1 62  ? 60.119  64.780  29.884  1.00 20.32 ? 63   ILE A C   1 
ATOM   459  O O   . ILE A 1 62  ? 60.244  63.651  30.412  1.00 21.82 ? 63   ILE A O   1 
ATOM   460  C CB  . ILE A 1 62  ? 62.327  65.981  29.878  1.00 21.03 ? 63   ILE A CB  1 
ATOM   461  C CG1 . ILE A 1 62  ? 62.988  67.328  30.216  1.00 20.77 ? 63   ILE A CG1 1 
ATOM   462  C CG2 . ILE A 1 62  ? 62.343  65.793  28.328  1.00 18.91 ? 63   ILE A CG2 1 
ATOM   463  C CD1 . ILE A 1 62  ? 64.452  67.418  29.801  1.00 21.59 ? 63   ILE A CD1 1 
ATOM   464  N N   . PHE A 1 63  ? 59.319  65.019  28.842  1.00 17.35 ? 64   PHE A N   1 
ATOM   465  C CA  . PHE A 1 63  ? 58.570  63.953  28.187  1.00 19.18 ? 64   PHE A CA  1 
ATOM   466  C C   . PHE A 1 63  ? 58.849  64.093  26.705  1.00 17.90 ? 64   PHE A C   1 
ATOM   467  O O   . PHE A 1 63  ? 58.615  65.145  26.135  1.00 20.90 ? 64   PHE A O   1 
ATOM   468  C CB  . PHE A 1 63  ? 57.056  64.116  28.443  1.00 19.45 ? 64   PHE A CB  1 
ATOM   469  C CG  . PHE A 1 63  ? 56.198  63.100  27.741  1.00 22.14 ? 64   PHE A CG  1 
ATOM   470  C CD1 . PHE A 1 63  ? 55.799  61.926  28.399  1.00 20.67 ? 64   PHE A CD1 1 
ATOM   471  C CD2 . PHE A 1 63  ? 55.792  63.310  26.406  1.00 19.49 ? 64   PHE A CD2 1 
ATOM   472  C CE1 . PHE A 1 63  ? 54.999  60.973  27.733  1.00 20.08 ? 64   PHE A CE1 1 
ATOM   473  C CE2 . PHE A 1 63  ? 55.002  62.368  25.736  1.00 20.20 ? 64   PHE A CE2 1 
ATOM   474  C CZ  . PHE A 1 63  ? 54.602  61.202  26.392  1.00 19.09 ? 64   PHE A CZ  1 
ATOM   475  N N   . VAL A 1 64  ? 59.355  63.030  26.096  1.00 19.05 ? 65   VAL A N   1 
ATOM   476  C CA  . VAL A 1 64  ? 59.641  63.017  24.686  1.00 21.22 ? 65   VAL A CA  1 
ATOM   477  C C   . VAL A 1 64  ? 58.606  62.132  24.009  1.00 19.27 ? 65   VAL A C   1 
ATOM   478  O O   . VAL A 1 64  ? 58.378  61.017  24.436  1.00 19.83 ? 65   VAL A O   1 
ATOM   479  C CB  . VAL A 1 64  ? 61.082  62.430  24.401  1.00 19.58 ? 65   VAL A CB  1 
ATOM   480  C CG1 . VAL A 1 64  ? 61.282  62.249  22.922  1.00 16.28 ? 65   VAL A CG1 1 
ATOM   481  C CG2 . VAL A 1 64  ? 62.145  63.366  24.945  1.00 20.09 ? 65   VAL A CG2 1 
ATOM   482  N N   . GLY A 1 65  ? 57.997  62.617  22.929  1.00 20.68 ? 66   GLY A N   1 
ATOM   483  C CA  . GLY A 1 65  ? 57.019  61.805  22.242  1.00 19.46 ? 66   GLY A CA  1 
ATOM   484  C C   . GLY A 1 65  ? 56.928  62.123  20.747  1.00 19.32 ? 66   GLY A C   1 
ATOM   485  O O   . GLY A 1 65  ? 57.839  62.720  20.171  1.00 18.38 ? 66   GLY A O   1 
ATOM   486  N N   . GLY A 1 66  ? 55.830  61.717  20.133  1.00 18.92 ? 67   GLY A N   1 
ATOM   487  C CA  . GLY A 1 66  ? 55.645  61.945  18.702  1.00 20.57 ? 67   GLY A CA  1 
ATOM   488  C C   . GLY A 1 66  ? 55.354  60.591  18.072  1.00 22.42 ? 67   GLY A C   1 
ATOM   489  O O   . GLY A 1 66  ? 55.432  59.562  18.766  1.00 21.98 ? 67   GLY A O   1 
ATOM   490  N N   . GLY A 1 67  ? 55.072  60.579  16.761  1.00 22.77 ? 68   GLY A N   1 
ATOM   491  C CA  . GLY A 1 67  ? 54.735  59.346  16.069  1.00 21.80 ? 68   GLY A CA  1 
ATOM   492  C C   . GLY A 1 67  ? 55.875  58.449  15.615  1.00 23.51 ? 68   GLY A C   1 
ATOM   493  O O   . GLY A 1 67  ? 55.728  57.217  15.610  1.00 26.19 ? 68   GLY A O   1 
ATOM   494  N N   . ASP A 1 68  ? 56.990  59.037  15.216  1.00 23.18 ? 69   ASP A N   1 
ATOM   495  C CA  . ASP A 1 68  ? 58.140  58.288  14.729  1.00 25.08 ? 69   ASP A CA  1 
ATOM   496  C C   . ASP A 1 68  ? 58.948  57.755  15.908  1.00 23.62 ? 69   ASP A C   1 
ATOM   497  O O   . ASP A 1 68  ? 59.688  58.503  16.504  1.00 21.13 ? 69   ASP A O   1 
ATOM   498  C CB  . ASP A 1 68  ? 59.022  59.228  13.909  1.00 29.91 ? 69   ASP A CB  1 
ATOM   499  C CG  . ASP A 1 68  ? 60.175  58.516  13.221  1.00 32.55 ? 69   ASP A CG  1 
ATOM   500  O OD1 . ASP A 1 68  ? 60.749  57.546  13.765  1.00 32.80 ? 69   ASP A OD1 1 
ATOM   501  O OD2 . ASP A 1 68  ? 60.518  58.962  12.112  1.00 38.48 ? 69   ASP A OD2 1 
ATOM   502  N N   . MET A 1 69  ? 58.836  56.469  16.217  1.00 22.72 ? 70   MET A N   1 
ATOM   503  C CA  . MET A 1 69  ? 59.554  55.947  17.374  1.00 25.82 ? 70   MET A CA  1 
ATOM   504  C C   . MET A 1 69  ? 61.058  56.111  17.296  1.00 25.98 ? 70   MET A C   1 
ATOM   505  O O   . MET A 1 69  ? 61.664  56.521  18.272  1.00 25.33 ? 70   MET A O   1 
ATOM   506  C CB  . MET A 1 69  ? 59.234  54.476  17.641  1.00 27.82 ? 70   MET A CB  1 
ATOM   507  C CG  . MET A 1 69  ? 59.975  53.934  18.891  1.00 27.62 ? 70   MET A CG  1 
ATOM   508  S SD  . MET A 1 69  ? 59.510  52.215  19.278  1.00 34.60 ? 70   MET A SD  1 
ATOM   509  C CE  . MET A 1 69  ? 60.438  51.320  18.167  1.00 28.72 ? 70   MET A CE  1 
ATOM   510  N N   . ALA A 1 70  ? 61.672  55.803  16.162  1.00 23.82 ? 71   ALA A N   1 
ATOM   511  C CA  . ALA A 1 70  ? 63.131  55.949  16.076  1.00 26.44 ? 71   ALA A CA  1 
ATOM   512  C C   . ALA A 1 70  ? 63.529  57.420  16.289  1.00 24.84 ? 71   ALA A C   1 
ATOM   513  O O   . ALA A 1 70  ? 64.523  57.700  16.961  1.00 26.38 ? 71   ALA A O   1 
ATOM   514  C CB  . ALA A 1 70  ? 63.668  55.414  14.711  1.00 24.76 ? 71   ALA A CB  1 
ATOM   515  N N   . ALA A 1 71  ? 62.776  58.350  15.705  1.00 22.63 ? 72   ALA A N   1 
ATOM   516  C CA  . ALA A 1 71  ? 63.059  59.778  15.902  1.00 24.14 ? 72   ALA A CA  1 
ATOM   517  C C   . ALA A 1 71  ? 63.020  60.116  17.416  1.00 23.10 ? 72   ALA A C   1 
ATOM   518  O O   . ALA A 1 71  ? 63.876  60.833  17.918  1.00 23.75 ? 72   ALA A O   1 
ATOM   519  C CB  . ALA A 1 71  ? 62.011  60.640  15.151  1.00 25.33 ? 72   ALA A CB  1 
ATOM   520  N N   . GLY A 1 72  ? 62.006  59.623  18.127  1.00 24.13 ? 73   GLY A N   1 
ATOM   521  C CA  . GLY A 1 72  ? 61.924  59.871  19.565  1.00 23.31 ? 73   GLY A CA  1 
ATOM   522  C C   . GLY A 1 72  ? 63.101  59.244  20.303  1.00 23.80 ? 73   GLY A C   1 
ATOM   523  O O   . GLY A 1 72  ? 63.651  59.835  21.241  1.00 19.78 ? 73   GLY A O   1 
ATOM   524  N N   . GLU A 1 73  ? 63.498  58.028  19.916  1.00 23.42 ? 74   GLU A N   1 
ATOM   525  C CA  . GLU A 1 73  ? 64.649  57.399  20.585  1.00 24.25 ? 74   GLU A CA  1 
ATOM   526  C C   . GLU A 1 73  ? 65.901  58.261  20.390  1.00 25.84 ? 74   GLU A C   1 
ATOM   527  O O   . GLU A 1 73  ? 66.715  58.425  21.325  1.00 24.25 ? 74   GLU A O   1 
ATOM   528  C CB  . GLU A 1 73  ? 64.929  55.994  20.028  1.00 26.29 ? 74   GLU A CB  1 
ATOM   529  C CG  . GLU A 1 73  ? 63.907  54.941  20.438  1.00 28.35 ? 74   GLU A CG  1 
ATOM   530  C CD  . GLU A 1 73  ? 64.039  53.671  19.621  1.00 34.86 ? 74   GLU A CD  1 
ATOM   531  O OE1 . GLU A 1 73  ? 63.766  52.574  20.159  1.00 36.76 ? 74   GLU A OE1 1 
ATOM   532  O OE2 . GLU A 1 73  ? 64.414  53.771  18.431  1.00 36.02 ? 74   GLU A OE2 1 
ATOM   533  N N   . ARG A 1 74  ? 66.079  58.820  19.196  1.00 21.26 ? 75   ARG A N   1 
ATOM   534  C CA  . ARG A 1 74  ? 67.259  59.672  19.002  1.00 23.60 ? 75   ARG A CA  1 
ATOM   535  C C   . ARG A 1 74  ? 67.196  60.949  19.852  1.00 25.99 ? 75   ARG A C   1 
ATOM   536  O O   . ARG A 1 74  ? 68.227  61.410  20.357  1.00 23.09 ? 75   ARG A O   1 
ATOM   537  C CB  . ARG A 1 74  ? 67.438  60.051  17.531  1.00 25.81 ? 75   ARG A CB  1 
ATOM   538  C CG  . ARG A 1 74  ? 67.792  58.840  16.660  1.00 31.13 ? 75   ARG A CG  1 
ATOM   539  C CD  . ARG A 1 74  ? 68.117  59.256  15.236  1.00 33.76 ? 75   ARG A CD  1 
ATOM   540  N NE  . ARG A 1 74  ? 66.975  59.823  14.508  1.00 35.00 ? 75   ARG A NE  1 
ATOM   541  C CZ  . ARG A 1 74  ? 66.094  59.113  13.802  1.00 34.83 ? 75   ARG A CZ  1 
ATOM   542  N NH1 . ARG A 1 74  ? 66.189  57.785  13.725  1.00 36.63 ? 75   ARG A NH1 1 
ATOM   543  N NH2 . ARG A 1 74  ? 65.152  59.738  13.118  1.00 37.95 ? 75   ARG A NH2 1 
ATOM   544  N N   . VAL A 1 75  ? 66.002  61.528  20.017  1.00 23.64 ? 76   VAL A N   1 
ATOM   545  C CA  . VAL A 1 75  ? 65.899  62.734  20.834  1.00 20.81 ? 76   VAL A CA  1 
ATOM   546  C C   . VAL A 1 75  ? 66.144  62.369  22.303  1.00 22.42 ? 76   VAL A C   1 
ATOM   547  O O   . VAL A 1 75  ? 66.827  63.082  23.029  1.00 20.74 ? 76   VAL A O   1 
ATOM   548  C CB  . VAL A 1 75  ? 64.522  63.384  20.691  1.00 21.48 ? 76   VAL A CB  1 
ATOM   549  C CG1 . VAL A 1 75  ? 64.363  64.523  21.744  1.00 20.43 ? 76   VAL A CG1 1 
ATOM   550  C CG2 . VAL A 1 75  ? 64.413  63.999  19.271  1.00 22.79 ? 76   VAL A CG2 1 
ATOM   551  N N   . PHE A 1 76  ? 65.582  61.242  22.723  1.00 21.62 ? 77   PHE A N   1 
ATOM   552  C CA  . PHE A 1 76  ? 65.730  60.790  24.086  1.00 22.16 ? 77   PHE A CA  1 
ATOM   553  C C   . PHE A 1 76  ? 67.206  60.558  24.428  1.00 23.41 ? 77   PHE A C   1 
ATOM   554  O O   . PHE A 1 76  ? 67.675  60.964  25.507  1.00 23.46 ? 77   PHE A O   1 
ATOM   555  C CB  . PHE A 1 76  ? 64.908  59.512  24.298  1.00 22.99 ? 77   PHE A CB  1 
ATOM   556  C CG  . PHE A 1 76  ? 64.599  59.223  25.750  1.00 22.99 ? 77   PHE A CG  1 
ATOM   557  C CD1 . PHE A 1 76  ? 63.807  60.099  26.494  1.00 24.72 ? 77   PHE A CD1 1 
ATOM   558  C CD2 . PHE A 1 76  ? 65.057  58.065  26.365  1.00 23.59 ? 77   PHE A CD2 1 
ATOM   559  C CE1 . PHE A 1 76  ? 63.473  59.821  27.827  1.00 20.17 ? 77   PHE A CE1 1 
ATOM   560  C CE2 . PHE A 1 76  ? 64.728  57.777  27.703  1.00 22.48 ? 77   PHE A CE2 1 
ATOM   561  C CZ  . PHE A 1 76  ? 63.930  58.663  28.434  1.00 20.74 ? 77   PHE A CZ  1 
ATOM   562  N N   . GLU A 1 77  ? 67.948  59.930  23.521  1.00 22.57 ? 78   GLU A N   1 
ATOM   563  C CA  . GLU A 1 77  ? 69.381  59.721  23.779  1.00 24.34 ? 78   GLU A CA  1 
ATOM   564  C C   . GLU A 1 77  ? 70.109  61.083  23.904  1.00 25.02 ? 78   GLU A C   1 
ATOM   565  O O   . GLU A 1 77  ? 70.944  61.261  24.798  1.00 23.89 ? 78   GLU A O   1 
ATOM   566  C CB  . GLU A 1 77  ? 70.023  58.873  22.668  1.00 25.79 ? 78   GLU A CB  1 
ATOM   567  C CG  . GLU A 1 77  ? 69.619  57.384  22.770  1.00 27.00 ? 78   GLU A CG  1 
ATOM   568  C CD  . GLU A 1 77  ? 69.742  56.847  24.198  1.00 30.49 ? 78   GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 77  ? 70.846  56.954  24.782  1.00 31.88 ? 78   GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 77  ? 68.749  56.317  24.757  1.00 32.77 ? 78   GLU A OE2 1 
ATOM   571  N N   . ALA A 1 78  ? 69.749  62.047  23.048  1.00 23.84 ? 79   ALA A N   1 
ATOM   572  C CA  . ALA A 1 78  ? 70.340  63.388  23.077  1.00 22.78 ? 79   ALA A CA  1 
ATOM   573  C C   . ALA A 1 78  ? 69.983  64.132  24.365  1.00 24.50 ? 79   ALA A C   1 
ATOM   574  O O   . ALA A 1 78  ? 70.729  64.990  24.819  1.00 23.67 ? 79   ALA A O   1 
ATOM   575  C CB  . ALA A 1 78  ? 69.861  64.187  21.894  1.00 23.53 ? 79   ALA A CB  1 
ATOM   576  N N   . VAL A 1 79  ? 68.822  63.833  24.939  1.00 23.35 ? 80   VAL A N   1 
ATOM   577  C CA  . VAL A 1 79  ? 68.424  64.488  26.180  1.00 23.01 ? 80   VAL A CA  1 
ATOM   578  C C   . VAL A 1 79  ? 69.335  63.981  27.309  1.00 23.93 ? 80   VAL A C   1 
ATOM   579  O O   . VAL A 1 79  ? 69.957  64.759  28.065  1.00 23.53 ? 80   VAL A O   1 
ATOM   580  C CB  . VAL A 1 79  ? 66.946  64.159  26.534  1.00 20.60 ? 80   VAL A CB  1 
ATOM   581  C CG1 . VAL A 1 79  ? 66.674  64.464  27.993  1.00 20.30 ? 80   VAL A CG1 1 
ATOM   582  C CG2 . VAL A 1 79  ? 66.006  64.992  25.670  1.00 19.21 ? 80   VAL A CG2 1 
ATOM   583  N N   . LYS A 1 80  ? 69.449  62.666  27.410  1.00 23.52 ? 81   LYS A N   1 
ATOM   584  C CA  . LYS A 1 80  ? 70.292  62.088  28.459  1.00 26.99 ? 81   LYS A CA  1 
ATOM   585  C C   . LYS A 1 80  ? 71.753  62.568  28.275  1.00 27.49 ? 81   LYS A C   1 
ATOM   586  O O   . LYS A 1 80  ? 72.451  62.881  29.232  1.00 27.24 ? 81   LYS A O   1 
ATOM   587  C CB  . LYS A 1 80  ? 70.233  60.566  28.381  1.00 25.13 ? 81   LYS A CB  1 
ATOM   588  C CG  . LYS A 1 80  ? 68.854  59.990  28.585  1.00 27.87 ? 81   LYS A CG  1 
ATOM   589  C CD  . LYS A 1 80  ? 68.711  58.704  27.722  1.00 32.19 ? 81   LYS A CD  1 
ATOM   590  C CE  . LYS A 1 80  ? 68.815  57.466  28.515  1.00 33.23 ? 81   LYS A CE  1 
ATOM   591  N NZ  . LYS A 1 80  ? 68.711  56.275  27.628  1.00 30.57 ? 81   LYS A NZ  1 
ATOM   592  N N   . LYS A 1 81  ? 72.190  62.657  27.036  1.00 28.11 ? 82   LYS A N   1 
ATOM   593  C CA  . LYS A 1 81  ? 73.556  63.058  26.781  1.00 31.16 ? 82   LYS A CA  1 
ATOM   594  C C   . LYS A 1 81  ? 73.840  64.490  27.281  1.00 31.82 ? 82   LYS A C   1 
ATOM   595  O O   . LYS A 1 81  ? 74.993  64.818  27.602  1.00 30.54 ? 82   LYS A O   1 
ATOM   596  C CB  . LYS A 1 81  ? 73.816  62.935  25.286  1.00 32.53 ? 82   LYS A CB  1 
ATOM   597  C CG  . LYS A 1 81  ? 75.240  63.128  24.815  1.00 37.91 ? 82   LYS A CG  1 
ATOM   598  C CD  . LYS A 1 81  ? 75.219  63.053  23.278  1.00 42.58 ? 82   LYS A CD  1 
ATOM   599  C CE  . LYS A 1 81  ? 76.575  63.355  22.633  1.00 45.43 ? 82   LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 81  ? 76.397  63.846  21.224  1.00 47.28 ? 82   LYS A NZ  1 
ATOM   601  N N   . ARG A 1 82  ? 72.794  65.316  27.390  1.00 29.96 ? 83   ARG A N   1 
ATOM   602  C CA  . ARG A 1 82  ? 72.947  66.717  27.804  1.00 29.76 ? 83   ARG A CA  1 
ATOM   603  C C   . ARG A 1 82  ? 73.150  66.855  29.325  1.00 30.76 ? 83   ARG A C   1 
ATOM   604  O O   . ARG A 1 82  ? 73.790  67.791  29.806  1.00 32.00 ? 83   ARG A O   1 
ATOM   605  C CB  . ARG A 1 82  ? 71.725  67.517  27.341  1.00 30.58 ? 83   ARG A CB  1 
ATOM   606  C CG  . ARG A 1 82  ? 71.871  69.000  27.382  1.00 29.17 ? 83   ARG A CG  1 
ATOM   607  C CD  . ARG A 1 82  ? 72.920  69.454  26.396  1.00 30.14 ? 83   ARG A CD  1 
ATOM   608  N NE  . ARG A 1 82  ? 72.889  70.899  26.202  1.00 31.65 ? 83   ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 82  ? 73.404  71.485  25.133  1.00 35.28 ? 83   ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 82  ? 73.991  70.730  24.196  1.00 35.67 ? 83   ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 82  ? 73.293  72.799  24.965  1.00 33.10 ? 83   ARG A NH2 1 
ATOM   612  N N   . PHE A 1 83  ? 72.600  65.912  30.070  1.00 26.88 ? 84   PHE A N   1 
ATOM   613  C CA  . PHE A 1 83  ? 72.746  65.883  31.501  1.00 28.86 ? 84   PHE A CA  1 
ATOM   614  C C   . PHE A 1 83  ? 74.203  65.669  31.908  1.00 32.22 ? 84   PHE A C   1 
ATOM   615  O O   . PHE A 1 83  ? 74.981  65.124  31.131  1.00 32.31 ? 84   PHE A O   1 
ATOM   616  C CB  . PHE A 1 83  ? 71.973  64.707  32.068  1.00 27.11 ? 84   PHE A CB  1 
ATOM   617  C CG  . PHE A 1 83  ? 70.488  64.752  31.810  1.00 24.42 ? 84   PHE A CG  1 
ATOM   618  C CD1 . PHE A 1 83  ? 69.818  65.961  31.699  1.00 21.07 ? 84   PHE A CD1 1 
ATOM   619  C CD2 . PHE A 1 83  ? 69.745  63.557  31.822  1.00 23.49 ? 84   PHE A CD2 1 
ATOM   620  C CE1 . PHE A 1 83  ? 68.403  65.993  31.620  1.00 21.32 ? 84   PHE A CE1 1 
ATOM   621  C CE2 . PHE A 1 83  ? 68.345  63.565  31.739  1.00 19.89 ? 84   PHE A CE2 1 
ATOM   622  C CZ  . PHE A 1 83  ? 67.673  64.794  31.643  1.00 23.22 ? 84   PHE A CZ  1 
ATOM   623  N N   . PHE A 1 84  ? 74.572  66.111  33.112  1.00 32.80 ? 85   PHE A N   1 
ATOM   624  C CA  . PHE A 1 84  ? 75.913  65.846  33.631  1.00 35.55 ? 85   PHE A CA  1 
ATOM   625  C C   . PHE A 1 84  ? 75.966  66.069  35.117  1.00 36.12 ? 85   PHE A C   1 
ATOM   626  O O   . PHE A 1 84  ? 75.462  67.067  35.660  1.00 34.99 ? 85   PHE A O   1 
ATOM   627  C CB  . PHE A 1 84  ? 77.017  66.599  32.867  1.00 40.01 ? 85   PHE A CB  1 
ATOM   628  C CG  . PHE A 1 84  ? 77.028  68.073  33.068  1.00 45.00 ? 85   PHE A CG  1 
ATOM   629  C CD1 . PHE A 1 84  ? 77.719  68.638  34.144  1.00 47.31 ? 85   PHE A CD1 1 
ATOM   630  C CD2 . PHE A 1 84  ? 76.397  68.911  32.149  1.00 47.73 ? 85   PHE A CD2 1 
ATOM   631  C CE1 . PHE A 1 84  ? 77.786  70.027  34.303  1.00 50.65 ? 85   PHE A CE1 1 
ATOM   632  C CE2 . PHE A 1 84  ? 76.451  70.303  32.290  1.00 50.74 ? 85   PHE A CE2 1 
ATOM   633  C CZ  . PHE A 1 84  ? 77.150  70.868  33.373  1.00 51.61 ? 85   PHE A CZ  1 
ATOM   634  N N   . GLY A 1 85  ? 76.535  65.075  35.786  1.00 36.30 ? 86   GLY A N   1 
ATOM   635  C CA  . GLY A 1 85  ? 76.605  65.124  37.225  1.00 35.48 ? 86   GLY A CA  1 
ATOM   636  C C   . GLY A 1 85  ? 75.188  65.180  37.750  1.00 36.10 ? 86   GLY A C   1 
ATOM   637  O O   . GLY A 1 85  ? 74.335  64.401  37.346  1.00 37.13 ? 86   GLY A O   1 
ATOM   638  N N   . PRO A 1 86  ? 74.905  66.109  38.661  1.00 35.50 ? 87   PRO A N   1 
ATOM   639  C CA  . PRO A 1 86  ? 73.579  66.256  39.238  1.00 35.11 ? 87   PRO A CA  1 
ATOM   640  C C   . PRO A 1 86  ? 72.722  67.190  38.393  1.00 34.03 ? 87   PRO A C   1 
ATOM   641  O O   . PRO A 1 86  ? 71.584  67.492  38.751  1.00 34.97 ? 87   PRO A O   1 
ATOM   642  C CB  . PRO A 1 86  ? 73.880  66.850  40.603  1.00 36.05 ? 87   PRO A CB  1 
ATOM   643  C CG  . PRO A 1 86  ? 74.954  67.829  40.277  1.00 36.04 ? 87   PRO A CG  1 
ATOM   644  C CD  . PRO A 1 86  ? 75.845  67.077  39.259  1.00 36.84 ? 87   PRO A CD  1 
ATOM   645  N N   . PHE A 1 87  ? 73.271  67.682  37.295  1.00 31.27 ? 88   PHE A N   1 
ATOM   646  C CA  . PHE A 1 87  ? 72.484  68.563  36.441  1.00 31.72 ? 88   PHE A CA  1 
ATOM   647  C C   . PHE A 1 87  ? 71.664  67.691  35.488  1.00 29.36 ? 88   PHE A C   1 
ATOM   648  O O   . PHE A 1 87  ? 72.106  67.378  34.381  1.00 28.55 ? 88   PHE A O   1 
ATOM   649  C CB  . PHE A 1 87  ? 73.404  69.495  35.670  1.00 33.98 ? 88   PHE A CB  1 
ATOM   650  C CG  . PHE A 1 87  ? 74.120  70.487  36.541  1.00 35.95 ? 88   PHE A CG  1 
ATOM   651  C CD1 . PHE A 1 87  ? 75.508  70.586  36.508  1.00 38.23 ? 88   PHE A CD1 1 
ATOM   652  C CD2 . PHE A 1 87  ? 73.403  71.381  37.328  1.00 35.76 ? 88   PHE A CD2 1 
ATOM   653  C CE1 . PHE A 1 87  ? 76.185  71.590  37.253  1.00 39.39 ? 88   PHE A CE1 1 
ATOM   654  C CE2 . PHE A 1 87  ? 74.050  72.379  38.068  1.00 39.58 ? 88   PHE A CE2 1 
ATOM   655  C CZ  . PHE A 1 87  ? 75.453  72.483  38.027  1.00 39.44 ? 88   PHE A CZ  1 
ATOM   656  N N   . ARG A 1 88  ? 70.483  67.284  35.964  1.00 30.38 ? 89   ARG A N   1 
ATOM   657  C CA  . ARG A 1 88  ? 69.559  66.423  35.218  1.00 28.63 ? 89   ARG A CA  1 
ATOM   658  C C   . ARG A 1 88  ? 68.186  66.512  35.861  1.00 25.27 ? 89   ARG A C   1 
ATOM   659  O O   . ARG A 1 88  ? 68.054  67.040  36.962  1.00 25.27 ? 89   ARG A O   1 
ATOM   660  C CB  . ARG A 1 88  ? 70.038  64.940  35.244  1.00 30.12 ? 89   ARG A CB  1 
ATOM   661  C CG  . ARG A 1 88  ? 70.033  64.255  36.618  1.00 31.14 ? 89   ARG A CG  1 
ATOM   662  C CD  . ARG A 1 88  ? 70.776  62.859  36.606  1.00 31.78 ? 89   ARG A CD  1 
ATOM   663  N NE  . ARG A 1 88  ? 72.191  63.034  36.246  1.00 31.94 ? 89   ARG A NE  1 
ATOM   664  C CZ  . ARG A 1 88  ? 72.784  62.543  35.155  1.00 29.66 ? 89   ARG A CZ  1 
ATOM   665  N NH1 . ARG A 1 88  ? 72.126  61.792  34.265  1.00 27.64 ? 89   ARG A NH1 1 
ATOM   666  N NH2 . ARG A 1 88  ? 74.049  62.867  34.916  1.00 31.73 ? 89   ARG A NH2 1 
ATOM   667  N N   . VAL A 1 89  ? 67.162  66.028  35.150  1.00 24.21 ? 90   VAL A N   1 
ATOM   668  C CA  . VAL A 1 89  ? 65.788  65.996  35.651  1.00 19.41 ? 90   VAL A CA  1 
ATOM   669  C C   . VAL A 1 89  ? 65.278  64.669  35.154  1.00 18.39 ? 90   VAL A C   1 
ATOM   670  O O   . VAL A 1 89  ? 65.925  64.051  34.303  1.00 18.18 ? 90   VAL A O   1 
ATOM   671  C CB  . VAL A 1 89  ? 64.916  67.135  35.088  1.00 23.44 ? 90   VAL A CB  1 
ATOM   672  C CG1 . VAL A 1 89  ? 65.393  68.465  35.663  1.00 24.52 ? 90   VAL A CG1 1 
ATOM   673  C CG2 . VAL A 1 89  ? 65.010  67.180  33.537  1.00 22.90 ? 90   VAL A CG2 1 
ATOM   674  N N   . SER A 1 90  ? 64.162  64.204  35.697  1.00 17.96 ? 91   SER A N   1 
ATOM   675  C CA  . SER A 1 90  ? 63.608  62.919  35.263  1.00 19.67 ? 91   SER A CA  1 
ATOM   676  C C   . SER A 1 90  ? 63.103  63.088  33.812  1.00 20.87 ? 91   SER A C   1 
ATOM   677  O O   . SER A 1 90  ? 62.717  64.202  33.409  1.00 20.92 ? 91   SER A O   1 
ATOM   678  C CB  . SER A 1 90  ? 62.444  62.535  36.158  1.00 18.98 ? 91   SER A CB  1 
ATOM   679  O OG  . SER A 1 90  ? 62.873  62.192  37.484  1.00 22.89 ? 91   SER A OG  1 
ATOM   680  N N   . CYS A 1 91  ? 63.117  62.002  33.036  1.00 19.10 ? 92   CYS A N   1 
ATOM   681  C CA  . CYS A 1 91  ? 62.623  62.073  31.651  1.00 19.25 ? 92   CYS A CA  1 
ATOM   682  C C   . CYS A 1 91  ? 61.882  60.788  31.286  1.00 20.69 ? 92   CYS A C   1 
ATOM   683  O O   . CYS A 1 91  ? 62.099  59.720  31.871  1.00 18.42 ? 92   CYS A O   1 
ATOM   684  C CB  . CYS A 1 91  ? 63.768  62.349  30.678  1.00 21.40 ? 92   CYS A CB  1 
ATOM   685  S SG  . CYS A 1 91  ? 65.076  61.103  30.760  1.00 23.89 ? 92   CYS A SG  1 
ATOM   686  N N   . MET A 1 92  ? 60.978  60.904  30.319  1.00 18.23 ? 93   MET A N   1 
ATOM   687  C CA  . MET A 1 92  ? 60.179  59.772  29.917  1.00 17.55 ? 93   MET A CA  1 
ATOM   688  C C   . MET A 1 92  ? 60.083  59.790  28.401  1.00 16.73 ? 93   MET A C   1 
ATOM   689  O O   . MET A 1 92  ? 60.074  60.861  27.788  1.00 14.73 ? 93   MET A O   1 
ATOM   690  C CB  . MET A 1 92  ? 58.776  59.924  30.502  1.00 17.61 ? 93   MET A CB  1 
ATOM   691  C CG  . MET A 1 92  ? 57.798  58.849  30.053  1.00 18.13 ? 93   MET A CG  1 
ATOM   692  S SD  . MET A 1 92  ? 56.198  59.029  30.929  1.00 20.08 ? 93   MET A SD  1 
ATOM   693  C CE  . MET A 1 92  ? 55.200  57.594  30.220  1.00 17.15 ? 93   MET A CE  1 
ATOM   694  N N   . LEU A 1 93  ? 60.003  58.606  27.811  1.00 16.81 ? 94   LEU A N   1 
ATOM   695  C CA  . LEU A 1 93  ? 59.853  58.476  26.366  1.00 15.64 ? 94   LEU A CA  1 
ATOM   696  C C   . LEU A 1 93  ? 58.606  57.628  26.121  1.00 18.70 ? 94   LEU A C   1 
ATOM   697  O O   . LEU A 1 93  ? 58.426  56.580  26.753  1.00 19.12 ? 94   LEU A O   1 
ATOM   698  C CB  . LEU A 1 93  ? 61.047  57.742  25.750  1.00 17.58 ? 94   LEU A CB  1 
ATOM   699  C CG  . LEU A 1 93  ? 60.932  57.390  24.254  1.00 20.87 ? 94   LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 93  ? 60.954  58.681  23.411  1.00 19.76 ? 94   LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 93  ? 62.116  56.504  23.834  1.00 20.24 ? 94   LEU A CD2 1 
ATOM   702  N N   . ASP A 1 94  ? 57.743  58.091  25.213  1.00 17.78 ? 95   ASP A N   1 
ATOM   703  C CA  . ASP A 1 94  ? 56.524  57.376  24.852  1.00 19.08 ? 95   ASP A CA  1 
ATOM   704  C C   . ASP A 1 94  ? 56.020  58.020  23.529  1.00 18.70 ? 95   ASP A C   1 
ATOM   705  O O   . ASP A 1 94  ? 55.507  59.134  23.542  1.00 21.35 ? 95   ASP A O   1 
ATOM   706  C CB  . ASP A 1 94  ? 55.447  57.492  25.960  1.00 16.77 ? 95   ASP A CB  1 
ATOM   707  C CG  . ASP A 1 94  ? 54.430  56.342  25.894  1.00 19.52 ? 95   ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 94  ? 54.852  55.215  25.513  1.00 22.18 ? 95   ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 94  ? 53.228  56.535  26.212  1.00 19.04 ? 95   ASP A OD2 1 
ATOM   710  N N   . SER A 1 95  ? 56.203  57.327  22.411  1.00 20.94 ? 96   SER A N   1 
ATOM   711  C CA  . SER A 1 95  ? 55.800  57.824  21.085  1.00 20.55 ? 96   SER A CA  1 
ATOM   712  C C   . SER A 1 95  ? 54.446  57.194  20.730  1.00 20.71 ? 96   SER A C   1 
ATOM   713  O O   . SER A 1 95  ? 54.363  56.030  20.289  1.00 21.53 ? 96   SER A O   1 
ATOM   714  C CB  . SER A 1 95  ? 56.859  57.416  20.058  1.00 23.50 ? 96   SER A CB  1 
ATOM   715  O OG  . SER A 1 95  ? 58.101  57.992  20.372  1.00 22.76 ? 96   SER A OG  1 
ATOM   716  N N   . ASN A 1 96  ? 53.385  57.962  20.954  1.00 20.22 ? 97   ASN A N   1 
ATOM   717  C CA  . ASN A 1 96  ? 52.024  57.508  20.757  1.00 19.96 ? 97   ASN A CA  1 
ATOM   718  C C   . ASN A 1 96  ? 51.855  56.151  21.450  1.00 20.53 ? 97   ASN A C   1 
ATOM   719  O O   . ASN A 1 96  ? 51.356  55.180  20.852  1.00 18.30 ? 97   ASN A O   1 
ATOM   720  C CB  . ASN A 1 96  ? 51.689  57.421  19.257  1.00 25.32 ? 97   ASN A CB  1 
ATOM   721  C CG  . ASN A 1 96  ? 51.516  58.795  18.636  1.00 28.20 ? 97   ASN A CG  1 
ATOM   722  O OD1 . ASN A 1 96  ? 51.285  59.792  19.351  1.00 28.26 ? 97   ASN A OD1 1 
ATOM   723  N ND2 . ASN A 1 96  ? 51.597  58.863  17.302  1.00 24.69 ? 97   ASN A ND2 1 
ATOM   724  N N   . GLY A 1 97  ? 52.274  56.095  22.724  1.00 21.16 ? 98   GLY A N   1 
ATOM   725  C CA  . GLY A 1 97  ? 52.135  54.874  23.504  1.00 19.96 ? 98   GLY A CA  1 
ATOM   726  C C   . GLY A 1 97  ? 53.048  53.699  23.170  1.00 21.35 ? 98   GLY A C   1 
ATOM   727  O O   . GLY A 1 97  ? 52.790  52.593  23.637  1.00 23.64 ? 98   GLY A O   1 
ATOM   728  N N   . SER A 1 98  ? 54.110  53.918  22.393  1.00 21.03 ? 99   SER A N   1 
ATOM   729  C CA  . SER A 1 98  ? 55.051  52.848  22.050  1.00 20.72 ? 99   SER A CA  1 
ATOM   730  C C   . SER A 1 98  ? 55.409  52.065  23.291  1.00 19.55 ? 99   SER A C   1 
ATOM   731  O O   . SER A 1 98  ? 55.341  50.846  23.301  1.00 21.57 ? 99   SER A O   1 
ATOM   732  C CB  . SER A 1 98  ? 56.324  53.420  21.435  1.00 18.48 ? 99   SER A CB  1 
ATOM   733  O OG  . SER A 1 98  ? 56.928  54.365  22.322  1.00 24.75 ? 99   SER A OG  1 
ATOM   734  N N   . ASN A 1 99  ? 55.825  52.765  24.339  1.00 17.63 ? 100  ASN A N   1 
ATOM   735  C CA  . ASN A 1 99  ? 56.139  52.110  25.599  1.00 16.39 ? 100  ASN A CA  1 
ATOM   736  C C   . ASN A 1 99  ? 54.975  51.769  26.495  1.00 18.53 ? 100  ASN A C   1 
ATOM   737  O O   . ASN A 1 99  ? 54.876  50.629  26.954  1.00 19.99 ? 100  ASN A O   1 
ATOM   738  C CB  . ASN A 1 99  ? 57.119  52.953  26.428  1.00 16.03 ? 100  ASN A CB  1 
ATOM   739  C CG  . ASN A 1 99  ? 58.549  52.917  25.881  1.00 17.97 ? 100  ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 99  ? 59.032  51.860  25.464  1.00 17.77 ? 100  ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 99  ? 59.245  54.068  25.916  1.00 15.56 ? 100  ASN A ND2 1 
ATOM   742  N N   . THR A 1 100 ? 54.099  52.736  26.790  1.00 17.96 ? 101  THR A N   1 
ATOM   743  C CA  . THR A 1 100 ? 52.991  52.477  27.716  1.00 16.66 ? 101  THR A CA  1 
ATOM   744  C C   . THR A 1 100 ? 51.978  51.445  27.239  1.00 19.46 ? 101  THR A C   1 
ATOM   745  O O   . THR A 1 100 ? 51.503  50.614  28.028  1.00 17.96 ? 101  THR A O   1 
ATOM   746  C CB  . THR A 1 100 ? 52.253  53.795  28.094  1.00 18.97 ? 101  THR A CB  1 
ATOM   747  O OG1 . THR A 1 100 ? 51.822  54.481  26.896  1.00 19.36 ? 101  THR A OG1 1 
ATOM   748  C CG2 . THR A 1 100 ? 53.209  54.699  28.883  1.00 21.19 ? 101  THR A CG2 1 
ATOM   749  N N   . THR A 1 101 ? 51.660  51.447  25.942  1.00 15.23 ? 102  THR A N   1 
ATOM   750  C CA  . THR A 1 101 ? 50.724  50.451  25.476  1.00 16.71 ? 102  THR A CA  1 
ATOM   751  C C   . THR A 1 101 ? 51.338  49.023  25.490  1.00 15.96 ? 102  THR A C   1 
ATOM   752  O O   . THR A 1 101 ? 50.726  48.047  26.005  1.00 18.71 ? 102  THR A O   1 
ATOM   753  C CB  . THR A 1 101 ? 50.195  50.824  24.032  1.00 18.55 ? 102  THR A CB  1 
ATOM   754  O OG1 . THR A 1 101 ? 49.437  52.049  24.115  1.00 21.26 ? 102  THR A OG1 1 
ATOM   755  C CG2 . THR A 1 101 ? 49.289  49.704  23.483  1.00 17.06 ? 102  THR A CG2 1 
ATOM   756  N N   . ALA A 1 102 ? 52.541  48.904  24.951  1.00 14.14 ? 103  ALA A N   1 
ATOM   757  C CA  . ALA A 1 102 ? 53.219  47.610  24.860  1.00 13.94 ? 103  ALA A CA  1 
ATOM   758  C C   . ALA A 1 102 ? 53.432  47.066  26.308  1.00 17.95 ? 103  ALA A C   1 
ATOM   759  O O   . ALA A 1 102 ? 53.201  45.880  26.580  1.00 16.77 ? 103  ALA A O   1 
ATOM   760  C CB  . ALA A 1 102 ? 54.564  47.778  24.120  1.00 14.50 ? 103  ALA A CB  1 
ATOM   761  N N   . ALA A 1 103 ? 53.858  47.927  27.224  1.00 16.79 ? 104  ALA A N   1 
ATOM   762  C CA  . ALA A 1 103 ? 54.057  47.467  28.601  1.00 19.86 ? 104  ALA A CA  1 
ATOM   763  C C   . ALA A 1 103 ? 52.748  47.000  29.249  1.00 16.83 ? 104  ALA A C   1 
ATOM   764  O O   . ALA A 1 103 ? 52.746  46.007  29.966  1.00 18.35 ? 104  ALA A O   1 
ATOM   765  C CB  . ALA A 1 103 ? 54.701  48.574  29.458  1.00 19.11 ? 104  ALA A CB  1 
ATOM   766  N N   . ALA A 1 104 ? 51.645  47.724  29.040  1.00 19.04 ? 105  ALA A N   1 
ATOM   767  C CA  . ALA A 1 104 ? 50.360  47.334  29.604  1.00 18.27 ? 105  ALA A CA  1 
ATOM   768  C C   . ALA A 1 104 ? 49.950  45.981  29.030  1.00 22.30 ? 105  ALA A C   1 
ATOM   769  O O   . ALA A 1 104 ? 49.484  45.081  29.753  1.00 19.55 ? 105  ALA A O   1 
ATOM   770  C CB  . ALA A 1 104 ? 49.281  48.371  29.285  1.00 20.30 ? 105  ALA A CB  1 
ATOM   771  N N   . GLY A 1 105 ? 50.130  45.821  27.724  1.00 20.02 ? 106  GLY A N   1 
ATOM   772  C CA  . GLY A 1 105 ? 49.740  44.559  27.111  1.00 20.72 ? 106  GLY A CA  1 
ATOM   773  C C   . GLY A 1 105 ? 50.563  43.354  27.561  1.00 22.04 ? 106  GLY A C   1 
ATOM   774  O O   . GLY A 1 105 ? 50.015  42.301  27.924  1.00 21.88 ? 106  GLY A O   1 
ATOM   775  N N   . VAL A 1 106 ? 51.885  43.476  27.479  1.00 19.93 ? 107  VAL A N   1 
ATOM   776  C CA  . VAL A 1 106 ? 52.748  42.384  27.900  1.00 22.57 ? 107  VAL A CA  1 
ATOM   777  C C   . VAL A 1 106 ? 52.582  42.081  29.406  1.00 22.45 ? 107  VAL A C   1 
ATOM   778  O O   . VAL A 1 106 ? 52.586  40.909  29.796  1.00 23.64 ? 107  VAL A O   1 
ATOM   779  C CB  . VAL A 1 106 ? 54.258  42.700  27.612  1.00 22.79 ? 107  VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 106 ? 55.135  41.687  28.294  1.00 24.40 ? 107  VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 106 ? 54.507  42.744  26.099  1.00 19.93 ? 107  VAL A CG2 1 
ATOM   782  N N   . ALA A 1 107 ? 52.422  43.113  30.246  1.00 20.85 ? 108  ALA A N   1 
ATOM   783  C CA  . ALA A 1 107 ? 52.281  42.856  31.685  1.00 20.79 ? 108  ALA A CA  1 
ATOM   784  C C   . ALA A 1 107 ? 50.990  42.087  31.959  1.00 23.94 ? 108  ALA A C   1 
ATOM   785  O O   . ALA A 1 107 ? 50.954  41.173  32.805  1.00 22.26 ? 108  ALA A O   1 
ATOM   786  C CB  . ALA A 1 107 ? 52.298  44.172  32.481  1.00 20.37 ? 108  ALA A CB  1 
ATOM   787  N N   . LEU A 1 108 ? 49.926  42.415  31.232  1.00 24.74 ? 109  LEU A N   1 
ATOM   788  C CA  . LEU A 1 108 ? 48.670  41.702  31.473  1.00 23.14 ? 109  LEU A CA  1 
ATOM   789  C C   . LEU A 1 108 ? 48.784  40.248  30.994  1.00 25.35 ? 109  LEU A C   1 
ATOM   790  O O   . LEU A 1 108 ? 48.295  39.330  31.672  1.00 23.78 ? 109  LEU A O   1 
ATOM   791  C CB  . LEU A 1 108 ? 47.507  42.428  30.782  1.00 24.54 ? 109  LEU A CB  1 
ATOM   792  C CG  . LEU A 1 108 ? 47.023  43.701  31.501  1.00 23.87 ? 109  LEU A CG  1 
ATOM   793  C CD1 . LEU A 1 108 ? 46.274  44.580  30.505  1.00 26.19 ? 109  LEU A CD1 1 
ATOM   794  C CD2 . LEU A 1 108 ? 46.081  43.347  32.682  1.00 23.85 ? 109  LEU A CD2 1 
ATOM   795  N N   . VAL A 1 109 ? 49.442  40.039  29.847  1.00 24.09 ? 110  VAL A N   1 
ATOM   796  C CA  . VAL A 1 109 ? 49.613  38.691  29.308  1.00 25.66 ? 110  VAL A CA  1 
ATOM   797  C C   . VAL A 1 109 ? 50.494  37.810  30.220  1.00 27.44 ? 110  VAL A C   1 
ATOM   798  O O   . VAL A 1 109 ? 50.125  36.669  30.511  1.00 24.91 ? 110  VAL A O   1 
ATOM   799  C CB  . VAL A 1 109 ? 50.211  38.728  27.885  1.00 25.33 ? 110  VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 109 ? 50.609  37.345  27.447  1.00 25.05 ? 110  VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 109 ? 49.164  39.263  26.910  1.00 21.71 ? 110  VAL A CG2 1 
ATOM   802  N N   . VAL A 1 110 ? 51.633  38.351  30.669  1.00 25.52 ? 111  VAL A N   1 
ATOM   803  C CA  . VAL A 1 110 ? 52.556  37.627  31.563  1.00 27.40 ? 111  VAL A CA  1 
ATOM   804  C C   . VAL A 1 110 ? 51.855  37.293  32.884  1.00 27.39 ? 111  VAL A C   1 
ATOM   805  O O   . VAL A 1 110 ? 52.047  36.217  33.455  1.00 30.28 ? 111  VAL A O   1 
ATOM   806  C CB  . VAL A 1 110 ? 53.837  38.473  31.885  1.00 25.97 ? 111  VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 110 ? 54.627  37.816  32.997  1.00 25.58 ? 111  VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 110 ? 54.731  38.603  30.617  1.00 23.02 ? 111  VAL A CG2 1 
ATOM   809  N N   . LYS A 1 111 ? 51.049  38.222  33.378  1.00 29.49 ? 112  LYS A N   1 
ATOM   810  C CA  . LYS A 1 111 ? 50.318  38.006  34.617  1.00 29.88 ? 112  LYS A CA  1 
ATOM   811  C C   . LYS A 1 111 ? 49.304  36.869  34.417  1.00 31.61 ? 112  LYS A C   1 
ATOM   812  O O   . LYS A 1 111 ? 49.214  35.948  35.242  1.00 29.24 ? 112  LYS A O   1 
ATOM   813  C CB  . LYS A 1 111 ? 49.581  39.280  35.044  1.00 30.91 ? 112  LYS A CB  1 
ATOM   814  C CG  . LYS A 1 111 ? 48.730  39.082  36.272  1.00 31.99 ? 112  LYS A CG  1 
ATOM   815  C CD  . LYS A 1 111 ? 47.921  40.318  36.620  1.00 36.43 ? 112  LYS A CD  1 
ATOM   816  C CE  . LYS A 1 111 ? 47.376  40.218  38.044  1.00 38.58 ? 112  LYS A CE  1 
ATOM   817  N NZ  . LYS A 1 111 ? 46.690  41.470  38.502  1.00 40.48 ? 112  LYS A NZ  1 
ATOM   818  N N   . ALA A 1 112 ? 48.578  36.911  33.302  1.00 30.64 ? 113  ALA A N   1 
ATOM   819  C CA  . ALA A 1 112 ? 47.573  35.890  33.020  1.00 31.64 ? 113  ALA A CA  1 
ATOM   820  C C   . ALA A 1 112 ? 48.214  34.532  32.777  1.00 31.51 ? 113  ALA A C   1 
ATOM   821  O O   . ALA A 1 112 ? 47.575  33.494  32.968  1.00 33.38 ? 113  ALA A O   1 
ATOM   822  C CB  . ALA A 1 112 ? 46.722  36.299  31.805  1.00 31.35 ? 113  ALA A CB  1 
ATOM   823  N N   . ALA A 1 113 ? 49.474  34.530  32.361  1.00 30.30 ? 114  ALA A N   1 
ATOM   824  C CA  . ALA A 1 113 ? 50.172  33.284  32.096  1.00 31.24 ? 114  ALA A CA  1 
ATOM   825  C C   . ALA A 1 113 ? 50.733  32.685  33.383  1.00 33.05 ? 114  ALA A C   1 
ATOM   826  O O   . ALA A 1 113 ? 51.375  31.629  33.361  1.00 34.08 ? 114  ALA A O   1 
ATOM   827  C CB  . ALA A 1 113 ? 51.292  33.524  31.146  1.00 30.56 ? 114  ALA A CB  1 
ATOM   828  N N   . GLY A 1 114 ? 50.514  33.372  34.493  1.00 33.14 ? 115  GLY A N   1 
ATOM   829  C CA  . GLY A 1 114 ? 51.010  32.892  35.767  1.00 33.55 ? 115  GLY A CA  1 
ATOM   830  C C   . GLY A 1 114 ? 52.338  33.504  36.187  1.00 36.00 ? 115  GLY A C   1 
ATOM   831  O O   . GLY A 1 114 ? 53.023  32.937  37.046  1.00 36.38 ? 115  GLY A O   1 
ATOM   832  N N   . GLY A 1 115 ? 52.741  34.623  35.577  1.00 32.95 ? 116  GLY A N   1 
ATOM   833  C CA  . GLY A 1 115 ? 53.981  35.267  35.999  1.00 31.31 ? 116  GLY A CA  1 
ATOM   834  C C   . GLY A 1 115 ? 55.237  34.996  35.202  1.00 32.11 ? 116  GLY A C   1 
ATOM   835  O O   . GLY A 1 115 ? 56.246  35.690  35.359  1.00 33.76 ? 116  GLY A O   1 
ATOM   836  N N   . SER A 1 116 ? 55.197  33.981  34.357  1.00 30.16 ? 117  SER A N   1 
ATOM   837  C CA  . SER A 1 116 ? 56.348  33.664  33.546  1.00 32.81 ? 117  SER A CA  1 
ATOM   838  C C   . SER A 1 116 ? 55.905  33.197  32.170  1.00 32.12 ? 117  SER A C   1 
ATOM   839  O O   . SER A 1 116 ? 54.865  32.535  32.008  1.00 32.72 ? 117  SER A O   1 
ATOM   840  C CB  . SER A 1 116 ? 57.205  32.559  34.200  1.00 33.47 ? 117  SER A CB  1 
ATOM   841  O OG  . SER A 1 116 ? 58.195  32.069  33.291  1.00 37.88 ? 117  SER A OG  1 
ATOM   842  N N   . VAL A 1 117 ? 56.709  33.560  31.188  1.00 30.83 ? 118  VAL A N   1 
ATOM   843  C CA  . VAL A 1 117 ? 56.485  33.161  29.804  1.00 32.85 ? 118  VAL A CA  1 
ATOM   844  C C   . VAL A 1 117 ? 57.851  32.648  29.342  1.00 33.84 ? 118  VAL A C   1 
ATOM   845  O O   . VAL A 1 117 ? 58.101  32.437  28.142  1.00 32.62 ? 118  VAL A O   1 
ATOM   846  C CB  . VAL A 1 117 ? 56.061  34.361  28.918  1.00 32.40 ? 118  VAL A CB  1 
ATOM   847  C CG1 . VAL A 1 117 ? 57.012  35.528  29.101  1.00 31.73 ? 118  VAL A CG1 1 
ATOM   848  C CG2 . VAL A 1 117 ? 56.073  33.936  27.467  1.00 36.43 ? 118  VAL A CG2 1 
ATOM   849  N N   . LYS A 1 118 ? 58.733  32.421  30.314  1.00 33.64 ? 119  LYS A N   1 
ATOM   850  C CA  . LYS A 1 118 ? 60.084  31.985  29.991  1.00 35.05 ? 119  LYS A CA  1 
ATOM   851  C C   . LYS A 1 118 ? 60.105  30.701  29.172  1.00 35.92 ? 119  LYS A C   1 
ATOM   852  O O   . LYS A 1 118 ? 59.459  29.717  29.516  1.00 35.09 ? 119  LYS A O   1 
ATOM   853  C CB  . LYS A 1 118 ? 60.909  31.809  31.270  1.00 37.54 ? 119  LYS A CB  1 
ATOM   854  C CG  . LYS A 1 118 ? 62.402  31.675  30.988  1.00 44.19 ? 119  LYS A CG  1 
ATOM   855  C CD  . LYS A 1 118 ? 63.213  31.396  32.277  1.00 48.20 ? 119  LYS A CD  1 
ATOM   856  C CE  . LYS A 1 118 ? 64.699  31.115  31.974  1.00 50.16 ? 119  LYS A CE  1 
ATOM   857  N NZ  . LYS A 1 118 ? 65.458  30.520  33.144  1.00 52.40 ? 119  LYS A NZ  1 
ATOM   858  N N   . GLY A 1 119 ? 60.843  30.731  28.068  1.00 36.93 ? 120  GLY A N   1 
ATOM   859  C CA  . GLY A 1 119 ? 60.959  29.566  27.214  1.00 37.92 ? 120  GLY A CA  1 
ATOM   860  C C   . GLY A 1 119 ? 59.793  29.218  26.300  1.00 38.52 ? 120  GLY A C   1 
ATOM   861  O O   . GLY A 1 119 ? 59.880  28.240  25.553  1.00 39.72 ? 120  GLY A O   1 
ATOM   862  N N   . LYS A 1 120 ? 58.715  29.998  26.337  1.00 35.20 ? 121  LYS A N   1 
ATOM   863  C CA  . LYS A 1 120 ? 57.568  29.735  25.483  1.00 33.40 ? 121  LYS A CA  1 
ATOM   864  C C   . LYS A 1 120 ? 57.613  30.561  24.198  1.00 32.12 ? 121  LYS A C   1 
ATOM   865  O O   . LYS A 1 120 ? 58.375  31.515  24.091  1.00 32.58 ? 121  LYS A O   1 
ATOM   866  C CB  . LYS A 1 120 ? 56.273  29.988  26.257  1.00 35.17 ? 121  LYS A CB  1 
ATOM   867  C CG  . LYS A 1 120 ? 55.813  28.750  27.071  1.00 37.42 ? 121  LYS A CG  1 
ATOM   868  C CD  . LYS A 1 120 ? 54.549  29.030  27.867  1.00 38.74 ? 121  LYS A CD  1 
ATOM   869  C CE  . LYS A 1 120 ? 54.032  27.809  28.639  1.00 40.47 ? 121  LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 120 ? 52.950  28.210  29.640  1.00 37.84 ? 121  LYS A NZ  1 
ATOM   871  N N   . LYS A 1 121 ? 56.806  30.195  23.210  1.00 31.00 ? 122  LYS A N   1 
ATOM   872  C CA  . LYS A 1 121 ? 56.818  30.901  21.939  1.00 30.78 ? 122  LYS A CA  1 
ATOM   873  C C   . LYS A 1 121 ? 55.807  32.025  21.827  1.00 29.13 ? 122  LYS A C   1 
ATOM   874  O O   . LYS A 1 121 ? 54.608  31.850  22.047  1.00 27.44 ? 122  LYS A O   1 
ATOM   875  C CB  . LYS A 1 121 ? 56.593  29.939  20.755  1.00 33.87 ? 122  LYS A CB  1 
ATOM   876  C CG  . LYS A 1 121 ? 56.712  30.683  19.401  1.00 38.52 ? 122  LYS A CG  1 
ATOM   877  C CD  . LYS A 1 121 ? 56.546  29.767  18.200  1.00 42.29 ? 122  LYS A CD  1 
ATOM   878  C CE  . LYS A 1 121 ? 56.810  30.524  16.889  1.00 43.22 ? 122  LYS A CE  1 
ATOM   879  N NZ  . LYS A 1 121 ? 56.628  29.644  15.689  1.00 43.99 ? 122  LYS A NZ  1 
ATOM   880  N N   . ALA A 1 122 ? 56.300  33.195  21.474  1.00 27.85 ? 123  ALA A N   1 
ATOM   881  C CA  . ALA A 1 122 ? 55.404  34.324  21.291  1.00 27.57 ? 123  ALA A CA  1 
ATOM   882  C C   . ALA A 1 122 ? 55.529  34.808  19.862  1.00 26.13 ? 123  ALA A C   1 
ATOM   883  O O   . ALA A 1 122 ? 56.629  34.893  19.314  1.00 27.71 ? 123  ALA A O   1 
ATOM   884  C CB  . ALA A 1 122 ? 55.761  35.431  22.246  1.00 28.86 ? 123  ALA A CB  1 
ATOM   885  N N   . VAL A 1 123 ? 54.396  35.117  19.260  1.00 25.38 ? 124  VAL A N   1 
ATOM   886  C CA  . VAL A 1 123 ? 54.374  35.621  17.904  1.00 24.06 ? 124  VAL A CA  1 
ATOM   887  C C   . VAL A 1 123 ? 53.675  36.973  17.901  1.00 22.93 ? 124  VAL A C   1 
ATOM   888  O O   . VAL A 1 123 ? 52.550  37.138  18.480  1.00 21.22 ? 124  VAL A O   1 
ATOM   889  C CB  . VAL A 1 123 ? 53.604  34.673  16.940  1.00 25.77 ? 124  VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 123 ? 53.536  35.304  15.543  1.00 24.47 ? 124  VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 123 ? 54.304  33.285  16.873  1.00 25.52 ? 124  VAL A CG2 1 
ATOM   892  N N   . VAL A 1 124 ? 54.355  37.948  17.302  1.00 21.16 ? 125  VAL A N   1 
ATOM   893  C CA  . VAL A 1 124 ? 53.771  39.275  17.180  1.00 23.32 ? 125  VAL A CA  1 
ATOM   894  C C   . VAL A 1 124 ? 53.469  39.527  15.687  1.00 21.22 ? 125  VAL A C   1 
ATOM   895  O O   . VAL A 1 124 ? 54.391  39.745  14.893  1.00 21.79 ? 125  VAL A O   1 
ATOM   896  C CB  . VAL A 1 124 ? 54.708  40.405  17.674  1.00 23.08 ? 125  VAL A CB  1 
ATOM   897  C CG1 . VAL A 1 124 ? 53.904  41.730  17.727  1.00 23.84 ? 125  VAL A CG1 1 
ATOM   898  C CG2 . VAL A 1 124 ? 55.291  40.078  19.062  1.00 21.06 ? 125  VAL A CG2 1 
ATOM   899  N N   . LEU A 1 125 ? 52.184  39.458  15.337  1.00 21.19 ? 126  LEU A N   1 
ATOM   900  C CA  . LEU A 1 125 ? 51.712  39.704  13.970  1.00 22.83 ? 126  LEU A CA  1 
ATOM   901  C C   . LEU A 1 125 ? 51.705  41.230  13.715  1.00 23.63 ? 126  LEU A C   1 
ATOM   902  O O   . LEU A 1 125 ? 51.383  42.020  14.618  1.00 20.06 ? 126  LEU A O   1 
ATOM   903  C CB  . LEU A 1 125 ? 50.312  39.099  13.779  1.00 23.02 ? 126  LEU A CB  1 
ATOM   904  C CG  . LEU A 1 125 ? 50.271  37.568  13.859  1.00 24.22 ? 126  LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 125 ? 48.832  37.087  13.727  1.00 25.80 ? 126  LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 125 ? 51.117  36.964  12.782  1.00 23.74 ? 126  LEU A CD2 1 
ATOM   907  N N   . ALA A 1 126 ? 52.068  41.624  12.492  1.00 24.00 ? 127  ALA A N   1 
ATOM   908  C CA  . ALA A 1 126 ? 52.182  43.047  12.114  1.00 23.71 ? 127  ALA A CA  1 
ATOM   909  C C   . ALA A 1 126 ? 52.987  43.743  13.240  1.00 24.84 ? 127  ALA A C   1 
ATOM   910  O O   . ALA A 1 126 ? 52.542  44.762  13.774  1.00 23.64 ? 127  ALA A O   1 
ATOM   911  C CB  . ALA A 1 126 ? 50.774  43.690  11.981  1.00 25.65 ? 127  ALA A CB  1 
ATOM   912  N N   . GLY A 1 127 ? 54.174  43.206  13.554  1.00 22.21 ? 128  GLY A N   1 
ATOM   913  C CA  . GLY A 1 127 ? 54.989  43.750  14.641  1.00 22.24 ? 128  GLY A CA  1 
ATOM   914  C C   . GLY A 1 127 ? 56.097  44.739  14.305  1.00 22.20 ? 128  GLY A C   1 
ATOM   915  O O   . GLY A 1 127 ? 56.965  44.985  15.153  1.00 23.86 ? 128  GLY A O   1 
ATOM   916  N N   . THR A 1 128 ? 56.051  45.357  13.125  1.00 19.43 ? 129  THR A N   1 
ATOM   917  C CA  . THR A 1 128 ? 57.123  46.299  12.737  1.00 22.66 ? 129  THR A CA  1 
ATOM   918  C C   . THR A 1 128 ? 56.837  47.749  13.161  1.00 24.13 ? 129  THR A C   1 
ATOM   919  O O   . THR A 1 128 ? 57.664  48.639  12.921  1.00 23.17 ? 129  THR A O   1 
ATOM   920  C CB  . THR A 1 128 ? 57.341  46.308  11.203  1.00 25.48 ? 129  THR A CB  1 
ATOM   921  O OG1 . THR A 1 128 ? 56.147  46.778  10.596  1.00 26.00 ? 129  THR A OG1 1 
ATOM   922  C CG2 . THR A 1 128 ? 57.640  44.918  10.672  1.00 24.00 ? 129  THR A CG2 1 
ATOM   923  N N   . GLY A 1 129 ? 55.653  47.989  13.730  1.00 21.78 ? 130  GLY A N   1 
ATOM   924  C CA  . GLY A 1 129 ? 55.304  49.310  14.228  1.00 24.14 ? 130  GLY A CA  1 
ATOM   925  C C   . GLY A 1 129 ? 55.835  49.480  15.665  1.00 24.19 ? 130  GLY A C   1 
ATOM   926  O O   . GLY A 1 129 ? 56.286  48.500  16.258  1.00 22.71 ? 130  GLY A O   1 
ATOM   927  N N   . PRO A 1 130 ? 55.741  50.685  16.269  1.00 23.71 ? 131  PRO A N   1 
ATOM   928  C CA  . PRO A 1 130 ? 56.243  50.937  17.624  1.00 22.76 ? 131  PRO A CA  1 
ATOM   929  C C   . PRO A 1 130 ? 55.773  50.009  18.726  1.00 21.29 ? 131  PRO A C   1 
ATOM   930  O O   . PRO A 1 130 ? 56.580  49.416  19.439  1.00 23.01 ? 131  PRO A O   1 
ATOM   931  C CB  . PRO A 1 130 ? 55.846  52.398  17.881  1.00 24.09 ? 131  PRO A CB  1 
ATOM   932  C CG  . PRO A 1 130 ? 55.814  53.001  16.478  1.00 25.52 ? 131  PRO A CG  1 
ATOM   933  C CD  . PRO A 1 130 ? 55.130  51.902  15.698  1.00 24.57 ? 131  PRO A CD  1 
ATOM   934  N N   . VAL A 1 131 ? 54.475  49.877  18.875  1.00 21.57 ? 132  VAL A N   1 
ATOM   935  C CA  . VAL A 1 131 ? 53.953  49.007  19.931  1.00 21.81 ? 132  VAL A CA  1 
ATOM   936  C C   . VAL A 1 131 ? 54.314  47.539  19.669  1.00 20.08 ? 132  VAL A C   1 
ATOM   937  O O   . VAL A 1 131 ? 54.593  46.784  20.602  1.00 20.80 ? 132  VAL A O   1 
ATOM   938  C CB  . VAL A 1 131 ? 52.430  49.151  20.053  1.00 23.55 ? 132  VAL A CB  1 
ATOM   939  C CG1 . VAL A 1 131 ? 51.896  48.118  21.078  1.00 21.92 ? 132  VAL A CG1 1 
ATOM   940  C CG2 . VAL A 1 131 ? 52.080  50.577  20.466  1.00 21.52 ? 132  VAL A CG2 1 
ATOM   941  N N   . GLY A 1 132 ? 54.301  47.130  18.404  1.00 20.42 ? 133  GLY A N   1 
ATOM   942  C CA  . GLY A 1 132 ? 54.705  45.751  18.073  1.00 19.91 ? 133  GLY A CA  1 
ATOM   943  C C   . GLY A 1 132 ? 56.167  45.481  18.447  1.00 18.92 ? 133  GLY A C   1 
ATOM   944  O O   . GLY A 1 132 ? 56.504  44.485  19.101  1.00 18.57 ? 133  GLY A O   1 
ATOM   945  N N   . MET A 1 133 ? 57.056  46.375  18.051  1.00 16.23 ? 134  MET A N   1 
ATOM   946  C CA  . MET A 1 133 ? 58.470  46.213  18.365  1.00 18.93 ? 134  MET A CA  1 
ATOM   947  C C   . MET A 1 133 ? 58.742  46.261  19.902  1.00 20.64 ? 134  MET A C   1 
ATOM   948  O O   . MET A 1 133 ? 59.490  45.425  20.436  1.00 18.85 ? 134  MET A O   1 
ATOM   949  C CB  . MET A 1 133 ? 59.316  47.288  17.649  1.00 19.63 ? 134  MET A CB  1 
ATOM   950  C CG  . MET A 1 133 ? 59.424  47.141  16.135  1.00 23.18 ? 134  MET A CG  1 
ATOM   951  S SD  . MET A 1 133 ? 60.281  48.554  15.347  1.00 26.39 ? 134  MET A SD  1 
ATOM   952  C CE  . MET A 1 133 ? 61.811  48.389  16.070  1.00 29.87 ? 134  MET A CE  1 
ATOM   953  N N   . ARG A 1 134 ? 58.146  47.215  20.624  1.00 18.99 ? 135  ARG A N   1 
ATOM   954  C CA  . ARG A 1 134 ? 58.388  47.248  22.088  1.00 19.12 ? 135  ARG A CA  1 
ATOM   955  C C   . ARG A 1 134 ? 57.749  46.009  22.743  1.00 19.34 ? 135  ARG A C   1 
ATOM   956  O O   . ARG A 1 134 ? 58.239  45.488  23.772  1.00 18.87 ? 135  ARG A O   1 
ATOM   957  C CB  . ARG A 1 134 ? 57.798  48.515  22.704  1.00 17.75 ? 135  ARG A CB  1 
ATOM   958  C CG  . ARG A 1 134 ? 58.681  49.734  22.531  1.00 21.40 ? 135  ARG A CG  1 
ATOM   959  C CD  . ARG A 1 134 ? 60.068  49.572  23.196  1.00 20.33 ? 135  ARG A CD  1 
ATOM   960  N NE  . ARG A 1 134 ? 60.656  50.857  23.564  1.00 21.32 ? 135  ARG A NE  1 
ATOM   961  C CZ  . ARG A 1 134 ? 61.520  51.537  22.822  1.00 23.36 ? 135  ARG A CZ  1 
ATOM   962  N NH1 . ARG A 1 134 ? 61.904  51.063  21.652  1.00 25.38 ? 135  ARG A NH1 1 
ATOM   963  N NH2 . ARG A 1 134 ? 62.012  52.684  23.268  1.00 22.75 ? 135  ARG A NH2 1 
ATOM   964  N N   . SER A 1 135 ? 56.660  45.520  22.161  1.00 18.92 ? 136  SER A N   1 
ATOM   965  C CA  . SER A 1 135 ? 56.044  44.326  22.753  1.00 20.47 ? 136  SER A CA  1 
ATOM   966  C C   . SER A 1 135 ? 57.024  43.155  22.614  1.00 22.16 ? 136  SER A C   1 
ATOM   967  O O   . SER A 1 135 ? 57.279  42.382  23.578  1.00 21.02 ? 136  SER A O   1 
ATOM   968  C CB  . SER A 1 135 ? 54.716  43.984  22.071  1.00 18.78 ? 136  SER A CB  1 
ATOM   969  O OG  . SER A 1 135 ? 53.694  44.883  22.513  1.00 21.55 ? 136  SER A OG  1 
ATOM   970  N N   . ALA A 1 136 ? 57.557  43.019  21.404  1.00 22.17 ? 137  ALA A N   1 
ATOM   971  C CA  . ALA A 1 136 ? 58.533  41.965  21.114  1.00 22.38 ? 137  ALA A CA  1 
ATOM   972  C C   . ALA A 1 136 ? 59.726  42.038  22.081  1.00 22.13 ? 137  ALA A C   1 
ATOM   973  O O   . ALA A 1 136 ? 60.245  41.015  22.577  1.00 20.21 ? 137  ALA A O   1 
ATOM   974  C CB  . ALA A 1 136 ? 59.026  42.125  19.685  1.00 19.98 ? 137  ALA A CB  1 
ATOM   975  N N   . ALA A 1 137 ? 60.147  43.257  22.363  1.00 21.90 ? 138  ALA A N   1 
ATOM   976  C CA  . ALA A 1 137 ? 61.293  43.482  23.209  1.00 22.91 ? 138  ALA A CA  1 
ATOM   977  C C   . ALA A 1 137 ? 61.048  43.051  24.639  1.00 23.48 ? 138  ALA A C   1 
ATOM   978  O O   . ALA A 1 137 ? 61.893  42.371  25.238  1.00 21.11 ? 138  ALA A O   1 
ATOM   979  C CB  . ALA A 1 137 ? 61.701  44.959  23.141  1.00 23.59 ? 138  ALA A CB  1 
ATOM   980  N N   . LEU A 1 138 ? 59.890  43.435  25.171  1.00 21.61 ? 139  LEU A N   1 
ATOM   981  C CA  . LEU A 1 138 ? 59.505  43.122  26.537  1.00 22.00 ? 139  LEU A CA  1 
ATOM   982  C C   . LEU A 1 138 ? 59.335  41.618  26.709  1.00 21.50 ? 139  LEU A C   1 
ATOM   983  O O   . LEU A 1 138 ? 59.772  41.036  27.721  1.00 21.24 ? 139  LEU A O   1 
ATOM   984  C CB  . LEU A 1 138 ? 58.201  43.870  26.891  1.00 19.59 ? 139  LEU A CB  1 
ATOM   985  C CG  . LEU A 1 138 ? 58.403  45.402  26.970  1.00 21.54 ? 139  LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 138 ? 57.115  46.084  27.464  1.00 18.70 ? 139  LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 138 ? 59.548  45.722  27.956  1.00 20.78 ? 139  LEU A CD2 1 
ATOM   988  N N   . LEU A 1 139 ? 58.707  40.994  25.714  1.00 22.42 ? 140  LEU A N   1 
ATOM   989  C CA  . LEU A 1 139 ? 58.478  39.535  25.703  1.00 24.81 ? 140  LEU A CA  1 
ATOM   990  C C   . LEU A 1 139 ? 59.856  38.821  25.682  1.00 25.28 ? 140  LEU A C   1 
ATOM   991  O O   . LEU A 1 139 ? 60.077  37.827  26.405  1.00 25.65 ? 140  LEU A O   1 
ATOM   992  C CB  . LEU A 1 139 ? 57.652  39.130  24.455  1.00 21.87 ? 140  LEU A CB  1 
ATOM   993  C CG  . LEU A 1 139 ? 56.146  39.478  24.529  1.00 21.24 ? 140  LEU A CG  1 
ATOM   994  C CD1 . LEU A 1 139 ? 55.467  39.442  23.152  1.00 18.71 ? 140  LEU A CD1 1 
ATOM   995  C CD2 . LEU A 1 139 ? 55.469  38.434  25.454  1.00 20.44 ? 140  LEU A CD2 1 
ATOM   996  N N   . ALA A 1 140 ? 60.760  39.322  24.848  1.00 24.62 ? 141  ALA A N   1 
ATOM   997  C CA  . ALA A 1 140 ? 62.113  38.744  24.767  1.00 27.02 ? 141  ALA A CA  1 
ATOM   998  C C   . ALA A 1 140 ? 62.829  38.956  26.125  1.00 27.29 ? 141  ALA A C   1 
ATOM   999  O O   . ALA A 1 140 ? 63.493  38.055  26.625  1.00 26.61 ? 141  ALA A O   1 
ATOM   1000 C CB  . ALA A 1 140 ? 62.885  39.384  23.650  1.00 24.51 ? 141  ALA A CB  1 
ATOM   1001 N N   . GLY A 1 141 ? 62.686  40.142  26.715  1.00 24.77 ? 142  GLY A N   1 
ATOM   1002 C CA  . GLY A 1 141 ? 63.277  40.387  28.024  1.00 27.65 ? 142  GLY A CA  1 
ATOM   1003 C C   . GLY A 1 141 ? 62.745  39.390  29.067  1.00 29.21 ? 142  GLY A C   1 
ATOM   1004 O O   . GLY A 1 141 ? 63.479  39.025  29.996  1.00 31.13 ? 142  GLY A O   1 
ATOM   1005 N N   . GLU A 1 142 ? 61.477  38.970  28.942  1.00 29.54 ? 143  GLU A N   1 
ATOM   1006 C CA  . GLU A 1 142 ? 60.861  37.991  29.852  1.00 28.34 ? 143  GLU A CA  1 
ATOM   1007 C C   . GLU A 1 142 ? 61.284  36.542  29.515  1.00 28.81 ? 143  GLU A C   1 
ATOM   1008 O O   . GLU A 1 142 ? 60.764  35.580  30.082  1.00 32.77 ? 143  GLU A O   1 
ATOM   1009 C CB  . GLU A 1 142 ? 59.322  38.094  29.832  1.00 24.90 ? 143  GLU A CB  1 
ATOM   1010 C CG  . GLU A 1 142 ? 58.745  39.334  30.562  1.00 27.88 ? 143  GLU A CG  1 
ATOM   1011 C CD  . GLU A 1 142 ? 58.675  39.181  32.096  1.00 29.65 ? 143  GLU A CD  1 
ATOM   1012 O OE1 . GLU A 1 142 ? 59.332  38.261  32.645  1.00 28.11 ? 143  GLU A OE1 1 
ATOM   1013 O OE2 . GLU A 1 142 ? 57.955  39.978  32.764  1.00 27.07 ? 143  GLU A OE2 1 
ATOM   1014 N N   . GLY A 1 143 ? 62.214  36.385  28.585  1.00 29.90 ? 144  GLY A N   1 
ATOM   1015 C CA  . GLY A 1 143 ? 62.692  35.052  28.254  1.00 31.03 ? 144  GLY A CA  1 
ATOM   1016 C C   . GLY A 1 143 ? 61.886  34.316  27.209  1.00 30.85 ? 144  GLY A C   1 
ATOM   1017 O O   . GLY A 1 143 ? 62.161  33.157  26.921  1.00 30.50 ? 144  GLY A O   1 
ATOM   1018 N N   . ALA A 1 144 ? 60.884  34.971  26.641  1.00 29.02 ? 145  ALA A N   1 
ATOM   1019 C CA  . ALA A 1 144 ? 60.087  34.299  25.624  1.00 30.97 ? 145  ALA A CA  1 
ATOM   1020 C C   . ALA A 1 144 ? 60.857  34.214  24.326  1.00 30.00 ? 145  ALA A C   1 
ATOM   1021 O O   . ALA A 1 144 ? 61.702  35.058  24.052  1.00 29.95 ? 145  ALA A O   1 
ATOM   1022 C CB  . ALA A 1 144 ? 58.778  35.043  25.398  1.00 24.98 ? 145  ALA A CB  1 
ATOM   1023 N N   . GLU A 1 145 ? 60.578  33.176  23.542  1.00 32.48 ? 146  GLU A N   1 
ATOM   1024 C CA  . GLU A 1 145 ? 61.187  32.997  22.220  1.00 33.40 ? 146  GLU A CA  1 
ATOM   1025 C C   . GLU A 1 145 ? 60.228  33.787  21.312  1.00 32.86 ? 146  GLU A C   1 
ATOM   1026 O O   . GLU A 1 145 ? 59.056  33.429  21.192  1.00 33.69 ? 146  GLU A O   1 
ATOM   1027 C CB  . GLU A 1 145 ? 61.189  31.514  21.851  1.00 38.66 ? 146  GLU A CB  1 
ATOM   1028 C CG  . GLU A 1 145 ? 61.700  31.216  20.448  1.00 49.31 ? 146  GLU A CG  1 
ATOM   1029 C CD  . GLU A 1 145 ? 61.155  29.890  19.894  1.00 54.99 ? 146  GLU A CD  1 
ATOM   1030 O OE1 . GLU A 1 145 ? 61.335  28.846  20.579  1.00 56.57 ? 146  GLU A OE1 1 
ATOM   1031 O OE2 . GLU A 1 145 ? 60.547  29.908  18.784  1.00 57.26 ? 146  GLU A OE2 1 
ATOM   1032 N N   . VAL A 1 146 ? 60.714  34.847  20.664  1.00 29.09 ? 147  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 146 ? 59.828  35.723  19.874  1.00 25.41 ? 147  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 146 ? 59.988  35.804  18.376  1.00 23.20 ? 147  VAL A C   1 
ATOM   1035 O O   . VAL A 1 146 ? 61.078  36.028  17.850  1.00 24.10 ? 147  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 146 ? 59.930  37.224  20.395  1.00 25.30 ? 147  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 146 ? 58.861  38.124  19.714  1.00 22.83 ? 147  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 146 ? 59.776  37.254  21.929  1.00 24.03 ? 147  VAL A CG2 1 
ATOM   1039 N N   . VAL A 1 147 ? 58.871  35.689  17.683  1.00 25.92 ? 148  VAL A N   1 
ATOM   1040 C CA  . VAL A 1 147 ? 58.896  35.827  16.236  1.00 25.52 ? 148  VAL A CA  1 
ATOM   1041 C C   . VAL A 1 147 ? 58.153  37.115  15.885  1.00 24.09 ? 148  VAL A C   1 
ATOM   1042 O O   . VAL A 1 147 ? 56.957  37.236  16.163  1.00 25.63 ? 148  VAL A O   1 
ATOM   1043 C CB  . VAL A 1 147 ? 58.211  34.666  15.525  1.00 26.78 ? 148  VAL A CB  1 
ATOM   1044 C CG1 . VAL A 1 147 ? 58.351  34.876  13.994  1.00 28.82 ? 148  VAL A CG1 1 
ATOM   1045 C CG2 . VAL A 1 147 ? 58.868  33.314  15.939  1.00 30.69 ? 148  VAL A CG2 1 
ATOM   1046 N N   . LEU A 1 148 ? 58.873  38.082  15.328  1.00 24.87 ? 149  LEU A N   1 
ATOM   1047 C CA  . LEU A 1 148 ? 58.280  39.368  14.929  1.00 26.05 ? 149  LEU A CA  1 
ATOM   1048 C C   . LEU A 1 148 ? 57.954  39.265  13.431  1.00 25.39 ? 149  LEU A C   1 
ATOM   1049 O O   . LEU A 1 148 ? 58.857  39.087  12.592  1.00 24.25 ? 149  LEU A O   1 
ATOM   1050 C CB  . LEU A 1 148 ? 59.270  40.511  15.189  1.00 25.13 ? 149  LEU A CB  1 
ATOM   1051 C CG  . LEU A 1 148 ? 58.735  41.943  15.016  1.00 28.02 ? 149  LEU A CG  1 
ATOM   1052 C CD1 . LEU A 1 148 ? 59.694  42.923  15.649  1.00 26.81 ? 149  LEU A CD1 1 
ATOM   1053 C CD2 . LEU A 1 148 ? 58.547  42.305  13.538  1.00 22.54 ? 149  LEU A CD2 1 
ATOM   1054 N N   . CYS A 1 149 ? 56.661  39.360  13.111  1.00 26.87 ? 150  CYS A N   1 
ATOM   1055 C CA  . CYS A 1 149 ? 56.169  39.252  11.728  1.00 27.26 ? 150  CYS A CA  1 
ATOM   1056 C C   . CYS A 1 149 ? 55.861  40.551  11.002  1.00 27.37 ? 150  CYS A C   1 
ATOM   1057 O O   . CYS A 1 149 ? 55.371  41.518  11.595  1.00 26.42 ? 150  CYS A O   1 
ATOM   1058 C CB  . CYS A 1 149 ? 54.901  38.388  11.681  1.00 25.76 ? 150  CYS A CB  1 
ATOM   1059 S SG  . CYS A 1 149 ? 55.109  36.741  12.340  1.00 30.71 ? 150  CYS A SG  1 
ATOM   1060 N N   . GLY A 1 150 ? 56.133  40.543  9.697   1.00 27.83 ? 151  GLY A N   1 
ATOM   1061 C CA  . GLY A 1 150 ? 55.845  41.688  8.861   1.00 27.04 ? 151  GLY A CA  1 
ATOM   1062 C C   . GLY A 1 150 ? 55.495  41.250  7.442   1.00 28.70 ? 151  GLY A C   1 
ATOM   1063 O O   . GLY A 1 150 ? 55.855  40.160  6.997   1.00 25.98 ? 151  GLY A O   1 
ATOM   1064 N N   . ARG A 1 151 ? 54.799  42.113  6.719   1.00 29.97 ? 152  ARG A N   1 
ATOM   1065 C CA  . ARG A 1 151 ? 54.412  41.816  5.346   1.00 31.77 ? 152  ARG A CA  1 
ATOM   1066 C C   . ARG A 1 151 ? 55.619  41.499  4.461   1.00 33.08 ? 152  ARG A C   1 
ATOM   1067 O O   . ARG A 1 151 ? 55.543  40.644  3.573   1.00 32.78 ? 152  ARG A O   1 
ATOM   1068 C CB  . ARG A 1 151 ? 53.651  42.995  4.773   1.00 34.28 ? 152  ARG A CB  1 
ATOM   1069 C CG  . ARG A 1 151 ? 52.896  42.623  3.521   1.00 40.01 ? 152  ARG A CG  1 
ATOM   1070 C CD  . ARG A 1 151 ? 52.476  43.851  2.770   1.00 41.57 ? 152  ARG A CD  1 
ATOM   1071 N NE  . ARG A 1 151 ? 52.051  43.494  1.425   1.00 44.76 ? 152  ARG A NE  1 
ATOM   1072 C CZ  . ARG A 1 151 ? 51.907  44.380  0.450   1.00 46.86 ? 152  ARG A CZ  1 
ATOM   1073 N NH1 . ARG A 1 151 ? 52.165  45.663  0.697   1.00 48.41 ? 152  ARG A NH1 1 
ATOM   1074 N NH2 . ARG A 1 151 ? 51.486  43.993  -0.753  1.00 45.72 ? 152  ARG A NH2 1 
ATOM   1075 N N   . LYS A 1 152 ? 56.723  42.204  4.684   1.00 33.35 ? 153  LYS A N   1 
ATOM   1076 C CA  . LYS A 1 152 ? 57.940  41.960  3.934   1.00 35.94 ? 153  LYS A CA  1 
ATOM   1077 C C   . LYS A 1 152 ? 59.036  41.634  4.918   1.00 37.83 ? 153  LYS A C   1 
ATOM   1078 O O   . LYS A 1 152 ? 59.195  42.295  5.964   1.00 36.10 ? 153  LYS A O   1 
ATOM   1079 C CB  . LYS A 1 152 ? 58.303  43.162  3.076   1.00 39.81 ? 153  LYS A CB  1 
ATOM   1080 C CG  . LYS A 1 152 ? 57.322  43.337  1.901   1.00 46.68 ? 153  LYS A CG  1 
ATOM   1081 C CD  . LYS A 1 152 ? 57.402  44.720  1.246   1.00 51.10 ? 153  LYS A CD  1 
ATOM   1082 C CE  . LYS A 1 152 ? 56.124  45.024  0.397   1.00 55.08 ? 153  LYS A CE  1 
ATOM   1083 N NZ  . LYS A 1 152 ? 56.073  46.428  -0.183  1.00 55.27 ? 153  LYS A NZ  1 
ATOM   1084 N N   . LEU A 1 153 ? 59.784  40.595  4.574   1.00 35.72 ? 154  LEU A N   1 
ATOM   1085 C CA  . LEU A 1 153 ? 60.861  40.102  5.406   1.00 37.85 ? 154  LEU A CA  1 
ATOM   1086 C C   . LEU A 1 153 ? 61.933  41.121  5.795   1.00 37.65 ? 154  LEU A C   1 
ATOM   1087 O O   . LEU A 1 153 ? 62.392  41.134  6.947   1.00 37.47 ? 154  LEU A O   1 
ATOM   1088 C CB  . LEU A 1 153 ? 61.524  38.927  4.709   1.00 38.34 ? 154  LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 153 ? 62.688  38.329  5.482   1.00 35.66 ? 154  LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 153 ? 62.153  37.674  6.762   1.00 34.58 ? 154  LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 153 ? 63.403  37.302  4.598   1.00 35.58 ? 154  LEU A CD2 1 
ATOM   1092 N N   . ASP A 1 154 ? 62.337  41.973  4.858   1.00 36.68 ? 155  ASP A N   1 
ATOM   1093 C CA  . ASP A 1 154 ? 63.372  42.944  5.188   1.00 39.56 ? 155  ASP A CA  1 
ATOM   1094 C C   . ASP A 1 154 ? 62.912  43.926  6.262   1.00 37.53 ? 155  ASP A C   1 
ATOM   1095 O O   . ASP A 1 154 ? 63.702  44.293  7.136   1.00 35.49 ? 155  ASP A O   1 
ATOM   1096 C CB  . ASP A 1 154 ? 63.862  43.692  3.934   1.00 42.45 ? 155  ASP A CB  1 
ATOM   1097 C CG  . ASP A 1 154 ? 62.745  44.368  3.180   1.00 47.56 ? 155  ASP A CG  1 
ATOM   1098 O OD1 . ASP A 1 154 ? 63.003  45.439  2.579   1.00 51.23 ? 155  ASP A OD1 1 
ATOM   1099 O OD2 . ASP A 1 154 ? 61.612  43.836  3.170   1.00 49.29 ? 155  ASP A OD2 1 
ATOM   1100 N N   . LYS A 1 155 ? 61.638  44.327  6.214   1.00 36.03 ? 156  LYS A N   1 
ATOM   1101 C CA  . LYS A 1 155 ? 61.091  45.261  7.203   1.00 35.15 ? 156  LYS A CA  1 
ATOM   1102 C C   . LYS A 1 155 ? 60.976  44.593  8.566   1.00 33.47 ? 156  LYS A C   1 
ATOM   1103 O O   . LYS A 1 155 ? 61.212  45.225  9.602   1.00 30.41 ? 156  LYS A O   1 
ATOM   1104 C CB  . LYS A 1 155 ? 59.695  45.757  6.812   1.00 36.30 ? 156  LYS A CB  1 
ATOM   1105 C CG  . LYS A 1 155 ? 59.618  46.489  5.475   1.00 40.80 ? 156  LYS A CG  1 
ATOM   1106 C CD  . LYS A 1 155 ? 60.725  47.520  5.347   1.00 44.82 ? 156  LYS A CD  1 
ATOM   1107 C CE  . LYS A 1 155 ? 60.592  48.334  4.059   1.00 45.39 ? 156  LYS A CE  1 
ATOM   1108 N NZ  . LYS A 1 155 ? 59.398  49.235  4.132   1.00 49.89 ? 156  LYS A NZ  1 
ATOM   1109 N N   . ALA A 1 156 ? 60.593  43.322  8.554   1.00 30.64 ? 157  ALA A N   1 
ATOM   1110 C CA  . ALA A 1 156 ? 60.443  42.553  9.791   1.00 30.18 ? 157  ALA A CA  1 
ATOM   1111 C C   . ALA A 1 156 ? 61.825  42.376  10.377  1.00 29.63 ? 157  ALA A C   1 
ATOM   1112 O O   . ALA A 1 156 ? 62.025  42.497  11.600  1.00 28.78 ? 157  ALA A O   1 
ATOM   1113 C CB  . ALA A 1 156 ? 59.807  41.171  9.504   1.00 27.42 ? 157  ALA A CB  1 
ATOM   1114 N N   . GLN A 1 157 ? 62.792  42.068  9.513   1.00 28.34 ? 158  GLN A N   1 
ATOM   1115 C CA  . GLN A 1 157 ? 64.152  41.894  10.005  1.00 28.09 ? 158  GLN A CA  1 
ATOM   1116 C C   . GLN A 1 157 ? 64.744  43.217  10.512  1.00 25.05 ? 158  GLN A C   1 
ATOM   1117 O O   . GLN A 1 157 ? 65.427  43.249  11.526  1.00 25.06 ? 158  GLN A O   1 
ATOM   1118 C CB  . GLN A 1 157 ? 65.047  41.297  8.911   1.00 30.36 ? 158  GLN A CB  1 
ATOM   1119 C CG  . GLN A 1 157 ? 66.437  40.970  9.387   1.00 29.49 ? 158  GLN A CG  1 
ATOM   1120 C CD  . GLN A 1 157 ? 66.450  39.903  10.461  1.00 32.37 ? 158  GLN A CD  1 
ATOM   1121 O OE1 . GLN A 1 157 ? 65.959  38.781  10.258  1.00 33.86 ? 158  GLN A OE1 1 
ATOM   1122 N NE2 . GLN A 1 157 ? 67.016  40.247  11.629  1.00 32.90 ? 158  GLN A NE2 1 
ATOM   1123 N N   . ALA A 1 158 ? 64.493  44.313  9.819   1.00 25.59 ? 159  ALA A N   1 
ATOM   1124 C CA  . ALA A 1 158 ? 65.011  45.612  10.278  1.00 24.64 ? 159  ALA A CA  1 
ATOM   1125 C C   . ALA A 1 158 ? 64.399  45.913  11.666  1.00 24.36 ? 159  ALA A C   1 
ATOM   1126 O O   . ALA A 1 158 ? 65.050  46.440  12.570  1.00 25.01 ? 159  ALA A O   1 
ATOM   1127 C CB  . ALA A 1 158 ? 64.614  46.697  9.277   1.00 23.41 ? 159  ALA A CB  1 
ATOM   1128 N N   . ALA A 1 159 ? 63.122  45.574  11.829  1.00 26.10 ? 160  ALA A N   1 
ATOM   1129 C CA  . ALA A 1 159 ? 62.439  45.799  13.101  1.00 24.15 ? 160  ALA A CA  1 
ATOM   1130 C C   . ALA A 1 159 ? 63.106  44.930  14.186  1.00 25.11 ? 160  ALA A C   1 
ATOM   1131 O O   . ALA A 1 159 ? 63.421  45.404  15.287  1.00 22.97 ? 160  ALA A O   1 
ATOM   1132 C CB  . ALA A 1 159 ? 60.946  45.445  12.955  1.00 25.81 ? 160  ALA A CB  1 
ATOM   1133 N N   . ALA A 1 160 ? 63.338  43.655  13.882  1.00 24.02 ? 161  ALA A N   1 
ATOM   1134 C CA  . ALA A 1 160 ? 63.983  42.770  14.862  1.00 25.19 ? 161  ALA A CA  1 
ATOM   1135 C C   . ALA A 1 160 ? 65.400  43.240  15.198  1.00 26.41 ? 161  ALA A C   1 
ATOM   1136 O O   . ALA A 1 160 ? 65.825  43.182  16.377  1.00 26.21 ? 161  ALA A O   1 
ATOM   1137 C CB  . ALA A 1 160 ? 64.009  41.317  14.356  1.00 25.76 ? 161  ALA A CB  1 
ATOM   1138 N N   . ASP A 1 161 ? 66.126  43.720  14.184  1.00 25.61 ? 162  ASP A N   1 
ATOM   1139 C CA  . ASP A 1 161 ? 67.490  44.206  14.379  1.00 27.84 ? 162  ASP A CA  1 
ATOM   1140 C C   . ASP A 1 161 ? 67.511  45.371  15.363  1.00 27.54 ? 162  ASP A C   1 
ATOM   1141 O O   . ASP A 1 161 ? 68.388  45.462  16.228  1.00 27.10 ? 162  ASP A O   1 
ATOM   1142 C CB  . ASP A 1 161 ? 68.081  44.671  13.047  1.00 28.80 ? 162  ASP A CB  1 
ATOM   1143 C CG  . ASP A 1 161 ? 68.488  43.495  12.140  1.00 31.72 ? 162  ASP A CG  1 
ATOM   1144 O OD1 . ASP A 1 161 ? 68.619  43.725  10.930  1.00 30.31 ? 162  ASP A OD1 1 
ATOM   1145 O OD2 . ASP A 1 161 ? 68.685  42.358  12.643  1.00 32.29 ? 162  ASP A OD2 1 
ATOM   1146 N N   . SER A 1 162 ? 66.535  46.265  15.202  1.00 28.34 ? 163  SER A N   1 
ATOM   1147 C CA  . SER A 1 162 ? 66.426  47.437  16.034  1.00 24.60 ? 163  SER A CA  1 
ATOM   1148 C C   . SER A 1 162 ? 66.195  47.006  17.475  1.00 24.59 ? 163  SER A C   1 
ATOM   1149 O O   . SER A 1 162 ? 66.890  47.455  18.397  1.00 24.04 ? 163  SER A O   1 
ATOM   1150 C CB  . SER A 1 162 ? 65.268  48.300  15.527  1.00 27.27 ? 163  SER A CB  1 
ATOM   1151 O OG  . SER A 1 162 ? 65.040  49.365  16.422  1.00 29.33 ? 163  SER A OG  1 
ATOM   1152 N N   . VAL A 1 163 ? 65.223  46.126  17.662  1.00 21.45 ? 164  VAL A N   1 
ATOM   1153 C CA  . VAL A 1 163 ? 64.886  45.593  18.965  1.00 23.04 ? 164  VAL A CA  1 
ATOM   1154 C C   . VAL A 1 163 ? 66.086  44.872  19.606  1.00 23.48 ? 164  VAL A C   1 
ATOM   1155 O O   . VAL A 1 163 ? 66.455  45.111  20.773  1.00 21.16 ? 164  VAL A O   1 
ATOM   1156 C CB  . VAL A 1 163 ? 63.700  44.618  18.804  1.00 22.19 ? 164  VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 163 ? 63.520  43.757  20.048  1.00 22.43 ? 164  VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 163 ? 62.427  45.433  18.489  1.00 24.60 ? 164  VAL A CG2 1 
ATOM   1159 N N   . ASN A 1 164 ? 66.701  43.987  18.837  1.00 23.71 ? 165  ASN A N   1 
ATOM   1160 C CA  . ASN A 1 164 ? 67.841  43.230  19.345  1.00 25.65 ? 165  ASN A CA  1 
ATOM   1161 C C   . ASN A 1 164 ? 69.013  44.098  19.795  1.00 24.15 ? 165  ASN A C   1 
ATOM   1162 O O   . ASN A 1 164 ? 69.638  43.813  20.805  1.00 26.77 ? 165  ASN A O   1 
ATOM   1163 C CB  . ASN A 1 164 ? 68.291  42.164  18.312  1.00 23.16 ? 165  ASN A CB  1 
ATOM   1164 C CG  . ASN A 1 164 ? 67.241  41.067  18.125  1.00 25.60 ? 165  ASN A CG  1 
ATOM   1165 O OD1 . ASN A 1 164 ? 66.329  40.926  18.952  1.00 25.58 ? 165  ASN A OD1 1 
ATOM   1166 N ND2 . ASN A 1 164 ? 67.356  40.283  17.043  1.00 26.91 ? 165  ASN A ND2 1 
ATOM   1167 N N   . LYS A 1 165 ? 69.287  45.169  19.079  1.00 24.55 ? 166  LYS A N   1 
ATOM   1168 C CA  . LYS A 1 165 ? 70.411  46.036  19.434  1.00 25.66 ? 166  LYS A CA  1 
ATOM   1169 C C   . LYS A 1 165 ? 70.087  46.872  20.678  1.00 27.02 ? 166  LYS A C   1 
ATOM   1170 O O   . LYS A 1 165 ? 70.885  46.982  21.617  1.00 24.65 ? 166  LYS A O   1 
ATOM   1171 C CB  . LYS A 1 165 ? 70.730  46.969  18.258  1.00 26.27 ? 166  LYS A CB  1 
ATOM   1172 C CG  . LYS A 1 165 ? 71.819  48.001  18.566  1.00 28.77 ? 166  LYS A CG  1 
ATOM   1173 C CD  . LYS A 1 165 ? 72.152  48.836  17.374  1.00 27.38 ? 166  LYS A CD  1 
ATOM   1174 C CE  . LYS A 1 165 ? 73.148  49.936  17.795  1.00 28.16 ? 166  LYS A CE  1 
ATOM   1175 N NZ  . LYS A 1 165 ? 73.878  50.492  16.632  1.00 28.29 ? 166  LYS A NZ  1 
ATOM   1176 N N   . ARG A 1 166 ? 68.888  47.441  20.690  1.00 24.45 ? 167  ARG A N   1 
ATOM   1177 C CA  . ARG A 1 166 ? 68.466  48.297  21.791  1.00 22.59 ? 167  ARG A CA  1 
ATOM   1178 C C   . ARG A 1 166 ? 68.303  47.528  23.078  1.00 23.14 ? 167  ARG A C   1 
ATOM   1179 O O   . ARG A 1 166 ? 68.677  48.022  24.143  1.00 23.26 ? 167  ARG A O   1 
ATOM   1180 C CB  . ARG A 1 166 ? 67.127  48.993  21.436  1.00 20.47 ? 167  ARG A CB  1 
ATOM   1181 C CG  . ARG A 1 166 ? 66.421  49.639  22.644  1.00 20.82 ? 167  ARG A CG  1 
ATOM   1182 C CD  . ARG A 1 166 ? 67.253  50.785  23.311  1.00 24.07 ? 167  ARG A CD  1 
ATOM   1183 N NE  . ARG A 1 166 ? 66.482  51.427  24.393  1.00 24.48 ? 167  ARG A NE  1 
ATOM   1184 C CZ  . ARG A 1 166 ? 66.312  50.887  25.599  1.00 27.97 ? 167  ARG A CZ  1 
ATOM   1185 N NH1 . ARG A 1 166 ? 66.873  49.710  25.885  1.00 23.81 ? 167  ARG A NH1 1 
ATOM   1186 N NH2 . ARG A 1 166 ? 65.551  51.490  26.508  1.00 26.42 ? 167  ARG A NH2 1 
ATOM   1187 N N   . PHE A 1 167 ? 67.757  46.325  22.977  1.00 22.62 ? 168  PHE A N   1 
ATOM   1188 C CA  . PHE A 1 167 ? 67.485  45.524  24.148  1.00 26.61 ? 168  PHE A CA  1 
ATOM   1189 C C   . PHE A 1 167 ? 68.379  44.307  24.441  1.00 27.06 ? 168  PHE A C   1 
ATOM   1190 O O   . PHE A 1 167 ? 68.186  43.632  25.459  1.00 28.96 ? 168  PHE A O   1 
ATOM   1191 C CB  . PHE A 1 167 ? 66.019  45.112  24.124  1.00 25.65 ? 168  PHE A CB  1 
ATOM   1192 C CG  . PHE A 1 167 ? 65.074  46.289  24.206  1.00 25.01 ? 168  PHE A CG  1 
ATOM   1193 C CD1 . PHE A 1 167 ? 64.459  46.784  23.067  1.00 23.31 ? 168  PHE A CD1 1 
ATOM   1194 C CD2 . PHE A 1 167 ? 64.858  46.931  25.426  1.00 23.46 ? 168  PHE A CD2 1 
ATOM   1195 C CE1 . PHE A 1 167 ? 63.635  47.914  23.128  1.00 24.20 ? 168  PHE A CE1 1 
ATOM   1196 C CE2 . PHE A 1 167 ? 64.032  48.065  25.502  1.00 22.91 ? 168  PHE A CE2 1 
ATOM   1197 C CZ  . PHE A 1 167 ? 63.423  48.552  24.340  1.00 23.84 ? 168  PHE A CZ  1 
ATOM   1198 N N   . LYS A 1 168 ? 69.358  44.048  23.578  1.00 26.87 ? 169  LYS A N   1 
ATOM   1199 C CA  . LYS A 1 168 ? 70.285  42.928  23.802  1.00 28.74 ? 169  LYS A CA  1 
ATOM   1200 C C   . LYS A 1 168 ? 69.558  41.587  23.871  1.00 27.95 ? 169  LYS A C   1 
ATOM   1201 O O   . LYS A 1 168 ? 69.758  40.800  24.815  1.00 29.10 ? 169  LYS A O   1 
ATOM   1202 C CB  . LYS A 1 168 ? 71.035  43.145  25.117  1.00 29.17 ? 169  LYS A CB  1 
ATOM   1203 C CG  . LYS A 1 168 ? 71.901  44.371  25.133  1.00 32.79 ? 169  LYS A CG  1 
ATOM   1204 C CD  . LYS A 1 168 ? 72.602  44.472  26.473  1.00 39.52 ? 169  LYS A CD  1 
ATOM   1205 C CE  . LYS A 1 168 ? 73.005  45.894  26.792  1.00 43.00 ? 169  LYS A CE  1 
ATOM   1206 N NZ  . LYS A 1 168 ? 73.141  45.996  28.294  1.00 47.41 ? 169  LYS A NZ  1 
ATOM   1207 N N   . VAL A 1 169 ? 68.693  41.341  22.895  1.00 27.68 ? 170  VAL A N   1 
ATOM   1208 C CA  . VAL A 1 169 ? 67.929  40.091  22.854  1.00 25.66 ? 170  VAL A CA  1 
ATOM   1209 C C   . VAL A 1 169 ? 68.046  39.486  21.466  1.00 25.96 ? 170  VAL A C   1 
ATOM   1210 O O   . VAL A 1 169 ? 68.787  39.976  20.597  1.00 25.89 ? 170  VAL A O   1 
ATOM   1211 C CB  . VAL A 1 169 ? 66.414  40.316  23.200  1.00 25.68 ? 170  VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 169 ? 66.244  40.563  24.697  1.00 24.01 ? 170  VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 169 ? 65.869  41.523  22.409  1.00 21.30 ? 170  VAL A CG2 1 
ATOM   1214 N N   . ASN A 1 170 ? 67.331  38.402  21.252  1.00 25.29 ? 171  ASN A N   1 
ATOM   1215 C CA  . ASN A 1 170 ? 67.414  37.790  19.953  1.00 28.89 ? 171  ASN A CA  1 
ATOM   1216 C C   . ASN A 1 170 ? 66.054  37.390  19.405  1.00 28.51 ? 171  ASN A C   1 
ATOM   1217 O O   . ASN A 1 170 ? 65.691  36.209  19.349  1.00 29.03 ? 171  ASN A O   1 
ATOM   1218 C CB  . ASN A 1 170 ? 68.379  36.588  19.972  1.00 32.02 ? 171  ASN A CB  1 
ATOM   1219 C CG  . ASN A 1 170 ? 68.548  35.985  18.581  1.00 37.92 ? 171  ASN A CG  1 
ATOM   1220 O OD1 . ASN A 1 170 ? 68.137  34.850  18.329  1.00 42.57 ? 171  ASN A OD1 1 
ATOM   1221 N ND2 . ASN A 1 170 ? 69.124  36.756  17.666  1.00 38.25 ? 171  ASN A ND2 1 
ATOM   1222 N N   . VAL A 1 171 ? 65.297  38.419  19.037  1.00 26.24 ? 172  VAL A N   1 
ATOM   1223 C CA  . VAL A 1 171 ? 63.979  38.270  18.440  1.00 27.22 ? 172  VAL A CA  1 
ATOM   1224 C C   . VAL A 1 171 ? 64.258  37.859  16.993  1.00 25.92 ? 172  VAL A C   1 
ATOM   1225 O O   . VAL A 1 171 ? 65.191  38.387  16.371  1.00 27.34 ? 172  VAL A O   1 
ATOM   1226 C CB  . VAL A 1 171 ? 63.244  39.628  18.405  1.00 27.49 ? 172  VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 171 ? 62.122  39.581  17.415  1.00 29.26 ? 172  VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 171 ? 62.751  39.967  19.794  1.00 26.79 ? 172  VAL A CG2 1 
ATOM   1229 N N   . THR A 1 172 ? 63.452  36.935  16.478  1.00 24.88 ? 173  THR A N   1 
ATOM   1230 C CA  . THR A 1 172 ? 63.558  36.458  15.088  1.00 28.94 ? 173  THR A CA  1 
ATOM   1231 C C   . THR A 1 172 ? 62.488  37.109  14.201  1.00 27.79 ? 173  THR A C   1 
ATOM   1232 O O   . THR A 1 172 ? 61.389  37.396  14.671  1.00 28.90 ? 173  THR A O   1 
ATOM   1233 C CB  . THR A 1 172 ? 63.350  34.920  15.047  1.00 30.95 ? 173  THR A CB  1 
ATOM   1234 O OG1 . THR A 1 172 ? 64.557  34.299  15.514  1.00 37.87 ? 173  THR A OG1 1 
ATOM   1235 C CG2 . THR A 1 172 ? 63.010  34.440  13.627  1.00 37.47 ? 173  THR A CG2 1 
ATOM   1236 N N   . ALA A 1 173 ? 62.784  37.284  12.916  1.00 26.64 ? 174  ALA A N   1 
ATOM   1237 C CA  . ALA A 1 173 ? 61.849  37.914  11.991  1.00 28.04 ? 174  ALA A CA  1 
ATOM   1238 C C   . ALA A 1 173 ? 61.227  36.886  11.047  1.00 30.06 ? 174  ALA A C   1 
ATOM   1239 O O   . ALA A 1 173 ? 61.816  35.828  10.795  1.00 28.85 ? 174  ALA A O   1 
ATOM   1240 C CB  . ALA A 1 173 ? 62.585  38.972  11.171  1.00 26.83 ? 174  ALA A CB  1 
ATOM   1241 N N   . ALA A 1 174 ? 60.039  37.192  10.545  1.00 29.83 ? 175  ALA A N   1 
ATOM   1242 C CA  . ALA A 1 174 ? 59.381  36.315  9.572   1.00 31.01 ? 175  ALA A CA  1 
ATOM   1243 C C   . ALA A 1 174 ? 58.503  37.139  8.664   1.00 31.53 ? 175  ALA A C   1 
ATOM   1244 O O   . ALA A 1 174 ? 57.908  38.156  9.081   1.00 31.41 ? 175  ALA A O   1 
ATOM   1245 C CB  . ALA A 1 174 ? 58.531  35.250  10.273  1.00 30.81 ? 175  ALA A CB  1 
ATOM   1246 N N   . GLU A 1 175 ? 58.431  36.718  7.407   1.00 32.78 ? 176  GLU A N   1 
ATOM   1247 C CA  . GLU A 1 175 ? 57.559  37.377  6.462   1.00 33.48 ? 176  GLU A CA  1 
ATOM   1248 C C   . GLU A 1 175 ? 56.212  36.628  6.518   1.00 33.19 ? 176  GLU A C   1 
ATOM   1249 O O   . GLU A 1 175 ? 56.175  35.408  6.556   1.00 32.30 ? 176  GLU A O   1 
ATOM   1250 C CB  . GLU A 1 175 ? 58.123  37.299  5.041   1.00 36.91 ? 176  GLU A CB  1 
ATOM   1251 C CG  . GLU A 1 175 ? 57.223  38.004  4.039   1.00 38.26 ? 176  GLU A CG  1 
ATOM   1252 C CD  . GLU A 1 175 ? 57.876  38.207  2.684   1.00 41.87 ? 176  GLU A CD  1 
ATOM   1253 O OE1 . GLU A 1 175 ? 58.915  38.907  2.616   1.00 38.73 ? 176  GLU A OE1 1 
ATOM   1254 O OE2 . GLU A 1 175 ? 57.335  37.676  1.682   1.00 43.73 ? 176  GLU A OE2 1 
ATOM   1255 N N   . THR A 1 176 ? 55.116  37.375  6.572   1.00 32.17 ? 177  THR A N   1 
ATOM   1256 C CA  . THR A 1 176 ? 53.774  36.808  6.572   1.00 31.71 ? 177  THR A CA  1 
ATOM   1257 C C   . THR A 1 176 ? 53.069  37.767  5.616   1.00 32.25 ? 177  THR A C   1 
ATOM   1258 O O   . THR A 1 176 ? 52.461  38.740  6.055   1.00 29.24 ? 177  THR A O   1 
ATOM   1259 C CB  . THR A 1 176 ? 53.072  36.881  7.986   1.00 31.69 ? 177  THR A CB  1 
ATOM   1260 O OG1 . THR A 1 176 ? 53.190  38.212  8.521   1.00 29.61 ? 177  THR A OG1 1 
ATOM   1261 C CG2 . THR A 1 176 ? 53.679  35.873  8.972   1.00 31.16 ? 177  THR A CG2 1 
ATOM   1262 N N   . ALA A 1 177 ? 53.140  37.491  4.311   1.00 35.35 ? 178  ALA A N   1 
ATOM   1263 C CA  . ALA A 1 177 ? 52.545  38.409  3.331   1.00 36.37 ? 178  ALA A CA  1 
ATOM   1264 C C   . ALA A 1 177 ? 51.020  38.406  3.213   1.00 37.79 ? 178  ALA A C   1 
ATOM   1265 O O   . ALA A 1 177 ? 50.435  39.389  2.745   1.00 38.48 ? 178  ALA A O   1 
ATOM   1266 C CB  . ALA A 1 177 ? 53.184  38.198  1.942   1.00 41.35 ? 178  ALA A CB  1 
ATOM   1267 N N   . ASP A 1 178 ? 50.377  37.329  3.655   1.00 36.55 ? 179  ASP A N   1 
ATOM   1268 C CA  . ASP A 1 178 ? 48.921  37.241  3.587   1.00 37.58 ? 179  ASP A CA  1 
ATOM   1269 C C   . ASP A 1 178 ? 48.288  36.549  4.782   1.00 37.02 ? 179  ASP A C   1 
ATOM   1270 O O   . ASP A 1 178 ? 48.975  36.038  5.663   1.00 35.99 ? 179  ASP A O   1 
ATOM   1271 C CB  . ASP A 1 178 ? 48.475  36.512  2.302   1.00 38.31 ? 179  ASP A CB  1 
ATOM   1272 C CG  . ASP A 1 178 ? 49.042  35.108  2.185   1.00 39.02 ? 179  ASP A CG  1 
ATOM   1273 O OD1 . ASP A 1 178 ? 49.586  34.560  3.177   1.00 36.98 ? 179  ASP A OD1 1 
ATOM   1274 O OD2 . ASP A 1 178 ? 48.924  34.540  1.075   1.00 41.05 ? 179  ASP A OD2 1 
ATOM   1275 N N   . ASP A 1 179 ? 46.962  36.523  4.792   1.00 37.50 ? 180  ASP A N   1 
ATOM   1276 C CA  . ASP A 1 179 ? 46.219  35.894  5.875   1.00 38.80 ? 180  ASP A CA  1 
ATOM   1277 C C   . ASP A 1 179 ? 46.662  34.437  6.078   1.00 37.77 ? 180  ASP A C   1 
ATOM   1278 O O   . ASP A 1 179 ? 46.818  33.974  7.218   1.00 37.37 ? 180  ASP A O   1 
ATOM   1279 C CB  . ASP A 1 179 ? 44.701  35.967  5.603   1.00 40.12 ? 180  ASP A CB  1 
ATOM   1280 C CG  . ASP A 1 179 ? 44.315  35.455  4.195   1.00 46.11 ? 180  ASP A CG  1 
ATOM   1281 O OD1 . ASP A 1 179 ? 45.071  34.646  3.591   1.00 46.28 ? 180  ASP A OD1 1 
ATOM   1282 O OD2 . ASP A 1 179 ? 43.237  35.860  3.691   1.00 46.97 ? 180  ASP A OD2 1 
ATOM   1283 N N   . ALA A 1 180 ? 46.875  33.708  4.982   1.00 34.66 ? 181  ALA A N   1 
ATOM   1284 C CA  . ALA A 1 180 ? 47.309  32.321  5.120   1.00 33.34 ? 181  ALA A CA  1 
ATOM   1285 C C   . ALA A 1 180 ? 48.642  32.215  5.890   1.00 33.28 ? 181  ALA A C   1 
ATOM   1286 O O   . ALA A 1 180 ? 48.794  31.371  6.790   1.00 30.78 ? 181  ALA A O   1 
ATOM   1287 C CB  . ALA A 1 180 ? 47.435  31.662  3.719   1.00 35.26 ? 181  ALA A CB  1 
ATOM   1288 N N   . SER A 1 181 ? 49.607  33.069  5.542   1.00 32.58 ? 182  SER A N   1 
ATOM   1289 C CA  . SER A 1 181 ? 50.910  33.030  6.205   1.00 32.05 ? 182  SER A CA  1 
ATOM   1290 C C   . SER A 1 181 ? 50.809  33.449  7.679   1.00 31.26 ? 182  SER A C   1 
ATOM   1291 O O   . SER A 1 181 ? 51.530  32.908  8.527   1.00 28.18 ? 182  SER A O   1 
ATOM   1292 C CB  . SER A 1 181 ? 51.930  33.908  5.475   1.00 31.95 ? 182  SER A CB  1 
ATOM   1293 O OG  . SER A 1 181 ? 51.461  35.243  5.369   1.00 37.27 ? 182  SER A OG  1 
ATOM   1294 N N   . ARG A 1 182 ? 49.913  34.390  7.991   1.00 29.87 ? 183  ARG A N   1 
ATOM   1295 C CA  . ARG A 1 182 ? 49.747  34.810  9.393   1.00 29.83 ? 183  ARG A CA  1 
ATOM   1296 C C   . ARG A 1 182 ? 49.175  33.621  10.189  1.00 30.55 ? 183  ARG A C   1 
ATOM   1297 O O   . ARG A 1 182 ? 49.631  33.315  11.295  1.00 31.95 ? 183  ARG A O   1 
ATOM   1298 C CB  . ARG A 1 182 ? 48.807  36.031  9.496   1.00 27.94 ? 183  ARG A CB  1 
ATOM   1299 C CG  . ARG A 1 182 ? 49.416  37.329  8.923   1.00 25.87 ? 183  ARG A CG  1 
ATOM   1300 C CD  . ARG A 1 182 ? 48.564  38.601  9.293   1.00 25.19 ? 183  ARG A CD  1 
ATOM   1301 N NE  . ARG A 1 182 ? 47.192  38.547  8.799   1.00 22.49 ? 183  ARG A NE  1 
ATOM   1302 C CZ  . ARG A 1 182 ? 46.763  38.975  7.596   1.00 28.30 ? 183  ARG A CZ  1 
ATOM   1303 N NH1 . ARG A 1 182 ? 47.598  39.513  6.715   1.00 26.22 ? 183  ARG A NH1 1 
ATOM   1304 N NH2 . ARG A 1 182 ? 45.471  38.871  7.274   1.00 25.25 ? 183  ARG A NH2 1 
ATOM   1305 N N   . ALA A 1 183 ? 48.186  32.939  9.625   1.00 29.62 ? 184  ALA A N   1 
ATOM   1306 C CA  . ALA A 1 183 ? 47.574  31.783  10.292  1.00 29.24 ? 184  ALA A CA  1 
ATOM   1307 C C   . ALA A 1 183 ? 48.600  30.683  10.521  1.00 29.79 ? 184  ALA A C   1 
ATOM   1308 O O   . ALA A 1 183 ? 48.559  29.972  11.531  1.00 31.14 ? 184  ALA A O   1 
ATOM   1309 C CB  . ALA A 1 183 ? 46.410  31.234  9.461   1.00 30.25 ? 184  ALA A CB  1 
ATOM   1310 N N   . GLU A 1 184 ? 49.524  30.543  9.578   1.00 32.84 ? 185  GLU A N   1 
ATOM   1311 C CA  . GLU A 1 184 ? 50.550  29.521  9.712   1.00 34.02 ? 185  GLU A CA  1 
ATOM   1312 C C   . GLU A 1 184 ? 51.544  29.912  10.801  1.00 33.85 ? 185  GLU A C   1 
ATOM   1313 O O   . GLU A 1 184 ? 51.919  29.078  11.635  1.00 34.43 ? 185  GLU A O   1 
ATOM   1314 C CB  . GLU A 1 184 ? 51.294  29.333  8.388   1.00 38.04 ? 185  GLU A CB  1 
ATOM   1315 C CG  . GLU A 1 184 ? 52.098  28.054  8.355   1.00 45.28 ? 185  GLU A CG  1 
ATOM   1316 C CD  . GLU A 1 184 ? 51.205  26.808  8.335   1.00 47.88 ? 185  GLU A CD  1 
ATOM   1317 O OE1 . GLU A 1 184 ? 51.747  25.689  8.448   1.00 51.93 ? 185  GLU A OE1 1 
ATOM   1318 O OE2 . GLU A 1 184 ? 49.969  26.947  8.194   1.00 49.11 ? 185  GLU A OE2 1 
ATOM   1319 N N   . ALA A 1 185 ? 51.946  31.189  10.805  1.00 31.81 ? 186  ALA A N   1 
ATOM   1320 C CA  . ALA A 1 185 ? 52.924  31.683  11.768  1.00 29.89 ? 186  ALA A CA  1 
ATOM   1321 C C   . ALA A 1 185 ? 52.550  31.428  13.211  1.00 29.24 ? 186  ALA A C   1 
ATOM   1322 O O   . ALA A 1 185 ? 53.424  31.255  14.046  1.00 30.04 ? 186  ALA A O   1 
ATOM   1323 C CB  . ALA A 1 185 ? 53.161  33.171  11.562  1.00 30.92 ? 186  ALA A CB  1 
ATOM   1324 N N   . VAL A 1 186 ? 51.259  31.383  13.512  1.00 29.33 ? 187  VAL A N   1 
ATOM   1325 C CA  . VAL A 1 186 ? 50.848  31.177  14.895  1.00 29.13 ? 187  VAL A CA  1 
ATOM   1326 C C   . VAL A 1 186 ? 50.814  29.723  15.330  1.00 29.42 ? 187  VAL A C   1 
ATOM   1327 O O   . VAL A 1 186 ? 50.632  29.429  16.500  1.00 27.65 ? 187  VAL A O   1 
ATOM   1328 C CB  . VAL A 1 186 ? 49.454  31.833  15.175  1.00 28.41 ? 187  VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 186 ? 49.518  33.342  14.849  1.00 26.89 ? 187  VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 186 ? 48.374  31.164  14.338  1.00 28.71 ? 187  VAL A CG2 1 
ATOM   1331 N N   . LYS A 1 187 ? 50.978  28.799  14.397  1.00 31.54 ? 188  LYS A N   1 
ATOM   1332 C CA  . LYS A 1 187 ? 50.921  27.400  14.799  1.00 32.16 ? 188  LYS A CA  1 
ATOM   1333 C C   . LYS A 1 187 ? 52.057  27.078  15.751  1.00 31.51 ? 188  LYS A C   1 
ATOM   1334 O O   . LYS A 1 187 ? 53.219  27.447  15.517  1.00 30.66 ? 188  LYS A O   1 
ATOM   1335 C CB  . LYS A 1 187 ? 50.945  26.494  13.559  1.00 35.49 ? 188  LYS A CB  1 
ATOM   1336 C CG  . LYS A 1 187 ? 49.657  26.636  12.745  1.00 37.56 ? 188  LYS A CG  1 
ATOM   1337 C CD  . LYS A 1 187 ? 49.633  25.742  11.508  1.00 40.93 ? 188  LYS A CD  1 
ATOM   1338 C CE  . LYS A 1 187 ? 48.229  25.723  10.922  1.00 40.26 ? 188  LYS A CE  1 
ATOM   1339 N NZ  . LYS A 1 187 ? 48.209  25.072  9.584   1.00 45.42 ? 188  LYS A NZ  1 
ATOM   1340 N N   . GLY A 1 188 ? 51.701  26.404  16.832  1.00 32.10 ? 189  GLY A N   1 
ATOM   1341 C CA  . GLY A 1 188 ? 52.683  26.028  17.834  1.00 33.06 ? 189  GLY A CA  1 
ATOM   1342 C C   . GLY A 1 188 ? 53.031  27.160  18.793  1.00 33.77 ? 189  GLY A C   1 
ATOM   1343 O O   . GLY A 1 188 ? 53.848  26.988  19.698  1.00 32.58 ? 189  GLY A O   1 
ATOM   1344 N N   . ALA A 1 189 ? 52.419  28.329  18.616  1.00 31.85 ? 190  ALA A N   1 
ATOM   1345 C CA  . ALA A 1 189 ? 52.749  29.435  19.508  1.00 30.33 ? 190  ALA A CA  1 
ATOM   1346 C C   . ALA A 1 189 ? 51.924  29.345  20.779  1.00 29.82 ? 190  ALA A C   1 
ATOM   1347 O O   . ALA A 1 189 ? 50.840  28.753  20.784  1.00 29.51 ? 190  ALA A O   1 
ATOM   1348 C CB  . ALA A 1 189 ? 52.485  30.763  18.810  1.00 29.07 ? 190  ALA A CB  1 
ATOM   1349 N N   . HIS A 1 190 ? 52.438  29.940  21.852  1.00 27.01 ? 191  HIS A N   1 
ATOM   1350 C CA  . HIS A 1 190 ? 51.727  29.975  23.113  1.00 26.46 ? 191  HIS A CA  1 
ATOM   1351 C C   . HIS A 1 190 ? 51.051  31.329  23.319  1.00 27.72 ? 191  HIS A C   1 
ATOM   1352 O O   . HIS A 1 190 ? 49.965  31.431  23.942  1.00 26.10 ? 191  HIS A O   1 
ATOM   1353 C CB  . HIS A 1 190 ? 52.694  29.736  24.265  1.00 30.75 ? 191  HIS A CB  1 
ATOM   1354 C CG  . HIS A 1 190 ? 53.341  28.390  24.222  1.00 33.19 ? 191  HIS A CG  1 
ATOM   1355 N ND1 . HIS A 1 190 ? 54.616  28.193  23.736  1.00 36.09 ? 191  HIS A ND1 1 
ATOM   1356 C CD2 . HIS A 1 190 ? 52.881  27.166  24.587  1.00 36.11 ? 191  HIS A CD2 1 
ATOM   1357 C CE1 . HIS A 1 190 ? 54.917  26.903  23.803  1.00 37.38 ? 191  HIS A CE1 1 
ATOM   1358 N NE2 . HIS A 1 190 ? 53.882  26.259  24.317  1.00 34.69 ? 191  HIS A NE2 1 
ATOM   1359 N N   . PHE A 1 191 ? 51.688  32.371  22.802  1.00 26.38 ? 192  PHE A N   1 
ATOM   1360 C CA  . PHE A 1 191 ? 51.139  33.714  22.960  1.00 27.31 ? 192  PHE A CA  1 
ATOM   1361 C C   . PHE A 1 191 ? 51.117  34.449  21.650  1.00 25.18 ? 192  PHE A C   1 
ATOM   1362 O O   . PHE A 1 191 ? 52.091  34.412  20.909  1.00 25.40 ? 192  PHE A O   1 
ATOM   1363 C CB  . PHE A 1 191 ? 51.960  34.468  23.994  1.00 22.87 ? 192  PHE A CB  1 
ATOM   1364 C CG  . PHE A 1 191 ? 52.108  33.707  25.280  1.00 25.97 ? 192  PHE A CG  1 
ATOM   1365 C CD1 . PHE A 1 191 ? 53.321  33.158  25.641  1.00 27.66 ? 192  PHE A CD1 1 
ATOM   1366 C CD2 . PHE A 1 191 ? 51.014  33.505  26.104  1.00 25.34 ? 192  PHE A CD2 1 
ATOM   1367 C CE1 . PHE A 1 191 ? 53.453  32.408  26.829  1.00 28.33 ? 192  PHE A CE1 1 
ATOM   1368 C CE2 . PHE A 1 191 ? 51.133  32.761  27.282  1.00 29.62 ? 192  PHE A CE2 1 
ATOM   1369 C CZ  . PHE A 1 191 ? 52.370  32.215  27.639  1.00 26.91 ? 192  PHE A CZ  1 
ATOM   1370 N N   . VAL A 1 192 ? 50.004  35.129  21.379  1.00 24.54 ? 193  VAL A N   1 
ATOM   1371 C CA  . VAL A 1 192 ? 49.894  35.849  20.116  1.00 23.40 ? 193  VAL A CA  1 
ATOM   1372 C C   . VAL A 1 192 ? 49.419  37.262  20.332  1.00 23.31 ? 193  VAL A C   1 
ATOM   1373 O O   . VAL A 1 192 ? 48.404  37.478  21.012  1.00 23.57 ? 193  VAL A O   1 
ATOM   1374 C CB  . VAL A 1 192 ? 48.872  35.186  19.130  1.00 25.93 ? 193  VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 192 ? 48.731  36.055  17.867  1.00 22.95 ? 193  VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 192 ? 49.339  33.784  18.737  1.00 24.40 ? 193  VAL A CG2 1 
ATOM   1377 N N   . PHE A 1 193 ? 50.175  38.206  19.765  1.00 21.39 ? 194  PHE A N   1 
ATOM   1378 C CA  . PHE A 1 193 ? 49.819  39.611  19.800  1.00 22.53 ? 194  PHE A CA  1 
ATOM   1379 C C   . PHE A 1 193 ? 49.586  40.074  18.361  1.00 21.52 ? 194  PHE A C   1 
ATOM   1380 O O   . PHE A 1 193 ? 50.291  39.661  17.457  1.00 23.13 ? 194  PHE A O   1 
ATOM   1381 C CB  . PHE A 1 193 ? 50.953  40.479  20.381  1.00 22.05 ? 194  PHE A CB  1 
ATOM   1382 C CG  . PHE A 1 193 ? 51.250  40.212  21.833  1.00 23.21 ? 194  PHE A CG  1 
ATOM   1383 C CD1 . PHE A 1 193 ? 51.780  38.983  22.233  1.00 22.88 ? 194  PHE A CD1 1 
ATOM   1384 C CD2 . PHE A 1 193 ? 51.012  41.193  22.796  1.00 19.01 ? 194  PHE A CD2 1 
ATOM   1385 C CE1 . PHE A 1 193 ? 52.073  38.727  23.592  1.00 23.48 ? 194  PHE A CE1 1 
ATOM   1386 C CE2 . PHE A 1 193 ? 51.295  40.956  24.154  1.00 21.23 ? 194  PHE A CE2 1 
ATOM   1387 C CZ  . PHE A 1 193 ? 51.826  39.716  24.551  1.00 22.80 ? 194  PHE A CZ  1 
ATOM   1388 N N   . THR A 1 194 ? 48.581  40.926  18.161  1.00 23.68 ? 195  THR A N   1 
ATOM   1389 C CA  . THR A 1 194 ? 48.325  41.542  16.840  1.00 21.81 ? 195  THR A CA  1 
ATOM   1390 C C   . THR A 1 194 ? 48.529  43.056  17.090  1.00 21.91 ? 195  THR A C   1 
ATOM   1391 O O   . THR A 1 194 ? 47.854  43.626  17.936  1.00 18.70 ? 195  THR A O   1 
ATOM   1392 C CB  . THR A 1 194 ? 46.884  41.312  16.309  1.00 20.25 ? 195  THR A CB  1 
ATOM   1393 O OG1 . THR A 1 194 ? 45.912  41.638  17.326  1.00 25.67 ? 195  THR A OG1 1 
ATOM   1394 C CG2 . THR A 1 194 ? 46.723  39.817  15.831  1.00 18.93 ? 195  THR A CG2 1 
ATOM   1395 N N   . ALA A 1 195 ? 49.474  43.674  16.377  1.00 18.78 ? 196  ALA A N   1 
ATOM   1396 C CA  . ALA A 1 195 ? 49.755  45.097  16.554  1.00 18.62 ? 196  ALA A CA  1 
ATOM   1397 C C   . ALA A 1 195 ? 49.624  45.797  15.204  1.00 19.05 ? 196  ALA A C   1 
ATOM   1398 O O   . ALA A 1 195 ? 50.447  46.690  14.857  1.00 19.75 ? 196  ALA A O   1 
ATOM   1399 C CB  . ALA A 1 195 ? 51.173  45.252  17.098  1.00 19.74 ? 196  ALA A CB  1 
ATOM   1400 N N   . GLY A 1 196 ? 48.586  45.394  14.470  1.00 17.81 ? 197  GLY A N   1 
ATOM   1401 C CA  . GLY A 1 196 ? 48.335  45.912  13.123  1.00 21.37 ? 197  GLY A CA  1 
ATOM   1402 C C   . GLY A 1 196 ? 47.575  47.217  13.023  1.00 22.38 ? 197  GLY A C   1 
ATOM   1403 O O   . GLY A 1 196 ? 47.339  47.902  14.023  1.00 21.96 ? 197  GLY A O   1 
ATOM   1404 N N   . ALA A 1 197 ? 47.198  47.563  11.797  1.00 22.45 ? 198  ALA A N   1 
ATOM   1405 C CA  . ALA A 1 197 ? 46.512  48.816  11.530  1.00 22.17 ? 198  ALA A CA  1 
ATOM   1406 C C   . ALA A 1 197 ? 45.178  48.927  12.195  1.00 22.79 ? 198  ALA A C   1 
ATOM   1407 O O   . ALA A 1 197 ? 44.537  47.922  12.503  1.00 22.87 ? 198  ALA A O   1 
ATOM   1408 C CB  . ALA A 1 197 ? 46.343  48.987  10.001  1.00 24.98 ? 198  ALA A CB  1 
ATOM   1409 N N   . ILE A 1 198 ? 44.727  50.155  12.403  1.00 22.51 ? 199  ILE A N   1 
ATOM   1410 C CA  . ILE A 1 198 ? 43.419  50.367  13.004  1.00 24.73 ? 199  ILE A CA  1 
ATOM   1411 C C   . ILE A 1 198 ? 42.322  49.817  12.065  1.00 25.04 ? 199  ILE A C   1 
ATOM   1412 O O   . ILE A 1 198 ? 42.409  49.985  10.861  1.00 25.47 ? 199  ILE A O   1 
ATOM   1413 C CB  . ILE A 1 198 ? 43.177  51.858  13.233  1.00 29.66 ? 199  ILE A CB  1 
ATOM   1414 C CG1 . ILE A 1 198 ? 44.129  52.374  14.341  1.00 30.64 ? 199  ILE A CG1 1 
ATOM   1415 C CG2 . ILE A 1 198 ? 41.698  52.097  13.562  1.00 30.86 ? 199  ILE A CG2 1 
ATOM   1416 C CD1 . ILE A 1 198 ? 44.248  53.903  14.359  1.00 33.59 ? 199  ILE A CD1 1 
ATOM   1417 N N   . GLY A 1 199 ? 41.315  49.146  12.624  1.00 24.89 ? 200  GLY A N   1 
ATOM   1418 C CA  . GLY A 1 199 ? 40.231  48.623  11.817  1.00 22.83 ? 200  GLY A CA  1 
ATOM   1419 C C   . GLY A 1 199 ? 40.605  47.513  10.854  1.00 26.15 ? 200  GLY A C   1 
ATOM   1420 O O   . GLY A 1 199 ? 40.081  47.435  9.738   1.00 26.84 ? 200  GLY A O   1 
ATOM   1421 N N   . LEU A 1 200 ? 41.519  46.640  11.260  1.00 26.39 ? 201  LEU A N   1 
ATOM   1422 C CA  . LEU A 1 200 ? 41.889  45.557  10.369  1.00 25.99 ? 201  LEU A CA  1 
ATOM   1423 C C   . LEU A 1 200 ? 42.067  44.241  11.099  1.00 27.99 ? 201  LEU A C   1 
ATOM   1424 O O   . LEU A 1 200 ? 42.774  44.161  12.108  1.00 27.37 ? 201  LEU A O   1 
ATOM   1425 C CB  . LEU A 1 200 ? 43.176  45.909  9.633   1.00 27.57 ? 201  LEU A CB  1 
ATOM   1426 C CG  . LEU A 1 200 ? 43.675  44.898  8.609   1.00 28.11 ? 201  LEU A CG  1 
ATOM   1427 C CD1 . LEU A 1 200 ? 42.844  45.038  7.315   1.00 33.96 ? 201  LEU A CD1 1 
ATOM   1428 C CD2 . LEU A 1 200 ? 45.129  45.191  8.314   1.00 30.74 ? 201  LEU A CD2 1 
ATOM   1429 N N   . GLU A 1 201 ? 41.423  43.209  10.583  1.00 25.48 ? 202  GLU A N   1 
ATOM   1430 C CA  . GLU A 1 201 ? 41.558  41.870  11.154  1.00 27.28 ? 202  GLU A CA  1 
ATOM   1431 C C   . GLU A 1 201 ? 42.789  41.154  10.593  1.00 26.04 ? 202  GLU A C   1 
ATOM   1432 O O   . GLU A 1 201 ? 42.977  41.115  9.383   1.00 24.65 ? 202  GLU A O   1 
ATOM   1433 C CB  . GLU A 1 201 ? 40.343  41.008  10.842  1.00 24.67 ? 202  GLU A CB  1 
ATOM   1434 C CG  . GLU A 1 201 ? 40.475  39.620  11.446  1.00 28.92 ? 202  GLU A CG  1 
ATOM   1435 C CD  . GLU A 1 201 ? 39.211  38.792  11.274  1.00 32.54 ? 202  GLU A CD  1 
ATOM   1436 O OE1 . GLU A 1 201 ? 38.872  38.473  10.124  1.00 35.13 ? 202  GLU A OE1 1 
ATOM   1437 O OE2 . GLU A 1 201 ? 38.555  38.476  12.279  1.00 34.26 ? 202  GLU A OE2 1 
ATOM   1438 N N   . LEU A 1 202 ? 43.575  40.543  11.478  1.00 24.40 ? 203  LEU A N   1 
ATOM   1439 C CA  . LEU A 1 202 ? 44.795  39.814  11.105  1.00 25.57 ? 203  LEU A CA  1 
ATOM   1440 C C   . LEU A 1 202 ? 44.712  38.330  11.439  1.00 28.65 ? 203  LEU A C   1 
ATOM   1441 O O   . LEU A 1 202 ? 45.488  37.532  10.914  1.00 31.79 ? 203  LEU A O   1 
ATOM   1442 C CB  . LEU A 1 202 ? 46.009  40.362  11.858  1.00 24.69 ? 203  LEU A CB  1 
ATOM   1443 C CG  . LEU A 1 202 ? 46.309  41.868  11.747  1.00 29.73 ? 203  LEU A CG  1 
ATOM   1444 C CD1 . LEU A 1 202 ? 47.672  42.193  12.362  1.00 28.30 ? 203  LEU A CD1 1 
ATOM   1445 C CD2 . LEU A 1 202 ? 46.295  42.278  10.278  1.00 32.06 ? 203  LEU A CD2 1 
ATOM   1446 N N   . LEU A 1 203 ? 43.792  37.958  12.321  1.00 27.17 ? 204  LEU A N   1 
ATOM   1447 C CA  . LEU A 1 203 ? 43.710  36.570  12.731  1.00 29.52 ? 204  LEU A CA  1 
ATOM   1448 C C   . LEU A 1 203 ? 42.296  36.170  13.084  1.00 28.71 ? 204  LEU A C   1 
ATOM   1449 O O   . LEU A 1 203 ? 41.862  36.314  14.226  1.00 23.19 ? 204  LEU A O   1 
ATOM   1450 C CB  . LEU A 1 203 ? 44.635  36.318  13.932  1.00 30.95 ? 204  LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 203 ? 44.993  34.863  14.273  1.00 33.77 ? 204  LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 203 ? 45.960  34.282  13.244  1.00 34.30 ? 204  LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 203 ? 45.632  34.847  15.629  1.00 35.24 ? 204  LEU A CD2 1 
ATOM   1454 N N   . PRO A 1 204 ? 41.551  35.670  12.085  1.00 28.67 ? 205  PRO A N   1 
ATOM   1455 C CA  . PRO A 1 204 ? 40.166  35.236  12.279  1.00 28.37 ? 205  PRO A CA  1 
ATOM   1456 C C   . PRO A 1 204 ? 40.072  34.200  13.417  1.00 26.96 ? 205  PRO A C   1 
ATOM   1457 O O   . PRO A 1 204 ? 41.031  33.519  13.759  1.00 26.17 ? 205  PRO A O   1 
ATOM   1458 C CB  . PRO A 1 204 ? 39.800  34.620  10.919  1.00 28.50 ? 205  PRO A CB  1 
ATOM   1459 C CG  . PRO A 1 204 ? 40.662  35.346  9.964   1.00 31.02 ? 205  PRO A CG  1 
ATOM   1460 C CD  . PRO A 1 204 ? 41.988  35.423  10.702  1.00 28.57 ? 205  PRO A CD  1 
ATOM   1461 N N   . GLN A 1 205 ? 38.886  34.085  13.982  1.00 27.52 ? 206  GLN A N   1 
ATOM   1462 C CA  . GLN A 1 205 ? 38.608  33.135  15.054  1.00 30.96 ? 206  GLN A CA  1 
ATOM   1463 C C   . GLN A 1 205 ? 39.133  31.730  14.733  1.00 30.99 ? 206  GLN A C   1 
ATOM   1464 O O   . GLN A 1 205 ? 39.728  31.057  15.579  1.00 30.09 ? 206  GLN A O   1 
ATOM   1465 C CB  . GLN A 1 205 ? 37.092  33.072  15.235  1.00 34.05 ? 206  GLN A CB  1 
ATOM   1466 C CG  . GLN A 1 205 ? 36.606  32.394  16.485  1.00 39.49 ? 206  GLN A CG  1 
ATOM   1467 C CD  . GLN A 1 205 ? 35.133  32.679  16.687  1.00 42.96 ? 206  GLN A CD  1 
ATOM   1468 O OE1 . GLN A 1 205 ? 34.609  33.642  16.120  1.00 46.73 ? 206  GLN A OE1 1 
ATOM   1469 N NE2 . GLN A 1 205 ? 34.456  31.861  17.491  1.00 43.13 ? 206  GLN A NE2 1 
ATOM   1470 N N   . ALA A 1 206 ? 38.893  31.297  13.504  1.00 31.32 ? 207  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 206 ? 39.303  29.967  13.066  1.00 33.35 ? 207  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 206 ? 40.797  29.782  13.016  1.00 34.71 ? 207  ALA A C   1 
ATOM   1473 O O   . ALA A 1 206 ? 41.265  28.637  12.954  1.00 35.34 ? 207  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 206 ? 38.725  29.662  11.680  1.00 35.60 ? 207  ALA A CB  1 
ATOM   1475 N N   . ALA A 1 207 ? 41.558  30.882  13.005  1.00 30.01 ? 208  ALA A N   1 
ATOM   1476 C CA  . ALA A 1 207 ? 43.000  30.723  12.934  1.00 31.07 ? 208  ALA A CA  1 
ATOM   1477 C C   . ALA A 1 207 ? 43.667  30.657  14.315  1.00 30.30 ? 208  ALA A C   1 
ATOM   1478 O O   . ALA A 1 207 ? 44.872  30.420  14.399  1.00 32.13 ? 208  ALA A O   1 
ATOM   1479 C CB  . ALA A 1 207 ? 43.629  31.853  12.074  1.00 32.81 ? 208  ALA A CB  1 
ATOM   1480 N N   . TRP A 1 208 ? 42.923  30.892  15.391  1.00 28.92 ? 209  TRP A N   1 
ATOM   1481 C CA  . TRP A 1 208 ? 43.552  30.778  16.703  1.00 29.70 ? 209  TRP A CA  1 
ATOM   1482 C C   . TRP A 1 208 ? 42.807  29.892  17.688  1.00 29.89 ? 209  TRP A C   1 
ATOM   1483 O O   . TRP A 1 208 ? 43.425  29.274  18.573  1.00 29.14 ? 209  TRP A O   1 
ATOM   1484 C CB  . TRP A 1 208 ? 43.789  32.158  17.358  1.00 28.37 ? 209  TRP A CB  1 
ATOM   1485 C CG  . TRP A 1 208 ? 42.548  32.959  17.684  1.00 25.88 ? 209  TRP A CG  1 
ATOM   1486 C CD1 . TRP A 1 208 ? 41.859  33.774  16.841  1.00 26.15 ? 209  TRP A CD1 1 
ATOM   1487 C CD2 . TRP A 1 208 ? 41.875  33.015  18.942  1.00 28.91 ? 209  TRP A CD2 1 
ATOM   1488 N NE1 . TRP A 1 208 ? 40.795  34.343  17.493  1.00 28.46 ? 209  TRP A NE1 1 
ATOM   1489 C CE2 . TRP A 1 208 ? 40.777  33.892  18.788  1.00 27.98 ? 209  TRP A CE2 1 
ATOM   1490 C CE3 . TRP A 1 208 ? 42.091  32.408  20.189  1.00 27.45 ? 209  TRP A CE3 1 
ATOM   1491 C CZ2 . TRP A 1 208 ? 39.890  34.183  19.837  1.00 30.93 ? 209  TRP A CZ2 1 
ATOM   1492 C CZ3 . TRP A 1 208 ? 41.204  32.692  21.244  1.00 30.15 ? 209  TRP A CZ3 1 
ATOM   1493 C CH2 . TRP A 1 208 ? 40.119  33.572  21.057  1.00 32.28 ? 209  TRP A CH2 1 
ATOM   1494 N N   . GLN A 1 209 ? 41.490  29.815  17.560  1.00 31.29 ? 210  GLN A N   1 
ATOM   1495 C CA  . GLN A 1 209 ? 40.740  29.006  18.516  1.00 32.88 ? 210  GLN A CA  1 
ATOM   1496 C C   . GLN A 1 209 ? 40.910  27.504  18.461  1.00 33.08 ? 210  GLN A C   1 
ATOM   1497 O O   . GLN A 1 209 ? 40.612  26.819  19.447  1.00 32.10 ? 210  GLN A O   1 
ATOM   1498 C CB  . GLN A 1 209 ? 39.273  29.359  18.458  1.00 35.04 ? 210  GLN A CB  1 
ATOM   1499 C CG  . GLN A 1 209 ? 39.067  30.793  18.884  1.00 39.57 ? 210  GLN A CG  1 
ATOM   1500 C CD  . GLN A 1 209 ? 37.635  31.088  19.216  1.00 42.37 ? 210  GLN A CD  1 
ATOM   1501 O OE1 . GLN A 1 209 ? 36.718  30.547  18.589  1.00 46.23 ? 210  GLN A OE1 1 
ATOM   1502 N NE2 . GLN A 1 209 ? 37.420  31.963  20.191  1.00 43.03 ? 210  GLN A NE2 1 
ATOM   1503 N N   . ASN A 1 210 ? 41.397  26.986  17.336  1.00 34.18 ? 211  ASN A N   1 
ATOM   1504 C CA  . ASN A 1 210 ? 41.612  25.540  17.207  1.00 34.19 ? 211  ASN A CA  1 
ATOM   1505 C C   . ASN A 1 210 ? 43.088  25.141  17.266  1.00 35.73 ? 211  ASN A C   1 
ATOM   1506 O O   . ASN A 1 210 ? 43.450  23.996  16.958  1.00 35.94 ? 211  ASN A O   1 
ATOM   1507 C CB  . ASN A 1 210 ? 40.960  25.025  15.916  1.00 34.06 ? 211  ASN A CB  1 
ATOM   1508 C CG  . ASN A 1 210 ? 39.466  25.307  15.884  1.00 34.32 ? 211  ASN A CG  1 
ATOM   1509 O OD1 . ASN A 1 210 ? 38.789  25.198  16.915  1.00 33.75 ? 211  ASN A OD1 1 
ATOM   1510 N ND2 . ASN A 1 210 ? 38.945  25.679  14.714  1.00 32.58 ? 211  ASN A ND2 1 
ATOM   1511 N N   . GLU A 1 211 ? 43.947  26.080  17.657  1.00 33.61 ? 212  GLU A N   1 
ATOM   1512 C CA  . GLU A 1 211 ? 45.367  25.782  17.783  1.00 33.64 ? 212  GLU A CA  1 
ATOM   1513 C C   . GLU A 1 211 ? 45.600  25.470  19.267  1.00 34.67 ? 212  GLU A C   1 
ATOM   1514 O O   . GLU A 1 211 ? 45.631  26.368  20.114  1.00 31.24 ? 212  GLU A O   1 
ATOM   1515 C CB  . GLU A 1 211 ? 46.201  26.997  17.329  1.00 34.61 ? 212  GLU A CB  1 
ATOM   1516 C CG  . GLU A 1 211 ? 47.712  26.764  17.238  1.00 33.97 ? 212  GLU A CG  1 
ATOM   1517 C CD  . GLU A 1 211 ? 48.109  25.690  16.207  1.00 39.89 ? 212  GLU A CD  1 
ATOM   1518 O OE1 . GLU A 1 211 ? 47.301  25.387  15.296  1.00 36.28 ? 212  GLU A OE1 1 
ATOM   1519 O OE2 . GLU A 1 211 ? 49.249  25.164  16.297  1.00 40.20 ? 212  GLU A OE2 1 
ATOM   1520 N N   . SER A 1 212 ? 45.790  24.190  19.584  1.00 35.94 ? 213  SER A N   1 
ATOM   1521 C CA  . SER A 1 212 ? 45.957  23.789  20.982  1.00 36.74 ? 213  SER A CA  1 
ATOM   1522 C C   . SER A 1 212 ? 47.064  24.491  21.768  1.00 35.31 ? 213  SER A C   1 
ATOM   1523 O O   . SER A 1 212 ? 46.885  24.793  22.948  1.00 37.72 ? 213  SER A O   1 
ATOM   1524 C CB  . SER A 1 212 ? 46.121  22.254  21.091  1.00 37.39 ? 213  SER A CB  1 
ATOM   1525 O OG  . SER A 1 212 ? 47.168  21.771  20.271  1.00 40.02 ? 213  SER A OG  1 
ATOM   1526 N N   . SER A 1 213 ? 48.201  24.755  21.132  1.00 35.10 ? 214  SER A N   1 
ATOM   1527 C CA  . SER A 1 213 ? 49.290  25.424  21.817  1.00 33.69 ? 214  SER A CA  1 
ATOM   1528 C C   . SER A 1 213 ? 48.924  26.838  22.323  1.00 34.74 ? 214  SER A C   1 
ATOM   1529 O O   . SER A 1 213 ? 49.338  27.241  23.418  1.00 34.76 ? 214  SER A O   1 
ATOM   1530 C CB  . SER A 1 213 ? 50.519  25.501  20.899  1.00 34.96 ? 214  SER A CB  1 
ATOM   1531 O OG  . SER A 1 213 ? 50.255  26.303  19.769  1.00 33.31 ? 214  SER A OG  1 
ATOM   1532 N N   . ILE A 1 214 ? 48.131  27.583  21.554  1.00 32.01 ? 215  ILE A N   1 
ATOM   1533 C CA  . ILE A 1 214 ? 47.784  28.950  21.959  1.00 31.06 ? 215  ILE A CA  1 
ATOM   1534 C C   . ILE A 1 214 ? 47.086  29.062  23.312  1.00 30.65 ? 215  ILE A C   1 
ATOM   1535 O O   . ILE A 1 214 ? 45.998  28.517  23.507  1.00 29.99 ? 215  ILE A O   1 
ATOM   1536 C CB  . ILE A 1 214 ? 46.910  29.645  20.879  1.00 30.88 ? 215  ILE A CB  1 
ATOM   1537 C CG1 . ILE A 1 214 ? 47.729  29.837  19.590  1.00 30.85 ? 215  ILE A CG1 1 
ATOM   1538 C CG2 . ILE A 1 214 ? 46.413  30.990  21.386  1.00 29.47 ? 215  ILE A CG2 1 
ATOM   1539 C CD1 . ILE A 1 214 ? 46.897  30.386  18.427  1.00 28.44 ? 215  ILE A CD1 1 
ATOM   1540 N N   . GLU A 1 215 ? 47.710  29.794  24.236  1.00 30.76 ? 216  GLU A N   1 
ATOM   1541 C CA  . GLU A 1 215 ? 47.173  30.013  25.585  1.00 31.31 ? 216  GLU A CA  1 
ATOM   1542 C C   . GLU A 1 215 ? 46.489  31.381  25.768  1.00 29.83 ? 216  GLU A C   1 
ATOM   1543 O O   . GLU A 1 215 ? 45.423  31.496  26.382  1.00 28.94 ? 216  GLU A O   1 
ATOM   1544 C CB  . GLU A 1 215 ? 48.308  29.909  26.610  1.00 33.07 ? 216  GLU A CB  1 
ATOM   1545 C CG  . GLU A 1 215 ? 48.913  28.509  26.766  1.00 39.47 ? 216  GLU A CG  1 
ATOM   1546 C CD  . GLU A 1 215 ? 50.217  28.512  27.601  1.00 42.42 ? 216  GLU A CD  1 
ATOM   1547 O OE1 . GLU A 1 215 ? 50.359  29.366  28.508  1.00 42.23 ? 216  GLU A OE1 1 
ATOM   1548 O OE2 . GLU A 1 215 ? 51.088  27.651  27.351  1.00 44.76 ? 216  GLU A OE2 1 
ATOM   1549 N N   . ILE A 1 216 ? 47.108  32.427  25.228  1.00 29.08 ? 217  ILE A N   1 
ATOM   1550 C CA  . ILE A 1 216 ? 46.565  33.774  25.361  1.00 24.87 ? 217  ILE A CA  1 
ATOM   1551 C C   . ILE A 1 216 ? 46.759  34.618  24.090  1.00 25.24 ? 217  ILE A C   1 
ATOM   1552 O O   . ILE A 1 216 ? 47.770  34.504  23.393  1.00 23.54 ? 217  ILE A O   1 
ATOM   1553 C CB  . ILE A 1 216 ? 47.278  34.501  26.517  1.00 26.82 ? 217  ILE A CB  1 
ATOM   1554 C CG1 . ILE A 1 216 ? 47.174  33.656  27.785  1.00 28.68 ? 217  ILE A CG1 1 
ATOM   1555 C CG2 . ILE A 1 216 ? 46.686  35.886  26.740  1.00 24.97 ? 217  ILE A CG2 1 
ATOM   1556 C CD1 . ILE A 1 216 ? 47.956  34.225  28.918  1.00 31.50 ? 217  ILE A CD1 1 
ATOM   1557 N N   . VAL A 1 217 ? 45.785  35.460  23.788  1.00 22.69 ? 218  VAL A N   1 
ATOM   1558 C CA  . VAL A 1 217 ? 45.934  36.327  22.642  1.00 23.65 ? 218  VAL A CA  1 
ATOM   1559 C C   . VAL A 1 217 ? 45.677  37.753  23.095  1.00 22.64 ? 218  VAL A C   1 
ATOM   1560 O O   . VAL A 1 217 ? 44.873  37.992  23.987  1.00 25.24 ? 218  VAL A O   1 
ATOM   1561 C CB  . VAL A 1 217 ? 44.981  35.958  21.511  1.00 25.71 ? 218  VAL A CB  1 
ATOM   1562 C CG1 . VAL A 1 217 ? 45.305  34.542  21.027  1.00 24.55 ? 218  VAL A CG1 1 
ATOM   1563 C CG2 . VAL A 1 217 ? 43.509  36.075  21.983  1.00 23.96 ? 218  VAL A CG2 1 
ATOM   1564 N N   . ALA A 1 218 ? 46.371  38.702  22.478  1.00 22.77 ? 219  ALA A N   1 
ATOM   1565 C CA  . ALA A 1 218 ? 46.238  40.111  22.848  1.00 22.13 ? 219  ALA A CA  1 
ATOM   1566 C C   . ALA A 1 218 ? 46.197  40.920  21.554  1.00 23.48 ? 219  ALA A C   1 
ATOM   1567 O O   . ALA A 1 218 ? 46.953  40.641  20.637  1.00 21.06 ? 219  ALA A O   1 
ATOM   1568 C CB  . ALA A 1 218 ? 47.426  40.520  23.679  1.00 22.65 ? 219  ALA A CB  1 
ATOM   1569 N N   . ASP A 1 219 ? 45.337  41.933  21.510  1.00 20.76 ? 220  ASP A N   1 
ATOM   1570 C CA  . ASP A 1 219 ? 45.166  42.726  20.312  1.00 22.05 ? 220  ASP A CA  1 
ATOM   1571 C C   . ASP A 1 219 ? 45.174  44.232  20.619  1.00 22.37 ? 220  ASP A C   1 
ATOM   1572 O O   . ASP A 1 219 ? 44.467  44.682  21.507  1.00 23.75 ? 220  ASP A O   1 
ATOM   1573 C CB  . ASP A 1 219 ? 43.846  42.280  19.663  1.00 21.18 ? 220  ASP A CB  1 
ATOM   1574 C CG  . ASP A 1 219 ? 43.455  43.128  18.459  1.00 27.25 ? 220  ASP A CG  1 
ATOM   1575 O OD1 . ASP A 1 219 ? 44.353  43.764  17.866  1.00 28.54 ? 220  ASP A OD1 1 
ATOM   1576 O OD2 . ASP A 1 219 ? 42.246  43.150  18.120  1.00 27.07 ? 220  ASP A OD2 1 
ATOM   1577 N N   . TYR A 1 220 ? 46.013  44.982  19.904  1.00 20.52 ? 221  TYR A N   1 
ATOM   1578 C CA  . TYR A 1 220 ? 46.128  46.414  20.103  1.00 20.76 ? 221  TYR A CA  1 
ATOM   1579 C C   . TYR A 1 220 ? 45.241  47.249  19.228  1.00 21.14 ? 221  TYR A C   1 
ATOM   1580 O O   . TYR A 1 220 ? 45.211  48.468  19.382  1.00 23.05 ? 221  TYR A O   1 
ATOM   1581 C CB  . TYR A 1 220 ? 47.583  46.872  19.915  1.00 18.61 ? 221  TYR A CB  1 
ATOM   1582 C CG  . TYR A 1 220 ? 48.507  46.256  20.958  1.00 19.38 ? 221  TYR A CG  1 
ATOM   1583 C CD1 . TYR A 1 220 ? 49.472  45.295  20.587  1.00 18.09 ? 221  TYR A CD1 1 
ATOM   1584 C CD2 . TYR A 1 220 ? 48.443  46.640  22.306  1.00 15.73 ? 221  TYR A CD2 1 
ATOM   1585 C CE1 . TYR A 1 220 ? 50.339  44.767  21.506  1.00 17.12 ? 221  TYR A CE1 1 
ATOM   1586 C CE2 . TYR A 1 220 ? 49.324  46.089  23.247  1.00 18.28 ? 221  TYR A CE2 1 
ATOM   1587 C CZ  . TYR A 1 220 ? 50.281  45.162  22.833  1.00 19.24 ? 221  TYR A CZ  1 
ATOM   1588 O OH  . TYR A 1 220 ? 51.255  44.692  23.702  1.00 20.74 ? 221  TYR A OH  1 
ATOM   1589 N N   . ASN A 1 221 ? 44.494  46.620  18.326  1.00 21.54 ? 222  ASN A N   1 
ATOM   1590 C CA  . ASN A 1 221 ? 43.595  47.406  17.481  1.00 22.86 ? 222  ASN A CA  1 
ATOM   1591 C C   . ASN A 1 221 ? 42.210  47.491  18.146  1.00 22.85 ? 222  ASN A C   1 
ATOM   1592 O O   . ASN A 1 221 ? 41.520  46.484  18.289  1.00 23.12 ? 222  ASN A O   1 
ATOM   1593 C CB  . ASN A 1 221 ? 43.471  46.775  16.091  1.00 23.47 ? 222  ASN A CB  1 
ATOM   1594 C CG  . ASN A 1 221 ? 42.294  47.333  15.319  1.00 23.82 ? 222  ASN A CG  1 
ATOM   1595 O OD1 . ASN A 1 221 ? 41.962  48.508  15.455  1.00 21.60 ? 222  ASN A OD1 1 
ATOM   1596 N ND2 . ASN A 1 221 ? 41.645  46.488  14.515  1.00 22.14 ? 222  ASN A ND2 1 
ATOM   1597 N N   . ALA A 1 222 ? 41.784  48.684  18.531  1.00 22.20 ? 223  ALA A N   1 
ATOM   1598 C CA  . ALA A 1 222 ? 40.470  48.813  19.195  1.00 24.66 ? 223  ALA A CA  1 
ATOM   1599 C C   . ALA A 1 222 ? 39.296  49.101  18.230  1.00 24.74 ? 223  ALA A C   1 
ATOM   1600 O O   . ALA A 1 222 ? 38.148  49.121  18.650  1.00 26.34 ? 223  ALA A O   1 
ATOM   1601 C CB  . ALA A 1 222 ? 40.528  49.935  20.249  1.00 22.55 ? 223  ALA A CB  1 
ATOM   1602 N N   . GLN A 1 223 ? 39.585  49.342  16.960  1.00 25.93 ? 224  GLN A N   1 
ATOM   1603 C CA  . GLN A 1 223 ? 38.537  49.642  15.979  1.00 28.53 ? 224  GLN A CA  1 
ATOM   1604 C C   . GLN A 1 223 ? 38.123  48.434  15.159  1.00 27.67 ? 224  GLN A C   1 
ATOM   1605 O O   . GLN A 1 223 ? 38.929  47.864  14.445  1.00 25.41 ? 224  GLN A O   1 
ATOM   1606 C CB  . GLN A 1 223 ? 39.010  50.747  15.029  1.00 31.37 ? 224  GLN A CB  1 
ATOM   1607 C CG  . GLN A 1 223 ? 37.930  51.196  14.036  1.00 41.44 ? 224  GLN A CG  1 
ATOM   1608 C CD  . GLN A 1 223 ? 38.396  52.318  13.117  1.00 45.86 ? 224  GLN A CD  1 
ATOM   1609 O OE1 . GLN A 1 223 ? 39.004  53.303  13.573  1.00 49.16 ? 224  GLN A OE1 1 
ATOM   1610 N NE2 . GLN A 1 223 ? 38.108  52.185  11.818  1.00 49.09 ? 224  GLN A NE2 1 
ATOM   1611 N N   . PRO A 1 224 ? 36.853  48.020  15.272  1.00 28.18 ? 225  PRO A N   1 
ATOM   1612 C CA  . PRO A 1 224 ? 36.308  46.874  14.542  1.00 28.91 ? 225  PRO A CA  1 
ATOM   1613 C C   . PRO A 1 224 ? 36.446  47.118  13.030  1.00 29.31 ? 225  PRO A C   1 
ATOM   1614 O O   . PRO A 1 224 ? 36.307  48.241  12.561  1.00 31.29 ? 225  PRO A O   1 
ATOM   1615 C CB  . PRO A 1 224 ? 34.835  46.867  14.968  1.00 30.79 ? 225  PRO A CB  1 
ATOM   1616 C CG  . PRO A 1 224 ? 34.883  47.504  16.363  1.00 32.83 ? 225  PRO A CG  1 
ATOM   1617 C CD  . PRO A 1 224 ? 35.819  48.646  16.115  1.00 31.40 ? 225  PRO A CD  1 
ATOM   1618 N N   . PRO A 1 225 ? 36.770  46.076  12.259  1.00 29.04 ? 226  PRO A N   1 
ATOM   1619 C CA  . PRO A 1 225 ? 37.033  44.699  12.715  1.00 26.19 ? 226  PRO A CA  1 
ATOM   1620 C C   . PRO A 1 225 ? 38.352  44.645  13.519  1.00 25.03 ? 226  PRO A C   1 
ATOM   1621 O O   . PRO A 1 225 ? 39.393  45.152  13.072  1.00 22.44 ? 226  PRO A O   1 
ATOM   1622 C CB  . PRO A 1 225 ? 37.098  43.917  11.393  1.00 28.05 ? 226  PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 225 ? 37.746  44.957  10.458  1.00 30.76 ? 226  PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 225 ? 36.937  46.199  10.794  1.00 29.92 ? 226  PRO A CD  1 
ATOM   1625 N N   . LEU A 1 226 ? 38.297  44.029  14.701  1.00 23.05 ? 227  LEU A N   1 
ATOM   1626 C CA  . LEU A 1 226 ? 39.472  43.928  15.562  1.00 24.07 ? 227  LEU A CA  1 
ATOM   1627 C C   . LEU A 1 226 ? 40.569  43.044  14.933  1.00 24.45 ? 227  LEU A C   1 
ATOM   1628 O O   . LEU A 1 226 ? 40.286  42.232  14.050  1.00 24.49 ? 227  LEU A O   1 
ATOM   1629 C CB  . LEU A 1 226 ? 39.069  43.357  16.939  1.00 23.41 ? 227  LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 226 ? 37.851  44.069  17.575  1.00 22.59 ? 227  LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 226 ? 37.517  43.403  18.899  1.00 24.88 ? 227  LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 226 ? 38.203  45.559  17.788  1.00 24.75 ? 227  LEU A CD2 1 
ATOM   1633 N N   . GLY A 1 227 ? 41.809  43.233  15.377  1.00 22.78 ? 228  GLY A N   1 
ATOM   1634 C CA  . GLY A 1 227 ? 42.922  42.432  14.877  1.00 24.70 ? 228  GLY A CA  1 
ATOM   1635 C C   . GLY A 1 227 ? 42.693  40.936  15.121  1.00 26.10 ? 228  GLY A C   1 
ATOM   1636 O O   . GLY A 1 227 ? 43.101  40.070  14.322  1.00 25.47 ? 228  GLY A O   1 
ATOM   1637 N N   . ILE A 1 228 ? 42.062  40.611  16.244  1.00 26.83 ? 229  ILE A N   1 
ATOM   1638 C CA  . ILE A 1 228 ? 41.787  39.204  16.563  1.00 26.09 ? 229  ILE A CA  1 
ATOM   1639 C C   . ILE A 1 228 ? 40.295  38.973  16.446  1.00 27.88 ? 229  ILE A C   1 
ATOM   1640 O O   . ILE A 1 228 ? 39.483  39.662  17.081  1.00 28.70 ? 229  ILE A O   1 
ATOM   1641 C CB  . ILE A 1 228 ? 42.288  38.846  17.993  1.00 26.19 ? 229  ILE A CB  1 
ATOM   1642 C CG1 . ILE A 1 228 ? 43.821  38.783  17.992  1.00 25.33 ? 229  ILE A CG1 1 
ATOM   1643 C CG2 . ILE A 1 228 ? 41.758  37.451  18.437  1.00 23.01 ? 229  ILE A CG2 1 
ATOM   1644 C CD1 . ILE A 1 228 ? 44.412  38.826  19.398  1.00 27.72 ? 229  ILE A CD1 1 
ATOM   1645 N N   . GLY A 1 229 ? 39.926  38.010  15.617  1.00 27.13 ? 230  GLY A N   1 
ATOM   1646 C CA  . GLY A 1 229 ? 38.516  37.744  15.436  1.00 28.76 ? 230  GLY A CA  1 
ATOM   1647 C C   . GLY A 1 229 ? 37.897  36.940  16.555  1.00 29.18 ? 230  GLY A C   1 
ATOM   1648 O O   . GLY A 1 229 ? 38.571  36.109  17.182  1.00 26.75 ? 230  GLY A O   1 
ATOM   1649 N N   . GLY A 1 230 ? 36.618  37.215  16.810  1.00 28.95 ? 231  GLY A N   1 
ATOM   1650 C CA  . GLY A 1 230 ? 35.875  36.486  17.815  1.00 30.68 ? 231  GLY A CA  1 
ATOM   1651 C C   . GLY A 1 230 ? 35.986  37.004  19.233  1.00 31.77 ? 231  GLY A C   1 
ATOM   1652 O O   . GLY A 1 230 ? 35.452  36.378  20.151  1.00 30.07 ? 231  GLY A O   1 
ATOM   1653 N N   . ILE A 1 231 ? 36.662  38.136  19.431  1.00 27.91 ? 232  ILE A N   1 
ATOM   1654 C CA  . ILE A 1 231 ? 36.771  38.673  20.784  1.00 26.19 ? 232  ILE A CA  1 
ATOM   1655 C C   . ILE A 1 231 ? 36.160  40.057  20.816  1.00 26.95 ? 232  ILE A C   1 
ATOM   1656 O O   . ILE A 1 231 ? 35.764  40.586  19.768  1.00 23.25 ? 232  ILE A O   1 
ATOM   1657 C CB  . ILE A 1 231 ? 38.263  38.763  21.239  1.00 25.66 ? 232  ILE A CB  1 
ATOM   1658 C CG1 . ILE A 1 231 ? 39.000  39.902  20.511  1.00 22.86 ? 232  ILE A CG1 1 
ATOM   1659 C CG2 . ILE A 1 231 ? 38.952  37.430  20.985  1.00 24.54 ? 232  ILE A CG2 1 
ATOM   1660 C CD1 . ILE A 1 231 ? 40.416  40.157  21.083  1.00 23.22 ? 232  ILE A CD1 1 
ATOM   1661 N N   . ASP A 1 232 ? 35.995  40.626  22.011  1.00 27.64 ? 233  ASP A N   1 
ATOM   1662 C CA  . ASP A 1 232 ? 35.522  42.006  22.063  1.00 29.27 ? 233  ASP A CA  1 
ATOM   1663 C C   . ASP A 1 232 ? 36.689  42.899  22.514  1.00 29.82 ? 233  ASP A C   1 
ATOM   1664 O O   . ASP A 1 232 ? 37.578  42.463  23.256  1.00 27.84 ? 233  ASP A O   1 
ATOM   1665 C CB  . ASP A 1 232 ? 34.315  42.193  22.996  1.00 32.40 ? 233  ASP A CB  1 
ATOM   1666 C CG  . ASP A 1 232 ? 33.792  43.661  22.984  1.00 38.83 ? 233  ASP A CG  1 
ATOM   1667 O OD1 . ASP A 1 232 ? 34.303  44.496  23.790  1.00 36.27 ? 233  ASP A OD1 1 
ATOM   1668 O OD2 . ASP A 1 232 ? 32.890  43.989  22.155  1.00 36.17 ? 233  ASP A OD2 1 
ATOM   1669 N N   . ALA A 1 233 ? 36.697  44.150  22.074  1.00 29.35 ? 234  ALA A N   1 
ATOM   1670 C CA  . ALA A 1 233 ? 37.797  45.037  22.429  1.00 29.69 ? 234  ALA A CA  1 
ATOM   1671 C C   . ALA A 1 233 ? 37.923  45.238  23.948  1.00 27.97 ? 234  ALA A C   1 
ATOM   1672 O O   . ALA A 1 233 ? 38.994  45.572  24.430  1.00 26.67 ? 234  ALA A O   1 
ATOM   1673 C CB  . ALA A 1 233 ? 37.619  46.370  21.731  1.00 30.65 ? 234  ALA A CB  1 
ATOM   1674 N N   . THR A 1 234 ? 36.828  45.047  24.688  1.00 28.41 ? 235  THR A N   1 
ATOM   1675 C CA  . THR A 1 234 ? 36.845  45.200  26.139  1.00 26.83 ? 235  THR A CA  1 
ATOM   1676 C C   . THR A 1 234 ? 37.371  43.961  26.863  1.00 28.89 ? 235  THR A C   1 
ATOM   1677 O O   . THR A 1 234 ? 37.674  44.010  28.058  1.00 30.46 ? 235  THR A O   1 
ATOM   1678 C CB  . THR A 1 234 ? 35.421  45.557  26.716  1.00 27.83 ? 235  THR A CB  1 
ATOM   1679 O OG1 . THR A 1 234 ? 34.454  44.597  26.272  1.00 27.55 ? 235  THR A OG1 1 
ATOM   1680 C CG2 . THR A 1 234 ? 34.999  46.940  26.294  1.00 26.57 ? 235  THR A CG2 1 
ATOM   1681 N N   . ASP A 1 235 ? 37.500  42.837  26.170  1.00 29.23 ? 236  ASP A N   1 
ATOM   1682 C CA  . ASP A 1 235 ? 37.997  41.644  26.857  1.00 29.70 ? 236  ASP A CA  1 
ATOM   1683 C C   . ASP A 1 235 ? 39.303  41.876  27.654  1.00 31.23 ? 236  ASP A C   1 
ATOM   1684 O O   . ASP A 1 235 ? 40.252  42.511  27.183  1.00 27.88 ? 236  ASP A O   1 
ATOM   1685 C CB  . ASP A 1 235 ? 38.203  40.516  25.863  1.00 30.23 ? 236  ASP A CB  1 
ATOM   1686 C CG  . ASP A 1 235 ? 36.885  39.986  25.284  1.00 30.68 ? 236  ASP A CG  1 
ATOM   1687 O OD1 . ASP A 1 235 ? 35.798  40.438  25.709  1.00 31.77 ? 236  ASP A OD1 1 
ATOM   1688 O OD2 . ASP A 1 235 ? 36.946  39.112  24.398  1.00 34.64 ? 236  ASP A OD2 1 
ATOM   1689 N N   . LYS A 1 236 ? 39.350  41.357  28.873  1.00 31.68 ? 237  LYS A N   1 
ATOM   1690 C CA  . LYS A 1 236 ? 40.533  41.527  29.693  1.00 32.18 ? 237  LYS A CA  1 
ATOM   1691 C C   . LYS A 1 236 ? 40.790  40.219  30.387  1.00 33.04 ? 237  LYS A C   1 
ATOM   1692 O O   . LYS A 1 236 ? 40.638  40.094  31.594  1.00 35.11 ? 237  LYS A O   1 
ATOM   1693 C CB  . LYS A 1 236 ? 40.316  42.674  30.690  1.00 31.43 ? 237  LYS A CB  1 
ATOM   1694 C CG  . LYS A 1 236 ? 41.582  43.104  31.440  1.00 32.37 ? 237  LYS A CG  1 
ATOM   1695 C CD  . LYS A 1 236 ? 41.356  44.384  32.261  1.00 36.27 ? 237  LYS A CD  1 
ATOM   1696 C CE  . LYS A 1 236 ? 42.577  44.778  33.106  1.00 35.92 ? 237  LYS A CE  1 
ATOM   1697 N NZ  . LYS A 1 236 ? 42.320  46.107  33.766  1.00 41.06 ? 237  LYS A NZ  1 
ATOM   1698 N N   . GLY A 1 237 ? 41.184  39.229  29.598  1.00 34.55 ? 238  GLY A N   1 
ATOM   1699 C CA  . GLY A 1 237 ? 41.428  37.910  30.137  1.00 33.77 ? 238  GLY A CA  1 
ATOM   1700 C C   . GLY A 1 237 ? 40.185  37.045  30.050  1.00 34.78 ? 238  GLY A C   1 
ATOM   1701 O O   . GLY A 1 237 ? 40.091  36.028  30.737  1.00 34.71 ? 238  GLY A O   1 
ATOM   1702 N N   . LYS A 1 238 ? 39.222  37.435  29.218  1.00 35.20 ? 239  LYS A N   1 
ATOM   1703 C CA  . LYS A 1 238 ? 38.002  36.638  29.081  1.00 35.95 ? 239  LYS A CA  1 
ATOM   1704 C C   . LYS A 1 238 ? 38.371  35.275  28.512  1.00 34.99 ? 239  LYS A C   1 
ATOM   1705 O O   . LYS A 1 238 ? 39.208  35.173  27.609  1.00 31.84 ? 239  LYS A O   1 
ATOM   1706 C CB  . LYS A 1 238 ? 37.005  37.325  28.154  1.00 40.01 ? 239  LYS A CB  1 
ATOM   1707 C CG  . LYS A 1 238 ? 35.804  36.443  27.774  1.00 42.12 ? 239  LYS A CG  1 
ATOM   1708 C CD  . LYS A 1 238 ? 34.484  37.184  27.970  1.00 43.90 ? 239  LYS A CD  1 
ATOM   1709 C CE  . LYS A 1 238 ? 33.306  36.458  27.272  1.00 44.13 ? 239  LYS A CE  1 
ATOM   1710 N NZ  . LYS A 1 238 ? 33.130  36.792  25.806  1.00 48.35 ? 239  LYS A NZ  1 
ATOM   1711 N N   . GLU A 1 239 ? 37.749  34.231  29.049  1.00 33.35 ? 240  GLU A N   1 
ATOM   1712 C CA  . GLU A 1 239 ? 38.022  32.854  28.614  1.00 38.00 ? 240  GLU A CA  1 
ATOM   1713 C C   . GLU A 1 239 ? 37.287  32.392  27.351  1.00 36.99 ? 240  GLU A C   1 
ATOM   1714 O O   . GLU A 1 239 ? 36.067  32.506  27.255  1.00 38.03 ? 240  GLU A O   1 
ATOM   1715 C CB  . GLU A 1 239 ? 37.679  31.860  29.739  1.00 40.37 ? 240  GLU A CB  1 
ATOM   1716 C CG  . GLU A 1 239 ? 38.592  31.889  30.943  1.00 48.42 ? 240  GLU A CG  1 
ATOM   1717 C CD  . GLU A 1 239 ? 37.837  31.563  32.234  1.00 53.00 ? 240  GLU A CD  1 
ATOM   1718 O OE1 . GLU A 1 239 ? 37.580  32.493  33.037  1.00 55.65 ? 240  GLU A OE1 1 
ATOM   1719 O OE2 . GLU A 1 239 ? 37.484  30.381  32.438  1.00 53.69 ? 240  GLU A OE2 1 
ATOM   1720 N N   . TYR A 1 240 ? 38.035  31.890  26.380  1.00 35.74 ? 241  TYR A N   1 
ATOM   1721 C CA  . TYR A 1 240 ? 37.431  31.348  25.174  1.00 35.94 ? 241  TYR A CA  1 
ATOM   1722 C C   . TYR A 1 240 ? 37.930  29.929  25.164  1.00 37.03 ? 241  TYR A C   1 
ATOM   1723 O O   . TYR A 1 240 ? 38.999  29.620  24.626  1.00 34.09 ? 241  TYR A O   1 
ATOM   1724 C CB  . TYR A 1 240 ? 37.855  32.091  23.916  1.00 34.18 ? 241  TYR A CB  1 
ATOM   1725 C CG  . TYR A 1 240 ? 37.235  33.469  23.842  1.00 34.72 ? 241  TYR A CG  1 
ATOM   1726 C CD1 . TYR A 1 240 ? 37.819  34.550  24.501  1.00 33.98 ? 241  TYR A CD1 1 
ATOM   1727 C CD2 . TYR A 1 240 ? 36.042  33.684  23.157  1.00 32.68 ? 241  TYR A CD2 1 
ATOM   1728 C CE1 . TYR A 1 240 ? 37.213  35.831  24.480  1.00 33.87 ? 241  TYR A CE1 1 
ATOM   1729 C CE2 . TYR A 1 240 ? 35.437  34.946  23.133  1.00 35.39 ? 241  TYR A CE2 1 
ATOM   1730 C CZ  . TYR A 1 240 ? 36.029  36.010  23.802  1.00 32.89 ? 241  TYR A CZ  1 
ATOM   1731 O OH  . TYR A 1 240 ? 35.401  37.226  23.841  1.00 29.99 ? 241  TYR A OH  1 
ATOM   1732 N N   . GLY A 1 241 ? 37.141  29.058  25.790  1.00 38.98 ? 242  GLY A N   1 
ATOM   1733 C CA  . GLY A 1 241 ? 37.548  27.673  25.904  1.00 40.87 ? 242  GLY A CA  1 
ATOM   1734 C C   . GLY A 1 241 ? 38.610  27.693  26.985  1.00 42.17 ? 242  GLY A C   1 
ATOM   1735 O O   . GLY A 1 241 ? 38.398  28.272  28.064  1.00 42.30 ? 242  GLY A O   1 
ATOM   1736 N N   . GLY A 1 242 ? 39.758  27.089  26.699  1.00 41.99 ? 243  GLY A N   1 
ATOM   1737 C CA  . GLY A 1 242 ? 40.840  27.098  27.668  1.00 43.67 ? 243  GLY A CA  1 
ATOM   1738 C C   . GLY A 1 242 ? 41.843  28.218  27.423  1.00 43.11 ? 243  GLY A C   1 
ATOM   1739 O O   . GLY A 1 242 ? 42.866  28.299  28.105  1.00 44.79 ? 243  GLY A O   1 
ATOM   1740 N N   . LYS A 1 243 ? 41.547  29.087  26.455  1.00 41.61 ? 244  LYS A N   1 
ATOM   1741 C CA  . LYS A 1 243 ? 42.428  30.213  26.100  1.00 39.29 ? 244  LYS A CA  1 
ATOM   1742 C C   . LYS A 1 243 ? 41.871  31.501  26.705  1.00 37.50 ? 244  LYS A C   1 
ATOM   1743 O O   . LYS A 1 243 ? 40.712  31.539  27.105  1.00 39.40 ? 244  LYS A O   1 
ATOM   1744 C CB  . LYS A 1 243 ? 42.501  30.347  24.573  1.00 37.59 ? 244  LYS A CB  1 
ATOM   1745 C CG  . LYS A 1 243 ? 42.764  29.037  23.878  1.00 38.01 ? 244  LYS A CG  1 
ATOM   1746 C CD  . LYS A 1 243 ? 42.791  29.159  22.361  1.00 36.50 ? 244  LYS A CD  1 
ATOM   1747 C CE  . LYS A 1 243 ? 42.945  27.776  21.714  1.00 34.43 ? 244  LYS A CE  1 
ATOM   1748 N NZ  . LYS A 1 243 ? 44.127  26.976  22.207  1.00 31.31 ? 244  LYS A NZ  1 
ATOM   1749 N N   A ARG A 1 244 ? 42.702  32.538  26.793  0.60 35.74 ? 245  ARG A N   1 
ATOM   1750 N N   B ARG A 1 244 ? 42.702  32.538  26.782  0.40 36.09 ? 245  ARG A N   1 
ATOM   1751 C CA  A ARG A 1 244 ? 42.278  33.831  27.334  0.60 35.00 ? 245  ARG A CA  1 
ATOM   1752 C CA  B ARG A 1 244 ? 42.280  33.829  27.321  0.40 35.03 ? 245  ARG A CA  1 
ATOM   1753 C C   A ARG A 1 244 ? 42.617  34.941  26.335  0.60 32.72 ? 245  ARG A C   1 
ATOM   1754 C C   B ARG A 1 244 ? 42.613  34.937  26.322  0.40 32.95 ? 245  ARG A C   1 
ATOM   1755 O O   A ARG A 1 244 ? 43.638  34.872  25.656  0.60 32.80 ? 245  ARG A O   1 
ATOM   1756 O O   B ARG A 1 244 ? 43.629  34.867  25.633  0.40 32.91 ? 245  ARG A O   1 
ATOM   1757 C CB  A ARG A 1 244 ? 42.971  34.108  28.676  0.60 34.62 ? 245  ARG A CB  1 
ATOM   1758 C CB  B ARG A 1 244 ? 42.978  34.115  28.657  0.40 35.06 ? 245  ARG A CB  1 
ATOM   1759 C CG  A ARG A 1 244 ? 42.168  33.621  29.889  0.60 37.00 ? 245  ARG A CG  1 
ATOM   1760 C CG  B ARG A 1 244 ? 42.540  33.187  29.783  0.40 37.14 ? 245  ARG A CG  1 
ATOM   1761 C CD  A ARG A 1 244 ? 42.957  33.686  31.185  0.60 37.12 ? 245  ARG A CD  1 
ATOM   1762 C CD  B ARG A 1 244 ? 42.237  33.953  31.067  0.40 37.14 ? 245  ARG A CD  1 
ATOM   1763 N NE  A ARG A 1 244 ? 44.001  32.663  31.227  0.60 39.03 ? 245  ARG A NE  1 
ATOM   1764 N NE  B ARG A 1 244 ? 41.528  33.105  32.023  0.40 39.48 ? 245  ARG A NE  1 
ATOM   1765 C CZ  A ARG A 1 244 ? 44.857  32.502  32.233  0.60 38.70 ? 245  ARG A CZ  1 
ATOM   1766 C CZ  B ARG A 1 244 ? 41.064  33.514  33.198  0.40 38.67 ? 245  ARG A CZ  1 
ATOM   1767 N NH1 A ARG A 1 244 ? 44.797  33.295  33.298  0.60 37.18 ? 245  ARG A NH1 1 
ATOM   1768 N NH1 B ARG A 1 244 ? 41.227  34.773  33.585  0.40 39.63 ? 245  ARG A NH1 1 
ATOM   1769 N NH2 A ARG A 1 244 ? 45.793  31.567  32.157  0.60 38.92 ? 245  ARG A NH2 1 
ATOM   1770 N NH2 B ARG A 1 244 ? 40.434  32.658  33.986  0.40 38.61 ? 245  ARG A NH2 1 
ATOM   1771 N N   . ALA A 1 245 ? 41.757  35.949  26.247  1.00 30.65 ? 246  ALA A N   1 
ATOM   1772 C CA  . ALA A 1 245 ? 41.976  37.058  25.316  1.00 30.26 ? 246  ALA A CA  1 
ATOM   1773 C C   . ALA A 1 245 ? 41.967  38.414  25.959  1.00 28.36 ? 246  ALA A C   1 
ATOM   1774 O O   . ALA A 1 245 ? 41.237  38.678  26.928  1.00 29.13 ? 246  ALA A O   1 
ATOM   1775 C CB  . ALA A 1 245 ? 40.939  37.036  24.208  1.00 30.28 ? 246  ALA A CB  1 
ATOM   1776 N N   . PHE A 1 246 ? 42.798  39.297  25.415  1.00 27.44 ? 247  PHE A N   1 
ATOM   1777 C CA  . PHE A 1 246 ? 42.856  40.665  25.905  1.00 22.89 ? 247  PHE A CA  1 
ATOM   1778 C C   . PHE A 1 246 ? 42.603  41.597  24.717  1.00 24.15 ? 247  PHE A C   1 
ATOM   1779 O O   . PHE A 1 246 ? 43.355  41.591  23.754  1.00 21.21 ? 247  PHE A O   1 
ATOM   1780 C CB  . PHE A 1 246 ? 44.223  40.963  26.541  1.00 25.34 ? 247  PHE A CB  1 
ATOM   1781 C CG  . PHE A 1 246 ? 44.431  40.279  27.883  1.00 26.89 ? 247  PHE A CG  1 
ATOM   1782 C CD1 . PHE A 1 246 ? 44.795  38.929  27.949  1.00 26.81 ? 247  PHE A CD1 1 
ATOM   1783 C CD2 . PHE A 1 246 ? 44.217  40.982  29.072  1.00 25.87 ? 247  PHE A CD2 1 
ATOM   1784 C CE1 . PHE A 1 246 ? 44.944  38.278  29.184  1.00 26.55 ? 247  PHE A CE1 1 
ATOM   1785 C CE2 . PHE A 1 246 ? 44.360  40.349  30.314  1.00 25.92 ? 247  PHE A CE2 1 
ATOM   1786 C CZ  . PHE A 1 246 ? 44.723  38.996  30.368  1.00 27.10 ? 247  PHE A CZ  1 
ATOM   1787 N N   . GLY A 1 247 ? 41.517  42.358  24.783  1.00 22.71 ? 248  GLY A N   1 
ATOM   1788 C CA  . GLY A 1 247 ? 41.214  43.312  23.728  1.00 23.05 ? 248  GLY A CA  1 
ATOM   1789 C C   . GLY A 1 247 ? 41.929  44.635  23.942  1.00 24.68 ? 248  GLY A C   1 
ATOM   1790 O O   . GLY A 1 247 ? 42.405  44.963  25.056  1.00 21.80 ? 248  GLY A O   1 
ATOM   1791 N N   . ALA A 1 248 ? 41.947  45.438  22.890  1.00 21.47 ? 249  ALA A N   1 
ATOM   1792 C CA  . ALA A 1 248 ? 42.661  46.707  22.903  1.00 21.51 ? 249  ALA A CA  1 
ATOM   1793 C C   . ALA A 1 248 ? 42.161  47.682  23.969  1.00 22.04 ? 249  ALA A C   1 
ATOM   1794 O O   . ALA A 1 248 ? 42.954  48.485  24.481  1.00 22.92 ? 249  ALA A O   1 
ATOM   1795 C CB  . ALA A 1 248 ? 42.569  47.342  21.529  1.00 19.30 ? 249  ALA A CB  1 
ATOM   1796 N N   . LEU A 1 249 ? 40.863  47.628  24.294  1.00 20.21 ? 250  LEU A N   1 
ATOM   1797 C CA  . LEU A 1 249 ? 40.353  48.541  25.315  1.00 21.85 ? 250  LEU A CA  1 
ATOM   1798 C C   . LEU A 1 249 ? 40.691  48.048  26.725  1.00 21.80 ? 250  LEU A C   1 
ATOM   1799 O O   . LEU A 1 249 ? 40.923  48.848  27.641  1.00 23.28 ? 250  LEU A O   1 
ATOM   1800 C CB  . LEU A 1 249 ? 38.845  48.730  25.170  1.00 23.88 ? 250  LEU A CB  1 
ATOM   1801 C CG  . LEU A 1 249 ? 38.491  49.533  23.912  1.00 25.18 ? 250  LEU A CG  1 
ATOM   1802 C CD1 . LEU A 1 249 ? 36.967  49.538  23.767  1.00 29.27 ? 250  LEU A CD1 1 
ATOM   1803 C CD2 . LEU A 1 249 ? 39.073  50.975  23.975  1.00 26.02 ? 250  LEU A CD2 1 
ATOM   1804 N N   . GLY A 1 250 ? 40.702  46.731  26.885  1.00 22.70 ? 251  GLY A N   1 
ATOM   1805 C CA  . GLY A 1 250 ? 41.055  46.135  28.165  1.00 25.22 ? 251  GLY A CA  1 
ATOM   1806 C C   . GLY A 1 250 ? 42.490  46.486  28.498  1.00 23.85 ? 251  GLY A C   1 
ATOM   1807 O O   . GLY A 1 250 ? 42.822  46.808  29.650  1.00 26.09 ? 251  GLY A O   1 
ATOM   1808 N N   . ILE A 1 251 ? 43.353  46.409  27.490  1.00 21.77 ? 252  ILE A N   1 
ATOM   1809 C CA  . ILE A 1 251 ? 44.764  46.766  27.649  1.00 21.74 ? 252  ILE A CA  1 
ATOM   1810 C C   . ILE A 1 251 ? 44.861  48.291  27.831  1.00 23.87 ? 252  ILE A C   1 
ATOM   1811 O O   . ILE A 1 251 ? 45.643  48.779  28.643  1.00 22.84 ? 252  ILE A O   1 
ATOM   1812 C CB  . ILE A 1 251 ? 45.548  46.395  26.381  1.00 21.65 ? 252  ILE A CB  1 
ATOM   1813 C CG1 . ILE A 1 251 ? 45.529  44.894  26.200  1.00 24.52 ? 252  ILE A CG1 1 
ATOM   1814 C CG2 . ILE A 1 251 ? 47.015  46.962  26.439  1.00 21.35 ? 252  ILE A CG2 1 
ATOM   1815 C CD1 . ILE A 1 251 ? 46.015  44.406  24.824  1.00 22.16 ? 252  ILE A CD1 1 
ATOM   1816 N N   . GLY A 1 252 ? 44.085  49.023  27.029  1.00 22.94 ? 253  GLY A N   1 
ATOM   1817 C CA  . GLY A 1 252 ? 44.098  50.489  27.080  1.00 22.27 ? 253  GLY A CA  1 
ATOM   1818 C C   . GLY A 1 252 ? 43.709  51.082  28.425  1.00 23.81 ? 253  GLY A C   1 
ATOM   1819 O O   . GLY A 1 252 ? 44.195  52.153  28.766  1.00 22.40 ? 253  GLY A O   1 
ATOM   1820 N N   . GLY A 1 253 ? 42.807  50.420  29.167  1.00 24.17 ? 254  GLY A N   1 
ATOM   1821 C CA  . GLY A 1 253 ? 42.419  50.895  30.493  1.00 24.38 ? 254  GLY A CA  1 
ATOM   1822 C C   . GLY A 1 253 ? 43.664  50.928  31.381  1.00 24.28 ? 254  GLY A C   1 
ATOM   1823 O O   . GLY A 1 253 ? 43.929  51.909  32.068  1.00 23.24 ? 254  GLY A O   1 
ATOM   1824 N N   . LEU A 1 254 ? 44.443  49.852  31.380  1.00 21.00 ? 255  LEU A N   1 
ATOM   1825 C CA  . LEU A 1 254 ? 45.674  49.834  32.151  1.00 23.32 ? 255  LEU A CA  1 
ATOM   1826 C C   . LEU A 1 254 ? 46.705  50.831  31.589  1.00 22.87 ? 255  LEU A C   1 
ATOM   1827 O O   . LEU A 1 254 ? 47.410  51.511  32.372  1.00 18.99 ? 255  LEU A O   1 
ATOM   1828 C CB  . LEU A 1 254 ? 46.292  48.444  32.146  1.00 22.95 ? 255  LEU A CB  1 
ATOM   1829 C CG  . LEU A 1 254 ? 47.659  48.338  32.828  1.00 25.78 ? 255  LEU A CG  1 
ATOM   1830 C CD1 . LEU A 1 254 ? 47.551  48.813  34.309  1.00 23.60 ? 255  LEU A CD1 1 
ATOM   1831 C CD2 . LEU A 1 254 ? 48.148  46.869  32.764  1.00 25.22 ? 255  LEU A CD2 1 
ATOM   1832 N N   . LYS A 1 255 ? 46.822  50.890  30.252  1.00 18.74 ? 256  LYS A N   1 
ATOM   1833 C CA  . LYS A 1 255 ? 47.762  51.838  29.616  1.00 19.33 ? 256  LYS A CA  1 
ATOM   1834 C C   . LYS A 1 255 ? 47.531  53.296  30.106  1.00 21.17 ? 256  LYS A C   1 
ATOM   1835 O O   . LYS A 1 255 ? 48.488  54.024  30.390  1.00 18.05 ? 256  LYS A O   1 
ATOM   1836 C CB  . LYS A 1 255 ? 47.638  51.773  28.076  1.00 20.16 ? 256  LYS A CB  1 
ATOM   1837 C CG  . LYS A 1 255 ? 48.518  52.796  27.341  1.00 20.83 ? 256  LYS A CG  1 
ATOM   1838 C CD  . LYS A 1 255 ? 47.783  54.146  27.266  1.00 22.59 ? 256  LYS A CD  1 
ATOM   1839 C CE  . LYS A 1 255 ? 48.353  55.090  26.208  1.00 24.12 ? 256  LYS A CE  1 
ATOM   1840 N NZ  . LYS A 1 255 ? 49.559  55.871  26.584  1.00 24.13 ? 256  LYS A NZ  1 
ATOM   1841 N N   . LEU A 1 256 ? 46.275  53.713  30.226  1.00 19.36 ? 257  LEU A N   1 
ATOM   1842 C CA  . LEU A 1 256 ? 45.986  55.088  30.666  1.00 21.74 ? 257  LEU A CA  1 
ATOM   1843 C C   . LEU A 1 256 ? 46.413  55.274  32.137  1.00 20.80 ? 257  LEU A C   1 
ATOM   1844 O O   . LEU A 1 256 ? 47.036  56.279  32.493  1.00 18.66 ? 257  LEU A O   1 
ATOM   1845 C CB  . LEU A 1 256 ? 44.489  55.413  30.519  1.00 22.38 ? 257  LEU A CB  1 
ATOM   1846 C CG  . LEU A 1 256 ? 44.092  55.770  29.078  1.00 27.52 ? 257  LEU A CG  1 
ATOM   1847 C CD1 . LEU A 1 256 ? 42.567  55.977  28.937  1.00 29.04 ? 257  LEU A CD1 1 
ATOM   1848 C CD2 . LEU A 1 256 ? 44.857  57.063  28.699  1.00 27.26 ? 257  LEU A CD2 1 
ATOM   1849 N N   . LYS A 1 257 ? 46.100  54.299  32.974  1.00 19.32 ? 258  LYS A N   1 
ATOM   1850 C CA  . LYS A 1 257 ? 46.503  54.403  34.389  1.00 21.85 ? 258  LYS A CA  1 
ATOM   1851 C C   . LYS A 1 257 ? 48.028  54.410  34.518  1.00 22.23 ? 258  LYS A C   1 
ATOM   1852 O O   . LYS A 1 257 ? 48.573  55.197  35.306  1.00 20.55 ? 258  LYS A O   1 
ATOM   1853 C CB  . LYS A 1 257 ? 45.895  53.254  35.205  1.00 24.84 ? 258  LYS A CB  1 
ATOM   1854 C CG  . LYS A 1 257 ? 44.372  53.426  35.321  1.00 26.54 ? 258  LYS A CG  1 
ATOM   1855 C CD  . LYS A 1 257 ? 43.641  52.298  36.039  1.00 31.14 ? 258  LYS A CD  1 
ATOM   1856 C CE  . LYS A 1 257 ? 42.134  52.645  36.110  1.00 33.05 ? 258  LYS A CE  1 
ATOM   1857 N NZ  . LYS A 1 257 ? 41.291  51.826  37.048  1.00 37.28 ? 258  LYS A NZ  1 
ATOM   1858 N N   . LEU A 1 258 ? 48.695  53.569  33.715  1.00 18.64 ? 259  LEU A N   1 
ATOM   1859 C CA  . LEU A 1 258 ? 50.161  53.427  33.720  1.00 17.88 ? 259  LEU A CA  1 
ATOM   1860 C C   . LEU A 1 258 ? 50.843  54.711  33.245  1.00 20.35 ? 259  LEU A C   1 
ATOM   1861 O O   . LEU A 1 258 ? 51.743  55.270  33.899  1.00 19.47 ? 259  LEU A O   1 
ATOM   1862 C CB  . LEU A 1 258 ? 50.594  52.238  32.828  1.00 19.54 ? 259  LEU A CB  1 
ATOM   1863 C CG  . LEU A 1 258 ? 52.106  52.124  32.508  1.00 17.79 ? 259  LEU A CG  1 
ATOM   1864 C CD1 . LEU A 1 258 ? 52.891  51.948  33.808  1.00 17.52 ? 259  LEU A CD1 1 
ATOM   1865 C CD2 . LEU A 1 258 ? 52.357  50.951  31.648  1.00 19.31 ? 259  LEU A CD2 1 
ATOM   1866 N N   . HIS A 1 259 ? 50.378  55.225  32.116  1.00 19.67 ? 260  HIS A N   1 
ATOM   1867 C CA  . HIS A 1 259 ? 50.966  56.443  31.589  1.00 19.48 ? 260  HIS A CA  1 
ATOM   1868 C C   . HIS A 1 259 ? 50.830  57.599  32.622  1.00 19.85 ? 260  HIS A C   1 
ATOM   1869 O O   . HIS A 1 259 ? 51.793  58.338  32.868  1.00 18.74 ? 260  HIS A O   1 
ATOM   1870 C CB  . HIS A 1 259 ? 50.259  56.719  30.269  1.00 20.36 ? 260  HIS A CB  1 
ATOM   1871 C CG  . HIS A 1 259 ? 50.781  57.892  29.506  1.00 21.52 ? 260  HIS A CG  1 
ATOM   1872 N ND1 . HIS A 1 259 ? 50.422  58.117  28.191  1.00 22.26 ? 260  HIS A ND1 1 
ATOM   1873 C CD2 . HIS A 1 259 ? 51.550  58.941  29.874  1.00 19.25 ? 260  HIS A CD2 1 
ATOM   1874 C CE1 . HIS A 1 259 ? 50.953  59.260  27.785  1.00 22.10 ? 260  HIS A CE1 1 
ATOM   1875 N NE2 . HIS A 1 259 ? 51.637  59.779  28.787  1.00 24.00 ? 260  HIS A NE2 1 
ATOM   1876 N N   . ARG A 1 260 ? 49.657  57.746  33.232  1.00 18.79 ? 261  ARG A N   1 
ATOM   1877 C CA  . ARG A 1 260 ? 49.470  58.807  34.238  1.00 21.25 ? 261  ARG A CA  1 
ATOM   1878 C C   . ARG A 1 260 ? 50.412  58.617  35.404  1.00 21.11 ? 261  ARG A C   1 
ATOM   1879 O O   . ARG A 1 260 ? 51.058  59.568  35.854  1.00 20.96 ? 261  ARG A O   1 
ATOM   1880 C CB  . ARG A 1 260 ? 48.037  58.797  34.807  1.00 22.40 ? 261  ARG A CB  1 
ATOM   1881 C CG  . ARG A 1 260 ? 46.967  59.124  33.782  1.00 22.87 ? 261  ARG A CG  1 
ATOM   1882 C CD  . ARG A 1 260 ? 45.594  58.967  34.386  1.00 24.09 ? 261  ARG A CD  1 
ATOM   1883 N NE  . ARG A 1 260 ? 44.558  59.142  33.371  1.00 29.96 ? 261  ARG A NE  1 
ATOM   1884 C CZ  . ARG A 1 260 ? 43.449  58.403  33.312  1.00 35.26 ? 261  ARG A CZ  1 
ATOM   1885 N NH1 . ARG A 1 260 ? 43.241  57.447  34.216  1.00 36.17 ? 261  ARG A NH1 1 
ATOM   1886 N NH2 . ARG A 1 260 ? 42.556  58.595  32.341  1.00 36.63 ? 261  ARG A NH2 1 
ATOM   1887 N N   . ALA A 1 261 ? 50.504  57.374  35.876  1.00 21.88 ? 262  ALA A N   1 
ATOM   1888 C CA  . ALA A 1 261 ? 51.337  57.073  37.035  1.00 22.83 ? 262  ALA A CA  1 
ATOM   1889 C C   . ALA A 1 261 ? 52.798  57.335  36.757  1.00 22.04 ? 262  ALA A C   1 
ATOM   1890 O O   . ALA A 1 261 ? 53.521  57.751  37.658  1.00 19.64 ? 262  ALA A O   1 
ATOM   1891 C CB  . ALA A 1 261 ? 51.129  55.619  37.498  1.00 22.01 ? 262  ALA A CB  1 
ATOM   1892 N N   . CYS A 1 262 ? 53.221  57.115  35.516  1.00 21.15 ? 263  CYS A N   1 
ATOM   1893 C CA  . CYS A 1 262 ? 54.602  57.354  35.134  1.00 19.68 ? 263  CYS A CA  1 
ATOM   1894 C C   . CYS A 1 262 ? 54.882  58.854  35.233  1.00 21.14 ? 263  CYS A C   1 
ATOM   1895 O O   . CYS A 1 262 ? 55.967  59.273  35.666  1.00 19.65 ? 263  CYS A O   1 
ATOM   1896 C CB  . CYS A 1 262 ? 54.866  56.915  33.688  1.00 20.49 ? 263  CYS A CB  1 
ATOM   1897 S SG  . CYS A 1 262 ? 54.995  55.076  33.412  1.00 23.90 ? 263  CYS A SG  1 
ATOM   1898 N N   . ILE A 1 263 ? 53.934  59.666  34.760  1.00 22.18 ? 264  ILE A N   1 
ATOM   1899 C CA  . ILE A 1 263 ? 54.131  61.118  34.810  1.00 19.79 ? 264  ILE A CA  1 
ATOM   1900 C C   . ILE A 1 263 ? 54.322  61.520  36.270  1.00 19.14 ? 264  ILE A C   1 
ATOM   1901 O O   . ILE A 1 263 ? 55.213  62.310  36.615  1.00 19.68 ? 264  ILE A O   1 
ATOM   1902 C CB  . ILE A 1 263 ? 52.917  61.860  34.228  1.00 17.84 ? 264  ILE A CB  1 
ATOM   1903 C CG1 . ILE A 1 263 ? 52.800  61.530  32.726  1.00 17.70 ? 264  ILE A CG1 1 
ATOM   1904 C CG2 . ILE A 1 263 ? 53.032  63.397  34.471  1.00 18.18 ? 264  ILE A CG2 1 
ATOM   1905 C CD1 . ILE A 1 263 ? 53.806  62.227  31.812  1.00 21.34 ? 264  ILE A CD1 1 
ATOM   1906 N N   . ALA A 1 264 ? 53.468  60.997  37.132  1.00 20.53 ? 265  ALA A N   1 
ATOM   1907 C CA  . ALA A 1 264 ? 53.583  61.322  38.565  1.00 23.92 ? 265  ALA A CA  1 
ATOM   1908 C C   . ALA A 1 264 ? 54.977  60.972  39.089  1.00 23.03 ? 265  ALA A C   1 
ATOM   1909 O O   . ALA A 1 264 ? 55.578  61.722  39.869  1.00 22.96 ? 265  ALA A O   1 
ATOM   1910 C CB  . ALA A 1 264 ? 52.519  60.569  39.351  1.00 19.54 ? 265  ALA A CB  1 
ATOM   1911 N N   . LYS A 1 265 ? 55.501  59.826  38.657  1.00 24.88 ? 266  LYS A N   1 
ATOM   1912 C CA  . LYS A 1 265 ? 56.816  59.377  39.109  1.00 25.10 ? 266  LYS A CA  1 
ATOM   1913 C C   . LYS A 1 265 ? 57.882  60.400  38.767  1.00 24.82 ? 266  LYS A C   1 
ATOM   1914 O O   . LYS A 1 265 ? 58.767  60.661  39.583  1.00 21.81 ? 266  LYS A O   1 
ATOM   1915 C CB  . LYS A 1 265 ? 57.221  58.039  38.467  1.00 27.80 ? 266  LYS A CB  1 
ATOM   1916 C CG  . LYS A 1 265 ? 56.426  56.827  38.924  1.00 31.96 ? 266  LYS A CG  1 
ATOM   1917 C CD  . LYS A 1 265 ? 56.678  56.523  40.375  1.00 34.27 ? 266  LYS A CD  1 
ATOM   1918 C CE  . LYS A 1 265 ? 55.739  55.437  40.877  1.00 35.20 ? 266  LYS A CE  1 
ATOM   1919 N NZ  . LYS A 1 265 ? 56.133  54.974  42.255  1.00 41.57 ? 266  LYS A NZ  1 
ATOM   1920 N N   . LEU A 1 266 ? 57.782  60.998  37.576  1.00 18.75 ? 267  LEU A N   1 
ATOM   1921 C CA  . LEU A 1 266 ? 58.779  61.965  37.122  1.00 17.08 ? 267  LEU A CA  1 
ATOM   1922 C C   . LEU A 1 266 ? 59.018  63.115  38.093  1.00 19.21 ? 267  LEU A C   1 
ATOM   1923 O O   . LEU A 1 266 ? 60.091  63.707  38.096  1.00 19.31 ? 267  LEU A O   1 
ATOM   1924 C CB  . LEU A 1 266 ? 58.395  62.553  35.738  1.00 17.18 ? 267  LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 266 ? 58.184  61.570  34.586  1.00 16.19 ? 267  LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 266 ? 57.726  62.319  33.296  1.00 15.34 ? 267  LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 266 ? 59.507  60.833  34.312  1.00 17.44 ? 267  LEU A CD2 1 
ATOM   1928 N N   . PHE A 1 267 ? 58.029  63.431  38.914  1.00 18.87 ? 268  PHE A N   1 
ATOM   1929 C CA  . PHE A 1 267 ? 58.210  64.547  39.833  1.00 22.02 ? 268  PHE A CA  1 
ATOM   1930 C C   . PHE A 1 267 ? 58.617  64.093  41.219  1.00 24.49 ? 268  PHE A C   1 
ATOM   1931 O O   . PHE A 1 267 ? 58.678  64.900  42.166  1.00 22.49 ? 268  PHE A O   1 
ATOM   1932 C CB  . PHE A 1 267 ? 56.933  65.376  39.866  1.00 20.49 ? 268  PHE A CB  1 
ATOM   1933 C CG  . PHE A 1 267 ? 56.627  66.041  38.514  1.00 18.08 ? 268  PHE A CG  1 
ATOM   1934 C CD1 . PHE A 1 267 ? 55.593  65.584  37.719  1.00 18.66 ? 268  PHE A CD1 1 
ATOM   1935 C CD2 . PHE A 1 267 ? 57.414  67.098  38.059  1.00 19.39 ? 268  PHE A CD2 1 
ATOM   1936 C CE1 . PHE A 1 267 ? 55.342  66.174  36.482  1.00 17.24 ? 268  PHE A CE1 1 
ATOM   1937 C CE2 . PHE A 1 267 ? 57.184  67.705  36.811  1.00 20.05 ? 268  PHE A CE2 1 
ATOM   1938 C CZ  . PHE A 1 267 ? 56.145  67.233  36.030  1.00 16.56 ? 268  PHE A CZ  1 
ATOM   1939 N N   . GLU A 1 268 ? 58.889  62.802  41.344  1.00 24.15 ? 269  GLU A N   1 
ATOM   1940 C CA  . GLU A 1 268 ? 59.317  62.274  42.640  1.00 27.42 ? 269  GLU A CA  1 
ATOM   1941 C C   . GLU A 1 268 ? 60.818  62.189  42.856  1.00 28.65 ? 269  GLU A C   1 
ATOM   1942 O O   . GLU A 1 268 ? 61.263  61.932  43.980  1.00 30.80 ? 269  GLU A O   1 
ATOM   1943 C CB  . GLU A 1 268 ? 58.665  60.930  42.883  1.00 28.65 ? 269  GLU A CB  1 
ATOM   1944 C CG  . GLU A 1 268 ? 57.199  61.070  43.219  1.00 26.79 ? 269  GLU A CG  1 
ATOM   1945 C CD  . GLU A 1 268 ? 56.506  59.743  43.199  1.00 30.75 ? 269  GLU A CD  1 
ATOM   1946 O OE1 . GLU A 1 268 ? 57.207  58.720  43.026  1.00 34.60 ? 269  GLU A OE1 1 
ATOM   1947 O OE2 . GLU A 1 268 ? 55.278  59.715  43.349  1.00 33.62 ? 269  GLU A OE2 1 
ATOM   1948 N N   . SER A 1 269 ? 61.607  62.429  41.809  1.00 27.39 ? 270  SER A N   1 
ATOM   1949 C CA  . SER A 1 269 ? 63.063  62.419  41.928  1.00 29.37 ? 270  SER A CA  1 
ATOM   1950 C C   . SER A 1 269 ? 63.543  63.106  40.696  1.00 29.21 ? 270  SER A C   1 
ATOM   1951 O O   . SER A 1 269 ? 62.754  63.278  39.776  1.00 28.46 ? 270  SER A O   1 
ATOM   1952 C CB  . SER A 1 269 ? 63.620  60.988  41.963  1.00 31.99 ? 270  SER A CB  1 
ATOM   1953 O OG  . SER A 1 269 ? 63.540  60.382  40.690  1.00 36.24 ? 270  SER A OG  1 
ATOM   1954 N N   . SER A 1 270 ? 64.813  63.506  40.652  1.00 26.15 ? 271  SER A N   1 
ATOM   1955 C CA  . SER A 1 270 ? 65.319  64.169  39.453  1.00 26.97 ? 271  SER A CA  1 
ATOM   1956 C C   . SER A 1 270 ? 66.222  63.246  38.624  1.00 26.12 ? 271  SER A C   1 
ATOM   1957 O O   . SER A 1 270 ? 67.002  63.720  37.803  1.00 27.24 ? 271  SER A O   1 
ATOM   1958 C CB  . SER A 1 270 ? 66.103  65.436  39.829  1.00 29.06 ? 271  SER A CB  1 
ATOM   1959 O OG  . SER A 1 270 ? 67.312  65.099  40.533  1.00 27.42 ? 271  SER A OG  1 
ATOM   1960 N N   . GLU A 1 271 ? 66.132  61.936  38.838  1.00 25.59 ? 272  GLU A N   1 
ATOM   1961 C CA  . GLU A 1 271 ? 66.967  61.016  38.078  1.00 28.63 ? 272  GLU A CA  1 
ATOM   1962 C C   . GLU A 1 271 ? 66.207  59.840  37.442  1.00 27.89 ? 272  GLU A C   1 
ATOM   1963 O O   . GLU A 1 271 ? 66.820  58.858  37.048  1.00 25.65 ? 272  GLU A O   1 
ATOM   1964 C CB  . GLU A 1 271 ? 68.114  60.485  38.959  1.00 35.58 ? 272  GLU A CB  1 
ATOM   1965 C CG  . GLU A 1 271 ? 67.751  60.162  40.397  1.00 43.47 ? 272  GLU A CG  1 
ATOM   1966 C CD  . GLU A 1 271 ? 68.037  61.328  41.379  1.00 49.86 ? 272  GLU A CD  1 
ATOM   1967 O OE1 . GLU A 1 271 ? 69.208  61.796  41.464  1.00 51.32 ? 272  GLU A OE1 1 
ATOM   1968 O OE2 . GLU A 1 271 ? 67.080  61.770  42.071  1.00 53.39 ? 272  GLU A OE2 1 
ATOM   1969 N N   . GLY A 1 272 ? 64.879  59.940  37.349  1.00 25.45 ? 273  GLY A N   1 
ATOM   1970 C CA  . GLY A 1 272 ? 64.098  58.863  36.761  1.00 23.55 ? 273  GLY A CA  1 
ATOM   1971 C C   . GLY A 1 272 ? 64.308  58.812  35.252  1.00 22.97 ? 273  GLY A C   1 
ATOM   1972 O O   . GLY A 1 272 ? 64.512  59.847  34.602  1.00 22.11 ? 273  GLY A O   1 
ATOM   1973 N N   . VAL A 1 273 ? 64.314  57.609  34.691  1.00 22.16 ? 274  VAL A N   1 
ATOM   1974 C CA  . VAL A 1 273 ? 64.464  57.443  33.237  1.00 24.19 ? 274  VAL A CA  1 
ATOM   1975 C C   . VAL A 1 273 ? 63.417  56.436  32.869  1.00 22.86 ? 274  VAL A C   1 
ATOM   1976 O O   . VAL A 1 273 ? 63.579  55.226  33.066  1.00 22.69 ? 274  VAL A O   1 
ATOM   1977 C CB  . VAL A 1 273 ? 65.859  56.969  32.845  1.00 23.11 ? 274  VAL A CB  1 
ATOM   1978 C CG1 . VAL A 1 273 ? 65.917  56.668  31.346  1.00 26.40 ? 274  VAL A CG1 1 
ATOM   1979 C CG2 . VAL A 1 273 ? 66.860  58.086  33.190  1.00 23.34 ? 274  VAL A CG2 1 
ATOM   1980 N N   . PHE A 1 274 ? 62.318  56.957  32.333  1.00 20.12 ? 275  PHE A N   1 
ATOM   1981 C CA  . PHE A 1 274 ? 61.168  56.138  32.013  1.00 20.68 ? 275  PHE A CA  1 
ATOM   1982 C C   . PHE A 1 274 ? 61.050  55.792  30.541  1.00 20.61 ? 275  PHE A C   1 
ATOM   1983 O O   . PHE A 1 274 ? 60.414  56.503  29.777  1.00 20.21 ? 275  PHE A O   1 
ATOM   1984 C CB  . PHE A 1 274 ? 59.890  56.823  32.536  1.00 18.43 ? 275  PHE A CB  1 
ATOM   1985 C CG  . PHE A 1 274 ? 59.693  56.636  34.034  1.00 24.64 ? 275  PHE A CG  1 
ATOM   1986 C CD1 . PHE A 1 274 ? 60.454  57.362  34.942  1.00 23.71 ? 275  PHE A CD1 1 
ATOM   1987 C CD2 . PHE A 1 274 ? 58.823  55.650  34.515  1.00 25.42 ? 275  PHE A CD2 1 
ATOM   1988 C CE1 . PHE A 1 274 ? 60.370  57.109  36.331  1.00 26.74 ? 275  PHE A CE1 1 
ATOM   1989 C CE2 . PHE A 1 274 ? 58.724  55.379  35.909  1.00 27.93 ? 275  PHE A CE2 1 
ATOM   1990 C CZ  . PHE A 1 274 ? 59.496  56.105  36.809  1.00 23.63 ? 275  PHE A CZ  1 
ATOM   1991 N N   . ASP A 1 275 ? 61.709  54.696  30.177  1.00 21.16 ? 276  ASP A N   1 
ATOM   1992 C CA  . ASP A 1 275 ? 61.704  54.166  28.816  1.00 21.37 ? 276  ASP A CA  1 
ATOM   1993 C C   . ASP A 1 275 ? 61.090  52.753  29.002  1.00 20.54 ? 276  ASP A C   1 
ATOM   1994 O O   . ASP A 1 275 ? 60.504  52.453  30.029  1.00 23.00 ? 276  ASP A O   1 
ATOM   1995 C CB  . ASP A 1 275 ? 63.149  54.101  28.281  1.00 18.17 ? 276  ASP A CB  1 
ATOM   1996 C CG  . ASP A 1 275 ? 63.219  53.921  26.771  1.00 20.89 ? 276  ASP A CG  1 
ATOM   1997 O OD1 . ASP A 1 275 ? 62.205  53.478  26.179  1.00 18.83 ? 276  ASP A OD1 1 
ATOM   1998 O OD2 . ASP A 1 275 ? 64.323  54.172  26.169  1.00 23.84 ? 276  ASP A OD2 1 
ATOM   1999 N N   . ALA A 1 276 ? 61.254  51.876  28.043  1.00 20.12 ? 277  ALA A N   1 
ATOM   2000 C CA  . ALA A 1 276 ? 60.633  50.559  28.146  1.00 21.29 ? 277  ALA A CA  1 
ATOM   2001 C C   . ALA A 1 276 ? 60.852  49.805  29.476  1.00 23.05 ? 277  ALA A C   1 
ATOM   2002 O O   . ALA A 1 276 ? 59.906  49.351  30.105  1.00 24.22 ? 277  ALA A O   1 
ATOM   2003 C CB  . ALA A 1 276 ? 61.089  49.689  26.958  1.00 24.81 ? 277  ALA A CB  1 
ATOM   2004 N N   . GLU A 1 277 ? 62.088  49.685  29.897  1.00 21.76 ? 278  GLU A N   1 
ATOM   2005 C CA  . GLU A 1 277 ? 62.400  48.935  31.119  1.00 25.49 ? 278  GLU A CA  1 
ATOM   2006 C C   . GLU A 1 277 ? 61.637  49.382  32.342  1.00 23.38 ? 278  GLU A C   1 
ATOM   2007 O O   . GLU A 1 277 ? 60.861  48.618  32.900  1.00 24.49 ? 278  GLU A O   1 
ATOM   2008 C CB  . GLU A 1 277 ? 63.899  49.003  31.404  1.00 25.46 ? 278  GLU A CB  1 
ATOM   2009 C CG  . GLU A 1 277 ? 64.754  48.268  30.358  1.00 28.44 ? 278  GLU A CG  1 
ATOM   2010 C CD  . GLU A 1 277 ? 65.149  49.157  29.161  1.00 30.94 ? 278  GLU A CD  1 
ATOM   2011 O OE1 . GLU A 1 277 ? 66.058  48.741  28.378  1.00 29.57 ? 278  GLU A OE1 1 
ATOM   2012 O OE2 . GLU A 1 277 ? 64.567  50.255  29.014  1.00 25.82 ? 278  GLU A OE2 1 
ATOM   2013 N N   . GLU A 1 278 ? 61.842  50.634  32.739  1.00 22.43 ? 279  GLU A N   1 
ATOM   2014 C CA  . GLU A 1 278 ? 61.165  51.179  33.913  1.00 24.61 ? 279  GLU A CA  1 
ATOM   2015 C C   . GLU A 1 278 ? 59.620  51.218  33.786  1.00 23.36 ? 279  GLU A C   1 
ATOM   2016 O O   . GLU A 1 278 ? 58.877  50.934  34.750  1.00 22.87 ? 279  GLU A O   1 
ATOM   2017 C CB  . GLU A 1 278 ? 61.724  52.587  34.186  1.00 26.18 ? 279  GLU A CB  1 
ATOM   2018 C CG  . GLU A 1 278 ? 61.580  53.041  35.600  1.00 34.24 ? 279  GLU A CG  1 
ATOM   2019 C CD  . GLU A 1 278 ? 62.448  52.209  36.555  1.00 36.17 ? 279  GLU A CD  1 
ATOM   2020 O OE1 . GLU A 1 278 ? 63.680  52.130  36.354  1.00 40.86 ? 279  GLU A OE1 1 
ATOM   2021 O OE2 . GLU A 1 278 ? 61.891  51.626  37.495  1.00 39.35 ? 279  GLU A OE2 1 
ATOM   2022 N N   . ILE A 1 279 ? 59.118  51.565  32.601  1.00 22.59 ? 280  ILE A N   1 
ATOM   2023 C CA  . ILE A 1 279 ? 57.678  51.615  32.400  1.00 21.22 ? 280  ILE A CA  1 
ATOM   2024 C C   . ILE A 1 279 ? 57.082  50.213  32.529  1.00 19.11 ? 280  ILE A C   1 
ATOM   2025 O O   . ILE A 1 279 ? 56.021  50.026  33.123  1.00 18.19 ? 280  ILE A O   1 
ATOM   2026 C CB  . ILE A 1 279 ? 57.348  52.205  31.015  1.00 19.86 ? 280  ILE A CB  1 
ATOM   2027 C CG1 . ILE A 1 279 ? 57.767  53.694  31.002  1.00 19.97 ? 280  ILE A CG1 1 
ATOM   2028 C CG2 . ILE A 1 279 ? 55.873  51.996  30.699  1.00 16.16 ? 280  ILE A CG2 1 
ATOM   2029 C CD1 . ILE A 1 279 ? 57.631  54.374  29.631  1.00 18.06 ? 280  ILE A CD1 1 
ATOM   2030 N N   . TYR A 1 280 ? 57.777  49.229  31.980  1.00 19.09 ? 281  TYR A N   1 
ATOM   2031 C CA  . TYR A 1 280 ? 57.285  47.844  32.066  1.00 21.19 ? 281  TYR A CA  1 
ATOM   2032 C C   . TYR A 1 280 ? 57.359  47.361  33.529  1.00 23.27 ? 281  TYR A C   1 
ATOM   2033 O O   . TYR A 1 280 ? 56.494  46.611  34.020  1.00 23.70 ? 281  TYR A O   1 
ATOM   2034 C CB  . TYR A 1 280 ? 58.118  46.922  31.175  1.00 22.46 ? 281  TYR A CB  1 
ATOM   2035 C CG  . TYR A 1 280 ? 57.641  45.477  31.247  1.00 23.06 ? 281  TYR A CG  1 
ATOM   2036 C CD1 . TYR A 1 280 ? 56.299  45.156  30.994  1.00 24.49 ? 281  TYR A CD1 1 
ATOM   2037 C CD2 . TYR A 1 280 ? 58.512  44.452  31.611  1.00 26.72 ? 281  TYR A CD2 1 
ATOM   2038 C CE1 . TYR A 1 280 ? 55.825  43.836  31.114  1.00 28.31 ? 281  TYR A CE1 1 
ATOM   2039 C CE2 . TYR A 1 280 ? 58.061  43.122  31.724  1.00 28.58 ? 281  TYR A CE2 1 
ATOM   2040 C CZ  . TYR A 1 280 ? 56.717  42.832  31.476  1.00 27.54 ? 281  TYR A CZ  1 
ATOM   2041 O OH  . TYR A 1 280 ? 56.275  41.541  31.572  1.00 27.93 ? 281  TYR A OH  1 
ATOM   2042 N N   . LYS A 1 281 ? 58.393  47.786  34.228  1.00 23.75 ? 282  LYS A N   1 
ATOM   2043 C CA  . LYS A 1 281 ? 58.508  47.423  35.649  1.00 24.87 ? 282  LYS A CA  1 
ATOM   2044 C C   . LYS A 1 281 ? 57.219  47.964  36.362  1.00 24.60 ? 282  LYS A C   1 
ATOM   2045 O O   . LYS A 1 281 ? 56.500  47.227  37.063  1.00 21.32 ? 282  LYS A O   1 
ATOM   2046 C CB  . LYS A 1 281 ? 59.777  48.072  36.205  1.00 25.99 ? 282  LYS A CB  1 
ATOM   2047 C CG  . LYS A 1 281 ? 60.080  47.741  37.628  1.00 30.99 ? 282  LYS A CG  1 
ATOM   2048 C CD  . LYS A 1 281 ? 61.206  48.608  38.144  1.00 36.96 ? 282  LYS A CD  1 
ATOM   2049 C CE  . LYS A 1 281 ? 61.499  48.322  39.616  1.00 40.48 ? 282  LYS A CE  1 
ATOM   2050 N NZ  . LYS A 1 281 ? 62.102  46.973  39.759  1.00 48.00 ? 282  LYS A NZ  1 
ATOM   2051 N N   . LEU A 1 282 ? 56.888  49.232  36.140  1.00 21.62 ? 283  LEU A N   1 
ATOM   2052 C CA  . LEU A 1 282 ? 55.669  49.791  36.777  1.00 21.07 ? 283  LEU A CA  1 
ATOM   2053 C C   . LEU A 1 282 ? 54.341  49.111  36.353  1.00 22.50 ? 283  LEU A C   1 
ATOM   2054 O O   . LEU A 1 282 ? 53.417  48.922  37.184  1.00 23.25 ? 283  LEU A O   1 
ATOM   2055 C CB  . LEU A 1 282 ? 55.611  51.317  36.554  1.00 20.07 ? 283  LEU A CB  1 
ATOM   2056 C CG  . LEU A 1 282 ? 54.464  52.075  37.282  1.00 24.18 ? 283  LEU A CG  1 
ATOM   2057 C CD1 . LEU A 1 282 ? 54.433  51.762  38.813  1.00 26.70 ? 283  LEU A CD1 1 
ATOM   2058 C CD2 . LEU A 1 282 ? 54.650  53.580  37.063  1.00 22.43 ? 283  LEU A CD2 1 
ATOM   2059 N N   . ALA A 1 283 ? 54.243  48.745  35.064  1.00 21.21 ? 284  ALA A N   1 
ATOM   2060 C CA  . ALA A 1 283 ? 53.088  48.059  34.519  1.00 21.00 ? 284  ALA A CA  1 
ATOM   2061 C C   . ALA A 1 283 ? 52.905  46.722  35.253  1.00 20.50 ? 284  ALA A C   1 
ATOM   2062 O O   . ALA A 1 283 ? 51.788  46.368  35.619  1.00 21.22 ? 284  ALA A O   1 
ATOM   2063 C CB  . ALA A 1 283 ? 53.280  47.802  32.995  1.00 21.98 ? 284  ALA A CB  1 
ATOM   2064 N N   . LYS A 1 284 ? 53.979  45.978  35.489  1.00 20.00 ? 285  LYS A N   1 
ATOM   2065 C CA  . LYS A 1 284 ? 53.761  44.709  36.225  1.00 25.96 ? 285  LYS A CA  1 
ATOM   2066 C C   . LYS A 1 284 ? 53.226  44.956  37.659  1.00 27.80 ? 285  LYS A C   1 
ATOM   2067 O O   . LYS A 1 284 ? 52.425  44.170  38.174  1.00 27.71 ? 285  LYS A O   1 
ATOM   2068 C CB  . LYS A 1 284 ? 55.048  43.861  36.286  1.00 26.28 ? 285  LYS A CB  1 
ATOM   2069 C CG  . LYS A 1 284 ? 55.561  43.412  34.921  1.00 27.03 ? 285  LYS A CG  1 
ATOM   2070 C CD  . LYS A 1 284 ? 56.862  42.545  35.009  1.00 28.72 ? 285  LYS A CD  1 
ATOM   2071 C CE  . LYS A 1 284 ? 56.557  41.080  35.363  1.00 27.73 ? 285  LYS A CE  1 
ATOM   2072 N NZ  . LYS A 1 284 ? 57.757  40.150  35.315  1.00 25.13 ? 285  LYS A NZ  1 
ATOM   2073 N N   . GLU A 1 285 ? 53.642  46.050  38.303  1.00 28.17 ? 286  GLU A N   1 
ATOM   2074 C CA  . GLU A 1 285 ? 53.164  46.324  39.674  1.00 29.52 ? 286  GLU A CA  1 
ATOM   2075 C C   . GLU A 1 285 ? 51.708  46.705  39.663  1.00 29.37 ? 286  GLU A C   1 
ATOM   2076 O O   . GLU A 1 285 ? 51.007  46.531  40.656  1.00 27.51 ? 286  GLU A O   1 
ATOM   2077 C CB  . GLU A 1 285 ? 53.848  47.519  40.307  1.00 31.04 ? 286  GLU A CB  1 
ATOM   2078 C CG  . GLU A 1 285 ? 55.330  47.538  40.321  1.00 37.30 ? 286  GLU A CG  1 
ATOM   2079 C CD  . GLU A 1 285 ? 55.823  48.891  40.845  1.00 40.41 ? 286  GLU A CD  1 
ATOM   2080 O OE1 . GLU A 1 285 ? 56.942  49.283  40.449  1.00 45.32 ? 286  GLU A OE1 1 
ATOM   2081 O OE2 . GLU A 1 285 ? 55.079  49.546  41.642  1.00 39.51 ? 286  GLU A OE2 1 
ATOM   2082 N N   . MET A 1 286 ? 51.277  47.292  38.545  1.00 27.32 ? 287  MET A N   1 
ATOM   2083 C CA  . MET A 1 286 ? 49.923  47.754  38.410  1.00 25.81 ? 287  MET A CA  1 
ATOM   2084 C C   . MET A 1 286 ? 48.955  46.784  37.759  1.00 28.35 ? 287  MET A C   1 
ATOM   2085 O O   . MET A 1 286 ? 47.773  46.885  38.022  1.00 28.42 ? 287  MET A O   1 
ATOM   2086 C CB  . MET A 1 286 ? 49.896  49.078  37.621  1.00 23.76 ? 287  MET A CB  1 
ATOM   2087 C CG  . MET A 1 286 ? 50.613  50.214  38.315  1.00 23.78 ? 287  MET A CG  1 
ATOM   2088 S SD  . MET A 1 286 ? 50.591  51.783  37.326  1.00 26.22 ? 287  MET A SD  1 
ATOM   2089 C CE  . MET A 1 286 ? 48.836  52.232  37.451  1.00 20.89 ? 287  MET A CE  1 
ATOM   2090 N N   . ALA A 1 287 ? 49.449  45.842  36.944  1.00 26.93 ? 288  ALA A N   1 
ATOM   2091 C CA  . ALA A 1 287 ? 48.556  44.947  36.209  1.00 29.56 ? 288  ALA A CA  1 
ATOM   2092 C C   . ALA A 1 287 ? 47.585  44.156  37.067  1.00 32.40 ? 288  ALA A C   1 
ATOM   2093 O O   . ALA A 1 287 ? 47.961  43.780  38.205  1.00 34.72 ? 288  ALA A O   1 
ATOM   2094 C CB  . ALA A 1 287 ? 49.368  43.996  35.317  1.00 23.99 ? 288  ALA A CB  1 
ATOM   2095 O OXT . ALA A 1 287 ? 46.453  43.918  36.573  1.00 35.83 ? 288  ALA A OXT 1 
ATOM   2096 N N   . SER B 1 1   ? 41.740  87.370  39.556  1.00 34.15 ? 2    SER B N   1 
ATOM   2097 C CA  . SER B 1 1   ? 42.220  87.117  38.181  1.00 31.88 ? 2    SER B CA  1 
ATOM   2098 C C   . SER B 1 1   ? 43.518  86.314  38.270  1.00 31.06 ? 2    SER B C   1 
ATOM   2099 O O   . SER B 1 1   ? 44.328  86.562  39.154  1.00 32.15 ? 2    SER B O   1 
ATOM   2100 C CB  . SER B 1 1   ? 42.514  88.446  37.457  1.00 33.68 ? 2    SER B CB  1 
ATOM   2101 O OG  . SER B 1 1   ? 41.350  89.253  37.373  1.00 40.43 ? 2    SER B OG  1 
ATOM   2102 N N   . LYS B 1 2   ? 43.713  85.357  37.369  1.00 24.55 ? 3    LYS B N   1 
ATOM   2103 C CA  . LYS B 1 2   ? 44.947  84.580  37.364  1.00 22.71 ? 3    LYS B CA  1 
ATOM   2104 C C   . LYS B 1 2   ? 46.030  85.465  36.728  1.00 23.20 ? 3    LYS B C   1 
ATOM   2105 O O   . LYS B 1 2   ? 45.745  86.268  35.824  1.00 19.33 ? 3    LYS B O   1 
ATOM   2106 C CB  . LYS B 1 2   ? 44.785  83.297  36.557  1.00 24.28 ? 3    LYS B CB  1 
ATOM   2107 C CG  . LYS B 1 2   ? 43.845  82.244  37.231  1.00 28.52 ? 3    LYS B CG  1 
ATOM   2108 C CD  . LYS B 1 2   ? 44.405  81.850  38.615  1.00 35.38 ? 3    LYS B CD  1 
ATOM   2109 C CE  . LYS B 1 2   ? 43.547  80.802  39.314  1.00 39.64 ? 3    LYS B CE  1 
ATOM   2110 N NZ  . LYS B 1 2   ? 43.948  80.660  40.771  1.00 43.26 ? 3    LYS B NZ  1 
ATOM   2111 N N   . LYS B 1 3   ? 47.265  85.309  37.195  1.00 19.15 ? 4    LYS B N   1 
ATOM   2112 C CA  . LYS B 1 3   ? 48.381  86.094  36.701  1.00 18.15 ? 4    LYS B CA  1 
ATOM   2113 C C   . LYS B 1 3   ? 48.865  85.453  35.424  1.00 21.87 ? 4    LYS B C   1 
ATOM   2114 O O   . LYS B 1 3   ? 49.470  84.351  35.421  1.00 19.45 ? 4    LYS B O   1 
ATOM   2115 C CB  . LYS B 1 3   ? 49.480  86.129  37.757  1.00 19.93 ? 4    LYS B CB  1 
ATOM   2116 C CG  . LYS B 1 3   ? 49.086  86.990  38.958  1.00 20.93 ? 4    LYS B CG  1 
ATOM   2117 C CD  . LYS B 1 3   ? 50.176  87.061  40.026  1.00 22.54 ? 4    LYS B CD  1 
ATOM   2118 C CE  . LYS B 1 3   ? 50.255  85.802  40.796  1.00 29.14 ? 4    LYS B CE  1 
ATOM   2119 N NZ  . LYS B 1 3   ? 51.253  85.967  41.944  1.00 35.11 ? 4    LYS B NZ  1 
ATOM   2120 N N   . LEU B 1 4   ? 48.600  86.160  34.333  1.00 20.06 ? 5    LEU B N   1 
ATOM   2121 C CA  . LEU B 1 4   ? 48.936  85.664  32.998  1.00 19.43 ? 5    LEU B CA  1 
ATOM   2122 C C   . LEU B 1 4   ? 50.177  86.293  32.415  1.00 19.46 ? 5    LEU B C   1 
ATOM   2123 O O   . LEU B 1 4   ? 50.190  87.511  32.195  1.00 18.28 ? 5    LEU B O   1 
ATOM   2124 C CB  . LEU B 1 4   ? 47.770  85.973  32.065  1.00 17.36 ? 5    LEU B CB  1 
ATOM   2125 C CG  . LEU B 1 4   ? 46.371  85.426  32.477  1.00 18.05 ? 5    LEU B CG  1 
ATOM   2126 C CD1 . LEU B 1 4   ? 45.412  85.651  31.335  1.00 14.23 ? 5    LEU B CD1 1 
ATOM   2127 C CD2 . LEU B 1 4   ? 46.421  83.924  32.812  1.00 17.13 ? 5    LEU B CD2 1 
ATOM   2128 N N   . LEU B 1 5   ? 51.202  85.488  32.137  1.00 16.22 ? 6    LEU B N   1 
ATOM   2129 C CA  . LEU B 1 5   ? 52.396  86.063  31.541  1.00 17.53 ? 6    LEU B CA  1 
ATOM   2130 C C   . LEU B 1 5   ? 52.419  85.655  30.048  1.00 17.21 ? 6    LEU B C   1 
ATOM   2131 O O   . LEU B 1 5   ? 52.256  84.467  29.724  1.00 18.22 ? 6    LEU B O   1 
ATOM   2132 C CB  . LEU B 1 5   ? 53.683  85.536  32.191  1.00 17.62 ? 6    LEU B CB  1 
ATOM   2133 C CG  . LEU B 1 5   ? 54.956  86.142  31.594  1.00 19.67 ? 6    LEU B CG  1 
ATOM   2134 C CD1 . LEU B 1 5   ? 55.083  87.645  31.978  1.00 19.74 ? 6    LEU B CD1 1 
ATOM   2135 C CD2 . LEU B 1 5   ? 56.162  85.349  32.123  1.00 20.19 ? 6    LEU B CD2 1 
ATOM   2136 N N   . PHE B 1 6   ? 52.572  86.640  29.173  1.00 15.71 ? 7    PHE B N   1 
ATOM   2137 C CA  . PHE B 1 6   ? 52.705  86.348  27.736  1.00 16.70 ? 7    PHE B CA  1 
ATOM   2138 C C   . PHE B 1 6   ? 54.143  86.531  27.330  1.00 18.08 ? 7    PHE B C   1 
ATOM   2139 O O   . PHE B 1 6   ? 54.718  87.617  27.450  1.00 20.17 ? 7    PHE B O   1 
ATOM   2140 C CB  . PHE B 1 6   ? 51.763  87.230  26.925  1.00 19.02 ? 7    PHE B CB  1 
ATOM   2141 C CG  . PHE B 1 6   ? 50.326  86.793  27.068  1.00 18.69 ? 7    PHE B CG  1 
ATOM   2142 C CD1 . PHE B 1 6   ? 49.538  87.313  28.078  1.00 16.46 ? 7    PHE B CD1 1 
ATOM   2143 C CD2 . PHE B 1 6   ? 49.814  85.747  26.273  1.00 17.74 ? 7    PHE B CD2 1 
ATOM   2144 C CE1 . PHE B 1 6   ? 48.243  86.807  28.321  1.00 18.71 ? 7    PHE B CE1 1 
ATOM   2145 C CE2 . PHE B 1 6   ? 48.507  85.233  26.499  1.00 17.45 ? 7    PHE B CE2 1 
ATOM   2146 C CZ  . PHE B 1 6   ? 47.730  85.757  27.512  1.00 17.28 ? 7    PHE B CZ  1 
ATOM   2147 N N   . GLN B 1 7   ? 54.744  85.441  26.864  1.00 16.24 ? 8    GLN B N   1 
ATOM   2148 C CA  . GLN B 1 7   ? 56.138  85.434  26.472  1.00 17.82 ? 8    GLN B CA  1 
ATOM   2149 C C   . GLN B 1 7   ? 56.313  85.572  24.964  1.00 19.17 ? 8    GLN B C   1 
ATOM   2150 O O   . GLN B 1 7   ? 55.831  84.706  24.217  1.00 17.41 ? 8    GLN B O   1 
ATOM   2151 C CB  . GLN B 1 7   ? 56.739  84.099  26.937  1.00 20.01 ? 8    GLN B CB  1 
ATOM   2152 C CG  . GLN B 1 7   ? 58.194  83.836  26.546  1.00 22.35 ? 8    GLN B CG  1 
ATOM   2153 C CD  . GLN B 1 7   ? 58.585  82.398  26.868  1.00 25.22 ? 8    GLN B CD  1 
ATOM   2154 O OE1 . GLN B 1 7   ? 57.700  81.560  27.065  1.00 26.71 ? 8    GLN B OE1 1 
ATOM   2155 N NE2 . GLN B 1 7   ? 59.894  82.092  26.887  1.00 22.52 ? 8    GLN B NE2 1 
ATOM   2156 N N   . PHE B 1 8   ? 57.003  86.634  24.527  1.00 16.10 ? 9    PHE B N   1 
ATOM   2157 C CA  . PHE B 1 8   ? 57.240  86.884  23.113  1.00 17.70 ? 9    PHE B CA  1 
ATOM   2158 C C   . PHE B 1 8   ? 58.736  86.696  22.872  1.00 18.84 ? 9    PHE B C   1 
ATOM   2159 O O   . PHE B 1 8   ? 59.556  87.539  23.255  1.00 20.01 ? 9    PHE B O   1 
ATOM   2160 C CB  . PHE B 1 8   ? 56.774  88.320  22.744  1.00 18.91 ? 9    PHE B CB  1 
ATOM   2161 C CG  . PHE B 1 8   ? 55.295  88.600  23.018  1.00 15.07 ? 9    PHE B CG  1 
ATOM   2162 C CD1 . PHE B 1 8   ? 54.868  89.901  23.398  1.00 18.57 ? 9    PHE B CD1 1 
ATOM   2163 C CD2 . PHE B 1 8   ? 54.329  87.585  22.926  1.00 16.23 ? 9    PHE B CD2 1 
ATOM   2164 C CE1 . PHE B 1 8   ? 53.536  90.173  23.682  1.00 19.30 ? 9    PHE B CE1 1 
ATOM   2165 C CE2 . PHE B 1 8   ? 52.979  87.844  23.212  1.00 20.66 ? 9    PHE B CE2 1 
ATOM   2166 C CZ  . PHE B 1 8   ? 52.574  89.156  23.597  1.00 21.80 ? 9    PHE B CZ  1 
ATOM   2167 N N   . ASP B 1 9   ? 59.083  85.561  22.265  1.00 17.58 ? 10   ASP B N   1 
ATOM   2168 C CA  . ASP B 1 9   ? 60.463  85.209  21.952  1.00 19.70 ? 10   ASP B CA  1 
ATOM   2169 C C   . ASP B 1 9   ? 60.722  85.456  20.453  1.00 21.64 ? 10   ASP B C   1 
ATOM   2170 O O   . ASP B 1 9   ? 59.888  85.103  19.606  1.00 21.62 ? 10   ASP B O   1 
ATOM   2171 C CB  . ASP B 1 9   ? 60.695  83.735  22.290  1.00 19.67 ? 10   ASP B CB  1 
ATOM   2172 C CG  . ASP B 1 9   ? 62.181  83.373  22.413  1.00 25.96 ? 10   ASP B CG  1 
ATOM   2173 O OD1 . ASP B 1 9   ? 62.944  83.593  21.432  1.00 22.72 ? 10   ASP B OD1 1 
ATOM   2174 O OD2 . ASP B 1 9   ? 62.578  82.838  23.502  1.00 24.95 ? 10   ASP B OD2 1 
ATOM   2175 N N   . THR B 1 10  ? 61.872  86.060  20.134  1.00 21.26 ? 11   THR B N   1 
ATOM   2176 C CA  . THR B 1 10  ? 62.226  86.351  18.742  1.00 24.19 ? 11   THR B CA  1 
ATOM   2177 C C   . THR B 1 10  ? 62.829  85.127  18.074  1.00 25.52 ? 11   THR B C   1 
ATOM   2178 O O   . THR B 1 10  ? 62.987  85.093  16.851  1.00 24.28 ? 11   THR B O   1 
ATOM   2179 C CB  . THR B 1 10  ? 63.229  87.555  18.649  1.00 26.63 ? 11   THR B CB  1 
ATOM   2180 O OG1 . THR B 1 10  ? 64.351  87.321  19.513  1.00 24.35 ? 11   THR B OG1 1 
ATOM   2181 C CG2 . THR B 1 10  ? 62.542  88.856  19.098  1.00 25.01 ? 11   THR B CG2 1 
ATOM   2182 N N   . ASP B 1 11  ? 63.178  84.109  18.855  1.00 24.20 ? 12   ASP B N   1 
ATOM   2183 C CA  . ASP B 1 11  ? 63.703  82.888  18.233  1.00 24.87 ? 12   ASP B CA  1 
ATOM   2184 C C   . ASP B 1 11  ? 62.514  82.076  17.749  1.00 26.09 ? 12   ASP B C   1 
ATOM   2185 O O   . ASP B 1 11  ? 61.337  82.432  18.000  1.00 25.17 ? 12   ASP B O   1 
ATOM   2186 C CB  . ASP B 1 11  ? 64.519  82.047  19.220  1.00 28.33 ? 12   ASP B CB  1 
ATOM   2187 C CG  . ASP B 1 11  ? 65.782  82.758  19.679  1.00 32.49 ? 12   ASP B CG  1 
ATOM   2188 O OD1 . ASP B 1 11  ? 66.348  83.555  18.882  1.00 31.40 ? 12   ASP B OD1 1 
ATOM   2189 O OD2 . ASP B 1 11  ? 66.211  82.508  20.821  1.00 29.89 ? 12   ASP B OD2 1 
ATOM   2190 N N   . ALA B 1 12  ? 62.819  80.954  17.108  1.00 24.69 ? 13   ALA B N   1 
ATOM   2191 C CA  . ALA B 1 12  ? 61.770  80.106  16.538  1.00 27.09 ? 13   ALA B CA  1 
ATOM   2192 C C   . ALA B 1 12  ? 60.777  79.549  17.568  1.00 24.56 ? 13   ALA B C   1 
ATOM   2193 O O   . ALA B 1 12  ? 59.601  79.421  17.270  1.00 23.14 ? 13   ALA B O   1 
ATOM   2194 C CB  . ALA B 1 12  ? 62.407  78.979  15.739  1.00 25.56 ? 13   ALA B CB  1 
ATOM   2195 N N   . THR B 1 13  ? 61.253  79.230  18.778  1.00 24.24 ? 14   THR B N   1 
ATOM   2196 C CA  . THR B 1 13  ? 60.376  78.706  19.836  1.00 23.20 ? 14   THR B CA  1 
ATOM   2197 C C   . THR B 1 13  ? 60.764  79.446  21.127  1.00 23.90 ? 14   THR B C   1 
ATOM   2198 O O   . THR B 1 13  ? 61.878  79.966  21.246  1.00 23.03 ? 14   THR B O   1 
ATOM   2199 C CB  . THR B 1 13  ? 60.584  77.179  20.041  1.00 23.60 ? 14   THR B CB  1 
ATOM   2200 O OG1 . THR B 1 13  ? 61.958  76.943  20.359  1.00 21.89 ? 14   THR B OG1 1 
ATOM   2201 C CG2 . THR B 1 13  ? 60.257  76.393  18.744  1.00 22.37 ? 14   THR B CG2 1 
ATOM   2202 N N   . PRO B 1 14  ? 59.858  79.504  22.097  1.00 20.87 ? 15   PRO B N   1 
ATOM   2203 C CA  . PRO B 1 14  ? 60.172  80.210  23.335  1.00 24.35 ? 15   PRO B CA  1 
ATOM   2204 C C   . PRO B 1 14  ? 61.191  79.488  24.201  1.00 24.19 ? 15   PRO B C   1 
ATOM   2205 O O   . PRO B 1 14  ? 61.225  78.259  24.274  1.00 22.82 ? 15   PRO B O   1 
ATOM   2206 C CB  . PRO B 1 14  ? 58.808  80.326  24.035  1.00 24.39 ? 15   PRO B CB  1 
ATOM   2207 C CG  . PRO B 1 14  ? 57.794  80.049  22.930  1.00 20.98 ? 15   PRO B CG  1 
ATOM   2208 C CD  . PRO B 1 14  ? 58.472  79.014  22.114  1.00 23.12 ? 15   PRO B CD  1 
ATOM   2209 N N   . SER B 1 15  ? 62.017  80.290  24.860  1.00 23.78 ? 16   SER B N   1 
ATOM   2210 C CA  . SER B 1 15  ? 63.058  79.784  25.739  1.00 22.57 ? 16   SER B CA  1 
ATOM   2211 C C   . SER B 1 15  ? 62.497  78.954  26.904  1.00 20.27 ? 16   SER B C   1 
ATOM   2212 O O   . SER B 1 15  ? 61.629  79.445  27.623  1.00 20.51 ? 16   SER B O   1 
ATOM   2213 C CB  . SER B 1 15  ? 63.831  80.961  26.327  1.00 23.37 ? 16   SER B CB  1 
ATOM   2214 O OG  . SER B 1 15  ? 64.551  80.533  27.482  1.00 23.30 ? 16   SER B OG  1 
ATOM   2215 N N   . VAL B 1 16  ? 62.994  77.730  27.087  1.00 17.87 ? 17   VAL B N   1 
ATOM   2216 C CA  . VAL B 1 16  ? 62.547  76.889  28.218  1.00 18.66 ? 17   VAL B CA  1 
ATOM   2217 C C   . VAL B 1 16  ? 63.044  77.572  29.535  1.00 19.89 ? 17   VAL B C   1 
ATOM   2218 O O   . VAL B 1 16  ? 62.339  77.637  30.552  1.00 20.59 ? 17   VAL B O   1 
ATOM   2219 C CB  . VAL B 1 16  ? 63.146  75.419  28.118  1.00 19.94 ? 17   VAL B CB  1 
ATOM   2220 C CG1 . VAL B 1 16  ? 62.981  74.678  29.443  1.00 19.57 ? 17   VAL B CG1 1 
ATOM   2221 C CG2 . VAL B 1 16  ? 62.428  74.621  27.010  1.00 18.22 ? 17   VAL B CG2 1 
ATOM   2222 N N   . PHE B 1 17  ? 64.272  78.072  29.501  1.00 20.54 ? 18   PHE B N   1 
ATOM   2223 C CA  . PHE B 1 17  ? 64.862  78.773  30.668  1.00 19.28 ? 18   PHE B CA  1 
ATOM   2224 C C   . PHE B 1 17  ? 63.904  79.852  31.188  1.00 17.42 ? 18   PHE B C   1 
ATOM   2225 O O   . PHE B 1 17  ? 63.599  79.898  32.372  1.00 16.39 ? 18   PHE B O   1 
ATOM   2226 C CB  . PHE B 1 17  ? 66.187  79.438  30.255  1.00 21.88 ? 18   PHE B CB  1 
ATOM   2227 C CG  . PHE B 1 17  ? 66.975  79.993  31.409  1.00 24.32 ? 18   PHE B CG  1 
ATOM   2228 C CD1 . PHE B 1 17  ? 68.065  79.290  31.915  1.00 27.07 ? 18   PHE B CD1 1 
ATOM   2229 C CD2 . PHE B 1 17  ? 66.597  81.174  32.023  1.00 22.74 ? 18   PHE B CD2 1 
ATOM   2230 C CE1 . PHE B 1 17  ? 68.776  79.753  33.034  1.00 29.01 ? 18   PHE B CE1 1 
ATOM   2231 C CE2 . PHE B 1 17  ? 67.295  81.651  33.138  1.00 27.79 ? 18   PHE B CE2 1 
ATOM   2232 C CZ  . PHE B 1 17  ? 68.391  80.930  33.644  1.00 27.37 ? 18   PHE B CZ  1 
ATOM   2233 N N   . ASP B 1 18  ? 63.393  80.696  30.296  1.00 17.96 ? 19   ASP B N   1 
ATOM   2234 C CA  . ASP B 1 18  ? 62.489  81.795  30.701  1.00 16.50 ? 19   ASP B CA  1 
ATOM   2235 C C   . ASP B 1 18  ? 61.137  81.319  31.241  1.00 18.79 ? 19   ASP B C   1 
ATOM   2236 O O   . ASP B 1 18  ? 60.506  81.991  32.080  1.00 17.25 ? 19   ASP B O   1 
ATOM   2237 C CB  . ASP B 1 18  ? 62.283  82.782  29.524  1.00 20.15 ? 19   ASP B CB  1 
ATOM   2238 C CG  . ASP B 1 18  ? 63.600  83.464  29.090  1.00 22.69 ? 19   ASP B CG  1 
ATOM   2239 O OD1 . ASP B 1 18  ? 64.441  83.697  29.990  1.00 22.94 ? 19   ASP B OD1 1 
ATOM   2240 O OD2 . ASP B 1 18  ? 63.787  83.777  27.873  1.00 22.43 ? 19   ASP B OD2 1 
ATOM   2241 N N   . VAL B 1 19  ? 60.681  80.162  30.755  1.00 17.59 ? 20   VAL B N   1 
ATOM   2242 C CA  . VAL B 1 19  ? 59.403  79.597  31.241  1.00 17.04 ? 20   VAL B CA  1 
ATOM   2243 C C   . VAL B 1 19  ? 59.529  79.156  32.697  1.00 17.22 ? 20   VAL B C   1 
ATOM   2244 O O   . VAL B 1 19  ? 58.673  79.468  33.538  1.00 18.24 ? 20   VAL B O   1 
ATOM   2245 C CB  . VAL B 1 19  ? 58.984  78.373  30.431  1.00 13.02 ? 20   VAL B CB  1 
ATOM   2246 C CG1 . VAL B 1 19  ? 57.774  77.706  31.075  1.00 16.18 ? 20   VAL B CG1 1 
ATOM   2247 C CG2 . VAL B 1 19  ? 58.621  78.792  29.009  1.00 17.35 ? 20   VAL B CG2 1 
ATOM   2248 N N   . VAL B 1 20  ? 60.570  78.400  33.014  1.00 17.01 ? 21   VAL B N   1 
ATOM   2249 C CA  . VAL B 1 20  ? 60.727  77.956  34.384  1.00 16.34 ? 21   VAL B CA  1 
ATOM   2250 C C   . VAL B 1 20  ? 60.843  79.171  35.323  1.00 16.02 ? 21   VAL B C   1 
ATOM   2251 O O   . VAL B 1 20  ? 60.162  79.264  36.339  1.00 18.01 ? 21   VAL B O   1 
ATOM   2252 C CB  . VAL B 1 20  ? 61.992  77.100  34.548  1.00 16.56 ? 21   VAL B CB  1 
ATOM   2253 C CG1 . VAL B 1 20  ? 62.174  76.694  35.992  1.00 15.57 ? 21   VAL B CG1 1 
ATOM   2254 C CG2 . VAL B 1 20  ? 61.905  75.870  33.669  1.00 16.10 ? 21   VAL B CG2 1 
ATOM   2255 N N   . VAL B 1 21  ? 61.717  80.097  34.982  1.00 17.11 ? 22   VAL B N   1 
ATOM   2256 C CA  . VAL B 1 21  ? 61.913  81.252  35.868  1.00 19.24 ? 22   VAL B CA  1 
ATOM   2257 C C   . VAL B 1 21  ? 60.628  82.070  35.985  1.00 18.59 ? 22   VAL B C   1 
ATOM   2258 O O   . VAL B 1 21  ? 60.301  82.555  37.045  1.00 17.91 ? 22   VAL B O   1 
ATOM   2259 C CB  . VAL B 1 21  ? 63.054  82.106  35.372  1.00 19.11 ? 22   VAL B CB  1 
ATOM   2260 C CG1 . VAL B 1 21  ? 63.331  83.258  36.357  1.00 21.55 ? 22   VAL B CG1 1 
ATOM   2261 C CG2 . VAL B 1 21  ? 64.294  81.211  35.221  1.00 21.82 ? 22   VAL B CG2 1 
ATOM   2262 N N   . GLY B 1 22  ? 59.901  82.221  34.876  1.00 16.80 ? 23   GLY B N   1 
ATOM   2263 C CA  . GLY B 1 22  ? 58.626  82.944  34.929  1.00 17.19 ? 23   GLY B CA  1 
ATOM   2264 C C   . GLY B 1 22  ? 57.634  82.265  35.859  1.00 19.15 ? 23   GLY B C   1 
ATOM   2265 O O   . GLY B 1 22  ? 56.925  82.938  36.602  1.00 16.75 ? 23   GLY B O   1 
ATOM   2266 N N   . TYR B 1 23  ? 57.567  80.929  35.849  1.00 16.44 ? 24   TYR B N   1 
ATOM   2267 C CA  . TYR B 1 23  ? 56.660  80.292  36.788  1.00 17.83 ? 24   TYR B CA  1 
ATOM   2268 C C   . TYR B 1 23  ? 57.200  80.421  38.241  1.00 18.42 ? 24   TYR B C   1 
ATOM   2269 O O   . TYR B 1 23  ? 56.435  80.641  39.165  1.00 17.83 ? 24   TYR B O   1 
ATOM   2270 C CB  . TYR B 1 23  ? 56.474  78.820  36.457  1.00 17.07 ? 24   TYR B CB  1 
ATOM   2271 C CG  . TYR B 1 23  ? 55.462  78.579  35.366  1.00 17.21 ? 24   TYR B CG  1 
ATOM   2272 C CD1 . TYR B 1 23  ? 55.808  77.847  34.247  1.00 18.37 ? 24   TYR B CD1 1 
ATOM   2273 C CD2 . TYR B 1 23  ? 54.145  79.035  35.485  1.00 20.96 ? 24   TYR B CD2 1 
ATOM   2274 C CE1 . TYR B 1 23  ? 54.900  77.568  33.258  1.00 19.78 ? 24   TYR B CE1 1 
ATOM   2275 C CE2 . TYR B 1 23  ? 53.197  78.748  34.480  1.00 22.28 ? 24   TYR B CE2 1 
ATOM   2276 C CZ  . TYR B 1 23  ? 53.597  78.022  33.370  1.00 21.22 ? 24   TYR B CZ  1 
ATOM   2277 O OH  . TYR B 1 23  ? 52.753  77.805  32.295  1.00 21.57 ? 24   TYR B OH  1 
ATOM   2278 N N   . ASP B 1 24  ? 58.504  80.279  38.425  1.00 20.18 ? 25   ASP B N   1 
ATOM   2279 C CA  . ASP B 1 24  ? 59.027  80.421  39.790  1.00 21.61 ? 25   ASP B CA  1 
ATOM   2280 C C   . ASP B 1 24  ? 58.923  81.878  40.267  1.00 21.68 ? 25   ASP B C   1 
ATOM   2281 O O   . ASP B 1 24  ? 58.985  82.165  41.461  1.00 20.77 ? 25   ASP B O   1 
ATOM   2282 C CB  . ASP B 1 24  ? 60.469  79.903  39.860  1.00 19.16 ? 25   ASP B CB  1 
ATOM   2283 C CG  . ASP B 1 24  ? 60.509  78.379  39.922  1.00 19.94 ? 25   ASP B CG  1 
ATOM   2284 O OD1 . ASP B 1 24  ? 59.467  77.793  40.310  1.00 20.52 ? 25   ASP B OD1 1 
ATOM   2285 O OD2 . ASP B 1 24  ? 61.546  77.782  39.592  1.00 20.40 ? 25   ASP B OD2 1 
ATOM   2286 N N   . GLY B 1 25  ? 58.740  82.791  39.323  1.00 21.07 ? 26   GLY B N   1 
ATOM   2287 C CA  . GLY B 1 25  ? 58.609  84.193  39.659  1.00 20.18 ? 26   GLY B CA  1 
ATOM   2288 C C   . GLY B 1 25  ? 57.182  84.498  40.056  1.00 22.07 ? 26   GLY B C   1 
ATOM   2289 O O   . GLY B 1 25  ? 56.884  85.616  40.438  1.00 24.97 ? 26   GLY B O   1 
ATOM   2290 N N   . GLY B 1 26  ? 56.286  83.524  39.955  1.00 19.68 ? 27   GLY B N   1 
ATOM   2291 C CA  . GLY B 1 26  ? 54.895  83.750  40.376  1.00 19.48 ? 27   GLY B CA  1 
ATOM   2292 C C   . GLY B 1 26  ? 53.794  83.810  39.294  1.00 19.27 ? 27   GLY B C   1 
ATOM   2293 O O   . GLY B 1 26  ? 52.609  84.005  39.618  1.00 22.21 ? 27   GLY B O   1 
ATOM   2294 N N   . ALA B 1 27  ? 54.148  83.689  38.022  1.00 18.26 ? 28   ALA B N   1 
ATOM   2295 C CA  . ALA B 1 27  ? 53.095  83.709  36.983  1.00 18.91 ? 28   ALA B CA  1 
ATOM   2296 C C   . ALA B 1 27  ? 52.182  82.487  37.217  1.00 18.07 ? 28   ALA B C   1 
ATOM   2297 O O   . ALA B 1 27  ? 52.692  81.406  37.478  1.00 20.88 ? 28   ALA B O   1 
ATOM   2298 C CB  . ALA B 1 27  ? 53.736  83.578  35.600  1.00 18.38 ? 28   ALA B CB  1 
ATOM   2299 N N   . ASP B 1 28  ? 50.870  82.655  37.146  1.00 17.79 ? 29   ASP B N   1 
ATOM   2300 C CA  . ASP B 1 28  ? 49.941  81.523  37.261  1.00 18.67 ? 29   ASP B CA  1 
ATOM   2301 C C   . ASP B 1 28  ? 49.935  80.710  35.938  1.00 19.26 ? 29   ASP B C   1 
ATOM   2302 O O   . ASP B 1 28  ? 49.748  79.496  35.945  1.00 17.36 ? 29   ASP B O   1 
ATOM   2303 C CB  . ASP B 1 28  ? 48.525  82.034  37.548  1.00 20.41 ? 29   ASP B CB  1 
ATOM   2304 C CG  . ASP B 1 28  ? 48.366  82.531  38.980  1.00 23.04 ? 29   ASP B CG  1 
ATOM   2305 O OD1 . ASP B 1 28  ? 49.031  81.992  39.864  1.00 20.95 ? 29   ASP B OD1 1 
ATOM   2306 O OD2 . ASP B 1 28  ? 47.567  83.435  39.243  1.00 22.35 ? 29   ASP B OD2 1 
ATOM   2307 N N   . HIS B 1 29  ? 50.114  81.391  34.803  1.00 18.71 ? 30   HIS B N   1 
ATOM   2308 C CA  . HIS B 1 29  ? 50.160  80.737  33.491  1.00 18.08 ? 30   HIS B CA  1 
ATOM   2309 C C   . HIS B 1 29  ? 51.084  81.500  32.542  1.00 21.31 ? 30   HIS B C   1 
ATOM   2310 O O   . HIS B 1 29  ? 51.141  82.729  32.576  1.00 22.86 ? 30   HIS B O   1 
ATOM   2311 C CB  . HIS B 1 29  ? 48.799  80.743  32.827  1.00 18.02 ? 30   HIS B CB  1 
ATOM   2312 C CG  . HIS B 1 29  ? 47.768  79.951  33.548  1.00 19.32 ? 30   HIS B CG  1 
ATOM   2313 N ND1 . HIS B 1 29  ? 47.783  78.575  33.583  1.00 18.34 ? 30   HIS B ND1 1 
ATOM   2314 C CD2 . HIS B 1 29  ? 46.695  80.341  34.280  1.00 19.69 ? 30   HIS B CD2 1 
ATOM   2315 C CE1 . HIS B 1 29  ? 46.765  78.148  34.312  1.00 19.04 ? 30   HIS B CE1 1 
ATOM   2316 N NE2 . HIS B 1 29  ? 46.089  79.198  34.749  1.00 21.03 ? 30   HIS B NE2 1 
ATOM   2317 N N   . ILE B 1 30  ? 51.797  80.772  31.700  1.00 17.72 ? 31   ILE B N   1 
ATOM   2318 C CA  . ILE B 1 30  ? 52.664  81.398  30.721  1.00 17.66 ? 31   ILE B CA  1 
ATOM   2319 C C   . ILE B 1 30  ? 52.235  80.879  29.321  1.00 18.92 ? 31   ILE B C   1 
ATOM   2320 O O   . ILE B 1 30  ? 52.073  79.680  29.102  1.00 20.93 ? 31   ILE B O   1 
ATOM   2321 C CB  . ILE B 1 30  ? 54.136  81.051  30.959  1.00 16.33 ? 31   ILE B CB  1 
ATOM   2322 C CG1 . ILE B 1 30  ? 54.614  81.560  32.370  1.00 13.22 ? 31   ILE B CG1 1 
ATOM   2323 C CG2 . ILE B 1 30  ? 55.000  81.731  29.898  1.00 15.12 ? 31   ILE B CG2 1 
ATOM   2324 C CD1 . ILE B 1 30  ? 56.084  81.253  32.646  1.00 17.18 ? 31   ILE B CD1 1 
ATOM   2325 N N   . THR B 1 31  ? 52.035  81.789  28.392  1.00 19.07 ? 32   THR B N   1 
ATOM   2326 C CA  . THR B 1 31  ? 51.651  81.426  27.022  1.00 18.89 ? 32   THR B CA  1 
ATOM   2327 C C   . THR B 1 31  ? 52.777  82.018  26.188  1.00 16.57 ? 32   THR B C   1 
ATOM   2328 O O   . THR B 1 31  ? 52.945  83.225  26.172  1.00 14.93 ? 32   THR B O   1 
ATOM   2329 C CB  . THR B 1 31  ? 50.322  82.067  26.637  1.00 19.04 ? 32   THR B CB  1 
ATOM   2330 O OG1 . THR B 1 31  ? 49.335  81.703  27.609  1.00 21.84 ? 32   THR B OG1 1 
ATOM   2331 C CG2 . THR B 1 31  ? 49.845  81.532  25.209  1.00 17.76 ? 32   THR B CG2 1 
ATOM   2332 N N   . GLY B 1 32  ? 53.542  81.155  25.531  1.00 17.84 ? 33   GLY B N   1 
ATOM   2333 C CA  . GLY B 1 32  ? 54.687  81.612  24.761  1.00 18.65 ? 33   GLY B CA  1 
ATOM   2334 C C   . GLY B 1 32  ? 54.524  81.591  23.247  1.00 21.27 ? 33   GLY B C   1 
ATOM   2335 O O   . GLY B 1 32  ? 53.822  80.728  22.667  1.00 19.91 ? 33   GLY B O   1 
ATOM   2336 N N   . TYR B 1 33  ? 55.183  82.552  22.603  1.00 20.38 ? 34   TYR B N   1 
ATOM   2337 C CA  . TYR B 1 33  ? 55.152  82.667  21.153  1.00 21.40 ? 34   TYR B CA  1 
ATOM   2338 C C   . TYR B 1 33  ? 56.579  82.779  20.624  1.00 21.06 ? 34   TYR B C   1 
ATOM   2339 O O   . TYR B 1 33  ? 57.405  83.454  21.232  1.00 20.00 ? 34   TYR B O   1 
ATOM   2340 C CB  . TYR B 1 33  ? 54.379  83.940  20.724  1.00 19.61 ? 34   TYR B CB  1 
ATOM   2341 C CG  . TYR B 1 33  ? 52.899  83.887  21.055  1.00 20.64 ? 34   TYR B CG  1 
ATOM   2342 C CD1 . TYR B 1 33  ? 52.456  84.113  22.353  1.00 19.82 ? 34   TYR B CD1 1 
ATOM   2343 C CD2 . TYR B 1 33  ? 51.949  83.592  20.069  1.00 21.40 ? 34   TYR B CD2 1 
ATOM   2344 C CE1 . TYR B 1 33  ? 51.101  84.052  22.691  1.00 18.63 ? 34   TYR B CE1 1 
ATOM   2345 C CE2 . TYR B 1 33  ? 50.573  83.532  20.404  1.00 19.15 ? 34   TYR B CE2 1 
ATOM   2346 C CZ  . TYR B 1 33  ? 50.169  83.768  21.735  1.00 19.24 ? 34   TYR B CZ  1 
ATOM   2347 O OH  . TYR B 1 33  ? 48.825  83.705  22.129  1.00 19.47 ? 34   TYR B OH  1 
ATOM   2348 N N   . GLY B 1 34  ? 56.857  82.089  19.518  1.00 19.50 ? 35   GLY B N   1 
ATOM   2349 C CA  . GLY B 1 34  ? 58.152  82.218  18.876  1.00 21.79 ? 35   GLY B CA  1 
ATOM   2350 C C   . GLY B 1 34  ? 57.930  83.105  17.635  1.00 23.90 ? 35   GLY B C   1 
ATOM   2351 O O   . GLY B 1 34  ? 56.788  83.516  17.329  1.00 21.39 ? 35   GLY B O   1 
ATOM   2352 N N   . ASN B 1 35  ? 59.029  83.432  16.956  1.00 24.31 ? 36   ASN B N   1 
ATOM   2353 C CA  . ASN B 1 35  ? 59.034  84.227  15.730  1.00 23.71 ? 36   ASN B CA  1 
ATOM   2354 C C   . ASN B 1 35  ? 58.374  85.591  15.861  1.00 24.11 ? 36   ASN B C   1 
ATOM   2355 O O   . ASN B 1 35  ? 57.845  86.147  14.872  1.00 19.53 ? 36   ASN B O   1 
ATOM   2356 C CB  . ASN B 1 35  ? 58.345  83.436  14.597  1.00 25.28 ? 36   ASN B CB  1 
ATOM   2357 C CG  . ASN B 1 35  ? 58.962  82.058  14.377  1.00 26.16 ? 36   ASN B CG  1 
ATOM   2358 O OD1 . ASN B 1 35  ? 60.156  81.927  14.167  1.00 28.27 ? 36   ASN B OD1 1 
ATOM   2359 N ND2 . ASN B 1 35  ? 58.139  81.028  14.420  1.00 27.55 ? 36   ASN B ND2 1 
ATOM   2360 N N   . VAL B 1 36  ? 58.400  86.157  17.064  1.00 22.04 ? 37   VAL B N   1 
ATOM   2361 C CA  . VAL B 1 36  ? 57.762  87.428  17.223  1.00 21.93 ? 37   VAL B CA  1 
ATOM   2362 C C   . VAL B 1 36  ? 58.636  88.491  16.551  1.00 24.70 ? 37   VAL B C   1 
ATOM   2363 O O   . VAL B 1 36  ? 59.874  88.415  16.572  1.00 24.25 ? 37   VAL B O   1 
ATOM   2364 C CB  . VAL B 1 36  ? 57.497  87.734  18.708  1.00 22.08 ? 37   VAL B CB  1 
ATOM   2365 C CG1 . VAL B 1 36  ? 56.732  89.079  18.853  1.00 20.80 ? 37   VAL B CG1 1 
ATOM   2366 C CG2 . VAL B 1 36  ? 56.674  86.571  19.329  1.00 17.12 ? 37   VAL B CG2 1 
ATOM   2367 N N   . THR B 1 37  ? 57.955  89.467  15.957  1.00 25.10 ? 38   THR B N   1 
ATOM   2368 C CA  . THR B 1 37  ? 58.565  90.570  15.233  1.00 25.61 ? 38   THR B CA  1 
ATOM   2369 C C   . THR B 1 37  ? 57.800  91.852  15.535  1.00 26.01 ? 38   THR B C   1 
ATOM   2370 O O   . THR B 1 37  ? 56.673  91.828  16.057  1.00 25.45 ? 38   THR B O   1 
ATOM   2371 C CB  . THR B 1 37  ? 58.498  90.361  13.701  1.00 25.44 ? 38   THR B CB  1 
ATOM   2372 O OG1 . THR B 1 37  ? 57.136  90.432  13.288  1.00 24.87 ? 38   THR B OG1 1 
ATOM   2373 C CG2 . THR B 1 37  ? 59.085  89.011  13.298  1.00 25.86 ? 38   THR B CG2 1 
ATOM   2374 N N   . PRO B 1 38  ? 58.412  93.003  15.222  1.00 26.23 ? 39   PRO B N   1 
ATOM   2375 C CA  . PRO B 1 38  ? 57.768  94.302  15.469  1.00 28.26 ? 39   PRO B CA  1 
ATOM   2376 C C   . PRO B 1 38  ? 56.428  94.425  14.781  1.00 27.91 ? 39   PRO B C   1 
ATOM   2377 O O   . PRO B 1 38  ? 55.546  95.149  15.251  1.00 30.05 ? 39   PRO B O   1 
ATOM   2378 C CB  . PRO B 1 38  ? 58.779  95.316  14.919  1.00 28.31 ? 39   PRO B CB  1 
ATOM   2379 C CG  . PRO B 1 38  ? 60.086  94.646  15.160  1.00 28.90 ? 39   PRO B CG  1 
ATOM   2380 C CD  . PRO B 1 38  ? 59.833  93.160  14.854  1.00 26.13 ? 39   PRO B CD  1 
ATOM   2381 N N   . ASP B 1 39  ? 56.260  93.704  13.676  1.00 28.01 ? 40   ASP B N   1 
ATOM   2382 C CA  . ASP B 1 39  ? 55.019  93.752  12.913  1.00 30.26 ? 40   ASP B CA  1 
ATOM   2383 C C   . ASP B 1 39  ? 53.898  92.866  13.466  1.00 31.31 ? 40   ASP B C   1 
ATOM   2384 O O   . ASP B 1 39  ? 52.751  93.311  13.519  1.00 33.20 ? 40   ASP B O   1 
ATOM   2385 C CB  . ASP B 1 39  ? 55.295  93.396  11.453  1.00 34.29 ? 40   ASP B CB  1 
ATOM   2386 C CG  . ASP B 1 39  ? 56.230  94.400  10.781  1.00 40.69 ? 40   ASP B CG  1 
ATOM   2387 O OD1 . ASP B 1 39  ? 57.063  93.942  9.966   1.00 43.88 ? 40   ASP B OD1 1 
ATOM   2388 O OD2 . ASP B 1 39  ? 56.135  95.635  11.063  1.00 38.95 ? 40   ASP B OD2 1 
ATOM   2389 N N   . ASN B 1 40  ? 54.204  91.643  13.891  1.00 27.65 ? 41   ASN B N   1 
ATOM   2390 C CA  . ASN B 1 40  ? 53.144  90.790  14.429  1.00 27.16 ? 41   ASN B CA  1 
ATOM   2391 C C   . ASN B 1 40  ? 52.848  90.899  15.939  1.00 27.67 ? 41   ASN B C   1 
ATOM   2392 O O   . ASN B 1 40  ? 51.842  90.351  16.411  1.00 28.42 ? 41   ASN B O   1 
ATOM   2393 C CB  . ASN B 1 40  ? 53.403  89.320  14.078  1.00 27.51 ? 41   ASN B CB  1 
ATOM   2394 C CG  . ASN B 1 40  ? 54.634  88.731  14.773  1.00 28.72 ? 41   ASN B CG  1 
ATOM   2395 O OD1 . ASN B 1 40  ? 55.078  89.190  15.835  1.00 26.92 ? 41   ASN B OD1 1 
ATOM   2396 N ND2 . ASN B 1 40  ? 55.178  87.678  14.167  1.00 31.92 ? 41   ASN B ND2 1 
ATOM   2397 N N   . VAL B 1 41  ? 53.687  91.608  16.696  1.00 27.01 ? 42   VAL B N   1 
ATOM   2398 C CA  . VAL B 1 41  ? 53.464  91.709  18.150  1.00 23.09 ? 42   VAL B CA  1 
ATOM   2399 C C   . VAL B 1 41  ? 52.309  92.634  18.519  1.00 22.96 ? 42   VAL B C   1 
ATOM   2400 O O   . VAL B 1 41  ? 51.667  92.479  19.559  1.00 21.20 ? 42   VAL B O   1 
ATOM   2401 C CB  . VAL B 1 41  ? 54.779  92.132  18.884  1.00 23.00 ? 42   VAL B CB  1 
ATOM   2402 C CG1 . VAL B 1 41  ? 55.045  93.624  18.686  1.00 24.13 ? 42   VAL B CG1 1 
ATOM   2403 C CG2 . VAL B 1 41  ? 54.718  91.711  20.376  1.00 21.19 ? 42   VAL B CG2 1 
ATOM   2404 N N   . GLY B 1 42  ? 52.011  93.601  17.654  1.00 24.28 ? 43   GLY B N   1 
ATOM   2405 C CA  . GLY B 1 42  ? 50.908  94.501  17.950  1.00 23.16 ? 43   GLY B CA  1 
ATOM   2406 C C   . GLY B 1 42  ? 49.573  93.818  18.237  1.00 23.56 ? 43   GLY B C   1 
ATOM   2407 O O   . GLY B 1 42  ? 48.853  94.203  19.158  1.00 24.12 ? 43   GLY B O   1 
ATOM   2408 N N   . ALA B 1 43  ? 49.228  92.801  17.458  1.00 21.71 ? 44   ALA B N   1 
ATOM   2409 C CA  . ALA B 1 43  ? 47.961  92.131  17.674  1.00 21.37 ? 44   ALA B CA  1 
ATOM   2410 C C   . ALA B 1 43  ? 48.056  91.337  18.982  1.00 20.72 ? 44   ALA B C   1 
ATOM   2411 O O   . ALA B 1 43  ? 47.075  91.229  19.685  1.00 20.03 ? 44   ALA B O   1 
ATOM   2412 C CB  . ALA B 1 43  ? 47.624  91.198  16.492  1.00 21.99 ? 44   ALA B CB  1 
ATOM   2413 N N   . TYR B 1 44  ? 49.228  90.786  19.286  1.00 21.09 ? 45   TYR B N   1 
ATOM   2414 C CA  . TYR B 1 44  ? 49.381  90.024  20.553  1.00 21.48 ? 45   TYR B CA  1 
ATOM   2415 C C   . TYR B 1 44  ? 49.137  91.004  21.730  1.00 21.50 ? 45   TYR B C   1 
ATOM   2416 O O   . TYR B 1 44  ? 48.400  90.710  22.673  1.00 22.74 ? 45   TYR B O   1 
ATOM   2417 C CB  . TYR B 1 44  ? 50.788  89.464  20.668  1.00 17.97 ? 45   TYR B CB  1 
ATOM   2418 C CG  . TYR B 1 44  ? 51.149  88.424  19.652  1.00 18.04 ? 45   TYR B CG  1 
ATOM   2419 C CD1 . TYR B 1 44  ? 52.477  88.247  19.287  1.00 17.87 ? 45   TYR B CD1 1 
ATOM   2420 C CD2 . TYR B 1 44  ? 50.183  87.598  19.074  1.00 19.21 ? 45   TYR B CD2 1 
ATOM   2421 C CE1 . TYR B 1 44  ? 52.862  87.271  18.375  1.00 22.38 ? 45   TYR B CE1 1 
ATOM   2422 C CE2 . TYR B 1 44  ? 50.552  86.607  18.121  1.00 21.07 ? 45   TYR B CE2 1 
ATOM   2423 C CZ  . TYR B 1 44  ? 51.893  86.453  17.791  1.00 17.33 ? 45   TYR B CZ  1 
ATOM   2424 O OH  . TYR B 1 44  ? 52.315  85.472  16.941  1.00 22.34 ? 45   TYR B OH  1 
ATOM   2425 N N   . VAL B 1 45  ? 49.739  92.189  21.653  1.00 21.83 ? 46   VAL B N   1 
ATOM   2426 C CA  . VAL B 1 45  ? 49.561  93.170  22.714  1.00 20.46 ? 46   VAL B CA  1 
ATOM   2427 C C   . VAL B 1 45  ? 48.108  93.604  22.871  1.00 21.77 ? 46   VAL B C   1 
ATOM   2428 O O   . VAL B 1 45  ? 47.611  93.766  24.002  1.00 19.06 ? 46   VAL B O   1 
ATOM   2429 C CB  . VAL B 1 45  ? 50.461  94.408  22.484  1.00 22.18 ? 46   VAL B CB  1 
ATOM   2430 C CG1 . VAL B 1 45  ? 50.286  95.421  23.649  1.00 20.97 ? 46   VAL B CG1 1 
ATOM   2431 C CG2 . VAL B 1 45  ? 51.925  93.959  22.419  1.00 18.23 ? 46   VAL B CG2 1 
ATOM   2432 N N   . ASP B 1 46  ? 47.405  93.775  21.747  1.00 21.59 ? 47   ASP B N   1 
ATOM   2433 C CA  . ASP B 1 46  ? 46.010  94.171  21.802  1.00 19.96 ? 47   ASP B CA  1 
ATOM   2434 C C   . ASP B 1 46  ? 45.240  93.165  22.668  1.00 20.52 ? 47   ASP B C   1 
ATOM   2435 O O   . ASP B 1 46  ? 44.353  93.543  23.412  1.00 19.83 ? 47   ASP B O   1 
ATOM   2436 C CB  . ASP B 1 46  ? 45.397  94.173  20.393  1.00 24.12 ? 47   ASP B CB  1 
ATOM   2437 C CG  . ASP B 1 46  ? 45.830  95.359  19.552  1.00 25.98 ? 47   ASP B CG  1 
ATOM   2438 O OD1 . ASP B 1 46  ? 46.453  96.308  20.087  1.00 25.39 ? 47   ASP B OD1 1 
ATOM   2439 O OD2 . ASP B 1 46  ? 45.525  95.340  18.321  1.00 29.70 ? 47   ASP B OD2 1 
ATOM   2440 N N   . GLY B 1 47  ? 45.597  91.881  22.567  1.00 19.37 ? 48   GLY B N   1 
ATOM   2441 C CA  . GLY B 1 47  ? 44.911  90.861  23.342  1.00 18.99 ? 48   GLY B CA  1 
ATOM   2442 C C   . GLY B 1 47  ? 45.177  91.018  24.847  1.00 19.26 ? 48   GLY B C   1 
ATOM   2443 O O   . GLY B 1 47  ? 44.416  90.514  25.698  1.00 21.35 ? 48   GLY B O   1 
ATOM   2444 N N   . THR B 1 48  ? 46.228  91.730  25.199  1.00 16.77 ? 49   THR B N   1 
ATOM   2445 C CA  . THR B 1 48  ? 46.499  91.909  26.647  1.00 18.86 ? 49   THR B CA  1 
ATOM   2446 C C   . THR B 1 48  ? 45.839  93.177  27.185  1.00 20.93 ? 49   THR B C   1 
ATOM   2447 O O   . THR B 1 48  ? 45.564  93.267  28.376  1.00 21.27 ? 49   THR B O   1 
ATOM   2448 C CB  . THR B 1 48  ? 48.007  92.058  26.970  1.00 19.19 ? 49   THR B CB  1 
ATOM   2449 O OG1 . THR B 1 48  ? 48.495  93.274  26.383  1.00 18.68 ? 49   THR B OG1 1 
ATOM   2450 C CG2 . THR B 1 48  ? 48.806  90.883  26.402  1.00 15.40 ? 49   THR B CG2 1 
ATOM   2451 N N   . ILE B 1 49  ? 45.564  94.149  26.309  1.00 19.43 ? 50   ILE B N   1 
ATOM   2452 C CA  . ILE B 1 49  ? 45.002  95.386  26.801  1.00 22.41 ? 50   ILE B CA  1 
ATOM   2453 C C   . ILE B 1 49  ? 43.491  95.568  26.619  1.00 23.94 ? 50   ILE B C   1 
ATOM   2454 O O   . ILE B 1 49  ? 42.936  96.471  27.202  1.00 24.51 ? 50   ILE B O   1 
ATOM   2455 C CB  . ILE B 1 49  ? 45.741  96.620  26.209  1.00 21.75 ? 50   ILE B CB  1 
ATOM   2456 C CG1 . ILE B 1 49  ? 45.696  96.590  24.680  1.00 21.54 ? 50   ILE B CG1 1 
ATOM   2457 C CG2 . ILE B 1 49  ? 47.171  96.622  26.652  1.00 23.23 ? 50   ILE B CG2 1 
ATOM   2458 C CD1 . ILE B 1 49  ? 46.425  97.817  24.008  1.00 21.29 ? 50   ILE B CD1 1 
ATOM   2459 N N   . TYR B 1 50  ? 42.827  94.719  25.834  1.00 23.31 ? 51   TYR B N   1 
ATOM   2460 C CA  . TYR B 1 50  ? 41.392  94.861  25.627  1.00 23.14 ? 51   TYR B CA  1 
ATOM   2461 C C   . TYR B 1 50  ? 40.547  93.785  26.288  1.00 21.39 ? 51   TYR B C   1 
ATOM   2462 O O   . TYR B 1 50  ? 39.351  93.770  26.137  1.00 20.42 ? 51   TYR B O   1 
ATOM   2463 C CB  . TYR B 1 50  ? 41.093  94.908  24.115  1.00 27.35 ? 51   TYR B CB  1 
ATOM   2464 C CG  . TYR B 1 50  ? 41.777  96.095  23.448  1.00 32.89 ? 51   TYR B CG  1 
ATOM   2465 C CD1 . TYR B 1 50  ? 42.542  95.921  22.302  1.00 34.12 ? 51   TYR B CD1 1 
ATOM   2466 C CD2 . TYR B 1 50  ? 41.672  97.377  23.985  1.00 34.20 ? 51   TYR B CD2 1 
ATOM   2467 C CE1 . TYR B 1 50  ? 43.192  96.990  21.691  1.00 38.90 ? 51   TYR B CE1 1 
ATOM   2468 C CE2 . TYR B 1 50  ? 42.329  98.468  23.383  1.00 40.03 ? 51   TYR B CE2 1 
ATOM   2469 C CZ  . TYR B 1 50  ? 43.087  98.254  22.227  1.00 39.64 ? 51   TYR B CZ  1 
ATOM   2470 O OH  . TYR B 1 50  ? 43.729  99.290  21.581  1.00 46.26 ? 51   TYR B OH  1 
ATOM   2471 N N   . THR B 1 51  ? 41.177  92.912  27.067  1.00 23.06 ? 52   THR B N   1 
ATOM   2472 C CA  . THR B 1 51  ? 40.479  91.801  27.705  1.00 19.42 ? 52   THR B CA  1 
ATOM   2473 C C   . THR B 1 51  ? 40.174  91.916  29.203  1.00 20.61 ? 52   THR B C   1 
ATOM   2474 O O   . THR B 1 51  ? 39.340  91.165  29.721  1.00 19.71 ? 52   THR B O   1 
ATOM   2475 C CB  . THR B 1 51  ? 41.292  90.480  27.522  1.00 19.44 ? 52   THR B CB  1 
ATOM   2476 O OG1 . THR B 1 51  ? 42.656  90.741  27.861  1.00 20.96 ? 52   THR B OG1 1 
ATOM   2477 C CG2 . THR B 1 51  ? 41.205  89.940  26.026  1.00 16.20 ? 52   THR B CG2 1 
ATOM   2478 N N   . ARG B 1 52  ? 40.849  92.816  29.903  1.00 19.48 ? 53   ARG B N   1 
ATOM   2479 C CA  . ARG B 1 52  ? 40.626  92.974  31.336  1.00 18.07 ? 53   ARG B CA  1 
ATOM   2480 C C   . ARG B 1 52  ? 40.514  94.434  31.655  1.00 21.59 ? 53   ARG B C   1 
ATOM   2481 O O   . ARG B 1 52  ? 41.315  95.264  31.168  1.00 23.02 ? 53   ARG B O   1 
ATOM   2482 C CB  . ARG B 1 52  ? 41.756  92.314  32.122  1.00 19.67 ? 53   ARG B CB  1 
ATOM   2483 C CG  . ARG B 1 52  ? 41.782  90.782  31.963  1.00 19.38 ? 53   ARG B CG  1 
ATOM   2484 C CD  . ARG B 1 52  ? 42.996  90.151  32.643  1.00 17.32 ? 53   ARG B CD  1 
ATOM   2485 N NE  . ARG B 1 52  ? 42.744  88.783  33.113  1.00 19.12 ? 53   ARG B NE  1 
ATOM   2486 C CZ  . ARG B 1 52  ? 43.663  87.991  33.695  1.00 15.43 ? 53   ARG B CZ  1 
ATOM   2487 N NH1 . ARG B 1 52  ? 44.924  88.405  33.858  1.00 14.48 ? 53   ARG B NH1 1 
ATOM   2488 N NH2 . ARG B 1 52  ? 43.303  86.808  34.177  1.00 15.61 ? 53   ARG B NH2 1 
ATOM   2489 N N   . GLY B 1 53  ? 39.494  94.766  32.441  1.00 22.32 ? 54   GLY B N   1 
ATOM   2490 C CA  . GLY B 1 53  ? 39.290  96.160  32.774  1.00 25.18 ? 54   GLY B CA  1 
ATOM   2491 C C   . GLY B 1 53  ? 39.784  96.577  34.143  1.00 26.10 ? 54   GLY B C   1 
ATOM   2492 O O   . GLY B 1 53  ? 40.003  95.737  35.015  1.00 23.65 ? 54   GLY B O   1 
ATOM   2493 N N   . GLY B 1 54  ? 39.973  97.885  34.318  1.00 27.20 ? 55   GLY B N   1 
ATOM   2494 C CA  . GLY B 1 54  ? 40.411  98.422  35.602  1.00 29.04 ? 55   GLY B CA  1 
ATOM   2495 C C   . GLY B 1 54  ? 41.662  97.784  36.171  1.00 26.74 ? 55   GLY B C   1 
ATOM   2496 O O   . GLY B 1 54  ? 42.631  97.554  35.444  1.00 27.98 ? 55   GLY B O   1 
ATOM   2497 N N   . LYS B 1 55  ? 41.636  97.499  37.472  1.00 28.17 ? 56   LYS B N   1 
ATOM   2498 C CA  . LYS B 1 55  ? 42.784  96.891  38.142  1.00 26.74 ? 56   LYS B CA  1 
ATOM   2499 C C   . LYS B 1 55  ? 43.011  95.419  37.799  1.00 26.45 ? 56   LYS B C   1 
ATOM   2500 O O   . LYS B 1 55  ? 43.967  94.800  38.309  1.00 25.08 ? 56   LYS B O   1 
ATOM   2501 C CB  . LYS B 1 55  ? 42.650  97.037  39.637  1.00 29.60 ? 56   LYS B CB  1 
ATOM   2502 C CG  . LYS B 1 55  ? 42.512  98.475  40.069  1.00 38.08 ? 56   LYS B CG  1 
ATOM   2503 C CD  . LYS B 1 55  ? 43.662  98.894  40.947  1.00 40.14 ? 56   LYS B CD  1 
ATOM   2504 C CE  . LYS B 1 55  ? 43.405  100.275 41.549  1.00 43.72 ? 56   LYS B CE  1 
ATOM   2505 N NZ  . LYS B 1 55  ? 44.440  100.585 42.589  1.00 46.51 ? 56   LYS B NZ  1 
ATOM   2506 N N   . GLU B 1 56  ? 42.124  94.825  37.006  1.00 23.97 ? 57   GLU B N   1 
ATOM   2507 C CA  . GLU B 1 56  ? 42.389  93.435  36.604  1.00 25.27 ? 57   GLU B CA  1 
ATOM   2508 C C   . GLU B 1 56  ? 43.553  93.464  35.614  1.00 23.25 ? 57   GLU B C   1 
ATOM   2509 O O   . GLU B 1 56  ? 44.224  92.446  35.351  1.00 23.40 ? 57   GLU B O   1 
ATOM   2510 C CB  . GLU B 1 56  ? 41.149  92.800  35.951  1.00 25.11 ? 57   GLU B CB  1 
ATOM   2511 C CG  . GLU B 1 56  ? 40.087  92.534  36.979  1.00 26.50 ? 57   GLU B CG  1 
ATOM   2512 C CD  . GLU B 1 56  ? 38.794  92.014  36.399  1.00 33.65 ? 57   GLU B CD  1 
ATOM   2513 O OE1 . GLU B 1 56  ? 38.759  91.540  35.234  1.00 33.87 ? 57   GLU B OE1 1 
ATOM   2514 O OE2 . GLU B 1 56  ? 37.791  92.078  37.136  1.00 36.86 ? 57   GLU B OE2 1 
ATOM   2515 N N   . LYS B 1 57  ? 43.816  94.641  35.051  1.00 23.22 ? 58   LYS B N   1 
ATOM   2516 C CA  . LYS B 1 57  ? 44.910  94.729  34.067  1.00 26.40 ? 58   LYS B CA  1 
ATOM   2517 C C   . LYS B 1 57  ? 46.266  94.357  34.629  1.00 25.21 ? 58   LYS B C   1 
ATOM   2518 O O   . LYS B 1 57  ? 47.107  93.784  33.928  1.00 22.22 ? 58   LYS B O   1 
ATOM   2519 C CB  . LYS B 1 57  ? 45.008  96.131  33.450  1.00 28.24 ? 58   LYS B CB  1 
ATOM   2520 C CG  . LYS B 1 57  ? 43.882  96.411  32.495  1.00 36.23 ? 58   LYS B CG  1 
ATOM   2521 C CD  . LYS B 1 57  ? 43.965  97.840  32.001  1.00 38.98 ? 58   LYS B CD  1 
ATOM   2522 C CE  . LYS B 1 57  ? 43.738  98.799  33.146  1.00 43.99 ? 58   LYS B CE  1 
ATOM   2523 N NZ  . LYS B 1 57  ? 44.167  100.156 32.763  1.00 46.62 ? 58   LYS B NZ  1 
ATOM   2524 N N   . GLN B 1 58  ? 46.499  94.650  35.900  1.00 24.13 ? 59   GLN B N   1 
ATOM   2525 C CA  . GLN B 1 58  ? 47.801  94.301  36.414  1.00 24.15 ? 59   GLN B CA  1 
ATOM   2526 C C   . GLN B 1 58  ? 48.021  92.807  36.570  1.00 23.55 ? 59   GLN B C   1 
ATOM   2527 O O   . GLN B 1 58  ? 49.096  92.416  36.978  1.00 24.72 ? 59   GLN B O   1 
ATOM   2528 C CB  . GLN B 1 58  ? 48.072  95.020  37.742  1.00 26.40 ? 59   GLN B CB  1 
ATOM   2529 C CG  . GLN B 1 58  ? 47.080  94.721  38.824  1.00 31.22 ? 59   GLN B CG  1 
ATOM   2530 C CD  . GLN B 1 58  ? 47.023  95.851  39.840  1.00 35.21 ? 59   GLN B CD  1 
ATOM   2531 O OE1 . GLN B 1 58  ? 47.265  97.015  39.497  1.00 36.04 ? 59   GLN B OE1 1 
ATOM   2532 N NE2 . GLN B 1 58  ? 46.669  95.527  41.078  1.00 36.93 ? 59   GLN B NE2 1 
ATOM   2533 N N   . SER B 1 59  ? 47.022  91.975  36.261  1.00 22.45 ? 60   SER B N   1 
ATOM   2534 C CA  . SER B 1 59  ? 47.181  90.522  36.359  1.00 20.28 ? 60   SER B CA  1 
ATOM   2535 C C   . SER B 1 59  ? 47.616  89.939  35.009  1.00 19.90 ? 60   SER B C   1 
ATOM   2536 O O   . SER B 1 59  ? 47.729  88.735  34.850  1.00 17.79 ? 60   SER B O   1 
ATOM   2537 C CB  . SER B 1 59  ? 45.882  89.877  36.844  1.00 25.25 ? 60   SER B CB  1 
ATOM   2538 O OG  . SER B 1 59  ? 45.755  90.054  38.256  1.00 22.99 ? 60   SER B OG  1 
ATOM   2539 N N   . THR B 1 60  ? 47.796  90.797  34.009  1.00 18.46 ? 61   THR B N   1 
ATOM   2540 C CA  . THR B 1 60  ? 48.337  90.335  32.739  1.00 15.00 ? 61   THR B CA  1 
ATOM   2541 C C   . THR B 1 60  ? 49.677  91.066  32.513  1.00 15.97 ? 61   THR B C   1 
ATOM   2542 O O   . THR B 1 60  ? 49.792  92.241  32.839  1.00 17.16 ? 61   THR B O   1 
ATOM   2543 C CB  . THR B 1 60  ? 47.392  90.655  31.553  1.00 16.16 ? 61   THR B CB  1 
ATOM   2544 O OG1 . THR B 1 60  ? 46.146  89.943  31.708  1.00 19.49 ? 61   THR B OG1 1 
ATOM   2545 C CG2 . THR B 1 60  ? 48.102  90.268  30.251  1.00 18.15 ? 61   THR B CG2 1 
ATOM   2546 N N   . ALA B 1 61  ? 50.696  90.385  31.974  1.00 15.79 ? 62   ALA B N   1 
ATOM   2547 C CA  . ALA B 1 61  ? 52.000  91.032  31.743  1.00 19.17 ? 62   ALA B CA  1 
ATOM   2548 C C   . ALA B 1 61  ? 52.680  90.443  30.534  1.00 19.78 ? 62   ALA B C   1 
ATOM   2549 O O   . ALA B 1 61  ? 52.288  89.358  30.027  1.00 23.24 ? 62   ALA B O   1 
ATOM   2550 C CB  . ALA B 1 61  ? 52.934  90.885  32.995  1.00 17.07 ? 62   ALA B CB  1 
ATOM   2551 N N   . ILE B 1 62  ? 53.748  91.112  30.115  1.00 20.07 ? 63   ILE B N   1 
ATOM   2552 C CA  . ILE B 1 62  ? 54.470  90.725  28.916  1.00 17.34 ? 63   ILE B CA  1 
ATOM   2553 C C   . ILE B 1 62  ? 55.935  90.561  29.128  1.00 18.45 ? 63   ILE B C   1 
ATOM   2554 O O   . ILE B 1 62  ? 56.558  91.337  29.860  1.00 22.42 ? 63   ILE B O   1 
ATOM   2555 C CB  . ILE B 1 62  ? 54.244  91.805  27.799  1.00 17.13 ? 63   ILE B CB  1 
ATOM   2556 C CG1 . ILE B 1 62  ? 52.808  91.700  27.291  1.00 19.73 ? 63   ILE B CG1 1 
ATOM   2557 C CG2 . ILE B 1 62  ? 55.310  91.682  26.669  1.00 18.23 ? 63   ILE B CG2 1 
ATOM   2558 C CD1 . ILE B 1 62  ? 52.362  92.932  26.466  1.00 18.37 ? 63   ILE B CD1 1 
ATOM   2559 N N   . PHE B 1 63  ? 56.507  89.549  28.496  1.00 19.32 ? 64   PHE B N   1 
ATOM   2560 C CA  . PHE B 1 63  ? 57.940  89.316  28.625  1.00 20.75 ? 64   PHE B CA  1 
ATOM   2561 C C   . PHE B 1 63  ? 58.508  89.078  27.253  1.00 20.87 ? 64   PHE B C   1 
ATOM   2562 O O   . PHE B 1 63  ? 58.022  88.198  26.524  1.00 19.12 ? 64   PHE B O   1 
ATOM   2563 C CB  . PHE B 1 63  ? 58.210  88.091  29.534  1.00 20.63 ? 64   PHE B CB  1 
ATOM   2564 C CG  . PHE B 1 63  ? 59.654  87.714  29.635  1.00 22.11 ? 64   PHE B CG  1 
ATOM   2565 C CD1 . PHE B 1 63  ? 60.435  88.158  30.704  1.00 21.36 ? 64   PHE B CD1 1 
ATOM   2566 C CD2 . PHE B 1 63  ? 60.254  86.917  28.637  1.00 21.98 ? 64   PHE B CD2 1 
ATOM   2567 C CE1 . PHE B 1 63  ? 61.790  87.828  30.794  1.00 18.27 ? 64   PHE B CE1 1 
ATOM   2568 C CE2 . PHE B 1 63  ? 61.599  86.580  28.716  1.00 23.17 ? 64   PHE B CE2 1 
ATOM   2569 C CZ  . PHE B 1 63  ? 62.377  87.043  29.815  1.00 23.75 ? 64   PHE B CZ  1 
ATOM   2570 N N   . VAL B 1 64  ? 59.529  89.859  26.893  1.00 21.27 ? 65   VAL B N   1 
ATOM   2571 C CA  . VAL B 1 64  ? 60.184  89.729  25.596  1.00 20.10 ? 65   VAL B CA  1 
ATOM   2572 C C   . VAL B 1 64  ? 61.580  89.133  25.746  1.00 21.47 ? 65   VAL B C   1 
ATOM   2573 O O   . VAL B 1 64  ? 62.398  89.596  26.566  1.00 21.04 ? 65   VAL B O   1 
ATOM   2574 C CB  . VAL B 1 64  ? 60.266  91.120  24.867  1.00 19.92 ? 65   VAL B CB  1 
ATOM   2575 C CG1 . VAL B 1 64  ? 60.894  90.973  23.492  1.00 20.08 ? 65   VAL B CG1 1 
ATOM   2576 C CG2 . VAL B 1 64  ? 58.883  91.704  24.731  1.00 18.87 ? 65   VAL B CG2 1 
ATOM   2577 N N   . GLY B 1 65  ? 61.847  88.074  24.991  1.00 20.88 ? 66   GLY B N   1 
ATOM   2578 C CA  . GLY B 1 65  ? 63.153  87.447  25.071  1.00 20.31 ? 66   GLY B CA  1 
ATOM   2579 C C   . GLY B 1 65  ? 63.633  86.903  23.761  1.00 20.78 ? 66   GLY B C   1 
ATOM   2580 O O   . GLY B 1 65  ? 63.128  87.273  22.687  1.00 19.60 ? 66   GLY B O   1 
ATOM   2581 N N   . GLY B 1 66  ? 64.595  85.988  23.842  1.00 20.96 ? 67   GLY B N   1 
ATOM   2582 C CA  . GLY B 1 66  ? 65.161  85.423  22.636  1.00 23.80 ? 67   GLY B CA  1 
ATOM   2583 C C   . GLY B 1 66  ? 66.651  85.714  22.633  1.00 25.00 ? 67   GLY B C   1 
ATOM   2584 O O   . GLY B 1 66  ? 67.113  86.469  23.470  1.00 26.96 ? 67   GLY B O   1 
ATOM   2585 N N   . GLY B 1 67  ? 67.392  85.129  21.704  1.00 26.00 ? 68   GLY B N   1 
ATOM   2586 C CA  . GLY B 1 67  ? 68.830  85.313  21.694  1.00 26.83 ? 68   GLY B CA  1 
ATOM   2587 C C   . GLY B 1 67  ? 69.409  86.586  21.125  1.00 29.00 ? 68   GLY B C   1 
ATOM   2588 O O   . GLY B 1 67  ? 70.470  87.029  21.572  1.00 29.73 ? 68   GLY B O   1 
ATOM   2589 N N   . ASP B 1 68  ? 68.729  87.163  20.140  1.00 27.83 ? 69   ASP B N   1 
ATOM   2590 C CA  . ASP B 1 68  ? 69.193  88.358  19.447  1.00 29.20 ? 69   ASP B CA  1 
ATOM   2591 C C   . ASP B 1 68  ? 68.718  89.558  20.230  1.00 29.08 ? 69   ASP B C   1 
ATOM   2592 O O   . ASP B 1 68  ? 67.517  89.849  20.252  1.00 30.31 ? 69   ASP B O   1 
ATOM   2593 C CB  . ASP B 1 68  ? 68.578  88.338  18.047  1.00 33.44 ? 69   ASP B CB  1 
ATOM   2594 C CG  . ASP B 1 68  ? 69.042  89.489  17.161  1.00 37.73 ? 69   ASP B CG  1 
ATOM   2595 O OD1 . ASP B 1 68  ? 69.257  90.629  17.647  1.00 33.49 ? 69   ASP B OD1 1 
ATOM   2596 O OD2 . ASP B 1 68  ? 69.148  89.219  15.936  1.00 44.22 ? 69   ASP B OD2 1 
ATOM   2597 N N   . MET B 1 69  ? 69.647  90.264  20.865  1.00 26.33 ? 70   MET B N   1 
ATOM   2598 C CA  . MET B 1 69  ? 69.279  91.395  21.674  1.00 26.97 ? 70   MET B CA  1 
ATOM   2599 C C   . MET B 1 69  ? 68.650  92.535  20.936  1.00 26.57 ? 70   MET B C   1 
ATOM   2600 O O   . MET B 1 69  ? 67.662  93.092  21.407  1.00 24.77 ? 70   MET B O   1 
ATOM   2601 C CB  . MET B 1 69  ? 70.482  91.922  22.465  1.00 31.96 ? 70   MET B CB  1 
ATOM   2602 C CG  . MET B 1 69  ? 70.175  93.195  23.239  1.00 36.04 ? 70   MET B CG  1 
ATOM   2603 S SD  . MET B 1 69  ? 71.561  93.670  24.313  1.00 46.00 ? 70   MET B SD  1 
ATOM   2604 C CE  . MET B 1 69  ? 72.485  94.908  23.295  1.00 42.18 ? 70   MET B CE  1 
ATOM   2605 N N   . ALA B 1 70  ? 69.210  92.903  19.782  1.00 26.65 ? 71   ALA B N   1 
ATOM   2606 C CA  . ALA B 1 70  ? 68.651  94.017  19.024  1.00 25.98 ? 71   ALA B CA  1 
ATOM   2607 C C   . ALA B 1 70  ? 67.246  93.689  18.534  1.00 24.78 ? 71   ALA B C   1 
ATOM   2608 O O   . ALA B 1 70  ? 66.386  94.566  18.461  1.00 25.12 ? 71   ALA B O   1 
ATOM   2609 C CB  . ALA B 1 70  ? 69.578  94.398  17.840  1.00 25.46 ? 71   ALA B CB  1 
ATOM   2610 N N   . ALA B 1 71  ? 67.018  92.427  18.198  1.00 23.85 ? 72   ALA B N   1 
ATOM   2611 C CA  . ALA B 1 71  ? 65.693  92.004  17.742  1.00 24.75 ? 72   ALA B CA  1 
ATOM   2612 C C   . ALA B 1 71  ? 64.723  92.167  18.902  1.00 23.29 ? 72   ALA B C   1 
ATOM   2613 O O   . ALA B 1 71  ? 63.604  92.672  18.752  1.00 22.75 ? 72   ALA B O   1 
ATOM   2614 C CB  . ALA B 1 71  ? 65.737  90.547  17.278  1.00 25.29 ? 72   ALA B CB  1 
ATOM   2615 N N   . GLY B 1 72  ? 65.164  91.749  20.087  1.00 23.64 ? 73   GLY B N   1 
ATOM   2616 C CA  . GLY B 1 72  ? 64.328  91.882  21.260  1.00 22.53 ? 73   GLY B CA  1 
ATOM   2617 C C   . GLY B 1 72  ? 64.012  93.347  21.515  1.00 22.87 ? 73   GLY B C   1 
ATOM   2618 O O   . GLY B 1 72  ? 62.903  93.674  21.885  1.00 21.22 ? 73   GLY B O   1 
ATOM   2619 N N   . GLU B 1 73  ? 64.977  94.247  21.315  1.00 25.67 ? 74   GLU B N   1 
ATOM   2620 C CA  . GLU B 1 73  ? 64.726  95.671  21.564  1.00 24.66 ? 74   GLU B CA  1 
ATOM   2621 C C   . GLU B 1 73  ? 63.680  96.215  20.580  1.00 23.56 ? 74   GLU B C   1 
ATOM   2622 O O   . GLU B 1 73  ? 62.801  96.994  20.942  1.00 26.35 ? 74   GLU B O   1 
ATOM   2623 C CB  . GLU B 1 73  ? 66.052  96.459  21.475  1.00 26.79 ? 74   GLU B CB  1 
ATOM   2624 C CG  . GLU B 1 73  ? 67.079  96.041  22.565  1.00 31.44 ? 74   GLU B CG  1 
ATOM   2625 C CD  . GLU B 1 73  ? 68.345  96.889  22.557  1.00 34.14 ? 74   GLU B CD  1 
ATOM   2626 O OE1 . GLU B 1 73  ? 68.620  97.561  23.582  1.00 38.51 ? 74   GLU B OE1 1 
ATOM   2627 O OE2 . GLU B 1 73  ? 69.044  96.874  21.531  1.00 33.24 ? 74   GLU B OE2 1 
ATOM   2628 N N   . ARG B 1 74  ? 63.765  95.800  19.319  1.00 24.90 ? 75   ARG B N   1 
ATOM   2629 C CA  . ARG B 1 74  ? 62.765  96.247  18.349  1.00 23.92 ? 75   ARG B CA  1 
ATOM   2630 C C   . ARG B 1 74  ? 61.366  95.796  18.779  1.00 23.64 ? 75   ARG B C   1 
ATOM   2631 O O   . ARG B 1 74  ? 60.425  96.566  18.740  1.00 22.74 ? 75   ARG B O   1 
ATOM   2632 C CB  . ARG B 1 74  ? 63.090  95.678  16.983  1.00 25.00 ? 75   ARG B CB  1 
ATOM   2633 C CG  . ARG B 1 74  ? 64.211  96.459  16.316  1.00 34.03 ? 75   ARG B CG  1 
ATOM   2634 C CD  . ARG B 1 74  ? 64.509  95.907  14.957  1.00 36.67 ? 75   ARG B CD  1 
ATOM   2635 N NE  . ARG B 1 74  ? 65.833  95.317  14.980  1.00 44.15 ? 75   ARG B NE  1 
ATOM   2636 C CZ  . ARG B 1 74  ? 66.079  94.064  14.646  1.00 43.04 ? 75   ARG B CZ  1 
ATOM   2637 N NH1 . ARG B 1 74  ? 65.081  93.285  14.259  1.00 47.00 ? 75   ARG B NH1 1 
ATOM   2638 N NH2 . ARG B 1 74  ? 67.309  93.592  14.723  1.00 43.13 ? 75   ARG B NH2 1 
ATOM   2639 N N   . VAL B 1 75  ? 61.245  94.543  19.224  1.00 23.27 ? 76   VAL B N   1 
ATOM   2640 C CA  . VAL B 1 75  ? 59.929  94.050  19.649  1.00 19.22 ? 76   VAL B CA  1 
ATOM   2641 C C   . VAL B 1 75  ? 59.488  94.810  20.881  1.00 17.34 ? 76   VAL B C   1 
ATOM   2642 O O   . VAL B 1 75  ? 58.347  95.232  20.974  1.00 20.33 ? 76   VAL B O   1 
ATOM   2643 C CB  . VAL B 1 75  ? 59.986  92.505  19.898  1.00 19.84 ? 76   VAL B CB  1 
ATOM   2644 C CG1 . VAL B 1 75  ? 58.654  91.993  20.482  1.00 20.57 ? 76   VAL B CG1 1 
ATOM   2645 C CG2 . VAL B 1 75  ? 60.204  91.785  18.544  1.00 21.41 ? 76   VAL B CG2 1 
ATOM   2646 N N   . PHE B 1 76  ? 60.401  95.008  21.834  1.00 19.46 ? 77   PHE B N   1 
ATOM   2647 C CA  . PHE B 1 76  ? 60.051  95.730  23.045  1.00 19.70 ? 77   PHE B CA  1 
ATOM   2648 C C   . PHE B 1 76  ? 59.559  97.124  22.674  1.00 21.02 ? 77   PHE B C   1 
ATOM   2649 O O   . PHE B 1 76  ? 58.516  97.564  23.152  1.00 20.93 ? 77   PHE B O   1 
ATOM   2650 C CB  . PHE B 1 76  ? 61.267  95.781  24.006  1.00 21.23 ? 77   PHE B CB  1 
ATOM   2651 C CG  . PHE B 1 76  ? 60.897  96.091  25.434  1.00 25.16 ? 77   PHE B CG  1 
ATOM   2652 C CD1 . PHE B 1 76  ? 60.104  95.204  26.173  1.00 22.91 ? 77   PHE B CD1 1 
ATOM   2653 C CD2 . PHE B 1 76  ? 61.420  97.219  26.074  1.00 24.22 ? 77   PHE B CD2 1 
ATOM   2654 C CE1 . PHE B 1 76  ? 59.857  95.443  27.558  1.00 22.50 ? 77   PHE B CE1 1 
ATOM   2655 C CE2 . PHE B 1 76  ? 61.187  97.481  27.445  1.00 23.36 ? 77   PHE B CE2 1 
ATOM   2656 C CZ  . PHE B 1 76  ? 60.399  96.577  28.190  1.00 24.46 ? 77   PHE B CZ  1 
ATOM   2657 N N   . GLU B 1 77  ? 60.293  97.855  21.830  1.00 23.42 ? 78   GLU B N   1 
ATOM   2658 C CA  . GLU B 1 77  ? 59.789  99.190  21.435  1.00 24.49 ? 78   GLU B CA  1 
ATOM   2659 C C   . GLU B 1 77  ? 58.374  99.143  20.783  1.00 23.05 ? 78   GLU B C   1 
ATOM   2660 O O   . GLU B 1 77  ? 57.529  100.029 21.019  1.00 23.53 ? 78   GLU B O   1 
ATOM   2661 C CB  . GLU B 1 77  ? 60.796  99.872  20.489  1.00 28.85 ? 78   GLU B CB  1 
ATOM   2662 C CG  . GLU B 1 77  ? 62.091  100.306 21.207  1.00 30.80 ? 78   GLU B CG  1 
ATOM   2663 C CD  . GLU B 1 77  ? 61.811  101.105 22.502  1.00 34.22 ? 78   GLU B CD  1 
ATOM   2664 O OE1 . GLU B 1 77  ? 61.055  102.106 22.451  1.00 37.28 ? 78   GLU B OE1 1 
ATOM   2665 O OE2 . GLU B 1 77  ? 62.333  100.735 23.587  1.00 34.97 ? 78   GLU B OE2 1 
ATOM   2666 N N   . ALA B 1 78  ? 58.115  98.088  20.003  1.00 22.22 ? 79   ALA B N   1 
ATOM   2667 C CA  . ALA B 1 78  ? 56.818  97.902  19.313  1.00 22.19 ? 79   ALA B CA  1 
ATOM   2668 C C   . ALA B 1 78  ? 55.724  97.647  20.345  1.00 23.42 ? 79   ALA B C   1 
ATOM   2669 O O   . ALA B 1 78  ? 54.589  98.132  20.220  1.00 21.65 ? 79   ALA B O   1 
ATOM   2670 C CB  . ALA B 1 78  ? 56.916  96.708  18.312  1.00 23.28 ? 79   ALA B CB  1 
ATOM   2671 N N   . VAL B 1 79  ? 56.065  96.875  21.377  1.00 22.70 ? 80   VAL B N   1 
ATOM   2672 C CA  . VAL B 1 79  ? 55.094  96.604  22.438  1.00 21.51 ? 80   VAL B CA  1 
ATOM   2673 C C   . VAL B 1 79  ? 54.696  97.891  23.090  1.00 21.53 ? 80   VAL B C   1 
ATOM   2674 O O   . VAL B 1 79  ? 53.503  98.154  23.274  1.00 22.02 ? 80   VAL B O   1 
ATOM   2675 C CB  . VAL B 1 79  ? 55.654  95.636  23.535  1.00 20.82 ? 80   VAL B CB  1 
ATOM   2676 C CG1 . VAL B 1 79  ? 54.805  95.717  24.809  1.00 16.73 ? 80   VAL B CG1 1 
ATOM   2677 C CG2 . VAL B 1 79  ? 55.625  94.232  23.014  1.00 19.71 ? 80   VAL B CG2 1 
ATOM   2678 N N   . LYS B 1 80  ? 55.678  98.721  23.425  1.00 23.84 ? 81   LYS B N   1 
ATOM   2679 C CA  . LYS B 1 80  ? 55.360  99.974  24.110  1.00 25.81 ? 81   LYS B CA  1 
ATOM   2680 C C   . LYS B 1 80  ? 54.614  100.970 23.225  1.00 27.35 ? 81   LYS B C   1 
ATOM   2681 O O   . LYS B 1 80  ? 53.822  101.775 23.707  1.00 28.29 ? 81   LYS B O   1 
ATOM   2682 C CB  . LYS B 1 80  ? 56.637  100.623 24.634  1.00 29.34 ? 81   LYS B CB  1 
ATOM   2683 C CG  . LYS B 1 80  ? 57.333  99.828  25.716  1.00 30.76 ? 81   LYS B CG  1 
ATOM   2684 C CD  . LYS B 1 80  ? 58.561  100.528 26.254  1.00 36.11 ? 81   LYS B CD  1 
ATOM   2685 C CE  . LYS B 1 80  ? 59.735  100.564 25.284  1.00 36.19 ? 81   LYS B CE  1 
ATOM   2686 N NZ  . LYS B 1 80  ? 60.946  101.178 25.976  1.00 36.69 ? 81   LYS B NZ  1 
ATOM   2687 N N   . LYS B 1 81  ? 54.899  100.925 21.936  1.00 30.25 ? 82   LYS B N   1 
ATOM   2688 C CA  . LYS B 1 81  ? 54.264  101.810 20.960  1.00 32.31 ? 82   LYS B CA  1 
ATOM   2689 C C   . LYS B 1 81  ? 52.749  101.480 20.864  1.00 32.25 ? 82   LYS B C   1 
ATOM   2690 O O   . LYS B 1 81  ? 51.908  102.366 20.657  1.00 29.50 ? 82   LYS B O   1 
ATOM   2691 C CB  . LYS B 1 81  ? 54.996  101.644 19.613  1.00 35.11 ? 82   LYS B CB  1 
ATOM   2692 C CG  . LYS B 1 81  ? 54.496  102.507 18.446  1.00 42.43 ? 82   LYS B CG  1 
ATOM   2693 C CD  . LYS B 1 81  ? 54.998  101.919 17.095  1.00 43.77 ? 82   LYS B CD  1 
ATOM   2694 C CE  . LYS B 1 81  ? 54.493  102.699 15.864  1.00 46.06 ? 82   LYS B CE  1 
ATOM   2695 N NZ  . LYS B 1 81  ? 54.791  101.975 14.576  1.00 43.52 ? 82   LYS B NZ  1 
ATOM   2696 N N   . ARG B 1 82  ? 52.400  100.208 21.066  1.00 30.52 ? 83   ARG B N   1 
ATOM   2697 C CA  . ARG B 1 82  ? 51.002  99.780  21.019  1.00 28.74 ? 83   ARG B CA  1 
ATOM   2698 C C   . ARG B 1 82  ? 50.163  100.258 22.218  1.00 27.97 ? 83   ARG B C   1 
ATOM   2699 O O   . ARG B 1 82  ? 48.961  100.450 22.108  1.00 25.39 ? 83   ARG B O   1 
ATOM   2700 C CB  . ARG B 1 82  ? 50.930  98.260  20.929  1.00 29.60 ? 83   ARG B CB  1 
ATOM   2701 C CG  . ARG B 1 82  ? 49.630  97.783  20.398  1.00 30.13 ? 83   ARG B CG  1 
ATOM   2702 C CD  . ARG B 1 82  ? 49.468  98.185  18.943  1.00 29.02 ? 83   ARG B CD  1 
ATOM   2703 N NE  . ARG B 1 82  ? 48.556  97.274  18.270  1.00 34.33 ? 83   ARG B NE  1 
ATOM   2704 C CZ  . ARG B 1 82  ? 48.555  97.047  16.957  1.00 38.38 ? 83   ARG B CZ  1 
ATOM   2705 N NH1 . ARG B 1 82  ? 49.417  97.685  16.159  1.00 37.37 ? 83   ARG B NH1 1 
ATOM   2706 N NH2 . ARG B 1 82  ? 47.733  96.137  16.442  1.00 36.29 ? 83   ARG B NH2 1 
ATOM   2707 N N   . PHE B 1 83  ? 50.801  100.462 23.371  1.00 26.12 ? 84   PHE B N   1 
ATOM   2708 C CA  . PHE B 1 83  ? 50.077  100.926 24.539  1.00 26.88 ? 84   PHE B CA  1 
ATOM   2709 C C   . PHE B 1 83  ? 49.596  102.324 24.259  1.00 29.69 ? 84   PHE B C   1 
ATOM   2710 O O   . PHE B 1 83  ? 50.159  103.009 23.397  1.00 31.39 ? 84   PHE B O   1 
ATOM   2711 C CB  . PHE B 1 83  ? 50.987  101.018 25.783  1.00 24.30 ? 84   PHE B CB  1 
ATOM   2712 C CG  . PHE B 1 83  ? 51.530  99.693  26.252  1.00 22.85 ? 84   PHE B CG  1 
ATOM   2713 C CD1 . PHE B 1 83  ? 50.800  98.522  26.070  1.00 24.38 ? 84   PHE B CD1 1 
ATOM   2714 C CD2 . PHE B 1 83  ? 52.752  99.629  26.944  1.00 24.00 ? 84   PHE B CD2 1 
ATOM   2715 C CE1 . PHE B 1 83  ? 51.267  97.276  26.574  1.00 20.74 ? 84   PHE B CE1 1 
ATOM   2716 C CE2 . PHE B 1 83  ? 53.234  98.398  27.458  1.00 25.28 ? 84   PHE B CE2 1 
ATOM   2717 C CZ  . PHE B 1 83  ? 52.478  97.219  27.267  1.00 22.99 ? 84   PHE B CZ  1 
ATOM   2718 N N   . PHE B 1 84  ? 48.589  102.752 25.016  1.00 29.95 ? 85   PHE B N   1 
ATOM   2719 C CA  . PHE B 1 84  ? 48.063  104.107 24.920  1.00 32.96 ? 85   PHE B CA  1 
ATOM   2720 C C   . PHE B 1 84  ? 47.126  104.417 26.108  1.00 30.49 ? 85   PHE B C   1 
ATOM   2721 O O   . PHE B 1 84  ? 46.237  103.626 26.465  1.00 30.97 ? 85   PHE B O   1 
ATOM   2722 C CB  . PHE B 1 84  ? 47.355  104.325 23.556  1.00 34.77 ? 85   PHE B CB  1 
ATOM   2723 C CG  . PHE B 1 84  ? 46.073  103.572 23.406  1.00 37.14 ? 85   PHE B CG  1 
ATOM   2724 C CD1 . PHE B 1 84  ? 44.856  104.159 23.753  1.00 39.59 ? 85   PHE B CD1 1 
ATOM   2725 C CD2 . PHE B 1 84  ? 46.073  102.270 22.910  1.00 39.55 ? 85   PHE B CD2 1 
ATOM   2726 C CE1 . PHE B 1 84  ? 43.650  103.445 23.602  1.00 40.37 ? 85   PHE B CE1 1 
ATOM   2727 C CE2 . PHE B 1 84  ? 44.876  101.548 22.755  1.00 39.76 ? 85   PHE B CE2 1 
ATOM   2728 C CZ  . PHE B 1 84  ? 43.669  102.128 23.098  1.00 37.83 ? 85   PHE B CZ  1 
ATOM   2729 N N   . GLY B 1 85  ? 47.362  105.558 26.738  1.00 29.03 ? 86   GLY B N   1 
ATOM   2730 C CA  . GLY B 1 85  ? 46.545  105.957 27.869  1.00 33.27 ? 86   GLY B CA  1 
ATOM   2731 C C   . GLY B 1 85  ? 46.625  104.916 28.970  1.00 35.15 ? 86   GLY B C   1 
ATOM   2732 O O   . GLY B 1 85  ? 47.710  104.535 29.375  1.00 34.52 ? 86   GLY B O   1 
ATOM   2733 N N   . PRO B 1 86  ? 45.483  104.438 29.473  1.00 36.56 ? 87   PRO B N   1 
ATOM   2734 C CA  . PRO B 1 86  ? 45.448  103.430 30.538  1.00 36.44 ? 87   PRO B CA  1 
ATOM   2735 C C   . PRO B 1 86  ? 45.562  102.020 29.974  1.00 35.48 ? 87   PRO B C   1 
ATOM   2736 O O   . PRO B 1 86  ? 45.748  101.068 30.732  1.00 36.22 ? 87   PRO B O   1 
ATOM   2737 C CB  . PRO B 1 86  ? 44.079  103.647 31.159  1.00 36.21 ? 87   PRO B CB  1 
ATOM   2738 C CG  . PRO B 1 86  ? 43.258  103.896 29.939  1.00 38.48 ? 87   PRO B CG  1 
ATOM   2739 C CD  . PRO B 1 86  ? 44.117  104.898 29.157  1.00 37.10 ? 87   PRO B CD  1 
ATOM   2740 N N   . PHE B 1 87  ? 45.435  101.895 28.653  1.00 31.78 ? 88   PHE B N   1 
ATOM   2741 C CA  . PHE B 1 87  ? 45.501  100.602 27.987  1.00 27.98 ? 88   PHE B CA  1 
ATOM   2742 C C   . PHE B 1 87  ? 46.943  100.123 27.884  1.00 25.69 ? 88   PHE B C   1 
ATOM   2743 O O   . PHE B 1 87  ? 47.645  100.360 26.885  1.00 22.18 ? 88   PHE B O   1 
ATOM   2744 C CB  . PHE B 1 87  ? 44.818  100.689 26.595  1.00 30.61 ? 88   PHE B CB  1 
ATOM   2745 C CG  . PHE B 1 87  ? 43.348  101.005 26.671  1.00 32.07 ? 88   PHE B CG  1 
ATOM   2746 C CD1 . PHE B 1 87  ? 42.902  102.323 26.657  1.00 32.02 ? 88   PHE B CD1 1 
ATOM   2747 C CD2 . PHE B 1 87  ? 42.406  99.979  26.789  1.00 34.45 ? 88   PHE B CD2 1 
ATOM   2748 C CE1 . PHE B 1 87  ? 41.530  102.622 26.758  1.00 35.91 ? 88   PHE B CE1 1 
ATOM   2749 C CE2 . PHE B 1 87  ? 41.037  100.254 26.890  1.00 36.66 ? 88   PHE B CE2 1 
ATOM   2750 C CZ  . PHE B 1 87  ? 40.596  101.590 26.873  1.00 36.32 ? 88   PHE B CZ  1 
ATOM   2751 N N   . ARG B 1 88  ? 47.406  99.496  28.976  1.00 22.99 ? 89   ARG B N   1 
ATOM   2752 C CA  . ARG B 1 88  ? 48.771  98.986  29.033  1.00 23.15 ? 89   ARG B CA  1 
ATOM   2753 C C   . ARG B 1 88  ? 48.864  97.948  30.154  1.00 19.95 ? 89   ARG B C   1 
ATOM   2754 O O   . ARG B 1 88  ? 47.949  97.835  30.976  1.00 19.51 ? 89   ARG B O   1 
ATOM   2755 C CB  . ARG B 1 88  ? 49.786  100.136 29.273  1.00 24.44 ? 89   ARG B CB  1 
ATOM   2756 C CG  . ARG B 1 88  ? 49.793  100.777 30.669  1.00 27.01 ? 89   ARG B CG  1 
ATOM   2757 C CD  . ARG B 1 88  ? 50.692  102.059 30.716  1.00 29.18 ? 89   ARG B CD  1 
ATOM   2758 N NE  . ARG B 1 88  ? 50.202  103.057 29.765  1.00 29.88 ? 89   ARG B NE  1 
ATOM   2759 C CZ  . ARG B 1 88  ? 50.871  103.496 28.702  1.00 27.72 ? 89   ARG B CZ  1 
ATOM   2760 N NH1 . ARG B 1 88  ? 52.092  103.058 28.439  1.00 25.85 ? 89   ARG B NH1 1 
ATOM   2761 N NH2 . ARG B 1 88  ? 50.266  104.316 27.831  1.00 28.96 ? 89   ARG B NH2 1 
ATOM   2762 N N   . VAL B 1 89  ? 49.947  97.187  30.130  1.00 20.55 ? 90   VAL B N   1 
ATOM   2763 C CA  . VAL B 1 89  ? 50.264  96.189  31.152  1.00 21.52 ? 90   VAL B CA  1 
ATOM   2764 C C   . VAL B 1 89  ? 51.772  96.282  31.311  1.00 22.86 ? 90   VAL B C   1 
ATOM   2765 O O   . VAL B 1 89  ? 52.452  96.838  30.445  1.00 23.37 ? 90   VAL B O   1 
ATOM   2766 C CB  . VAL B 1 89  ? 49.890  94.739  30.723  1.00 16.86 ? 90   VAL B CB  1 
ATOM   2767 C CG1 . VAL B 1 89  ? 48.377  94.679  30.439  1.00 19.92 ? 90   VAL B CG1 1 
ATOM   2768 C CG2 . VAL B 1 89  ? 50.679  94.311  29.480  1.00 19.03 ? 90   VAL B CG2 1 
ATOM   2769 N N   . SER B 1 90  ? 52.300  95.748  32.415  1.00 21.45 ? 91   SER B N   1 
ATOM   2770 C CA  . SER B 1 90  ? 53.720  95.800  32.650  1.00 20.80 ? 91   SER B CA  1 
ATOM   2771 C C   . SER B 1 90  ? 54.458  94.936  31.655  1.00 19.47 ? 91   SER B C   1 
ATOM   2772 O O   . SER B 1 90  ? 53.959  93.895  31.202  1.00 18.52 ? 91   SER B O   1 
ATOM   2773 C CB  . SER B 1 90  ? 54.045  95.314  34.096  1.00 18.41 ? 91   SER B CB  1 
ATOM   2774 O OG  . SER B 1 90  ? 53.410  96.127  35.062  1.00 21.03 ? 91   SER B OG  1 
ATOM   2775 N N   . CYS B 1 91  ? 55.666  95.348  31.303  1.00 18.34 ? 92   CYS B N   1 
ATOM   2776 C CA  . CYS B 1 91  ? 56.412  94.546  30.371  1.00 20.07 ? 92   CYS B CA  1 
ATOM   2777 C C   . CYS B 1 91  ? 57.850  94.448  30.808  1.00 21.57 ? 92   CYS B C   1 
ATOM   2778 O O   . CYS B 1 91  ? 58.351  95.321  31.543  1.00 19.77 ? 92   CYS B O   1 
ATOM   2779 C CB  . CYS B 1 91  ? 56.294  95.116  28.953  1.00 18.65 ? 92   CYS B CB  1 
ATOM   2780 S SG  . CYS B 1 91  ? 56.801  96.869  28.808  1.00 24.61 ? 92   CYS B SG  1 
ATOM   2781 N N   . MET B 1 92  ? 58.503  93.394  30.332  1.00 18.08 ? 93   MET B N   1 
ATOM   2782 C CA  . MET B 1 92  ? 59.873  93.114  30.643  1.00 18.60 ? 93   MET B CA  1 
ATOM   2783 C C   . MET B 1 92  ? 60.680  92.659  29.463  1.00 18.68 ? 93   MET B C   1 
ATOM   2784 O O   . MET B 1 92  ? 60.212  91.868  28.605  1.00 19.25 ? 93   MET B O   1 
ATOM   2785 C CB  . MET B 1 92  ? 59.955  92.014  31.728  1.00 19.82 ? 93   MET B CB  1 
ATOM   2786 C CG  . MET B 1 92  ? 61.398  91.587  32.038  1.00 23.34 ? 93   MET B CG  1 
ATOM   2787 S SD  . MET B 1 92  ? 61.490  90.616  33.568  1.00 20.32 ? 93   MET B SD  1 
ATOM   2788 C CE  . MET B 1 92  ? 63.245  90.150  33.576  1.00 20.61 ? 93   MET B CE  1 
ATOM   2789 N N   . LEU B 1 93  ? 61.927  93.119  29.418  1.00 19.45 ? 94   LEU B N   1 
ATOM   2790 C CA  . LEU B 1 93  ? 62.825  92.691  28.353  1.00 18.48 ? 94   LEU B CA  1 
ATOM   2791 C C   . LEU B 1 93  ? 64.075  91.969  28.909  1.00 18.86 ? 94   LEU B C   1 
ATOM   2792 O O   . LEU B 1 93  ? 64.748  92.464  29.807  1.00 19.32 ? 94   LEU B O   1 
ATOM   2793 C CB  . LEU B 1 93  ? 63.258  93.918  27.497  1.00 19.61 ? 94   LEU B CB  1 
ATOM   2794 C CG  . LEU B 1 93  ? 64.334  93.610  26.437  1.00 21.65 ? 94   LEU B CG  1 
ATOM   2795 C CD1 . LEU B 1 93  ? 63.723  92.752  25.275  1.00 22.65 ? 94   LEU B CD1 1 
ATOM   2796 C CD2 . LEU B 1 93  ? 64.868  94.963  25.827  1.00 21.35 ? 94   LEU B CD2 1 
ATOM   2797 N N   . ASP B 1 94  ? 64.409  90.812  28.364  1.00 21.00 ? 95   ASP B N   1 
ATOM   2798 C CA  . ASP B 1 94  ? 65.598  90.089  28.803  1.00 23.87 ? 95   ASP B CA  1 
ATOM   2799 C C   . ASP B 1 94  ? 65.898  89.011  27.767  1.00 26.43 ? 95   ASP B C   1 
ATOM   2800 O O   . ASP B 1 94  ? 65.234  87.982  27.734  1.00 28.68 ? 95   ASP B O   1 
ATOM   2801 C CB  . ASP B 1 94  ? 65.346  89.500  30.207  1.00 24.15 ? 95   ASP B CB  1 
ATOM   2802 C CG  . ASP B 1 94  ? 66.645  89.114  30.937  1.00 23.57 ? 95   ASP B CG  1 
ATOM   2803 O OD1 . ASP B 1 94  ? 67.662  89.829  30.788  1.00 26.87 ? 95   ASP B OD1 1 
ATOM   2804 O OD2 . ASP B 1 94  ? 66.648  88.099  31.674  1.00 23.82 ? 95   ASP B OD2 1 
ATOM   2805 N N   . SER B 1 95  ? 66.882  89.263  26.901  1.00 28.23 ? 96   SER B N   1 
ATOM   2806 C CA  . SER B 1 95  ? 67.226  88.327  25.821  1.00 29.60 ? 96   SER B CA  1 
ATOM   2807 C C   . SER B 1 95  ? 68.381  87.428  26.239  1.00 31.43 ? 96   SER B C   1 
ATOM   2808 O O   . SER B 1 95  ? 69.562  87.797  26.140  1.00 31.65 ? 96   SER B O   1 
ATOM   2809 C CB  . SER B 1 95  ? 67.570  89.100  24.542  1.00 28.51 ? 96   SER B CB  1 
ATOM   2810 O OG  . SER B 1 95  ? 66.441  89.808  24.046  1.00 34.70 ? 96   SER B OG  1 
ATOM   2811 N N   . ASN B 1 96  ? 68.014  86.228  26.674  1.00 30.93 ? 97   ASN B N   1 
ATOM   2812 C CA  . ASN B 1 96  ? 68.935  85.240  27.238  1.00 33.46 ? 97   ASN B CA  1 
ATOM   2813 C C   . ASN B 1 96  ? 69.778  85.911  28.302  1.00 31.72 ? 97   ASN B C   1 
ATOM   2814 O O   . ASN B 1 96  ? 71.002  85.883  28.246  1.00 30.05 ? 97   ASN B O   1 
ATOM   2815 C CB  . ASN B 1 96  ? 69.829  84.565  26.185  1.00 36.51 ? 97   ASN B CB  1 
ATOM   2816 C CG  . ASN B 1 96  ? 69.043  83.587  25.301  1.00 40.57 ? 97   ASN B CG  1 
ATOM   2817 O OD1 . ASN B 1 96  ? 67.949  83.101  25.687  1.00 38.03 ? 97   ASN B OD1 1 
ATOM   2818 N ND2 . ASN B 1 96  ? 69.586  83.290  24.114  1.00 37.63 ? 97   ASN B ND2 1 
ATOM   2819 N N   . GLY B 1 97  ? 69.096  86.559  29.239  1.00 27.61 ? 98   GLY B N   1 
ATOM   2820 C CA  . GLY B 1 97  ? 69.770  87.197  30.368  1.00 30.49 ? 98   GLY B CA  1 
ATOM   2821 C C   . GLY B 1 97  ? 70.531  88.474  30.101  1.00 30.54 ? 98   GLY B C   1 
ATOM   2822 O O   . GLY B 1 97  ? 71.218  88.994  30.983  1.00 33.00 ? 98   GLY B O   1 
ATOM   2823 N N   . SER B 1 98  ? 70.404  88.996  28.887  1.00 31.64 ? 99   SER B N   1 
ATOM   2824 C CA  . SER B 1 98  ? 71.106  90.218  28.518  1.00 30.84 ? 99   SER B CA  1 
ATOM   2825 C C   . SER B 1 98  ? 71.026  91.295  29.597  1.00 28.26 ? 99   SER B C   1 
ATOM   2826 O O   . SER B 1 98  ? 72.043  91.944  29.888  1.00 31.09 ? 99   SER B O   1 
ATOM   2827 C CB  . SER B 1 98  ? 70.546  90.771  27.195  1.00 32.43 ? 99   SER B CB  1 
ATOM   2828 O OG  . SER B 1 98  ? 69.193  91.180  27.348  1.00 33.42 ? 99   SER B OG  1 
ATOM   2829 N N   . ASN B 1 99  ? 69.832  91.532  30.147  1.00 20.00 ? 100  ASN B N   1 
ATOM   2830 C CA  . ASN B 1 99  ? 69.657  92.526  31.196  1.00 18.38 ? 100  ASN B CA  1 
ATOM   2831 C C   . ASN B 1 99  ? 69.874  92.011  32.632  1.00 21.56 ? 100  ASN B C   1 
ATOM   2832 O O   . ASN B 1 99  ? 70.574  92.631  33.421  1.00 21.32 ? 100  ASN B O   1 
ATOM   2833 C CB  . ASN B 1 99  ? 68.246  93.125  31.225  1.00 20.88 ? 100  ASN B CB  1 
ATOM   2834 C CG  . ASN B 1 99  ? 68.040  94.212  30.192  1.00 22.20 ? 100  ASN B CG  1 
ATOM   2835 O OD1 . ASN B 1 99  ? 68.963  94.956  29.866  1.00 22.05 ? 100  ASN B OD1 1 
ATOM   2836 N ND2 . ASN B 1 99  ? 66.825  94.323  29.691  1.00 19.15 ? 100  ASN B ND2 1 
ATOM   2837 N N   A THR B 1 100 ? 69.371  90.796  32.936  0.60 19.58 ? 101  THR B N   1 
ATOM   2838 N N   B THR B 1 100 ? 69.099  91.023  33.017  0.40 20.18 ? 101  THR B N   1 
ATOM   2839 C CA  A THR B 1 100 ? 69.506  90.219  34.302  0.60 18.91 ? 101  THR B CA  1 
ATOM   2840 C CA  B THR B 1 100 ? 69.200  90.546  34.380  0.40 19.31 ? 101  THR B CA  1 
ATOM   2841 C C   A THR B 1 100 ? 70.916  89.695  34.672  0.60 17.25 ? 101  THR B C   1 
ATOM   2842 C C   B THR B 1 100 ? 70.625  90.174  34.803  0.40 18.52 ? 101  THR B C   1 
ATOM   2843 O O   A THR B 1 100 ? 71.341  89.817  35.822  0.60 16.98 ? 101  THR B O   1 
ATOM   2844 O O   B THR B 1 100 ? 70.989  90.327  35.970  0.40 19.61 ? 101  THR B O   1 
ATOM   2845 C CB  A THR B 1 100 ? 68.441  89.094  34.539  0.60 18.14 ? 101  THR B CB  1 
ATOM   2846 C CB  B THR B 1 100 ? 68.201  89.396  34.565  0.40 18.86 ? 101  THR B CB  1 
ATOM   2847 O OG1 A THR B 1 100 ? 68.561  88.104  33.515  0.60 20.04 ? 101  THR B OG1 1 
ATOM   2848 O OG1 B THR B 1 100 ? 68.362  88.449  33.504  0.40 18.41 ? 101  THR B OG1 1 
ATOM   2849 C CG2 A THR B 1 100 ? 67.019  89.675  34.468  0.60 19.17 ? 101  THR B CG2 1 
ATOM   2850 C CG2 B THR B 1 100 ? 66.765  89.953  34.482  0.40 18.47 ? 101  THR B CG2 1 
ATOM   2851 N N   A THR B 1 101 ? 71.639  89.106  33.718  0.60 17.95 ? 102  THR B N   1 
ATOM   2852 N N   B THR B 1 101 ? 71.436  89.714  33.853  0.40 18.88 ? 102  THR B N   1 
ATOM   2853 C CA  A THR B 1 101 ? 72.998  88.624  33.992  0.60 17.42 ? 102  THR B CA  1 
ATOM   2854 C CA  B THR B 1 101 ? 72.825  89.336  34.128  0.40 18.86 ? 102  THR B CA  1 
ATOM   2855 C C   A THR B 1 101 ? 73.914  89.839  34.143  0.60 18.09 ? 102  THR B C   1 
ATOM   2856 C C   B THR B 1 101 ? 73.686  90.572  34.392  0.40 19.64 ? 102  THR B C   1 
ATOM   2857 O O   A THR B 1 101 ? 74.637  89.966  35.137  0.60 18.12 ? 102  THR B O   1 
ATOM   2858 O O   B THR B 1 101 ? 74.419  90.624  35.393  0.40 18.68 ? 102  THR B O   1 
ATOM   2859 C CB  A THR B 1 101 ? 73.533  87.697  32.854  0.60 18.87 ? 102  THR B CB  1 
ATOM   2860 C CB  B THR B 1 101 ? 73.438  88.543  32.949  0.40 18.98 ? 102  THR B CB  1 
ATOM   2861 O OG1 A THR B 1 101 ? 72.824  86.445  32.888  0.60 19.90 ? 102  THR B OG1 1 
ATOM   2862 O OG1 B THR B 1 101 ? 72.811  87.257  32.865  0.40 21.56 ? 102  THR B OG1 1 
ATOM   2863 C CG2 A THR B 1 101 ? 75.059  87.418  33.019  0.60 16.54 ? 102  THR B CG2 1 
ATOM   2864 C CG2 B THR B 1 101 ? 74.950  88.362  33.131  0.40 18.99 ? 102  THR B CG2 1 
ATOM   2865 N N   A ALA B 1 102 ? 73.860  90.763  33.184  0.60 17.01 ? 103  ALA B N   1 
ATOM   2866 N N   B ALA B 1 102 ? 73.577  91.573  33.514  0.40 17.18 ? 103  ALA B N   1 
ATOM   2867 C CA  A ALA B 1 102 ? 74.715  91.950  33.274  0.60 18.77 ? 103  ALA B CA  1 
ATOM   2868 C CA  B ALA B 1 102 ? 74.369  92.795  33.673  0.40 17.57 ? 103  ALA B CA  1 
ATOM   2869 C C   A ALA B 1 102 ? 74.371  92.778  34.520  0.60 17.87 ? 103  ALA B C   1 
ATOM   2870 C C   B ALA B 1 102 ? 73.953  93.561  34.925  0.40 16.99 ? 103  ALA B C   1 
ATOM   2871 O O   A ALA B 1 102 ? 75.269  93.281  35.203  0.60 17.30 ? 103  ALA B O   1 
ATOM   2872 O O   B ALA B 1 102 ? 74.799  94.116  35.611  0.40 16.89 ? 103  ALA B O   1 
ATOM   2873 C CB  A ALA B 1 102 ? 74.584  92.820  31.996  0.60 15.32 ? 103  ALA B CB  1 
ATOM   2874 C CB  B ALA B 1 102 ? 74.247  93.688  32.430  0.40 15.85 ? 103  ALA B CB  1 
ATOM   2875 N N   A ALA B 1 103 ? 73.077  92.910  34.831  0.60 18.11 ? 104  ALA B N   1 
ATOM   2876 N N   B ALA B 1 103 ? 72.658  93.572  35.229  0.40 16.62 ? 104  ALA B N   1 
ATOM   2877 C CA  A ALA B 1 103 ? 72.685  93.683  36.006  0.60 17.62 ? 104  ALA B CA  1 
ATOM   2878 C CA  B ALA B 1 103 ? 72.174  94.263  36.415  0.40 16.83 ? 104  ALA B CA  1 
ATOM   2879 C C   A ALA B 1 103 ? 73.224  93.003  37.264  0.60 18.31 ? 104  ALA B C   1 
ATOM   2880 C C   B ALA B 1 103 ? 72.682  93.570  37.676  0.40 17.41 ? 104  ALA B C   1 
ATOM   2881 O O   A ALA B 1 103 ? 73.661  93.665  38.205  0.60 16.80 ? 104  ALA B O   1 
ATOM   2882 O O   B ALA B 1 103 ? 73.043  94.231  38.653  0.40 16.83 ? 104  ALA B O   1 
ATOM   2883 C CB  A ALA B 1 103 ? 71.168  93.804  36.087  0.60 17.27 ? 104  ALA B CB  1 
ATOM   2884 C CB  B ALA B 1 103 ? 70.660  94.294  36.426  0.40 14.89 ? 104  ALA B CB  1 
ATOM   2885 N N   A ALA B 1 104 ? 73.169  91.673  37.287  0.60 19.45 ? 105  ALA B N   1 
ATOM   2886 N N   B ALA B 1 104 ? 72.676  92.236  37.661  0.40 18.97 ? 105  ALA B N   1 
ATOM   2887 C CA  A ALA B 1 104 ? 73.658  90.909  38.445  0.60 19.21 ? 105  ALA B CA  1 
ATOM   2888 C CA  B ALA B 1 104 ? 73.149  91.453  38.802  0.40 18.21 ? 105  ALA B CA  1 
ATOM   2889 C C   A ALA B 1 104 ? 75.182  91.066  38.590  0.60 18.20 ? 105  ALA B C   1 
ATOM   2890 C C   B ALA B 1 104 ? 74.656  91.678  39.007  0.40 19.45 ? 105  ALA B C   1 
ATOM   2891 O O   A ALA B 1 104 ? 75.709  91.256  39.685  0.60 17.64 ? 105  ALA B O   1 
ATOM   2892 O O   B ALA B 1 104 ? 75.116  91.906  40.132  0.40 19.28 ? 105  ALA B O   1 
ATOM   2893 C CB  A ALA B 1 104 ? 73.316  89.415  38.277  0.60 17.87 ? 105  ALA B CB  1 
ATOM   2894 C CB  B ALA B 1 104 ? 72.866  89.965  38.571  0.40 19.32 ? 105  ALA B CB  1 
ATOM   2895 N N   A GLY B 1 105 ? 75.878  90.968  37.471  0.60 18.69 ? 106  GLY B N   1 
ATOM   2896 N N   B GLY B 1 105 ? 75.417  91.600  37.920  0.40 18.03 ? 106  GLY B N   1 
ATOM   2897 C CA  A GLY B 1 105 ? 77.324  91.059  37.510  0.60 19.62 ? 106  GLY B CA  1 
ATOM   2898 C CA  B GLY B 1 105 ? 76.850  91.802  38.015  0.40 19.10 ? 106  GLY B CA  1 
ATOM   2899 C C   A GLY B 1 105 ? 77.790  92.435  37.922  0.60 19.59 ? 106  GLY B C   1 
ATOM   2900 C C   B GLY B 1 105 ? 77.225  93.185  38.518  0.40 19.31 ? 106  GLY B C   1 
ATOM   2901 O O   A GLY B 1 105 ? 78.619  92.583  38.815  0.60 20.21 ? 106  GLY B O   1 
ATOM   2902 O O   B GLY B 1 105 ? 77.984  93.318  39.479  0.40 19.94 ? 106  GLY B O   1 
ATOM   2903 N N   A VAL B 1 106 ? 77.253  93.459  37.275  0.60 20.29 ? 107  VAL B N   1 
ATOM   2904 N N   B VAL B 1 106 ? 76.681  94.220  37.883  0.40 19.06 ? 107  VAL B N   1 
ATOM   2905 C CA  A VAL B 1 106 ? 77.666  94.813  37.611  0.60 18.66 ? 107  VAL B CA  1 
ATOM   2906 C CA  B VAL B 1 106 ? 76.997  95.587  38.277  0.40 19.31 ? 107  VAL B CA  1 
ATOM   2907 C C   A VAL B 1 106 ? 77.326  95.160  39.057  0.60 19.35 ? 107  VAL B C   1 
ATOM   2908 C C   B VAL B 1 106 ? 76.564  95.894  39.713  0.40 18.78 ? 107  VAL B C   1 
ATOM   2909 O O   A VAL B 1 106 ? 78.172  95.657  39.791  0.60 18.23 ? 107  VAL B O   1 
ATOM   2910 O O   B VAL B 1 106 ? 77.303  96.530  40.449  0.40 18.13 ? 107  VAL B O   1 
ATOM   2911 C CB  A VAL B 1 106 ? 77.019  95.836  36.653  0.60 19.29 ? 107  VAL B CB  1 
ATOM   2912 C CB  B VAL B 1 106 ? 76.355  96.612  37.311  0.40 18.57 ? 107  VAL B CB  1 
ATOM   2913 C CG1 A VAL B 1 106 ? 77.469  97.246  36.996  0.60 19.07 ? 107  VAL B CG1 1 
ATOM   2914 C CG1 B VAL B 1 106 ? 76.774  98.014  37.686  0.40 20.27 ? 107  VAL B CG1 1 
ATOM   2915 C CG2 A VAL B 1 106 ? 77.402  95.489  35.213  0.60 18.56 ? 107  VAL B CG2 1 
ATOM   2916 C CG2 B VAL B 1 106 ? 76.788  96.326  35.889  0.40 20.43 ? 107  VAL B CG2 1 
ATOM   2917 N N   A ALA B 1 107 ? 76.094  94.882  39.474  0.60 19.62 ? 108  ALA B N   1 
ATOM   2918 N N   B ALA B 1 107 ? 75.379  95.437  40.106  0.40 18.61 ? 108  ALA B N   1 
ATOM   2919 C CA  A ALA B 1 107 ? 75.691  95.200  40.833  0.60 18.17 ? 108  ALA B CA  1 
ATOM   2920 C CA  B ALA B 1 107 ? 74.883  95.680  41.457  0.40 17.94 ? 108  ALA B CA  1 
ATOM   2921 C C   A ALA B 1 107 ? 76.607  94.544  41.862  0.60 18.40 ? 108  ALA B C   1 
ATOM   2922 C C   B ALA B 1 107 ? 75.780  95.009  42.511  0.40 18.21 ? 108  ALA B C   1 
ATOM   2923 O O   A ALA B 1 107 ? 76.926  95.153  42.876  0.60 18.20 ? 108  ALA B O   1 
ATOM   2924 O O   B ALA B 1 107 ? 75.981  95.541  43.599  0.40 18.76 ? 108  ALA B O   1 
ATOM   2925 C CB  A ALA B 1 107 ? 74.252  94.775  41.067  0.60 17.20 ? 108  ALA B CB  1 
ATOM   2926 C CB  B ALA B 1 107 ? 73.445  95.182  41.581  0.40 18.16 ? 108  ALA B CB  1 
ATOM   2927 N N   A LEU B 1 108 ? 77.031  93.309  41.600  0.60 18.84 ? 109  LEU B N   1 
ATOM   2928 N N   B LEU B 1 108 ? 76.312  93.839  42.189  0.40 17.47 ? 109  LEU B N   1 
ATOM   2929 C CA  A LEU B 1 108 ? 77.924  92.613  42.534  0.60 18.28 ? 109  LEU B CA  1 
ATOM   2930 C CA  B LEU B 1 108 ? 77.193  93.135  43.113  0.40 16.41 ? 109  LEU B CA  1 
ATOM   2931 C C   A LEU B 1 108 ? 79.293  93.295  42.586  0.60 18.68 ? 109  LEU B C   1 
ATOM   2932 C C   B LEU B 1 108 ? 78.509  93.890  43.235  0.40 16.50 ? 109  LEU B C   1 
ATOM   2933 O O   A LEU B 1 108 ? 79.871  93.502  43.670  0.60 17.06 ? 109  LEU B O   1 
ATOM   2934 O O   B LEU B 1 108 ? 79.055  94.042  44.333  0.40 15.65 ? 109  LEU B O   1 
ATOM   2935 C CB  A LEU B 1 108 ? 78.110  91.148  42.115  0.60 18.86 ? 109  LEU B CB  1 
ATOM   2936 C CB  B LEU B 1 108 ? 77.440  91.714  42.614  0.40 17.12 ? 109  LEU B CB  1 
ATOM   2937 C CG  A LEU B 1 108 ? 76.947  90.203  42.485  0.60 19.85 ? 109  LEU B CG  1 
ATOM   2938 C CG  B LEU B 1 108 ? 76.300  90.720  42.859  0.40 16.20 ? 109  LEU B CG  1 
ATOM   2939 C CD1 A LEU B 1 108 ? 77.121  88.885  41.748  0.60 20.62 ? 109  LEU B CD1 1 
ATOM   2940 C CD1 B LEU B 1 108 ? 76.567  89.415  42.120  0.40 18.30 ? 109  LEU B CD1 1 
ATOM   2941 C CD2 A LEU B 1 108 ? 76.915  89.946  44.003  0.60 18.35 ? 109  LEU B CD2 1 
ATOM   2942 C CD2 B LEU B 1 108 ? 76.168  90.466  44.357  0.40 17.22 ? 109  LEU B CD2 1 
ATOM   2943 N N   A VAL B 1 109 ? 79.813  93.641  41.416  0.60 16.82 ? 110  VAL B N   1 
ATOM   2944 N N   B VAL B 1 109 ? 79.019  94.376  42.105  0.40 16.28 ? 110  VAL B N   1 
ATOM   2945 C CA  A VAL B 1 109 ? 81.112  94.290  41.347  0.60 18.22 ? 110  VAL B CA  1 
ATOM   2946 C CA  B VAL B 1 109 ? 80.281  95.108  42.118  0.40 18.11 ? 110  VAL B CA  1 
ATOM   2947 C C   A VAL B 1 109 ? 81.069  95.676  41.989  0.60 18.96 ? 110  VAL B C   1 
ATOM   2948 C C   B VAL B 1 109 ? 80.129  96.435  42.848  0.40 19.46 ? 110  VAL B C   1 
ATOM   2949 O O   A VAL B 1 109 ? 81.981  96.051  42.726  0.60 19.80 ? 110  VAL B O   1 
ATOM   2950 O O   B VAL B 1 109 ? 80.977  96.805  43.662  0.40 21.42 ? 110  VAL B O   1 
ATOM   2951 C CB  A VAL B 1 109 ? 81.595  94.398  39.885  0.60 17.33 ? 110  VAL B CB  1 
ATOM   2952 C CB  B VAL B 1 109 ? 80.812  95.356  40.684  0.40 17.56 ? 110  VAL B CB  1 
ATOM   2953 C CG1 A VAL B 1 109 ? 82.728  95.442  39.768  0.60 20.23 ? 110  VAL B CG1 1 
ATOM   2954 C CG1 B VAL B 1 109 ? 81.982  96.338  40.715  0.40 16.37 ? 110  VAL B CG1 1 
ATOM   2955 C CG2 A VAL B 1 109 ? 82.110  93.039  39.437  0.60 17.32 ? 110  VAL B CG2 1 
ATOM   2956 C CG2 B VAL B 1 109 ? 81.269  94.035  40.071  0.40 16.37 ? 110  VAL B CG2 1 
ATOM   2957 N N   A VAL B 1 110 ? 80.010  96.432  41.727  0.60 18.75 ? 111  VAL B N   1 
ATOM   2958 N N   B VAL B 1 110 ? 79.041  97.146  42.578  0.40 18.99 ? 111  VAL B N   1 
ATOM   2959 C CA  A VAL B 1 110 ? 79.900  97.765  42.305  0.60 19.05 ? 111  VAL B CA  1 
ATOM   2960 C CA  B VAL B 1 110 ? 78.832  98.415  43.239  0.40 19.02 ? 111  VAL B CA  1 
ATOM   2961 C C   A VAL B 1 110 ? 79.825  97.702  43.817  0.60 18.71 ? 111  VAL B C   1 
ATOM   2962 C C   B VAL B 1 110 ? 78.724  98.251  44.755  0.40 21.46 ? 111  VAL B C   1 
ATOM   2963 O O   A VAL B 1 110 ? 80.504  98.449  44.502  0.60 19.49 ? 111  VAL B O   1 
ATOM   2964 O O   B VAL B 1 110 ? 79.364  98.988  45.503  0.40 20.43 ? 111  VAL B O   1 
ATOM   2965 C CB  A VAL B 1 110 ? 78.696  98.519  41.735  0.60 18.81 ? 111  VAL B CB  1 
ATOM   2966 C CB  B VAL B 1 110 ? 77.576  99.116  42.714  0.40 19.03 ? 111  VAL B CB  1 
ATOM   2967 C CG1 A VAL B 1 110 ? 78.525  99.858  42.436  0.60 19.20 ? 111  VAL B CG1 1 
ATOM   2968 C CG1 B VAL B 1 110 ? 77.376  100.419 43.446  0.40 16.20 ? 111  VAL B CG1 1 
ATOM   2969 C CG2 A VAL B 1 110 ? 78.908  98.722  40.236  0.60 19.01 ? 111  VAL B CG2 1 
ATOM   2970 C CG2 B VAL B 1 110 ? 77.714  99.371  41.242  0.40 15.23 ? 111  VAL B CG2 1 
ATOM   2971 N N   A LYS B 1 111 ? 79.008  96.794  44.343  0.60 20.31 ? 112  LYS B N   1 
ATOM   2972 N N   B LYS B 1 111 ? 77.934  97.276  45.201  0.40 20.69 ? 112  LYS B N   1 
ATOM   2973 C CA  A LYS B 1 111 ? 78.878  96.644  45.778  0.60 20.12 ? 112  LYS B CA  1 
ATOM   2974 C CA  B LYS B 1 111 ? 77.755  97.043  46.632  0.40 22.64 ? 112  LYS B CA  1 
ATOM   2975 C C   A LYS B 1 111 ? 80.231  96.286  46.398  0.60 21.80 ? 112  LYS B C   1 
ATOM   2976 C C   B LYS B 1 111 ? 79.103  96.691  47.284  0.40 23.87 ? 112  LYS B C   1 
ATOM   2977 O O   A LYS B 1 111 ? 80.607  96.809  47.451  0.60 21.74 ? 112  LYS B O   1 
ATOM   2978 O O   B LYS B 1 111 ? 79.424  97.152  48.392  0.40 23.67 ? 112  LYS B O   1 
ATOM   2979 C CB  A LYS B 1 111 ? 77.858  95.539  46.112  0.60 18.96 ? 112  LYS B CB  1 
ATOM   2980 C CB  B LYS B 1 111 ? 76.741  95.919  46.857  0.40 20.84 ? 112  LYS B CB  1 
ATOM   2981 C CG  A LYS B 1 111 ? 77.568  95.409  47.612  0.60 18.18 ? 112  LYS B CG  1 
ATOM   2982 C CG  B LYS B 1 111 ? 76.379  95.678  48.319  0.40 21.02 ? 112  LYS B CG  1 
ATOM   2983 C CD  A LYS B 1 111 ? 76.822  94.118  47.912  0.60 19.60 ? 112  LYS B CD  1 
ATOM   2984 C CD  B LYS B 1 111 ? 75.573  94.390  48.490  0.40 20.04 ? 112  LYS B CD  1 
ATOM   2985 C CE  A LYS B 1 111 ? 76.634  93.902  49.411  0.60 22.16 ? 112  LYS B CE  1 
ATOM   2986 C CE  B LYS B 1 111 ? 75.304  94.120  49.955  0.40 21.00 ? 112  LYS B CE  1 
ATOM   2987 N NZ  A LYS B 1 111 ? 75.898  92.618  49.648  0.60 24.46 ? 112  LYS B NZ  1 
ATOM   2988 N NZ  B LYS B 1 111 ? 74.742  92.765  50.184  0.40 23.12 ? 112  LYS B NZ  1 
ATOM   2989 N N   A ALA B 1 112 ? 80.960  95.389  45.741  0.60 22.60 ? 113  ALA B N   1 
ATOM   2990 N N   B ALA B 1 112 ? 79.897  95.882  46.590  0.40 23.68 ? 113  ALA B N   1 
ATOM   2991 C CA  A ALA B 1 112 ? 82.271  94.961  46.223  0.60 23.27 ? 113  ALA B CA  1 
ATOM   2992 C CA  B ALA B 1 112 ? 81.204  95.490  47.106  0.40 24.26 ? 113  ALA B CA  1 
ATOM   2993 C C   A ALA B 1 112 ? 83.321  96.077  46.117  0.60 24.61 ? 113  ALA B C   1 
ATOM   2994 C C   B ALA B 1 112 ? 82.158  96.686  47.138  0.40 25.54 ? 113  ALA B C   1 
ATOM   2995 O O   A ALA B 1 112 ? 84.294  96.100  46.880  0.60 25.31 ? 113  ALA B O   1 
ATOM   2996 O O   B ALA B 1 112 ? 83.047  96.753  47.987  0.40 25.46 ? 113  ALA B O   1 
ATOM   2997 C CB  A ALA B 1 112 ? 82.729  93.736  45.437  0.60 21.44 ? 113  ALA B CB  1 
ATOM   2998 C CB  B ALA B 1 112 ? 81.785  94.376  46.258  0.40 23.76 ? 113  ALA B CB  1 
ATOM   2999 N N   A ALA B 1 113 ? 83.132  97.002  45.176  0.60 25.51 ? 114  ALA B N   1 
ATOM   3000 N N   B ALA B 1 113 ? 81.963  97.633  46.224  0.40 25.73 ? 114  ALA B N   1 
ATOM   3001 C CA  A ALA B 1 113 ? 84.071  98.107  45.004  0.60 27.01 ? 114  ALA B CA  1 
ATOM   3002 C CA  B ALA B 1 113 ? 82.816  98.822  46.148  0.40 27.73 ? 114  ALA B CA  1 
ATOM   3003 C C   A ALA B 1 113 ? 83.818  99.196  46.047  0.60 27.91 ? 114  ALA B C   1 
ATOM   3004 C C   B ALA B 1 113 ? 82.477  99.835  47.237  0.40 28.81 ? 114  ALA B C   1 
ATOM   3005 O O   A ALA B 1 113 ? 84.518  100.201 46.079  0.60 31.22 ? 114  ALA B O   1 
ATOM   3006 O O   B ALA B 1 113 ? 83.143  100.872 47.361  0.40 28.09 ? 114  ALA B O   1 
ATOM   3007 C CB  A ALA B 1 113 ? 83.938  98.701  43.600  0.60 27.41 ? 114  ALA B CB  1 
ATOM   3008 C CB  B ALA B 1 113 ? 82.676  99.484  44.760  0.40 27.46 ? 114  ALA B CB  1 
ATOM   3009 N N   A GLY B 1 114 ? 82.809  98.994  46.887  0.60 29.60 ? 115  GLY B N   1 
ATOM   3010 N N   B GLY B 1 114 ? 81.443  99.532  48.019  0.40 28.40 ? 115  GLY B N   1 
ATOM   3011 C CA  A GLY B 1 114 ? 82.481  99.981  47.904  0.60 31.22 ? 115  GLY B CA  1 
ATOM   3012 C CA  B GLY B 1 114 ? 81.028  100.426 49.081  0.40 28.84 ? 115  GLY B CA  1 
ATOM   3013 C C   A GLY B 1 114 ? 81.190  100.739 47.647  0.60 30.31 ? 115  GLY B C   1 
ATOM   3014 C C   B GLY B 1 114 ? 79.698  101.112 48.825  0.40 29.77 ? 115  GLY B C   1 
ATOM   3015 O O   A GLY B 1 114 ? 80.749  101.539 48.475  0.60 29.99 ? 115  GLY B O   1 
ATOM   3016 O O   B GLY B 1 114 ? 79.168  101.802 49.698  0.40 29.56 ? 115  GLY B O   1 
ATOM   3017 N N   A GLY B 1 115 ? 80.571  100.500 46.494  0.60 31.34 ? 116  GLY B N   1 
ATOM   3018 N N   B GLY B 1 115 ? 79.148  100.934 47.628  0.40 29.56 ? 116  GLY B N   1 
ATOM   3019 C CA  A GLY B 1 115 ? 79.324  101.187 46.194  0.60 28.73 ? 116  GLY B CA  1 
ATOM   3020 C CA  B GLY B 1 115 ? 77.871  101.553 47.327  0.40 31.21 ? 116  GLY B CA  1 
ATOM   3021 C C   A GLY B 1 115 ? 79.465  102.281 45.156  0.60 29.69 ? 116  GLY B C   1 
ATOM   3022 C C   B GLY B 1 115 ? 77.983  102.728 46.382  0.40 31.87 ? 116  GLY B C   1 
ATOM   3023 O O   A GLY B 1 115 ? 78.471  102.858 44.727  0.60 29.26 ? 116  GLY B O   1 
ATOM   3024 O O   B GLY B 1 115 ? 76.987  103.331 45.994  0.40 31.58 ? 116  GLY B O   1 
ATOM   3025 N N   A SER B 1 116 ? 80.693  102.591 44.764  0.60 30.94 ? 117  SER B N   1 
ATOM   3026 N N   B SER B 1 116 ? 79.205  103.073 46.012  0.40 33.11 ? 117  SER B N   1 
ATOM   3027 C CA  A SER B 1 116 ? 80.924  103.616 43.745  0.60 32.78 ? 117  SER B CA  1 
ATOM   3028 C CA  B SER B 1 116 ? 79.402  104.172 45.081  0.40 33.74 ? 117  SER B CA  1 
ATOM   3029 C C   A SER B 1 116 ? 82.087  103.176 42.876  0.60 32.24 ? 117  SER B C   1 
ATOM   3030 C C   B SER B 1 116 ? 80.626  103.867 44.245  0.40 33.30 ? 117  SER B C   1 
ATOM   3031 O O   A SER B 1 116 ? 83.088  102.654 43.374  0.60 33.12 ? 117  SER B O   1 
ATOM   3032 O O   B SER B 1 116 ? 81.617  103.333 44.744  0.40 34.79 ? 117  SER B O   1 
ATOM   3033 C CB  A SER B 1 116 ? 81.270  104.986 44.369  0.60 34.28 ? 117  SER B CB  1 
ATOM   3034 C CB  B SER B 1 116 ? 79.573  105.508 45.830  0.40 34.22 ? 117  SER B CB  1 
ATOM   3035 O OG  A SER B 1 116 ? 80.134  105.644 44.925  0.60 38.69 ? 117  SER B OG  1 
ATOM   3036 O OG  B SER B 1 116 ? 78.345  105.942 46.412  0.40 34.60 ? 117  SER B OG  1 
ATOM   3037 N N   A VAL B 1 117 ? 81.947  103.386 41.578  0.60 32.06 ? 118  VAL B N   1 
ATOM   3038 N N   B VAL B 1 117 ? 80.546  104.173 42.960  0.40 32.30 ? 118  VAL B N   1 
ATOM   3039 C CA  A VAL B 1 117 ? 82.990  103.045 40.636  0.60 30.35 ? 118  VAL B CA  1 
ATOM   3040 C CA  B VAL B 1 117 ? 81.672  103.942 42.075  0.40 31.93 ? 118  VAL B CA  1 
ATOM   3041 C C   A VAL B 1 117 ? 83.219  104.224 39.712  0.60 30.33 ? 118  VAL B C   1 
ATOM   3042 C C   B VAL B 1 117 ? 81.886  105.197 41.252  0.40 31.12 ? 118  VAL B C   1 
ATOM   3043 O O   A VAL B 1 117 ? 83.844  104.070 38.661  0.60 28.87 ? 118  VAL B O   1 
ATOM   3044 O O   B VAL B 1 117 ? 82.569  105.164 40.238  0.40 29.82 ? 118  VAL B O   1 
ATOM   3045 C CB  A VAL B 1 117 ? 82.620  101.828 39.777  0.60 31.41 ? 118  VAL B CB  1 
ATOM   3046 C CB  B VAL B 1 117 ? 81.418  102.764 41.106  0.40 32.17 ? 118  VAL B CB  1 
ATOM   3047 C CG1 A VAL B 1 117 ? 82.351  100.629 40.665  0.60 31.55 ? 118  VAL B CG1 1 
ATOM   3048 C CG1 B VAL B 1 117 ? 81.192  101.483 41.884  0.38 32.40 ? 118  VAL B CG1 1 
ATOM   3049 C CG2 A VAL B 1 117 ? 81.397  102.145 38.920  0.60 30.62 ? 118  VAL B CG2 1 
ATOM   3050 C CG2 B VAL B 1 117 ? 80.223  103.078 40.212  0.38 31.54 ? 118  VAL B CG2 1 
ATOM   3051 N N   A LYS B 1 118 ? 82.730  105.404 40.096  0.60 29.29 ? 119  LYS B N   1 
ATOM   3052 N N   B LYS B 1 118 ? 81.299  106.306 41.686  0.40 31.36 ? 119  LYS B N   1 
ATOM   3053 C CA  A LYS B 1 118 ? 82.914  106.575 39.236  0.60 29.72 ? 119  LYS B CA  1 
ATOM   3054 C CA  B LYS B 1 118 ? 81.447  107.538 40.927  0.40 32.03 ? 119  LYS B CA  1 
ATOM   3055 C C   A LYS B 1 118 ? 84.377  107.047 39.226  0.60 28.11 ? 119  LYS B C   1 
ATOM   3056 C C   B LYS B 1 118 ? 82.868  108.100 41.011  0.40 31.80 ? 119  LYS B C   1 
ATOM   3057 O O   A LYS B 1 118 ? 85.048  107.050 40.260  0.60 28.30 ? 119  LYS B O   1 
ATOM   3058 O O   B LYS B 1 118 ? 83.509  108.090 42.070  0.40 32.08 ? 119  LYS B O   1 
ATOM   3059 C CB  A LYS B 1 118 ? 81.990  107.730 39.655  0.60 30.74 ? 119  LYS B CB  1 
ATOM   3060 C CB  B LYS B 1 118 ? 80.410  108.589 41.368  0.40 33.41 ? 119  LYS B CB  1 
ATOM   3061 C CG  A LYS B 1 118 ? 82.549  108.696 40.688  0.60 34.62 ? 119  LYS B CG  1 
ATOM   3062 C CG  B LYS B 1 118 ? 80.822  109.504 42.507  0.40 35.63 ? 119  LYS B CG  1 
ATOM   3063 C CD  A LYS B 1 118 ? 81.631  109.926 40.838  0.60 37.92 ? 119  LYS B CD  1 
ATOM   3064 C CD  B LYS B 1 118 ? 79.859  110.685 42.605  0.40 37.45 ? 119  LYS B CD  1 
ATOM   3065 C CE  A LYS B 1 118 ? 82.294  111.045 41.661  0.60 40.33 ? 119  LYS B CE  1 
ATOM   3066 C CE  B LYS B 1 118 ? 80.370  111.754 43.558  0.40 38.25 ? 119  LYS B CE  1 
ATOM   3067 N NZ  A LYS B 1 118 ? 81.465  112.300 41.728  0.60 41.50 ? 119  LYS B NZ  1 
ATOM   3068 N NZ  B LYS B 1 118 ? 79.461  112.944 43.561  0.40 38.74 ? 119  LYS B NZ  1 
ATOM   3069 N N   A GLY B 1 119 ? 84.852  107.431 38.045  0.60 26.54 ? 120  GLY B N   1 
ATOM   3070 N N   B GLY B 1 119 ? 83.361  108.570 39.872  0.40 31.35 ? 120  GLY B N   1 
ATOM   3071 C CA  A GLY B 1 119 ? 86.225  107.881 37.891  0.60 28.10 ? 120  GLY B CA  1 
ATOM   3072 C CA  B GLY B 1 119 ? 84.704  109.119 39.821  0.40 31.42 ? 120  GLY B CA  1 
ATOM   3073 C C   A GLY B 1 119 ? 87.193  106.731 37.664  0.60 29.49 ? 120  GLY B C   1 
ATOM   3074 C C   B GLY B 1 119 ? 85.769  108.049 39.631  0.40 31.09 ? 120  GLY B C   1 
ATOM   3075 O O   A GLY B 1 119 ? 88.389  106.946 37.452  0.60 29.78 ? 120  GLY B O   1 
ATOM   3076 O O   B GLY B 1 119 ? 86.964  108.348 39.607  0.40 31.26 ? 120  GLY B O   1 
ATOM   3077 N N   A LYS B 1 120 ? 86.691  105.497 37.686  0.60 29.89 ? 121  LYS B N   1 
ATOM   3078 N N   B LYS B 1 120 ? 85.350  106.798 39.489  0.40 29.86 ? 121  LYS B N   1 
ATOM   3079 C CA  A LYS B 1 120 ? 87.585  104.358 37.509  0.60 28.48 ? 121  LYS B CA  1 
ATOM   3080 C CA  B LYS B 1 120 ? 86.317  105.723 39.317  0.40 28.06 ? 121  LYS B CA  1 
ATOM   3081 C C   A LYS B 1 120 ? 87.457  103.688 36.155  0.60 27.89 ? 121  LYS B C   1 
ATOM   3082 C C   B LYS B 1 120 ? 86.278  105.152 37.906  0.40 26.73 ? 121  LYS B C   1 
ATOM   3083 O O   A LYS B 1 120 ? 86.424  103.777 35.496  0.60 27.67 ? 121  LYS B O   1 
ATOM   3084 O O   B LYS B 1 120 ? 85.294  105.307 37.199  0.40 25.75 ? 121  LYS B O   1 
ATOM   3085 C CB  A LYS B 1 120 ? 87.373  103.359 38.644  0.60 30.55 ? 121  LYS B CB  1 
ATOM   3086 C CB  B LYS B 1 120 ? 86.078  104.647 40.378  0.40 29.38 ? 121  LYS B CB  1 
ATOM   3087 C CG  A LYS B 1 120 ? 87.423  104.043 40.003  0.60 32.45 ? 121  LYS B CG  1 
ATOM   3088 C CG  B LYS B 1 120 ? 86.004  105.258 41.780  0.40 30.79 ? 121  LYS B CG  1 
ATOM   3089 C CD  A LYS B 1 120 ? 87.728  103.104 41.144  0.60 33.40 ? 121  LYS B CD  1 
ATOM   3090 C CD  B LYS B 1 120 ? 86.321  104.271 42.881  0.40 31.90 ? 121  LYS B CD  1 
ATOM   3091 C CE  A LYS B 1 120 ? 87.992  103.908 42.423  0.60 36.39 ? 121  LYS B CE  1 
ATOM   3092 C CE  B LYS B 1 120 ? 86.447  105.013 44.200  0.40 32.96 ? 121  LYS B CE  1 
ATOM   3093 N NZ  A LYS B 1 120 ? 88.635  103.087 43.494  0.60 36.67 ? 121  LYS B NZ  1 
ATOM   3094 N NZ  B LYS B 1 120 ? 87.110  104.195 45.245  0.40 35.16 ? 121  LYS B NZ  1 
ATOM   3095 N N   A LYS B 1 121 ? 88.523  103.018 35.739  0.60 27.35 ? 122  LYS B N   1 
ATOM   3096 N N   B LYS B 1 121 ? 87.373  104.519 37.498  0.40 25.92 ? 122  LYS B N   1 
ATOM   3097 C CA  A LYS B 1 121 ? 88.547  102.359 34.441  0.60 25.17 ? 122  LYS B CA  1 
ATOM   3098 C CA  B LYS B 1 121 ? 87.487  103.966 36.161  0.40 26.20 ? 122  LYS B CA  1 
ATOM   3099 C C   A LYS B 1 121 ? 88.055  100.904 34.483  0.60 24.83 ? 122  LYS B C   1 
ATOM   3100 C C   B LYS B 1 121 ? 87.076  102.507 36.107  0.40 25.41 ? 122  LYS B C   1 
ATOM   3101 O O   A LYS B 1 121 ? 88.553  100.086 35.248  0.60 23.38 ? 122  LYS B O   1 
ATOM   3102 O O   B LYS B 1 121 ? 87.575  101.688 36.871  0.40 26.29 ? 122  LYS B O   1 
ATOM   3103 C CB  A LYS B 1 121 ? 89.957  102.408 33.875  0.60 24.63 ? 122  LYS B CB  1 
ATOM   3104 C CB  B LYS B 1 121 ? 88.929  104.131 35.660  0.40 26.71 ? 122  LYS B CB  1 
ATOM   3105 C CG  A LYS B 1 121 ? 90.053  101.905 32.436  0.60 26.84 ? 122  LYS B CG  1 
ATOM   3106 C CG  B LYS B 1 121 ? 89.188  103.588 34.252  0.40 28.27 ? 122  LYS B CG  1 
ATOM   3107 C CD  A LYS B 1 121 ? 91.443  102.117 31.862  0.60 30.21 ? 122  LYS B CD  1 
ATOM   3108 C CD  B LYS B 1 121 ? 90.537  104.079 33.727  0.40 28.71 ? 122  LYS B CD  1 
ATOM   3109 C CE  A LYS B 1 121 ? 91.419  101.998 30.327  0.60 28.78 ? 122  LYS B CE  1 
ATOM   3110 C CE  B LYS B 1 121 ? 90.669  103.879 32.227  0.40 26.92 ? 122  LYS B CE  1 
ATOM   3111 N NZ  A LYS B 1 121 ? 92.776  102.222 29.759  0.60 30.62 ? 122  LYS B NZ  1 
ATOM   3112 N NZ  B LYS B 1 121 ? 91.965  104.415 31.718  0.40 31.10 ? 122  LYS B NZ  1 
ATOM   3113 N N   A ALA B 1 122 ? 87.067  100.601 33.652  0.60 23.53 ? 123  ALA B N   1 
ATOM   3114 N N   B ALA B 1 122 ? 86.143  102.195 35.212  0.40 25.79 ? 123  ALA B N   1 
ATOM   3115 C CA  A ALA B 1 122 ? 86.524  99.254  33.582  0.60 21.40 ? 123  ALA B CA  1 
ATOM   3116 C CA  B ALA B 1 122 ? 85.681  100.826 35.026  0.40 23.13 ? 123  ALA B CA  1 
ATOM   3117 C C   A ALA B 1 122 ? 86.671  98.804  32.154  0.60 22.05 ? 123  ALA B C   1 
ATOM   3118 C C   B ALA B 1 122 ? 85.930  100.444 33.577  0.40 23.40 ? 123  ALA B C   1 
ATOM   3119 O O   A ALA B 1 122 ? 86.366  99.557  31.220  0.60 19.47 ? 123  ALA B O   1 
ATOM   3120 O O   B ALA B 1 122 ? 85.578  101.199 32.658  0.40 23.59 ? 123  ALA B O   1 
ATOM   3121 C CB  A ALA B 1 122 ? 85.072  99.250  33.981  0.60 21.87 ? 123  ALA B CB  1 
ATOM   3122 C CB  B ALA B 1 122 ? 84.199  100.716 35.348  0.40 23.90 ? 123  ALA B CB  1 
ATOM   3123 N N   A VAL B 1 123 ? 87.144  97.573  31.991  0.60 20.19 ? 124  VAL B N   1 
ATOM   3124 N N   B VAL B 1 123 ? 86.531  99.273  33.376  0.40 21.56 ? 124  VAL B N   1 
ATOM   3125 C CA  A VAL B 1 123 ? 87.355  96.990  30.685  0.60 19.06 ? 124  VAL B CA  1 
ATOM   3126 C CA  B VAL B 1 123 ? 86.828  98.787  32.042  0.40 22.17 ? 124  VAL B CA  1 
ATOM   3127 C C   A VAL B 1 123 ? 86.491  95.741  30.517  0.60 19.23 ? 124  VAL B C   1 
ATOM   3128 C C   B VAL B 1 123 ? 86.076  97.497  31.760  0.40 20.66 ? 124  VAL B C   1 
ATOM   3129 O O   A VAL B 1 123 ? 86.426  94.888  31.397  0.60 20.61 ? 124  VAL B O   1 
ATOM   3130 O O   B VAL B 1 123 ? 86.067  96.585  32.582  0.40 21.89 ? 124  VAL B O   1 
ATOM   3131 C CB  A VAL B 1 123 ? 88.837  96.583  30.485  0.60 16.56 ? 124  VAL B CB  1 
ATOM   3132 C CB  B VAL B 1 123 ? 88.328  98.500  31.861  0.40 21.82 ? 124  VAL B CB  1 
ATOM   3133 C CG1 A VAL B 1 123 ? 89.025  95.958  29.104  0.60 19.38 ? 124  VAL B CG1 1 
ATOM   3134 C CG1 B VAL B 1 123 ? 88.563  97.896  30.490  0.40 22.67 ? 124  VAL B CG1 1 
ATOM   3135 C CG2 A VAL B 1 123 ? 89.757  97.808  30.634  0.60 17.91 ? 124  VAL B CG2 1 
ATOM   3136 C CG2 B VAL B 1 123 ? 89.146  99.789  32.039  0.40 20.30 ? 124  VAL B CG2 1 
ATOM   3137 N N   A VAL B 1 124 ? 85.813  95.642  29.387  0.60 18.86 ? 125  VAL B N   1 
ATOM   3138 N N   B VAL B 1 124 ? 85.449  97.436  30.593  0.40 20.68 ? 125  VAL B N   1 
ATOM   3139 C CA  A VAL B 1 124 ? 84.990  94.469  29.105  0.60 18.71 ? 125  VAL B CA  1 
ATOM   3140 C CA  B VAL B 1 124 ? 84.707  96.259  30.178  0.40 19.90 ? 125  VAL B CA  1 
ATOM   3141 C C   A VAL B 1 124 ? 85.590  93.761  27.904  0.60 20.95 ? 125  VAL B C   1 
ATOM   3142 C C   B VAL B 1 124 ? 85.409  95.671  28.972  0.40 20.78 ? 125  VAL B C   1 
ATOM   3143 O O   A VAL B 1 124 ? 85.526  94.258  26.764  0.60 20.61 ? 125  VAL B O   1 
ATOM   3144 O O   B VAL B 1 124 ? 85.409  96.260  27.875  0.40 19.58 ? 125  VAL B O   1 
ATOM   3145 C CB  A VAL B 1 124 ? 83.537  94.859  28.777  0.60 20.95 ? 125  VAL B CB  1 
ATOM   3146 C CB  B VAL B 1 124 ? 83.254  96.609  29.798  0.40 19.27 ? 125  VAL B CB  1 
ATOM   3147 C CG1 A VAL B 1 124 ? 82.689  93.602  28.502  0.60 18.28 ? 125  VAL B CG1 1 
ATOM   3148 C CG1 B VAL B 1 124 ? 82.505  95.351  29.375  0.40 18.27 ? 125  VAL B CG1 1 
ATOM   3149 C CG2 A VAL B 1 124 ? 82.963  95.655  29.944  0.60 18.20 ? 125  VAL B CG2 1 
ATOM   3150 C CG2 B VAL B 1 124 ? 82.564  97.268  30.981  0.40 18.79 ? 125  VAL B CG2 1 
ATOM   3151 N N   A LEU B 1 125 ? 86.200  92.612  28.176  0.60 21.05 ? 126  LEU B N   1 
ATOM   3152 N N   B LEU B 1 125 ? 86.012  94.506  29.189  0.40 21.01 ? 126  LEU B N   1 
ATOM   3153 C CA  A LEU B 1 125 ? 86.825  91.803  27.130  0.60 22.28 ? 126  LEU B CA  1 
ATOM   3154 C CA  B LEU B 1 125 ? 86.736  93.793  28.144  0.40 22.18 ? 126  LEU B CA  1 
ATOM   3155 C C   A LEU B 1 125 ? 85.745  90.979  26.419  0.60 22.00 ? 126  LEU B C   1 
ATOM   3156 C C   B LEU B 1 125 ? 85.749  92.983  27.312  0.40 23.23 ? 126  LEU B C   1 
ATOM   3157 O O   A LEU B 1 125 ? 84.881  90.390  27.067  0.60 22.89 ? 126  LEU B O   1 
ATOM   3158 O O   B LEU B 1 125 ? 84.872  92.303  27.864  0.40 24.43 ? 126  LEU B O   1 
ATOM   3159 C CB  A LEU B 1 125 ? 87.906  90.911  27.760  0.60 19.89 ? 126  LEU B CB  1 
ATOM   3160 C CB  B LEU B 1 125 ? 87.798  92.884  28.779  0.40 21.48 ? 126  LEU B CB  1 
ATOM   3161 C CG  A LEU B 1 125 ? 89.088  91.738  28.308  0.60 21.39 ? 126  LEU B CG  1 
ATOM   3162 C CG  B LEU B 1 125 ? 88.940  93.682  29.426  0.40 22.18 ? 126  LEU B CG  1 
ATOM   3163 C CD1 A LEU B 1 125 ? 90.051  90.890  29.092  0.60 18.29 ? 126  LEU B CD1 1 
ATOM   3164 C CD1 B LEU B 1 125 ? 89.899  92.754  30.156  0.40 20.03 ? 126  LEU B CD1 1 
ATOM   3165 C CD2 A LEU B 1 125 ? 89.794  92.383  27.135  0.60 19.23 ? 126  LEU B CD2 1 
ATOM   3166 C CD2 B LEU B 1 125 ? 89.668  94.464  28.347  0.40 20.09 ? 126  LEU B CD2 1 
ATOM   3167 N N   A ALA B 1 126 ? 85.802  90.976  25.084  0.60 22.39 ? 127  ALA B N   1 
ATOM   3168 N N   B ALA B 1 126 ? 85.889  93.070  25.989  0.40 23.34 ? 127  ALA B N   1 
ATOM   3169 C CA  A ALA B 1 126 ? 84.831  90.273  24.243  0.60 21.45 ? 127  ALA B CA  1 
ATOM   3170 C CA  B ALA B 1 126 ? 84.996  92.371  25.061  0.40 23.21 ? 127  ALA B CA  1 
ATOM   3171 C C   A ALA B 1 126 ? 83.456  90.769  24.659  0.60 24.46 ? 127  ALA B C   1 
ATOM   3172 C C   B ALA B 1 126 ? 83.561  92.741  25.406  0.40 23.35 ? 127  ALA B C   1 
ATOM   3173 O O   A ALA B 1 126 ? 82.550  89.987  24.963  0.60 24.05 ? 127  ALA B O   1 
ATOM   3174 O O   B ALA B 1 126 ? 82.700  91.879  25.597  0.40 23.58 ? 127  ALA B O   1 
ATOM   3175 C CB  A ALA B 1 126 ? 84.943  88.751  24.440  0.60 23.93 ? 127  ALA B CB  1 
ATOM   3176 C CB  B ALA B 1 126 ? 85.194  90.864  25.168  0.40 23.01 ? 127  ALA B CB  1 
ATOM   3177 N N   A GLY B 1 127 ? 83.297  92.088  24.667  0.60 23.84 ? 128  GLY B N   1 
ATOM   3178 N N   B GLY B 1 127 ? 83.308  94.040  25.484  0.40 23.21 ? 128  GLY B N   1 
ATOM   3179 C CA  A GLY B 1 127 ? 82.021  92.628  25.067  0.60 24.15 ? 128  GLY B CA  1 
ATOM   3180 C CA  B GLY B 1 127 ? 81.985  94.490  25.846  0.40 23.96 ? 128  GLY B CA  1 
ATOM   3181 C C   A GLY B 1 127 ? 81.108  93.040  23.929  0.60 24.02 ? 128  GLY B C   1 
ATOM   3182 C C   B GLY B 1 127 ? 81.085  94.898  24.698  0.40 23.17 ? 128  GLY B C   1 
ATOM   3183 O O   A GLY B 1 127 ? 80.260  93.901  24.141  0.60 23.38 ? 128  GLY B O   1 
ATOM   3184 O O   B GLY B 1 127 ? 80.144  95.649  24.918  0.40 23.73 ? 128  GLY B O   1 
ATOM   3185 N N   A THR B 1 128 ? 81.278  92.479  22.734  0.60 23.16 ? 129  THR B N   1 
ATOM   3186 N N   B THR B 1 128 ? 81.361  94.424  23.484  0.40 23.65 ? 129  THR B N   1 
ATOM   3187 C CA  A THR B 1 128 ? 80.367  92.849  21.646  0.60 25.02 ? 129  THR B CA  1 
ATOM   3188 C CA  B THR B 1 128 ? 80.503  94.777  22.353  0.40 24.51 ? 129  THR B CA  1 
ATOM   3189 C C   A THR B 1 128 ? 79.077  92.047  21.722  0.60 23.52 ? 129  THR B C   1 
ATOM   3190 C C   B THR B 1 128 ? 79.231  93.918  22.351  0.40 24.34 ? 129  THR B C   1 
ATOM   3191 O O   A THR B 1 128 ? 78.157  92.283  20.933  0.60 25.72 ? 129  THR B O   1 
ATOM   3192 O O   B THR B 1 128 ? 78.307  94.175  21.586  0.40 24.61 ? 129  THR B O   1 
ATOM   3193 C CB  A THR B 1 128 ? 80.994  92.650  20.237  0.60 24.46 ? 129  THR B CB  1 
ATOM   3194 C CB  B THR B 1 128 ? 81.234  94.629  20.987  0.40 24.26 ? 129  THR B CB  1 
ATOM   3195 O OG1 A THR B 1 128 ? 81.271  91.266  20.012  0.60 27.14 ? 129  THR B OG1 1 
ATOM   3196 O OG1 B THR B 1 128 ? 81.596  93.266  20.766  0.40 24.45 ? 129  THR B OG1 1 
ATOM   3197 C CG2 A THR B 1 128 ? 82.266  93.452  20.121  0.60 26.62 ? 129  THR B CG2 1 
ATOM   3198 C CG2 B THR B 1 128 ? 82.485  95.484  20.964  0.40 26.45 ? 129  THR B CG2 1 
ATOM   3199 N N   A GLY B 1 129 ? 79.015  91.090  22.657  0.60 23.20 ? 130  GLY B N   1 
ATOM   3200 N N   B GLY B 1 129 ? 79.189  92.913  23.226  0.40 24.62 ? 130  GLY B N   1 
ATOM   3201 C CA  A GLY B 1 129 ? 77.805  90.288  22.834  0.60 23.52 ? 130  GLY B CA  1 
ATOM   3202 C CA  B GLY B 1 129 ? 78.017  92.055  23.343  0.40 23.83 ? 130  GLY B CA  1 
ATOM   3203 C C   A GLY B 1 129 ? 76.800  91.011  23.725  0.60 23.85 ? 130  GLY B C   1 
ATOM   3204 C C   B GLY B 1 129 ? 76.936  92.665  24.228  0.40 23.74 ? 130  GLY B C   1 
ATOM   3205 O O   A GLY B 1 129 ? 77.143  92.063  24.268  0.60 23.82 ? 130  GLY B O   1 
ATOM   3206 O O   B GLY B 1 129 ? 77.186  93.684  24.882  0.40 22.59 ? 130  GLY B O   1 
ATOM   3207 N N   A PRO B 1 130 ? 75.561  90.483  23.912  0.60 24.63 ? 131  PRO B N   1 
ATOM   3208 N N   B PRO B 1 130 ? 75.727  92.061  24.287  0.40 23.95 ? 131  PRO B N   1 
ATOM   3209 C CA  A PRO B 1 130 ? 74.505  91.094  24.741  0.60 22.87 ? 131  PRO B CA  1 
ATOM   3210 C CA  B PRO B 1 130 ? 74.586  92.530  25.086  0.40 22.29 ? 131  PRO B CA  1 
ATOM   3211 C C   A PRO B 1 130 ? 74.892  91.405  26.181  0.60 23.34 ? 131  PRO B C   1 
ATOM   3212 C C   B PRO B 1 130 ? 74.880  92.774  26.565  0.40 21.50 ? 131  PRO B C   1 
ATOM   3213 O O   A PRO B 1 130 ? 74.704  92.534  26.663  0.60 21.30 ? 131  PRO B O   1 
ATOM   3214 O O   B PRO B 1 130 ? 74.563  93.831  27.105  0.40 20.00 ? 131  PRO B O   1 
ATOM   3215 C CB  A PRO B 1 130 ? 73.373  90.064  24.685  0.60 24.46 ? 131  PRO B CB  1 
ATOM   3216 C CB  B PRO B 1 130 ? 73.552  91.421  24.895  0.40 22.75 ? 131  PRO B CB  1 
ATOM   3217 C CG  A PRO B 1 130 ? 73.538  89.459  23.348  0.60 23.65 ? 131  PRO B CG  1 
ATOM   3218 C CG  B PRO B 1 130 ? 73.828  90.951  23.506  0.40 25.50 ? 131  PRO B CG  1 
ATOM   3219 C CD  A PRO B 1 130 ? 75.048  89.264  23.257  0.60 23.99 ? 131  PRO B CD  1 
ATOM   3220 C CD  B PRO B 1 130 ? 75.347  90.864  23.512  0.40 25.40 ? 131  PRO B CD  1 
ATOM   3221 N N   A VAL B 1 131 ? 75.416  90.396  26.868  0.60 20.66 ? 132  VAL B N   1 
ATOM   3222 N N   B VAL B 1 131 ? 75.464  91.782  27.223  0.40 21.66 ? 132  VAL B N   1 
ATOM   3223 C CA  A VAL B 1 131 ? 75.810  90.574  28.256  0.60 22.34 ? 132  VAL B CA  1 
ATOM   3224 C CA  B VAL B 1 131 ? 75.782  91.906  28.638  0.40 20.89 ? 132  VAL B CA  1 
ATOM   3225 C C   A VAL B 1 131 ? 76.951  91.586  28.301  0.60 20.97 ? 132  VAL B C   1 
ATOM   3226 C C   B VAL B 1 131 ? 76.891  92.940  28.813  0.40 19.84 ? 132  VAL B C   1 
ATOM   3227 O O   A VAL B 1 131 ? 76.961  92.484  29.142  0.60 21.33 ? 132  VAL B O   1 
ATOM   3228 O O   B VAL B 1 131 ? 76.893  93.726  29.766  0.40 18.98 ? 132  VAL B O   1 
ATOM   3229 C CB  A VAL B 1 131 ? 76.264  89.228  28.882  0.60 23.18 ? 132  VAL B CB  1 
ATOM   3230 C CB  B VAL B 1 131 ? 76.218  90.547  29.200  0.40 22.60 ? 132  VAL B CB  1 
ATOM   3231 C CG1 A VAL B 1 131 ? 76.697  89.443  30.359  0.60 25.44 ? 132  VAL B CG1 1 
ATOM   3232 C CG1 B VAL B 1 131 ? 76.610  90.674  30.671  0.40 23.08 ? 132  VAL B CG1 1 
ATOM   3233 C CG2 A VAL B 1 131 ? 75.109  88.239  28.830  0.60 24.99 ? 132  VAL B CG2 1 
ATOM   3234 C CG2 B VAL B 1 131 ? 75.075  89.547  29.031  0.40 23.11 ? 132  VAL B CG2 1 
ATOM   3235 N N   A GLY B 1 132 ? 77.908  91.441  27.384  0.60 20.49 ? 133  GLY B N   1 
ATOM   3236 N N   B GLY B 1 132 ? 77.830  92.944  27.877  0.40 18.22 ? 133  GLY B N   1 
ATOM   3237 C CA  A GLY B 1 132 ? 79.018  92.375  27.359  0.60 18.30 ? 133  GLY B CA  1 
ATOM   3238 C CA  B GLY B 1 132 ? 78.919  93.889  27.949  0.40 18.75 ? 133  GLY B CA  1 
ATOM   3239 C C   A GLY B 1 132 ? 78.534  93.800  27.167  0.60 18.71 ? 133  GLY B C   1 
ATOM   3240 C C   B GLY B 1 132 ? 78.387  95.304  27.856  0.40 18.70 ? 133  GLY B C   1 
ATOM   3241 O O   A GLY B 1 132 ? 78.942  94.719  27.904  0.60 18.00 ? 133  GLY B O   1 
ATOM   3242 O O   B GLY B 1 132 ? 78.709  96.148  28.686  0.40 17.76 ? 133  GLY B O   1 
ATOM   3243 N N   A MET B 1 133 ? 77.679  94.007  26.162  0.60 18.05 ? 134  MET B N   1 
ATOM   3244 N N   B MET B 1 133 ? 77.548  95.544  26.848  0.40 18.79 ? 134  MET B N   1 
ATOM   3245 C CA  A MET B 1 133 ? 77.158  95.341  25.893  0.60 19.97 ? 134  MET B CA  1 
ATOM   3246 C CA  B MET B 1 133 ? 76.952  96.858  26.618  0.40 18.68 ? 134  MET B CA  1 
ATOM   3247 C C   A MET B 1 133 ? 76.372  95.958  27.051  0.60 20.65 ? 134  MET B C   1 
ATOM   3248 C C   B MET B 1 133 ? 76.094  97.322  27.793  0.40 18.25 ? 134  MET B C   1 
ATOM   3249 O O   A MET B 1 133 ? 76.569  97.130  27.385  0.60 18.90 ? 134  MET B O   1 
ATOM   3250 O O   B MET B 1 133 ? 76.287  98.428  28.306  0.40 18.18 ? 134  MET B O   1 
ATOM   3251 C CB  A MET B 1 133 ? 76.301  95.327  24.622  0.60 20.12 ? 134  MET B CB  1 
ATOM   3252 C CB  B MET B 1 133 ? 76.139  96.832  25.315  0.40 18.30 ? 134  MET B CB  1 
ATOM   3253 C CG  A MET B 1 133 ? 77.112  94.999  23.388  0.60 21.53 ? 134  MET B CG  1 
ATOM   3254 C CG  B MET B 1 133 ? 77.027  96.692  24.086  0.40 19.23 ? 134  MET B CG  1 
ATOM   3255 S SD  A MET B 1 133 ? 76.196  94.949  21.824  0.60 24.82 ? 134  MET B SD  1 
ATOM   3256 S SD  B MET B 1 133 ? 76.167  96.660  22.518  0.40 23.92 ? 134  MET B SD  1 
ATOM   3257 C CE  A MET B 1 133 ? 75.544  96.546  21.746  0.60 24.63 ? 134  MET B CE  1 
ATOM   3258 C CE  B MET B 1 133 ? 75.581  98.368  22.422  0.40 20.43 ? 134  MET B CE  1 
ATOM   3259 N N   A ARG B 1 134 ? 75.488  95.177  27.663  0.60 19.83 ? 135  ARG B N   1 
ATOM   3260 N N   B ARG B 1 134 ? 75.160  96.481  28.233  0.40 17.78 ? 135  ARG B N   1 
ATOM   3261 C CA  A ARG B 1 134 ? 74.689  95.678  28.775  0.60 21.08 ? 135  ARG B CA  1 
ATOM   3262 C CA  B ARG B 1 134 ? 74.307  96.836  29.366  0.40 19.43 ? 135  ARG B CA  1 
ATOM   3263 C C   A ARG B 1 134 ? 75.543  95.943  30.009  0.60 21.23 ? 135  ARG B C   1 
ATOM   3264 C C   B ARG B 1 134 ? 75.122  97.085  30.649  0.40 20.76 ? 135  ARG B C   1 
ATOM   3265 O O   A ARG B 1 134 ? 75.259  96.867  30.785  0.60 21.68 ? 135  ARG B O   1 
ATOM   3266 O O   B ARG B 1 134 ? 74.812  97.985  31.425  0.40 23.35 ? 135  ARG B O   1 
ATOM   3267 C CB  A ARG B 1 134 ? 73.556  94.691  29.100  0.60 20.77 ? 135  ARG B CB  1 
ATOM   3268 C CB  B ARG B 1 134 ? 73.261  95.745  29.602  0.40 19.66 ? 135  ARG B CB  1 
ATOM   3269 C CG  A ARG B 1 134 ? 72.376  94.789  28.127  0.60 21.38 ? 135  ARG B CG  1 
ATOM   3270 C CG  B ARG B 1 134 ? 72.094  95.803  28.625  0.40 20.26 ? 135  ARG B CG  1 
ATOM   3271 C CD  A ARG B 1 134 ? 71.682  96.133  28.278  0.60 22.25 ? 135  ARG B CD  1 
ATOM   3272 C CD  B ARG B 1 134 ? 71.397  97.166  28.700  0.40 22.54 ? 135  ARG B CD  1 
ATOM   3273 N NE  A ARG B 1 134 ? 70.282  96.129  27.842  0.60 24.95 ? 135  ARG B NE  1 
ATOM   3274 N NE  B ARG B 1 134 ? 70.009  97.083  28.251  0.40 22.22 ? 135  ARG B NE  1 
ATOM   3275 C CZ  A ARG B 1 134 ? 69.866  96.356  26.603  0.60 23.59 ? 135  ARG B CZ  1 
ATOM   3276 C CZ  B ARG B 1 134 ? 69.605  97.265  26.999  0.40 23.53 ? 135  ARG B CZ  1 
ATOM   3277 N NH1 A ARG B 1 134 ? 70.728  96.618  25.633  0.60 24.04 ? 135  ARG B NH1 1 
ATOM   3278 N NH1 B ARG B 1 134 ? 70.477  97.560  26.038  0.40 19.90 ? 135  ARG B NH1 1 
ATOM   3279 N NH2 A ARG B 1 134 ? 68.573  96.324  26.340  0.60 25.06 ? 135  ARG B NH2 1 
ATOM   3280 N NH2 B ARG B 1 134 ? 68.315  97.143  26.712  0.40 22.95 ? 135  ARG B NH2 1 
ATOM   3281 N N   A SER B 1 135 ? 76.582  95.143  30.203  0.60 20.58 ? 136  SER B N   1 
ATOM   3282 N N   B SER B 1 135 ? 76.166  96.293  30.874  0.40 21.07 ? 136  SER B N   1 
ATOM   3283 C CA  A SER B 1 135 ? 77.461  95.378  31.345  0.60 21.30 ? 136  SER B CA  1 
ATOM   3284 C CA  B SER B 1 135 ? 76.999  96.496  32.060  0.40 20.78 ? 136  SER B CA  1 
ATOM   3285 C C   A SER B 1 135 ? 78.185  96.698  31.103  0.60 20.17 ? 136  SER B C   1 
ATOM   3286 C C   B SER B 1 135 ? 77.654  97.883  31.961  0.40 20.60 ? 136  SER B C   1 
ATOM   3287 O O   A SER B 1 135 ? 78.340  97.508  32.007  0.60 19.18 ? 136  SER B O   1 
ATOM   3288 O O   B SER B 1 135 ? 77.722  98.621  32.936  0.40 19.43 ? 136  SER B O   1 
ATOM   3289 C CB  A SER B 1 135 ? 78.490  94.257  31.487  0.60 20.11 ? 136  SER B CB  1 
ATOM   3290 C CB  B SER B 1 135 ? 78.092  95.428  32.144  0.40 20.34 ? 136  SER B CB  1 
ATOM   3291 O OG  A SER B 1 135 ? 77.842  93.029  31.701  0.60 20.64 ? 136  SER B OG  1 
ATOM   3292 O OG  B SER B 1 135 ? 77.553  94.122  32.245  0.40 20.26 ? 136  SER B OG  1 
ATOM   3293 N N   A ALA B 1 136 ? 78.600  96.925  29.864  0.60 21.11 ? 137  ALA B N   1 
ATOM   3294 N N   B ALA B 1 136 ? 78.129  98.228  30.769  0.40 21.97 ? 137  ALA B N   1 
ATOM   3295 C CA  A ALA B 1 136 ? 79.319  98.164  29.520  0.60 22.59 ? 137  ALA B CA  1 
ATOM   3296 C CA  B ALA B 1 136 ? 78.779  99.519  30.556  0.40 22.44 ? 137  ALA B CA  1 
ATOM   3297 C C   A ALA B 1 136 ? 78.406  99.371  29.736  0.60 21.99 ? 137  ALA B C   1 
ATOM   3298 C C   B ALA B 1 136 ? 77.809  100.672 30.794  0.40 22.23 ? 137  ALA B C   1 
ATOM   3299 O O   A ALA B 1 136 ? 78.856  100.428 30.175  0.60 21.29 ? 137  ALA B O   1 
ATOM   3300 O O   B ALA B 1 136 ? 78.207  101.731 31.277  0.40 22.07 ? 137  ALA B O   1 
ATOM   3301 C CB  A ALA B 1 136 ? 79.792  98.114  28.050  0.60 22.56 ? 137  ALA B CB  1 
ATOM   3302 C CB  B ALA B 1 136 ? 79.340  99.593  29.142  0.40 23.24 ? 137  ALA B CB  1 
ATOM   3303 N N   A ALA B 1 137 ? 77.118  99.207  29.443  0.60 21.66 ? 138  ALA B N   1 
ATOM   3304 N N   B ALA B 1 137 ? 76.538  100.455 30.461  0.40 22.62 ? 138  ALA B N   1 
ATOM   3305 C CA  A ALA B 1 137 ? 76.164  100.308 29.612  0.60 21.30 ? 138  ALA B CA  1 
ATOM   3306 C CA  B ALA B 1 137 ? 75.510  101.484 30.620  0.40 22.92 ? 138  ALA B CA  1 
ATOM   3307 C C   A ALA B 1 137 ? 75.913  100.657 31.080  0.60 21.55 ? 138  ALA B C   1 
ATOM   3308 C C   B ALA B 1 137 ? 75.151  101.713 32.084  0.40 23.52 ? 138  ALA B C   1 
ATOM   3309 O O   A ALA B 1 137 ? 75.828  101.828 31.440  0.60 19.50 ? 138  ALA B O   1 
ATOM   3310 O O   B ALA B 1 137 ? 74.964  102.846 32.522  0.40 25.51 ? 138  ALA B O   1 
ATOM   3311 C CB  A ALA B 1 137 ? 74.843  99.974  28.933  0.60 21.20 ? 138  ALA B CB  1 
ATOM   3312 C CB  B ALA B 1 137 ? 74.252  101.096 29.818  0.40 21.28 ? 138  ALA B CB  1 
ATOM   3313 N N   A LEU B 1 138 ? 75.770  99.642  31.922  0.60 22.31 ? 139  LEU B N   1 
ATOM   3314 N N   B LEU B 1 138 ? 75.052  100.636 32.851  0.40 23.99 ? 139  LEU B N   1 
ATOM   3315 C CA  A LEU B 1 138 ? 75.519  99.879  33.342  0.60 20.42 ? 139  LEU B CA  1 
ATOM   3316 C CA  B LEU B 1 138 ? 74.701  100.775 34.257  0.40 24.00 ? 139  LEU B CA  1 
ATOM   3317 C C   A LEU B 1 138 ? 76.724  100.508 34.037  0.60 19.33 ? 139  LEU B C   1 
ATOM   3318 C C   B LEU B 1 138 ? 75.841  101.427 35.035  0.40 24.11 ? 139  LEU B C   1 
ATOM   3319 O O   A LEU B 1 138 ? 76.593  101.382 34.906  0.60 22.42 ? 139  LEU B O   1 
ATOM   3320 O O   B LEU B 1 138 ? 75.607  102.221 35.946  0.40 25.66 ? 139  LEU B O   1 
ATOM   3321 C CB  A LEU B 1 138 ? 75.108  98.563  34.012  0.60 18.80 ? 139  LEU B CB  1 
ATOM   3322 C CB  B LEU B 1 138 ? 74.343  99.407  34.844  0.40 21.55 ? 139  LEU B CB  1 
ATOM   3323 C CG  A LEU B 1 138 ? 73.754  98.026  33.525  0.60 20.40 ? 139  LEU B CG  1 
ATOM   3324 C CG  B LEU B 1 138 ? 73.059  98.825  34.238  0.40 20.31 ? 139  LEU B CG  1 
ATOM   3325 C CD1 A LEU B 1 138 ? 73.429  96.742  34.237  0.60 16.97 ? 139  LEU B CD1 1 
ATOM   3326 C CD1 B LEU B 1 138 ? 72.808  97.435  34.787  0.40 18.08 ? 139  LEU B CD1 1 
ATOM   3327 C CD2 A LEU B 1 138 ? 72.644  99.048  33.791  0.60 16.95 ? 139  LEU B CD2 1 
ATOM   3328 C CD2 B LEU B 1 138 ? 71.887  99.748  34.531  0.40 19.05 ? 139  LEU B CD2 1 
ATOM   3329 N N   A LEU B 1 139 ? 77.909  100.073 33.649  0.60 18.94 ? 140  LEU B N   1 
ATOM   3330 N N   B LEU B 1 139 ? 77.072  101.086 34.676  0.40 23.02 ? 140  LEU B N   1 
ATOM   3331 C CA  A LEU B 1 139 ? 79.140  100.622 34.195  0.60 19.61 ? 140  LEU B CA  1 
ATOM   3332 C CA  B LEU B 1 139 ? 78.231  101.669 35.325  0.40 21.40 ? 140  LEU B CA  1 
ATOM   3333 C C   A LEU B 1 139 ? 79.274  102.084 33.804  0.60 19.95 ? 140  LEU B C   1 
ATOM   3334 C C   B LEU B 1 139 ? 78.297  103.168 35.025  0.40 21.53 ? 140  LEU B C   1 
ATOM   3335 O O   A LEU B 1 139 ? 79.692  102.910 34.615  0.60 21.56 ? 140  LEU B O   1 
ATOM   3336 O O   B LEU B 1 139 ? 78.640  103.966 35.886  0.40 21.22 ? 140  LEU B O   1 
ATOM   3337 C CB  A LEU B 1 139 ? 80.348  99.846  33.667  0.60 16.29 ? 140  LEU B CB  1 
ATOM   3338 C CB  B LEU B 1 139 ? 79.505  101.000 34.821  0.40 19.06 ? 140  LEU B CB  1 
ATOM   3339 C CG  A LEU B 1 139 ? 80.517  98.425  34.192  0.60 16.89 ? 140  LEU B CG  1 
ATOM   3340 C CG  B LEU B 1 139 ? 79.736  99.550  35.245  0.40 18.31 ? 140  LEU B CG  1 
ATOM   3341 C CD1 A LEU B 1 139 ? 81.514  97.704  33.303  0.60 16.34 ? 140  LEU B CD1 1 
ATOM   3342 C CD1 B LEU B 1 139 ? 80.807  98.939  34.360  0.40 17.10 ? 140  LEU B CD1 1 
ATOM   3343 C CD2 A LEU B 1 139 ? 81.021  98.461  35.644  0.60 15.33 ? 140  LEU B CD2 1 
ATOM   3344 C CD2 B LEU B 1 139 ? 80.130  99.503  36.696  0.40 13.37 ? 140  LEU B CD2 1 
ATOM   3345 N N   A ALA B 1 140 ? 78.931  102.402 32.561  0.60 19.34 ? 141  ALA B N   1 
ATOM   3346 N N   B ALA B 1 140 ? 77.990  103.547 33.792  0.40 21.97 ? 141  ALA B N   1 
ATOM   3347 C CA  A ALA B 1 140 ? 79.013  103.778 32.096  0.60 21.26 ? 141  ALA B CA  1 
ATOM   3348 C CA  B ALA B 1 140 ? 78.024  104.956 33.435  0.40 22.16 ? 141  ALA B CA  1 
ATOM   3349 C C   A ALA B 1 140 ? 78.022  104.597 32.914  0.60 22.26 ? 141  ALA B C   1 
ATOM   3350 C C   B ALA B 1 140 ? 76.963  105.684 34.256  0.40 23.15 ? 141  ALA B C   1 
ATOM   3351 O O   A ALA B 1 140 ? 78.346  105.680 33.385  0.60 23.41 ? 141  ALA B O   1 
ATOM   3352 O O   B ALA B 1 140 ? 77.219  106.762 34.800  0.40 22.53 ? 141  ALA B O   1 
ATOM   3353 C CB  A ALA B 1 140 ? 78.679  103.853 30.598  0.60 21.12 ? 141  ALA B CB  1 
ATOM   3354 C CB  B ALA B 1 140 ? 77.775  105.130 31.944  0.40 21.50 ? 141  ALA B CB  1 
ATOM   3355 N N   A GLY B 1 141 ? 76.820  104.055 33.109  0.60 22.55 ? 142  GLY B N   1 
ATOM   3356 N N   B GLY B 1 141 ? 75.779  105.080 34.360  0.40 22.95 ? 142  GLY B N   1 
ATOM   3357 C CA  A GLY B 1 141 ? 75.811  104.758 33.881  0.60 22.78 ? 142  GLY B CA  1 
ATOM   3358 C CA  B GLY B 1 141 ? 74.703  105.679 35.130  0.40 23.21 ? 142  GLY B CA  1 
ATOM   3359 C C   A GLY B 1 141 ? 76.258  105.022 35.314  0.60 23.58 ? 142  GLY B C   1 
ATOM   3360 C C   B GLY B 1 141 ? 75.058  105.882 36.596  0.40 24.12 ? 142  GLY B C   1 
ATOM   3361 O O   A GLY B 1 141 ? 75.773  105.943 35.954  0.60 23.32 ? 142  GLY B O   1 
ATOM   3362 O O   B GLY B 1 141 ? 74.466  106.715 37.282  0.40 21.55 ? 142  GLY B O   1 
ATOM   3363 N N   A GLU B 1 142 ? 77.199  104.221 35.809  0.60 23.86 ? 143  GLU B N   1 
ATOM   3364 N N   B GLU B 1 142 ? 76.039  105.122 37.075  0.40 24.93 ? 143  GLU B N   1 
ATOM   3365 C CA  A GLU B 1 142 ? 77.714  104.361 37.176  0.60 25.28 ? 143  GLU B CA  1 
ATOM   3366 C CA  B GLU B 1 142 ? 76.472  105.200 38.466  0.40 25.04 ? 143  GLU B CA  1 
ATOM   3367 C C   A GLU B 1 142 ? 78.850  105.399 37.201  0.60 25.85 ? 143  GLU B C   1 
ATOM   3368 C C   B GLU B 1 142 ? 77.521  106.308 38.611  0.40 26.33 ? 143  GLU B C   1 
ATOM   3369 O O   A GLU B 1 142 ? 79.368  105.752 38.258  0.60 25.34 ? 143  GLU B O   1 
ATOM   3370 O O   B GLU B 1 142 ? 77.954  106.634 39.713  0.40 27.11 ? 143  GLU B O   1 
ATOM   3371 C CB  A GLU B 1 142 ? 78.207  102.989 37.643  0.60 26.40 ? 143  GLU B CB  1 
ATOM   3372 C CB  B GLU B 1 142 ? 77.053  103.845 38.892  0.40 26.28 ? 143  GLU B CB  1 
ATOM   3373 C CG  A GLU B 1 142 ? 78.156  102.708 39.138  0.60 31.30 ? 143  GLU B CG  1 
ATOM   3374 C CG  B GLU B 1 142 ? 76.930  103.497 40.386  0.40 25.55 ? 143  GLU B CG  1 
ATOM   3375 C CD  A GLU B 1 142 ? 76.789  102.887 39.764  0.60 30.34 ? 143  GLU B CD  1 
ATOM   3376 C CD  B GLU B 1 142 ? 75.481  103.456 40.885  0.40 27.46 ? 143  GLU B CD  1 
ATOM   3377 O OE1 A GLU B 1 142 ? 76.509  104.025 40.199  0.60 32.91 ? 143  GLU B OE1 1 
ATOM   3378 O OE1 B GLU B 1 142 ? 74.979  104.510 41.333  0.40 26.14 ? 143  GLU B OE1 1 
ATOM   3379 O OE2 A GLU B 1 142 ? 76.002  101.901 39.830  0.60 28.33 ? 143  GLU B OE2 1 
ATOM   3380 O OE2 B GLU B 1 142 ? 74.847  102.373 40.812  0.40 24.29 ? 143  GLU B OE2 1 
ATOM   3381 N N   A GLY B 1 143 ? 79.224  105.884 36.019  0.60 25.31 ? 144  GLY B N   1 
ATOM   3382 N N   B GLY B 1 143 ? 77.921  106.885 37.482  0.40 26.36 ? 144  GLY B N   1 
ATOM   3383 C CA  A GLY B 1 143 ? 80.277  106.880 35.924  0.60 24.27 ? 144  GLY B CA  1 
ATOM   3384 C CA  B GLY B 1 143 ? 78.903  107.953 37.502  0.40 26.58 ? 144  GLY B CA  1 
ATOM   3385 C C   A GLY B 1 143 ? 81.661  106.328 35.654  0.60 24.51 ? 144  GLY B C   1 
ATOM   3386 C C   B GLY B 1 143 ? 80.340  107.519 37.285  0.40 25.93 ? 144  GLY B C   1 
ATOM   3387 O O   A GLY B 1 143 ? 82.639  107.075 35.668  0.60 23.82 ? 144  GLY B O   1 
ATOM   3388 O O   B GLY B 1 143 ? 81.253  108.329 37.423  0.40 26.24 ? 144  GLY B O   1 
ATOM   3389 N N   A ALA B 1 144 ? 81.778  105.020 35.424  0.60 23.17 ? 145  ALA B N   1 
ATOM   3390 N N   B ALA B 1 144 ? 80.563  106.252 36.953  0.40 25.57 ? 145  ALA B N   1 
ATOM   3391 C CA  A ALA B 1 144 ? 83.109  104.466 35.162  0.60 24.25 ? 145  ALA B CA  1 
ATOM   3392 C CA  B ALA B 1 144 ? 81.931  105.784 36.731  0.40 25.76 ? 145  ALA B CA  1 
ATOM   3393 C C   A ALA B 1 144 ? 83.545  104.807 33.734  0.60 23.29 ? 145  ALA B C   1 
ATOM   3394 C C   B ALA B 1 144 ? 82.395  106.220 35.346  0.40 25.22 ? 145  ALA B C   1 
ATOM   3395 O O   A ALA B 1 144 ? 82.715  105.126 32.900  0.60 23.23 ? 145  ALA B O   1 
ATOM   3396 O O   B ALA B 1 144 ? 81.572  106.522 34.487  0.40 23.93 ? 145  ALA B O   1 
ATOM   3397 C CB  A ALA B 1 144 ? 83.101  102.989 35.343  0.60 22.02 ? 145  ALA B CB  1 
ATOM   3398 C CB  B ALA B 1 144 ? 81.991  104.260 36.836  0.40 24.38 ? 145  ALA B CB  1 
ATOM   3399 N N   A GLU B 1 145 ? 84.843  104.764 33.465  0.60 24.89 ? 146  GLU B N   1 
ATOM   3400 N N   B GLU B 1 145 ? 83.709  106.266 35.141  0.40 24.36 ? 146  GLU B N   1 
ATOM   3401 C CA  A GLU B 1 145 ? 85.336  105.030 32.118  0.60 26.29 ? 146  GLU B CA  1 
ATOM   3402 C CA  B GLU B 1 145 ? 84.259  106.614 33.831  0.40 26.48 ? 146  GLU B CA  1 
ATOM   3403 C C   A GLU B 1 145 ? 85.440  103.629 31.558  0.60 27.63 ? 146  GLU B C   1 
ATOM   3404 C C   B GLU B 1 145 ? 84.464  105.243 33.188  0.40 25.75 ? 146  GLU B C   1 
ATOM   3405 O O   A GLU B 1 145 ? 86.333  102.863 31.926  0.60 29.37 ? 146  GLU B O   1 
ATOM   3406 O O   B GLU B 1 145 ? 85.364  104.492 33.560  0.40 26.19 ? 146  GLU B O   1 
ATOM   3407 C CB  A GLU B 1 145 ? 86.708  105.708 32.170  0.60 27.62 ? 146  GLU B CB  1 
ATOM   3408 C CB  B GLU B 1 145 ? 85.590  107.353 33.984  0.40 27.13 ? 146  GLU B CB  1 
ATOM   3409 C CG  A GLU B 1 145 ? 86.770  106.811 33.222  0.60 31.76 ? 146  GLU B CG  1 
ATOM   3410 C CG  B GLU B 1 145 ? 85.558  108.389 35.110  0.40 31.75 ? 146  GLU B CG  1 
ATOM   3411 C CD  A GLU B 1 145 ? 88.025  107.669 33.112  0.60 33.83 ? 146  GLU B CD  1 
ATOM   3412 C CD  B GLU B 1 145 ? 86.706  109.381 35.049  0.40 33.82 ? 146  GLU B CD  1 
ATOM   3413 O OE1 A GLU B 1 145 ? 89.127  107.110 32.929  0.60 36.22 ? 146  GLU B OE1 1 
ATOM   3414 O OE1 B GLU B 1 145 ? 87.870  108.947 34.882  0.40 36.39 ? 146  GLU B OE1 1 
ATOM   3415 O OE2 A GLU B 1 145 ? 87.899  108.908 33.214  0.60 36.09 ? 146  GLU B OE2 1 
ATOM   3416 O OE2 B GLU B 1 145 ? 86.438  110.597 35.177  0.40 34.53 ? 146  GLU B OE2 1 
ATOM   3417 N N   A VAL B 1 146 ? 84.528  103.298 30.656  0.60 26.75 ? 147  VAL B N   1 
ATOM   3418 N N   B VAL B 1 146 ? 83.622  104.929 32.218  0.40 25.75 ? 147  VAL B N   1 
ATOM   3419 C CA  A VAL B 1 146 ? 84.454  101.942 30.097  0.60 25.46 ? 147  VAL B CA  1 
ATOM   3420 C CA  B VAL B 1 146 ? 83.654  103.623 31.576  0.40 25.41 ? 147  VAL B CA  1 
ATOM   3421 C C   A VAL B 1 146 ? 85.032  101.727 28.712  0.60 24.64 ? 147  VAL B C   1 
ATOM   3422 C C   B VAL B 1 146 ? 84.335  103.502 30.214  0.40 24.65 ? 147  VAL B C   1 
ATOM   3423 O O   A VAL B 1 146 ? 84.789  102.516 27.797  0.60 24.91 ? 147  VAL B O   1 
ATOM   3424 O O   B VAL B 1 146 ? 84.113  104.309 29.312  0.40 23.77 ? 147  VAL B O   1 
ATOM   3425 C CB  A VAL B 1 146 ? 82.967  101.463 30.048  0.60 23.84 ? 147  VAL B CB  1 
ATOM   3426 C CB  B VAL B 1 146 ? 82.217  103.084 31.444  0.40 23.93 ? 147  VAL B CB  1 
ATOM   3427 C CG1 A VAL B 1 146 ? 82.898  100.016 29.614  0.60 23.32 ? 147  VAL B CG1 1 
ATOM   3428 C CG1 B VAL B 1 146 ? 82.229  101.656 30.924  0.40 25.29 ? 147  VAL B CG1 1 
ATOM   3429 C CG2 A VAL B 1 146 ? 82.304  101.650 31.410  0.60 24.53 ? 147  VAL B CG2 1 
ATOM   3430 C CG2 B VAL B 1 146 ? 81.513  103.172 32.796  0.40 25.74 ? 147  VAL B CG2 1 
ATOM   3431 N N   A VAL B 1 147 ? 85.781  100.639 28.562  0.60 25.77 ? 148  VAL B N   1 
ATOM   3432 N N   B VAL B 1 147 ? 85.149  102.458 30.068  0.40 24.55 ? 148  VAL B N   1 
ATOM   3433 C CA  A VAL B 1 147 ? 86.367  100.276 27.274  0.60 25.56 ? 148  VAL B CA  1 
ATOM   3434 C CA  B VAL B 1 147 ? 85.820  102.196 28.808  0.40 25.20 ? 148  VAL B CA  1 
ATOM   3435 C C   A VAL B 1 147 ? 85.792  98.909  26.892  0.60 25.89 ? 148  VAL B C   1 
ATOM   3436 C C   B VAL B 1 147 ? 85.340  100.839 28.300  0.40 24.01 ? 148  VAL B C   1 
ATOM   3437 O O   A VAL B 1 147 ? 85.913  97.929  27.633  0.60 25.88 ? 148  VAL B O   1 
ATOM   3438 O O   B VAL B 1 147 ? 85.495  99.814  28.973  0.40 23.02 ? 148  VAL B O   1 
ATOM   3439 C CB  A VAL B 1 147 ? 87.907  100.170 27.334  0.60 24.96 ? 148  VAL B CB  1 
ATOM   3440 C CB  B VAL B 1 147 ? 87.363  102.176 28.955  0.40 25.23 ? 148  VAL B CB  1 
ATOM   3441 C CG1 A VAL B 1 147 ? 88.452  99.878  25.935  0.60 24.06 ? 148  VAL B CG1 1 
ATOM   3442 C CG1 B VAL B 1 147 ? 88.002  102.020 27.583  0.40 26.73 ? 148  VAL B CG1 1 
ATOM   3443 C CG2 A VAL B 1 147 ? 88.515  101.460 27.900  0.60 27.66 ? 148  VAL B CG2 1 
ATOM   3444 C CG2 B VAL B 1 147 ? 87.855  103.472 29.617  0.40 26.61 ? 148  VAL B CG2 1 
ATOM   3445 N N   A LEU B 1 148 ? 85.162  98.868  25.729  0.60 24.32 ? 149  LEU B N   1 
ATOM   3446 N N   B LEU B 1 148 ? 84.749  100.849 27.111  0.40 23.14 ? 149  LEU B N   1 
ATOM   3447 C CA  A LEU B 1 148 ? 84.520  97.676  25.205  0.60 23.33 ? 149  LEU B CA  1 
ATOM   3448 C CA  B LEU B 1 148 ? 84.213  99.643  26.491  0.40 23.00 ? 149  LEU B CA  1 
ATOM   3449 C C   A LEU B 1 148 ? 85.361  97.108  24.080  0.60 23.76 ? 149  LEU B C   1 
ATOM   3450 C C   B LEU B 1 148 ? 85.162  99.187  25.392  0.40 22.48 ? 149  LEU B C   1 
ATOM   3451 O O   A LEU B 1 148 ? 85.475  97.720  23.014  0.60 23.12 ? 149  LEU B O   1 
ATOM   3452 O O   B LEU B 1 148 ? 85.348  99.879  24.379  0.40 19.94 ? 149  LEU B O   1 
ATOM   3453 C CB  A LEU B 1 148 ? 83.123  98.063  24.707  0.60 25.03 ? 149  LEU B CB  1 
ATOM   3454 C CB  B LEU B 1 148 ? 82.817  99.934  25.929  0.40 24.23 ? 149  LEU B CB  1 
ATOM   3455 C CG  A LEU B 1 148 ? 82.237  97.003  24.095  0.60 24.81 ? 149  LEU B CG  1 
ATOM   3456 C CG  B LEU B 1 148 ? 82.081  98.844  25.153  0.40 26.11 ? 149  LEU B CG  1 
ATOM   3457 C CD1 A LEU B 1 148 ? 82.509  95.665  24.746  0.60 31.33 ? 149  LEU B CD1 1 
ATOM   3458 C CD1 B LEU B 1 148 ? 82.418  97.495  25.731  0.40 27.79 ? 149  LEU B CD1 1 
ATOM   3459 C CD2 A LEU B 1 148 ? 80.796  97.413  24.299  0.60 26.51 ? 149  LEU B CD2 1 
ATOM   3460 C CD2 B LEU B 1 148 ? 80.566  99.111  25.208  0.40 27.77 ? 149  LEU B CD2 1 
ATOM   3461 N N   A CYS B 1 149 ? 85.939  95.937  24.335  0.60 23.58 ? 150  CYS B N   1 
ATOM   3462 N N   B CYS B 1 149 ? 85.751  98.014  25.604  0.40 21.33 ? 150  CYS B N   1 
ATOM   3463 C CA  A CYS B 1 149 ? 86.842  95.246  23.418  0.60 26.28 ? 150  CYS B CA  1 
ATOM   3464 C CA  B CYS B 1 149 ? 86.729  97.455  24.678  0.40 23.77 ? 150  CYS B CA  1 
ATOM   3465 C C   A CYS B 1 149 ? 86.208  94.152  22.588  0.60 27.86 ? 150  CYS B C   1 
ATOM   3466 C C   B CYS B 1 149 ? 86.208  96.395  23.726  0.40 23.61 ? 150  CYS B C   1 
ATOM   3467 O O   A CYS B 1 149 ? 85.375  93.394  23.074  0.60 27.17 ? 150  CYS B O   1 
ATOM   3468 O O   B CYS B 1 149 ? 85.350  95.609  24.078  0.40 23.82 ? 150  CYS B O   1 
ATOM   3469 C CB  A CYS B 1 149 ? 87.998  94.610  24.209  0.60 26.49 ? 150  CYS B CB  1 
ATOM   3470 C CB  B CYS B 1 149 ? 87.896  96.866  25.468  0.40 21.89 ? 150  CYS B CB  1 
ATOM   3471 S SG  A CYS B 1 149 ? 88.837  95.789  25.280  0.60 26.88 ? 150  CYS B SG  1 
ATOM   3472 S SG  B CYS B 1 149 ? 88.691  98.059  26.536  0.40 25.58 ? 150  CYS B SG  1 
ATOM   3473 N N   A GLY B 1 150 ? 86.636  94.068  21.336  0.60 28.62 ? 151  GLY B N   1 
ATOM   3474 N N   B GLY B 1 150 ? 86.765  96.387  22.522  0.40 25.03 ? 151  GLY B N   1 
ATOM   3475 C CA  A GLY B 1 150 ? 86.137  93.037  20.443  0.60 28.44 ? 151  GLY B CA  1 
ATOM   3476 C CA  B GLY B 1 150 ? 86.386  95.418  21.516  0.40 26.10 ? 151  GLY B CA  1 
ATOM   3477 C C   A GLY B 1 150 ? 87.322  92.604  19.606  0.60 29.10 ? 151  GLY B C   1 
ATOM   3478 C C   B GLY B 1 150 ? 87.621  95.089  20.699  0.40 27.83 ? 151  GLY B C   1 
ATOM   3479 O O   A GLY B 1 150 ? 88.351  93.282  19.570  0.60 26.89 ? 151  GLY B O   1 
ATOM   3480 O O   B GLY B 1 150 ? 88.609  95.825  20.721  0.40 26.37 ? 151  GLY B O   1 
ATOM   3481 N N   A ARG B 1 151 ? 87.177  91.471  18.936  0.60 32.40 ? 152  ARG B N   1 
ATOM   3482 N N   B ARG B 1 151 ? 87.570  93.982  19.976  0.40 30.06 ? 152  ARG B N   1 
ATOM   3483 C CA  A ARG B 1 151 ? 88.230  90.915  18.087  0.60 34.41 ? 152  ARG B CA  1 
ATOM   3484 C CA  B ARG B 1 151 ? 88.684  93.550  19.148  0.40 33.18 ? 152  ARG B CA  1 
ATOM   3485 C C   A ARG B 1 151 ? 88.561  91.851  16.901  0.60 34.41 ? 152  ARG B C   1 
ATOM   3486 C C   B ARG B 1 151 ? 89.007  94.586  18.053  0.40 33.78 ? 152  ARG B C   1 
ATOM   3487 O O   A ARG B 1 151 ? 89.659  91.804  16.335  0.60 34.28 ? 152  ARG B O   1 
ATOM   3488 O O   B ARG B 1 151 ? 90.128  94.642  17.542  0.40 34.91 ? 152  ARG B O   1 
ATOM   3489 C CB  A ARG B 1 151 ? 87.763  89.547  17.592  0.60 36.68 ? 152  ARG B CB  1 
ATOM   3490 C CB  B ARG B 1 151 ? 88.327  92.201  18.525  0.40 35.79 ? 152  ARG B CB  1 
ATOM   3491 C CG  A ARG B 1 151 ? 88.843  88.630  17.072  0.60 40.79 ? 152  ARG B CG  1 
ATOM   3492 C CG  B ARG B 1 151 ? 89.489  91.400  17.986  0.40 40.33 ? 152  ARG B CG  1 
ATOM   3493 C CD  A ARG B 1 151 ? 88.217  87.319  16.567  0.60 44.41 ? 152  ARG B CD  1 
ATOM   3494 C CD  B ARG B 1 151 ? 88.979  90.145  17.289  0.40 42.24 ? 152  ARG B CD  1 
ATOM   3495 N NE  A ARG B 1 151 ? 89.221  86.388  16.055  0.60 47.89 ? 152  ARG B NE  1 
ATOM   3496 N NE  B ARG B 1 151 ? 90.073  89.315  16.804  0.40 46.42 ? 152  ARG B NE  1 
ATOM   3497 C CZ  A ARG B 1 151 ? 88.990  85.481  15.105  0.60 49.41 ? 152  ARG B CZ  1 
ATOM   3498 C CZ  B ARG B 1 151 ? 89.960  88.434  15.815  0.40 47.93 ? 152  ARG B CZ  1 
ATOM   3499 N NH1 A ARG B 1 151 ? 87.786  85.375  14.551  0.60 48.87 ? 152  ARG B NH1 1 
ATOM   3500 N NH1 B ARG B 1 151 ? 88.794  88.272  15.196  0.40 48.90 ? 152  ARG B NH1 1 
ATOM   3501 N NH2 A ARG B 1 151 ? 89.966  84.678  14.709  0.60 50.72 ? 152  ARG B NH2 1 
ATOM   3502 N NH2 B ARG B 1 151 ? 91.011  87.712  15.449  0.40 48.54 ? 152  ARG B NH2 1 
ATOM   3503 N N   A LYS B 1 152 ? 87.607  92.699  16.533  0.60 32.66 ? 153  LYS B N   1 
ATOM   3504 N N   B LYS B 1 152 ? 88.028  95.413  17.709  0.40 33.80 ? 153  LYS B N   1 
ATOM   3505 C CA  A LYS B 1 152 ? 87.812  93.631  15.429  0.60 34.07 ? 153  LYS B CA  1 
ATOM   3506 C CA  B LYS B 1 152 ? 88.202  96.429  16.677  0.40 34.64 ? 153  LYS B CA  1 
ATOM   3507 C C   A LYS B 1 152 ? 87.261  95.001  15.791  0.60 32.61 ? 153  LYS B C   1 
ATOM   3508 C C   B LYS B 1 152 ? 87.518  97.731  17.085  0.40 34.42 ? 153  LYS B C   1 
ATOM   3509 O O   A LYS B 1 152 ? 86.112  95.104  16.206  0.60 31.17 ? 153  LYS B O   1 
ATOM   3510 O O   B LYS B 1 152 ? 86.335  97.723  17.449  0.40 32.71 ? 153  LYS B O   1 
ATOM   3511 C CB  A LYS B 1 152 ? 87.115  93.113  14.174  0.60 35.44 ? 153  LYS B CB  1 
ATOM   3512 C CB  B LYS B 1 152 ? 87.608  95.933  15.354  0.40 35.20 ? 153  LYS B CB  1 
ATOM   3513 C CG  A LYS B 1 152 ? 87.999  92.266  13.290  0.60 38.69 ? 153  LYS B CG  1 
ATOM   3514 C CG  B LYS B 1 152 ? 88.580  95.197  14.467  0.40 37.42 ? 153  LYS B CG  1 
ATOM   3515 C CD  A LYS B 1 152 ? 89.090  93.132  12.695  0.60 39.25 ? 153  LYS B CD  1 
ATOM   3516 C CD  B LYS B 1 152 ? 89.607  96.154  13.884  0.40 38.24 ? 153  LYS B CD  1 
ATOM   3517 C CE  A LYS B 1 152 ? 89.841  92.422  11.596  0.60 41.42 ? 153  LYS B CE  1 
ATOM   3518 C CE  B LYS B 1 152 ? 90.375  95.519  12.739  0.40 38.70 ? 153  LYS B CE  1 
ATOM   3519 N NZ  A LYS B 1 152 ? 90.890  93.331  11.040  0.60 42.61 ? 153  LYS B NZ  1 
ATOM   3520 N NZ  B LYS B 1 152 ? 91.277  96.511  12.105  0.40 40.22 ? 153  LYS B NZ  1 
ATOM   3521 N N   A LEU B 1 153 ? 88.068  96.051  15.631  0.60 33.52 ? 154  LEU B N   1 
ATOM   3522 N N   B LEU B 1 153 ? 88.254  98.844  17.021  0.40 33.66 ? 154  LEU B N   1 
ATOM   3523 C CA  A LEU B 1 153 ? 87.609  97.406  15.976  0.60 34.30 ? 154  LEU B CA  1 
ATOM   3524 C CA  B LEU B 1 153 ? 87.697  100.149 17.391  0.40 34.30 ? 154  LEU B CA  1 
ATOM   3525 C C   A LEU B 1 153 ? 86.245  97.656  15.358  0.60 34.37 ? 154  LEU B C   1 
ATOM   3526 C C   B LEU B 1 153 ? 86.356  100.341 16.705  0.40 34.14 ? 154  LEU B C   1 
ATOM   3527 O O   A LEU B 1 153 ? 85.384  98.313  15.934  0.60 33.06 ? 154  LEU B O   1 
ATOM   3528 O O   B LEU B 1 153 ? 85.425  100.916 17.262  0.40 33.68 ? 154  LEU B O   1 
ATOM   3529 C CB  A LEU B 1 153 ? 88.593  98.472  15.484  0.60 33.91 ? 154  LEU B CB  1 
ATOM   3530 C CB  B LEU B 1 153 ? 88.638  101.289 16.981  0.40 33.19 ? 154  LEU B CB  1 
ATOM   3531 C CG  A LEU B 1 153 ? 88.234  99.910  15.888  0.60 33.69 ? 154  LEU B CG  1 
ATOM   3532 C CG  B LEU B 1 153 ? 88.193  102.681 17.455  0.40 32.63 ? 154  LEU B CG  1 
ATOM   3533 C CD1 A LEU B 1 153 ? 88.074  99.984  17.393  0.60 33.79 ? 154  LEU B CD1 1 
ATOM   3534 C CD1 B LEU B 1 153 ? 87.958  102.646 18.949  0.40 31.44 ? 154  LEU B CD1 1 
ATOM   3535 C CD2 A LEU B 1 153 ? 89.302  100.875 15.427  0.60 31.26 ? 154  LEU B CD2 1 
ATOM   3536 C CD2 B LEU B 1 153 ? 89.252  103.713 17.125  0.40 30.87 ? 154  LEU B CD2 1 
ATOM   3537 N N   A ASP B 1 154 ? 86.077  97.099  14.171  0.60 36.60 ? 155  ASP B N   1 
ATOM   3538 N N   B ASP B 1 154 ? 86.291  99.844  15.480  0.40 36.03 ? 155  ASP B N   1 
ATOM   3539 C CA  A ASP B 1 154 ? 84.857  97.182  13.392  0.60 38.34 ? 155  ASP B CA  1 
ATOM   3540 C CA  B ASP B 1 154 ? 85.104  99.894  14.643  0.40 38.25 ? 155  ASP B CA  1 
ATOM   3541 C C   A ASP B 1 154 ? 83.589  96.931  14.241  0.60 37.50 ? 155  ASP B C   1 
ATOM   3542 C C   B ASP B 1 154 ? 83.819  99.525  15.404  0.40 38.02 ? 155  ASP B C   1 
ATOM   3543 O O   A ASP B 1 154 ? 82.777  97.838  14.452  0.60 37.21 ? 155  ASP B O   1 
ATOM   3544 O O   B ASP B 1 154 ? 82.957  100.369 15.623  0.40 38.64 ? 155  ASP B O   1 
ATOM   3545 C CB  A ASP B 1 154 ? 84.970  96.158  12.262  0.60 41.69 ? 155  ASP B CB  1 
ATOM   3546 C CB  B ASP B 1 154 ? 85.318  98.945  13.467  0.40 39.25 ? 155  ASP B CB  1 
ATOM   3547 C CG  A ASP B 1 154 ? 83.800  96.180  11.341  0.60 44.72 ? 155  ASP B CG  1 
ATOM   3548 C CG  B ASP B 1 154 ? 84.187  98.971  12.488  0.40 41.94 ? 155  ASP B CG  1 
ATOM   3549 O OD1 A ASP B 1 154 ? 83.595  97.218  10.675  0.60 47.80 ? 155  ASP B OD1 1 
ATOM   3550 O OD1 B ASP B 1 154 ? 83.861  100.069 11.984  0.40 43.74 ? 155  ASP B OD1 1 
ATOM   3551 O OD2 A ASP B 1 154 ? 83.085  95.158  11.283  0.60 46.78 ? 155  ASP B OD2 1 
ATOM   3552 O OD2 B ASP B 1 154 ? 83.629  97.889  12.218  0.40 41.25 ? 155  ASP B OD2 1 
ATOM   3553 N N   A LYS B 1 155 ? 83.420  95.708  14.731  0.60 36.11 ? 156  LYS B N   1 
ATOM   3554 N N   B LYS B 1 155 ? 83.693  98.267  15.812  0.40 38.52 ? 156  LYS B N   1 
ATOM   3555 C CA  A LYS B 1 155 ? 82.248  95.395  15.530  0.60 35.87 ? 156  LYS B CA  1 
ATOM   3556 C CA  B LYS B 1 155 ? 82.499  97.837  16.532  0.40 37.75 ? 156  LYS B CA  1 
ATOM   3557 C C   A LYS B 1 155 ? 82.319  95.962  16.946  0.60 35.50 ? 156  LYS B C   1 
ATOM   3558 C C   B LYS B 1 155 ? 82.470  98.303  17.985  0.40 37.22 ? 156  LYS B C   1 
ATOM   3559 O O   A LYS B 1 155 ? 81.288  96.094  17.615  0.60 34.54 ? 156  LYS B O   1 
ATOM   3560 O O   B LYS B 1 155 ? 81.409  98.305  18.621  0.40 36.92 ? 156  LYS B O   1 
ATOM   3561 C CB  A LYS B 1 155 ? 82.003  93.880  15.574  0.60 38.22 ? 156  LYS B CB  1 
ATOM   3562 C CB  B LYS B 1 155 ? 82.343  96.312  16.465  0.40 39.72 ? 156  LYS B CB  1 
ATOM   3563 C CG  A LYS B 1 155 ? 83.177  93.015  15.150  0.60 40.54 ? 156  LYS B CG  1 
ATOM   3564 C CG  B LYS B 1 155 ? 83.577  95.552  16.017  0.40 40.74 ? 156  LYS B CG  1 
ATOM   3565 C CD  A LYS B 1 155 ? 82.803  91.523  15.136  0.60 41.88 ? 156  LYS B CD  1 
ATOM   3566 C CD  B LYS B 1 155 ? 83.280  94.058  15.890  0.40 41.45 ? 156  LYS B CD  1 
ATOM   3567 C CE  A LYS B 1 155 ? 82.450  91.001  16.529  0.60 42.64 ? 156  LYS B CE  1 
ATOM   3568 C CE  B LYS B 1 155 ? 82.978  93.405  17.245  0.40 42.23 ? 156  LYS B CE  1 
ATOM   3569 N NZ  A LYS B 1 155 ? 83.616  90.987  17.473  0.60 43.83 ? 156  LYS B NZ  1 
ATOM   3570 N NZ  B LYS B 1 155 ? 84.166  93.398  18.157  0.40 41.90 ? 156  LYS B NZ  1 
ATOM   3571 N N   A ALA B 1 156 ? 83.522  96.313  17.399  0.60 32.99 ? 157  ALA B N   1 
ATOM   3572 N N   B ALA B 1 156 ? 83.626  98.703  18.507  0.40 34.25 ? 157  ALA B N   1 
ATOM   3573 C CA  A ALA B 1 156 ? 83.673  96.876  18.733  0.60 32.02 ? 157  ALA B CA  1 
ATOM   3574 C CA  B ALA B 1 156 ? 83.695  99.183  19.881  0.40 33.42 ? 157  ALA B CA  1 
ATOM   3575 C C   A ALA B 1 156 ? 83.042  98.260  18.752  0.60 31.26 ? 157  ALA B C   1 
ATOM   3576 C C   B ALA B 1 156 ? 82.973  100.527 19.954  0.40 31.26 ? 157  ALA B C   1 
ATOM   3577 O O   A ALA B 1 156 ? 82.269  98.585  19.659  0.60 30.09 ? 157  ALA B O   1 
ATOM   3578 O O   B ALA B 1 156 ? 82.133  100.746 20.822  0.40 29.97 ? 157  ALA B O   1 
ATOM   3579 C CB  A ALA B 1 156 ? 85.150  96.962  19.116  0.60 33.61 ? 157  ALA B CB  1 
ATOM   3580 C CB  B ALA B 1 156 ? 85.155  99.331  20.319  0.40 32.65 ? 157  ALA B CB  1 
ATOM   3581 N N   A GLN B 1 157 ? 83.361  99.074  17.747  0.60 30.73 ? 158  GLN B N   1 
ATOM   3582 N N   B GLN B 1 157 ? 83.283  101.418 19.019  0.40 29.37 ? 158  GLN B N   1 
ATOM   3583 C CA  A GLN B 1 157 ? 82.790  100.418 17.654  0.60 31.36 ? 158  GLN B CA  1 
ATOM   3584 C CA  B GLN B 1 157 ? 82.645  102.728 19.008  0.40 30.11 ? 158  GLN B CA  1 
ATOM   3585 C C   A GLN B 1 157 ? 81.268  100.371 17.475  0.60 29.84 ? 158  GLN B C   1 
ATOM   3586 C C   B GLN B 1 157 ? 81.138  102.607 18.763  0.40 29.54 ? 158  GLN B C   1 
ATOM   3587 O O   A GLN B 1 157 ? 80.556  101.214 18.011  0.60 30.08 ? 158  GLN B O   1 
ATOM   3588 O O   B GLN B 1 157 ? 80.354  103.341 19.349  0.40 29.99 ? 158  GLN B O   1 
ATOM   3589 C CB  A GLN B 1 157 ? 83.410  101.207 16.492  0.60 32.31 ? 158  GLN B CB  1 
ATOM   3590 C CB  B GLN B 1 157 ? 83.282  103.630 17.943  0.40 30.98 ? 158  GLN B CB  1 
ATOM   3591 C CG  A GLN B 1 157 ? 83.051  102.683 16.535  0.60 31.57 ? 158  GLN B CG  1 
ATOM   3592 C CG  B GLN B 1 157 ? 82.827  105.083 18.030  0.40 32.05 ? 158  GLN B CG  1 
ATOM   3593 C CD  A GLN B 1 157 ? 83.468  103.323 17.854  0.60 32.79 ? 158  GLN B CD  1 
ATOM   3594 C CD  B GLN B 1 157 ? 83.084  105.695 19.394  0.40 31.77 ? 158  GLN B CD  1 
ATOM   3595 O OE1 A GLN B 1 157 ? 84.653  103.370 18.182  0.60 32.14 ? 158  GLN B OE1 1 
ATOM   3596 O OE1 B GLN B 1 157 ? 84.226  105.824 19.827  0.40 32.43 ? 158  GLN B OE1 1 
ATOM   3597 N NE2 A GLN B 1 157 ? 82.490  103.797 18.628  0.60 33.44 ? 158  GLN B NE2 1 
ATOM   3598 N NE2 B GLN B 1 157 ? 82.019  106.075 20.076  0.40 33.35 ? 158  GLN B NE2 1 
ATOM   3599 N N   A ALA B 1 158 ? 80.771  99.394  16.723  0.60 29.13 ? 159  ALA B N   1 
ATOM   3600 N N   B ALA B 1 158 ? 80.737  101.677 17.901  0.40 29.40 ? 159  ALA B N   1 
ATOM   3601 C CA  A ALA B 1 158 ? 79.328  99.261  16.517  0.60 28.72 ? 159  ALA B CA  1 
ATOM   3602 C CA  B ALA B 1 158 ? 79.318  101.480 17.612  0.40 28.60 ? 159  ALA B CA  1 
ATOM   3603 C C   A ALA B 1 158 ? 78.648  98.972  17.861  0.60 27.92 ? 159  ALA B C   1 
ATOM   3604 C C   B ALA B 1 158 ? 78.601  101.038 18.881  0.40 27.69 ? 159  ALA B C   1 
ATOM   3605 O O   A ALA B 1 158 ? 77.583  99.517  18.162  0.60 26.58 ? 159  ALA B O   1 
ATOM   3606 O O   B ALA B 1 158 ? 77.471  101.432 19.140  0.40 26.69 ? 159  ALA B O   1 
ATOM   3607 C CB  A ALA B 1 158 ? 79.029  98.137  15.540  0.60 29.14 ? 159  ALA B CB  1 
ATOM   3608 C CB  B ALA B 1 158 ? 79.142  100.438 16.519  0.40 29.68 ? 159  ALA B CB  1 
ATOM   3609 N N   A ALA B 1 159 ? 79.260  98.095  18.653  0.60 27.03 ? 160  ALA B N   1 
ATOM   3610 N N   B ALA B 1 159 ? 79.277  100.210 19.669  0.40 27.27 ? 160  ALA B N   1 
ATOM   3611 C CA  A ALA B 1 159 ? 78.705  97.765  19.956  0.60 25.35 ? 160  ALA B CA  1 
ATOM   3612 C CA  B ALA B 1 159 ? 78.714  99.717  20.912  0.40 26.66 ? 160  ALA B CA  1 
ATOM   3613 C C   A ALA B 1 159 ? 78.682  99.029  20.810  0.60 26.06 ? 160  ALA B C   1 
ATOM   3614 C C   B ALA B 1 159 ? 78.552  100.897 21.862  0.40 25.60 ? 160  ALA B C   1 
ATOM   3615 O O   A ALA B 1 159 ? 77.656  99.364  21.418  0.60 24.23 ? 160  ALA B O   1 
ATOM   3616 O O   B ALA B 1 159 ? 77.491  101.095 22.450  0.40 24.92 ? 160  ALA B O   1 
ATOM   3617 C CB  A ALA B 1 159 ? 79.547  96.694  20.625  0.60 26.05 ? 160  ALA B CB  1 
ATOM   3618 C CB  B ALA B 1 159 ? 79.638  98.659  21.510  0.40 26.70 ? 160  ALA B CB  1 
ATOM   3619 N N   A ALA B 1 160 ? 79.808  99.743  20.840  0.60 24.47 ? 161  ALA B N   1 
ATOM   3620 N N   B ALA B 1 160 ? 79.612  101.688 21.997  0.40 25.21 ? 161  ALA B N   1 
ATOM   3621 C CA  A ALA B 1 160 ? 79.913  100.976 21.623  0.60 24.93 ? 161  ALA B CA  1 
ATOM   3622 C CA  B ALA B 1 160 ? 79.569  102.856 22.868  0.40 25.64 ? 161  ALA B CA  1 
ATOM   3623 C C   A ALA B 1 160 ? 78.878  102.015 21.181  0.60 26.52 ? 161  ALA B C   1 
ATOM   3624 C C   B ALA B 1 160 ? 78.499  103.844 22.398  0.40 24.17 ? 161  ALA B C   1 
ATOM   3625 O O   A ALA B 1 160 ? 78.209  102.643 22.009  0.60 26.29 ? 161  ALA B O   1 
ATOM   3626 O O   B ALA B 1 160 ? 77.742  104.360 23.198  0.40 23.44 ? 161  ALA B O   1 
ATOM   3627 C CB  A ALA B 1 160 ? 81.312  101.563 21.481  0.60 23.83 ? 161  ALA B CB  1 
ATOM   3628 C CB  B ALA B 1 160 ? 80.942  103.538 22.917  0.40 26.05 ? 161  ALA B CB  1 
ATOM   3629 N N   A ASP B 1 161 ? 78.745  102.198 19.871  0.60 26.38 ? 162  ASP B N   1 
ATOM   3630 N N   B ASP B 1 161 ? 78.429  104.098 21.099  0.40 25.10 ? 162  ASP B N   1 
ATOM   3631 C CA  A ASP B 1 161 ? 77.806  103.180 19.355  0.60 27.13 ? 162  ASP B CA  1 
ATOM   3632 C CA  B ASP B 1 161 ? 77.426  105.030 20.588  0.40 26.30 ? 162  ASP B CA  1 
ATOM   3633 C C   A ASP B 1 161 ? 76.384  102.793 19.772  0.60 25.09 ? 162  ASP B C   1 
ATOM   3634 C C   B ASP B 1 161 ? 76.015  104.566 20.907  0.40 25.84 ? 162  ASP B C   1 
ATOM   3635 O O   A ASP B 1 161 ? 75.591  103.650 20.149  0.60 27.01 ? 162  ASP B O   1 
ATOM   3636 O O   B ASP B 1 161 ? 75.162  105.360 21.273  0.40 26.17 ? 162  ASP B O   1 
ATOM   3637 C CB  A ASP B 1 161 ? 77.891  103.263 17.822  0.60 27.71 ? 162  ASP B CB  1 
ATOM   3638 C CB  B ASP B 1 161 ? 77.589  105.200 19.081  0.40 26.25 ? 162  ASP B CB  1 
ATOM   3639 C CG  A ASP B 1 161 ? 79.184  103.904 17.319  0.60 30.31 ? 162  ASP B CG  1 
ATOM   3640 C CG  B ASP B 1 161 ? 78.871  105.929 18.724  0.40 26.45 ? 162  ASP B CG  1 
ATOM   3641 O OD1 A ASP B 1 161 ? 79.369  103.939 16.081  0.60 29.53 ? 162  ASP B OD1 1 
ATOM   3642 O OD1 B ASP B 1 161 ? 79.224  105.983 17.521  0.40 25.62 ? 162  ASP B OD1 1 
ATOM   3643 O OD2 A ASP B 1 161 ? 80.009  104.373 18.131  0.60 29.52 ? 162  ASP B OD2 1 
ATOM   3644 O OD2 B ASP B 1 161 ? 79.510  106.445 19.667  0.40 24.92 ? 162  ASP B OD2 1 
ATOM   3645 N N   A SER B 1 162 ? 76.069  101.502 19.713  0.60 25.20 ? 163  SER B N   1 
ATOM   3646 N N   B SER B 1 162 ? 75.771  103.273 20.760  0.40 26.23 ? 163  SER B N   1 
ATOM   3647 C CA  A SER B 1 162 ? 74.730  101.043 20.083  0.60 25.15 ? 163  SER B CA  1 
ATOM   3648 C CA  B SER B 1 162 ? 74.451  102.731 21.036  0.40 25.59 ? 163  SER B CA  1 
ATOM   3649 C C   A SER B 1 162 ? 74.448  101.405 21.544  0.60 23.44 ? 163  SER B C   1 
ATOM   3650 C C   B SER B 1 162 ? 74.071  102.985 22.490  0.40 23.93 ? 163  SER B C   1 
ATOM   3651 O O   A SER B 1 162 ? 73.373  101.908 21.886  0.60 21.86 ? 163  SER B O   1 
ATOM   3652 O O   B SER B 1 162 ? 72.964  103.439 22.782  0.40 22.18 ? 163  SER B O   1 
ATOM   3653 C CB  A SER B 1 162 ? 74.621  99.532  19.879  0.60 23.56 ? 163  SER B CB  1 
ATOM   3654 C CB  B SER B 1 162 ? 74.429  101.231 20.731  0.40 24.88 ? 163  SER B CB  1 
ATOM   3655 O OG  A SER B 1 162 ? 73.399  99.064  20.399  0.60 29.02 ? 163  SER B OG  1 
ATOM   3656 O OG  B SER B 1 162 ? 73.137  100.690 20.914  0.40 25.64 ? 163  SER B OG  1 
ATOM   3657 N N   A VAL B 1 163 ? 75.427  101.142 22.407  0.60 23.94 ? 164  VAL B N   1 
ATOM   3658 N N   B VAL B 1 163 ? 75.004  102.700 23.394  0.40 24.73 ? 164  VAL B N   1 
ATOM   3659 C CA  A VAL B 1 163 ? 75.297  101.446 23.816  0.60 22.97 ? 164  VAL B CA  1 
ATOM   3660 C CA  B VAL B 1 163 ? 74.793  102.896 24.824  0.40 23.61 ? 164  VAL B CA  1 
ATOM   3661 C C   A VAL B 1 163 ? 75.150  102.933 24.095  0.60 24.39 ? 164  VAL B C   1 
ATOM   3662 C C   B VAL B 1 163 ? 74.575  104.364 25.191  0.40 24.40 ? 164  VAL B C   1 
ATOM   3663 O O   A VAL B 1 163 ? 74.227  103.345 24.800  0.60 20.14 ? 164  VAL B O   1 
ATOM   3664 O O   B VAL B 1 163 ? 73.614  104.700 25.893  0.40 24.90 ? 164  VAL B O   1 
ATOM   3665 C CB  A VAL B 1 163 ? 76.492  100.918 24.613  0.60 23.37 ? 164  VAL B CB  1 
ATOM   3666 C CB  B VAL B 1 163 ? 76.001  102.348 25.624  0.40 22.65 ? 164  VAL B CB  1 
ATOM   3667 C CG1 A VAL B 1 163 ? 76.380  101.387 26.068  0.60 22.51 ? 164  VAL B CG1 1 
ATOM   3668 C CG1 B VAL B 1 163 ? 75.889  102.710 27.080  0.40 22.99 ? 164  VAL B CG1 1 
ATOM   3669 C CG2 A VAL B 1 163 ? 76.530  99.388  24.519  0.60 20.57 ? 164  VAL B CG2 1 
ATOM   3670 C CG2 B VAL B 1 163 ? 76.064  100.851 25.477  0.40 23.22 ? 164  VAL B CG2 1 
ATOM   3671 N N   A ASN B 1 164 ? 76.052  103.736 23.530  0.60 24.96 ? 165  ASN B N   1 
ATOM   3672 N N   B ASN B 1 164 ? 75.467  105.233 24.719  0.40 23.70 ? 165  ASN B N   1 
ATOM   3673 C CA  A ASN B 1 164 ? 76.031  105.190 23.725  0.60 25.61 ? 165  ASN B CA  1 
ATOM   3674 C CA  B ASN B 1 164 ? 75.378  106.656 25.028  0.40 25.06 ? 165  ASN B CA  1 
ATOM   3675 C C   A ASN B 1 164 ? 74.739  105.884 23.312  0.60 26.26 ? 165  ASN B C   1 
ATOM   3676 C C   B ASN B 1 164 ? 74.063  107.287 24.589  0.40 24.94 ? 165  ASN B C   1 
ATOM   3677 O O   A ASN B 1 164 ? 74.280  106.808 23.982  0.60 26.83 ? 165  ASN B O   1 
ATOM   3678 O O   B ASN B 1 164 ? 73.529  108.141 25.282  0.40 23.57 ? 165  ASN B O   1 
ATOM   3679 C CB  A ASN B 1 164 ? 77.214  105.818 22.988  0.60 26.42 ? 165  ASN B CB  1 
ATOM   3680 C CB  B ASN B 1 164 ? 76.552  107.414 24.400  0.40 25.69 ? 165  ASN B CB  1 
ATOM   3681 C CG  A ASN B 1 164 ? 78.541  105.335 23.535  0.60 27.98 ? 165  ASN B CG  1 
ATOM   3682 C CG  B ASN B 1 164 ? 77.885  106.995 24.977  0.40 26.80 ? 165  ASN B CG  1 
ATOM   3683 O OD1 A ASN B 1 164 ? 78.595  104.776 24.642  0.60 27.07 ? 165  ASN B OD1 1 
ATOM   3684 O OD1 B ASN B 1 164 ? 77.955  106.525 26.113  0.40 24.80 ? 165  ASN B OD1 1 
ATOM   3685 N ND2 A ASN B 1 164 ? 79.618  105.547 22.782  0.60 30.60 ? 165  ASN B ND2 1 
ATOM   3686 N ND2 B ASN B 1 164 ? 78.959  107.176 24.203  0.40 27.44 ? 165  ASN B ND2 1 
ATOM   3687 N N   A LYS B 1 165 ? 74.164  105.440 22.197  0.60 27.58 ? 166  LYS B N   1 
ATOM   3688 N N   B LYS B 1 165 ? 73.562  106.860 23.431  0.40 26.68 ? 166  LYS B N   1 
ATOM   3689 C CA  A LYS B 1 165 ? 72.918  105.975 21.688  0.60 27.36 ? 166  LYS B CA  1 
ATOM   3690 C CA  B LYS B 1 165 ? 72.305  107.367 22.889  0.40 28.97 ? 166  LYS B CA  1 
ATOM   3691 C C   A LYS B 1 165 ? 71.755  105.530 22.577  0.60 27.82 ? 166  LYS B C   1 
ATOM   3692 C C   B LYS B 1 165 ? 71.106  106.843 23.679  0.40 28.21 ? 166  LYS B C   1 
ATOM   3693 O O   A LYS B 1 165 ? 70.869  106.319 22.862  0.60 27.73 ? 166  LYS B O   1 
ATOM   3694 O O   B LYS B 1 165 ? 70.140  107.575 23.916  0.40 28.96 ? 166  LYS B O   1 
ATOM   3695 C CB  A LYS B 1 165 ? 72.696  105.487 20.249  0.60 30.29 ? 166  LYS B CB  1 
ATOM   3696 C CB  B LYS B 1 165 ? 72.163  106.954 21.417  0.40 30.05 ? 166  LYS B CB  1 
ATOM   3697 C CG  A LYS B 1 165 ? 71.293  105.705 19.713  0.60 33.85 ? 166  LYS B CG  1 
ATOM   3698 C CG  B LYS B 1 165 ? 70.799  107.284 20.807  0.40 32.81 ? 166  LYS B CG  1 
ATOM   3699 C CD  A LYS B 1 165 ? 71.120  105.110 18.318  0.60 34.54 ? 166  LYS B CD  1 
ATOM   3700 C CD  B LYS B 1 165 ? 70.647  106.723 19.391  0.40 34.46 ? 166  LYS B CD  1 
ATOM   3701 C CE  A LYS B 1 165 ? 69.644  105.147 17.925  0.60 36.44 ? 166  LYS B CE  1 
ATOM   3702 C CE  B LYS B 1 165 ? 69.217  106.913 18.877  0.40 35.35 ? 166  LYS B CE  1 
ATOM   3703 N NZ  A LYS B 1 165 ? 69.368  104.547 16.590  0.60 37.81 ? 166  LYS B NZ  1 
ATOM   3704 N NZ  B LYS B 1 165 ? 68.998  106.312 17.529  0.40 37.15 ? 166  LYS B NZ  1 
ATOM   3705 N N   A ARG B 1 166 ? 71.768  104.279 23.035  0.60 27.18 ? 167  ARG B N   1 
ATOM   3706 N N   B ARG B 1 166 ? 71.172  105.580 24.092  0.40 27.44 ? 167  ARG B N   1 
ATOM   3707 C CA  A ARG B 1 166 ? 70.677  103.779 23.876  0.60 27.09 ? 167  ARG B CA  1 
ATOM   3708 C CA  B ARG B 1 166 ? 70.072  104.960 24.834  0.40 27.97 ? 167  ARG B CA  1 
ATOM   3709 C C   A ARG B 1 166 ? 70.669  104.329 25.300  0.60 28.71 ? 167  ARG B C   1 
ATOM   3710 C C   B ARG B 1 166 ? 69.949  105.400 26.297  0.40 28.68 ? 167  ARG B C   1 
ATOM   3711 O O   A ARG B 1 166 ? 69.607  104.720 25.807  0.60 26.82 ? 167  ARG B O   1 
ATOM   3712 O O   B ARG B 1 166 ? 68.844  105.666 26.783  0.40 28.21 ? 167  ARG B O   1 
ATOM   3713 C CB  A ARG B 1 166 ? 70.690  102.249 23.931  0.60 27.50 ? 167  ARG B CB  1 
ATOM   3714 C CB  B ARG B 1 166 ? 70.195  103.426 24.765  0.40 27.76 ? 167  ARG B CB  1 
ATOM   3715 C CG  A ARG B 1 166 ? 69.766  101.640 24.999  0.60 25.46 ? 167  ARG B CG  1 
ATOM   3716 C CG  B ARG B 1 166 ? 69.248  102.650 25.708  0.40 24.81 ? 167  ARG B CG  1 
ATOM   3717 C CD  A ARG B 1 166 ? 68.267  101.842 24.703  0.60 27.43 ? 167  ARG B CD  1 
ATOM   3718 C CD  B ARG B 1 166 ? 67.763  102.850 25.350  0.40 24.85 ? 167  ARG B CD  1 
ATOM   3719 N NE  A ARG B 1 166 ? 67.446  101.166 25.716  0.60 27.64 ? 167  ARG B NE  1 
ATOM   3720 N NE  B ARG B 1 166 ? 66.890  102.104 26.256  0.40 23.44 ? 167  ARG B NE  1 
ATOM   3721 C CZ  A ARG B 1 166 ? 67.350  101.567 26.983  0.60 25.85 ? 167  ARG B CZ  1 
ATOM   3722 C CZ  B ARG B 1 166 ? 66.702  102.409 27.539  0.40 24.69 ? 167  ARG B CZ  1 
ATOM   3723 N NH1 A ARG B 1 166 ? 68.005  102.653 27.385  0.60 24.76 ? 167  ARG B NH1 1 
ATOM   3724 N NH1 B ARG B 1 166 ? 67.318  103.456 28.069  0.40 17.48 ? 167  ARG B NH1 1 
ATOM   3725 N NH2 A ARG B 1 166 ? 66.658  100.855 27.869  0.60 23.42 ? 167  ARG B NH2 1 
ATOM   3726 N NH2 B ARG B 1 166 ? 65.915  101.648 28.301  0.40 22.39 ? 167  ARG B NH2 1 
ATOM   3727 N N   A PHE B 1 167 ? 71.833  104.359 25.949  0.60 28.16 ? 168  PHE B N   1 
ATOM   3728 N N   B PHE B 1 167 ? 71.079  105.483 26.992  0.40 29.53 ? 168  PHE B N   1 
ATOM   3729 C CA  A PHE B 1 167 ? 71.894  104.853 27.331  0.60 29.77 ? 168  PHE B CA  1 
ATOM   3730 C CA  B PHE B 1 167 ? 71.076  105.857 28.400  0.40 29.96 ? 168  PHE B CA  1 
ATOM   3731 C C   A PHE B 1 167 ? 72.494  106.234 27.535  0.60 30.99 ? 168  PHE B C   1 
ATOM   3732 C C   B PHE B 1 167 ? 71.605  107.249 28.716  0.40 30.86 ? 168  PHE B C   1 
ATOM   3733 O O   A PHE B 1 167 ? 72.686  106.663 28.678  0.60 31.64 ? 168  PHE B O   1 
ATOM   3734 O O   B PHE B 1 167 ? 71.806  107.582 29.882  0.40 29.86 ? 168  PHE B O   1 
ATOM   3735 C CB  A PHE B 1 167 ? 72.648  103.861 28.211  0.60 28.50 ? 168  PHE B CB  1 
ATOM   3736 C CB  B PHE B 1 167 ? 71.866  104.827 29.209  0.40 29.41 ? 168  PHE B CB  1 
ATOM   3737 C CG  A PHE B 1 167 ? 72.058  102.495 28.192  0.60 24.98 ? 168  PHE B CG  1 
ATOM   3738 C CG  B PHE B 1 167 ? 71.364  103.423 29.047  0.40 27.02 ? 168  PHE B CG  1 
ATOM   3739 C CD1 A PHE B 1 167 ? 72.438  101.580 27.223  0.60 23.20 ? 168  PHE B CD1 1 
ATOM   3740 C CD1 B PHE B 1 167 ? 71.856  102.606 28.036  0.40 26.01 ? 168  PHE B CD1 1 
ATOM   3741 C CD2 A PHE B 1 167 ? 71.074  102.144 29.103  0.60 24.99 ? 168  PHE B CD2 1 
ATOM   3742 C CD2 B PHE B 1 167 ? 70.370  102.934 29.879  0.40 27.66 ? 168  PHE B CD2 1 
ATOM   3743 C CE1 A PHE B 1 167 ? 71.846  100.334 27.151  0.60 23.16 ? 168  PHE B CE1 1 
ATOM   3744 C CE1 B PHE B 1 167 ? 71.364  101.316 27.853  0.40 26.26 ? 168  PHE B CE1 1 
ATOM   3745 C CE2 A PHE B 1 167 ? 70.469  100.890 29.039  0.60 25.69 ? 168  PHE B CE2 1 
ATOM   3746 C CE2 B PHE B 1 167 ? 69.864  101.645 29.709  0.40 26.17 ? 168  PHE B CE2 1 
ATOM   3747 C CZ  A PHE B 1 167 ? 70.864  99.989  28.052  0.60 25.11 ? 168  PHE B CZ  1 
ATOM   3748 C CZ  B PHE B 1 167 ? 70.362  100.837 28.694  0.40 26.69 ? 168  PHE B CZ  1 
ATOM   3749 N N   A LYS B 1 168 ? 72.790  106.923 26.437  0.60 32.45 ? 169  LYS B N   1 
ATOM   3750 N N   B LYS B 1 168 ? 71.829  108.051 27.681  0.40 31.82 ? 169  LYS B N   1 
ATOM   3751 C CA  A LYS B 1 168 ? 73.372  108.265 26.501  0.60 33.20 ? 169  LYS B CA  1 
ATOM   3752 C CA  B LYS B 1 168 ? 72.326  109.408 27.858  0.40 33.44 ? 169  LYS B CA  1 
ATOM   3753 C C   A LYS B 1 168 ? 74.653  108.274 27.325  0.60 32.32 ? 169  LYS B C   1 
ATOM   3754 C C   B LYS B 1 168 ? 73.561  109.434 28.763  0.40 33.86 ? 169  LYS B C   1 
ATOM   3755 O O   A LYS B 1 168 ? 74.771  108.995 28.309  0.60 32.08 ? 169  LYS B O   1 
ATOM   3756 O O   B LYS B 1 168 ? 73.558  110.055 29.830  0.40 32.34 ? 169  LYS B O   1 
ATOM   3757 C CB  A LYS B 1 168 ? 72.352  109.242 27.106  0.60 34.63 ? 169  LYS B CB  1 
ATOM   3758 C CB  B LYS B 1 168 ? 71.218  110.281 28.451  0.40 36.05 ? 169  LYS B CB  1 
ATOM   3759 C CG  A LYS B 1 168 ? 70.987  109.201 26.422  0.60 37.67 ? 169  LYS B CG  1 
ATOM   3760 C CG  B LYS B 1 168 ? 69.921  110.274 27.637  0.40 38.37 ? 169  LYS B CG  1 
ATOM   3761 C CD  A LYS B 1 168 ? 70.100  110.357 26.853  0.60 38.81 ? 169  LYS B CD  1 
ATOM   3762 C CD  B LYS B 1 168 ? 68.917  111.287 28.179  0.40 40.52 ? 169  LYS B CD  1 
ATOM   3763 C CE  A LYS B 1 168 ? 68.838  110.419 26.019  0.60 41.67 ? 169  LYS B CE  1 
ATOM   3764 C CE  B LYS B 1 168 ? 67.686  111.388 27.288  0.40 42.38 ? 169  LYS B CE  1 
ATOM   3765 N NZ  A LYS B 1 168 ? 68.069  111.670 26.291  0.60 43.49 ? 169  LYS B NZ  1 
ATOM   3766 N NZ  B LYS B 1 168 ? 66.800  112.536 27.668  0.40 43.30 ? 169  LYS B NZ  1 
ATOM   3767 N N   A VAL B 1 169 ? 75.622  107.464 26.924  0.60 33.31 ? 170  VAL B N   1 
ATOM   3768 N N   B VAL B 1 169 ? 74.617  108.752 28.328  0.40 33.54 ? 170  VAL B N   1 
ATOM   3769 C CA  A VAL B 1 169 ? 76.879  107.392 27.653  0.60 32.98 ? 170  VAL B CA  1 
ATOM   3770 C CA  B VAL B 1 169 ? 75.849  108.690 29.100  0.40 33.70 ? 170  VAL B CA  1 
ATOM   3771 C C   A VAL B 1 169 ? 78.010  107.437 26.647  0.60 32.97 ? 170  VAL B C   1 
ATOM   3772 C C   B VAL B 1 169 ? 77.034  108.873 28.164  0.40 33.94 ? 170  VAL B C   1 
ATOM   3773 O O   A VAL B 1 169 ? 77.764  107.515 25.445  0.60 33.74 ? 170  VAL B O   1 
ATOM   3774 O O   B VAL B 1 169 ? 76.849  109.011 26.955  0.40 33.85 ? 170  VAL B O   1 
ATOM   3775 C CB  A VAL B 1 169 ? 76.962  106.094 28.475  0.60 33.79 ? 170  VAL B CB  1 
ATOM   3776 C CB  B VAL B 1 169 ? 75.960  107.349 29.842  0.40 33.15 ? 170  VAL B CB  1 
ATOM   3777 C CG1 A VAL B 1 169 ? 75.882  106.089 29.550  0.60 31.37 ? 170  VAL B CG1 1 
ATOM   3778 C CG1 B VAL B 1 169 ? 74.793  107.205 30.817  0.40 32.54 ? 170  VAL B CG1 1 
ATOM   3779 C CG2 A VAL B 1 169 ? 76.794  104.889 27.550  0.60 32.41 ? 170  VAL B CG2 1 
ATOM   3780 C CG2 B VAL B 1 169 ? 75.960  106.207 28.853  0.40 32.61 ? 170  VAL B CG2 1 
ATOM   3781 N N   A ASN B 1 170 ? 79.248  107.381 27.120  0.60 33.24 ? 171  ASN B N   1 
ATOM   3782 N N   B ASN B 1 170 ? 78.245  108.879 28.711  0.40 34.43 ? 171  ASN B N   1 
ATOM   3783 C CA  A ASN B 1 170 ? 80.371  107.451 26.198  0.60 33.83 ? 171  ASN B CA  1 
ATOM   3784 C CA  B ASN B 1 170 ? 79.413  109.086 27.862  0.40 34.65 ? 171  ASN B CA  1 
ATOM   3785 C C   A ASN B 1 170 ? 81.357  106.301 26.317  0.60 32.83 ? 171  ASN B C   1 
ATOM   3786 C C   B ASN B 1 170 ? 80.466  107.989 27.922  0.40 34.09 ? 171  ASN B C   1 
ATOM   3787 O O   A ASN B 1 170 ? 82.513  106.477 26.716  0.60 33.23 ? 171  ASN B O   1 
ATOM   3788 O O   B ASN B 1 170 ? 81.607  108.216 28.338  0.40 33.92 ? 171  ASN B O   1 
ATOM   3789 C CB  A ASN B 1 170 ? 81.098  108.792 26.362  0.60 35.15 ? 171  ASN B CB  1 
ATOM   3790 C CB  B ASN B 1 170 ? 80.055  110.435 28.170  0.40 34.96 ? 171  ASN B CB  1 
ATOM   3791 C CG  A ASN B 1 170 ? 82.161  109.011 25.295  0.60 36.33 ? 171  ASN B CG  1 
ATOM   3792 C CG  B ASN B 1 170 ? 81.087  110.826 27.131  0.40 37.24 ? 171  ASN B CG  1 
ATOM   3793 O OD1 A ASN B 1 170 ? 81.987  108.620 24.136  0.60 37.28 ? 171  ASN B OD1 1 
ATOM   3794 O OD1 B ASN B 1 170 ? 80.904  110.559 25.939  0.40 38.16 ? 171  ASN B OD1 1 
ATOM   3795 N ND2 A ASN B 1 170 ? 83.265  109.639 25.679  0.60 37.44 ? 171  ASN B ND2 1 
ATOM   3796 N ND2 B ASN B 1 170 ? 82.171  111.465 27.567  0.40 35.47 ? 171  ASN B ND2 1 
ATOM   3797 N N   A VAL B 1 171 ? 80.890  105.108 25.976  0.60 31.90 ? 172  VAL B N   1 
ATOM   3798 N N   B VAL B 1 171 ? 80.076  106.799 27.485  0.40 33.48 ? 172  VAL B N   1 
ATOM   3799 C CA  A VAL B 1 171 ? 81.736  103.929 26.013  0.60 29.81 ? 172  VAL B CA  1 
ATOM   3800 C CA  B VAL B 1 171 ? 80.985  105.661 27.469  0.40 32.88 ? 172  VAL B CA  1 
ATOM   3801 C C   A VAL B 1 171 ? 82.724  104.041 24.843  0.60 30.58 ? 172  VAL B C   1 
ATOM   3802 C C   B VAL B 1 171 ? 82.028  105.897 26.387  0.40 32.91 ? 172  VAL B C   1 
ATOM   3803 O O   A VAL B 1 171 ? 82.370  104.529 23.774  0.60 30.39 ? 172  VAL B O   1 
ATOM   3804 O O   B VAL B 1 171 ? 81.716  106.446 25.335  0.40 31.94 ? 172  VAL B O   1 
ATOM   3805 C CB  A VAL B 1 171 ? 80.894  102.649 25.858  0.60 29.93 ? 172  VAL B CB  1 
ATOM   3806 C CB  B VAL B 1 171 ? 80.232  104.349 27.161  0.40 32.76 ? 172  VAL B CB  1 
ATOM   3807 C CG1 A VAL B 1 171 ? 81.796  101.435 25.731  0.60 30.27 ? 172  VAL B CG1 1 
ATOM   3808 C CG1 B VAL B 1 171 ? 81.220  103.202 27.002  0.40 30.84 ? 172  VAL B CG1 1 
ATOM   3809 C CG2 A VAL B 1 171 ? 79.951  102.501 27.039  0.60 29.33 ? 172  VAL B CG2 1 
ATOM   3810 C CG2 B VAL B 1 171 ? 79.237  104.050 28.279  0.40 33.61 ? 172  VAL B CG2 1 
ATOM   3811 N N   A THR B 1 172 ? 83.953  103.588 25.054  0.60 29.31 ? 173  THR B N   1 
ATOM   3812 N N   B THR B 1 172 ? 83.265  105.497 26.657  0.40 32.46 ? 173  THR B N   1 
ATOM   3813 C CA  A THR B 1 172 ? 84.990  103.621 24.031  0.60 30.11 ? 173  THR B CA  1 
ATOM   3814 C CA  B THR B 1 172 ? 84.356  105.650 25.694  0.40 32.92 ? 173  THR B CA  1 
ATOM   3815 C C   A THR B 1 172 ? 85.220  102.194 23.553  0.60 30.36 ? 173  THR B C   1 
ATOM   3816 C C   B THR B 1 172 ? 84.670  104.264 25.123  0.40 32.62 ? 173  THR B C   1 
ATOM   3817 O O   A THR B 1 172 ? 85.021  101.248 24.313  0.60 29.90 ? 173  THR B O   1 
ATOM   3818 O O   B THR B 1 172 ? 84.456  103.260 25.792  0.40 33.61 ? 173  THR B O   1 
ATOM   3819 C CB  A THR B 1 172 ? 86.314  104.176 24.617  0.60 30.89 ? 173  THR B CB  1 
ATOM   3820 C CB  B THR B 1 172 ? 85.625  106.211 26.386  0.40 32.63 ? 173  THR B CB  1 
ATOM   3821 O OG1 A THR B 1 172 ? 87.326  104.184 23.614  0.60 33.91 ? 173  THR B OG1 1 
ATOM   3822 O OG1 B THR B 1 172 ? 86.668  106.391 25.420  0.40 34.65 ? 173  THR B OG1 1 
ATOM   3823 C CG2 A THR B 1 172 ? 86.791  103.323 25.752  0.60 31.95 ? 173  THR B CG2 1 
ATOM   3824 C CG2 B THR B 1 172 ? 86.110  105.246 27.455  0.40 30.17 ? 173  THR B CG2 1 
ATOM   3825 N N   A ALA B 1 173 ? 85.642  102.020 22.303  0.60 30.10 ? 174  ALA B N   1 
ATOM   3826 N N   B ALA B 1 173 ? 85.169  104.194 23.896  0.40 31.95 ? 174  ALA B N   1 
ATOM   3827 C CA  A ALA B 1 173 ? 85.886  100.671 21.809  0.60 29.14 ? 174  ALA B CA  1 
ATOM   3828 C CA  B ALA B 1 173 ? 85.494  102.894 23.333  0.40 31.67 ? 174  ALA B CA  1 
ATOM   3829 C C   A ALA B 1 173 ? 87.356  100.427 21.503  0.60 28.20 ? 174  ALA B C   1 
ATOM   3830 C C   B ALA B 1 173 ? 86.985  102.784 23.019  0.40 31.80 ? 174  ALA B C   1 
ATOM   3831 O O   A ALA B 1 173 ? 88.091  101.331 21.132  0.60 27.30 ? 174  ALA B O   1 
ATOM   3832 O O   B ALA B 1 173 ? 87.631  103.766 22.647  0.40 31.62 ? 174  ALA B O   1 
ATOM   3833 C CB  A ALA B 1 173 ? 85.048  100.405 20.567  0.60 31.41 ? 174  ALA B CB  1 
ATOM   3834 C CB  B ALA B 1 173 ? 84.664  102.637 22.087  0.40 31.34 ? 174  ALA B CB  1 
ATOM   3835 N N   A ALA B 1 174 ? 87.799  99.193  21.667  0.60 28.51 ? 175  ALA B N   1 
ATOM   3836 N N   B ALA B 1 174 ? 87.535  101.590 23.189  0.40 30.53 ? 175  ALA B N   1 
ATOM   3837 C CA  A ALA B 1 174 ? 89.181  98.876  21.363  0.60 29.33 ? 175  ALA B CA  1 
ATOM   3838 C CA  B ALA B 1 174 ? 88.942  101.369 22.918  0.40 30.57 ? 175  ALA B CA  1 
ATOM   3839 C C   A ALA B 1 174 ? 89.248  97.522  20.684  0.60 30.26 ? 175  ALA B C   1 
ATOM   3840 C C   B ALA B 1 174 ? 89.110  100.052 22.174  0.40 31.14 ? 175  ALA B C   1 
ATOM   3841 O O   A ALA B 1 174 ? 88.410  96.648  20.929  0.60 29.09 ? 175  ALA B O   1 
ATOM   3842 O O   B ALA B 1 174 ? 88.307  99.130  22.321  0.40 30.01 ? 175  ALA B O   1 
ATOM   3843 C CB  A ALA B 1 174 ? 90.009  98.863  22.634  0.60 31.04 ? 175  ALA B CB  1 
ATOM   3844 C CB  B ALA B 1 174 ? 89.730  101.348 24.219  0.40 30.10 ? 175  ALA B CB  1 
ATOM   3845 N N   A GLU B 1 175 ? 90.233  97.350  19.812  0.60 29.82 ? 176  GLU B N   1 
ATOM   3846 N N   B GLU B 1 175 ? 90.147  99.978  21.356  0.40 31.86 ? 176  GLU B N   1 
ATOM   3847 C CA  A GLU B 1 175 ? 90.400  96.074  19.142  0.60 31.35 ? 176  GLU B CA  1 
ATOM   3848 C CA  B GLU B 1 175 ? 90.433  98.769  20.609  0.40 32.91 ? 176  GLU B CA  1 
ATOM   3849 C C   A GLU B 1 175 ? 91.465  95.239  19.845  0.60 30.56 ? 176  GLU B C   1 
ATOM   3850 C C   B GLU B 1 175 ? 91.532  97.973  21.310  0.40 32.88 ? 176  GLU B C   1 
ATOM   3851 O O   A GLU B 1 175 ? 92.572  95.717  20.098  0.60 30.36 ? 176  GLU B O   1 
ATOM   3852 O O   B GLU B 1 175 ? 92.593  98.511  21.619  0.40 33.06 ? 176  GLU B O   1 
ATOM   3853 C CB  A GLU B 1 175 ? 90.783  96.291  17.677  0.60 32.21 ? 176  GLU B CB  1 
ATOM   3854 C CB  B GLU B 1 175 ? 90.880  99.128  19.192  0.40 34.61 ? 176  GLU B CB  1 
ATOM   3855 C CG  A GLU B 1 175 ? 91.440  95.088  17.017  0.60 35.36 ? 176  GLU B CG  1 
ATOM   3856 C CG  B GLU B 1 175 ? 91.699  98.052  18.506  0.40 35.24 ? 176  GLU B CG  1 
ATOM   3857 C CD  A GLU B 1 175 ? 91.658  95.282  15.522  0.60 37.71 ? 176  GLU B CD  1 
ATOM   3858 C CD  B GLU B 1 175 ? 91.997  98.389  17.066  0.40 37.18 ? 176  GLU B CD  1 
ATOM   3859 O OE1 A GLU B 1 175 ? 92.670  94.765  14.990  0.60 38.52 ? 176  GLU B OE1 1 
ATOM   3860 O OE1 B GLU B 1 175 ? 93.035  97.924  16.546  0.40 38.75 ? 176  GLU B OE1 1 
ATOM   3861 O OE2 A GLU B 1 175 ? 90.811  95.944  14.879  0.60 38.33 ? 176  GLU B OE2 1 
ATOM   3862 O OE2 B GLU B 1 175 ? 91.185  99.110  16.449  0.40 38.18 ? 176  GLU B OE2 1 
ATOM   3863 N N   A THR B 1 176 ? 91.119  94.001  20.185  0.60 30.56 ? 177  THR B N   1 
ATOM   3864 N N   B THR B 1 176 ? 91.256  96.698  21.573  0.40 33.10 ? 177  THR B N   1 
ATOM   3865 C CA  A THR B 1 176 ? 92.057  93.084  20.834  0.60 30.89 ? 177  THR B CA  1 
ATOM   3866 C CA  B THR B 1 176 ? 92.217  95.796  22.198  0.40 33.04 ? 177  THR B CA  1 
ATOM   3867 C C   A THR B 1 176 ? 91.958  91.748  20.093  0.60 32.78 ? 177  THR B C   1 
ATOM   3868 C C   B THR B 1 176 ? 92.201  94.502  21.383  0.40 34.21 ? 177  THR B C   1 
ATOM   3869 O O   A THR B 1 176 ? 91.159  90.875  20.440  0.60 32.57 ? 177  THR B O   1 
ATOM   3870 O O   B THR B 1 176 ? 91.423  93.587  21.652  0.40 34.32 ? 177  THR B O   1 
ATOM   3871 C CB  A THR B 1 176 ? 91.725  92.888  22.329  0.60 30.86 ? 177  THR B CB  1 
ATOM   3872 C CB  B THR B 1 176 ? 91.848  95.474  23.666  0.40 32.43 ? 177  THR B CB  1 
ATOM   3873 O OG1 A THR B 1 176 ? 90.455  92.237  22.474  0.60 26.19 ? 177  THR B OG1 1 
ATOM   3874 O OG1 B THR B 1 176 ? 90.578  94.822  23.713  0.40 30.19 ? 177  THR B OG1 1 
ATOM   3875 C CG2 A THR B 1 176 ? 91.676  94.252  23.045  0.60 32.26 ? 177  THR B CG2 1 
ATOM   3876 C CG2 B THR B 1 176 ? 91.791  96.747  24.498  0.40 33.05 ? 177  THR B CG2 1 
ATOM   3877 N N   A ALA B 1 177 ? 92.786  91.596  19.065  0.60 32.88 ? 178  ALA B N   1 
ATOM   3878 N N   B ALA B 1 177 ? 93.063  94.434  20.376  0.40 35.07 ? 178  ALA B N   1 
ATOM   3879 C CA  A ALA B 1 177 ? 92.741  90.395  18.250  0.60 35.14 ? 178  ALA B CA  1 
ATOM   3880 C CA  B ALA B 1 177 ? 93.111  93.260  19.514  0.40 35.30 ? 178  ALA B CA  1 
ATOM   3881 C C   A ALA B 1 177 ? 93.676  89.292  18.719  0.60 34.06 ? 178  ALA B C   1 
ATOM   3882 C C   B ALA B 1 177 ? 94.119  92.208  19.953  0.40 34.13 ? 178  ALA B C   1 
ATOM   3883 O O   A ALA B 1 177 ? 93.584  88.167  18.235  0.60 34.73 ? 178  ALA B O   1 
ATOM   3884 O O   B ALA B 1 177 ? 94.137  91.109  19.398  0.40 33.87 ? 178  ALA B O   1 
ATOM   3885 C CB  A ALA B 1 177 ? 93.042  90.764  16.779  0.60 34.84 ? 178  ALA B CB  1 
ATOM   3886 C CB  B ALA B 1 177 ? 93.397  93.691  18.075  0.40 36.32 ? 178  ALA B CB  1 
ATOM   3887 N N   A ASP B 1 178 ? 94.541  89.630  19.675  0.60 32.71 ? 179  ASP B N   1 
ATOM   3888 N N   B ASP B 1 178 ? 94.935  92.548  20.953  0.40 32.99 ? 179  ASP B N   1 
ATOM   3889 C CA  A ASP B 1 178 ? 95.562  88.738  20.229  0.60 34.08 ? 179  ASP B CA  1 
ATOM   3890 C CA  B ASP B 1 178 ? 95.982  91.665  21.487  0.40 33.84 ? 179  ASP B CA  1 
ATOM   3891 C C   A ASP B 1 178 ? 95.380  88.507  21.724  0.60 32.22 ? 179  ASP B C   1 
ATOM   3892 C C   B ASP B 1 178 ? 95.748  91.326  22.958  0.40 33.14 ? 179  ASP B C   1 
ATOM   3893 O O   A ASP B 1 178 ? 94.628  89.210  22.391  0.60 30.94 ? 179  ASP B O   1 
ATOM   3894 O O   B ASP B 1 178 ? 94.895  91.917  23.622  0.40 32.27 ? 179  ASP B O   1 
ATOM   3895 C CB  A ASP B 1 178 ? 96.968  89.371  20.055  0.60 34.30 ? 179  ASP B CB  1 
ATOM   3896 C CB  B ASP B 1 178 ? 97.369  92.348  21.413  0.40 34.54 ? 179  ASP B CB  1 
ATOM   3897 C CG  A ASP B 1 178 ? 97.482  89.315  18.637  0.60 37.38 ? 179  ASP B CG  1 
ATOM   3898 C CG  B ASP B 1 178 ? 97.960  92.377  20.009  0.40 36.67 ? 179  ASP B CG  1 
ATOM   3899 O OD1 A ASP B 1 178 ? 96.670  89.392  17.690  0.60 42.32 ? 179  ASP B OD1 1 
ATOM   3900 O OD1 B ASP B 1 178 ? 97.194  92.525  19.031  0.40 38.50 ? 179  ASP B OD1 1 
ATOM   3901 O OD2 A ASP B 1 178 ? 98.715  89.214  18.453  0.60 36.96 ? 179  ASP B OD2 1 
ATOM   3902 O OD2 B ASP B 1 178 ? 99.205  92.276  19.885  0.40 35.22 ? 179  ASP B OD2 1 
ATOM   3903 N N   A ASP B 1 179 ? 96.121  87.533  22.235  0.60 30.38 ? 180  ASP B N   1 
ATOM   3904 N N   B ASP B 1 179 ? 96.542  90.382  23.456  0.40 31.48 ? 180  ASP B N   1 
ATOM   3905 C CA  A ASP B 1 179 ? 96.141  87.215  23.654  0.60 29.80 ? 180  ASP B CA  1 
ATOM   3906 C CA  B ASP B 1 179 ? 96.507  89.972  24.858  0.40 31.56 ? 180  ASP B CA  1 
ATOM   3907 C C   A ASP B 1 179 ? 96.882  88.416  24.247  0.60 28.54 ? 180  ASP B C   1 
ATOM   3908 C C   B ASP B 1 179 ? 97.143  91.199  25.526  0.40 30.07 ? 180  ASP B C   1 
ATOM   3909 O O   A ASP B 1 179 ? 96.466  89.018  25.243  0.60 25.79 ? 180  ASP B O   1 
ATOM   3910 O O   B ASP B 1 179 ? 96.633  91.737  26.505  0.40 29.45 ? 180  ASP B O   1 
ATOM   3911 C CB  A ASP B 1 179 ? 96.959  85.938  23.851  0.60 35.32 ? 180  ASP B CB  1 
ATOM   3912 C CB  B ASP B 1 179 ? 97.395  88.728  25.049  0.40 34.51 ? 180  ASP B CB  1 
ATOM   3913 C CG  A ASP B 1 179 ? 96.938  85.432  25.280  0.60 40.86 ? 180  ASP B CG  1 
ATOM   3914 C CG  B ASP B 1 179 ? 97.265  88.091  26.437  0.40 38.72 ? 180  ASP B CG  1 
ATOM   3915 O OD1 A ASP B 1 179 ? 97.612  84.407  25.542  0.60 44.92 ? 180  ASP B OD1 1 
ATOM   3916 O OD1 B ASP B 1 179 ? 98.045  87.146  26.731  0.40 41.10 ? 180  ASP B OD1 1 
ATOM   3917 O OD2 A ASP B 1 179 ? 96.252  86.044  26.137  0.60 44.36 ? 180  ASP B OD2 1 
ATOM   3918 O OD2 B ASP B 1 179 ? 96.393  88.507  27.235  0.40 40.70 ? 180  ASP B OD2 1 
ATOM   3919 N N   A ALA B 1 180 ? 97.979  88.760  23.573  0.60 25.67 ? 181  ALA B N   1 
ATOM   3920 N N   B ALA B 1 180 ? 98.251  91.645  24.936  0.40 28.13 ? 181  ALA B N   1 
ATOM   3921 C CA  A ALA B 1 180 ? 98.848  89.877  23.922  0.60 24.85 ? 181  ALA B CA  1 
ATOM   3922 C CA  B ALA B 1 180 ? 99.006  92.805  25.397  0.40 28.07 ? 181  ALA B CA  1 
ATOM   3923 C C   A ALA B 1 180 ? 98.059  91.171  24.083  0.60 25.04 ? 181  ALA B C   1 
ATOM   3924 C C   B ALA B 1 180 ? 98.144  94.068  25.546  0.40 26.12 ? 181  ALA B C   1 
ATOM   3925 O O   A ALA B 1 180 ? 98.191  91.847  25.104  0.60 22.83 ? 181  ALA B O   1 
ATOM   3926 O O   B ALA B 1 180 ? 98.210  94.744  26.571  0.40 26.67 ? 181  ALA B O   1 
ATOM   3927 C CB  A ALA B 1 180 ? 99.916  90.055  22.850  0.60 19.39 ? 181  ALA B CB  1 
ATOM   3928 C CB  B ALA B 1 180 ? 100.177 93.081  24.431  0.40 26.72 ? 181  ALA B CB  1 
ATOM   3929 N N   A SER B 1 181 ? 97.241  91.508  23.083  0.60 24.44 ? 182  SER B N   1 
ATOM   3930 N N   B SER B 1 181 ? 97.341  94.384  24.532  0.40 24.64 ? 182  SER B N   1 
ATOM   3931 C CA  A SER B 1 181 ? 96.437  92.735  23.126  0.60 25.75 ? 182  SER B CA  1 
ATOM   3932 C CA  B SER B 1 181 ? 96.498  95.579  24.594  0.40 24.45 ? 182  SER B CA  1 
ATOM   3933 C C   A SER B 1 181 ? 95.432  92.750  24.263  0.60 25.04 ? 182  SER B C   1 
ATOM   3934 C C   B SER B 1 181 ? 95.434  95.466  25.692  0.40 25.94 ? 182  SER B C   1 
ATOM   3935 O O   A SER B 1 181 ? 95.180  93.800  24.871  0.60 23.98 ? 182  SER B O   1 
ATOM   3936 O O   B SER B 1 181 ? 95.089  96.464  26.330  0.40 24.44 ? 182  SER B O   1 
ATOM   3937 C CB  A SER B 1 181 ? 95.724  92.947  21.792  0.60 26.85 ? 182  SER B CB  1 
ATOM   3938 C CB  B SER B 1 181 ? 95.855  95.860  23.224  0.40 19.85 ? 182  SER B CB  1 
ATOM   3939 O OG  A SER B 1 181 ? 96.715  93.110  20.794  0.60 30.51 ? 182  SER B OG  1 
ATOM   3940 O OG  B SER B 1 181 ? 96.861  95.965  22.210  0.40 18.14 ? 182  SER B OG  1 
ATOM   3941 N N   A ARG B 1 182 ? 94.841  91.598  24.563  0.60 25.04 ? 183  ARG B N   1 
ATOM   3942 N N   B ARG B 1 182 ? 94.923  94.256  25.924  0.40 25.89 ? 183  ARG B N   1 
ATOM   3943 C CA  A ARG B 1 182 ? 93.903  91.543  25.676  0.60 26.52 ? 183  ARG B CA  1 
ATOM   3944 C CA  B ARG B 1 182 ? 93.937  94.062  26.979  0.40 28.30 ? 183  ARG B CA  1 
ATOM   3945 C C   A ARG B 1 182 ? 94.670  91.818  26.980  0.60 25.81 ? 183  ARG B C   1 
ATOM   3946 C C   B ARG B 1 182 ? 94.616  94.287  28.331  0.40 28.35 ? 183  ARG B C   1 
ATOM   3947 O O   A ARG B 1 182 ? 94.204  92.534  27.866  0.60 25.32 ? 183  ARG B O   1 
ATOM   3948 O O   B ARG B 1 182 ? 94.048  94.909  29.226  0.40 28.35 ? 183  ARG B O   1 
ATOM   3949 C CB  A ARG B 1 182 ? 93.215  90.169  25.737  0.60 29.47 ? 183  ARG B CB  1 
ATOM   3950 C CB  B ARG B 1 182 ? 93.353  92.651  26.919  0.40 30.67 ? 183  ARG B CB  1 
ATOM   3951 C CG  A ARG B 1 182 ? 91.841  90.151  25.076  0.60 34.25 ? 183  ARG B CG  1 
ATOM   3952 C CG  B ARG B 1 182 ? 92.000  92.561  26.228  0.40 34.56 ? 183  ARG B CG  1 
ATOM   3953 C CD  A ARG B 1 182 ? 91.647  88.958  24.149  0.60 37.49 ? 183  ARG B CD  1 
ATOM   3954 C CD  B ARG B 1 182 ? 91.994  91.467  25.183  0.40 36.25 ? 183  ARG B CD  1 
ATOM   3955 N NE  A ARG B 1 182 ? 92.098  87.689  24.727  0.60 38.31 ? 183  ARG B NE  1 
ATOM   3956 N NE  B ARG B 1 182 ? 92.473  90.189  25.702  0.40 37.93 ? 183  ARG B NE  1 
ATOM   3957 C CZ  A ARG B 1 182 ? 92.587  86.694  23.994  0.60 39.43 ? 183  ARG B CZ  1 
ATOM   3958 C CZ  B ARG B 1 182 ? 92.972  89.231  24.931  0.40 38.54 ? 183  ARG B CZ  1 
ATOM   3959 N NH1 A ARG B 1 182 ? 92.672  86.833  22.678  0.60 39.67 ? 183  ARG B NH1 1 
ATOM   3960 N NH1 B ARG B 1 182 ? 93.056  89.423  23.619  0.40 38.91 ? 183  ARG B NH1 1 
ATOM   3961 N NH2 A ARG B 1 182 ? 93.018  85.582  24.567  0.60 40.45 ? 183  ARG B NH2 1 
ATOM   3962 N NH2 B ARG B 1 182 ? 93.375  88.083  25.462  0.40 41.11 ? 183  ARG B NH2 1 
ATOM   3963 N N   A ALA B 1 183 ? 95.864  91.261  27.082  0.60 27.21 ? 184  ALA B N   1 
ATOM   3964 N N   B ALA B 1 183 ? 95.841  93.793  28.472  0.40 28.33 ? 184  ALA B N   1 
ATOM   3965 C CA  A ALA B 1 183 ? 96.692  91.447  28.273  0.60 27.28 ? 184  ALA B CA  1 
ATOM   3966 C CA  B ALA B 1 183 ? 96.573  93.958  29.721  0.40 26.80 ? 184  ALA B CA  1 
ATOM   3967 C C   A ALA B 1 183 ? 97.046  92.926  28.419  0.60 26.56 ? 184  ALA B C   1 
ATOM   3968 C C   B ALA B 1 183 ? 96.875  95.437  29.948  0.40 26.26 ? 184  ALA B C   1 
ATOM   3969 O O   A ALA B 1 183 ? 97.144  93.449  29.526  0.60 27.28 ? 184  ALA B O   1 
ATOM   3970 O O   B ALA B 1 183 ? 96.956  95.899  31.083  0.40 24.83 ? 184  ALA B O   1 
ATOM   3971 C CB  A ALA B 1 183 ? 97.971  90.615  28.149  0.60 27.13 ? 184  ALA B CB  1 
ATOM   3972 C CB  B ALA B 1 183 ? 97.876  93.150  29.685  0.40 28.34 ? 184  ALA B CB  1 
ATOM   3973 N N   A GLU B 1 184 ? 97.223  93.593  27.286  0.60 25.08 ? 185  GLU B N   1 
ATOM   3974 N N   B GLU B 1 184 ? 97.024  96.172  28.854  0.40 25.54 ? 185  GLU B N   1 
ATOM   3975 C CA  A GLU B 1 184 ? 97.587  95.007  27.259  0.60 25.94 ? 185  GLU B CA  1 
ATOM   3976 C CA  B GLU B 1 184 ? 97.320  97.596  28.901  0.40 25.64 ? 185  GLU B CA  1 
ATOM   3977 C C   A GLU B 1 184 ? 96.416  95.943  27.569  0.60 24.80 ? 185  GLU B C   1 
ATOM   3978 C C   B GLU B 1 184 ? 96.080  98.458  29.168  0.40 24.91 ? 185  GLU B C   1 
ATOM   3979 O O   A GLU B 1 184 ? 96.580  96.951  28.252  0.60 24.05 ? 185  GLU B O   1 
ATOM   3980 O O   B GLU B 1 184 ? 96.164  99.486  29.820  0.40 22.88 ? 185  GLU B O   1 
ATOM   3981 C CB  A GLU B 1 184 ? 98.165  95.359  25.883  0.60 25.95 ? 185  GLU B CB  1 
ATOM   3982 C CB  B GLU B 1 184 ? 97.969  98.020  27.582  0.40 26.53 ? 185  GLU B CB  1 
ATOM   3983 C CG  A GLU B 1 184 ? 98.610  96.818  25.752  0.60 27.52 ? 185  GLU B CG  1 
ATOM   3984 C CG  B GLU B 1 184 ? 98.329  99.490  27.513  0.40 26.99 ? 185  GLU B CG  1 
ATOM   3985 C CD  A GLU B 1 184 ? 99.793  97.160  26.656  0.60 28.19 ? 185  GLU B CD  1 
ATOM   3986 C CD  B GLU B 1 184 ? 99.316  99.879  28.567  0.40 25.88 ? 185  GLU B CD  1 
ATOM   3987 O OE1 A GLU B 1 184 ? 99.863  98.308  27.119  0.60 30.74 ? 185  GLU B OE1 1 
ATOM   3988 O OE1 B GLU B 1 184 ? 99.113  100.943 29.156  0.40 31.29 ? 185  GLU B OE1 1 
ATOM   3989 O OE2 A GLU B 1 184 ? 100.657 96.286  26.897  0.60 28.53 ? 185  GLU B OE2 1 
ATOM   3990 O OE2 B GLU B 1 184 ? 100.289 99.141  28.807  0.40 25.94 ? 185  GLU B OE2 1 
ATOM   3991 N N   A ALA B 1 185 ? 95.236  95.602  27.070  0.60 24.43 ? 186  ALA B N   1 
ATOM   3992 N N   B ALA B 1 185 ? 94.923  98.029  28.677  0.40 24.77 ? 186  ALA B N   1 
ATOM   3993 C CA  A ALA B 1 185 ? 94.043  96.420  27.267  0.60 23.61 ? 186  ALA B CA  1 
ATOM   3994 C CA  B ALA B 1 185 ? 93.705  98.808  28.875  0.40 23.79 ? 186  ALA B CA  1 
ATOM   3995 C C   A ALA B 1 185 ? 93.661  96.568  28.743  0.60 22.70 ? 186  ALA B C   1 
ATOM   3996 C C   B ALA B 1 185 ? 93.236  98.834  30.329  0.40 22.54 ? 186  ALA B C   1 
ATOM   3997 O O   A ALA B 1 185 ? 92.987  97.519  29.129  0.60 23.08 ? 186  ALA B O   1 
ATOM   3998 O O   B ALA B 1 185 ? 92.547  99.763  30.741  0.40 18.34 ? 186  ALA B O   1 
ATOM   3999 C CB  A ALA B 1 185 ? 92.865  95.817  26.476  0.60 22.25 ? 186  ALA B CB  1 
ATOM   4000 C CB  B ALA B 1 185 ? 92.592  98.283  27.973  0.40 24.25 ? 186  ALA B CB  1 
ATOM   4001 N N   A VAL B 1 186 ? 94.097  95.639  29.579  0.60 23.07 ? 187  VAL B N   1 
ATOM   4002 N N   B VAL B 1 186 ? 93.632  97.836  31.116  0.40 22.15 ? 187  VAL B N   1 
ATOM   4003 C CA  A VAL B 1 186 ? 93.732  95.716  30.987  0.60 22.51 ? 187  VAL B CA  1 
ATOM   4004 C CA  B VAL B 1 186 ? 93.183  97.792  32.511  0.40 23.52 ? 187  VAL B CA  1 
ATOM   4005 C C   A VAL B 1 186 ? 94.696  96.457  31.884  0.60 21.56 ? 187  VAL B C   1 
ATOM   4006 C C   B VAL B 1 186 ? 94.060  98.502  33.547  0.40 22.89 ? 187  VAL B C   1 
ATOM   4007 O O   A VAL B 1 186 ? 94.388  96.712  33.043  0.60 23.39 ? 187  VAL B O   1 
ATOM   4008 O O   B VAL B 1 186 ? 93.659  98.629  34.699  0.40 24.81 ? 187  VAL B O   1 
ATOM   4009 C CB  A VAL B 1 186 ? 93.523  94.308  31.587  0.60 22.28 ? 187  VAL B CB  1 
ATOM   4010 C CB  B VAL B 1 186 ? 92.969  96.340  32.991  0.40 21.72 ? 187  VAL B CB  1 
ATOM   4011 C CG1 A VAL B 1 186 ? 92.381  93.584  30.851  0.60 22.54 ? 187  VAL B CG1 1 
ATOM   4012 C CG1 B VAL B 1 186 ? 91.967  95.638  32.091  0.40 23.73 ? 187  VAL B CG1 1 
ATOM   4013 C CG2 A VAL B 1 186 ? 94.810  93.525  31.502  0.60 22.11 ? 187  VAL B CG2 1 
ATOM   4014 C CG2 B VAL B 1 186 ? 94.293  95.588  33.011  0.40 24.63 ? 187  VAL B CG2 1 
ATOM   4015 N N   A LYS B 1 187 ? 95.880  96.777  31.390  0.60 21.77 ? 188  LYS B N   1 
ATOM   4016 N N   B LYS B 1 187 ? 95.249  98.948  33.159  0.40 23.31 ? 188  LYS B N   1 
ATOM   4017 C CA  A LYS B 1 187 ? 96.845  97.484  32.237  0.60 20.87 ? 188  LYS B CA  1 
ATOM   4018 C CA  B LYS B 1 187 ? 96.117  99.631  34.114  0.40 23.10 ? 188  LYS B CA  1 
ATOM   4019 C C   A LYS B 1 187 ? 96.266  98.830  32.623  0.60 21.42 ? 188  LYS B C   1 
ATOM   4020 C C   B LYS B 1 187 ? 95.475  100.956 34.501  0.40 22.85 ? 188  LYS B C   1 
ATOM   4021 O O   A LYS B 1 187 ? 95.819  99.585  31.757  0.60 21.08 ? 188  LYS B O   1 
ATOM   4022 O O   B LYS B 1 187 ? 95.029  101.715 33.644  0.40 22.81 ? 188  LYS B O   1 
ATOM   4023 C CB  A LYS B 1 187 ? 98.180  97.653  31.497  0.60 19.81 ? 188  LYS B CB  1 
ATOM   4024 C CB  B LYS B 1 187 ? 97.505  99.843  33.508  0.40 23.39 ? 188  LYS B CB  1 
ATOM   4025 C CG  A LYS B 1 187 ? 98.806  96.286  31.167  0.60 22.14 ? 188  LYS B CG  1 
ATOM   4026 C CG  B LYS B 1 187 ? 98.153  98.546  33.033  0.40 23.73 ? 188  LYS B CG  1 
ATOM   4027 C CD  A LYS B 1 187 ? 100.173 96.360  30.528  0.60 25.58 ? 188  LYS B CD  1 
ATOM   4028 C CD  B LYS B 1 187 ? 99.607  98.729  32.630  0.40 24.08 ? 188  LYS B CD  1 
ATOM   4029 C CE  A LYS B 1 187 ? 100.743 94.936  30.398  0.60 26.26 ? 188  LYS B CE  1 
ATOM   4030 C CE  B LYS B 1 187 ? 100.193 97.411  32.117  0.40 26.14 ? 188  LYS B CE  1 
ATOM   4031 N NZ  A LYS B 1 187 ? 102.049 94.877  29.674  0.60 29.37 ? 188  LYS B NZ  1 
ATOM   4032 N NZ  B LYS B 1 187 ? 101.615 97.528  31.700  0.40 26.74 ? 188  LYS B NZ  1 
ATOM   4033 N N   A GLY B 1 188 ? 96.276  99.137  33.919  0.60 22.38 ? 189  GLY B N   1 
ATOM   4034 N N   B GLY B 1 188 ? 95.405  101.224 35.800  0.40 23.80 ? 189  GLY B N   1 
ATOM   4035 C CA  A GLY B 1 188 ? 95.723  100.403 34.365  0.60 21.68 ? 189  GLY B CA  1 
ATOM   4036 C CA  B GLY B 1 188 ? 94.784  102.459 36.254  0.40 23.54 ? 189  GLY B CA  1 
ATOM   4037 C C   A GLY B 1 188 ? 94.241  100.317 34.690  0.60 23.92 ? 189  GLY B C   1 
ATOM   4038 C C   B GLY B 1 188 ? 93.283  102.301 36.494  0.40 23.71 ? 189  GLY B C   1 
ATOM   4039 O O   A GLY B 1 188 ? 93.668  101.255 35.237  0.60 24.35 ? 189  GLY B O   1 
ATOM   4040 O O   B GLY B 1 188 ? 92.619  103.228 36.963  0.40 24.51 ? 189  GLY B O   1 
ATOM   4041 N N   A ALA B 1 189 ? 93.602  99.197  34.353  0.60 23.30 ? 190  ALA B N   1 
ATOM   4042 N N   B ALA B 1 189 ? 92.735  101.134 36.177  0.40 21.78 ? 190  ALA B N   1 
ATOM   4043 C CA  A ALA B 1 189 ? 92.177  99.035  34.651  0.60 21.53 ? 190  ALA B CA  1 
ATOM   4044 C CA  B ALA B 1 189 ? 91.310  100.908 36.374  0.40 22.18 ? 190  ALA B CA  1 
ATOM   4045 C C   A ALA B 1 189 ? 91.909  98.658  36.112  0.60 20.96 ? 190  ALA B C   1 
ATOM   4046 C C   B ALA B 1 189 ? 90.992  100.377 37.764  0.40 22.52 ? 190  ALA B C   1 
ATOM   4047 O O   A ALA B 1 189 ? 92.712  97.966  36.745  0.60 22.04 ? 190  ALA B O   1 
ATOM   4048 O O   B ALA B 1 189 ? 91.788  99.662  38.377  0.40 22.99 ? 190  ALA B O   1 
ATOM   4049 C CB  A ALA B 1 189 ? 91.553  97.985  33.720  0.60 21.41 ? 190  ALA B CB  1 
ATOM   4050 C CB  B ALA B 1 189 ? 90.761  99.954  35.308  0.40 22.71 ? 190  ALA B CB  1 
ATOM   4051 N N   A HIS B 1 190 ? 90.768  99.107  36.637  0.60 21.15 ? 191  HIS B N   1 
ATOM   4052 N N   B HIS B 1 190 ? 89.810  100.733 38.254  0.40 22.24 ? 191  HIS B N   1 
ATOM   4053 C CA  A HIS B 1 190 ? 90.379  98.800  38.015  0.60 24.22 ? 191  HIS B CA  1 
ATOM   4054 C CA  B HIS B 1 190 ? 89.357  100.302 39.565  0.40 22.75 ? 191  HIS B CA  1 
ATOM   4055 C C   A HIS B 1 190 ? 89.421  97.610  38.021  0.60 23.23 ? 191  HIS B C   1 
ATOM   4056 C C   B HIS B 1 190 ? 88.511  99.048  39.464  0.40 21.34 ? 191  HIS B C   1 
ATOM   4057 O O   A HIS B 1 190 ? 89.428  96.796  38.961  0.60 23.47 ? 191  HIS B O   1 
ATOM   4058 O O   B HIS B 1 190 ? 88.601  98.169  40.311  0.40 21.32 ? 191  HIS B O   1 
ATOM   4059 C CB  A HIS B 1 190 ? 89.684  100.000 38.668  0.60 26.28 ? 191  HIS B CB  1 
ATOM   4060 C CB  B HIS B 1 190 ? 88.554  101.426 40.230  0.40 25.80 ? 191  HIS B CB  1 
ATOM   4061 C CG  A HIS B 1 190 ? 90.571  101.197 38.809  0.60 31.89 ? 191  HIS B CG  1 
ATOM   4062 C CG  B HIS B 1 190 ? 89.367  102.654 40.494  0.40 31.56 ? 191  HIS B CG  1 
ATOM   4063 N ND1 A HIS B 1 190 ? 91.494  101.325 39.825  0.60 34.01 ? 191  HIS B ND1 1 
ATOM   4064 N ND1 B HIS B 1 190 ? 90.279  102.729 41.527  0.40 32.94 ? 191  HIS B ND1 1 
ATOM   4065 C CD2 A HIS B 1 190 ? 90.732  102.285 38.019  0.60 34.28 ? 191  HIS B CD2 1 
ATOM   4066 C CD2 B HIS B 1 190 ? 89.474  103.819 39.812  0.40 32.98 ? 191  HIS B CD2 1 
ATOM   4067 C CE1 A HIS B 1 190 ? 92.189  102.435 39.654  0.60 34.72 ? 191  HIS B CE1 1 
ATOM   4068 C CE1 B HIS B 1 190 ? 90.914  103.886 41.468  0.40 34.06 ? 191  HIS B CE1 1 
ATOM   4069 N NE2 A HIS B 1 190 ? 91.748  103.037 38.565  0.60 35.53 ? 191  HIS B NE2 1 
ATOM   4070 N NE2 B HIS B 1 190 ? 90.446  104.567 40.437  0.40 35.24 ? 191  HIS B NE2 1 
ATOM   4071 N N   A PHE B 1 191 ? 88.583  97.506  36.992  0.60 20.70 ? 192  PHE B N   1 
ATOM   4072 N N   B PHE B 1 191 ? 87.684  98.966  38.426  0.40 20.19 ? 192  PHE B N   1 
ATOM   4073 C CA  A PHE B 1 191 ? 87.635  96.392  36.938  0.60 21.84 ? 192  PHE B CA  1 
ATOM   4074 C CA  B PHE B 1 191 ? 86.825  97.800  38.247  0.40 20.27 ? 192  PHE B CA  1 
ATOM   4075 C C   A PHE B 1 191 ? 87.646  95.778  35.563  0.60 21.05 ? 192  PHE B C   1 
ATOM   4076 C C   B PHE B 1 191 ? 86.928  97.277  36.834  0.40 20.03 ? 192  PHE B C   1 
ATOM   4077 O O   A PHE B 1 191 ? 87.597  96.492  34.547  0.60 21.42 ? 192  PHE B O   1 
ATOM   4078 O O   B PHE B 1 191 ? 86.866  98.053  35.891  0.40 17.77 ? 192  PHE B O   1 
ATOM   4079 C CB  A PHE B 1 191 ? 86.217  96.873  37.277  0.60 21.35 ? 192  PHE B CB  1 
ATOM   4080 C CB  B PHE B 1 191 ? 85.371  98.164  38.540  0.40 21.50 ? 192  PHE B CB  1 
ATOM   4081 C CG  A PHE B 1 191 ? 86.157  97.748  38.481  0.60 20.82 ? 192  PHE B CG  1 
ATOM   4082 C CG  B PHE B 1 191 ? 85.201  98.979  39.785  0.40 22.10 ? 192  PHE B CG  1 
ATOM   4083 C CD1 A PHE B 1 191 ? 85.910  99.115  38.350  0.60 23.44 ? 192  PHE B CD1 1 
ATOM   4084 C CD1 B PHE B 1 191 ? 84.914  100.338 39.708  0.40 22.44 ? 192  PHE B CD1 1 
ATOM   4085 C CD2 A PHE B 1 191 ? 86.405  97.224  39.749  0.60 21.30 ? 192  PHE B CD2 1 
ATOM   4086 C CD2 B PHE B 1 191 ? 85.401  98.405  41.036  0.40 22.35 ? 192  PHE B CD2 1 
ATOM   4087 C CE1 A PHE B 1 191 ? 85.914  99.952  39.468  0.60 23.21 ? 192  PHE B CE1 1 
ATOM   4088 C CE1 B PHE B 1 191 ? 84.834  101.109 40.854  0.40 22.65 ? 192  PHE B CE1 1 
ATOM   4089 C CE2 A PHE B 1 191 ? 86.414  98.044  40.875  0.60 20.59 ? 192  PHE B CE2 1 
ATOM   4090 C CE2 B PHE B 1 191 ? 85.324  99.174  42.192  0.40 23.56 ? 192  PHE B CE2 1 
ATOM   4091 C CZ  A PHE B 1 191 ? 86.170  99.409  40.740  0.60 24.06 ? 192  PHE B CZ  1 
ATOM   4092 C CZ  B PHE B 1 191 ? 85.042  100.528 42.101  0.40 23.25 ? 192  PHE B CZ  1 
ATOM   4093 N N   A VAL B 1 192 ? 87.727  94.453  35.513  0.60 20.02 ? 193  VAL B N   1 
ATOM   4094 N N   B VAL B 1 192 ? 87.104  95.964  36.688  0.40 19.47 ? 193  VAL B N   1 
ATOM   4095 C CA  A VAL B 1 192 ? 87.712  93.785  34.227  0.60 20.15 ? 193  VAL B CA  1 
ATOM   4096 C CA  B VAL B 1 192 ? 87.169  95.379  35.359  0.40 21.00 ? 193  VAL B CA  1 
ATOM   4097 C C   A VAL B 1 192 ? 86.579  92.745  34.192  0.60 21.03 ? 193  VAL B C   1 
ATOM   4098 C C   B VAL B 1 192 ? 86.122  94.289  35.216  0.40 19.17 ? 193  VAL B C   1 
ATOM   4099 O O   A VAL B 1 192 ? 86.317  92.039  35.176  0.60 19.98 ? 193  VAL B O   1 
ATOM   4100 O O   B VAL B 1 192 ? 85.876  93.513  36.145  0.40 20.59 ? 193  VAL B O   1 
ATOM   4101 C CB  A VAL B 1 192 ? 89.072  93.108  33.875  0.60 20.53 ? 193  VAL B CB  1 
ATOM   4102 C CB  B VAL B 1 192 ? 88.561  94.767  35.007  0.40 20.64 ? 193  VAL B CB  1 
ATOM   4103 C CG1 A VAL B 1 192 ? 90.235  94.049  34.174  0.60 19.60 ? 193  VAL B CG1 1 
ATOM   4104 C CG1 B VAL B 1 192 ? 89.673  95.730  35.358  0.40 22.45 ? 193  VAL B CG1 1 
ATOM   4105 C CG2 A VAL B 1 192 ? 89.231  91.823  34.642  0.60 25.07 ? 193  VAL B CG2 1 
ATOM   4106 C CG2 B VAL B 1 192 ? 88.735  93.444  35.692  0.40 24.34 ? 193  VAL B CG2 1 
ATOM   4107 N N   A PHE B 1 193 ? 85.894  92.691  33.055  0.60 19.29 ? 194  PHE B N   1 
ATOM   4108 N N   B PHE B 1 193 ? 85.501  94.251  34.041  0.40 19.75 ? 194  PHE B N   1 
ATOM   4109 C CA  A PHE B 1 193 ? 84.804  91.744  32.856  0.60 22.21 ? 194  PHE B CA  1 
ATOM   4110 C CA  B PHE B 1 193 ? 84.476  93.266  33.728  0.40 21.50 ? 194  PHE B CA  1 
ATOM   4111 C C   A PHE B 1 193 ? 85.078  90.932  31.600  0.60 23.42 ? 194  PHE B C   1 
ATOM   4112 C C   B PHE B 1 193 ? 84.870  92.530  32.450  0.40 24.00 ? 194  PHE B C   1 
ATOM   4113 O O   A PHE B 1 193 ? 85.523  91.487  30.587  0.60 24.30 ? 194  PHE B O   1 
ATOM   4114 O O   B PHE B 1 193 ? 85.350  93.153  31.498  0.40 25.00 ? 194  PHE B O   1 
ATOM   4115 C CB  A PHE B 1 193 ? 83.468  92.482  32.651  0.60 21.48 ? 194  PHE B CB  1 
ATOM   4116 C CB  B PHE B 1 193 ? 83.118  93.941  33.468  0.40 20.42 ? 194  PHE B CB  1 
ATOM   4117 C CG  A PHE B 1 193 ? 82.930  93.158  33.871  0.60 19.74 ? 194  PHE B CG  1 
ATOM   4118 C CG  B PHE B 1 193 ? 82.453  94.522  34.690  0.40 19.59 ? 194  PHE B CG  1 
ATOM   4119 C CD1 A PHE B 1 193 ? 83.542  94.279  34.390  0.60 21.60 ? 194  PHE B CD1 1 
ATOM   4120 C CD1 B PHE B 1 193 ? 82.947  95.669  35.299  0.40 19.17 ? 194  PHE B CD1 1 
ATOM   4121 C CD2 A PHE B 1 193 ? 81.755  92.705  34.463  0.60 19.84 ? 194  PHE B CD2 1 
ATOM   4122 C CD2 B PHE B 1 193 ? 81.303  93.936  35.214  0.40 18.46 ? 194  PHE B CD2 1 
ATOM   4123 C CE1 A PHE B 1 193 ? 82.995  94.954  35.488  0.60 21.67 ? 194  PHE B CE1 1 
ATOM   4124 C CE1 B PHE B 1 193 ? 82.306  96.222  36.411  0.40 18.30 ? 194  PHE B CE1 1 
ATOM   4125 C CE2 A PHE B 1 193 ? 81.203  93.368  35.553  0.60 19.56 ? 194  PHE B CE2 1 
ATOM   4126 C CE2 B PHE B 1 193 ? 80.653  94.485  36.327  0.40 18.41 ? 194  PHE B CE2 1 
ATOM   4127 C CZ  A PHE B 1 193 ? 81.830  94.499  36.066  0.60 18.72 ? 194  PHE B CZ  1 
ATOM   4128 C CZ  B PHE B 1 193 ? 81.157  95.629  36.926  0.40 14.38 ? 194  PHE B CZ  1 
ATOM   4129 N N   A THR B 1 194 ? 84.812  89.626  31.656  0.60 24.89 ? 195  THR B N   1 
ATOM   4130 N N   B THR B 1 194 ? 84.685  91.210  32.433  0.40 23.02 ? 195  THR B N   1 
ATOM   4131 C CA  A THR B 1 194 ? 84.982  88.757  30.488  0.60 25.21 ? 195  THR B CA  1 
ATOM   4132 C CA  B THR B 1 194 ? 84.951  90.433  31.230  0.40 25.36 ? 195  THR B CA  1 
ATOM   4133 C C   A THR B 1 194 ? 83.604  88.195  30.117  0.60 26.38 ? 195  THR B C   1 
ATOM   4134 C C   B THR B 1 194 ? 83.621  89.856  30.743  0.40 24.52 ? 195  THR B C   1 
ATOM   4135 O O   A THR B 1 194 ? 82.935  87.562  30.937  0.60 25.85 ? 195  THR B O   1 
ATOM   4136 O O   B THR B 1 194 ? 82.916  89.159  31.482  0.40 23.20 ? 195  THR B O   1 
ATOM   4137 C CB  A THR B 1 194 ? 85.963  87.595  30.737  0.60 27.02 ? 195  THR B CB  1 
ATOM   4138 C CB  B THR B 1 194 ? 85.973  89.288  31.474  0.40 25.30 ? 195  THR B CB  1 
ATOM   4139 O OG1 A THR B 1 194 ? 85.600  86.893  31.931  0.60 27.88 ? 195  THR B OG1 1 
ATOM   4140 O OG1 B THR B 1 194 ? 85.571  88.498  32.604  0.40 24.97 ? 195  THR B OG1 1 
ATOM   4141 C CG2 A THR B 1 194 ? 87.417  88.136  30.864  0.60 27.46 ? 195  THR B CG2 1 
ATOM   4142 C CG2 B THR B 1 194 ? 87.367  89.876  31.731  0.40 26.69 ? 195  THR B CG2 1 
ATOM   4143 N N   A ALA B 1 195 ? 83.174  88.483  28.889  0.60 26.70 ? 196  ALA B N   1 
ATOM   4144 N N   B ALA B 1 195 ? 83.265  90.179  29.503  0.40 26.38 ? 196  ALA B N   1 
ATOM   4145 C CA  A ALA B 1 195 ? 81.875  88.053  28.396  0.60 26.86 ? 196  ALA B CA  1 
ATOM   4146 C CA  B ALA B 1 195 ? 82.019  89.693  28.919  0.40 26.35 ? 196  ALA B CA  1 
ATOM   4147 C C   A ALA B 1 195 ? 82.063  87.335  27.061  0.60 28.23 ? 196  ALA B C   1 
ATOM   4148 C C   B ALA B 1 195 ? 82.290  89.097  27.555  0.40 27.44 ? 196  ALA B C   1 
ATOM   4149 O O   A ALA B 1 195 ? 81.316  87.565  26.112  0.60 27.19 ? 196  ALA B O   1 
ATOM   4150 O O   B ALA B 1 195 ? 81.561  89.366  26.597  0.40 27.66 ? 196  ALA B O   1 
ATOM   4151 C CB  A ALA B 1 195 ? 80.979  89.267  28.219  0.60 26.04 ? 196  ALA B CB  1 
ATOM   4152 C CB  B ALA B 1 195 ? 81.033  90.833  28.791  0.40 26.06 ? 196  ALA B CB  1 
ATOM   4153 N N   A GLY B 1 196 ? 83.058  86.453  27.003  0.60 28.48 ? 197  GLY B N   1 
ATOM   4154 N N   B GLY B 1 196 ? 83.340  88.289  27.471  0.40 28.30 ? 197  GLY B N   1 
ATOM   4155 C CA  A GLY B 1 196 ? 83.356  85.744  25.771  0.60 29.97 ? 197  GLY B CA  1 
ATOM   4156 C CA  B GLY B 1 196 ? 83.706  87.680  26.207  0.40 29.27 ? 197  GLY B CA  1 
ATOM   4157 C C   A GLY B 1 196 ? 82.570  84.468  25.532  0.60 31.43 ? 197  GLY B C   1 
ATOM   4158 C C   B GLY B 1 196 ? 83.028  86.357  25.887  0.40 30.02 ? 197  GLY B C   1 
ATOM   4159 O O   A GLY B 1 196 ? 81.655  84.159  26.277  0.60 31.01 ? 197  GLY B O   1 
ATOM   4160 O O   B GLY B 1 196 ? 82.148  85.891  26.613  0.40 28.99 ? 197  GLY B O   1 
ATOM   4161 N N   A ALA B 1 197 ? 82.946  83.729  24.488  0.60 33.05 ? 198  ALA B N   1 
ATOM   4162 N N   B ALA B 1 197 ? 83.453  85.760  24.779  0.40 31.04 ? 198  ALA B N   1 
ATOM   4163 C CA  A ALA B 1 197 ? 82.267  82.480  24.131  0.60 33.19 ? 198  ALA B CA  1 
ATOM   4164 C CA  B ALA B 1 197 ? 82.922  84.485  24.298  0.40 32.15 ? 198  ALA B CA  1 
ATOM   4165 C C   A ALA B 1 197 ? 82.455  81.417  25.217  0.60 33.53 ? 198  ALA B C   1 
ATOM   4166 C C   B ALA B 1 197 ? 83.118  83.410  25.356  0.40 31.65 ? 198  ALA B C   1 
ATOM   4167 O O   A ALA B 1 197 ? 83.417  81.441  25.986  0.60 30.38 ? 198  ALA B O   1 
ATOM   4168 O O   B ALA B 1 197 ? 83.998  83.532  26.193  0.40 31.28 ? 198  ALA B O   1 
ATOM   4169 C CB  A ALA B 1 197 ? 82.794  81.960  22.786  0.60 33.66 ? 198  ALA B CB  1 
ATOM   4170 C CB  B ALA B 1 197 ? 83.633  84.087  23.008  0.40 31.54 ? 198  ALA B CB  1 
ATOM   4171 N N   A ILE B 1 198 ? 81.531  80.467  25.273  0.60 33.93 ? 199  ILE B N   1 
ATOM   4172 N N   B ILE B 1 198 ? 82.294  82.366  25.315  0.40 32.25 ? 199  ILE B N   1 
ATOM   4173 C CA  A ILE B 1 198 ? 81.619  79.429  26.275  0.60 32.59 ? 199  ILE B CA  1 
ATOM   4174 C CA  B ILE B 1 198 ? 82.380  81.273  26.283  0.40 32.22 ? 199  ILE B CA  1 
ATOM   4175 C C   A ILE B 1 198 ? 82.864  78.556  26.079  0.60 31.34 ? 199  ILE B C   1 
ATOM   4176 C C   B ILE B 1 198 ? 83.650  80.453  26.089  0.40 32.06 ? 199  ILE B C   1 
ATOM   4177 O O   A ILE B 1 198 ? 83.228  78.214  24.959  0.60 30.44 ? 199  ILE B O   1 
ATOM   4178 O O   B ILE B 1 198 ? 84.012  80.116  24.962  0.40 32.17 ? 199  ILE B O   1 
ATOM   4179 C CB  A ILE B 1 198 ? 80.338  78.579  26.256  0.60 33.91 ? 199  ILE B CB  1 
ATOM   4180 C CB  B ILE B 1 198 ? 81.139  80.348  26.166  0.40 32.76 ? 199  ILE B CB  1 
ATOM   4181 C CG1 A ILE B 1 198 ? 79.124  79.506  26.374  0.60 36.30 ? 199  ILE B CG1 1 
ATOM   4182 C CG1 B ILE B 1 198 ? 79.867  81.189  26.330  0.40 33.65 ? 199  ILE B CG1 1 
ATOM   4183 C CG2 A ILE B 1 198 ? 80.339  77.617  27.420  0.60 34.11 ? 199  ILE B CG2 1 
ATOM   4184 C CG2 B ILE B 1 198 ? 81.197  79.248  27.215  0.40 33.01 ? 199  ILE B CG2 1 
ATOM   4185 C CD1 A ILE B 1 198 ? 77.788  78.805  26.484  0.60 39.00 ? 199  ILE B CD1 1 
ATOM   4186 C CD1 B ILE B 1 198 ? 78.574  80.394  26.340  0.40 35.93 ? 199  ILE B CD1 1 
ATOM   4187 N N   A GLY B 1 199 ? 83.548  78.245  27.177  0.60 31.70 ? 200  GLY B N   1 
ATOM   4188 N N   B GLY B 1 199 ? 84.333  80.147  27.190  0.40 32.38 ? 200  GLY B N   1 
ATOM   4189 C CA  A GLY B 1 199 ? 84.730  77.396  27.103  0.60 32.22 ? 200  GLY B CA  1 
ATOM   4190 C CA  B GLY B 1 199 ? 85.545  79.348  27.116  0.40 32.11 ? 200  GLY B CA  1 
ATOM   4191 C C   A GLY B 1 199 ? 85.969  77.998  26.461  0.60 33.67 ? 200  GLY B C   1 
ATOM   4192 C C   B GLY B 1 199 ? 86.783  80.054  26.594  0.40 32.85 ? 200  GLY B C   1 
ATOM   4193 O O   A GLY B 1 199 ? 86.774  77.278  25.853  0.60 31.83 ? 200  GLY B O   1 
ATOM   4194 O O   B GLY B 1 199 ? 87.680  79.421  26.028  0.40 32.64 ? 200  GLY B O   1 
ATOM   4195 N N   A LEU B 1 200 ? 86.120  79.315  26.589  0.60 32.56 ? 201  LEU B N   1 
ATOM   4196 N N   B LEU B 1 200 ? 86.838  81.367  26.781  0.40 32.59 ? 201  LEU B N   1 
ATOM   4197 C CA  A LEU B 1 200 ? 87.276  80.018  26.037  0.60 33.89 ? 201  LEU B CA  1 
ATOM   4198 C CA  B LEU B 1 200 ? 87.983  82.151  26.341  0.40 34.01 ? 201  LEU B CA  1 
ATOM   4199 C C   A LEU B 1 200 ? 87.862  80.950  27.091  0.60 34.26 ? 201  LEU B C   1 
ATOM   4200 C C   B LEU B 1 200 ? 88.469  83.009  27.505  0.40 33.50 ? 201  LEU B C   1 
ATOM   4201 O O   A LEU B 1 200 ? 87.128  81.660  27.786  0.60 31.97 ? 201  LEU B O   1 
ATOM   4202 O O   B LEU B 1 200 ? 87.669  83.553  28.265  0.40 31.80 ? 201  LEU B O   1 
ATOM   4203 C CB  A LEU B 1 200 ? 86.879  80.837  24.805  0.60 35.06 ? 201  LEU B CB  1 
ATOM   4204 C CB  B LEU B 1 200 ? 87.600  83.045  25.154  0.40 34.65 ? 201  LEU B CB  1 
ATOM   4205 C CG  A LEU B 1 200 ? 87.988  81.703  24.198  0.60 37.39 ? 201  LEU B CG  1 
ATOM   4206 C CG  B LEU B 1 200 ? 88.697  83.969  24.604  0.40 37.05 ? 201  LEU B CG  1 
ATOM   4207 C CD1 A LEU B 1 200 ? 89.124  80.813  23.677  0.60 37.69 ? 201  LEU B CD1 1 
ATOM   4208 C CD1 B LEU B 1 200 ? 89.869  83.140  24.086  0.40 36.62 ? 201  LEU B CD1 1 
ATOM   4209 C CD2 A LEU B 1 200 ? 87.402  82.560  23.076  0.60 38.23 ? 201  LEU B CD2 1 
ATOM   4210 C CD2 B LEU B 1 200 ? 88.126  84.841  23.488  0.40 37.43 ? 201  LEU B CD2 1 
ATOM   4211 N N   A GLU B 1 201 ? 89.185  80.938  27.217  0.60 33.61 ? 202  GLU B N   1 
ATOM   4212 N N   B GLU B 1 201 ? 89.783  83.114  27.660  0.40 33.26 ? 202  GLU B N   1 
ATOM   4213 C CA  A GLU B 1 201 ? 89.853  81.804  28.178  0.60 34.68 ? 202  GLU B CA  1 
ATOM   4214 C CA  B GLU B 1 201 ? 90.327  83.929  28.735  0.40 33.83 ? 202  GLU B CA  1 
ATOM   4215 C C   A GLU B 1 201 ? 90.238  83.095  27.491  0.60 33.51 ? 202  GLU B C   1 
ATOM   4216 C C   B GLU B 1 201 ? 90.693  85.291  28.160  0.40 33.76 ? 202  GLU B C   1 
ATOM   4217 O O   A GLU B 1 201 ? 90.817  83.070  26.416  0.60 34.33 ? 202  GLU B O   1 
ATOM   4218 O O   B GLU B 1 201 ? 91.342  85.377  27.124  0.40 31.51 ? 202  GLU B O   1 
ATOM   4219 C CB  A GLU B 1 201 ? 91.125  81.146  28.724  0.60 35.80 ? 202  GLU B CB  1 
ATOM   4220 C CB  B GLU B 1 201 ? 91.570  83.275  29.342  0.40 35.33 ? 202  GLU B CB  1 
ATOM   4221 C CG  A GLU B 1 201 ? 91.883  82.019  29.716  0.60 35.47 ? 202  GLU B CG  1 
ATOM   4222 C CG  B GLU B 1 201 ? 92.253  84.149  30.384  0.40 37.41 ? 202  GLU B CG  1 
ATOM   4223 C CD  A GLU B 1 201 ? 93.173  81.367  30.208  0.60 37.35 ? 202  GLU B CD  1 
ATOM   4224 C CD  B GLU B 1 201 ? 93.546  83.550  30.904  0.40 37.92 ? 202  GLU B CD  1 
ATOM   4225 O OE1 A GLU B 1 201 ? 94.140  81.250  29.410  0.60 37.89 ? 202  GLU B OE1 1 
ATOM   4226 O OE1 B GLU B 1 201 ? 94.512  83.449  30.117  0.40 39.27 ? 202  GLU B OE1 1 
ATOM   4227 O OE2 A GLU B 1 201 ? 93.214  80.966  31.388  0.60 34.57 ? 202  GLU B OE2 1 
ATOM   4228 O OE2 B GLU B 1 201 ? 93.591  83.178  32.098  0.40 37.43 ? 202  GLU B OE2 1 
ATOM   4229 N N   A LEU B 1 202 ? 89.926  84.221  28.120  0.60 33.41 ? 203  LEU B N   1 
ATOM   4230 N N   B LEU B 1 202 ? 90.267  86.355  28.830  0.40 33.11 ? 203  LEU B N   1 
ATOM   4231 C CA  A LEU B 1 202 ? 90.263  85.530  27.563  0.60 34.02 ? 203  LEU B CA  1 
ATOM   4232 C CA  B LEU B 1 202 ? 90.571  87.697  28.361  0.40 33.78 ? 203  LEU B CA  1 
ATOM   4233 C C   A LEU B 1 202 ? 91.380  86.193  28.354  0.60 32.70 ? 203  LEU B C   1 
ATOM   4234 C C   B LEU B 1 202 ? 91.620  88.361  29.243  0.40 32.57 ? 203  LEU B C   1 
ATOM   4235 O O   A LEU B 1 202 ? 92.196  86.923  27.798  0.60 31.39 ? 203  LEU B O   1 
ATOM   4236 O O   B LEU B 1 202 ? 92.443  89.135  28.760  0.40 33.34 ? 203  LEU B O   1 
ATOM   4237 C CB  A LEU B 1 202 ? 89.037  86.454  27.568  0.60 36.37 ? 203  LEU B CB  1 
ATOM   4238 C CB  B LEU B 1 202 ? 89.303  88.553  28.335  0.40 34.97 ? 203  LEU B CB  1 
ATOM   4239 C CG  A LEU B 1 202 ? 88.130  86.513  26.331  0.60 38.88 ? 203  LEU B CG  1 
ATOM   4240 C CG  B LEU B 1 202 ? 88.431  88.596  27.076  0.40 36.67 ? 203  LEU B CG  1 
ATOM   4241 C CD1 A LEU B 1 202 ? 88.867  87.218  25.193  0.60 40.65 ? 203  LEU B CD1 1 
ATOM   4242 C CD1 B LEU B 1 202 ? 89.144  89.375  25.986  0.40 38.43 ? 203  LEU B CD1 1 
ATOM   4243 C CD2 A LEU B 1 202 ? 87.716  85.127  25.916  0.60 39.93 ? 203  LEU B CD2 1 
ATOM   4244 C CD2 B LEU B 1 202 ? 88.093  87.194  26.619  0.40 39.31 ? 203  LEU B CD2 1 
ATOM   4245 N N   A LEU B 1 203 ? 91.421  85.939  29.658  0.60 32.05 ? 204  LEU B N   1 
ATOM   4246 N N   B LEU B 1 203 ? 91.607  88.045  30.534  0.40 31.25 ? 204  LEU B N   1 
ATOM   4247 C CA  A LEU B 1 203 ? 92.450  86.560  30.477  0.60 31.12 ? 204  LEU B CA  1 
ATOM   4248 C CA  B LEU B 1 203 ? 92.560  88.658  31.442  0.40 30.89 ? 204  LEU B CA  1 
ATOM   4249 C C   A LEU B 1 203 ? 93.129  85.578  31.424  0.60 30.04 ? 204  LEU B C   1 
ATOM   4250 C C   B LEU B 1 203 ? 93.263  87.655  32.350  0.40 30.02 ? 204  LEU B C   1 
ATOM   4251 O O   A LEU B 1 203 ? 92.606  85.270  32.490  0.60 29.52 ? 204  LEU B O   1 
ATOM   4252 O O   B LEU B 1 203 ? 92.717  87.243  33.377  0.40 29.35 ? 204  LEU B O   1 
ATOM   4253 C CB  A LEU B 1 203 ? 91.832  87.719  31.253  0.60 30.87 ? 204  LEU B CB  1 
ATOM   4254 C CB  B LEU B 1 203 ? 91.843  89.704  32.292  0.40 31.86 ? 204  LEU B CB  1 
ATOM   4255 C CG  A LEU B 1 203 ? 92.794  88.819  31.683  0.60 32.27 ? 204  LEU B CG  1 
ATOM   4256 C CG  B LEU B 1 203 ? 92.702  90.863  32.804  0.40 32.75 ? 204  LEU B CG  1 
ATOM   4257 C CD1 A LEU B 1 203 ? 92.013  89.894  32.387  0.60 33.51 ? 204  LEU B CD1 1 
ATOM   4258 C CD1 B LEU B 1 203 ? 91.810  91.918  33.426  0.40 32.84 ? 204  LEU B CD1 1 
ATOM   4259 C CD2 A LEU B 1 203 ? 93.853  88.252  32.609  0.60 34.40 ? 204  LEU B CD2 1 
ATOM   4260 C CD2 B LEU B 1 203 ? 93.719  90.355  33.808  0.40 32.67 ? 204  LEU B CD2 1 
ATOM   4261 N N   A PRO B 1 204 ? 94.312  85.076  31.037  0.60 28.91 ? 205  PRO B N   1 
ATOM   4262 N N   B PRO B 1 204 ? 94.501  87.269  31.993  0.40 28.45 ? 205  PRO B N   1 
ATOM   4263 C CA  A PRO B 1 204 ? 95.084  84.124  31.843  0.60 27.77 ? 205  PRO B CA  1 
ATOM   4264 C CA  B PRO B 1 204 ? 95.284  86.311  32.783  0.40 28.39 ? 205  PRO B CA  1 
ATOM   4265 C C   A PRO B 1 204 ? 95.463  84.685  33.210  0.60 27.40 ? 205  PRO B C   1 
ATOM   4266 C C   B PRO B 1 204 ? 95.579  86.822  34.193  0.40 27.27 ? 205  PRO B C   1 
ATOM   4267 O O   A PRO B 1 204 ? 95.568  85.895  33.394  0.60 26.71 ? 205  PRO B O   1 
ATOM   4268 O O   B PRO B 1 204 ? 95.626  88.028  34.433  0.40 27.16 ? 205  PRO B O   1 
ATOM   4269 C CB  A PRO B 1 204 ? 96.303  83.827  30.964  0.60 28.01 ? 205  PRO B CB  1 
ATOM   4270 C CB  B PRO B 1 204 ? 96.555  86.128  31.948  0.40 28.09 ? 205  PRO B CB  1 
ATOM   4271 C CG  A PRO B 1 204 ? 96.454  85.102  30.155  0.60 29.80 ? 205  PRO B CG  1 
ATOM   4272 C CG  B PRO B 1 204 ? 96.707  87.460  31.278  0.40 29.83 ? 205  PRO B CG  1 
ATOM   4273 C CD  A PRO B 1 204 ? 95.029  85.432  29.796  0.60 27.90 ? 205  PRO B CD  1 
ATOM   4274 C CD  B PRO B 1 204 ? 95.285  87.771  30.851  0.40 28.85 ? 205  PRO B CD  1 
ATOM   4275 N N   A GLN B 1 205 ? 95.669  83.796  34.166  0.60 26.35 ? 206  GLN B N   1 
ATOM   4276 N N   B GLN B 1 205 ? 95.769  85.894  35.122  0.40 27.49 ? 206  GLN B N   1 
ATOM   4277 C CA  A GLN B 1 205 ? 96.021  84.197  35.511  0.60 27.06 ? 206  GLN B CA  1 
ATOM   4278 C CA  B GLN B 1 205 ? 96.057  86.242  36.510  0.40 26.96 ? 206  GLN B CA  1 
ATOM   4279 C C   A GLN B 1 205 ? 97.161  85.242  35.515  0.60 28.27 ? 206  GLN B C   1 
ATOM   4280 C C   B GLN B 1 205 ? 97.114  87.352  36.610  0.40 25.73 ? 206  GLN B C   1 
ATOM   4281 O O   A GLN B 1 205 ? 97.040  86.311  36.123  0.60 27.91 ? 206  GLN B O   1 
ATOM   4282 O O   B GLN B 1 205 ? 96.890  88.381  37.230  0.40 23.65 ? 206  GLN B O   1 
ATOM   4283 C CB  A GLN B 1 205 ? 96.421  82.947  36.295  0.60 27.20 ? 206  GLN B CB  1 
ATOM   4284 C CB  B GLN B 1 205 ? 96.548  84.996  37.243  0.40 29.29 ? 206  GLN B CB  1 
ATOM   4285 C CG  A GLN B 1 205 ? 96.269  83.031  37.791  0.60 30.40 ? 206  GLN B CG  1 
ATOM   4286 C CG  B GLN B 1 205 ? 96.395  85.013  38.742  0.40 32.43 ? 206  GLN B CG  1 
ATOM   4287 C CD  A GLN B 1 205 ? 96.705  81.745  38.483  0.60 32.80 ? 206  GLN B CD  1 
ATOM   4288 C CD  B GLN B 1 205 ? 96.844  83.703  39.366  0.40 33.16 ? 206  GLN B CD  1 
ATOM   4289 O OE1 A GLN B 1 205 ? 96.479  81.557  39.677  0.60 34.23 ? 206  GLN B OE1 1 
ATOM   4290 O OE1 B GLN B 1 205 ? 96.494  83.395  40.498  0.40 35.88 ? 206  GLN B OE1 1 
ATOM   4291 N NE2 A GLN B 1 205 ? 97.343  80.853  37.728  0.60 34.98 ? 206  GLN B NE2 1 
ATOM   4292 N NE2 B GLN B 1 205 ? 97.630  82.927  38.624  0.40 33.65 ? 206  GLN B NE2 1 
ATOM   4293 N N   A ALA B 1 206 ? 98.264  84.936  34.836  0.60 28.66 ? 207  ALA B N   1 
ATOM   4294 N N   B ALA B 1 206 ? 98.265  87.150  35.987  0.40 25.77 ? 207  ALA B N   1 
ATOM   4295 C CA  A ALA B 1 206 ? 99.390  85.859  34.789  0.60 30.86 ? 207  ALA B CA  1 
ATOM   4296 C CA  B ALA B 1 206 ? 99.324  88.154  36.057  0.40 25.97 ? 207  ALA B CA  1 
ATOM   4297 C C   A ALA B 1 206 ? 99.061  87.231  34.175  0.60 31.47 ? 207  ALA B C   1 
ATOM   4298 C C   B ALA B 1 206 ? 98.927  89.542  35.527  0.40 26.16 ? 207  ALA B C   1 
ATOM   4299 O O   A ALA B 1 206 ? 99.864  88.150  34.254  0.60 32.78 ? 207  ALA B O   1 
ATOM   4300 O O   B ALA B 1 206 ? 99.623  90.519  35.761  0.40 23.49 ? 207  ALA B O   1 
ATOM   4301 C CB  A ALA B 1 206 ? 100.541 85.230  34.033  0.60 30.93 ? 207  ALA B CB  1 
ATOM   4302 C CB  B ALA B 1 206 ? 100.556 87.647  35.330  0.40 28.43 ? 207  ALA B CB  1 
ATOM   4303 N N   A ALA B 1 207 ? 97.892  87.384  33.568  0.60 30.48 ? 208  ALA B N   1 
ATOM   4304 N N   B ALA B 1 207 ? 97.798  89.638  34.828  0.40 26.59 ? 208  ALA B N   1 
ATOM   4305 C CA  A ALA B 1 207 ? 97.579  88.668  32.972  0.60 30.13 ? 208  ALA B CA  1 
ATOM   4306 C CA  B ALA B 1 207 ? 97.379  90.923  34.279  0.40 25.58 ? 208  ALA B CA  1 
ATOM   4307 C C   A ALA B 1 207 ? 96.762  89.606  33.863  0.60 29.58 ? 208  ALA B C   1 
ATOM   4308 C C   B ALA B 1 207 ? 96.461  91.760  35.179  0.40 26.10 ? 208  ALA B C   1 
ATOM   4309 O O   A ALA B 1 207 ? 96.559  90.770  33.497  0.60 29.79 ? 208  ALA B O   1 
ATOM   4310 O O   B ALA B 1 207 ? 96.175  92.923  34.865  0.40 25.45 ? 208  ALA B O   1 
ATOM   4311 C CB  A ALA B 1 207 ? 96.880  88.469  31.639  0.60 30.28 ? 208  ALA B CB  1 
ATOM   4312 C CB  B ALA B 1 207 ? 96.725  90.711  32.906  0.40 27.12 ? 208  ALA B CB  1 
ATOM   4313 N N   A TRP B 1 208 ? 96.284  89.125  35.012  0.60 24.25 ? 209  TRP B N   1 
ATOM   4314 N N   B TRP B 1 208 ? 95.980  91.192  36.284  0.40 25.47 ? 209  TRP B N   1 
ATOM   4315 C CA  A TRP B 1 208 ? 95.517  90.000  35.883  0.60 23.92 ? 209  TRP B CA  1 
ATOM   4316 C CA  B TRP B 1 208 ? 95.131  91.982  37.177  0.40 25.51 ? 209  TRP B CA  1 
ATOM   4317 C C   A TRP B 1 208 ? 96.038  90.076  37.316  0.60 24.20 ? 209  TRP B C   1 
ATOM   4318 C C   B TRP B 1 208 ? 95.585  92.000  38.638  0.40 25.85 ? 209  TRP B C   1 
ATOM   4319 O O   A TRP B 1 208 ? 95.984  91.133  37.943  0.60 24.02 ? 209  TRP B O   1 
ATOM   4320 O O   B TRP B 1 208 ? 95.391  92.997  39.324  0.40 25.75 ? 209  TRP B O   1 
ATOM   4321 C CB  A TRP B 1 208 ? 93.999  89.641  35.858  0.60 23.88 ? 209  TRP B CB  1 
ATOM   4322 C CB  B TRP B 1 208 ? 93.649  91.549  37.096  0.40 25.38 ? 209  TRP B CB  1 
ATOM   4323 C CG  A TRP B 1 208 ? 93.597  88.299  36.381  0.60 23.37 ? 209  TRP B CG  1 
ATOM   4324 C CG  B TRP B 1 208 ? 93.326  90.124  37.499  0.40 23.72 ? 209  TRP B CG  1 
ATOM   4325 C CD1 A TRP B 1 208 ? 93.545  87.129  35.680  0.60 24.87 ? 209  TRP B CD1 1 
ATOM   4326 C CD1 B TRP B 1 208 ? 93.430  89.004  36.718  0.40 23.95 ? 209  TRP B CD1 1 
ATOM   4327 C CD2 A TRP B 1 208 ? 93.154  87.990  37.711  0.60 24.29 ? 209  TRP B CD2 1 
ATOM   4328 C CD2 B TRP B 1 208 ? 92.818  89.679  38.767  0.40 24.02 ? 209  TRP B CD2 1 
ATOM   4329 N NE1 A TRP B 1 208 ? 93.100  86.109  36.491  0.60 26.25 ? 209  TRP B NE1 1 
ATOM   4330 N NE1 B TRP B 1 208 ? 93.015  87.900  37.419  0.40 23.65 ? 209  TRP B NE1 1 
ATOM   4331 C CE2 A TRP B 1 208 ? 92.852  86.606  37.742  0.60 24.84 ? 209  TRP B CE2 1 
ATOM   4332 C CE2 B TRP B 1 208 ? 92.636  88.284  38.679  0.40 23.70 ? 209  TRP B CE2 1 
ATOM   4333 C CE3 A TRP B 1 208 ? 92.985  88.745  38.880  0.60 22.58 ? 209  TRP B CE3 1 
ATOM   4334 C CE3 B TRP B 1 208 ? 92.497  90.327  39.970  0.40 23.94 ? 209  TRP B CE3 1 
ATOM   4335 C CZ2 A TRP B 1 208 ? 92.391  85.959  38.896  0.60 25.15 ? 209  TRP B CZ2 1 
ATOM   4336 C CZ2 B TRP B 1 208 ? 92.146  87.518  39.754  0.40 25.96 ? 209  TRP B CZ2 1 
ATOM   4337 C CZ3 A TRP B 1 208 ? 92.524  88.097  40.040  0.60 26.81 ? 209  TRP B CZ3 1 
ATOM   4338 C CZ3 B TRP B 1 208 ? 92.010  89.567  41.040  0.40 24.79 ? 209  TRP B CZ3 1 
ATOM   4339 C CH2 A TRP B 1 208 ? 92.232  86.713  40.035  0.60 23.17 ? 209  TRP B CH2 1 
ATOM   4340 C CH2 B TRP B 1 208 ? 91.840  88.179  40.923  0.40 24.76 ? 209  TRP B CH2 1 
ATOM   4341 N N   A GLN B 1 209 ? 96.601  88.986  37.829  0.60 25.70 ? 210  GLN B N   1 
ATOM   4342 N N   B GLN B 1 209 ? 96.199  90.921  39.109  0.40 26.21 ? 210  GLN B N   1 
ATOM   4343 C CA  A GLN B 1 209 ? 97.090  89.008  39.211  0.60 25.72 ? 210  GLN B CA  1 
ATOM   4344 C CA  B GLN B 1 209 ? 96.645  90.856  40.501  0.40 26.90 ? 210  GLN B CA  1 
ATOM   4345 C C   A GLN B 1 209 ? 98.330  89.848  39.521  0.60 25.55 ? 210  GLN B C   1 
ATOM   4346 C C   B GLN B 1 209 ? 97.835  91.735  40.909  0.40 27.44 ? 210  GLN B C   1 
ATOM   4347 O O   A GLN B 1 209 ? 98.587  90.167  40.683  0.60 25.56 ? 210  GLN B O   1 
ATOM   4348 O O   B GLN B 1 209 ? 98.094  91.945  42.102  0.40 26.00 ? 210  GLN B O   1 
ATOM   4349 C CB  A GLN B 1 209 ? 97.285  87.582  39.717  0.60 28.07 ? 210  GLN B CB  1 
ATOM   4350 C CB  B GLN B 1 209 ? 96.895  89.398  40.907  0.40 28.42 ? 210  GLN B CB  1 
ATOM   4351 C CG  A GLN B 1 209 ? 95.957  86.945  40.062  0.60 28.76 ? 210  GLN B CG  1 
ATOM   4352 C CG  B GLN B 1 209 ? 95.595  88.658  41.243  0.40 29.58 ? 210  GLN B CG  1 
ATOM   4353 C CD  A GLN B 1 209 ? 96.115  85.633  40.788  0.60 30.97 ? 210  GLN B CD  1 
ATOM   4354 C CD  B GLN B 1 209 ? 95.815  87.289  41.844  0.40 30.72 ? 210  GLN B CD  1 
ATOM   4355 O OE1 A GLN B 1 209 ? 97.159  85.369  41.371  0.60 29.30 ? 210  GLN B OE1 1 
ATOM   4356 O OE1 B GLN B 1 209 ? 96.798  87.056  42.537  0.40 32.56 ? 210  GLN B OE1 1 
ATOM   4357 N NE2 A GLN B 1 209 ? 95.063  84.808  40.772  0.60 31.88 ? 210  GLN B NE2 1 
ATOM   4358 N NE2 B GLN B 1 209 ? 94.878  86.377  41.602  0.40 31.82 ? 210  GLN B NE2 1 
ATOM   4359 N N   A ASN B 1 210 ? 99.087  90.218  38.498  0.60 24.66 ? 211  ASN B N   1 
ATOM   4360 N N   B ASN B 1 210 ? 98.552  92.279  39.938  0.40 26.60 ? 211  ASN B N   1 
ATOM   4361 C CA  A ASN B 1 210 ? 100.275 91.028  38.723  0.60 25.81 ? 211  ASN B CA  1 
ATOM   4362 C CA  B ASN B 1 210 ? 99.677  93.119  40.303  0.40 27.58 ? 211  ASN B CA  1 
ATOM   4363 C C   A ASN B 1 210 ? 100.044 92.486  38.335  0.60 26.31 ? 211  ASN B C   1 
ATOM   4364 C C   B ASN B 1 210 ? 99.406  94.586  39.997  0.40 26.92 ? 211  ASN B C   1 
ATOM   4365 O O   A ASN B 1 210 ? 100.984 93.291  38.377  0.60 25.52 ? 211  ASN B O   1 
ATOM   4366 O O   B ASN B 1 210 ? 100.288 95.425  40.127  0.40 27.59 ? 211  ASN B O   1 
ATOM   4367 C CB  A ASN B 1 210 ? 101.474 90.470  37.944  0.60 28.59 ? 211  ASN B CB  1 
ATOM   4368 C CB  B ASN B 1 210 ? 100.951 92.639  39.602  0.40 29.20 ? 211  ASN B CB  1 
ATOM   4369 C CG  A ASN B 1 210 ? 101.782 89.029  38.304  0.60 32.34 ? 211  ASN B CG  1 
ATOM   4370 C CG  B ASN B 1 210 ? 101.249 91.168  39.881  0.40 31.38 ? 211  ASN B CG  1 
ATOM   4371 O OD1 A ASN B 1 210 ? 101.723 88.644  39.476  0.60 33.34 ? 211  ASN B OD1 1 
ATOM   4372 O OD1 B ASN B 1 210 ? 101.113 90.691  41.021  0.40 32.62 ? 211  ASN B OD1 1 
ATOM   4373 N ND2 A ASN B 1 210 ? 102.131 88.221  37.294  0.60 32.00 ? 211  ASN B ND2 1 
ATOM   4374 N ND2 B ASN B 1 210 ? 101.672 90.445  38.845  0.40 30.18 ? 211  ASN B ND2 1 
ATOM   4375 N N   A GLU B 1 211 ? 98.806  92.816  37.955  0.60 23.46 ? 212  GLU B N   1 
ATOM   4376 N N   B GLU B 1 211 ? 98.170  94.889  39.613  0.40 26.53 ? 212  GLU B N   1 
ATOM   4377 C CA  A GLU B 1 211 ? 98.455  94.185  37.593  0.60 24.57 ? 212  GLU B CA  1 
ATOM   4378 C CA  B GLU B 1 211 ? 97.765  96.258  39.303  0.40 25.54 ? 212  GLU B CA  1 
ATOM   4379 C C   A GLU B 1 211 ? 97.938  94.943  38.830  0.60 24.35 ? 212  GLU B C   1 
ATOM   4380 C C   B GLU B 1 211 ? 97.128  96.878  40.551  0.40 25.91 ? 212  GLU B C   1 
ATOM   4381 O O   A GLU B 1 211 ? 96.787  94.748  39.239  0.60 25.29 ? 212  GLU B O   1 
ATOM   4382 O O   B GLU B 1 211 ? 95.975  96.577  40.901  0.40 27.20 ? 212  GLU B O   1 
ATOM   4383 C CB  A GLU B 1 211 ? 97.380  94.176  36.501  0.60 23.97 ? 212  GLU B CB  1 
ATOM   4384 C CB  B GLU B 1 211 ? 96.770  96.257  38.142  0.40 22.96 ? 212  GLU B CB  1 
ATOM   4385 C CG  A GLU B 1 211 ? 97.106  95.553  35.907  0.60 19.67 ? 212  GLU B CG  1 
ATOM   4386 C CG  B GLU B 1 211 ? 96.449  97.625  37.580  0.40 20.59 ? 212  GLU B CG  1 
ATOM   4387 C CD  A GLU B 1 211 ? 98.351  96.179  35.334  0.60 19.95 ? 212  GLU B CD  1 
ATOM   4388 C CD  B GLU B 1 211 ? 97.688  98.373  37.101  0.40 21.00 ? 212  GLU B CD  1 
ATOM   4389 O OE1 A GLU B 1 211 ? 99.261  95.428  34.959  0.60 16.35 ? 212  GLU B OE1 1 
ATOM   4390 O OE1 B GLU B 1 211 ? 98.716  97.726  36.810  0.40 20.49 ? 212  GLU B OE1 1 
ATOM   4391 O OE2 A GLU B 1 211 ? 98.421  97.423  35.232  0.60 18.05 ? 212  GLU B OE2 1 
ATOM   4392 O OE2 B GLU B 1 211 ? 97.636  99.614  36.994  0.40 20.03 ? 212  GLU B OE2 1 
ATOM   4393 N N   A SER B 1 212 ? 98.799  95.782  39.421  0.60 24.24 ? 213  SER B N   1 
ATOM   4394 N N   B SER B 1 212 ? 97.893  97.744  41.210  0.40 25.87 ? 213  SER B N   1 
ATOM   4395 C CA  A SER B 1 212 ? 98.500  96.597  40.619  0.60 23.61 ? 213  SER B CA  1 
ATOM   4396 C CA  B SER B 1 212 ? 97.483  98.429  42.438  0.40 25.17 ? 213  SER B CA  1 
ATOM   4397 C C   A SER B 1 212 ? 97.097  97.180  40.669  0.60 23.12 ? 213  SER B C   1 
ATOM   4398 C C   B SER B 1 212 ? 96.054  98.945  42.458  0.40 23.64 ? 213  SER B C   1 
ATOM   4399 O O   A SER B 1 212 ? 96.364  97.061  41.662  0.60 23.79 ? 213  SER B O   1 
ATOM   4400 O O   B SER B 1 212 ? 95.302  98.701  43.400  0.40 22.15 ? 213  SER B O   1 
ATOM   4401 C CB  A SER B 1 212 ? 99.423  97.844  40.721  0.60 23.65 ? 213  SER B CB  1 
ATOM   4402 C CB  B SER B 1 212 ? 98.417  99.611  42.708  0.40 25.29 ? 213  SER B CB  1 
ATOM   4403 O OG  A SER B 1 212 ? 100.763 97.641  40.353  0.60 27.09 ? 213  SER B OG  1 
ATOM   4404 O OG  B SER B 1 212 ? 99.773  99.230  42.500  0.40 29.16 ? 213  SER B OG  1 
ATOM   4405 N N   A SER B 1 213 ? 96.753  97.867  39.594  0.60 20.47 ? 214  SER B N   1 
ATOM   4406 N N   B SER B 1 213 ? 95.692  99.662  41.403  0.40 22.82 ? 214  SER B N   1 
ATOM   4407 C CA  A SER B 1 213 ? 95.486  98.561  39.515  0.60 19.94 ? 214  SER B CA  1 
ATOM   4408 C CA  B SER B 1 213 ? 94.380  100.275 41.307  0.40 21.82 ? 214  SER B CA  1 
ATOM   4409 C C   A SER B 1 213 ? 94.225  97.716  39.607  0.60 19.94 ? 214  SER B C   1 
ATOM   4410 C C   B SER B 1 213 ? 93.163  99.348  41.270  0.40 22.00 ? 214  SER B C   1 
ATOM   4411 O O   A SER B 1 213 ? 93.202  98.206  40.082  0.60 18.01 ? 214  SER B O   1 
ATOM   4412 O O   B SER B 1 213 ? 92.087  99.746  41.696  0.40 21.82 ? 214  SER B O   1 
ATOM   4413 C CB  A SER B 1 213 ? 95.457  99.392  38.228  0.60 18.92 ? 214  SER B CB  1 
ATOM   4414 C CB  B SER B 1 213 ? 94.358  101.202 40.085  0.40 22.68 ? 214  SER B CB  1 
ATOM   4415 O OG  A SER B 1 213 ? 95.412  98.536  37.104  0.60 19.21 ? 214  SER B OG  1 
ATOM   4416 O OG  B SER B 1 213 ? 94.351  100.467 38.866  0.40 19.73 ? 214  SER B OG  1 
ATOM   4417 N N   A ILE B 1 214 ? 94.276  96.455  39.172  0.60 19.63 ? 215  ILE B N   1 
ATOM   4418 N N   B ILE B 1 214 ? 93.305  98.127  40.754  0.40 21.93 ? 215  ILE B N   1 
ATOM   4419 C CA  A ILE B 1 214 ? 93.060  95.644  39.196  0.60 18.27 ? 215  ILE B CA  1 
ATOM   4420 C CA  B ILE B 1 214 ? 92.152  97.217  40.665  0.40 21.39 ? 215  ILE B CA  1 
ATOM   4421 C C   A ILE B 1 214 ? 92.510  95.341  40.603  0.60 20.74 ? 215  ILE B C   1 
ATOM   4422 C C   B ILE B 1 214 ? 91.590  96.779  42.026  0.40 23.42 ? 215  ILE B C   1 
ATOM   4423 O O   A ILE B 1 214 ? 93.193  94.780  41.451  0.60 19.18 ? 215  ILE B O   1 
ATOM   4424 O O   B ILE B 1 214 ? 92.298  96.180  42.840  0.40 24.90 ? 215  ILE B O   1 
ATOM   4425 C CB  A ILE B 1 214 ? 93.266  94.332  38.371  0.60 20.45 ? 215  ILE B CB  1 
ATOM   4426 C CB  B ILE B 1 214 ? 92.487  95.963  39.808  0.40 20.49 ? 215  ILE B CB  1 
ATOM   4427 C CG1 A ILE B 1 214 ? 93.540  94.701  36.901  0.60 20.21 ? 215  ILE B CG1 1 
ATOM   4428 C CG1 B ILE B 1 214 ? 92.767  96.389  38.366  0.40 20.90 ? 215  ILE B CG1 1 
ATOM   4429 C CG2 A ILE B 1 214 ? 92.007  93.427  38.474  0.60 19.53 ? 215  ILE B CG2 1 
ATOM   4430 C CG2 B ILE B 1 214 ? 91.314  94.964  39.841  0.40 22.37 ? 215  ILE B CG2 1 
ATOM   4431 C CD1 A ILE B 1 214 ? 93.714  93.494  35.922  0.60 20.69 ? 215  ILE B CD1 1 
ATOM   4432 C CD1 B ILE B 1 214 ? 93.127  95.261  37.417  0.40 20.48 ? 215  ILE B CD1 1 
ATOM   4433 N N   A GLU B 1 215 ? 91.263  95.741  40.839  0.60 19.74 ? 216  GLU B N   1 
ATOM   4434 N N   B GLU B 1 215 ? 90.314  97.090  42.256  0.40 22.22 ? 216  GLU B N   1 
ATOM   4435 C CA  A GLU B 1 215 ? 90.599  95.533  42.122  0.60 21.92 ? 216  GLU B CA  1 
ATOM   4436 C CA  B GLU B 1 215 ? 89.625  96.754  43.506  0.40 22.48 ? 216  GLU B CA  1 
ATOM   4437 C C   A GLU B 1 215 ? 89.638  94.353  42.117  0.60 21.44 ? 216  GLU B C   1 
ATOM   4438 C C   B GLU B 1 215 ? 88.749  95.525  43.381  0.40 21.86 ? 216  GLU B C   1 
ATOM   4439 O O   A GLU B 1 215 ? 89.568  93.596  43.090  0.60 21.88 ? 216  GLU B O   1 
ATOM   4440 O O   B GLU B 1 215 ? 88.690  94.690  44.294  0.40 22.87 ? 216  GLU B O   1 
ATOM   4441 C CB  A GLU B 1 215 ? 89.788  96.757  42.499  0.60 22.24 ? 216  GLU B CB  1 
ATOM   4442 C CB  B GLU B 1 215 ? 88.706  97.897  43.949  0.40 23.99 ? 216  GLU B CB  1 
ATOM   4443 C CG  A GLU B 1 215 ? 90.577  98.009  42.722  0.60 24.94 ? 216  GLU B CG  1 
ATOM   4444 C CG  B GLU B 1 215 ? 89.375  99.193  44.394  0.40 24.75 ? 216  GLU B CG  1 
ATOM   4445 C CD  A GLU B 1 215 ? 89.669  99.193  42.993  0.60 26.36 ? 216  GLU B CD  1 
ATOM   4446 C CD  B GLU B 1 215 ? 88.343  100.296 44.590  0.40 25.73 ? 216  GLU B CD  1 
ATOM   4447 O OE1 A GLU B 1 215 ? 88.525  98.979  43.471  0.60 27.05 ? 216  GLU B OE1 1 
ATOM   4448 O OE1 B GLU B 1 215 ? 87.219  99.984  45.060  0.40 23.72 ? 216  GLU B OE1 1 
ATOM   4449 O OE2 A GLU B 1 215 ? 90.104  100.334 42.738  0.60 28.25 ? 216  GLU B OE2 1 
ATOM   4450 O OE2 B GLU B 1 215 ? 88.649  101.467 44.272  0.40 26.97 ? 216  GLU B OE2 1 
ATOM   4451 N N   A ILE B 1 216 ? 88.873  94.220  41.038  0.60 20.14 ? 217  ILE B N   1 
ATOM   4452 N N   B ILE B 1 216 ? 88.029  95.438  42.267  0.40 20.57 ? 217  ILE B N   1 
ATOM   4453 C CA  A ILE B 1 216 ? 87.892  93.144  40.933  0.60 19.93 ? 217  ILE B CA  1 
ATOM   4454 C CA  B ILE B 1 216 ? 87.113  94.328  42.047  0.40 20.75 ? 217  ILE B CA  1 
ATOM   4455 C C   A ILE B 1 216 ? 87.758  92.646  39.506  0.60 20.42 ? 217  ILE B C   1 
ATOM   4456 C C   B ILE B 1 216 ? 87.081  93.884  40.596  0.40 20.51 ? 217  ILE B C   1 
ATOM   4457 O O   A ILE B 1 216 ? 87.820  93.428  38.540  0.60 20.80 ? 217  ILE B O   1 
ATOM   4458 O O   B ILE B 1 216 ? 87.169  94.707  39.685  0.40 21.91 ? 217  ILE B O   1 
ATOM   4459 C CB  A ILE B 1 216 ? 86.496  93.623  41.401  0.60 20.42 ? 217  ILE B CB  1 
ATOM   4460 C CB  B ILE B 1 216 ? 85.667  94.726  42.443  0.40 21.29 ? 217  ILE B CB  1 
ATOM   4461 C CG1 A ILE B 1 216 ? 86.574  94.192  42.812  0.60 21.46 ? 217  ILE B CG1 1 
ATOM   4462 C CG1 B ILE B 1 216 ? 85.619  95.138  43.922  0.40 22.16 ? 217  ILE B CG1 1 
ATOM   4463 C CG2 A ILE B 1 216 ? 85.497  92.456  41.396  0.60 18.13 ? 217  ILE B CG2 1 
ATOM   4464 C CG2 B ILE B 1 216 ? 84.704  93.568  42.143  0.40 21.04 ? 217  ILE B CG2 1 
ATOM   4465 C CD1 A ILE B 1 216 ? 85.312  94.974  43.229  0.60 23.98 ? 217  ILE B CD1 1 
ATOM   4466 C CD1 B ILE B 1 216 ? 84.334  95.812  44.332  0.40 22.29 ? 217  ILE B CD1 1 
ATOM   4467 N N   A VAL B 1 217 ? 87.564  91.343  39.366  0.60 21.00 ? 218  VAL B N   1 
ATOM   4468 N N   B VAL B 1 217 ? 86.968  92.578  40.381  0.40 19.49 ? 218  VAL B N   1 
ATOM   4469 C CA  A VAL B 1 217 ? 87.383  90.748  38.056  0.60 20.08 ? 218  VAL B CA  1 
ATOM   4470 C CA  B VAL B 1 217 ? 86.860  92.053  39.028  0.40 20.35 ? 218  VAL B CA  1 
ATOM   4471 C C   A VAL B 1 217 ? 86.083  89.950  38.098  0.60 21.07 ? 218  VAL B C   1 
ATOM   4472 C C   B VAL B 1 217 ? 85.584  91.204  38.934  0.40 20.13 ? 218  VAL B C   1 
ATOM   4473 O O   A VAL B 1 217 ? 85.735  89.358  39.128  0.60 21.63 ? 218  VAL B O   1 
ATOM   4474 O O   B VAL B 1 217 ? 85.175  90.555  39.906  0.40 19.73 ? 218  VAL B O   1 
ATOM   4475 C CB  A VAL B 1 217 ? 88.567  89.844  37.675  0.60 22.82 ? 218  VAL B CB  1 
ATOM   4476 C CB  B VAL B 1 217 ? 88.112  91.221  38.620  0.40 19.94 ? 218  VAL B CB  1 
ATOM   4477 C CG1 A VAL B 1 217 ? 89.857  90.700  37.572  0.60 21.18 ? 218  VAL B CG1 1 
ATOM   4478 C CG1 B VAL B 1 217 ? 89.354  92.134  38.582  0.40 19.22 ? 218  VAL B CG1 1 
ATOM   4479 C CG2 A VAL B 1 217 ? 88.739  88.716  38.702  0.60 20.60 ? 218  VAL B CG2 1 
ATOM   4480 C CG2 B VAL B 1 217 ? 88.338  90.086  39.595  0.40 19.42 ? 218  VAL B CG2 1 
ATOM   4481 N N   A ALA B 1 218 ? 85.350  89.971  36.985  0.60 21.79 ? 219  ALA B N   1 
ATOM   4482 N N   B ALA B 1 218 ? 84.939  91.236  37.769  0.40 20.34 ? 219  ALA B N   1 
ATOM   4483 C CA  A ALA B 1 218 ? 84.063  89.280  36.882  0.60 21.99 ? 219  ALA B CA  1 
ATOM   4484 C CA  B ALA B 1 218 ? 83.713  90.477  37.552  0.40 18.47 ? 219  ALA B CA  1 
ATOM   4485 C C   A ALA B 1 218 ? 84.022  88.535  35.547  0.60 22.80 ? 219  ALA B C   1 
ATOM   4486 C C   B ALA B 1 218 ? 83.771  89.818  36.173  0.40 20.56 ? 219  ALA B C   1 
ATOM   4487 O O   A ALA B 1 218 ? 84.412  89.081  34.513  0.60 22.67 ? 219  ALA B O   1 
ATOM   4488 O O   B ALA B 1 218 ? 84.145  90.448  35.170  0.40 18.05 ? 219  ALA B O   1 
ATOM   4489 C CB  A ALA B 1 218 ? 82.936  90.288  36.969  0.60 22.63 ? 219  ALA B CB  1 
ATOM   4490 C CB  B ALA B 1 218 ? 82.496  91.394  37.671  0.40 20.24 ? 219  ALA B CB  1 
ATOM   4491 N N   A ASP B 1 219 ? 83.553  87.292  35.589  0.60 23.11 ? 220  ASP B N   1 
ATOM   4492 N N   B ASP B 1 219 ? 83.386  88.547  36.133  0.40 20.40 ? 220  ASP B N   1 
ATOM   4493 C CA  A ASP B 1 219 ? 83.528  86.413  34.422  0.60 22.67 ? 220  ASP B CA  1 
ATOM   4494 C CA  B ASP B 1 219 ? 83.449  87.756  34.915  0.40 21.79 ? 220  ASP B CA  1 
ATOM   4495 C C   A ASP B 1 219 ? 82.158  85.789  34.180  0.60 22.72 ? 220  ASP B C   1 
ATOM   4496 C C   B ASP B 1 219 ? 82.127  87.058  34.591  0.40 22.95 ? 220  ASP B C   1 
ATOM   4497 O O   A ASP B 1 219 ? 81.593  85.188  35.080  0.60 21.69 ? 220  ASP B O   1 
ATOM   4498 O O   B ASP B 1 219 ? 81.549  86.388  35.442  0.40 21.77 ? 220  ASP B O   1 
ATOM   4499 C CB  A ASP B 1 219 ? 84.550  85.288  34.649  0.60 23.56 ? 220  ASP B CB  1 
ATOM   4500 C CB  B ASP B 1 219 ? 84.563  86.724  35.086  0.40 23.45 ? 220  ASP B CB  1 
ATOM   4501 C CG  A ASP B 1 219 ? 84.679  84.354  33.462  0.60 24.08 ? 220  ASP B CG  1 
ATOM   4502 C CG  B ASP B 1 219 ? 84.753  85.871  33.872  0.40 25.03 ? 220  ASP B CG  1 
ATOM   4503 O OD1 A ASP B 1 219 ? 85.247  83.255  33.664  0.60 26.07 ? 220  ASP B OD1 1 
ATOM   4504 O OD1 B ASP B 1 219 ? 85.415  84.815  34.002  0.40 26.33 ? 220  ASP B OD1 1 
ATOM   4505 O OD2 A ASP B 1 219 ? 84.239  84.726  32.341  0.60 22.37 ? 220  ASP B OD2 1 
ATOM   4506 O OD2 B ASP B 1 219 ? 84.247  86.261  32.795  0.40 23.14 ? 220  ASP B OD2 1 
ATOM   4507 N N   A TYR B 1 220 ? 81.656  85.900  32.952  0.60 23.91 ? 221  TYR B N   1 
ATOM   4508 N N   B TYR B 1 220 ? 81.667  87.206  33.349  0.40 23.57 ? 221  TYR B N   1 
ATOM   4509 C CA  A TYR B 1 220 ? 80.353  85.343  32.597  0.60 25.64 ? 221  TYR B CA  1 
ATOM   4510 C CA  B TYR B 1 220 ? 80.411  86.613  32.913  0.40 24.74 ? 221  TYR B CA  1 
ATOM   4511 C C   A TYR B 1 220 ? 80.380  83.952  31.929  0.60 27.29 ? 221  TYR B C   1 
ATOM   4512 C C   B TYR B 1 220 ? 80.560  85.286  32.165  0.40 26.59 ? 221  TYR B C   1 
ATOM   4513 O O   A TYR B 1 220 ? 79.324  83.393  31.631  0.60 26.26 ? 221  TYR B O   1 
ATOM   4514 O O   B TYR B 1 220 ? 79.560  84.677  31.770  0.40 26.21 ? 221  TYR B O   1 
ATOM   4515 C CB  A TYR B 1 220 ? 79.596  86.325  31.700  0.60 23.58 ? 221  TYR B CB  1 
ATOM   4516 C CB  B TYR B 1 220 ? 79.647  87.595  32.026  0.40 24.16 ? 221  TYR B CB  1 
ATOM   4517 C CG  A TYR B 1 220 ? 79.284  87.656  32.351  0.60 21.86 ? 221  TYR B CG  1 
ATOM   4518 C CG  B TYR B 1 220 ? 79.215  88.865  32.722  0.40 22.43 ? 221  TYR B CG  1 
ATOM   4519 C CD1 A TYR B 1 220 ? 79.878  88.840  31.888  0.60 21.10 ? 221  TYR B CD1 1 
ATOM   4520 C CD1 B TYR B 1 220 ? 79.758  90.100  32.358  0.40 22.33 ? 221  TYR B CD1 1 
ATOM   4521 C CD2 A TYR B 1 220 ? 78.353  87.744  33.386  0.60 18.12 ? 221  TYR B CD2 1 
ATOM   4522 C CD2 B TYR B 1 220 ? 78.234  88.839  33.708  0.40 21.49 ? 221  TYR B CD2 1 
ATOM   4523 C CE1 A TYR B 1 220 ? 79.533  90.082  32.449  0.60 21.31 ? 221  TYR B CE1 1 
ATOM   4524 C CE1 B TYR B 1 220 ? 79.330  91.275  32.952  0.40 21.33 ? 221  TYR B CE1 1 
ATOM   4525 C CE2 A TYR B 1 220 ? 78.005  88.970  33.943  0.60 20.49 ? 221  TYR B CE2 1 
ATOM   4526 C CE2 B TYR B 1 220 ? 77.794  90.010  34.314  0.40 21.38 ? 221  TYR B CE2 1 
ATOM   4527 C CZ  A TYR B 1 220 ? 78.592  90.134  33.469  0.60 21.03 ? 221  TYR B CZ  1 
ATOM   4528 C CZ  B TYR B 1 220 ? 78.346  91.226  33.930  0.40 22.41 ? 221  TYR B CZ  1 
ATOM   4529 O OH  A TYR B 1 220 ? 78.200  91.361  33.986  0.60 22.19 ? 221  TYR B OH  1 
ATOM   4530 O OH  B TYR B 1 220 ? 77.916  92.388  34.516  0.40 21.97 ? 221  TYR B OH  1 
ATOM   4531 N N   A ASN B 1 221 ? 81.569  83.402  31.678  0.60 27.27 ? 222  ASN B N   1 
ATOM   4532 N N   B ASN B 1 221 ? 81.795  84.840  31.960  0.40 28.31 ? 222  ASN B N   1 
ATOM   4533 C CA  A ASN B 1 221 ? 81.669  82.061  31.078  0.60 30.51 ? 222  ASN B CA  1 
ATOM   4534 C CA  B ASN B 1 221 ? 82.036  83.576  31.276  0.40 29.17 ? 222  ASN B CA  1 
ATOM   4535 C C   A ASN B 1 221 ? 81.710  81.054  32.219  0.60 31.62 ? 222  ASN B C   1 
ATOM   4536 C C   B ASN B 1 221 ? 82.098  82.479  32.332  0.40 30.73 ? 222  ASN B C   1 
ATOM   4537 O O   A ASN B 1 221 ? 82.633  81.064  33.037  0.60 32.02 ? 222  ASN B O   1 
ATOM   4538 O O   B ASN B 1 221 ? 82.996  82.473  33.175  0.40 30.10 ? 222  ASN B O   1 
ATOM   4539 C CB  A ASN B 1 221 ? 82.936  81.942  30.221  0.60 29.73 ? 222  ASN B CB  1 
ATOM   4540 C CB  B ASN B 1 221 ? 83.353  83.639  30.504  0.40 30.10 ? 222  ASN B CB  1 
ATOM   4541 C CG  A ASN B 1 221 ? 83.207  80.510  29.731  0.60 29.99 ? 222  ASN B CG  1 
ATOM   4542 C CG  B ASN B 1 221 ? 83.741  82.302  29.911  0.40 31.19 ? 222  ASN B CG  1 
ATOM   4543 O OD1 A ASN B 1 221 ? 82.291  79.760  29.376  0.60 30.14 ? 222  ASN B OD1 1 
ATOM   4544 O OD1 B ASN B 1 221 ? 82.903  81.594  29.350  0.40 31.67 ? 222  ASN B OD1 1 
ATOM   4545 N ND2 A ASN B 1 221 ? 84.479  80.144  29.679  0.60 26.89 ? 222  ASN B ND2 1 
ATOM   4546 N ND2 B ASN B 1 221 ? 85.021  81.957  30.014  0.40 29.88 ? 222  ASN B ND2 1 
ATOM   4547 N N   A ALA B 1 222 ? 80.701  80.193  32.282  0.60 32.75 ? 223  ALA B N   1 
ATOM   4548 N N   B ALA B 1 222 ? 81.150  81.548  32.279  0.40 31.91 ? 223  ALA B N   1 
ATOM   4549 C CA  A ALA B 1 222 ? 80.618  79.204  33.348  0.60 34.50 ? 223  ALA B CA  1 
ATOM   4550 C CA  B ALA B 1 222 ? 81.079  80.468  33.259  0.40 32.55 ? 223  ALA B CA  1 
ATOM   4551 C C   A ALA B 1 222 ? 81.249  77.860  33.006  0.60 34.86 ? 223  ALA B C   1 
ATOM   4552 C C   B ALA B 1 222 ? 81.850  79.208  32.882  0.40 34.08 ? 223  ALA B C   1 
ATOM   4553 O O   A ALA B 1 222 ? 81.430  77.023  33.887  0.60 35.50 ? 223  ALA B O   1 
ATOM   4554 O O   B ALA B 1 222 ? 82.125  78.365  33.740  0.40 32.15 ? 223  ALA B O   1 
ATOM   4555 C CB  A ALA B 1 222 ? 79.170  79.004  33.747  0.60 33.55 ? 223  ALA B CB  1 
ATOM   4556 C CB  B ALA B 1 222 ? 79.617  80.112  33.515  0.40 31.83 ? 223  ALA B CB  1 
ATOM   4557 N N   A GLN B 1 223 ? 81.597  77.662  31.739  0.60 35.78 ? 224  GLN B N   1 
ATOM   4558 N N   B GLN B 1 223 ? 82.208  79.089  31.606  0.40 35.73 ? 224  GLN B N   1 
ATOM   4559 C CA  A GLN B 1 223 ? 82.188  76.400  31.298  0.60 36.88 ? 224  GLN B CA  1 
ATOM   4560 C CA  B GLN B 1 223 ? 82.910  77.908  31.116  0.40 36.89 ? 224  GLN B CA  1 
ATOM   4561 C C   A GLN B 1 223 ? 83.702  76.466  31.052  0.60 36.66 ? 224  GLN B C   1 
ATOM   4562 C C   B GLN B 1 223 ? 84.422  78.076  30.956  0.40 36.92 ? 224  GLN B C   1 
ATOM   4563 O O   A GLN B 1 223 ? 84.184  77.239  30.224  0.60 35.16 ? 224  GLN B O   1 
ATOM   4564 O O   B GLN B 1 223 ? 84.895  78.937  30.211  0.40 37.15 ? 224  GLN B O   1 
ATOM   4565 C CB  A GLN B 1 223 ? 81.447  75.925  30.042  0.60 38.67 ? 224  GLN B CB  1 
ATOM   4566 C CB  B GLN B 1 223 ? 82.271  77.478  29.793  0.40 38.78 ? 224  GLN B CB  1 
ATOM   4567 C CG  A GLN B 1 223 ? 81.888  74.587  29.469  0.60 41.85 ? 224  GLN B CG  1 
ATOM   4568 C CG  B GLN B 1 223 ? 82.837  76.220  29.153  0.40 41.61 ? 224  GLN B CG  1 
ATOM   4569 C CD  A GLN B 1 223 ? 80.838  73.992  28.533  0.60 43.44 ? 224  GLN B CD  1 
ATOM   4570 C CD  B GLN B 1 223 ? 81.893  75.641  28.111  0.40 43.56 ? 224  GLN B CD  1 
ATOM   4571 O OE1 A GLN B 1 223 ? 81.131  73.100  27.727  0.60 45.95 ? 224  GLN B OE1 1 
ATOM   4572 O OE1 B GLN B 1 223 ? 82.283  74.812  27.287  0.40 45.73 ? 224  GLN B OE1 1 
ATOM   4573 N NE2 A GLN B 1 223 ? 79.602  74.474  28.651  0.60 44.13 ? 224  GLN B NE2 1 
ATOM   4574 N NE2 B GLN B 1 223 ? 80.636  76.068  28.154  0.40 46.08 ? 224  GLN B NE2 1 
ATOM   4575 N N   A PRO B 1 224 ? 84.470  75.637  31.778  0.60 36.56 ? 225  PRO B N   1 
ATOM   4576 N N   B PRO B 1 224 ? 85.202  77.245  31.666  0.40 36.84 ? 225  PRO B N   1 
ATOM   4577 C CA  A PRO B 1 224 ? 85.931  75.582  31.660  0.60 35.99 ? 225  PRO B CA  1 
ATOM   4578 C CA  B PRO B 1 224 ? 86.669  77.272  31.627  0.40 36.09 ? 225  PRO B CA  1 
ATOM   4579 C C   A PRO B 1 224 ? 86.414  75.237  30.259  0.60 35.38 ? 225  PRO B C   1 
ATOM   4580 C C   B PRO B 1 224 ? 87.255  77.068  30.226  0.40 35.49 ? 225  PRO B C   1 
ATOM   4581 O O   A PRO B 1 224 ? 85.785  74.434  29.558  0.60 36.13 ? 225  PRO B O   1 
ATOM   4582 O O   B PRO B 1 224 ? 86.730  76.283  29.431  0.40 35.08 ? 225  PRO B O   1 
ATOM   4583 C CB  A PRO B 1 224 ? 86.318  74.510  32.670  0.60 35.88 ? 225  PRO B CB  1 
ATOM   4584 C CB  B PRO B 1 224 ? 87.054  76.144  32.578  0.40 36.51 ? 225  PRO B CB  1 
ATOM   4585 C CG  A PRO B 1 224 ? 85.263  74.649  33.725  0.60 36.56 ? 225  PRO B CG  1 
ATOM   4586 C CG  B PRO B 1 224 ? 85.960  76.185  33.589  0.40 36.54 ? 225  PRO B CG  1 
ATOM   4587 C CD  A PRO B 1 224 ? 84.008  74.796  32.899  0.60 36.62 ? 225  PRO B CD  1 
ATOM   4588 C CD  B PRO B 1 224 ? 84.731  76.334  32.724  0.40 37.01 ? 225  PRO B CD  1 
ATOM   4589 N N   A PRO B 1 225 ? 87.542  75.838  29.832  0.60 33.31 ? 226  PRO B N   1 
ATOM   4590 N N   B PRO B 1 225 ? 88.350  77.785  29.905  0.40 33.81 ? 226  PRO B N   1 
ATOM   4591 C CA  A PRO B 1 225 ? 88.316  76.798  30.636  0.60 32.03 ? 226  PRO B CA  1 
ATOM   4592 C CA  B PRO B 1 225 ? 89.003  78.742  30.805  0.40 33.04 ? 226  PRO B CA  1 
ATOM   4593 C C   A PRO B 1 225 ? 87.581  78.139  30.749  0.60 30.88 ? 226  PRO B C   1 
ATOM   4594 C C   B PRO B 1 225 ? 88.167  80.009  30.941  0.40 32.08 ? 226  PRO B C   1 
ATOM   4595 O O   A PRO B 1 225 ? 87.079  78.660  29.757  0.60 29.20 ? 226  PRO B O   1 
ATOM   4596 O O   B PRO B 1 225 ? 87.655  80.532  29.951  0.40 31.42 ? 226  PRO B O   1 
ATOM   4597 C CB  A PRO B 1 225 ? 89.629  76.917  29.865  0.60 30.95 ? 226  PRO B CB  1 
ATOM   4598 C CB  B PRO B 1 225 ? 90.348  78.992  30.129  0.40 33.19 ? 226  PRO B CB  1 
ATOM   4599 C CG  A PRO B 1 225 ? 89.180  76.742  28.438  0.60 34.81 ? 226  PRO B CG  1 
ATOM   4600 C CG  B PRO B 1 225 ? 90.020  78.847  28.677  0.40 34.35 ? 226  PRO B CG  1 
ATOM   4601 C CD  A PRO B 1 225 ? 88.210  75.574  28.544  0.60 33.02 ? 226  PRO B CD  1 
ATOM   4602 C CD  B PRO B 1 225 ? 89.135  77.616  28.671  0.40 34.18 ? 226  PRO B CD  1 
ATOM   4603 N N   A LEU B 1 226 ? 87.522  78.685  31.964  0.60 30.18 ? 227  LEU B N   1 
ATOM   4604 N N   B LEU B 1 226 ? 88.026  80.492  32.170  0.40 30.45 ? 227  LEU B N   1 
ATOM   4605 C CA  A LEU B 1 226 ? 86.832  79.959  32.214  0.60 29.05 ? 227  LEU B CA  1 
ATOM   4606 C CA  B LEU B 1 226 ? 87.233  81.682  32.440  0.40 29.96 ? 227  LEU B CA  1 
ATOM   4607 C C   A LEU B 1 226 ? 87.482  81.145  31.511  0.60 28.01 ? 227  LEU B C   1 
ATOM   4608 C C   B LEU B 1 226 ? 87.859  82.951  31.851  0.40 29.39 ? 227  LEU B C   1 
ATOM   4609 O O   A LEU B 1 226 ? 88.661  81.098  31.143  0.60 28.03 ? 227  LEU B O   1 
ATOM   4610 O O   B LEU B 1 226 ? 89.055  82.988  31.545  0.40 27.72 ? 227  LEU B O   1 
ATOM   4611 C CB  A LEU B 1 226 ? 86.764  80.229  33.718  0.60 28.19 ? 227  LEU B CB  1 
ATOM   4612 C CB  B LEU B 1 226 ? 87.055  81.837  33.950  0.40 30.64 ? 227  LEU B CB  1 
ATOM   4613 C CG  A LEU B 1 226 ? 86.211  79.053  34.517  0.60 29.31 ? 227  LEU B CG  1 
ATOM   4614 C CG  B LEU B 1 226 ? 86.590  80.568  34.669  0.40 28.56 ? 227  LEU B CG  1 
ATOM   4615 C CD1 A LEU B 1 226 ? 86.259  79.363  35.999  0.60 28.60 ? 227  LEU B CD1 1 
ATOM   4616 C CD1 B LEU B 1 226 ? 86.590  80.810  36.169  0.40 28.53 ? 227  LEU B CD1 1 
ATOM   4617 C CD2 A LEU B 1 226 ? 84.779  78.754  34.073  0.60 30.20 ? 227  LEU B CD2 1 
ATOM   4618 C CD2 B LEU B 1 226 ? 85.203  80.181  34.187  0.40 27.57 ? 227  LEU B CD2 1 
ATOM   4619 N N   A GLY B 1 227 ? 86.702  82.210  31.321  0.60 27.52 ? 228  GLY B N   1 
ATOM   4620 N N   B GLY B 1 227 ? 87.033  83.982  31.687  0.40 29.52 ? 228  GLY B N   1 
ATOM   4621 C CA  A GLY B 1 227 ? 87.215  83.395  30.652  0.60 26.35 ? 228  GLY B CA  1 
ATOM   4622 C CA  B GLY B 1 227 ? 87.508  85.241  31.136  0.40 28.59 ? 228  GLY B CA  1 
ATOM   4623 C C   A GLY B 1 227 ? 88.395  83.989  31.398  0.60 27.35 ? 228  GLY B C   1 
ATOM   4624 C C   B GLY B 1 227 ? 88.590  85.873  31.986  0.40 29.11 ? 228  GLY B C   1 
ATOM   4625 O O   A GLY B 1 227 ? 89.348  84.503  30.799  0.60 27.89 ? 228  GLY B O   1 
ATOM   4626 O O   B GLY B 1 227 ? 89.487  86.549  31.484  0.40 28.29 ? 228  GLY B O   1 
ATOM   4627 N N   A ILE B 1 228 ? 88.321  83.927  32.721  0.60 26.03 ? 229  ILE B N   1 
ATOM   4628 N N   B ILE B 1 228 ? 88.502  85.657  33.292  0.40 29.13 ? 229  ILE B N   1 
ATOM   4629 C CA  A ILE B 1 228 ? 89.385  84.445  33.555  0.60 27.43 ? 229  ILE B CA  1 
ATOM   4630 C CA  B ILE B 1 228 ? 89.480  86.202  34.210  0.40 29.09 ? 229  ILE B CA  1 
ATOM   4631 C C   A ILE B 1 228 ? 90.130  83.266  34.181  0.60 27.23 ? 229  ILE B C   1 
ATOM   4632 C C   B ILE B 1 228 ? 90.243  85.040  34.821  0.40 28.86 ? 229  ILE B C   1 
ATOM   4633 O O   A ILE B 1 228 ? 89.555  82.476  34.921  0.60 27.51 ? 229  ILE B O   1 
ATOM   4634 O O   B ILE B 1 228 ? 89.660  84.187  35.494  0.40 29.37 ? 229  ILE B O   1 
ATOM   4635 C CB  A ILE B 1 228 ? 88.822  85.373  34.641  0.60 26.62 ? 229  ILE B CB  1 
ATOM   4636 C CB  B ILE B 1 228 ? 88.787  87.044  35.310  0.40 28.48 ? 229  ILE B CB  1 
ATOM   4637 C CG1 A ILE B 1 228 ? 88.346  86.679  33.994  0.60 27.72 ? 229  ILE B CG1 1 
ATOM   4638 C CG1 B ILE B 1 228 ? 88.224  88.324  34.684  0.40 28.56 ? 229  ILE B CG1 1 
ATOM   4639 C CG2 A ILE B 1 228 ? 89.893  85.675  35.687  0.60 26.90 ? 229  ILE B CG2 1 
ATOM   4640 C CG2 B ILE B 1 228 ? 89.771  87.375  36.424  0.40 29.19 ? 229  ILE B CG2 1 
ATOM   4641 C CD1 A ILE B 1 228 ? 87.752  87.669  34.970  0.60 27.40 ? 229  ILE B CD1 1 
ATOM   4642 C CD1 B ILE B 1 228 ? 87.518  89.253  35.664  0.40 26.22 ? 229  ILE B CD1 1 
ATOM   4643 N N   A GLY B 1 229 ? 91.407  83.133  33.836  0.60 28.82 ? 230  GLY B N   1 
ATOM   4644 N N   B GLY B 1 229 ? 91.547  84.999  34.561  0.40 27.81 ? 230  GLY B N   1 
ATOM   4645 C CA  A GLY B 1 229 ? 92.205  82.049  34.374  0.60 29.20 ? 230  GLY B CA  1 
ATOM   4646 C CA  B GLY B 1 229 ? 92.372  83.926  35.080  0.40 26.01 ? 230  GLY B CA  1 
ATOM   4647 C C   A GLY B 1 229 ? 92.520  82.214  35.847  0.60 29.71 ? 230  GLY B C   1 
ATOM   4648 C C   B GLY B 1 229 ? 92.623  84.048  36.569  0.40 26.61 ? 230  GLY B C   1 
ATOM   4649 O O   A GLY B 1 229 ? 92.662  83.341  36.334  0.60 29.61 ? 230  GLY B O   1 
ATOM   4650 O O   B GLY B 1 229 ? 92.708  85.148  37.111  0.40 25.49 ? 230  GLY B O   1 
ATOM   4651 N N   A GLY B 1 230 ? 92.612  81.087  36.560  0.60 29.09 ? 231  GLY B N   1 
ATOM   4652 N N   B GLY B 1 230 ? 92.720  82.907  37.238  0.40 26.89 ? 231  GLY B N   1 
ATOM   4653 C CA  A GLY B 1 230 ? 92.929  81.127  37.975  0.60 29.68 ? 231  GLY B CA  1 
ATOM   4654 C CA  B GLY B 1 230 ? 92.998  82.908  38.661  0.40 26.98 ? 231  GLY B CA  1 
ATOM   4655 C C   A GLY B 1 230 ? 91.780  81.203  38.966  0.60 29.23 ? 231  GLY B C   1 
ATOM   4656 C C   B GLY B 1 230 ? 91.813  82.829  39.599  0.40 28.27 ? 231  GLY B C   1 
ATOM   4657 O O   A GLY B 1 230 ? 92.005  81.039  40.157  0.60 28.97 ? 231  GLY B O   1 
ATOM   4658 O O   B GLY B 1 230 ? 91.996  82.639  40.793  0.40 27.00 ? 231  GLY B O   1 
ATOM   4659 N N   A ILE B 1 231 ? 90.560  81.466  38.512  0.60 29.25 ? 232  ILE B N   1 
ATOM   4660 N N   B ILE B 1 231 ? 90.598  82.972  39.084  0.40 28.34 ? 232  ILE B N   1 
ATOM   4661 C CA  A ILE B 1 231 ? 89.449  81.517  39.459  0.60 29.95 ? 232  ILE B CA  1 
ATOM   4662 C CA  B ILE B 1 231 ? 89.432  82.914  39.953  0.40 28.53 ? 232  ILE B CA  1 
ATOM   4663 C C   A ILE B 1 231 ? 88.551  80.295  39.320  0.60 28.81 ? 232  ILE B C   1 
ATOM   4664 C C   B ILE B 1 231 ? 88.609  81.655  39.701  0.40 29.31 ? 232  ILE B C   1 
ATOM   4665 O O   A ILE B 1 231 ? 88.839  79.371  38.545  0.60 28.07 ? 232  ILE B O   1 
ATOM   4666 O O   B ILE B 1 231 ? 88.978  80.797  38.903  0.40 28.26 ? 232  ILE B O   1 
ATOM   4667 C CB  A ILE B 1 231 ? 88.573  82.796  39.275  0.60 30.74 ? 232  ILE B CB  1 
ATOM   4668 C CB  B ILE B 1 231 ? 88.513  84.147  39.753  0.40 28.54 ? 232  ILE B CB  1 
ATOM   4669 C CG1 A ILE B 1 231 ? 87.808  82.730  37.954  0.60 28.44 ? 232  ILE B CG1 1 
ATOM   4670 C CG1 B ILE B 1 231 ? 87.788  84.053  38.406  0.40 29.07 ? 232  ILE B CG1 1 
ATOM   4671 C CG2 A ILE B 1 231 ? 89.451  84.041  39.298  0.60 29.41 ? 232  ILE B CG2 1 
ATOM   4672 C CG2 B ILE B 1 231 ? 89.339  85.413  39.801  0.40 28.20 ? 232  ILE B CG2 1 
ATOM   4673 C CD1 A ILE B 1 231 ? 86.859  83.869  37.744  0.60 29.70 ? 232  ILE B CD1 1 
ATOM   4674 C CD1 B ILE B 1 231 ? 86.773  85.168  38.171  0.40 29.38 ? 232  ILE B CD1 1 
ATOM   4675 N N   A ASP B 1 232 ? 87.474  80.292  40.092  0.60 30.07 ? 233  ASP B N   1 
ATOM   4676 N N   B ASP B 1 232 ? 87.489  81.555  40.400  0.40 30.35 ? 233  ASP B N   1 
ATOM   4677 C CA  A ASP B 1 232 ? 86.489  79.219  40.053  0.60 31.49 ? 233  ASP B CA  1 
ATOM   4678 C CA  B ASP B 1 232 ? 86.595  80.422  40.246  0.40 32.56 ? 233  ASP B CA  1 
ATOM   4679 C C   A ASP B 1 232 ? 85.129  79.825  39.702  0.60 31.69 ? 233  ASP B C   1 
ATOM   4680 C C   B ASP B 1 232 ? 85.214  80.958  39.876  0.40 31.33 ? 233  ASP B C   1 
ATOM   4681 O O   A ASP B 1 232 ? 84.778  80.915  40.169  0.60 30.29 ? 233  ASP B O   1 
ATOM   4682 O O   B ASP B 1 232 ? 84.776  81.980  40.396  0.40 31.12 ? 233  ASP B O   1 
ATOM   4683 C CB  A ASP B 1 232 ? 86.396  78.505  41.403  0.60 34.63 ? 233  ASP B CB  1 
ATOM   4684 C CB  B ASP B 1 232 ? 86.523  79.618  41.547  0.40 34.46 ? 233  ASP B CB  1 
ATOM   4685 C CG  A ASP B 1 232 ? 85.562  77.224  41.331  0.60 37.72 ? 233  ASP B CG  1 
ATOM   4686 C CG  B ASP B 1 232 ? 85.738  78.337  41.392  0.40 36.90 ? 233  ASP B CG  1 
ATOM   4687 O OD1 A ASP B 1 232 ? 84.311  77.303  41.220  0.60 39.62 ? 233  ASP B OD1 1 
ATOM   4688 O OD1 B ASP B 1 232 ? 84.496  78.406  41.254  0.40 39.46 ? 233  ASP B OD1 1 
ATOM   4689 O OD2 A ASP B 1 232 ? 86.166  76.126  41.370  0.60 40.01 ? 233  ASP B OD2 1 
ATOM   4690 O OD2 B ASP B 1 232 ? 86.366  77.257  41.394  0.40 39.45 ? 233  ASP B OD2 1 
ATOM   4691 N N   A ALA B 1 233 ? 84.371  79.105  38.881  0.60 31.51 ? 234  ALA B N   1 
ATOM   4692 N N   B ALA B 1 233 ? 84.540  80.261  38.968  0.40 31.45 ? 234  ALA B N   1 
ATOM   4693 C CA  A ALA B 1 233 ? 83.052  79.545  38.440  0.60 30.82 ? 234  ALA B CA  1 
ATOM   4694 C CA  B ALA B 1 233 ? 83.214  80.661  38.505  0.40 30.50 ? 234  ALA B CA  1 
ATOM   4695 C C   A ALA B 1 233 ? 82.151  80.008  39.583  0.60 30.65 ? 234  ALA B C   1 
ATOM   4696 C C   B ALA B 1 233 ? 82.202  80.896  39.624  0.40 30.47 ? 234  ALA B C   1 
ATOM   4697 O O   A ALA B 1 233 ? 81.291  80.882  39.399  0.60 30.23 ? 234  ALA B O   1 
ATOM   4698 O O   B ALA B 1 233 ? 81.326  81.751  39.501  0.40 28.82 ? 234  ALA B O   1 
ATOM   4699 C CB  A ALA B 1 233 ? 82.383  78.420  37.665  0.60 30.97 ? 234  ALA B CB  1 
ATOM   4700 C CB  B ALA B 1 233 ? 82.671  79.620  37.531  0.40 30.64 ? 234  ALA B CB  1 
ATOM   4701 N N   A THR B 1 234 ? 82.352  79.457  40.771  0.60 27.66 ? 235  THR B N   1 
ATOM   4702 N N   B THR B 1 234 ? 82.301  80.140  40.714  0.40 29.07 ? 235  THR B N   1 
ATOM   4703 C CA  A THR B 1 234 ? 81.506  79.834  41.900  0.60 29.36 ? 235  THR B CA  1 
ATOM   4704 C CA  B THR B 1 234 ? 81.336  80.310  41.803  0.40 29.55 ? 235  THR B CA  1 
ATOM   4705 C C   A THR B 1 234 ? 81.957  81.023  42.821  0.60 29.02 ? 235  THR B C   1 
ATOM   4706 C C   B THR B 1 234 ? 81.800  81.400  42.714  0.40 28.75 ? 235  THR B C   1 
ATOM   4707 O O   A THR B 1 234 ? 81.261  81.294  43.783  0.60 26.91 ? 235  THR B O   1 
ATOM   4708 O O   B THR B 1 234 ? 81.076  81.871  43.594  0.40 26.62 ? 235  THR B O   1 
ATOM   4709 C CB  A THR B 1 234 ? 81.239  78.591  42.793  0.60 31.17 ? 235  THR B CB  1 
ATOM   4710 C CB  B THR B 1 234 ? 81.191  79.048  42.628  0.40 30.83 ? 235  THR B CB  1 
ATOM   4711 O OG1 A THR B 1 234 ? 82.474  78.154  43.384  0.60 32.64 ? 235  THR B OG1 1 
ATOM   4712 O OG1 B THR B 1 234 ? 82.437  78.755  43.277  0.40 32.17 ? 235  THR B OG1 1 
ATOM   4713 C CG2 A THR B 1 234 ? 80.670  77.451  41.956  0.60 31.05 ? 235  THR B CG2 1 
ATOM   4714 C CG2 B THR B 1 234 ? 80.800  77.898  41.731  0.40 30.26 ? 235  THR B CG2 1 
ATOM   4715 N N   . ASP B 1 235 ? 83.052  81.760  42.521  1.00 28.20 ? 236  ASP B N   1 
ATOM   4716 C CA  . ASP B 1 235 ? 83.556  82.847  43.357  1.00 28.58 ? 236  ASP B CA  1 
ATOM   4717 C C   . ASP B 1 235 ? 82.545  83.964  43.400  1.00 27.19 ? 236  ASP B C   1 
ATOM   4718 O O   . ASP B 1 235 ? 82.017  84.359  42.358  1.00 26.88 ? 236  ASP B O   1 
ATOM   4719 C CB  . ASP B 1 235 ? 84.874  83.411  42.810  1.00 32.95 ? 236  ASP B CB  1 
ATOM   4720 C CG  . ASP B 1 235 ? 86.049  82.478  43.004  1.00 36.92 ? 236  ASP B CG  1 
ATOM   4721 O OD1 . ASP B 1 235 ? 85.931  81.455  43.731  1.00 37.01 ? 236  ASP B OD1 1 
ATOM   4722 O OD2 . ASP B 1 235 ? 87.116  82.782  42.425  1.00 38.28 ? 236  ASP B OD2 1 
ATOM   4723 N N   . LYS B 1 236 ? 82.251  84.460  44.592  1.00 22.34 ? 237  LYS B N   1 
ATOM   4724 C CA  . LYS B 1 236 ? 81.332  85.553  44.735  1.00 27.74 ? 237  LYS B CA  1 
ATOM   4725 C C   . LYS B 1 236 ? 81.972  86.574  45.660  1.00 29.56 ? 237  LYS B C   1 
ATOM   4726 O O   . LYS B 1 236 ? 81.610  86.730  46.830  1.00 28.39 ? 237  LYS B O   1 
ATOM   4727 C CB  . LYS B 1 236 ? 79.971  85.069  45.269  1.00 27.90 ? 237  LYS B CB  1 
ATOM   4728 C CG  . LYS B 1 236 ? 78.846  86.107  45.106  1.00 27.06 ? 237  LYS B CG  1 
ATOM   4729 C CD  . LYS B 1 236 ? 77.501  85.501  45.494  1.00 29.36 ? 237  LYS B CD  1 
ATOM   4730 C CE  . LYS B 1 236 ? 76.352  86.500  45.456  1.00 29.10 ? 237  LYS B CE  1 
ATOM   4731 N NZ  . LYS B 1 236 ? 76.341  87.410  46.638  1.00 32.88 ? 237  LYS B NZ  1 
ATOM   4732 N N   . GLY B 1 237 ? 82.951  87.289  45.115  1.00 32.31 ? 238  GLY B N   1 
ATOM   4733 C CA  . GLY B 1 237 ? 83.641  88.265  45.929  1.00 31.21 ? 238  GLY B CA  1 
ATOM   4734 C C   . GLY B 1 237 ? 84.763  87.586  46.689  1.00 32.86 ? 238  GLY B C   1 
ATOM   4735 O O   . GLY B 1 237 ? 85.150  88.044  47.745  1.00 34.45 ? 238  GLY B O   1 
ATOM   4736 N N   . LYS B 1 238 ? 85.285  86.492  46.155  1.00 34.37 ? 239  LYS B N   1 
ATOM   4737 C CA  . LYS B 1 238 ? 86.380  85.795  46.823  1.00 39.03 ? 239  LYS B CA  1 
ATOM   4738 C C   . LYS B 1 238 ? 87.645  86.653  46.686  1.00 41.43 ? 239  LYS B C   1 
ATOM   4739 O O   . LYS B 1 238 ? 87.797  87.406  45.713  1.00 39.65 ? 239  LYS B O   1 
ATOM   4740 C CB  . LYS B 1 238 ? 86.616  84.427  46.184  1.00 39.56 ? 239  LYS B CB  1 
ATOM   4741 C CG  . LYS B 1 238 ? 87.633  83.588  46.933  1.00 42.74 ? 239  LYS B CG  1 
ATOM   4742 C CD  . LYS B 1 238 ? 87.951  82.277  46.226  1.00 44.27 ? 239  LYS B CD  1 
ATOM   4743 C CE  . LYS B 1 238 ? 88.987  81.465  47.019  1.00 44.31 ? 239  LYS B CE  1 
ATOM   4744 N NZ  . LYS B 1 238 ? 89.814  80.567  46.129  1.00 45.23 ? 239  LYS B NZ  1 
ATOM   4745 N N   . GLU B 1 239 ? 88.556  86.525  47.650  1.00 40.97 ? 240  GLU B N   1 
ATOM   4746 C CA  . GLU B 1 239 ? 89.799  87.302  47.651  1.00 41.64 ? 240  GLU B CA  1 
ATOM   4747 C C   . GLU B 1 239 ? 90.980  86.602  47.022  1.00 42.06 ? 240  GLU B C   1 
ATOM   4748 O O   . GLU B 1 239 ? 91.186  85.406  47.206  1.00 40.73 ? 240  GLU B O   1 
ATOM   4749 C CB  . GLU B 1 239 ? 90.151  87.703  49.080  1.00 44.98 ? 240  GLU B CB  1 
ATOM   4750 C CG  . GLU B 1 239 ? 89.052  88.515  49.730  1.00 48.65 ? 240  GLU B CG  1 
ATOM   4751 C CD  . GLU B 1 239 ? 88.897  88.198  51.193  1.00 55.43 ? 240  GLU B CD  1 
ATOM   4752 O OE1 . GLU B 1 239 ? 89.779  88.611  51.982  1.00 57.83 ? 240  GLU B OE1 1 
ATOM   4753 O OE2 . GLU B 1 239 ? 87.897  87.523  51.557  1.00 59.02 ? 240  GLU B OE2 1 
ATOM   4754 N N   . TYR B 1 240 ? 91.757  87.361  46.255  1.00 43.27 ? 241  TYR B N   1 
ATOM   4755 C CA  . TYR B 1 240 ? 92.951  86.831  45.607  1.00 44.67 ? 241  TYR B CA  1 
ATOM   4756 C C   . TYR B 1 240 ? 93.994  87.946  45.694  1.00 47.30 ? 241  TYR B C   1 
ATOM   4757 O O   . TYR B 1 240 ? 94.501  88.427  44.674  1.00 48.19 ? 241  TYR B O   1 
ATOM   4758 C CB  . TYR B 1 240 ? 92.687  86.476  44.136  1.00 41.86 ? 241  TYR B CB  1 
ATOM   4759 C CG  . TYR B 1 240 ? 91.794  85.278  43.896  1.00 40.38 ? 241  TYR B CG  1 
ATOM   4760 C CD1 . TYR B 1 240 ? 90.409  85.409  43.876  1.00 38.52 ? 241  TYR B CD1 1 
ATOM   4761 C CD2 . TYR B 1 240 ? 92.341  84.013  43.659  1.00 38.72 ? 241  TYR B CD2 1 
ATOM   4762 C CE1 . TYR B 1 240 ? 89.588  84.309  43.618  1.00 39.00 ? 241  TYR B CE1 1 
ATOM   4763 C CE2 . TYR B 1 240 ? 91.534  82.910  43.409  1.00 38.25 ? 241  TYR B CE2 1 
ATOM   4764 C CZ  . TYR B 1 240 ? 90.152  83.062  43.387  1.00 38.54 ? 241  TYR B CZ  1 
ATOM   4765 O OH  . TYR B 1 240 ? 89.343  81.961  43.140  1.00 40.88 ? 241  TYR B OH  1 
ATOM   4766 N N   . GLY B 1 241 ? 94.314  88.329  46.932  1.00 48.81 ? 242  GLY B N   1 
ATOM   4767 C CA  . GLY B 1 241 ? 95.260  89.405  47.192  1.00 48.45 ? 242  GLY B CA  1 
ATOM   4768 C C   . GLY B 1 241 ? 94.393  90.419  47.899  1.00 47.88 ? 242  GLY B C   1 
ATOM   4769 O O   . GLY B 1 241 ? 93.654  90.064  48.815  1.00 48.96 ? 242  GLY B O   1 
ATOM   4770 N N   . GLY B 1 242 ? 94.473  91.675  47.492  1.00 46.88 ? 243  GLY B N   1 
ATOM   4771 C CA  . GLY B 1 242 ? 93.607  92.674  48.083  1.00 46.72 ? 243  GLY B CA  1 
ATOM   4772 C C   . GLY B 1 242 ? 92.399  92.767  47.146  1.00 45.87 ? 243  GLY B C   1 
ATOM   4773 O O   . GLY B 1 242 ? 91.405  93.456  47.415  1.00 44.77 ? 243  GLY B O   1 
ATOM   4774 N N   . LYS B 1 243 ? 92.502  92.026  46.046  1.00 44.21 ? 244  LYS B N   1 
ATOM   4775 C CA  . LYS B 1 243 ? 91.481  91.978  45.009  1.00 44.47 ? 244  LYS B CA  1 
ATOM   4776 C C   . LYS B 1 243 ? 90.320  91.012  45.344  1.00 45.70 ? 244  LYS B C   1 
ATOM   4777 O O   . LYS B 1 243 ? 90.393  90.274  46.337  1.00 45.72 ? 244  LYS B O   1 
ATOM   4778 C CB  . LYS B 1 243 ? 92.160  91.575  43.704  1.00 44.25 ? 244  LYS B CB  1 
ATOM   4779 C CG  . LYS B 1 243 ? 93.355  92.470  43.393  1.00 45.84 ? 244  LYS B CG  1 
ATOM   4780 C CD  . LYS B 1 243 ? 94.083  92.082  42.126  1.00 46.13 ? 244  LYS B CD  1 
ATOM   4781 C CE  . LYS B 1 243 ? 95.391  92.897  42.012  1.00 47.93 ? 244  LYS B CE  1 
ATOM   4782 N NZ  . LYS B 1 243 ? 95.297  94.369  42.220  1.00 46.94 ? 244  LYS B NZ  1 
ATOM   4783 N N   . ARG B 1 244 ? 89.260  91.031  44.525  1.00 43.41 ? 245  ARG B N   1 
ATOM   4784 C CA  . ARG B 1 244 ? 88.088  90.159  44.719  1.00 41.14 ? 245  ARG B CA  1 
ATOM   4785 C C   . ARG B 1 244 ? 87.588  89.705  43.358  1.00 41.20 ? 245  ARG B C   1 
ATOM   4786 O O   . ARG B 1 244 ? 87.685  90.459  42.378  1.00 39.24 ? 245  ARG B O   1 
ATOM   4787 C CB  . ARG B 1 244 ? 86.975  90.911  45.440  1.00 42.52 ? 245  ARG B CB  1 
ATOM   4788 C CG  . ARG B 1 244 ? 87.490  91.682  46.610  1.00 44.53 ? 245  ARG B CG  1 
ATOM   4789 C CD  . ARG B 1 244 ? 86.892  91.240  47.919  1.00 49.22 ? 245  ARG B CD  1 
ATOM   4790 N NE  . ARG B 1 244 ? 85.805  92.109  48.371  1.00 53.15 ? 245  ARG B NE  1 
ATOM   4791 C CZ  . ARG B 1 244 ? 85.775  93.440  48.229  1.00 55.83 ? 245  ARG B CZ  1 
ATOM   4792 N NH1 . ARG B 1 244 ? 86.781  94.082  47.630  1.00 56.40 ? 245  ARG B NH1 1 
ATOM   4793 N NH2 . ARG B 1 244 ? 84.739  94.140  48.704  1.00 53.91 ? 245  ARG B NH2 1 
ATOM   4794 N N   . ALA B 1 245 ? 87.060  88.482  43.295  1.00 37.38 ? 246  ALA B N   1 
ATOM   4795 C CA  . ALA B 1 245 ? 86.560  87.943  42.041  1.00 35.67 ? 246  ALA B CA  1 
ATOM   4796 C C   . ALA B 1 245 ? 85.119  87.411  42.087  1.00 36.62 ? 246  ALA B C   1 
ATOM   4797 O O   . ALA B 1 245 ? 84.662  86.868  43.105  1.00 34.60 ? 246  ALA B O   1 
ATOM   4798 C CB  . ALA B 1 245 ? 87.448  86.880  41.573  1.00 33.92 ? 246  ALA B CB  1 
ATOM   4799 N N   . PHE B 1 246 ? 84.417  87.600  40.964  1.00 33.12 ? 247  PHE B N   1 
ATOM   4800 C CA  . PHE B 1 246 ? 83.054  87.117  40.804  1.00 30.50 ? 247  PHE B CA  1 
ATOM   4801 C C   . PHE B 1 246 ? 83.033  86.227  39.559  1.00 30.97 ? 247  PHE B C   1 
ATOM   4802 O O   . PHE B 1 246 ? 83.250  86.700  38.437  1.00 32.00 ? 247  PHE B O   1 
ATOM   4803 C CB  . PHE B 1 246 ? 82.084  88.281  40.635  1.00 30.65 ? 247  PHE B CB  1 
ATOM   4804 C CG  . PHE B 1 246 ? 81.876  89.095  41.890  1.00 31.47 ? 247  PHE B CG  1 
ATOM   4805 C CD1 . PHE B 1 246 ? 82.758  90.119  42.232  1.00 32.61 ? 247  PHE B CD1 1 
ATOM   4806 C CD2 . PHE B 1 246 ? 80.817  88.824  42.739  1.00 28.02 ? 247  PHE B CD2 1 
ATOM   4807 C CE1 . PHE B 1 246 ? 82.587  90.862  43.414  1.00 28.72 ? 247  PHE B CE1 1 
ATOM   4808 C CE2 . PHE B 1 246 ? 80.628  89.555  43.922  1.00 27.16 ? 247  PHE B CE2 1 
ATOM   4809 C CZ  . PHE B 1 246 ? 81.516  90.575  44.261  1.00 30.13 ? 247  PHE B CZ  1 
ATOM   4810 N N   . GLY B 1 247 ? 82.800  84.935  39.763  1.00 27.13 ? 248  GLY B N   1 
ATOM   4811 C CA  . GLY B 1 247 ? 82.746  83.999  38.654  1.00 26.60 ? 248  GLY B CA  1 
ATOM   4812 C C   . GLY B 1 247 ? 81.337  84.037  38.101  1.00 27.50 ? 248  GLY B C   1 
ATOM   4813 O O   . GLY B 1 247 ? 80.431  84.615  38.737  1.00 25.75 ? 248  GLY B O   1 
ATOM   4814 N N   . ALA B 1 248 ? 81.127  83.394  36.956  1.00 28.30 ? 249  ALA B N   1 
ATOM   4815 C CA  . ALA B 1 248 ? 79.809  83.457  36.328  1.00 28.26 ? 249  ALA B CA  1 
ATOM   4816 C C   . ALA B 1 248 ? 78.727  82.782  37.175  1.00 29.36 ? 249  ALA B C   1 
ATOM   4817 O O   . ALA B 1 248 ? 77.602  83.256  37.237  1.00 28.60 ? 249  ALA B O   1 
ATOM   4818 C CB  . ALA B 1 248 ? 79.865  82.860  34.977  1.00 27.84 ? 249  ALA B CB  1 
ATOM   4819 N N   . LEU B 1 249 ? 79.075  81.701  37.856  1.00 29.05 ? 250  LEU B N   1 
ATOM   4820 C CA  . LEU B 1 249 ? 78.086  81.042  38.672  1.00 30.71 ? 250  LEU B CA  1 
ATOM   4821 C C   . LEU B 1 249 ? 77.719  81.889  39.884  1.00 30.78 ? 250  LEU B C   1 
ATOM   4822 O O   . LEU B 1 249 ? 76.545  81.917  40.297  1.00 30.85 ? 250  LEU B O   1 
ATOM   4823 C CB  . LEU B 1 249 ? 78.595  79.655  39.076  1.00 33.48 ? 250  LEU B CB  1 
ATOM   4824 C CG  . LEU B 1 249 ? 78.790  78.749  37.847  1.00 35.70 ? 250  LEU B CG  1 
ATOM   4825 C CD1 . LEU B 1 249 ? 79.402  77.432  38.308  1.00 37.31 ? 250  LEU B CD1 1 
ATOM   4826 C CD2 . LEU B 1 249 ? 77.466  78.508  37.115  1.00 34.94 ? 250  LEU B CD2 1 
ATOM   4827 N N   . GLY B 1 250 ? 78.691  82.590  40.457  1.00 28.01 ? 251  GLY B N   1 
ATOM   4828 C CA  . GLY B 1 250 ? 78.386  83.434  41.613  1.00 26.77 ? 251  GLY B CA  1 
ATOM   4829 C C   . GLY B 1 250 ? 77.415  84.544  41.197  1.00 26.44 ? 251  GLY B C   1 
ATOM   4830 O O   . GLY B 1 250 ? 76.458  84.908  41.908  1.00 25.82 ? 251  GLY B O   1 
ATOM   4831 N N   . ILE B 1 251 ? 77.680  85.104  40.021  1.00 26.93 ? 252  ILE B N   1 
ATOM   4832 C CA  . ILE B 1 251 ? 76.827  86.159  39.477  1.00 23.34 ? 252  ILE B CA  1 
ATOM   4833 C C   . ILE B 1 251 ? 75.460  85.566  39.100  1.00 23.14 ? 252  ILE B C   1 
ATOM   4834 O O   . ILE B 1 251 ? 74.431  86.180  39.358  1.00 21.77 ? 252  ILE B O   1 
ATOM   4835 C CB  . ILE B 1 251 ? 77.484  86.795  38.239  1.00 23.52 ? 252  ILE B CB  1 
ATOM   4836 C CG1 . ILE B 1 251 ? 78.674  87.663  38.694  1.00 23.95 ? 252  ILE B CG1 1 
ATOM   4837 C CG2 . ILE B 1 251 ? 76.515  87.735  37.529  1.00 24.16 ? 252  ILE B CG2 1 
ATOM   4838 C CD1 . ILE B 1 251 ? 79.634  88.044  37.542  1.00 21.38 ? 252  ILE B CD1 1 
ATOM   4839 N N   . GLY B 1 252 ? 75.479  84.382  38.488  1.00 24.31 ? 253  GLY B N   1 
ATOM   4840 C CA  . GLY B 1 252 ? 74.259  83.712  38.046  1.00 23.91 ? 253  GLY B CA  1 
ATOM   4841 C C   . GLY B 1 252 ? 73.293  83.396  39.169  1.00 24.29 ? 253  GLY B C   1 
ATOM   4842 O O   . GLY B 1 252 ? 72.080  83.312  38.955  1.00 23.80 ? 253  GLY B O   1 
ATOM   4843 N N   . GLY B 1 253 ? 73.830  83.220  40.375  1.00 24.95 ? 254  GLY B N   1 
ATOM   4844 C CA  . GLY B 1 253 ? 72.992  82.926  41.520  1.00 23.06 ? 254  GLY B CA  1 
ATOM   4845 C C   . GLY B 1 253 ? 72.094  84.107  41.803  1.00 23.22 ? 254  GLY B C   1 
ATOM   4846 O O   . GLY B 1 253 ? 70.907  83.951  42.095  1.00 21.34 ? 254  GLY B O   1 
ATOM   4847 N N   . LEU B 1 254 ? 72.658  85.310  41.734  1.00 21.87 ? 255  LEU B N   1 
ATOM   4848 C CA  . LEU B 1 254 ? 71.860  86.505  41.969  1.00 20.91 ? 255  LEU B CA  1 
ATOM   4849 C C   . LEU B 1 254 ? 70.980  86.725  40.742  1.00 20.26 ? 255  LEU B C   1 
ATOM   4850 O O   . LEU B 1 254 ? 69.828  87.073  40.894  1.00 19.82 ? 255  LEU B O   1 
ATOM   4851 C CB  . LEU B 1 254 ? 72.745  87.749  42.153  1.00 19.28 ? 255  LEU B CB  1 
ATOM   4852 C CG  . LEU B 1 254 ? 71.993  89.103  42.242  1.00 23.06 ? 255  LEU B CG  1 
ATOM   4853 C CD1 . LEU B 1 254 ? 71.007  89.153  43.427  1.00 23.18 ? 255  LEU B CD1 1 
ATOM   4854 C CD2 . LEU B 1 254 ? 73.020  90.237  42.346  1.00 21.58 ? 255  LEU B CD2 1 
ATOM   4855 N N   . LYS B 1 255 ? 71.532  86.555  39.538  1.00 19.03 ? 256  LYS B N   1 
ATOM   4856 C CA  . LYS B 1 255 ? 70.703  86.751  38.338  1.00 19.07 ? 256  LYS B CA  1 
ATOM   4857 C C   . LYS B 1 255 ? 69.366  85.941  38.432  1.00 21.51 ? 256  LYS B C   1 
ATOM   4858 O O   . LYS B 1 255 ? 68.296  86.468  38.111  1.00 20.22 ? 256  LYS B O   1 
ATOM   4859 C CB  . LYS B 1 255 ? 71.502  86.355  37.091  1.00 20.03 ? 256  LYS B CB  1 
ATOM   4860 C CG  . LYS B 1 255 ? 70.727  86.289  35.777  1.00 21.77 ? 256  LYS B CG  1 
ATOM   4861 C CD  . LYS B 1 255 ? 70.143  84.867  35.597  1.00 25.67 ? 256  LYS B CD  1 
ATOM   4862 C CE  . LYS B 1 255 ? 69.672  84.611  34.172  1.00 30.05 ? 256  LYS B CE  1 
ATOM   4863 N NZ  . LYS B 1 255 ? 68.430  85.359  33.837  1.00 26.74 ? 256  LYS B NZ  1 
ATOM   4864 N N   . LEU B 1 256 ? 69.426  84.682  38.883  1.00 22.77 ? 257  LEU B N   1 
ATOM   4865 C CA  . LEU B 1 256 ? 68.192  83.874  38.975  1.00 23.27 ? 257  LEU B CA  1 
ATOM   4866 C C   . LEU B 1 256 ? 67.173  84.498  39.910  1.00 23.97 ? 257  LEU B C   1 
ATOM   4867 O O   . LEU B 1 256 ? 66.013  84.651  39.549  1.00 22.02 ? 257  LEU B O   1 
ATOM   4868 C CB  . LEU B 1 256 ? 68.512  82.442  39.416  1.00 25.45 ? 257  LEU B CB  1 
ATOM   4869 C CG  . LEU B 1 256 ? 68.731  81.546  38.211  1.00 30.26 ? 257  LEU B CG  1 
ATOM   4870 C CD1 . LEU B 1 256 ? 69.523  80.269  38.537  1.00 31.68 ? 257  LEU B CD1 1 
ATOM   4871 C CD2 . LEU B 1 256 ? 67.323  81.196  37.670  1.00 28.53 ? 257  LEU B CD2 1 
ATOM   4872 N N   . LYS B 1 257 ? 67.610  84.866  41.118  1.00 19.47 ? 258  LYS B N   1 
ATOM   4873 C CA  . LYS B 1 257 ? 66.719  85.471  42.081  1.00 20.49 ? 258  LYS B CA  1 
ATOM   4874 C C   . LYS B 1 257 ? 66.168  86.787  41.558  1.00 17.80 ? 258  LYS B C   1 
ATOM   4875 O O   . LYS B 1 257 ? 65.001  87.104  41.763  1.00 16.77 ? 258  LYS B O   1 
ATOM   4876 C CB  . LYS B 1 257 ? 67.450  85.712  43.396  1.00 20.17 ? 258  LYS B CB  1 
ATOM   4877 C CG  . LYS B 1 257 ? 67.953  84.444  44.064  1.00 25.68 ? 258  LYS B CG  1 
ATOM   4878 C CD  . LYS B 1 257 ? 68.749  84.835  45.318  1.00 31.99 ? 258  LYS B CD  1 
ATOM   4879 C CE  . LYS B 1 257 ? 69.094  83.618  46.180  1.00 36.17 ? 258  LYS B CE  1 
ATOM   4880 N NZ  . LYS B 1 257 ? 70.080  82.731  45.474  1.00 41.13 ? 258  LYS B NZ  1 
ATOM   4881 N N   . LEU B 1 258 ? 67.020  87.560  40.899  1.00 20.01 ? 259  LEU B N   1 
ATOM   4882 C CA  . LEU B 1 258 ? 66.598  88.856  40.354  1.00 18.02 ? 259  LEU B CA  1 
ATOM   4883 C C   . LEU B 1 258 ? 65.547  88.669  39.247  1.00 18.35 ? 259  LEU B C   1 
ATOM   4884 O O   . LEU B 1 258 ? 64.538  89.371  39.183  1.00 17.15 ? 259  LEU B O   1 
ATOM   4885 C CB  . LEU B 1 258 ? 67.807  89.573  39.754  1.00 18.17 ? 259  LEU B CB  1 
ATOM   4886 C CG  . LEU B 1 258 ? 67.514  90.803  38.901  1.00 18.24 ? 259  LEU B CG  1 
ATOM   4887 C CD1 . LEU B 1 258 ? 67.000  91.952  39.821  1.00 20.09 ? 259  LEU B CD1 1 
ATOM   4888 C CD2 . LEU B 1 258 ? 68.866  91.232  38.250  1.00 18.21 ? 259  LEU B CD2 1 
ATOM   4889 N N   . HIS B 1 259 ? 65.824  87.758  38.340  1.00 18.64 ? 260  HIS B N   1 
ATOM   4890 C CA  . HIS B 1 259 ? 64.887  87.511  37.234  1.00 20.47 ? 260  HIS B CA  1 
ATOM   4891 C C   . HIS B 1 259 ? 63.523  87.011  37.830  1.00 18.56 ? 260  HIS B C   1 
ATOM   4892 O O   . HIS B 1 259 ? 62.473  87.462  37.435  1.00 18.20 ? 260  HIS B O   1 
ATOM   4893 C CB  . HIS B 1 259 ? 65.536  86.509  36.323  1.00 19.93 ? 260  HIS B CB  1 
ATOM   4894 C CG  . HIS B 1 259 ? 64.739  86.144  35.109  1.00 20.88 ? 260  HIS B CG  1 
ATOM   4895 N ND1 . HIS B 1 259 ? 65.311  85.487  34.040  1.00 25.60 ? 260  HIS B ND1 1 
ATOM   4896 C CD2 . HIS B 1 259 ? 63.433  86.317  34.795  1.00 21.74 ? 260  HIS B CD2 1 
ATOM   4897 C CE1 . HIS B 1 259 ? 64.391  85.275  33.113  1.00 24.64 ? 260  HIS B CE1 1 
ATOM   4898 N NE2 . HIS B 1 259 ? 63.245  85.767  33.547  1.00 25.33 ? 260  HIS B NE2 1 
ATOM   4899 N N   . ARG B 1 260 ? 63.546  86.125  38.818  1.00 21.03 ? 261  ARG B N   1 
ATOM   4900 C CA  . ARG B 1 260 ? 62.268  85.713  39.415  1.00 20.92 ? 261  ARG B CA  1 
ATOM   4901 C C   . ARG B 1 260 ? 61.556  86.925  40.017  1.00 21.43 ? 261  ARG B C   1 
ATOM   4902 O O   . ARG B 1 260 ? 60.329  87.103  39.854  1.00 23.03 ? 261  ARG B O   1 
ATOM   4903 C CB  . ARG B 1 260 ? 62.479  84.690  40.528  1.00 18.87 ? 261  ARG B CB  1 
ATOM   4904 C CG  . ARG B 1 260 ? 63.169  83.444  40.048  1.00 20.84 ? 261  ARG B CG  1 
ATOM   4905 C CD  . ARG B 1 260 ? 63.426  82.451  41.177  1.00 26.36 ? 261  ARG B CD  1 
ATOM   4906 N NE  . ARG B 1 260 ? 64.188  81.309  40.683  1.00 27.98 ? 261  ARG B NE  1 
ATOM   4907 C CZ  . ARG B 1 260 ? 65.111  80.663  41.397  1.00 33.79 ? 261  ARG B CZ  1 
ATOM   4908 N NH1 . ARG B 1 260 ? 65.386  81.056  42.646  1.00 35.49 ? 261  ARG B NH1 1 
ATOM   4909 N NH2 . ARG B 1 260 ? 65.757  79.622  40.869  1.00 31.58 ? 261  ARG B NH2 1 
ATOM   4910 N N   . ALA B 1 261 ? 62.327  87.759  40.717  1.00 20.62 ? 262  ALA B N   1 
ATOM   4911 C CA  . ALA B 1 261 ? 61.755  88.923  41.395  1.00 19.26 ? 262  ALA B CA  1 
ATOM   4912 C C   . ALA B 1 261 ? 61.166  89.905  40.414  1.00 17.37 ? 262  ALA B C   1 
ATOM   4913 O O   . ALA B 1 261 ? 60.150  90.515  40.707  1.00 20.84 ? 262  ALA B O   1 
ATOM   4914 C CB  . ALA B 1 261 ? 62.827  89.647  42.278  1.00 22.58 ? 262  ALA B CB  1 
ATOM   4915 N N   . CYS B 1 262 ? 61.791  90.076  39.255  1.00 20.31 ? 263  CYS B N   1 
ATOM   4916 C CA  . CYS B 1 262 ? 61.214  91.014  38.280  1.00 21.64 ? 263  CYS B CA  1 
ATOM   4917 C C   . CYS B 1 262 ? 59.855  90.496  37.824  1.00 21.25 ? 263  CYS B C   1 
ATOM   4918 O O   . CYS B 1 262 ? 58.903  91.265  37.671  1.00 22.09 ? 263  CYS B O   1 
ATOM   4919 C CB  . CYS B 1 262 ? 62.094  91.147  37.039  1.00 21.04 ? 263  CYS B CB  1 
ATOM   4920 S SG  . CYS B 1 262 ? 63.691  91.995  37.373  1.00 25.03 ? 263  CYS B SG  1 
ATOM   4921 N N   . ILE B 1 263 ? 59.772  89.192  37.560  1.00 19.59 ? 264  ILE B N   1 
ATOM   4922 C CA  . ILE B 1 263 ? 58.504  88.645  37.090  1.00 18.21 ? 264  ILE B CA  1 
ATOM   4923 C C   . ILE B 1 263 ? 57.399  88.989  38.084  1.00 19.27 ? 264  ILE B C   1 
ATOM   4924 O O   . ILE B 1 263 ? 56.317  89.414  37.699  1.00 18.45 ? 264  ILE B O   1 
ATOM   4925 C CB  . ILE B 1 263 ? 58.579  87.103  36.931  1.00 20.91 ? 264  ILE B CB  1 
ATOM   4926 C CG1 . ILE B 1 263 ? 59.559  86.732  35.817  1.00 18.78 ? 264  ILE B CG1 1 
ATOM   4927 C CG2 . ILE B 1 263 ? 57.170  86.538  36.642  1.00 20.37 ? 264  ILE B CG2 1 
ATOM   4928 C CD1 . ILE B 1 263 ? 59.149  87.297  34.445  1.00 22.16 ? 264  ILE B CD1 1 
ATOM   4929 N N   . ALA B 1 264 ? 57.697  88.877  39.379  1.00 18.69 ? 265  ALA B N   1 
ATOM   4930 C CA  . ALA B 1 264 ? 56.677  89.146  40.349  1.00 19.12 ? 265  ALA B CA  1 
ATOM   4931 C C   . ALA B 1 264 ? 56.246  90.625  40.264  1.00 20.04 ? 265  ALA B C   1 
ATOM   4932 O O   . ALA B 1 264 ? 55.091  90.937  40.437  1.00 20.84 ? 265  ALA B O   1 
ATOM   4933 C CB  . ALA B 1 264 ? 57.178  88.804  41.775  1.00 21.98 ? 265  ALA B CB  1 
ATOM   4934 N N   . LYS B 1 265 ? 57.192  91.522  40.017  1.00 18.11 ? 266  LYS B N   1 
ATOM   4935 C CA  . LYS B 1 265 ? 56.885  92.951  39.926  1.00 21.68 ? 266  LYS B CA  1 
ATOM   4936 C C   . LYS B 1 265 ? 55.912  93.263  38.782  1.00 19.25 ? 266  LYS B C   1 
ATOM   4937 O O   . LYS B 1 265 ? 55.164  94.245  38.869  1.00 18.78 ? 266  LYS B O   1 
ATOM   4938 C CB  . LYS B 1 265 ? 58.162  93.773  39.642  1.00 23.73 ? 266  LYS B CB  1 
ATOM   4939 C CG  . LYS B 1 265 ? 59.261  93.713  40.670  1.00 27.89 ? 266  LYS B CG  1 
ATOM   4940 C CD  . LYS B 1 265 ? 58.838  94.351  41.969  1.00 29.04 ? 266  LYS B CD  1 
ATOM   4941 C CE  . LYS B 1 265 ? 60.114  94.676  42.808  1.00 31.32 ? 266  LYS B CE  1 
ATOM   4942 N NZ  . LYS B 1 265 ? 59.871  94.681  44.291  1.00 27.51 ? 266  LYS B NZ  1 
ATOM   4943 N N   . LEU B 1 266 ? 55.946  92.459  37.713  1.00 17.92 ? 267  LEU B N   1 
ATOM   4944 C CA  . LEU B 1 266 ? 55.056  92.703  36.549  1.00 17.89 ? 267  LEU B CA  1 
ATOM   4945 C C   . LEU B 1 266 ? 53.573  92.625  36.926  1.00 21.36 ? 267  LEU B C   1 
ATOM   4946 O O   . LEU B 1 266 ? 52.730  93.231  36.246  1.00 22.16 ? 267  LEU B O   1 
ATOM   4947 C CB  . LEU B 1 266 ? 55.362  91.706  35.416  1.00 16.98 ? 267  LEU B CB  1 
ATOM   4948 C CG  . LEU B 1 266 ? 56.826  91.631  34.989  1.00 20.54 ? 267  LEU B CG  1 
ATOM   4949 C CD1 . LEU B 1 266 ? 57.054  90.611  33.862  1.00 18.92 ? 267  LEU B CD1 1 
ATOM   4950 C CD2 . LEU B 1 266 ? 57.226  92.993  34.495  1.00 21.71 ? 267  LEU B CD2 1 
ATOM   4951 N N   . PHE B 1 267 ? 53.259  91.901  38.013  1.00 19.28 ? 268  PHE B N   1 
ATOM   4952 C CA  . PHE B 1 267 ? 51.876  91.741  38.475  1.00 20.17 ? 268  PHE B CA  1 
ATOM   4953 C C   . PHE B 1 267 ? 51.447  92.672  39.609  1.00 21.62 ? 268  PHE B C   1 
ATOM   4954 O O   . PHE B 1 267 ? 50.309  92.584  40.090  1.00 23.78 ? 268  PHE B O   1 
ATOM   4955 C CB  . PHE B 1 267 ? 51.614  90.260  38.839  1.00 18.89 ? 268  PHE B CB  1 
ATOM   4956 C CG  . PHE B 1 267 ? 51.828  89.324  37.659  1.00 18.64 ? 268  PHE B CG  1 
ATOM   4957 C CD1 . PHE B 1 267 ? 52.893  88.446  37.624  1.00 20.78 ? 268  PHE B CD1 1 
ATOM   4958 C CD2 . PHE B 1 267 ? 50.973  89.393  36.537  1.00 19.91 ? 268  PHE B CD2 1 
ATOM   4959 C CE1 . PHE B 1 267 ? 53.132  87.639  36.494  1.00 18.66 ? 268  PHE B CE1 1 
ATOM   4960 C CE2 . PHE B 1 267 ? 51.185  88.620  35.436  1.00 16.69 ? 268  PHE B CE2 1 
ATOM   4961 C CZ  . PHE B 1 267 ? 52.274  87.726  35.388  1.00 18.88 ? 268  PHE B CZ  1 
ATOM   4962 N N   . GLU B 1 268 ? 52.338  93.586  40.002  1.00 22.85 ? 269  GLU B N   1 
ATOM   4963 C CA  . GLU B 1 268 ? 52.030  94.539  41.074  1.00 24.31 ? 269  GLU B CA  1 
ATOM   4964 C C   . GLU B 1 268 ? 51.429  95.847  40.558  1.00 26.36 ? 269  GLU B C   1 
ATOM   4965 O O   . GLU B 1 268 ? 50.900  96.630  41.355  1.00 26.58 ? 269  GLU B O   1 
ATOM   4966 C CB  . GLU B 1 268 ? 53.286  94.817  41.908  1.00 27.59 ? 269  GLU B CB  1 
ATOM   4967 C CG  . GLU B 1 268 ? 53.832  93.517  42.536  1.00 29.20 ? 269  GLU B CG  1 
ATOM   4968 C CD  . GLU B 1 268 ? 55.085  93.711  43.381  1.00 29.33 ? 269  GLU B CD  1 
ATOM   4969 O OE1 . GLU B 1 268 ? 55.652  94.826  43.384  1.00 26.68 ? 269  GLU B OE1 1 
ATOM   4970 O OE2 . GLU B 1 268 ? 55.489  92.724  44.025  1.00 31.21 ? 269  GLU B OE2 1 
ATOM   4971 N N   . SER B 1 269 ? 51.509  96.080  39.241  1.00 21.34 ? 270  SER B N   1 
ATOM   4972 C CA  . SER B 1 269 ? 50.900  97.282  38.621  1.00 23.58 ? 270  SER B CA  1 
ATOM   4973 C C   . SER B 1 269 ? 50.828  96.961  37.134  1.00 19.62 ? 270  SER B C   1 
ATOM   4974 O O   . SER B 1 269 ? 51.431  95.994  36.689  1.00 19.26 ? 270  SER B O   1 
ATOM   4975 C CB  . SER B 1 269 ? 51.774  98.543  38.802  1.00 23.74 ? 270  SER B CB  1 
ATOM   4976 O OG  . SER B 1 269 ? 52.824  98.615  37.834  1.00 26.66 ? 270  SER B OG  1 
ATOM   4977 N N   . SER B 1 270 ? 50.141  97.787  36.363  1.00 20.90 ? 271  SER B N   1 
ATOM   4978 C CA  . SER B 1 270 ? 50.073  97.575  34.912  1.00 21.23 ? 271  SER B CA  1 
ATOM   4979 C C   . SER B 1 270 ? 50.921  98.607  34.177  1.00 24.16 ? 271  SER B C   1 
ATOM   4980 O O   . SER B 1 270 ? 50.776  98.796  32.968  1.00 24.61 ? 271  SER B O   1 
ATOM   4981 C CB  . SER B 1 270 ? 48.633  97.659  34.429  1.00 24.62 ? 271  SER B CB  1 
ATOM   4982 O OG  . SER B 1 270 ? 48.002  98.817  34.951  1.00 26.25 ? 271  SER B OG  1 
ATOM   4983 N N   . GLU B 1 271 ? 51.832  99.251  34.898  1.00 25.72 ? 272  GLU B N   1 
ATOM   4984 C CA  . GLU B 1 271 ? 52.672  100.279 34.300  1.00 26.12 ? 272  GLU B CA  1 
ATOM   4985 C C   . GLU B 1 271 ? 54.155  100.004 34.366  1.00 26.45 ? 272  GLU B C   1 
ATOM   4986 O O   . GLU B 1 271 ? 54.953  100.872 34.002  1.00 25.65 ? 272  GLU B O   1 
ATOM   4987 C CB  . GLU B 1 271 ? 52.422  101.643 34.953  1.00 30.01 ? 272  GLU B CB  1 
ATOM   4988 C CG  . GLU B 1 271 ? 50.982  101.993 35.168  1.00 36.92 ? 272  GLU B CG  1 
ATOM   4989 C CD  . GLU B 1 271 ? 50.827  103.380 35.763  1.00 41.29 ? 272  GLU B CD  1 
ATOM   4990 O OE1 . GLU B 1 271 ? 50.512  104.321 35.001  1.00 46.14 ? 272  GLU B OE1 1 
ATOM   4991 O OE2 . GLU B 1 271 ? 51.039  103.532 36.991  1.00 45.27 ? 272  GLU B OE2 1 
ATOM   4992 N N   . GLY B 1 272 ? 54.545  98.812  34.805  1.00 25.95 ? 273  GLY B N   1 
ATOM   4993 C CA  . GLY B 1 272 ? 55.970  98.551  34.900  1.00 25.23 ? 273  GLY B CA  1 
ATOM   4994 C C   . GLY B 1 272 ? 56.703  98.392  33.578  1.00 26.45 ? 273  GLY B C   1 
ATOM   4995 O O   . GLY B 1 272 ? 56.166  97.817  32.639  1.00 23.49 ? 273  GLY B O   1 
ATOM   4996 N N   . VAL B 1 273 ? 57.929  98.921  33.495  1.00 24.46 ? 274  VAL B N   1 
ATOM   4997 C CA  . VAL B 1 273 ? 58.731  98.747  32.292  1.00 25.20 ? 274  VAL B CA  1 
ATOM   4998 C C   . VAL B 1 273 ? 60.084  98.258  32.785  1.00 26.22 ? 274  VAL B C   1 
ATOM   4999 O O   . VAL B 1 273 ? 60.898  99.036  33.262  1.00 27.12 ? 274  VAL B O   1 
ATOM   5000 C CB  . VAL B 1 273 ? 58.901  100.054 31.509  1.00 26.40 ? 274  VAL B CB  1 
ATOM   5001 C CG1 . VAL B 1 273 ? 59.816  99.816  30.289  1.00 25.33 ? 274  VAL B CG1 1 
ATOM   5002 C CG2 . VAL B 1 273 ? 57.531  100.566 31.080  1.00 24.46 ? 274  VAL B CG2 1 
ATOM   5003 N N   . PHE B 1 274 ? 60.313  96.959  32.683  1.00 23.12 ? 275  PHE B N   1 
ATOM   5004 C CA  . PHE B 1 274 ? 61.555  96.390  33.163  1.00 24.41 ? 275  PHE B CA  1 
ATOM   5005 C C   . PHE B 1 274 ? 62.567  96.101  32.067  1.00 23.34 ? 275  PHE B C   1 
ATOM   5006 O O   . PHE B 1 274 ? 62.521  95.068  31.413  1.00 24.00 ? 275  PHE B O   1 
ATOM   5007 C CB  . PHE B 1 274 ? 61.262  95.137  34.008  1.00 24.47 ? 275  PHE B CB  1 
ATOM   5008 C CG  . PHE B 1 274 ? 60.660  95.447  35.360  1.00 27.44 ? 275  PHE B CG  1 
ATOM   5009 C CD1 . PHE B 1 274 ? 59.336  95.844  35.474  1.00 26.54 ? 275  PHE B CD1 1 
ATOM   5010 C CD2 . PHE B 1 274 ? 61.463  95.456  36.505  1.00 28.63 ? 275  PHE B CD2 1 
ATOM   5011 C CE1 . PHE B 1 274 ? 58.815  96.264  36.704  1.00 29.97 ? 275  PHE B CE1 1 
ATOM   5012 C CE2 . PHE B 1 274 ? 60.953  95.877  37.746  1.00 28.12 ? 275  PHE B CE2 1 
ATOM   5013 C CZ  . PHE B 1 274 ? 59.620  96.289  37.842  1.00 26.21 ? 275  PHE B CZ  1 
ATOM   5014 N N   . ASP B 1 275 ? 63.468  97.064  31.859  1.00 24.63 ? 276  ASP B N   1 
ATOM   5015 C CA  . ASP B 1 275 ? 64.547  96.962  30.884  1.00 25.59 ? 276  ASP B CA  1 
ATOM   5016 C C   . ASP B 1 275 ? 65.779  97.151  31.801  1.00 24.97 ? 276  ASP B C   1 
ATOM   5017 O O   . ASP B 1 275 ? 65.642  97.122  33.045  1.00 22.60 ? 276  ASP B O   1 
ATOM   5018 C CB  . ASP B 1 275 ? 64.429  98.110  29.849  1.00 24.10 ? 276  ASP B CB  1 
ATOM   5019 C CG  . ASP B 1 275 ? 65.264  97.872  28.588  1.00 25.28 ? 276  ASP B CG  1 
ATOM   5020 O OD1 . ASP B 1 275 ? 66.219  97.034  28.571  1.00 21.52 ? 276  ASP B OD1 1 
ATOM   5021 O OD2 . ASP B 1 275 ? 64.955  98.554  27.587  1.00 25.69 ? 276  ASP B OD2 1 
ATOM   5022 N N   . ALA B 1 276 ? 66.950  97.380  31.215  1.00 24.74 ? 277  ALA B N   1 
ATOM   5023 C CA  . ALA B 1 276 ? 68.179  97.557  32.006  1.00 26.42 ? 277  ALA B CA  1 
ATOM   5024 C C   . ALA B 1 276 ? 68.086  98.495  33.204  1.00 25.46 ? 277  ALA B C   1 
ATOM   5025 O O   . ALA B 1 276 ? 68.558  98.162  34.286  1.00 25.66 ? 277  ALA B O   1 
ATOM   5026 C CB  . ALA B 1 276 ? 69.329  97.996  31.106  1.00 26.91 ? 277  ALA B CB  1 
ATOM   5027 N N   . GLU B 1 277 ? 67.476  99.655  33.044  1.00 26.18 ? 278  GLU B N   1 
ATOM   5028 C CA  . GLU B 1 277 ? 67.404  100.594 34.167  1.00 26.98 ? 278  GLU B CA  1 
ATOM   5029 C C   . GLU B 1 277 ? 66.685  100.119 35.416  1.00 29.48 ? 278  GLU B C   1 
ATOM   5030 O O   . GLU B 1 277 ? 67.236  100.197 36.545  1.00 29.98 ? 278  GLU B O   1 
ATOM   5031 C CB  . GLU B 1 277 ? 66.784  101.933 33.738  1.00 26.88 ? 278  GLU B CB  1 
ATOM   5032 C CG  . GLU B 1 277 ? 67.622  102.743 32.752  1.00 26.84 ? 278  GLU B CG  1 
ATOM   5033 C CD  . GLU B 1 277 ? 67.284  102.379 31.291  1.00 31.66 ? 278  GLU B CD  1 
ATOM   5034 O OE1 . GLU B 1 277 ? 67.670  103.124 30.370  1.00 30.49 ? 278  GLU B OE1 1 
ATOM   5035 O OE2 . GLU B 1 277 ? 66.639  101.332 31.071  1.00 29.93 ? 278  GLU B OE2 1 
ATOM   5036 N N   . GLU B 1 278 ? 65.456  99.652  35.238  1.00 24.50 ? 279  GLU B N   1 
ATOM   5037 C CA  . GLU B 1 278 ? 64.671  99.198  36.373  1.00 24.47 ? 279  GLU B CA  1 
ATOM   5038 C C   . GLU B 1 278 ? 65.181  97.863  36.907  1.00 23.05 ? 279  GLU B C   1 
ATOM   5039 O O   . GLU B 1 278 ? 65.177  97.620  38.114  1.00 24.30 ? 279  GLU B O   1 
ATOM   5040 C CB  . GLU B 1 278 ? 63.204  99.096  35.990  1.00 28.04 ? 279  GLU B CB  1 
ATOM   5041 C CG  . GLU B 1 278 ? 62.506  100.450 35.935  1.00 34.54 ? 279  GLU B CG  1 
ATOM   5042 C CD  . GLU B 1 278 ? 62.513  101.201 37.263  1.00 38.72 ? 279  GLU B CD  1 
ATOM   5043 O OE1 . GLU B 1 278 ? 62.528  102.451 37.218  1.00 40.26 ? 279  GLU B OE1 1 
ATOM   5044 O OE2 . GLU B 1 278 ? 62.488  100.565 38.341  1.00 37.65 ? 279  GLU B OE2 1 
ATOM   5045 N N   . ILE B 1 279 ? 65.663  97.007  36.020  1.00 22.88 ? 280  ILE B N   1 
ATOM   5046 C CA  . ILE B 1 279 ? 66.181  95.721  36.482  1.00 22.83 ? 280  ILE B CA  1 
ATOM   5047 C C   . ILE B 1 279 ? 67.414  95.958  37.365  1.00 24.93 ? 280  ILE B C   1 
ATOM   5048 O O   . ILE B 1 279 ? 67.525  95.377  38.462  1.00 21.87 ? 280  ILE B O   1 
ATOM   5049 C CB  . ILE B 1 279 ? 66.496  94.802  35.285  1.00 22.65 ? 280  ILE B CB  1 
ATOM   5050 C CG1 . ILE B 1 279 ? 65.170  94.329  34.671  1.00 23.64 ? 280  ILE B CG1 1 
ATOM   5051 C CG2 . ILE B 1 279 ? 67.417  93.653  35.717  1.00 19.84 ? 280  ILE B CG2 1 
ATOM   5052 C CD1 . ILE B 1 279 ? 65.278  93.871  33.195  1.00 26.15 ? 280  ILE B CD1 1 
ATOM   5053 N N   . TYR B 1 280 ? 68.320  96.827  36.905  1.00 23.45 ? 281  TYR B N   1 
ATOM   5054 C CA  . TYR B 1 280 ? 69.514  97.161  37.690  1.00 27.23 ? 281  TYR B CA  1 
ATOM   5055 C C   . TYR B 1 280 ? 69.138  97.809  39.042  1.00 27.67 ? 281  TYR B C   1 
ATOM   5056 O O   . TYR B 1 280 ? 69.749  97.507  40.081  1.00 29.04 ? 281  TYR B O   1 
ATOM   5057 C CB  . TYR B 1 280 ? 70.421  98.107  36.899  1.00 29.84 ? 281  TYR B CB  1 
ATOM   5058 C CG  . TYR B 1 280 ? 71.689  98.457  37.650  1.00 34.09 ? 281  TYR B CG  1 
ATOM   5059 C CD1 . TYR B 1 280 ? 72.556  97.453  38.090  1.00 36.01 ? 281  TYR B CD1 1 
ATOM   5060 C CD2 . TYR B 1 280 ? 72.021  99.789  37.926  1.00 35.69 ? 281  TYR B CD2 1 
ATOM   5061 C CE1 . TYR B 1 280 ? 73.734  97.773  38.789  1.00 36.70 ? 281  TYR B CE1 1 
ATOM   5062 C CE2 . TYR B 1 280 ? 73.193  100.120 38.628  1.00 36.98 ? 281  TYR B CE2 1 
ATOM   5063 C CZ  . TYR B 1 280 ? 74.040  99.107  39.046  1.00 38.13 ? 281  TYR B CZ  1 
ATOM   5064 O OH  . TYR B 1 280 ? 75.211  99.423  39.692  1.00 38.15 ? 281  TYR B OH  1 
ATOM   5065 N N   . LYS B 1 281 ? 68.154  98.700  39.032  1.00 25.79 ? 282  LYS B N   1 
ATOM   5066 C CA  . LYS B 1 281 ? 67.688  99.293  40.262  1.00 28.99 ? 282  LYS B CA  1 
ATOM   5067 C C   . LYS B 1 281 ? 67.228  98.189  41.257  1.00 29.54 ? 282  LYS B C   1 
ATOM   5068 O O   . LYS B 1 281 ? 67.481  98.294  42.483  1.00 29.40 ? 282  LYS B O   1 
ATOM   5069 C CB  . LYS B 1 281 ? 66.541  100.256 39.978  1.00 31.69 ? 282  LYS B CB  1 
ATOM   5070 C CG  . LYS B 1 281 ? 66.014  100.957 41.200  1.00 39.02 ? 282  LYS B CG  1 
ATOM   5071 C CD  . LYS B 1 281 ? 64.827  101.871 40.861  1.00 44.31 ? 282  LYS B CD  1 
ATOM   5072 C CE  . LYS B 1 281 ? 64.242  102.494 42.133  1.00 49.14 ? 282  LYS B CE  1 
ATOM   5073 N NZ  . LYS B 1 281 ? 62.816  102.943 41.969  1.00 50.63 ? 282  LYS B NZ  1 
ATOM   5074 N N   . LEU B 1 282 ? 66.545  97.143  40.762  1.00 26.12 ? 283  LEU B N   1 
ATOM   5075 C CA  . LEU B 1 282 ? 66.141  96.042  41.655  1.00 23.93 ? 283  LEU B CA  1 
ATOM   5076 C C   . LEU B 1 282 ? 67.381  95.201  42.014  1.00 23.42 ? 283  LEU B C   1 
ATOM   5077 O O   . LEU B 1 282 ? 67.550  94.786  43.179  1.00 24.36 ? 283  LEU B O   1 
ATOM   5078 C CB  . LEU B 1 282 ? 65.043  95.170  41.020  1.00 23.58 ? 283  LEU B CB  1 
ATOM   5079 C CG  . LEU B 1 282 ? 64.481  93.997  41.823  1.00 24.85 ? 283  LEU B CG  1 
ATOM   5080 C CD1 . LEU B 1 282 ? 63.955  94.488  43.166  1.00 24.09 ? 283  LEU B CD1 1 
ATOM   5081 C CD2 . LEU B 1 282 ? 63.352  93.307  41.026  1.00 22.75 ? 283  LEU B CD2 1 
ATOM   5082 N N   . ALA B 1 283 ? 68.271  94.973  41.052  1.00 21.41 ? 284  ALA B N   1 
ATOM   5083 C CA  . ALA B 1 283 ? 69.505  94.219  41.324  1.00 22.88 ? 284  ALA B CA  1 
ATOM   5084 C C   . ALA B 1 283 ? 70.319  94.822  42.487  1.00 28.43 ? 284  ALA B C   1 
ATOM   5085 O O   . ALA B 1 283 ? 70.898  94.075  43.321  1.00 23.54 ? 284  ALA B O   1 
ATOM   5086 C CB  . ALA B 1 283 ? 70.393  94.158  40.090  1.00 21.53 ? 284  ALA B CB  1 
ATOM   5087 N N   . LYS B 1 284 ? 70.379  96.158  42.548  1.00 27.12 ? 285  LYS B N   1 
ATOM   5088 C CA  . LYS B 1 284 ? 71.128  96.800  43.632  1.00 28.14 ? 285  LYS B CA  1 
ATOM   5089 C C   . LYS B 1 284 ? 70.418  96.574  44.955  1.00 30.90 ? 285  LYS B C   1 
ATOM   5090 O O   . LYS B 1 284 ? 71.060  96.402  45.980  1.00 30.66 ? 285  LYS B O   1 
ATOM   5091 C CB  . LYS B 1 284 ? 71.307  98.304  43.390  1.00 27.03 ? 285  LYS B CB  1 
ATOM   5092 C CG  . LYS B 1 284 ? 72.290  98.619  42.273  1.00 30.96 ? 285  LYS B CG  1 
ATOM   5093 C CD  . LYS B 1 284 ? 72.546  100.119 42.126  1.00 35.59 ? 285  LYS B CD  1 
ATOM   5094 C CE  . LYS B 1 284 ? 73.709  100.569 43.032  1.00 40.66 ? 285  LYS B CE  1 
ATOM   5095 N NZ  . LYS B 1 284 ? 74.019  102.025 42.860  1.00 42.20 ? 285  LYS B NZ  1 
ATOM   5096 N N   . GLU B 1 285 ? 69.093  96.596  44.946  1.00 31.75 ? 286  GLU B N   1 
ATOM   5097 C CA  . GLU B 1 285 ? 68.357  96.356  46.169  1.00 32.64 ? 286  GLU B CA  1 
ATOM   5098 C C   . GLU B 1 285 ? 68.575  94.938  46.685  1.00 32.88 ? 286  GLU B C   1 
ATOM   5099 O O   . GLU B 1 285 ? 68.579  94.706  47.892  1.00 33.05 ? 286  GLU B O   1 
ATOM   5100 C CB  . GLU B 1 285 ? 66.876  96.545  45.939  1.00 36.04 ? 286  GLU B CB  1 
ATOM   5101 C CG  . GLU B 1 285 ? 66.450  97.988  45.807  1.00 45.34 ? 286  GLU B CG  1 
ATOM   5102 C CD  . GLU B 1 285 ? 65.028  98.137  45.252  1.00 50.53 ? 286  GLU B CD  1 
ATOM   5103 O OE1 . GLU B 1 285 ? 64.145  97.312  45.607  1.00 51.89 ? 286  GLU B OE1 1 
ATOM   5104 O OE2 . GLU B 1 285 ? 64.802  99.092  44.468  1.00 53.87 ? 286  GLU B OE2 1 
ATOM   5105 N N   . MET B 1 286 ? 68.763  93.985  45.778  1.00 31.23 ? 287  MET B N   1 
ATOM   5106 C CA  . MET B 1 286 ? 68.920  92.597  46.177  1.00 28.47 ? 287  MET B CA  1 
ATOM   5107 C C   . MET B 1 286 ? 70.336  92.056  46.329  1.00 29.35 ? 287  MET B C   1 
ATOM   5108 O O   . MET B 1 286 ? 70.507  90.998  46.939  1.00 28.66 ? 287  MET B O   1 
ATOM   5109 C CB  . MET B 1 286 ? 68.188  91.680  45.171  1.00 30.27 ? 287  MET B CB  1 
ATOM   5110 C CG  . MET B 1 286 ? 66.693  91.932  45.010  1.00 27.60 ? 287  MET B CG  1 
ATOM   5111 S SD  . MET B 1 286 ? 65.979  90.908  43.689  1.00 29.91 ? 287  MET B SD  1 
ATOM   5112 C CE  . MET B 1 286 ? 66.300  89.177  44.354  1.00 26.84 ? 287  MET B CE  1 
ATOM   5113 N N   . ALA B 1 287 ? 71.345  92.740  45.774  1.00 28.40 ? 288  ALA B N   1 
ATOM   5114 C CA  . ALA B 1 287 ? 72.718  92.250  45.814  1.00 30.37 ? 288  ALA B CA  1 
ATOM   5115 C C   . ALA B 1 287 ? 73.311  92.114  47.221  1.00 32.59 ? 288  ALA B C   1 
ATOM   5116 O O   . ALA B 1 287 ? 74.147  91.203  47.421  1.00 33.18 ? 288  ALA B O   1 
ATOM   5117 C CB  . ALA B 1 287 ? 73.643  93.141  44.939  1.00 29.24 ? 288  ALA B CB  1 
ATOM   5118 O OXT . ALA B 1 287 ? 72.942  92.926  48.084  1.00 32.46 ? 288  ALA B OXT 1 
ATOM   5119 N N   . SER C 1 1   ? 38.693  66.907  38.174  1.00 30.95 ? 2    SER C N   1 
ATOM   5120 C CA  . SER C 1 1   ? 39.663  66.840  37.038  1.00 28.67 ? 2    SER C CA  1 
ATOM   5121 C C   . SER C 1 1   ? 39.903  68.279  36.601  1.00 25.74 ? 2    SER C C   1 
ATOM   5122 O O   . SER C 1 1   ? 38.996  69.091  36.679  1.00 24.98 ? 2    SER C O   1 
ATOM   5123 C CB  . SER C 1 1   ? 39.055  66.057  35.867  1.00 33.00 ? 2    SER C CB  1 
ATOM   5124 O OG  . SER C 1 1   ? 38.383  64.892  36.302  1.00 34.03 ? 2    SER C OG  1 
ATOM   5125 N N   . LYS C 1 2   ? 41.112  68.579  36.145  1.00 22.99 ? 3    LYS C N   1 
ATOM   5126 C CA  . LYS C 1 2   ? 41.466  69.927  35.697  1.00 21.07 ? 3    LYS C CA  1 
ATOM   5127 C C   . LYS C 1 2   ? 40.727  70.203  34.403  1.00 18.12 ? 3    LYS C C   1 
ATOM   5128 O O   . LYS C 1 2   ? 40.617  69.346  33.527  1.00 16.78 ? 3    LYS C O   1 
ATOM   5129 C CB  . LYS C 1 2   ? 42.972  70.048  35.416  1.00 25.91 ? 3    LYS C CB  1 
ATOM   5130 C CG  . LYS C 1 2   ? 43.894  69.849  36.613  1.00 30.17 ? 3    LYS C CG  1 
ATOM   5131 C CD  . LYS C 1 2   ? 43.473  70.729  37.733  1.00 35.07 ? 3    LYS C CD  1 
ATOM   5132 C CE  . LYS C 1 2   ? 44.683  71.245  38.531  1.00 42.62 ? 3    LYS C CE  1 
ATOM   5133 N NZ  . LYS C 1 2   ? 44.202  71.888  39.798  1.00 42.77 ? 3    LYS C NZ  1 
ATOM   5134 N N   A LYS C 1 3   ? 40.226  71.421  34.300  0.60 19.13 ? 4    LYS C N   1 
ATOM   5135 N N   B LYS C 1 3   ? 40.186  71.405  34.292  0.40 18.54 ? 4    LYS C N   1 
ATOM   5136 C CA  A LYS C 1 3   ? 39.497  71.867  33.123  0.60 18.50 ? 4    LYS C CA  1 
ATOM   5137 C CA  B LYS C 1 3   ? 39.460  71.784  33.089  0.40 17.60 ? 4    LYS C CA  1 
ATOM   5138 C C   A LYS C 1 3   ? 40.491  72.236  32.017  0.60 20.11 ? 4    LYS C C   1 
ATOM   5139 C C   B LYS C 1 3   ? 40.463  72.215  32.025  0.40 19.06 ? 4    LYS C C   1 
ATOM   5140 O O   A LYS C 1 3   ? 41.144  73.285  32.095  0.60 18.95 ? 4    LYS C O   1 
ATOM   5141 O O   B LYS C 1 3   ? 41.100  73.268  32.144  0.40 18.27 ? 4    LYS C O   1 
ATOM   5142 C CB  A LYS C 1 3   ? 38.638  73.084  33.505  0.60 18.74 ? 4    LYS C CB  1 
ATOM   5143 C CB  B LYS C 1 3   ? 38.484  72.919  33.406  0.40 17.60 ? 4    LYS C CB  1 
ATOM   5144 C CG  A LYS C 1 3   ? 37.389  72.699  34.318  0.60 19.62 ? 4    LYS C CG  1 
ATOM   5145 C CG  B LYS C 1 3   ? 37.269  72.456  34.206  0.40 16.48 ? 4    LYS C CG  1 
ATOM   5146 C CD  A LYS C 1 3   ? 36.589  73.913  34.822  0.60 20.88 ? 4    LYS C CD  1 
ATOM   5147 C CD  B LYS C 1 3   ? 36.333  73.616  34.541  0.40 16.49 ? 4    LYS C CD  1 
ATOM   5148 C CE  A LYS C 1 3   ? 37.247  74.556  36.042  0.60 20.62 ? 4    LYS C CE  1 
ATOM   5149 C CE  B LYS C 1 3   ? 35.236  73.160  35.476  0.40 17.45 ? 4    LYS C CE  1 
ATOM   5150 N NZ  A LYS C 1 3   ? 36.369  75.635  36.644  0.60 28.19 ? 4    LYS C NZ  1 
ATOM   5151 N NZ  B LYS C 1 3   ? 35.792  72.581  36.732  0.40 15.74 ? 4    LYS C NZ  1 
ATOM   5152 N N   . LEU C 1 4   ? 40.566  71.415  30.966  1.00 17.53 ? 5    LEU C N   1 
ATOM   5153 C CA  . LEU C 1 4   ? 41.523  71.677  29.905  1.00 16.76 ? 5    LEU C CA  1 
ATOM   5154 C C   . LEU C 1 4   ? 40.867  72.200  28.635  1.00 19.08 ? 5    LEU C C   1 
ATOM   5155 O O   . LEU C 1 4   ? 40.020  71.532  28.047  1.00 18.59 ? 5    LEU C O   1 
ATOM   5156 C CB  . LEU C 1 4   ? 42.266  70.375  29.550  1.00 15.20 ? 5    LEU C CB  1 
ATOM   5157 C CG  . LEU C 1 4   ? 42.805  69.571  30.755  1.00 18.56 ? 5    LEU C CG  1 
ATOM   5158 C CD1 . LEU C 1 4   ? 43.344  68.221  30.315  1.00 17.01 ? 5    LEU C CD1 1 
ATOM   5159 C CD2 . LEU C 1 4   ? 43.860  70.363  31.475  1.00 14.83 ? 5    LEU C CD2 1 
ATOM   5160 N N   . LEU C 1 5   ? 41.307  73.364  28.183  1.00 17.63 ? 6    LEU C N   1 
ATOM   5161 C CA  . LEU C 1 5   ? 40.744  73.945  26.934  1.00 15.47 ? 6    LEU C CA  1 
ATOM   5162 C C   . LEU C 1 5   ? 41.811  73.810  25.844  1.00 17.12 ? 6    LEU C C   1 
ATOM   5163 O O   . LEU C 1 5   ? 42.956  74.223  26.045  1.00 17.62 ? 6    LEU C O   1 
ATOM   5164 C CB  . LEU C 1 5   ? 40.425  75.447  27.119  1.00 16.03 ? 6    LEU C CB  1 
ATOM   5165 C CG  . LEU C 1 5   ? 39.772  76.106  25.869  1.00 17.04 ? 6    LEU C CG  1 
ATOM   5166 C CD1 . LEU C 1 5   ? 38.346  75.523  25.715  1.00 17.92 ? 6    LEU C CD1 1 
ATOM   5167 C CD2 . LEU C 1 5   ? 39.671  77.657  26.058  1.00 19.96 ? 6    LEU C CD2 1 
ATOM   5168 N N   . PHE C 1 6   ? 41.432  73.227  24.704  1.00 16.91 ? 7    PHE C N   1 
ATOM   5169 C CA  . PHE C 1 6   ? 42.344  73.074  23.582  1.00 18.76 ? 7    PHE C CA  1 
ATOM   5170 C C   . PHE C 1 6   ? 41.866  74.072  22.570  1.00 17.77 ? 7    PHE C C   1 
ATOM   5171 O O   . PHE C 1 6   ? 40.734  74.015  22.150  1.00 16.59 ? 7    PHE C O   1 
ATOM   5172 C CB  . PHE C 1 6   ? 42.309  71.647  23.084  1.00 18.75 ? 7    PHE C CB  1 
ATOM   5173 C CG  . PHE C 1 6   ? 43.010  70.715  23.993  1.00 19.35 ? 7    PHE C CG  1 
ATOM   5174 C CD1 . PHE C 1 6   ? 42.322  70.057  25.004  1.00 20.37 ? 7    PHE C CD1 1 
ATOM   5175 C CD2 . PHE C 1 6   ? 44.414  70.591  23.921  1.00 19.38 ? 7    PHE C CD2 1 
ATOM   5176 C CE1 . PHE C 1 6   ? 43.031  69.287  25.966  1.00 19.26 ? 7    PHE C CE1 1 
ATOM   5177 C CE2 . PHE C 1 6   ? 45.134  69.821  24.873  1.00 18.98 ? 7    PHE C CE2 1 
ATOM   5178 C CZ  . PHE C 1 6   ? 44.429  69.175  25.899  1.00 18.62 ? 7    PHE C CZ  1 
ATOM   5179 N N   . GLN C 1 7   ? 42.743  75.027  22.259  1.00 20.20 ? 8    GLN C N   1 
ATOM   5180 C CA  . GLN C 1 7   ? 42.436  76.154  21.355  1.00 18.51 ? 8    GLN C CA  1 
ATOM   5181 C C   . GLN C 1 7   ? 43.038  75.842  20.016  1.00 15.24 ? 8    GLN C C   1 
ATOM   5182 O O   . GLN C 1 7   ? 44.263  75.629  19.910  1.00 15.88 ? 8    GLN C O   1 
ATOM   5183 C CB  . GLN C 1 7   ? 43.066  77.427  21.943  1.00 20.94 ? 8    GLN C CB  1 
ATOM   5184 C CG  . GLN C 1 7   ? 43.060  78.678  21.019  1.00 19.31 ? 8    GLN C CG  1 
ATOM   5185 C CD  . GLN C 1 7   ? 43.764  79.875  21.689  1.00 22.69 ? 8    GLN C CD  1 
ATOM   5186 O OE1 . GLN C 1 7   ? 44.550  79.691  22.630  1.00 20.05 ? 8    GLN C OE1 1 
ATOM   5187 N NE2 . GLN C 1 7   ? 43.491  81.093  21.205  1.00 17.53 ? 8    GLN C NE2 1 
ATOM   5188 N N   . PHE C 1 8   ? 42.188  75.791  18.996  1.00 16.71 ? 9    PHE C N   1 
ATOM   5189 C CA  . PHE C 1 8   ? 42.646  75.464  17.634  1.00 17.07 ? 9    PHE C CA  1 
ATOM   5190 C C   . PHE C 1 8   ? 42.375  76.743  16.855  1.00 16.05 ? 9    PHE C C   1 
ATOM   5191 O O   . PHE C 1 8   ? 41.220  77.099  16.648  1.00 18.40 ? 9    PHE C O   1 
ATOM   5192 C CB  . PHE C 1 8   ? 41.780  74.317  17.080  1.00 17.08 ? 9    PHE C CB  1 
ATOM   5193 C CG  . PHE C 1 8   ? 41.838  73.056  17.897  1.00 19.05 ? 9    PHE C CG  1 
ATOM   5194 C CD1 . PHE C 1 8   ? 40.721  72.195  17.951  1.00 20.63 ? 9    PHE C CD1 1 
ATOM   5195 C CD2 . PHE C 1 8   ? 43.011  72.684  18.557  1.00 20.23 ? 9    PHE C CD2 1 
ATOM   5196 C CE1 . PHE C 1 8   ? 40.783  70.975  18.651  1.00 20.74 ? 9    PHE C CE1 1 
ATOM   5197 C CE2 . PHE C 1 8   ? 43.102  71.467  19.265  1.00 18.86 ? 9    PHE C CE2 1 
ATOM   5198 C CZ  . PHE C 1 8   ? 41.971  70.607  19.307  1.00 20.19 ? 9    PHE C CZ  1 
ATOM   5199 N N   . ASP C 1 9   ? 43.448  77.399  16.426  1.00 16.60 ? 10   ASP C N   1 
ATOM   5200 C CA  . ASP C 1 9   ? 43.369  78.675  15.749  1.00 16.40 ? 10   ASP C CA  1 
ATOM   5201 C C   . ASP C 1 9   ? 43.834  78.470  14.314  1.00 17.45 ? 10   ASP C C   1 
ATOM   5202 O O   . ASP C 1 9   ? 44.859  77.802  14.049  1.00 15.88 ? 10   ASP C O   1 
ATOM   5203 C CB  . ASP C 1 9   ? 44.247  79.696  16.497  1.00 17.60 ? 10   ASP C CB  1 
ATOM   5204 C CG  . ASP C 1 9   ? 43.936  81.136  16.114  1.00 22.17 ? 10   ASP C CG  1 
ATOM   5205 O OD1 . ASP C 1 9   ? 43.874  81.403  14.903  1.00 21.96 ? 10   ASP C OD1 1 
ATOM   5206 O OD2 . ASP C 1 9   ? 43.752  82.011  17.008  1.00 20.04 ? 10   ASP C OD2 1 
ATOM   5207 N N   . THR C 1 10  ? 43.074  79.047  13.387  1.00 20.00 ? 11   THR C N   1 
ATOM   5208 C CA  . THR C 1 10  ? 43.398  78.896  11.981  1.00 21.91 ? 11   THR C CA  1 
ATOM   5209 C C   . THR C 1 10  ? 44.513  79.817  11.546  1.00 24.65 ? 11   THR C C   1 
ATOM   5210 O O   . THR C 1 10  ? 45.083  79.639  10.455  1.00 23.72 ? 11   THR C O   1 
ATOM   5211 C CB  . THR C 1 10  ? 42.165  79.155  11.074  1.00 21.53 ? 11   THR C CB  1 
ATOM   5212 O OG1 . THR C 1 10  ? 41.571  80.420  11.405  1.00 20.36 ? 11   THR C OG1 1 
ATOM   5213 C CG2 . THR C 1 10  ? 41.159  78.029  11.246  1.00 18.88 ? 11   THR C CG2 1 
ATOM   5214 N N   . ASP C 1 11  ? 44.801  80.824  12.371  1.00 24.40 ? 12   ASP C N   1 
ATOM   5215 C CA  . ASP C 1 11  ? 45.906  81.743  12.064  1.00 24.49 ? 12   ASP C CA  1 
ATOM   5216 C C   . ASP C 1 11  ? 47.224  81.046  12.399  1.00 23.79 ? 12   ASP C C   1 
ATOM   5217 O O   . ASP C 1 11  ? 47.228  79.929  12.930  1.00 24.82 ? 12   ASP C O   1 
ATOM   5218 C CB  . ASP C 1 11  ? 45.789  83.022  12.890  1.00 25.71 ? 12   ASP C CB  1 
ATOM   5219 C CG  . ASP C 1 11  ? 44.633  83.899  12.444  1.00 26.09 ? 12   ASP C CG  1 
ATOM   5220 O OD1 . ASP C 1 11  ? 44.311  83.882  11.228  1.00 26.02 ? 12   ASP C OD1 1 
ATOM   5221 O OD2 . ASP C 1 11  ? 44.064  84.622  13.291  1.00 21.77 ? 12   ASP C OD2 1 
ATOM   5222 N N   . ALA C 1 12  ? 48.341  81.710  12.134  1.00 23.44 ? 13   ALA C N   1 
ATOM   5223 C CA  . ALA C 1 12  ? 49.639  81.093  12.377  1.00 24.80 ? 13   ALA C CA  1 
ATOM   5224 C C   . ALA C 1 12  ? 49.949  80.820  13.863  1.00 21.46 ? 13   ALA C C   1 
ATOM   5225 O O   . ALA C 1 12  ? 50.673  79.884  14.152  1.00 26.06 ? 13   ALA C O   1 
ATOM   5226 C CB  . ALA C 1 12  ? 50.775  81.931  11.722  1.00 25.82 ? 13   ALA C CB  1 
ATOM   5227 N N   . THR C 1 13  ? 49.423  81.626  14.777  1.00 20.56 ? 14   THR C N   1 
ATOM   5228 C CA  . THR C 1 13  ? 49.622  81.392  16.208  1.00 19.46 ? 14   THR C CA  1 
ATOM   5229 C C   . THR C 1 13  ? 48.272  81.642  16.888  1.00 21.50 ? 14   THR C C   1 
ATOM   5230 O O   . THR C 1 13  ? 47.395  82.358  16.346  1.00 19.93 ? 14   THR C O   1 
ATOM   5231 C CB  . THR C 1 13  ? 50.668  82.345  16.839  1.00 22.17 ? 14   THR C CB  1 
ATOM   5232 O OG1 . THR C 1 13  ? 50.258  83.708  16.616  1.00 21.44 ? 14   THR C OG1 1 
ATOM   5233 C CG2 . THR C 1 13  ? 52.104  82.108  16.240  1.00 19.44 ? 14   THR C CG2 1 
ATOM   5234 N N   . PRO C 1 14  ? 48.077  81.089  18.099  1.00 19.90 ? 15   PRO C N   1 
ATOM   5235 C CA  . PRO C 1 14  ? 46.788  81.311  18.763  1.00 17.86 ? 15   PRO C CA  1 
ATOM   5236 C C   . PRO C 1 14  ? 46.578  82.751  19.236  1.00 19.51 ? 15   PRO C C   1 
ATOM   5237 O O   . PRO C 1 14  ? 47.517  83.441  19.631  1.00 20.87 ? 15   PRO C O   1 
ATOM   5238 C CB  . PRO C 1 14  ? 46.818  80.319  19.940  1.00 19.91 ? 15   PRO C CB  1 
ATOM   5239 C CG  . PRO C 1 14  ? 47.852  79.223  19.463  1.00 17.68 ? 15   PRO C CG  1 
ATOM   5240 C CD  . PRO C 1 14  ? 48.916  80.140  18.876  1.00 18.14 ? 15   PRO C CD  1 
ATOM   5241 N N   . SER C 1 15  ? 45.319  83.181  19.200  1.00 19.23 ? 16   SER C N   1 
ATOM   5242 C CA  . SER C 1 15  ? 44.924  84.525  19.590  1.00 19.26 ? 16   SER C CA  1 
ATOM   5243 C C   . SER C 1 15  ? 45.218  84.783  21.078  1.00 20.39 ? 16   SER C C   1 
ATOM   5244 O O   . SER C 1 15  ? 44.746  84.060  21.922  1.00 19.65 ? 16   SER C O   1 
ATOM   5245 C CB  . SER C 1 15  ? 43.432  84.681  19.383  1.00 19.55 ? 16   SER C CB  1 
ATOM   5246 O OG  . SER C 1 15  ? 42.937  85.803  20.087  1.00 18.29 ? 16   SER C OG  1 
ATOM   5247 N N   . VAL C 1 16  ? 45.966  85.822  21.377  1.00 18.37 ? 17   VAL C N   1 
ATOM   5248 C CA  . VAL C 1 16  ? 46.231  86.178  22.781  1.00 17.61 ? 17   VAL C CA  1 
ATOM   5249 C C   . VAL C 1 16  ? 44.903  86.575  23.447  1.00 18.28 ? 17   VAL C C   1 
ATOM   5250 O O   . VAL C 1 16  ? 44.637  86.252  24.602  1.00 20.87 ? 17   VAL C O   1 
ATOM   5251 C CB  . VAL C 1 16  ? 47.215  87.366  22.822  1.00 15.45 ? 17   VAL C CB  1 
ATOM   5252 C CG1 . VAL C 1 16  ? 47.204  88.047  24.214  1.00 17.05 ? 17   VAL C CG1 1 
ATOM   5253 C CG2 . VAL C 1 16  ? 48.612  86.859  22.503  1.00 15.72 ? 17   VAL C CG2 1 
ATOM   5254 N N   . PHE C 1 17  ? 44.040  87.263  22.701  1.00 17.48 ? 18   PHE C N   1 
ATOM   5255 C CA  . PHE C 1 17  ? 42.746  87.713  23.230  1.00 17.95 ? 18   PHE C CA  1 
ATOM   5256 C C   . PHE C 1 17  ? 41.932  86.503  23.718  1.00 17.78 ? 18   PHE C C   1 
ATOM   5257 O O   . PHE C 1 17  ? 41.387  86.494  24.836  1.00 17.22 ? 18   PHE C O   1 
ATOM   5258 C CB  . PHE C 1 17  ? 41.959  88.448  22.091  1.00 18.20 ? 18   PHE C CB  1 
ATOM   5259 C CG  . PHE C 1 17  ? 40.655  89.043  22.531  1.00 18.40 ? 18   PHE C CG  1 
ATOM   5260 C CD1 . PHE C 1 17  ? 40.537  90.414  22.755  1.00 17.77 ? 18   PHE C CD1 1 
ATOM   5261 C CD2 . PHE C 1 17  ? 39.542  88.244  22.701  1.00 18.48 ? 18   PHE C CD2 1 
ATOM   5262 C CE1 . PHE C 1 17  ? 39.317  90.980  23.153  1.00 18.80 ? 18   PHE C CE1 1 
ATOM   5263 C CE2 . PHE C 1 17  ? 38.326  88.776  23.082  1.00 19.85 ? 18   PHE C CE2 1 
ATOM   5264 C CZ  . PHE C 1 17  ? 38.205  90.160  23.315  1.00 20.79 ? 18   PHE C CZ  1 
ATOM   5265 N N   . ASP C 1 18  ? 41.892  85.457  22.900  1.00 14.96 ? 19   ASP C N   1 
ATOM   5266 C CA  . ASP C 1 18  ? 41.096  84.287  23.247  1.00 17.52 ? 19   ASP C CA  1 
ATOM   5267 C C   . ASP C 1 18  ? 41.697  83.528  24.465  1.00 17.15 ? 19   ASP C C   1 
ATOM   5268 O O   . ASP C 1 18  ? 40.972  82.880  25.217  1.00 16.65 ? 19   ASP C O   1 
ATOM   5269 C CB  . ASP C 1 18  ? 40.971  83.340  22.051  1.00 16.54 ? 19   ASP C CB  1 
ATOM   5270 C CG  . ASP C 1 18  ? 40.165  83.949  20.888  1.00 18.31 ? 19   ASP C CG  1 
ATOM   5271 O OD1 . ASP C 1 18  ? 39.267  84.777  21.141  1.00 19.24 ? 19   ASP C OD1 1 
ATOM   5272 O OD2 . ASP C 1 18  ? 40.426  83.558  19.737  1.00 16.79 ? 19   ASP C OD2 1 
ATOM   5273 N N   . VAL C 1 19  ? 43.006  83.589  24.617  1.00 17.16 ? 20   VAL C N   1 
ATOM   5274 C CA  . VAL C 1 19  ? 43.657  82.926  25.787  1.00 18.57 ? 20   VAL C CA  1 
ATOM   5275 C C   . VAL C 1 19  ? 43.248  83.610  27.074  1.00 17.43 ? 20   VAL C C   1 
ATOM   5276 O O   . VAL C 1 19  ? 42.869  82.952  28.063  1.00 18.54 ? 20   VAL C O   1 
ATOM   5277 C CB  . VAL C 1 19  ? 45.205  82.979  25.719  1.00 14.64 ? 20   VAL C CB  1 
ATOM   5278 C CG1 . VAL C 1 19  ? 45.809  82.389  27.046  1.00 17.50 ? 20   VAL C CG1 1 
ATOM   5279 C CG2 . VAL C 1 19  ? 45.697  82.125  24.545  1.00 17.46 ? 20   VAL C CG2 1 
ATOM   5280 N N   . VAL C 1 20  ? 43.365  84.931  27.096  1.00 16.34 ? 21   VAL C N   1 
ATOM   5281 C CA  . VAL C 1 20  ? 42.992  85.656  28.309  1.00 18.84 ? 21   VAL C CA  1 
ATOM   5282 C C   . VAL C 1 20  ? 41.524  85.406  28.686  1.00 20.26 ? 21   VAL C C   1 
ATOM   5283 O O   . VAL C 1 20  ? 41.197  85.113  29.849  1.00 16.37 ? 21   VAL C O   1 
ATOM   5284 C CB  . VAL C 1 20  ? 43.199  87.178  28.144  1.00 18.08 ? 21   VAL C CB  1 
ATOM   5285 C CG1 . VAL C 1 20  ? 42.721  87.915  29.405  1.00 17.84 ? 21   VAL C CG1 1 
ATOM   5286 C CG2 . VAL C 1 20  ? 44.681  87.477  27.876  1.00 13.35 ? 21   VAL C CG2 1 
ATOM   5287 N N   . VAL C 1 21  ? 40.616  85.523  27.717  1.00 18.04 ? 22   VAL C N   1 
ATOM   5288 C CA  . VAL C 1 21  ? 39.202  85.310  28.048  1.00 17.03 ? 22   VAL C CA  1 
ATOM   5289 C C   . VAL C 1 21  ? 38.979  83.849  28.472  1.00 15.46 ? 22   VAL C C   1 
ATOM   5290 O O   . VAL C 1 21  ? 38.134  83.581  29.297  1.00 16.64 ? 22   VAL C O   1 
ATOM   5291 C CB  . VAL C 1 21  ? 38.269  85.677  26.833  1.00 18.44 ? 22   VAL C CB  1 
ATOM   5292 C CG1 . VAL C 1 21  ? 36.782  85.454  27.183  1.00 18.04 ? 22   VAL C CG1 1 
ATOM   5293 C CG2 . VAL C 1 21  ? 38.482  87.150  26.483  1.00 18.00 ? 22   VAL C CG2 1 
ATOM   5294 N N   . GLY C 1 22  ? 39.759  82.923  27.907  1.00 18.90 ? 23   GLY C N   1 
ATOM   5295 C CA  . GLY C 1 22  ? 39.607  81.497  28.256  1.00 20.95 ? 23   GLY C CA  1 
ATOM   5296 C C   . GLY C 1 22  ? 39.928  81.262  29.742  1.00 19.07 ? 23   GLY C C   1 
ATOM   5297 O O   . GLY C 1 22  ? 39.198  80.548  30.457  1.00 16.88 ? 23   GLY C O   1 
ATOM   5298 N N   . TYR C 1 23  ? 40.989  81.899  30.219  1.00 17.18 ? 24   TYR C N   1 
ATOM   5299 C CA  . TYR C 1 23  ? 41.368  81.760  31.645  1.00 17.62 ? 24   TYR C CA  1 
ATOM   5300 C C   . TYR C 1 23  ? 40.334  82.461  32.527  1.00 19.78 ? 24   TYR C C   1 
ATOM   5301 O O   . TYR C 1 23  ? 39.905  81.922  33.555  1.00 19.25 ? 24   TYR C O   1 
ATOM   5302 C CB  . TYR C 1 23  ? 42.795  82.308  31.841  1.00 15.13 ? 24   TYR C CB  1 
ATOM   5303 C CG  . TYR C 1 23  ? 43.832  81.294  31.409  1.00 18.41 ? 24   TYR C CG  1 
ATOM   5304 C CD1 . TYR C 1 23  ? 44.833  81.647  30.551  1.00 12.80 ? 24   TYR C CD1 1 
ATOM   5305 C CD2 . TYR C 1 23  ? 43.814  79.968  31.913  1.00 18.20 ? 24   TYR C CD2 1 
ATOM   5306 C CE1 . TYR C 1 23  ? 45.841  80.749  30.157  1.00 15.27 ? 24   TYR C CE1 1 
ATOM   5307 C CE2 . TYR C 1 23  ? 44.800  79.065  31.536  1.00 16.57 ? 24   TYR C CE2 1 
ATOM   5308 C CZ  . TYR C 1 23  ? 45.808  79.468  30.654  1.00 19.18 ? 24   TYR C CZ  1 
ATOM   5309 O OH  . TYR C 1 23  ? 46.798  78.629  30.266  1.00 18.45 ? 24   TYR C OH  1 
ATOM   5310 N N   . ASP C 1 24  ? 39.873  83.639  32.099  1.00 17.75 ? 25   ASP C N   1 
ATOM   5311 C CA  . ASP C 1 24  ? 38.864  84.320  32.867  1.00 18.86 ? 25   ASP C CA  1 
ATOM   5312 C C   . ASP C 1 24  ? 37.542  83.597  32.842  1.00 18.23 ? 25   ASP C C   1 
ATOM   5313 O O   . ASP C 1 24  ? 36.733  83.767  33.745  1.00 18.43 ? 25   ASP C O   1 
ATOM   5314 C CB  . ASP C 1 24  ? 38.734  85.789  32.421  1.00 19.27 ? 25   ASP C CB  1 
ATOM   5315 C CG  . ASP C 1 24  ? 39.915  86.640  32.934  1.00 22.81 ? 25   ASP C CG  1 
ATOM   5316 O OD1 . ASP C 1 24  ? 40.570  86.232  33.937  1.00 20.62 ? 25   ASP C OD1 1 
ATOM   5317 O OD2 . ASP C 1 24  ? 40.178  87.705  32.363  1.00 22.08 ? 25   ASP C OD2 1 
ATOM   5318 N N   . GLY C 1 25  ? 37.319  82.767  31.828  1.00 18.89 ? 26   GLY C N   1 
ATOM   5319 C CA  . GLY C 1 25  ? 36.088  81.979  31.779  1.00 18.34 ? 26   GLY C CA  1 
ATOM   5320 C C   . GLY C 1 25  ? 36.198  80.727  32.634  1.00 23.35 ? 26   GLY C C   1 
ATOM   5321 O O   . GLY C 1 25  ? 35.248  79.936  32.762  1.00 23.04 ? 26   GLY C O   1 
ATOM   5322 N N   . GLY C 1 26  ? 37.365  80.504  33.225  1.00 23.21 ? 27   GLY C N   1 
ATOM   5323 C CA  . GLY C 1 26  ? 37.486  79.323  34.068  1.00 25.85 ? 27   GLY C CA  1 
ATOM   5324 C C   . GLY C 1 26  ? 38.283  78.126  33.559  1.00 25.77 ? 27   GLY C C   1 
ATOM   5325 O O   . GLY C 1 26  ? 38.274  77.117  34.230  1.00 26.65 ? 27   GLY C O   1 
ATOM   5326 N N   . ALA C 1 27  ? 38.933  78.179  32.396  1.00 22.11 ? 28   ALA C N   1 
ATOM   5327 C CA  . ALA C 1 27  ? 39.764  77.016  32.043  1.00 22.67 ? 28   ALA C CA  1 
ATOM   5328 C C   . ALA C 1 27  ? 40.916  76.944  33.063  1.00 20.61 ? 28   ALA C C   1 
ATOM   5329 O O   . ALA C 1 27  ? 41.443  77.985  33.481  1.00 19.66 ? 28   ALA C O   1 
ATOM   5330 C CB  . ALA C 1 27  ? 40.368  77.161  30.664  1.00 22.18 ? 28   ALA C CB  1 
ATOM   5331 N N   . ASP C 1 28  ? 41.323  75.737  33.458  1.00 18.67 ? 29   ASP C N   1 
ATOM   5332 C CA  . ASP C 1 28  ? 42.467  75.613  34.362  1.00 18.36 ? 29   ASP C CA  1 
ATOM   5333 C C   . ASP C 1 28  ? 43.754  75.666  33.532  1.00 17.05 ? 29   ASP C C   1 
ATOM   5334 O O   . ASP C 1 28  ? 44.797  76.084  34.025  1.00 16.88 ? 29   ASP C O   1 
ATOM   5335 C CB  . ASP C 1 28  ? 42.430  74.278  35.140  1.00 18.51 ? 29   ASP C CB  1 
ATOM   5336 C CG  . ASP C 1 28  ? 41.279  74.215  36.106  1.00 21.12 ? 29   ASP C CG  1 
ATOM   5337 O OD1 . ASP C 1 28  ? 41.023  75.243  36.775  1.00 26.35 ? 29   ASP C OD1 1 
ATOM   5338 O OD2 . ASP C 1 28  ? 40.618  73.158  36.197  1.00 20.30 ? 29   ASP C OD2 1 
ATOM   5339 N N   . HIS C 1 29  ? 43.690  75.172  32.290  1.00 17.52 ? 30   HIS C N   1 
ATOM   5340 C CA  . HIS C 1 29  ? 44.831  75.168  31.368  1.00 19.68 ? 30   HIS C CA  1 
ATOM   5341 C C   . HIS C 1 29  ? 44.345  75.323  29.950  1.00 20.86 ? 30   HIS C C   1 
ATOM   5342 O O   . HIS C 1 29  ? 43.311  74.767  29.592  1.00 21.33 ? 30   HIS C O   1 
ATOM   5343 C CB  . HIS C 1 29  ? 45.620  73.862  31.401  1.00 16.85 ? 30   HIS C CB  1 
ATOM   5344 C CG  . HIS C 1 29  ? 46.239  73.599  32.729  1.00 25.09 ? 30   HIS C CG  1 
ATOM   5345 N ND1 . HIS C 1 29  ? 47.279  74.363  33.224  1.00 23.01 ? 30   HIS C ND1 1 
ATOM   5346 C CD2 . HIS C 1 29  ? 45.861  72.771  33.728  1.00 21.64 ? 30   HIS C CD2 1 
ATOM   5347 C CE1 . HIS C 1 29  ? 47.507  74.020  34.477  1.00 26.45 ? 30   HIS C CE1 1 
ATOM   5348 N NE2 . HIS C 1 29  ? 46.657  73.060  34.808  1.00 28.88 ? 30   HIS C NE2 1 
ATOM   5349 N N   . ILE C 1 30  ? 45.111  76.061  29.159  1.00 17.43 ? 31   ILE C N   1 
ATOM   5350 C CA  . ILE C 1 30  ? 44.776  76.271  27.764  1.00 18.06 ? 31   ILE C CA  1 
ATOM   5351 C C   . ILE C 1 30  ? 45.986  75.835  26.941  1.00 19.93 ? 31   ILE C C   1 
ATOM   5352 O O   . ILE C 1 30  ? 47.102  76.337  27.144  1.00 20.89 ? 31   ILE C O   1 
ATOM   5353 C CB  . ILE C 1 30  ? 44.469  77.744  27.458  1.00 16.55 ? 31   ILE C CB  1 
ATOM   5354 C CG1 . ILE C 1 30  ? 43.252  78.210  28.300  1.00 17.16 ? 31   ILE C CG1 1 
ATOM   5355 C CG2 . ILE C 1 30  ? 44.115  77.882  25.959  1.00 19.77 ? 31   ILE C CG2 1 
ATOM   5356 C CD1 . ILE C 1 30  ? 42.763  79.663  27.960  1.00 18.20 ? 31   ILE C CD1 1 
ATOM   5357 N N   . THR C 1 31  ? 45.775  74.900  26.023  1.00 18.94 ? 32   THR C N   1 
ATOM   5358 C CA  . THR C 1 31  ? 46.879  74.443  25.159  1.00 18.32 ? 32   THR C CA  1 
ATOM   5359 C C   . THR C 1 31  ? 46.466  74.895  23.761  1.00 16.55 ? 32   THR C C   1 
ATOM   5360 O O   . THR C 1 31  ? 45.423  74.486  23.308  1.00 12.42 ? 32   THR C O   1 
ATOM   5361 C CB  . THR C 1 31  ? 47.004  72.914  25.197  1.00 20.12 ? 32   THR C CB  1 
ATOM   5362 O OG1 . THR C 1 31  ? 47.250  72.518  26.564  1.00 26.25 ? 32   THR C OG1 1 
ATOM   5363 C CG2 . THR C 1 31  ? 48.186  72.426  24.328  1.00 18.48 ? 32   THR C CG2 1 
ATOM   5364 N N   . GLY C 1 32  ? 47.290  75.714  23.109  1.00 13.88 ? 33   GLY C N   1 
ATOM   5365 C CA  . GLY C 1 32  ? 46.927  76.262  21.825  1.00 15.53 ? 33   GLY C CA  1 
ATOM   5366 C C   . GLY C 1 32  ? 47.743  75.794  20.632  1.00 13.85 ? 33   GLY C C   1 
ATOM   5367 O O   . GLY C 1 32  ? 48.959  75.554  20.701  1.00 16.98 ? 33   GLY C O   1 
ATOM   5368 N N   . TYR C 1 33  ? 47.056  75.728  19.505  1.00 15.94 ? 34   TYR C N   1 
ATOM   5369 C CA  . TYR C 1 33  ? 47.656  75.315  18.254  1.00 16.53 ? 34   TYR C CA  1 
ATOM   5370 C C   . TYR C 1 33  ? 47.313  76.342  17.180  1.00 17.18 ? 34   TYR C C   1 
ATOM   5371 O O   . TYR C 1 33  ? 46.204  76.845  17.164  1.00 15.53 ? 34   TYR C O   1 
ATOM   5372 C CB  . TYR C 1 33  ? 47.068  74.000  17.791  1.00 16.71 ? 34   TYR C CB  1 
ATOM   5373 C CG  . TYR C 1 33  ? 47.413  72.847  18.713  1.00 17.79 ? 34   TYR C CG  1 
ATOM   5374 C CD1 . TYR C 1 33  ? 46.702  72.631  19.895  1.00 19.09 ? 34   TYR C CD1 1 
ATOM   5375 C CD2 . TYR C 1 33  ? 48.506  72.053  18.446  1.00 19.92 ? 34   TYR C CD2 1 
ATOM   5376 C CE1 . TYR C 1 33  ? 47.116  71.616  20.825  1.00 20.39 ? 34   TYR C CE1 1 
ATOM   5377 C CE2 . TYR C 1 33  ? 48.917  71.065  19.342  1.00 23.17 ? 34   TYR C CE2 1 
ATOM   5378 C CZ  . TYR C 1 33  ? 48.220  70.862  20.519  1.00 20.66 ? 34   TYR C CZ  1 
ATOM   5379 O OH  . TYR C 1 33  ? 48.656  69.898  21.376  1.00 22.05 ? 34   TYR C OH  1 
ATOM   5380 N N   . GLY C 1 34  ? 48.291  76.651  16.327  1.00 16.04 ? 35   GLY C N   1 
ATOM   5381 C CA  . GLY C 1 34  ? 48.041  77.543  15.207  1.00 21.08 ? 35   GLY C CA  1 
ATOM   5382 C C   . GLY C 1 34  ? 48.057  76.690  13.930  1.00 20.30 ? 35   GLY C C   1 
ATOM   5383 O O   . GLY C 1 34  ? 48.334  75.472  13.972  1.00 21.36 ? 35   GLY C O   1 
ATOM   5384 N N   . ASN C 1 35  ? 47.754  77.322  12.796  1.00 21.86 ? 36   ASN C N   1 
ATOM   5385 C CA  . ASN C 1 35  ? 47.760  76.637  11.521  1.00 22.76 ? 36   ASN C CA  1 
ATOM   5386 C C   . ASN C 1 35  ? 46.860  75.407  11.513  1.00 19.91 ? 36   ASN C C   1 
ATOM   5387 O O   . ASN C 1 35  ? 47.171  74.437  10.844  1.00 21.14 ? 36   ASN C O   1 
ATOM   5388 C CB  . ASN C 1 35  ? 49.188  76.200  11.161  1.00 23.02 ? 36   ASN C CB  1 
ATOM   5389 C CG  . ASN C 1 35  ? 50.145  77.372  11.078  1.00 27.98 ? 36   ASN C CG  1 
ATOM   5390 O OD1 . ASN C 1 35  ? 49.926  78.305  10.309  1.00 29.67 ? 36   ASN C OD1 1 
ATOM   5391 N ND2 . ASN C 1 35  ? 51.194  77.348  11.894  1.00 29.87 ? 36   ASN C ND2 1 
ATOM   5392 N N   . VAL C 1 36  ? 45.744  75.452  12.233  1.00 19.93 ? 37   VAL C N   1 
ATOM   5393 C CA  . VAL C 1 36  ? 44.878  74.281  12.274  1.00 20.73 ? 37   VAL C CA  1 
ATOM   5394 C C   . VAL C 1 36  ? 44.024  74.238  10.996  1.00 21.73 ? 37   VAL C C   1 
ATOM   5395 O O   . VAL C 1 36  ? 43.554  75.281  10.530  1.00 21.00 ? 37   VAL C O   1 
ATOM   5396 C CB  . VAL C 1 36  ? 43.977  74.302  13.545  1.00 19.59 ? 37   VAL C CB  1 
ATOM   5397 C CG1 . VAL C 1 36  ? 43.044  73.095  13.547  1.00 20.96 ? 37   VAL C CG1 1 
ATOM   5398 C CG2 . VAL C 1 36  ? 44.883  74.253  14.851  1.00 17.70 ? 37   VAL C CG2 1 
ATOM   5399 N N   . THR C 1 37  ? 43.843  73.039  10.443  1.00 20.40 ? 38   THR C N   1 
ATOM   5400 C CA  . THR C 1 37  ? 43.054  72.853  9.220   1.00 22.99 ? 38   THR C CA  1 
ATOM   5401 C C   . THR C 1 37  ? 42.086  71.686  9.388   1.00 24.13 ? 38   THR C C   1 
ATOM   5402 O O   . THR C 1 37  ? 42.241  70.834  10.299  1.00 23.34 ? 38   THR C O   1 
ATOM   5403 C CB  . THR C 1 37  ? 43.954  72.506  8.021   1.00 24.77 ? 38   THR C CB  1 
ATOM   5404 O OG1 . THR C 1 37  ? 44.521  71.200  8.233   1.00 26.35 ? 38   THR C OG1 1 
ATOM   5405 C CG2 . THR C 1 37  ? 45.118  73.537  7.882   1.00 25.93 ? 38   THR C CG2 1 
ATOM   5406 N N   . PRO C 1 38  ? 41.081  71.606  8.504   1.00 23.89 ? 39   PRO C N   1 
ATOM   5407 C CA  . PRO C 1 38  ? 40.134  70.494  8.618   1.00 25.55 ? 39   PRO C CA  1 
ATOM   5408 C C   . PRO C 1 38  ? 40.917  69.187  8.546   1.00 26.93 ? 39   PRO C C   1 
ATOM   5409 O O   . PRO C 1 38  ? 40.454  68.131  8.989   1.00 27.21 ? 39   PRO C O   1 
ATOM   5410 C CB  . PRO C 1 38  ? 39.229  70.679  7.401   1.00 26.26 ? 39   PRO C CB  1 
ATOM   5411 C CG  . PRO C 1 38  ? 39.234  72.182  7.233   1.00 30.05 ? 39   PRO C CG  1 
ATOM   5412 C CD  . PRO C 1 38  ? 40.685  72.528  7.426   1.00 24.03 ? 39   PRO C CD  1 
ATOM   5413 N N   . ASP C 1 39  ? 42.108  69.243  7.977   1.00 27.31 ? 40   ASP C N   1 
ATOM   5414 C CA  . ASP C 1 39  ? 42.872  68.007  7.912   1.00 32.24 ? 40   ASP C CA  1 
ATOM   5415 C C   . ASP C 1 39  ? 43.670  67.587  9.134   1.00 32.04 ? 40   ASP C C   1 
ATOM   5416 O O   . ASP C 1 39  ? 43.649  66.422  9.512   1.00 33.85 ? 40   ASP C O   1 
ATOM   5417 C CB  . ASP C 1 39  ? 43.811  68.004  6.734   1.00 36.29 ? 40   ASP C CB  1 
ATOM   5418 C CG  . ASP C 1 39  ? 43.290  67.140  5.633   1.00 45.92 ? 40   ASP C CG  1 
ATOM   5419 O OD1 . ASP C 1 39  ? 42.505  67.675  4.792   1.00 46.11 ? 40   ASP C OD1 1 
ATOM   5420 O OD2 . ASP C 1 39  ? 43.630  65.916  5.650   1.00 48.17 ? 40   ASP C OD2 1 
ATOM   5421 N N   . ASN C 1 40  ? 44.384  68.509  9.756   1.00 28.99 ? 41   ASN C N   1 
ATOM   5422 C CA  . ASN C 1 40  ? 45.180  68.084  10.880  1.00 25.25 ? 41   ASN C CA  1 
ATOM   5423 C C   . ASN C 1 40  ? 44.443  68.103  12.205  1.00 23.19 ? 41   ASN C C   1 
ATOM   5424 O O   . ASN C 1 40  ? 44.963  67.569  13.199  1.00 23.15 ? 41   ASN C O   1 
ATOM   5425 C CB  . ASN C 1 40  ? 46.464  68.919  10.957  1.00 25.81 ? 41   ASN C CB  1 
ATOM   5426 C CG  . ASN C 1 40  ? 46.193  70.396  11.107  1.00 19.15 ? 41   ASN C CG  1 
ATOM   5427 O OD1 . ASN C 1 40  ? 45.123  70.798  11.553  1.00 18.29 ? 41   ASN C OD1 1 
ATOM   5428 N ND2 . ASN C 1 40  ? 47.170  71.216  10.742  1.00 25.22 ? 41   ASN C ND2 1 
ATOM   5429 N N   . VAL C 1 41  ? 43.227  68.667  12.231  1.00 20.68 ? 42   VAL C N   1 
ATOM   5430 C CA  . VAL C 1 41  ? 42.496  68.755  13.495  1.00 21.13 ? 42   VAL C CA  1 
ATOM   5431 C C   . VAL C 1 41  ? 41.944  67.441  14.045  1.00 22.06 ? 42   VAL C C   1 
ATOM   5432 O O   . VAL C 1 41  ? 41.806  67.264  15.275  1.00 19.63 ? 42   VAL C O   1 
ATOM   5433 C CB  . VAL C 1 41  ? 41.366  69.837  13.423  1.00 24.11 ? 42   VAL C CB  1 
ATOM   5434 C CG1 . VAL C 1 41  ? 40.145  69.313  12.682  1.00 24.52 ? 42   VAL C CG1 1 
ATOM   5435 C CG2 . VAL C 1 41  ? 40.986  70.264  14.822  1.00 19.89 ? 42   VAL C CG2 1 
ATOM   5436 N N   . GLY C 1 42  ? 41.675  66.490  13.148  1.00 22.44 ? 43   GLY C N   1 
ATOM   5437 C CA  . GLY C 1 42  ? 41.133  65.217  13.597  1.00 19.04 ? 43   GLY C CA  1 
ATOM   5438 C C   . GLY C 1 42  ? 42.013  64.526  14.630  1.00 18.34 ? 43   GLY C C   1 
ATOM   5439 O O   . GLY C 1 42  ? 41.488  64.033  15.630  1.00 18.60 ? 43   GLY C O   1 
ATOM   5440 N N   . ALA C 1 43  ? 43.331  64.510  14.410  1.00 19.88 ? 44   ALA C N   1 
ATOM   5441 C CA  . ALA C 1 43  ? 44.234  63.867  15.327  1.00 22.26 ? 44   ALA C CA  1 
ATOM   5442 C C   . ALA C 1 43  ? 44.214  64.607  16.669  1.00 23.20 ? 44   ALA C C   1 
ATOM   5443 O O   . ALA C 1 43  ? 44.283  63.978  17.711  1.00 21.21 ? 44   ALA C O   1 
ATOM   5444 C CB  . ALA C 1 43  ? 45.682  63.814  14.738  1.00 26.13 ? 44   ALA C CB  1 
ATOM   5445 N N   . TYR C 1 44  ? 44.078  65.938  16.641  1.00 21.40 ? 45   TYR C N   1 
ATOM   5446 C CA  . TYR C 1 44  ? 44.020  66.713  17.897  1.00 19.68 ? 45   TYR C CA  1 
ATOM   5447 C C   . TYR C 1 44  ? 42.743  66.291  18.651  1.00 20.54 ? 45   TYR C C   1 
ATOM   5448 O O   . TYR C 1 44  ? 42.740  66.021  19.871  1.00 19.61 ? 45   TYR C O   1 
ATOM   5449 C CB  . TYR C 1 44  ? 43.929  68.209  17.606  1.00 19.52 ? 45   TYR C CB  1 
ATOM   5450 C CG  . TYR C 1 44  ? 45.126  68.802  16.930  1.00 19.15 ? 45   TYR C CG  1 
ATOM   5451 C CD1 . TYR C 1 44  ? 45.009  69.994  16.216  1.00 24.57 ? 45   TYR C CD1 1 
ATOM   5452 C CD2 . TYR C 1 44  ? 46.383  68.207  17.016  1.00 19.19 ? 45   TYR C CD2 1 
ATOM   5453 C CE1 . TYR C 1 44  ? 46.112  70.587  15.614  1.00 20.50 ? 45   TYR C CE1 1 
ATOM   5454 C CE2 . TYR C 1 44  ? 47.508  68.793  16.393  1.00 20.58 ? 45   TYR C CE2 1 
ATOM   5455 C CZ  . TYR C 1 44  ? 47.343  69.999  15.696  1.00 20.11 ? 45   TYR C CZ  1 
ATOM   5456 O OH  . TYR C 1 44  ? 48.410  70.607  15.108  1.00 19.44 ? 45   TYR C OH  1 
ATOM   5457 N N   . VAL C 1 45  ? 41.649  66.205  17.923  1.00 18.39 ? 46   VAL C N   1 
ATOM   5458 C CA  . VAL C 1 45  ? 40.388  65.831  18.564  1.00 18.05 ? 46   VAL C CA  1 
ATOM   5459 C C   . VAL C 1 45  ? 40.498  64.443  19.188  1.00 18.92 ? 46   VAL C C   1 
ATOM   5460 O O   . VAL C 1 45  ? 39.967  64.239  20.274  1.00 21.41 ? 46   VAL C O   1 
ATOM   5461 C CB  . VAL C 1 45  ? 39.217  65.831  17.557  1.00 18.36 ? 46   VAL C CB  1 
ATOM   5462 C CG1 . VAL C 1 45  ? 37.937  65.327  18.224  1.00 16.61 ? 46   VAL C CG1 1 
ATOM   5463 C CG2 . VAL C 1 45  ? 38.993  67.257  17.013  1.00 18.45 ? 46   VAL C CG2 1 
ATOM   5464 N N   . ASP C 1 46  ? 41.158  63.487  18.503  1.00 19.21 ? 47   ASP C N   1 
ATOM   5465 C CA  . ASP C 1 46  ? 41.284  62.121  19.038  1.00 18.99 ? 47   ASP C CA  1 
ATOM   5466 C C   . ASP C 1 46  ? 41.901  62.234  20.455  1.00 19.33 ? 47   ASP C C   1 
ATOM   5467 O O   . ASP C 1 46  ? 41.518  61.508  21.388  1.00 18.41 ? 47   ASP C O   1 
ATOM   5468 C CB  . ASP C 1 46  ? 42.207  61.274  18.162  1.00 20.50 ? 47   ASP C CB  1 
ATOM   5469 C CG  . ASP C 1 46  ? 41.552  60.853  16.838  1.00 22.75 ? 47   ASP C CG  1 
ATOM   5470 O OD1 . ASP C 1 46  ? 40.315  60.931  16.694  1.00 20.06 ? 47   ASP C OD1 1 
ATOM   5471 O OD2 . ASP C 1 46  ? 42.295  60.413  15.954  1.00 23.29 ? 47   ASP C OD2 1 
ATOM   5472 N N   . GLY C 1 47  ? 42.847  63.165  20.600  1.00 20.69 ? 48   GLY C N   1 
ATOM   5473 C CA  . GLY C 1 47  ? 43.487  63.371  21.898  1.00 18.33 ? 48   GLY C CA  1 
ATOM   5474 C C   . GLY C 1 47  ? 42.535  63.846  22.992  1.00 19.09 ? 48   GLY C C   1 
ATOM   5475 O O   . GLY C 1 47  ? 42.791  63.624  24.192  1.00 22.02 ? 48   GLY C O   1 
ATOM   5476 N N   . THR C 1 48  ? 41.461  64.525  22.615  1.00 16.51 ? 49   THR C N   1 
ATOM   5477 C CA  . THR C 1 48  ? 40.475  64.976  23.599  1.00 19.04 ? 49   THR C CA  1 
ATOM   5478 C C   . THR C 1 48  ? 39.408  63.931  23.919  1.00 19.01 ? 49   THR C C   1 
ATOM   5479 O O   . THR C 1 48  ? 38.791  64.024  24.959  1.00 20.96 ? 49   THR C O   1 
ATOM   5480 C CB  . THR C 1 48  ? 39.669  66.252  23.169  1.00 18.89 ? 49   THR C CB  1 
ATOM   5481 O OG1 . THR C 1 48  ? 38.846  65.956  22.032  1.00 19.91 ? 49   THR C OG1 1 
ATOM   5482 C CG2 . THR C 1 48  ? 40.624  67.441  22.824  1.00 17.79 ? 49   THR C CG2 1 
ATOM   5483 N N   . ILE C 1 49  ? 39.153  62.975  23.027  1.00 18.04 ? 50   ILE C N   1 
ATOM   5484 C CA  . ILE C 1 49  ? 38.071  62.030  23.293  1.00 19.15 ? 50   ILE C CA  1 
ATOM   5485 C C   . ILE C 1 49  ? 38.476  60.633  23.742  1.00 22.27 ? 50   ILE C C   1 
ATOM   5486 O O   . ILE C 1 49  ? 37.625  59.860  24.213  1.00 23.01 ? 50   ILE C O   1 
ATOM   5487 C CB  . ILE C 1 49  ? 37.116  61.898  22.062  1.00 20.60 ? 50   ILE C CB  1 
ATOM   5488 C CG1 . ILE C 1 49  ? 37.898  61.404  20.840  1.00 19.72 ? 50   ILE C CG1 1 
ATOM   5489 C CG2 . ILE C 1 49  ? 36.444  63.264  21.756  1.00 20.76 ? 50   ILE C CG2 1 
ATOM   5490 C CD1 . ILE C 1 49  ? 37.027  61.180  19.580  1.00 20.88 ? 50   ILE C CD1 1 
ATOM   5491 N N   . TYR C 1 50  ? 39.763  60.309  23.638  1.00 22.55 ? 51   TYR C N   1 
ATOM   5492 C CA  . TYR C 1 50  ? 40.233  58.983  24.037  1.00 25.27 ? 51   TYR C CA  1 
ATOM   5493 C C   . TYR C 1 50  ? 41.084  58.985  25.292  1.00 24.84 ? 51   TYR C C   1 
ATOM   5494 O O   . TYR C 1 50  ? 41.641  57.948  25.655  1.00 24.47 ? 51   TYR C O   1 
ATOM   5495 C CB  . TYR C 1 50  ? 41.036  58.361  22.910  1.00 28.59 ? 51   TYR C CB  1 
ATOM   5496 C CG  . TYR C 1 50  ? 40.206  58.197  21.677  1.00 30.60 ? 51   TYR C CG  1 
ATOM   5497 C CD1 . TYR C 1 50  ? 40.695  58.580  20.428  1.00 35.34 ? 51   TYR C CD1 1 
ATOM   5498 C CD2 . TYR C 1 50  ? 38.913  57.658  21.759  1.00 33.91 ? 51   TYR C CD2 1 
ATOM   5499 C CE1 . TYR C 1 50  ? 39.914  58.436  19.266  1.00 35.77 ? 51   TYR C CE1 1 
ATOM   5500 C CE2 . TYR C 1 50  ? 38.119  57.501  20.608  1.00 35.74 ? 51   TYR C CE2 1 
ATOM   5501 C CZ  . TYR C 1 50  ? 38.628  57.894  19.374  1.00 36.88 ? 51   TYR C CZ  1 
ATOM   5502 O OH  . TYR C 1 50  ? 37.849  57.754  18.245  1.00 39.98 ? 51   TYR C OH  1 
ATOM   5503 N N   . THR C 1 51  ? 41.156  60.133  25.974  1.00 21.55 ? 52   THR C N   1 
ATOM   5504 C CA  . THR C 1 51  ? 42.010  60.234  27.167  1.00 22.36 ? 52   THR C CA  1 
ATOM   5505 C C   . THR C 1 51  ? 41.297  60.251  28.497  1.00 20.74 ? 52   THR C C   1 
ATOM   5506 O O   . THR C 1 51  ? 41.898  59.990  29.523  1.00 23.33 ? 52   THR C O   1 
ATOM   5507 C CB  . THR C 1 51  ? 42.850  61.504  27.091  1.00 20.82 ? 52   THR C CB  1 
ATOM   5508 O OG1 . THR C 1 51  ? 42.006  62.566  26.639  1.00 20.60 ? 52   THR C OG1 1 
ATOM   5509 C CG2 . THR C 1 51  ? 44.060  61.320  26.128  1.00 18.22 ? 52   THR C CG2 1 
ATOM   5510 N N   . ARG C 1 52  ? 40.029  60.631  28.471  1.00 24.61 ? 53   ARG C N   1 
ATOM   5511 C CA  . ARG C 1 52  ? 39.211  60.718  29.660  1.00 23.75 ? 53   ARG C CA  1 
ATOM   5512 C C   . ARG C 1 52  ? 37.913  59.977  29.428  1.00 27.02 ? 53   ARG C C   1 
ATOM   5513 O O   . ARG C 1 52  ? 37.388  59.990  28.310  1.00 25.49 ? 53   ARG C O   1 
ATOM   5514 C CB  . ARG C 1 52  ? 38.935  62.171  29.983  1.00 24.09 ? 53   ARG C CB  1 
ATOM   5515 C CG  . ARG C 1 52  ? 40.144  62.838  30.618  1.00 23.14 ? 53   ARG C CG  1 
ATOM   5516 C CD  . ARG C 1 52  ? 39.943  64.359  30.781  1.00 22.80 ? 53   ARG C CD  1 
ATOM   5517 N NE  . ARG C 1 52  ? 40.928  64.915  31.706  1.00 22.75 ? 53   ARG C NE  1 
ATOM   5518 C CZ  . ARG C 1 52  ? 40.967  66.193  32.063  1.00 20.69 ? 53   ARG C CZ  1 
ATOM   5519 N NH1 . ARG C 1 52  ? 40.091  67.062  31.545  1.00 19.57 ? 53   ARG C NH1 1 
ATOM   5520 N NH2 . ARG C 1 52  ? 41.816  66.581  33.000  1.00 20.02 ? 53   ARG C NH2 1 
ATOM   5521 N N   . GLY C 1 53  ? 37.414  59.330  30.478  1.00 25.93 ? 54   GLY C N   1 
ATOM   5522 C CA  . GLY C 1 53  ? 36.185  58.568  30.370  1.00 28.57 ? 54   GLY C CA  1 
ATOM   5523 C C   . GLY C 1 53  ? 35.073  59.067  31.275  1.00 28.32 ? 54   GLY C C   1 
ATOM   5524 O O   . GLY C 1 53  ? 35.317  59.763  32.272  1.00 28.92 ? 54   GLY C O   1 
ATOM   5525 N N   . GLY C 1 54  ? 33.852  58.711  30.903  1.00 30.14 ? 55   GLY C N   1 
ATOM   5526 C CA  . GLY C 1 54  ? 32.670  59.096  31.651  1.00 28.16 ? 55   GLY C CA  1 
ATOM   5527 C C   . GLY C 1 54  ? 32.496  60.571  31.925  1.00 29.38 ? 55   GLY C C   1 
ATOM   5528 O O   . GLY C 1 54  ? 32.586  61.406  31.025  1.00 29.93 ? 55   GLY C O   1 
ATOM   5529 N N   . LYS C 1 55  ? 32.265  60.884  33.192  1.00 28.39 ? 56   LYS C N   1 
ATOM   5530 C CA  . LYS C 1 55  ? 32.033  62.246  33.637  1.00 28.63 ? 56   LYS C CA  1 
ATOM   5531 C C   . LYS C 1 55  ? 33.239  63.139  33.403  1.00 28.51 ? 56   LYS C C   1 
ATOM   5532 O O   . LYS C 1 55  ? 33.093  64.365  33.223  1.00 25.96 ? 56   LYS C O   1 
ATOM   5533 C CB  . LYS C 1 55  ? 31.709  62.230  35.119  1.00 33.54 ? 56   LYS C CB  1 
ATOM   5534 C CG  . LYS C 1 55  ? 30.956  63.446  35.605  1.00 39.76 ? 56   LYS C CG  1 
ATOM   5535 C CD  . LYS C 1 55  ? 30.782  63.355  37.120  1.00 44.62 ? 56   LYS C CD  1 
ATOM   5536 C CE  . LYS C 1 55  ? 32.138  63.187  37.821  1.00 45.21 ? 56   LYS C CE  1 
ATOM   5537 N NZ  . LYS C 1 55  ? 31.958  62.918  39.280  1.00 47.32 ? 56   LYS C NZ  1 
ATOM   5538 N N   . GLU C 1 56  ? 34.428  62.528  33.412  1.00 25.34 ? 57   GLU C N   1 
ATOM   5539 C CA  . GLU C 1 56  ? 35.665  63.290  33.208  1.00 26.37 ? 57   GLU C CA  1 
ATOM   5540 C C   . GLU C 1 56  ? 35.764  63.973  31.857  1.00 20.91 ? 57   GLU C C   1 
ATOM   5541 O O   . GLU C 1 56  ? 36.508  64.923  31.720  1.00 20.62 ? 57   GLU C O   1 
ATOM   5542 C CB  . GLU C 1 56  ? 36.906  62.400  33.395  1.00 29.57 ? 57   GLU C CB  1 
ATOM   5543 C CG  . GLU C 1 56  ? 37.235  62.116  34.867  1.00 39.04 ? 57   GLU C CG  1 
ATOM   5544 C CD  . GLU C 1 56  ? 36.015  61.599  35.633  1.00 46.21 ? 57   GLU C CD  1 
ATOM   5545 O OE1 . GLU C 1 56  ? 35.465  60.536  35.215  1.00 50.03 ? 57   GLU C OE1 1 
ATOM   5546 O OE2 . GLU C 1 56  ? 35.598  62.251  36.642  1.00 51.59 ? 57   GLU C OE2 1 
ATOM   5547 N N   . LYS C 1 57  ? 35.073  63.475  30.838  1.00 22.16 ? 58   LYS C N   1 
ATOM   5548 C CA  . LYS C 1 57  ? 35.149  64.129  29.533  1.00 23.39 ? 58   LYS C CA  1 
ATOM   5549 C C   . LYS C 1 57  ? 34.649  65.576  29.575  1.00 25.43 ? 58   LYS C C   1 
ATOM   5550 O O   . LYS C 1 57  ? 35.097  66.422  28.799  1.00 21.21 ? 58   LYS C O   1 
ATOM   5551 C CB  . LYS C 1 57  ? 34.328  63.354  28.498  1.00 24.39 ? 58   LYS C CB  1 
ATOM   5552 C CG  . LYS C 1 57  ? 34.892  61.955  28.236  1.00 28.29 ? 58   LYS C CG  1 
ATOM   5553 C CD  . LYS C 1 57  ? 34.194  61.265  27.021  1.00 31.57 ? 58   LYS C CD  1 
ATOM   5554 C CE  . LYS C 1 57  ? 33.000  60.437  27.413  1.00 33.47 ? 58   LYS C CE  1 
ATOM   5555 N NZ  . LYS C 1 57  ? 32.061  61.177  28.250  1.00 40.49 ? 58   LYS C NZ  1 
ATOM   5556 N N   . GLN C 1 58  ? 33.721  65.880  30.476  1.00 23.87 ? 59   GLN C N   1 
ATOM   5557 C CA  . GLN C 1 58  ? 33.215  67.243  30.481  1.00 25.05 ? 59   GLN C CA  1 
ATOM   5558 C C   . GLN C 1 58  ? 34.284  68.218  30.946  1.00 24.70 ? 59   GLN C C   1 
ATOM   5559 O O   . GLN C 1 58  ? 34.102  69.418  30.839  1.00 25.13 ? 59   GLN C O   1 
ATOM   5560 C CB  . GLN C 1 58  ? 31.937  67.372  31.321  1.00 24.15 ? 59   GLN C CB  1 
ATOM   5561 C CG  . GLN C 1 58  ? 32.123  67.428  32.803  1.00 28.29 ? 59   GLN C CG  1 
ATOM   5562 C CD  . GLN C 1 58  ? 30.772  67.554  33.505  1.00 32.44 ? 59   GLN C CD  1 
ATOM   5563 O OE1 . GLN C 1 58  ? 29.982  66.615  33.527  1.00 28.25 ? 59   GLN C OE1 1 
ATOM   5564 N NE2 . GLN C 1 58  ? 30.500  68.734  34.070  1.00 32.84 ? 59   GLN C NE2 1 
ATOM   5565 N N   . SER C 1 59  ? 35.404  67.695  31.425  1.00 20.63 ? 60   SER C N   1 
ATOM   5566 C CA  . SER C 1 59  ? 36.457  68.566  31.870  1.00 18.62 ? 60   SER C CA  1 
ATOM   5567 C C   . SER C 1 59  ? 37.466  68.891  30.772  1.00 16.68 ? 60   SER C C   1 
ATOM   5568 O O   . SER C 1 59  ? 38.477  69.504  31.034  1.00 16.93 ? 60   SER C O   1 
ATOM   5569 C CB  . SER C 1 59  ? 37.149  67.989  33.111  1.00 19.43 ? 60   SER C CB  1 
ATOM   5570 O OG  . SER C 1 59  ? 36.281  68.110  34.242  1.00 21.03 ? 60   SER C OG  1 
ATOM   5571 N N   . THR C 1 60  ? 37.210  68.432  29.545  1.00 18.33 ? 61   THR C N   1 
ATOM   5572 C CA  . THR C 1 60  ? 38.083  68.799  28.434  1.00 19.30 ? 61   THR C CA  1 
ATOM   5573 C C   . THR C 1 60  ? 37.150  69.438  27.407  1.00 20.41 ? 61   THR C C   1 
ATOM   5574 O O   . THR C 1 60  ? 36.035  68.942  27.207  1.00 20.78 ? 61   THR C O   1 
ATOM   5575 C CB  . THR C 1 60  ? 38.729  67.573  27.748  1.00 21.43 ? 61   THR C CB  1 
ATOM   5576 O OG1 . THR C 1 60  ? 39.613  66.925  28.663  1.00 22.18 ? 61   THR C OG1 1 
ATOM   5577 C CG2 . THR C 1 60  ? 39.500  67.993  26.519  1.00 22.52 ? 61   THR C CG2 1 
ATOM   5578 N N   . ALA C 1 61  ? 37.580  70.534  26.782  1.00 15.56 ? 62   ALA C N   1 
ATOM   5579 C CA  . ALA C 1 61  ? 36.747  71.168  25.751  1.00 17.88 ? 62   ALA C CA  1 
ATOM   5580 C C   . ALA C 1 61  ? 37.591  71.767  24.648  1.00 17.93 ? 62   ALA C C   1 
ATOM   5581 O O   . ALA C 1 61  ? 38.811  71.916  24.804  1.00 19.01 ? 62   ALA C O   1 
ATOM   5582 C CB  . ALA C 1 61  ? 35.841  72.205  26.356  1.00 15.95 ? 62   ALA C CB  1 
ATOM   5583 N N   . ILE C 1 62  ? 36.937  72.144  23.533  1.00 18.15 ? 63   ILE C N   1 
ATOM   5584 C CA  . ILE C 1 62  ? 37.639  72.651  22.370  1.00 17.54 ? 63   ILE C CA  1 
ATOM   5585 C C   . ILE C 1 62  ? 37.137  74.055  22.000  1.00 14.63 ? 63   ILE C C   1 
ATOM   5586 O O   . ILE C 1 62  ? 35.985  74.329  22.127  1.00 16.51 ? 63   ILE C O   1 
ATOM   5587 C CB  . ILE C 1 62  ? 37.383  71.659  21.182  1.00 19.85 ? 63   ILE C CB  1 
ATOM   5588 C CG1 . ILE C 1 62  ? 38.111  70.323  21.465  1.00 17.11 ? 63   ILE C CG1 1 
ATOM   5589 C CG2 . ILE C 1 62  ? 37.795  72.304  19.820  1.00 19.63 ? 63   ILE C CG2 1 
ATOM   5590 C CD1 . ILE C 1 62  ? 37.724  69.147  20.491  1.00 17.09 ? 63   ILE C CD1 1 
ATOM   5591 N N   . PHE C 1 63  ? 38.020  74.924  21.546  1.00 15.66 ? 64   PHE C N   1 
ATOM   5592 C CA  . PHE C 1 63  ? 37.637  76.284  21.171  1.00 16.67 ? 64   PHE C CA  1 
ATOM   5593 C C   . PHE C 1 63  ? 38.319  76.489  19.849  1.00 17.12 ? 64   PHE C C   1 
ATOM   5594 O O   . PHE C 1 63  ? 39.520  76.356  19.764  1.00 16.43 ? 64   PHE C O   1 
ATOM   5595 C CB  . PHE C 1 63  ? 38.166  77.325  22.176  1.00 19.98 ? 64   PHE C CB  1 
ATOM   5596 C CG  . PHE C 1 63  ? 37.879  78.753  21.756  1.00 18.61 ? 64   PHE C CG  1 
ATOM   5597 C CD1 . PHE C 1 63  ? 36.680  79.366  22.111  1.00 14.76 ? 64   PHE C CD1 1 
ATOM   5598 C CD2 . PHE C 1 63  ? 38.800  79.457  20.967  1.00 17.17 ? 64   PHE C CD2 1 
ATOM   5599 C CE1 . PHE C 1 63  ? 36.394  80.662  21.700  1.00 13.18 ? 64   PHE C CE1 1 
ATOM   5600 C CE2 . PHE C 1 63  ? 38.515  80.783  20.543  1.00 16.29 ? 64   PHE C CE2 1 
ATOM   5601 C CZ  . PHE C 1 63  ? 37.320  81.364  20.918  1.00 12.68 ? 64   PHE C CZ  1 
ATOM   5602 N N   . VAL C 1 64  ? 37.543  76.797  18.811  1.00 19.38 ? 65   VAL C N   1 
ATOM   5603 C CA  . VAL C 1 64  ? 38.078  77.019  17.469  1.00 17.40 ? 65   VAL C CA  1 
ATOM   5604 C C   . VAL C 1 64  ? 37.963  78.492  17.182  1.00 18.40 ? 65   VAL C C   1 
ATOM   5605 O O   . VAL C 1 64  ? 36.902  79.086  17.386  1.00 18.71 ? 65   VAL C O   1 
ATOM   5606 C CB  . VAL C 1 64  ? 37.258  76.246  16.416  1.00 19.75 ? 65   VAL C CB  1 
ATOM   5607 C CG1 . VAL C 1 64  ? 37.753  76.616  14.994  1.00 16.14 ? 65   VAL C CG1 1 
ATOM   5608 C CG2 . VAL C 1 64  ? 37.377  74.754  16.698  1.00 13.88 ? 65   VAL C CG2 1 
ATOM   5609 N N   . GLY C 1 65  ? 39.061  79.078  16.733  1.00 19.21 ? 66   GLY C N   1 
ATOM   5610 C CA  . GLY C 1 65  ? 39.070  80.496  16.458  1.00 22.02 ? 66   GLY C CA  1 
ATOM   5611 C C   . GLY C 1 65  ? 40.061  80.856  15.367  1.00 21.72 ? 66   GLY C C   1 
ATOM   5612 O O   . GLY C 1 65  ? 40.549  79.974  14.655  1.00 22.46 ? 66   GLY C O   1 
ATOM   5613 N N   . GLY C 1 66  ? 40.353  82.153  15.256  1.00 19.13 ? 67   GLY C N   1 
ATOM   5614 C CA  . GLY C 1 66  ? 41.226  82.678  14.223  1.00 17.60 ? 67   GLY C CA  1 
ATOM   5615 C C   . GLY C 1 66  ? 40.495  83.841  13.515  1.00 19.40 ? 67   GLY C C   1 
ATOM   5616 O O   . GLY C 1 66  ? 39.336  84.149  13.808  1.00 20.04 ? 67   GLY C O   1 
ATOM   5617 N N   . GLY C 1 67  ? 41.152  84.487  12.572  1.00 21.07 ? 68   GLY C N   1 
ATOM   5618 C CA  . GLY C 1 67  ? 40.523  85.643  11.941  1.00 21.37 ? 68   GLY C CA  1 
ATOM   5619 C C   . GLY C 1 67  ? 39.573  85.330  10.797  1.00 22.89 ? 68   GLY C C   1 
ATOM   5620 O O   . GLY C 1 67  ? 38.621  86.052  10.578  1.00 24.48 ? 68   GLY C O   1 
ATOM   5621 N N   . ASP C 1 68  ? 39.817  84.243  10.076  1.00 25.47 ? 69   ASP C N   1 
ATOM   5622 C CA  . ASP C 1 68  ? 38.968  83.889  8.926   1.00 23.55 ? 69   ASP C CA  1 
ATOM   5623 C C   . ASP C 1 68  ? 37.785  83.032  9.361   1.00 21.88 ? 69   ASP C C   1 
ATOM   5624 O O   . ASP C 1 68  ? 37.970  81.874  9.729   1.00 20.31 ? 69   ASP C O   1 
ATOM   5625 C CB  . ASP C 1 68  ? 39.813  83.148  7.902   1.00 26.35 ? 69   ASP C CB  1 
ATOM   5626 C CG  . ASP C 1 68  ? 39.072  82.928  6.585   1.00 28.80 ? 69   ASP C CG  1 
ATOM   5627 O OD1 . ASP C 1 68  ? 38.037  82.244  6.559   1.00 24.66 ? 69   ASP C OD1 1 
ATOM   5628 O OD2 . ASP C 1 68  ? 39.534  83.465  5.570   1.00 35.72 ? 69   ASP C OD2 1 
ATOM   5629 N N   . MET C 1 69  ? 36.580  83.599  9.303   1.00 22.55 ? 70   MET C N   1 
ATOM   5630 C CA  . MET C 1 69  ? 35.390  82.889  9.748   1.00 24.69 ? 70   MET C CA  1 
ATOM   5631 C C   . MET C 1 69  ? 35.101  81.602  8.979   1.00 25.39 ? 70   MET C C   1 
ATOM   5632 O O   . MET C 1 69  ? 34.822  80.559  9.586   1.00 23.85 ? 70   MET C O   1 
ATOM   5633 C CB  . MET C 1 69  ? 34.167  83.806  9.710   1.00 26.07 ? 70   MET C CB  1 
ATOM   5634 C CG  . MET C 1 69  ? 32.880  83.061  9.970   1.00 29.18 ? 70   MET C CG  1 
ATOM   5635 S SD  . MET C 1 69  ? 31.403  84.128  9.992   1.00 41.29 ? 70   MET C SD  1 
ATOM   5636 C CE  . MET C 1 69  ? 31.054  83.975  11.663  1.00 40.08 ? 70   MET C CE  1 
ATOM   5637 N N   . ALA C 1 70  ? 35.180  81.668  7.656   1.00 22.50 ? 71   ALA C N   1 
ATOM   5638 C CA  . ALA C 1 70  ? 34.934  80.492  6.833   1.00 23.38 ? 71   ALA C CA  1 
ATOM   5639 C C   . ALA C 1 70  ? 35.935  79.361  7.180   1.00 22.08 ? 71   ALA C C   1 
ATOM   5640 O O   . ALA C 1 70  ? 35.540  78.187  7.263   1.00 21.50 ? 71   ALA C O   1 
ATOM   5641 C CB  . ALA C 1 70  ? 35.025  80.875  5.300   1.00 21.90 ? 71   ALA C CB  1 
ATOM   5642 N N   . ALA C 1 71  ? 37.217  79.693  7.355   1.00 22.98 ? 72   ALA C N   1 
ATOM   5643 C CA  . ALA C 1 71  ? 38.208  78.649  7.740   1.00 24.97 ? 72   ALA C CA  1 
ATOM   5644 C C   . ALA C 1 71  ? 37.857  78.056  9.114   1.00 24.24 ? 72   ALA C C   1 
ATOM   5645 O O   . ALA C 1 71  ? 37.954  76.826  9.333   1.00 21.05 ? 72   ALA C O   1 
ATOM   5646 C CB  . ALA C 1 71  ? 39.637  79.218  7.771   1.00 24.24 ? 72   ALA C CB  1 
ATOM   5647 N N   . GLY C 1 72  ? 37.472  78.924  10.047  1.00 23.38 ? 73   GLY C N   1 
ATOM   5648 C CA  . GLY C 1 72  ? 37.076  78.446  11.367  1.00 23.60 ? 73   GLY C CA  1 
ATOM   5649 C C   . GLY C 1 72  ? 35.883  77.501  11.269  1.00 24.42 ? 73   GLY C C   1 
ATOM   5650 O O   . GLY C 1 72  ? 35.807  76.457  11.968  1.00 21.49 ? 73   GLY C O   1 
ATOM   5651 N N   . GLU C 1 73  ? 34.925  77.851  10.408  1.00 24.05 ? 74   GLU C N   1 
ATOM   5652 C CA  . GLU C 1 73  ? 33.745  76.988  10.237  1.00 23.31 ? 74   GLU C CA  1 
ATOM   5653 C C   . GLU C 1 73  ? 34.133  75.618  9.679   1.00 22.64 ? 74   GLU C C   1 
ATOM   5654 O O   . GLU C 1 73  ? 33.546  74.608  10.068  1.00 22.88 ? 74   GLU C O   1 
ATOM   5655 C CB  . GLU C 1 73  ? 32.722  77.641  9.299   1.00 24.80 ? 74   GLU C CB  1 
ATOM   5656 C CG  . GLU C 1 73  ? 32.036  78.833  9.956   1.00 28.05 ? 74   GLU C CG  1 
ATOM   5657 C CD  . GLU C 1 73  ? 30.983  79.460  9.064   1.00 33.17 ? 74   GLU C CD  1 
ATOM   5658 O OE1 . GLU C 1 73  ? 29.847  79.675  9.547   1.00 33.90 ? 74   GLU C OE1 1 
ATOM   5659 O OE2 . GLU C 1 73  ? 31.306  79.728  7.885   1.00 34.45 ? 74   GLU C OE2 1 
ATOM   5660 N N   . ARG C 1 74  ? 35.103  75.590  8.762   1.00 23.27 ? 75   ARG C N   1 
ATOM   5661 C CA  . ARG C 1 74  ? 35.550  74.308  8.178   1.00 21.80 ? 75   ARG C CA  1 
ATOM   5662 C C   . ARG C 1 74  ? 36.222  73.450  9.258   1.00 24.13 ? 75   ARG C C   1 
ATOM   5663 O O   . ARG C 1 74  ? 35.957  72.249  9.385   1.00 20.09 ? 75   ARG C O   1 
ATOM   5664 C CB  . ARG C 1 74  ? 36.489  74.553  7.017   1.00 26.54 ? 75   ARG C CB  1 
ATOM   5665 C CG  . ARG C 1 74  ? 35.752  75.157  5.771   1.00 30.40 ? 75   ARG C CG  1 
ATOM   5666 C CD  . ARG C 1 74  ? 36.626  75.153  4.535   1.00 31.38 ? 75   ARG C CD  1 
ATOM   5667 N NE  . ARG C 1 74  ? 37.747  76.090  4.612   1.00 36.14 ? 75   ARG C NE  1 
ATOM   5668 C CZ  . ARG C 1 74  ? 37.698  77.387  4.298   1.00 36.97 ? 75   ARG C CZ  1 
ATOM   5669 N NH1 . ARG C 1 74  ? 36.576  77.958  3.868   1.00 38.49 ? 75   ARG C NH1 1 
ATOM   5670 N NH2 . ARG C 1 74  ? 38.791  78.125  4.420   1.00 39.69 ? 75   ARG C NH2 1 
ATOM   5671 N N   . VAL C 1 75  ? 37.068  74.074  10.073  1.00 19.97 ? 76   VAL C N   1 
ATOM   5672 C CA  . VAL C 1 75  ? 37.706  73.316  11.144  1.00 19.68 ? 76   VAL C CA  1 
ATOM   5673 C C   . VAL C 1 75  ? 36.633  72.824  12.122  1.00 16.29 ? 76   VAL C C   1 
ATOM   5674 O O   . VAL C 1 75  ? 36.623  71.666  12.545  1.00 21.17 ? 76   VAL C O   1 
ATOM   5675 C CB  . VAL C 1 75  ? 38.710  74.214  11.884  1.00 18.33 ? 76   VAL C CB  1 
ATOM   5676 C CG1 . VAL C 1 75  ? 39.219  73.469  13.142  1.00 15.69 ? 76   VAL C CG1 1 
ATOM   5677 C CG2 . VAL C 1 75  ? 39.919  74.563  10.923  1.00 17.70 ? 76   VAL C CG2 1 
ATOM   5678 N N   . PHE C 1 76  ? 35.690  73.693  12.463  1.00 17.19 ? 77   PHE C N   1 
ATOM   5679 C CA  . PHE C 1 76  ? 34.650  73.336  13.429  1.00 19.31 ? 77   PHE C CA  1 
ATOM   5680 C C   . PHE C 1 76  ? 33.809  72.160  12.932  1.00 21.41 ? 77   PHE C C   1 
ATOM   5681 O O   . PHE C 1 76  ? 33.435  71.305  13.717  1.00 20.82 ? 77   PHE C O   1 
ATOM   5682 C CB  . PHE C 1 76  ? 33.774  74.552  13.708  1.00 20.81 ? 77   PHE C CB  1 
ATOM   5683 C CG  . PHE C 1 76  ? 32.940  74.436  14.947  1.00 22.90 ? 77   PHE C CG  1 
ATOM   5684 C CD1 . PHE C 1 76  ? 33.546  74.340  16.219  1.00 22.97 ? 77   PHE C CD1 1 
ATOM   5685 C CD2 . PHE C 1 76  ? 31.546  74.493  14.872  1.00 21.24 ? 77   PHE C CD2 1 
ATOM   5686 C CE1 . PHE C 1 76  ? 32.732  74.308  17.406  1.00 25.19 ? 77   PHE C CE1 1 
ATOM   5687 C CE2 . PHE C 1 76  ? 30.736  74.463  16.014  1.00 23.05 ? 77   PHE C CE2 1 
ATOM   5688 C CZ  . PHE C 1 76  ? 31.331  74.368  17.299  1.00 22.55 ? 77   PHE C CZ  1 
ATOM   5689 N N   . GLU C 1 77  ? 33.522  72.100  11.622  1.00 23.32 ? 78   GLU C N   1 
ATOM   5690 C CA  . GLU C 1 77  ? 32.770  70.950  11.084  1.00 22.81 ? 78   GLU C CA  1 
ATOM   5691 C C   . GLU C 1 77  ? 33.653  69.694  11.169  1.00 21.22 ? 78   GLU C C   1 
ATOM   5692 O O   . GLU C 1 77  ? 33.159  68.633  11.509  1.00 21.51 ? 78   GLU C O   1 
ATOM   5693 C CB  . GLU C 1 77  ? 32.343  71.178  9.603   1.00 25.10 ? 78   GLU C CB  1 
ATOM   5694 C CG  . GLU C 1 77  ? 31.221  72.206  9.397   1.00 27.42 ? 78   GLU C CG  1 
ATOM   5695 C CD  . GLU C 1 77  ? 30.013  71.946  10.298  1.00 33.74 ? 78   GLU C CD  1 
ATOM   5696 O OE1 . GLU C 1 77  ? 29.547  70.784  10.332  1.00 34.82 ? 78   GLU C OE1 1 
ATOM   5697 O OE2 . GLU C 1 77  ? 29.517  72.885  10.984  1.00 33.86 ? 78   GLU C OE2 1 
ATOM   5698 N N   . ALA C 1 78  ? 34.951  69.807  10.838  1.00 20.06 ? 79   ALA C N   1 
ATOM   5699 C CA  . ALA C 1 78  ? 35.835  68.649  10.911  1.00 17.61 ? 79   ALA C CA  1 
ATOM   5700 C C   . ALA C 1 78  ? 35.930  68.129  12.368  1.00 21.95 ? 79   ALA C C   1 
ATOM   5701 O O   . ALA C 1 78  ? 36.051  66.924  12.578  1.00 22.70 ? 79   ALA C O   1 
ATOM   5702 C CB  . ALA C 1 78  ? 37.253  69.000  10.366  1.00 17.78 ? 79   ALA C CB  1 
ATOM   5703 N N   . VAL C 1 79  ? 35.834  69.026  13.358  1.00 21.01 ? 80   VAL C N   1 
ATOM   5704 C CA  . VAL C 1 79  ? 35.873  68.635  14.769  1.00 21.51 ? 80   VAL C CA  1 
ATOM   5705 C C   . VAL C 1 79  ? 34.617  67.834  15.110  1.00 23.34 ? 80   VAL C C   1 
ATOM   5706 O O   . VAL C 1 79  ? 34.709  66.753  15.704  1.00 21.99 ? 80   VAL C O   1 
ATOM   5707 C CB  . VAL C 1 79  ? 35.924  69.881  15.711  1.00 21.21 ? 80   VAL C CB  1 
ATOM   5708 C CG1 . VAL C 1 79  ? 35.575  69.473  17.207  1.00 17.23 ? 80   VAL C CG1 1 
ATOM   5709 C CG2 . VAL C 1 79  ? 37.310  70.491  15.652  1.00 22.49 ? 80   VAL C CG2 1 
ATOM   5710 N N   . LYS C 1 80  ? 33.440  68.357  14.746  1.00 22.41 ? 81   LYS C N   1 
ATOM   5711 C CA  . LYS C 1 80  ? 32.210  67.635  15.062  1.00 24.19 ? 81   LYS C CA  1 
ATOM   5712 C C   . LYS C 1 80  ? 32.142  66.273  14.334  1.00 24.39 ? 81   LYS C C   1 
ATOM   5713 O O   . LYS C 1 80  ? 31.600  65.313  14.867  1.00 25.78 ? 81   LYS C O   1 
ATOM   5714 C CB  . LYS C 1 80  ? 30.973  68.490  14.733  1.00 23.17 ? 81   LYS C CB  1 
ATOM   5715 C CG  . LYS C 1 80  ? 30.840  69.739  15.634  1.00 24.16 ? 81   LYS C CG  1 
ATOM   5716 C CD  . LYS C 1 80  ? 29.644  70.617  15.277  1.00 26.40 ? 81   LYS C CD  1 
ATOM   5717 C CE  . LYS C 1 80  ? 29.654  71.103  13.818  1.00 27.00 ? 81   LYS C CE  1 
ATOM   5718 N NZ  . LYS C 1 80  ? 28.427  71.952  13.584  1.00 27.77 ? 81   LYS C NZ  1 
ATOM   5719 N N   . LYS C 1 81  ? 32.713  66.188  13.139  1.00 25.28 ? 82   LYS C N   1 
ATOM   5720 C CA  . LYS C 1 81  ? 32.717  64.925  12.373  1.00 28.21 ? 82   LYS C CA  1 
ATOM   5721 C C   . LYS C 1 81  ? 33.603  63.851  13.013  1.00 29.24 ? 82   LYS C C   1 
ATOM   5722 O O   . LYS C 1 81  ? 33.384  62.637  12.833  1.00 27.08 ? 82   LYS C O   1 
ATOM   5723 C CB  . LYS C 1 81  ? 33.215  65.195  10.960  1.00 29.43 ? 82   LYS C CB  1 
ATOM   5724 C CG  . LYS C 1 81  ? 33.395  63.975  10.079  1.00 35.92 ? 82   LYS C CG  1 
ATOM   5725 C CD  . LYS C 1 81  ? 33.776  64.410  8.631   1.00 40.43 ? 82   LYS C CD  1 
ATOM   5726 C CE  . LYS C 1 81  ? 34.491  63.275  7.875   1.00 44.36 ? 82   LYS C CE  1 
ATOM   5727 N NZ  . LYS C 1 81  ? 34.931  63.644  6.479   1.00 44.66 ? 82   LYS C NZ  1 
ATOM   5728 N N   . ARG C 1 82  ? 34.614  64.287  13.756  1.00 28.93 ? 83   ARG C N   1 
ATOM   5729 C CA  . ARG C 1 82  ? 35.523  63.320  14.379  1.00 27.41 ? 83   ARG C CA  1 
ATOM   5730 C C   . ARG C 1 82  ? 34.890  62.640  15.598  1.00 26.85 ? 83   ARG C C   1 
ATOM   5731 O O   . ARG C 1 82  ? 35.278  61.520  15.969  1.00 27.93 ? 83   ARG C O   1 
ATOM   5732 C CB  . ARG C 1 82  ? 36.825  64.006  14.768  1.00 27.66 ? 83   ARG C CB  1 
ATOM   5733 C CG  . ARG C 1 82  ? 37.931  63.051  15.117  1.00 30.12 ? 83   ARG C CG  1 
ATOM   5734 C CD  . ARG C 1 82  ? 38.381  62.342  13.857  1.00 27.73 ? 83   ARG C CD  1 
ATOM   5735 N NE  . ARG C 1 82  ? 39.690  61.728  14.017  1.00 32.80 ? 83   ARG C NE  1 
ATOM   5736 C CZ  . ARG C 1 82  ? 40.514  61.489  13.007  1.00 32.63 ? 83   ARG C CZ  1 
ATOM   5737 N NH1 . ARG C 1 82  ? 40.155  61.824  11.772  1.00 34.32 ? 83   ARG C NH1 1 
ATOM   5738 N NH2 . ARG C 1 82  ? 41.689  60.914  13.228  1.00 33.39 ? 83   ARG C NH2 1 
ATOM   5739 N N   . PHE C 1 83  ? 33.930  63.304  16.236  1.00 25.26 ? 84   PHE C N   1 
ATOM   5740 C CA  . PHE C 1 83  ? 33.282  62.709  17.393  1.00 26.87 ? 84   PHE C CA  1 
ATOM   5741 C C   . PHE C 1 83  ? 32.551  61.445  16.929  1.00 29.93 ? 84   PHE C C   1 
ATOM   5742 O O   . PHE C 1 83  ? 32.147  61.339  15.775  1.00 26.80 ? 84   PHE C O   1 
ATOM   5743 C CB  . PHE C 1 83  ? 32.228  63.648  18.003  1.00 25.60 ? 84   PHE C CB  1 
ATOM   5744 C CG  . PHE C 1 83  ? 32.780  64.973  18.510  1.00 24.54 ? 84   PHE C CG  1 
ATOM   5745 C CD1 . PHE C 1 83  ? 34.052  65.045  19.093  1.00 22.30 ? 84   PHE C CD1 1 
ATOM   5746 C CD2 . PHE C 1 83  ? 31.970  66.128  18.490  1.00 20.05 ? 84   PHE C CD2 1 
ATOM   5747 C CE1 . PHE C 1 83  ? 34.517  66.250  19.659  1.00 21.61 ? 84   PHE C CE1 1 
ATOM   5748 C CE2 . PHE C 1 83  ? 32.421  67.344  19.057  1.00 20.80 ? 84   PHE C CE2 1 
ATOM   5749 C CZ  . PHE C 1 83  ? 33.688  67.414  19.643  1.00 19.37 ? 84   PHE C CZ  1 
ATOM   5750 N N   A PHE C 1 84  ? 32.379  60.518  17.859  0.60 31.59 ? 85   PHE C N   1 
ATOM   5751 N N   B PHE C 1 84  ? 32.354  60.499  17.830  0.40 30.39 ? 85   PHE C N   1 
ATOM   5752 C CA  A PHE C 1 84  ? 31.745  59.236  17.584  0.60 35.30 ? 85   PHE C CA  1 
ATOM   5753 C CA  B PHE C 1 84  ? 31.615  59.298  17.476  0.40 32.74 ? 85   PHE C CA  1 
ATOM   5754 C C   A PHE C 1 84  ? 30.954  58.816  18.817  0.60 34.75 ? 85   PHE C C   1 
ATOM   5755 C C   B PHE C 1 84  ? 30.963  58.790  18.749  0.40 33.22 ? 85   PHE C C   1 
ATOM   5756 O O   A PHE C 1 84  ? 31.504  58.770  19.915  0.60 35.09 ? 85   PHE C O   1 
ATOM   5757 O O   B PHE C 1 84  ? 31.604  58.670  19.790  0.40 33.61 ? 85   PHE C O   1 
ATOM   5758 C CB  A PHE C 1 84  ? 32.842  58.197  17.311  0.60 37.25 ? 85   PHE C CB  1 
ATOM   5759 C CB  B PHE C 1 84  ? 32.533  58.255  16.806  0.40 32.69 ? 85   PHE C CB  1 
ATOM   5760 C CG  A PHE C 1 84  ? 32.352  56.936  16.670  0.60 40.94 ? 85   PHE C CG  1 
ATOM   5761 C CG  B PHE C 1 84  ? 33.286  57.371  17.757  0.40 32.14 ? 85   PHE C CG  1 
ATOM   5762 C CD1 A PHE C 1 84  ? 31.972  56.923  15.330  0.60 42.58 ? 85   PHE C CD1 1 
ATOM   5763 C CD1 B PHE C 1 84  ? 32.640  56.329  18.423  0.40 33.85 ? 85   PHE C CD1 1 
ATOM   5764 C CD2 A PHE C 1 84  ? 32.307  55.746  17.394  0.60 42.84 ? 85   PHE C CD2 1 
ATOM   5765 C CD2 B PHE C 1 84  ? 34.656  57.528  17.932  0.40 32.64 ? 85   PHE C CD2 1 
ATOM   5766 C CE1 A PHE C 1 84  ? 31.559  55.741  14.717  0.60 43.76 ? 85   PHE C CE1 1 
ATOM   5767 C CE1 B PHE C 1 84  ? 33.349  55.455  19.243  0.40 34.00 ? 85   PHE C CE1 1 
ATOM   5768 C CE2 A PHE C 1 84  ? 31.896  54.558  16.794  0.60 44.03 ? 85   PHE C CE2 1 
ATOM   5769 C CE2 B PHE C 1 84  ? 35.373  56.659  18.751  0.40 32.61 ? 85   PHE C CE2 1 
ATOM   5770 C CZ  A PHE C 1 84  ? 31.522  54.554  15.452  0.60 44.39 ? 85   PHE C CZ  1 
ATOM   5771 C CZ  B PHE C 1 84  ? 34.722  55.620  19.407  0.40 33.75 ? 85   PHE C CZ  1 
ATOM   5772 N N   . GLY C 1 85  ? 29.666  58.533  18.654  1.00 34.75 ? 86   GLY C N   1 
ATOM   5773 C CA  . GLY C 1 85  ? 28.890  58.085  19.790  1.00 33.45 ? 86   GLY C CA  1 
ATOM   5774 C C   . GLY C 1 85  ? 29.097  58.966  20.998  1.00 34.79 ? 86   GLY C C   1 
ATOM   5775 O O   . GLY C 1 85  ? 28.930  60.183  20.907  1.00 36.83 ? 86   GLY C O   1 
ATOM   5776 N N   . PRO C 1 86  ? 29.447  58.377  22.155  1.00 34.07 ? 87   PRO C N   1 
ATOM   5777 C CA  . PRO C 1 86  ? 29.699  59.055  23.434  1.00 31.25 ? 87   PRO C CA  1 
ATOM   5778 C C   . PRO C 1 86  ? 31.118  59.682  23.471  1.00 29.75 ? 87   PRO C C   1 
ATOM   5779 O O   . PRO C 1 86  ? 31.497  60.347  24.430  1.00 29.36 ? 87   PRO C O   1 
ATOM   5780 C CB  . PRO C 1 86  ? 29.561  57.932  24.441  1.00 34.42 ? 87   PRO C CB  1 
ATOM   5781 C CG  . PRO C 1 86  ? 30.225  56.790  23.721  1.00 34.35 ? 87   PRO C CG  1 
ATOM   5782 C CD  . PRO C 1 86  ? 29.690  56.926  22.273  1.00 33.12 ? 87   PRO C CD  1 
ATOM   5783 N N   A PHE C 1 87  ? 31.887  59.454  22.414  0.60 27.97 ? 88   PHE C N   1 
ATOM   5784 N N   B PHE C 1 87  ? 31.897  59.452  22.424  0.40 28.18 ? 88   PHE C N   1 
ATOM   5785 C CA  A PHE C 1 87  ? 33.239  59.992  22.335  0.60 28.67 ? 88   PHE C CA  1 
ATOM   5786 C CA  B PHE C 1 87  ? 33.242  60.004  22.385  0.40 28.21 ? 88   PHE C CA  1 
ATOM   5787 C C   A PHE C 1 87  ? 33.234  61.398  21.748  0.60 25.33 ? 88   PHE C C   1 
ATOM   5788 C C   B PHE C 1 87  ? 33.244  61.391  21.765  0.40 25.70 ? 88   PHE C C   1 
ATOM   5789 O O   A PHE C 1 87  ? 33.427  61.583  20.545  0.60 26.09 ? 88   PHE C O   1 
ATOM   5790 O O   B PHE C 1 87  ? 33.450  61.555  20.562  0.40 26.15 ? 88   PHE C O   1 
ATOM   5791 C CB  A PHE C 1 87  ? 34.117  59.048  21.510  0.60 28.79 ? 88   PHE C CB  1 
ATOM   5792 C CB  B PHE C 1 87  ? 34.172  59.065  21.625  0.40 28.22 ? 88   PHE C CB  1 
ATOM   5793 C CG  A PHE C 1 87  ? 34.222  57.676  22.113  0.60 32.54 ? 88   PHE C CG  1 
ATOM   5794 C CG  B PHE C 1 87  ? 34.342  57.733  22.296  0.40 30.10 ? 88   PHE C CG  1 
ATOM   5795 C CD1 A PHE C 1 87  ? 33.884  56.536  21.365  0.60 31.28 ? 88   PHE C CD1 1 
ATOM   5796 C CD1 B PHE C 1 87  ? 33.256  56.862  22.429  0.40 30.04 ? 88   PHE C CD1 1 
ATOM   5797 C CD2 A PHE C 1 87  ? 34.587  57.526  23.458  0.60 31.20 ? 88   PHE C CD2 1 
ATOM   5798 C CD2 B PHE C 1 87  ? 35.583  57.344  22.793  0.40 28.01 ? 88   PHE C CD2 1 
ATOM   5799 C CE1 A PHE C 1 87  ? 33.898  55.268  21.949  0.60 31.13 ? 88   PHE C CE1 1 
ATOM   5800 C CE1 B PHE C 1 87  ? 33.405  55.619  23.045  0.40 30.47 ? 88   PHE C CE1 1 
ATOM   5801 C CE2 A PHE C 1 87  ? 34.609  56.268  24.055  0.60 34.49 ? 88   PHE C CE2 1 
ATOM   5802 C CE2 B PHE C 1 87  ? 35.748  56.115  23.406  0.40 29.34 ? 88   PHE C CE2 1 
ATOM   5803 C CZ  A PHE C 1 87  ? 34.260  55.130  23.298  0.60 34.16 ? 88   PHE C CZ  1 
ATOM   5804 C CZ  B PHE C 1 87  ? 34.658  55.242  23.536  0.40 31.06 ? 88   PHE C CZ  1 
ATOM   5805 N N   . ARG C 1 88  ? 33.013  62.388  22.613  1.00 25.45 ? 89   ARG C N   1 
ATOM   5806 C CA  . ARG C 1 88  ? 32.967  63.792  22.182  1.00 23.96 ? 89   ARG C CA  1 
ATOM   5807 C C   . ARG C 1 88  ? 33.183  64.638  23.410  1.00 21.53 ? 89   ARG C C   1 
ATOM   5808 O O   . ARG C 1 88  ? 33.166  64.121  24.524  1.00 21.57 ? 89   ARG C O   1 
ATOM   5809 C CB  . ARG C 1 88  ? 31.581  64.126  21.571  1.00 23.40 ? 89   ARG C CB  1 
ATOM   5810 C CG  . ARG C 1 88  ? 30.407  63.978  22.576  1.00 25.05 ? 89   ARG C CG  1 
ATOM   5811 C CD  . ARG C 1 88  ? 28.984  64.131  21.901  1.00 25.97 ? 89   ARG C CD  1 
ATOM   5812 N NE  . ARG C 1 88  ? 28.859  63.060  20.918  1.00 25.41 ? 89   ARG C NE  1 
ATOM   5813 C CZ  . ARG C 1 88  ? 28.780  63.212  19.592  1.00 27.06 ? 89   ARG C CZ  1 
ATOM   5814 N NH1 . ARG C 1 88  ? 28.775  64.431  19.013  1.00 21.67 ? 89   ARG C NH1 1 
ATOM   5815 N NH2 . ARG C 1 88  ? 28.779  62.113  18.831  1.00 23.63 ? 89   ARG C NH2 1 
ATOM   5816 N N   . VAL C 1 89  ? 33.424  65.936  23.212  1.00 22.52 ? 90   VAL C N   1 
ATOM   5817 C CA  . VAL C 1 89  ? 33.594  66.873  24.341  1.00 20.16 ? 90   VAL C CA  1 
ATOM   5818 C C   . VAL C 1 89  ? 32.899  68.127  23.865  1.00 19.00 ? 90   VAL C C   1 
ATOM   5819 O O   . VAL C 1 89  ? 32.587  68.203  22.689  1.00 19.85 ? 90   VAL C O   1 
ATOM   5820 C CB  . VAL C 1 89  ? 35.110  67.192  24.635  1.00 23.59 ? 90   VAL C CB  1 
ATOM   5821 C CG1 . VAL C 1 89  ? 35.811  65.914  25.229  1.00 20.05 ? 90   VAL C CG1 1 
ATOM   5822 C CG2 . VAL C 1 89  ? 35.839  67.652  23.328  1.00 19.88 ? 90   VAL C CG2 1 
ATOM   5823 N N   . SER C 1 90  ? 32.653  69.090  24.741  1.00 17.40 ? 91   SER C N   1 
ATOM   5824 C CA  . SER C 1 90  ? 31.981  70.329  24.300  1.00 19.64 ? 91   SER C CA  1 
ATOM   5825 C C   . SER C 1 90  ? 32.900  71.136  23.387  1.00 19.88 ? 91   SER C C   1 
ATOM   5826 O O   . SER C 1 90  ? 34.119  71.073  23.538  1.00 17.58 ? 91   SER C O   1 
ATOM   5827 C CB  . SER C 1 90  ? 31.570  71.173  25.508  1.00 17.92 ? 91   SER C CB  1 
ATOM   5828 O OG  . SER C 1 90  ? 30.547  70.518  26.264  1.00 19.45 ? 91   SER C OG  1 
ATOM   5829 N N   . CYS C 1 91  ? 32.335  71.887  22.423  1.00 16.66 ? 92   CYS C N   1 
ATOM   5830 C CA  . CYS C 1 91  ? 33.198  72.664  21.564  1.00 18.30 ? 92   CYS C CA  1 
ATOM   5831 C C   . CYS C 1 91  ? 32.523  74.017  21.305  1.00 17.62 ? 92   CYS C C   1 
ATOM   5832 O O   . CYS C 1 91  ? 31.300  74.148  21.434  1.00 18.69 ? 92   CYS C O   1 
ATOM   5833 C CB  . CYS C 1 91  ? 33.480  71.894  20.262  1.00 21.56 ? 92   CYS C CB  1 
ATOM   5834 S SG  . CYS C 1 91  ? 31.970  71.417  19.367  1.00 22.61 ? 92   CYS C SG  1 
ATOM   5835 N N   . MET C 1 92  ? 33.328  75.018  20.981  1.00 17.74 ? 93   MET C N   1 
ATOM   5836 C CA  . MET C 1 92  ? 32.820  76.374  20.743  1.00 15.55 ? 93   MET C CA  1 
ATOM   5837 C C   . MET C 1 92  ? 33.560  76.971  19.540  1.00 14.69 ? 93   MET C C   1 
ATOM   5838 O O   . MET C 1 92  ? 34.768  76.670  19.299  1.00 15.89 ? 93   MET C O   1 
ATOM   5839 C CB  . MET C 1 92  ? 33.131  77.253  21.945  1.00 17.50 ? 93   MET C CB  1 
ATOM   5840 C CG  . MET C 1 92  ? 32.943  78.754  21.637  1.00 15.90 ? 93   MET C CG  1 
ATOM   5841 S SD  . MET C 1 92  ? 33.008  79.610  23.260  1.00 18.60 ? 93   MET C SD  1 
ATOM   5842 C CE  . MET C 1 92  ? 32.765  81.374  22.780  1.00 21.20 ? 93   MET C CE  1 
ATOM   5843 N N   . LEU C 1 93  ? 32.855  77.829  18.808  1.00 14.66 ? 94   LEU C N   1 
ATOM   5844 C CA  . LEU C 1 93  ? 33.412  78.471  17.624  1.00 14.88 ? 94   LEU C CA  1 
ATOM   5845 C C   . LEU C 1 93  ? 33.276  79.949  17.813  1.00 11.40 ? 94   LEU C C   1 
ATOM   5846 O O   . LEU C 1 93  ? 32.212  80.425  18.159  1.00 13.53 ? 94   LEU C O   1 
ATOM   5847 C CB  . LEU C 1 93  ? 32.586  78.136  16.357  1.00 14.99 ? 94   LEU C CB  1 
ATOM   5848 C CG  . LEU C 1 93  ? 33.046  78.850  15.075  1.00 15.58 ? 94   LEU C CG  1 
ATOM   5849 C CD1 . LEU C 1 93  ? 34.504  78.425  14.699  1.00 16.67 ? 94   LEU C CD1 1 
ATOM   5850 C CD2 . LEU C 1 93  ? 32.082  78.439  13.936  1.00 18.39 ? 94   LEU C CD2 1 
ATOM   5851 N N   . ASP C 1 94  ? 34.331  80.689  17.569  1.00 13.88 ? 95   ASP C N   1 
ATOM   5852 C CA  . ASP C 1 94  ? 34.213  82.149  17.693  1.00 18.38 ? 95   ASP C CA  1 
ATOM   5853 C C   . ASP C 1 94  ? 35.501  82.637  17.059  1.00 19.81 ? 95   ASP C C   1 
ATOM   5854 O O   . ASP C 1 94  ? 36.546  82.604  17.671  1.00 26.06 ? 95   ASP C O   1 
ATOM   5855 C CB  . ASP C 1 94  ? 34.143  82.584  19.166  1.00 19.43 ? 95   ASP C CB  1 
ATOM   5856 C CG  . ASP C 1 94  ? 33.601  84.031  19.342  1.00 21.64 ? 95   ASP C CG  1 
ATOM   5857 O OD1 . ASP C 1 94  ? 32.757  84.446  18.519  1.00 21.21 ? 95   ASP C OD1 1 
ATOM   5858 O OD2 . ASP C 1 94  ? 33.992  84.752  20.309  1.00 24.21 ? 95   ASP C OD2 1 
ATOM   5859 N N   . SER C 1 95  ? 35.421  83.066  15.823  1.00 21.67 ? 96   SER C N   1 
ATOM   5860 C CA  . SER C 1 95  ? 36.598  83.520  15.098  1.00 19.88 ? 96   SER C CA  1 
ATOM   5861 C C   . SER C 1 95  ? 36.690  85.023  15.251  1.00 22.96 ? 96   SER C C   1 
ATOM   5862 O O   . SER C 1 95  ? 35.936  85.758  14.630  1.00 21.66 ? 96   SER C O   1 
ATOM   5863 C CB  . SER C 1 95  ? 36.439  83.155  13.618  1.00 23.41 ? 96   SER C CB  1 
ATOM   5864 O OG  . SER C 1 95  ? 36.466  81.758  13.442  1.00 25.17 ? 96   SER C OG  1 
ATOM   5865 N N   . ASN C 1 96  ? 37.569  85.497  16.124  1.00 25.69 ? 97   ASN C N   1 
ATOM   5866 C CA  . ASN C 1 96  ? 37.692  86.926  16.266  1.00 27.50 ? 97   ASN C CA  1 
ATOM   5867 C C   . ASN C 1 96  ? 36.353  87.549  16.691  1.00 25.22 ? 97   ASN C C   1 
ATOM   5868 O O   . ASN C 1 96  ? 35.985  88.627  16.218  1.00 25.13 ? 97   ASN C O   1 
ATOM   5869 C CB  . ASN C 1 96  ? 38.095  87.473  14.903  1.00 32.26 ? 97   ASN C CB  1 
ATOM   5870 C CG  . ASN C 1 96  ? 39.202  88.453  14.987  1.00 41.36 ? 97   ASN C CG  1 
ATOM   5871 O OD1 . ASN C 1 96  ? 40.391  88.123  14.710  1.00 41.26 ? 97   ASN C OD1 1 
ATOM   5872 N ND2 . ASN C 1 96  ? 38.849  89.689  15.379  1.00 37.50 ? 97   ASN C ND2 1 
ATOM   5873 N N   . GLY C 1 97  ? 35.614  86.881  17.565  1.00 22.33 ? 98   GLY C N   1 
ATOM   5874 C CA  . GLY C 1 97  ? 34.335  87.416  18.007  1.00 23.44 ? 98   GLY C CA  1 
ATOM   5875 C C   . GLY C 1 97  ? 33.162  87.387  17.042  1.00 25.29 ? 98   GLY C C   1 
ATOM   5876 O O   . GLY C 1 97  ? 32.108  87.967  17.341  1.00 25.83 ? 98   GLY C O   1 
ATOM   5877 N N   . SER C 1 98  ? 33.306  86.682  15.918  1.00 21.40 ? 99   SER C N   1 
ATOM   5878 C CA  . SER C 1 98  ? 32.230  86.592  14.926  1.00 25.50 ? 99   SER C CA  1 
ATOM   5879 C C   . SER C 1 98  ? 30.868  86.211  15.568  1.00 24.72 ? 99   SER C C   1 
ATOM   5880 O O   . SER C 1 98  ? 29.815  86.788  15.236  1.00 23.55 ? 99   SER C O   1 
ATOM   5881 C CB  . SER C 1 98  ? 32.600  85.569  13.856  1.00 27.81 ? 99   SER C CB  1 
ATOM   5882 O OG  . SER C 1 98  ? 32.759  84.268  14.421  1.00 27.67 ? 99   SER C OG  1 
ATOM   5883 N N   . ASN C 1 99  ? 30.880  85.238  16.479  1.00 20.18 ? 100  ASN C N   1 
ATOM   5884 C CA  . ASN C 1 99  ? 29.671  84.854  17.161  1.00 17.13 ? 100  ASN C CA  1 
ATOM   5885 C C   . ASN C 1 99  ? 29.360  85.682  18.422  1.00 19.94 ? 100  ASN C C   1 
ATOM   5886 O O   . ASN C 1 99  ? 28.216  86.146  18.641  1.00 21.51 ? 100  ASN C O   1 
ATOM   5887 C CB  . ASN C 1 99  ? 29.735  83.361  17.577  1.00 20.41 ? 100  ASN C CB  1 
ATOM   5888 C CG  . ASN C 1 99  ? 29.434  82.405  16.404  1.00 22.52 ? 100  ASN C CG  1 
ATOM   5889 O OD1 . ASN C 1 99  ? 28.658  82.743  15.506  1.00 23.44 ? 100  ASN C OD1 1 
ATOM   5890 N ND2 . ASN C 1 99  ? 30.059  81.226  16.406  1.00 20.00 ? 100  ASN C ND2 1 
ATOM   5891 N N   . THR C 1 100 ? 30.353  85.834  19.290  1.00 17.20 ? 101  THR C N   1 
ATOM   5892 C CA  . THR C 1 100 ? 30.068  86.552  20.533  1.00 18.02 ? 101  THR C CA  1 
ATOM   5893 C C   . THR C 1 100 ? 29.730  88.012  20.338  1.00 16.61 ? 101  THR C C   1 
ATOM   5894 O O   . THR C 1 100 ? 28.826  88.508  20.977  1.00 19.38 ? 101  THR C O   1 
ATOM   5895 C CB  . THR C 1 100 ? 31.178  86.339  21.556  1.00 19.33 ? 101  THR C CB  1 
ATOM   5896 O OG1 . THR C 1 100 ? 32.449  86.699  21.000  1.00 19.56 ? 101  THR C OG1 1 
ATOM   5897 C CG2 . THR C 1 100 ? 31.230  84.858  21.904  1.00 16.44 ? 101  THR C CG2 1 
ATOM   5898 N N   . THR C 1 101 ? 30.415  88.686  19.419  1.00 18.25 ? 102  THR C N   1 
ATOM   5899 C CA  . THR C 1 101 ? 30.060  90.069  19.148  1.00 18.11 ? 102  THR C CA  1 
ATOM   5900 C C   . THR C 1 101 ? 28.669  90.228  18.587  1.00 19.40 ? 102  THR C C   1 
ATOM   5901 O O   . THR C 1 101 ? 27.852  91.039  19.080  1.00 19.02 ? 102  THR C O   1 
ATOM   5902 C CB  . THR C 1 101 ? 31.053  90.699  18.197  1.00 18.02 ? 102  THR C CB  1 
ATOM   5903 O OG1 . THR C 1 101 ? 32.341  90.683  18.836  1.00 19.14 ? 102  THR C OG1 1 
ATOM   5904 C CG2 . THR C 1 101 ? 30.627  92.180  17.883  1.00 18.68 ? 102  THR C CG2 1 
ATOM   5905 N N   . ALA C 1 102 ? 28.372  89.449  17.544  1.00 19.25 ? 103  ALA C N   1 
ATOM   5906 C CA  . ALA C 1 102 ? 27.064  89.540  16.915  1.00 18.20 ? 103  ALA C CA  1 
ATOM   5907 C C   . ALA C 1 102 ? 25.947  89.169  17.899  1.00 19.62 ? 103  ALA C C   1 
ATOM   5908 O O   . ALA C 1 102 ? 24.913  89.851  17.973  1.00 20.47 ? 103  ALA C O   1 
ATOM   5909 C CB  . ALA C 1 102 ? 27.027  88.612  15.641  1.00 15.38 ? 103  ALA C CB  1 
ATOM   5910 N N   . ALA C 1 103 ? 26.141  88.112  18.679  1.00 19.48 ? 104  ALA C N   1 
ATOM   5911 C CA  . ALA C 1 103 ? 25.129  87.703  19.650  1.00 16.38 ? 104  ALA C CA  1 
ATOM   5912 C C   . ALA C 1 103 ? 24.897  88.787  20.671  1.00 17.89 ? 104  ALA C C   1 
ATOM   5913 O O   . ALA C 1 103 ? 23.758  89.018  21.070  1.00 15.29 ? 104  ALA C O   1 
ATOM   5914 C CB  . ALA C 1 103 ? 25.552  86.410  20.360  1.00 18.22 ? 104  ALA C CB  1 
ATOM   5915 N N   . ALA C 1 104 ? 25.961  89.439  21.131  1.00 19.54 ? 105  ALA C N   1 
ATOM   5916 C CA  . ALA C 1 104 ? 25.782  90.532  22.121  1.00 17.24 ? 105  ALA C CA  1 
ATOM   5917 C C   . ALA C 1 104 ? 24.989  91.681  21.456  1.00 19.24 ? 105  ALA C C   1 
ATOM   5918 O O   . ALA C 1 104 ? 24.023  92.184  22.012  1.00 15.51 ? 105  ALA C O   1 
ATOM   5919 C CB  . ALA C 1 104 ? 27.155  91.066  22.600  1.00 17.78 ? 105  ALA C CB  1 
ATOM   5920 N N   . GLY C 1 105 ? 25.400  92.071  20.254  1.00 17.28 ? 106  GLY C N   1 
ATOM   5921 C CA  . GLY C 1 105 ? 24.717  93.156  19.562  1.00 16.80 ? 106  GLY C CA  1 
ATOM   5922 C C   . GLY C 1 105 ? 23.237  92.901  19.358  1.00 17.14 ? 106  GLY C C   1 
ATOM   5923 O O   . GLY C 1 105 ? 22.370  93.705  19.717  1.00 16.59 ? 106  GLY C O   1 
ATOM   5924 N N   . VAL C 1 106 ? 22.914  91.752  18.774  1.00 18.67 ? 107  VAL C N   1 
ATOM   5925 C CA  . VAL C 1 106 ? 21.512  91.426  18.528  1.00 17.07 ? 107  VAL C CA  1 
ATOM   5926 C C   . VAL C 1 106 ? 20.724  91.241  19.819  1.00 17.30 ? 107  VAL C C   1 
ATOM   5927 O O   . VAL C 1 106 ? 19.589  91.698  19.932  1.00 18.29 ? 107  VAL C O   1 
ATOM   5928 C CB  . VAL C 1 106 ? 21.416  90.149  17.622  1.00 18.27 ? 107  VAL C CB  1 
ATOM   5929 C CG1 . VAL C 1 106 ? 19.979  89.795  17.347  1.00 19.16 ? 107  VAL C CG1 1 
ATOM   5930 C CG2 . VAL C 1 106 ? 22.184  90.408  16.333  1.00 16.90 ? 107  VAL C CG2 1 
ATOM   5931 N N   . ALA C 1 107 ? 21.323  90.618  20.837  1.00 17.46 ? 108  ALA C N   1 
ATOM   5932 C CA  . ALA C 1 107 ? 20.560  90.440  22.087  1.00 18.21 ? 108  ALA C CA  1 
ATOM   5933 C C   . ALA C 1 107 ? 20.203  91.772  22.724  1.00 20.10 ? 108  ALA C C   1 
ATOM   5934 O O   . ALA C 1 107 ? 19.107  91.924  23.293  1.00 19.10 ? 108  ALA C O   1 
ATOM   5935 C CB  . ALA C 1 107 ? 21.345  89.573  23.115  1.00 19.58 ? 108  ALA C CB  1 
ATOM   5936 N N   . LEU C 1 108 ? 21.135  92.722  22.666  1.00 18.75 ? 109  LEU C N   1 
ATOM   5937 C CA  . LEU C 1 108 ? 20.900  94.047  23.248  1.00 20.27 ? 109  LEU C CA  1 
ATOM   5938 C C   . LEU C 1 108 ? 19.780  94.772  22.489  1.00 18.64 ? 109  LEU C C   1 
ATOM   5939 O O   . LEU C 1 108 ? 18.920  95.429  23.069  1.00 20.10 ? 109  LEU C O   1 
ATOM   5940 C CB  . LEU C 1 108 ? 22.206  94.893  23.179  1.00 21.11 ? 109  LEU C CB  1 
ATOM   5941 C CG  . LEU C 1 108 ? 23.186  94.588  24.307  1.00 23.50 ? 109  LEU C CG  1 
ATOM   5942 C CD1 . LEU C 1 108 ? 24.554  95.177  23.983  1.00 23.23 ? 109  LEU C CD1 1 
ATOM   5943 C CD2 . LEU C 1 108 ? 22.618  95.091  25.616  1.00 21.18 ? 109  LEU C CD2 1 
ATOM   5944 N N   . VAL C 1 109 ? 19.791  94.644  21.177  1.00 18.90 ? 110  VAL C N   1 
ATOM   5945 C CA  . VAL C 1 109 ? 18.762  95.302  20.382  1.00 19.15 ? 110  VAL C CA  1 
ATOM   5946 C C   . VAL C 1 109 ? 17.368  94.669  20.589  1.00 21.66 ? 110  VAL C C   1 
ATOM   5947 O O   . VAL C 1 109 ? 16.374  95.383  20.788  1.00 21.59 ? 110  VAL C O   1 
ATOM   5948 C CB  . VAL C 1 109 ? 19.164  95.287  18.918  1.00 20.18 ? 110  VAL C CB  1 
ATOM   5949 C CG1 . VAL C 1 109 ? 18.041  95.817  18.055  1.00 21.92 ? 110  VAL C CG1 1 
ATOM   5950 C CG2 . VAL C 1 109 ? 20.427  96.140  18.731  1.00 20.30 ? 110  VAL C CG2 1 
ATOM   5951 N N   . VAL C 1 110 ? 17.305  93.340  20.570  1.00 22.69 ? 111  VAL C N   1 
ATOM   5952 C CA  . VAL C 1 110 ? 16.040  92.624  20.771  1.00 19.51 ? 111  VAL C CA  1 
ATOM   5953 C C   . VAL C 1 110 ? 15.502  92.963  22.150  1.00 22.85 ? 111  VAL C C   1 
ATOM   5954 O O   . VAL C 1 110 ? 14.296  93.228  22.329  1.00 25.21 ? 111  VAL C O   1 
ATOM   5955 C CB  . VAL C 1 110 ? 16.232  91.102  20.581  1.00 20.98 ? 111  VAL C CB  1 
ATOM   5956 C CG1 . VAL C 1 110 ? 14.938  90.300  20.977  1.00 18.38 ? 111  VAL C CG1 1 
ATOM   5957 C CG2 . VAL C 1 110 ? 16.551  90.822  19.095  1.00 15.47 ? 111  VAL C CG2 1 
ATOM   5958 N N   . LYS C 1 111 ? 16.391  93.030  23.132  1.00 25.04 ? 112  LYS C N   1 
ATOM   5959 C CA  . LYS C 1 111 ? 15.936  93.392  24.461  1.00 24.13 ? 112  LYS C CA  1 
ATOM   5960 C C   . LYS C 1 111 ? 15.380  94.829  24.446  1.00 25.58 ? 112  LYS C C   1 
ATOM   5961 O O   . LYS C 1 111 ? 14.265  95.084  24.968  1.00 24.12 ? 112  LYS C O   1 
ATOM   5962 C CB  . LYS C 1 111 ? 17.075  93.295  25.463  1.00 26.72 ? 112  LYS C CB  1 
ATOM   5963 C CG  . LYS C 1 111 ? 16.667  93.791  26.844  1.00 31.07 ? 112  LYS C CG  1 
ATOM   5964 C CD  . LYS C 1 111 ? 17.807  93.603  27.830  1.00 34.99 ? 112  LYS C CD  1 
ATOM   5965 C CE  . LYS C 1 111 ? 17.542  94.367  29.107  1.00 37.67 ? 112  LYS C CE  1 
ATOM   5966 N NZ  . LYS C 1 111 ? 18.091  93.640  30.285  1.00 41.86 ? 112  LYS C NZ  1 
ATOM   5967 N N   . ALA C 1 112 ? 16.106  95.762  23.825  1.00 23.93 ? 113  ALA C N   1 
ATOM   5968 C CA  . ALA C 1 112 ? 15.622  97.152  23.797  1.00 26.25 ? 113  ALA C CA  1 
ATOM   5969 C C   . ALA C 1 112 ? 14.332  97.330  22.999  1.00 28.87 ? 113  ALA C C   1 
ATOM   5970 O O   . ALA C 1 112 ? 13.568  98.274  23.254  1.00 29.55 ? 113  ALA C O   1 
ATOM   5971 C CB  . ALA C 1 112 ? 16.688  98.088  23.258  1.00 26.13 ? 113  ALA C CB  1 
ATOM   5972 N N   . ALA C 1 113 ? 14.077  96.430  22.047  1.00 28.62 ? 114  ALA C N   1 
ATOM   5973 C CA  . ALA C 1 113 ? 12.872  96.490  21.235  1.00 29.95 ? 114  ALA C CA  1 
ATOM   5974 C C   . ALA C 1 113 ? 11.659  95.973  21.998  1.00 29.53 ? 114  ALA C C   1 
ATOM   5975 O O   . ALA C 1 113 ? 10.539  96.035  21.490  1.00 31.13 ? 114  ALA C O   1 
ATOM   5976 C CB  . ALA C 1 113 ? 13.046  95.666  19.972  1.00 29.06 ? 114  ALA C CB  1 
ATOM   5977 N N   . GLY C 1 114 ? 11.880  95.437  23.196  1.00 28.90 ? 115  GLY C N   1 
ATOM   5978 C CA  . GLY C 1 114 ? 10.771  94.903  23.967  1.00 26.19 ? 115  GLY C CA  1 
ATOM   5979 C C   . GLY C 1 114 ? 10.728  93.387  24.025  1.00 28.91 ? 115  GLY C C   1 
ATOM   5980 O O   . GLY C 1 114 ? 9.756   92.821  24.546  1.00 29.86 ? 115  GLY C O   1 
ATOM   5981 N N   . GLY C 1 115 ? 11.746  92.708  23.485  1.00 23.70 ? 116  GLY C N   1 
ATOM   5982 C CA  . GLY C 1 115 ? 11.735  91.255  23.558  1.00 24.48 ? 116  GLY C CA  1 
ATOM   5983 C C   . GLY C 1 115 ? 11.456  90.534  22.247  1.00 26.35 ? 116  GLY C C   1 
ATOM   5984 O O   . GLY C 1 115 ? 11.672  89.319  22.147  1.00 23.98 ? 116  GLY C O   1 
ATOM   5985 N N   . SER C 1 116 ? 11.000  91.277  21.239  1.00 25.71 ? 117  SER C N   1 
ATOM   5986 C CA  . SER C 1 116 ? 10.696  90.690  19.940  1.00 27.50 ? 117  SER C CA  1 
ATOM   5987 C C   . SER C 1 116 ? 10.935  91.677  18.817  1.00 27.91 ? 117  SER C C   1 
ATOM   5988 O O   . SER C 1 116 ? 10.679  92.863  18.967  1.00 27.95 ? 117  SER C O   1 
ATOM   5989 C CB  . SER C 1 116 ? 9.233   90.221  19.888  1.00 27.09 ? 117  SER C CB  1 
ATOM   5990 O OG  . SER C 1 116 ? 8.922   89.668  18.621  1.00 27.58 ? 117  SER C OG  1 
ATOM   5991 N N   . VAL C 1 117 ? 11.447  91.190  17.700  1.00 24.42 ? 118  VAL C N   1 
ATOM   5992 C CA  . VAL C 1 117 ? 11.663  92.072  16.568  1.00 25.68 ? 118  VAL C CA  1 
ATOM   5993 C C   . VAL C 1 117 ? 10.938  91.429  15.388  1.00 26.58 ? 118  VAL C C   1 
ATOM   5994 O O   . VAL C 1 117 ? 11.134  91.782  14.228  1.00 26.00 ? 118  VAL C O   1 
ATOM   5995 C CB  . VAL C 1 117 ? 13.198  92.249  16.277  1.00 24.51 ? 118  VAL C CB  1 
ATOM   5996 C CG1 . VAL C 1 117 ? 13.847  92.933  17.452  1.00 25.21 ? 118  VAL C CG1 1 
ATOM   5997 C CG2 . VAL C 1 117 ? 13.878  90.909  16.047  1.00 23.05 ? 118  VAL C CG2 1 
ATOM   5998 N N   . LYS C 1 118 ? 10.074  90.478  15.719  1.00 28.84 ? 119  LYS C N   1 
ATOM   5999 C CA  . LYS C 1 118 ? 9.338   89.731  14.712  1.00 29.29 ? 119  LYS C CA  1 
ATOM   6000 C C   . LYS C 1 118 ? 8.464   90.624  13.829  1.00 30.75 ? 119  LYS C C   1 
ATOM   6001 O O   . LYS C 1 118 ? 7.698   91.481  14.316  1.00 30.70 ? 119  LYS C O   1 
ATOM   6002 C CB  . LYS C 1 118 ? 8.499   88.628  15.383  1.00 32.23 ? 119  LYS C CB  1 
ATOM   6003 C CG  . LYS C 1 118 ? 8.018   87.545  14.395  1.00 36.38 ? 119  LYS C CG  1 
ATOM   6004 C CD  . LYS C 1 118 ? 7.557   86.278  15.111  1.00 41.06 ? 119  LYS C CD  1 
ATOM   6005 C CE  . LYS C 1 118 ? 6.765   85.339  14.166  1.00 42.32 ? 119  LYS C CE  1 
ATOM   6006 N NZ  . LYS C 1 118 ? 7.596   84.716  13.086  1.00 44.06 ? 119  LYS C NZ  1 
ATOM   6007 N N   . GLY C 1 119 ? 8.612   90.430  12.527  1.00 32.51 ? 120  GLY C N   1 
ATOM   6008 C CA  . GLY C 1 119 ? 7.837   91.202  11.568  1.00 34.59 ? 120  GLY C CA  1 
ATOM   6009 C C   . GLY C 1 119 ? 8.415   92.575  11.279  1.00 36.15 ? 120  GLY C C   1 
ATOM   6010 O O   . GLY C 1 119 ? 7.937   93.276  10.368  1.00 38.21 ? 120  GLY C O   1 
ATOM   6011 N N   . LYS C 1 120 ? 9.430   92.994  12.037  1.00 33.91 ? 121  LYS C N   1 
ATOM   6012 C CA  . LYS C 1 120 ? 10.014  94.316  11.775  1.00 33.14 ? 121  LYS C CA  1 
ATOM   6013 C C   . LYS C 1 120 ? 11.168  94.210  10.787  1.00 30.53 ? 121  LYS C C   1 
ATOM   6014 O O   . LYS C 1 120 ? 11.646  93.122  10.473  1.00 29.16 ? 121  LYS C O   1 
ATOM   6015 C CB  . LYS C 1 120 ? 10.500  94.965  13.067  1.00 34.63 ? 121  LYS C CB  1 
ATOM   6016 C CG  . LYS C 1 120 ? 9.467   94.902  14.152  1.00 38.72 ? 121  LYS C CG  1 
ATOM   6017 C CD  . LYS C 1 120 ? 8.622   96.131  14.187  1.00 40.87 ? 121  LYS C CD  1 
ATOM   6018 C CE  . LYS C 1 120 ? 9.083   97.030  15.303  1.00 40.90 ? 121  LYS C CE  1 
ATOM   6019 N NZ  . LYS C 1 120 ? 8.000   97.995  15.705  1.00 42.94 ? 121  LYS C NZ  1 
ATOM   6020 N N   . LYS C 1 121 ? 11.613  95.355  10.304  1.00 28.86 ? 122  LYS C N   1 
ATOM   6021 C CA  . LYS C 1 121 ? 12.697  95.394  9.339   1.00 29.36 ? 122  LYS C CA  1 
ATOM   6022 C C   . LYS C 1 121 ? 14.041  95.838  9.903   1.00 28.45 ? 122  LYS C C   1 
ATOM   6023 O O   . LYS C 1 121 ? 14.157  96.885  10.535  1.00 27.06 ? 122  LYS C O   1 
ATOM   6024 C CB  . LYS C 1 121 ? 12.336  96.311  8.165   1.00 29.92 ? 122  LYS C CB  1 
ATOM   6025 C CG  . LYS C 1 121 ? 13.516  96.529  7.250   1.00 34.05 ? 122  LYS C CG  1 
ATOM   6026 C CD  . LYS C 1 121 ? 13.077  96.902  5.812   1.00 42.71 ? 122  LYS C CD  1 
ATOM   6027 C CE  . LYS C 1 121 ? 14.277  96.951  4.830   1.00 41.87 ? 122  LYS C CE  1 
ATOM   6028 N NZ  . LYS C 1 121 ? 13.836  97.165  3.414   1.00 43.19 ? 122  LYS C NZ  1 
ATOM   6029 N N   . ALA C 1 122 ? 15.059  95.038  9.617   1.00 26.07 ? 123  ALA C N   1 
ATOM   6030 C CA  . ALA C 1 122 ? 16.410  95.315  10.056  1.00 25.86 ? 123  ALA C CA  1 
ATOM   6031 C C   . ALA C 1 122 ? 17.305  95.351  8.840   1.00 26.64 ? 123  ALA C C   1 
ATOM   6032 O O   . ALA C 1 122 ? 17.222  94.479  7.957   1.00 25.23 ? 123  ALA C O   1 
ATOM   6033 C CB  . ALA C 1 122 ? 16.894  94.223  11.016  1.00 24.77 ? 123  ALA C CB  1 
ATOM   6034 N N   . VAL C 1 123 ? 18.171  96.354  8.808   1.00 23.64 ? 124  VAL C N   1 
ATOM   6035 C CA  . VAL C 1 123 ? 19.108  96.501  7.716   1.00 24.89 ? 124  VAL C CA  1 
ATOM   6036 C C   . VAL C 1 123 ? 20.499  96.408  8.297   1.00 23.81 ? 124  VAL C C   1 
ATOM   6037 O O   . VAL C 1 123 ? 20.814  97.109  9.267   1.00 25.49 ? 124  VAL C O   1 
ATOM   6038 C CB  . VAL C 1 123 ? 18.928  97.869  7.040   1.00 24.65 ? 124  VAL C CB  1 
ATOM   6039 C CG1 . VAL C 1 123 ? 19.991  98.092  6.019   1.00 23.11 ? 124  VAL C CG1 1 
ATOM   6040 C CG2 . VAL C 1 123 ? 17.539  97.941  6.425   1.00 22.91 ? 124  VAL C CG2 1 
ATOM   6041 N N   . VAL C 1 124 ? 21.321  95.526  7.753   1.00 20.50 ? 125  VAL C N   1 
ATOM   6042 C CA  . VAL C 1 124 ? 22.695  95.410  8.242   1.00 21.70 ? 125  VAL C CA  1 
ATOM   6043 C C   . VAL C 1 124 ? 23.658  96.022  7.205   1.00 24.83 ? 125  VAL C C   1 
ATOM   6044 O O   . VAL C 1 124 ? 23.882  95.426  6.129   1.00 24.41 ? 125  VAL C O   1 
ATOM   6045 C CB  . VAL C 1 124 ? 23.110  93.925  8.475   1.00 21.56 ? 125  VAL C CB  1 
ATOM   6046 C CG1 . VAL C 1 124 ? 24.543  93.874  9.002   1.00 17.99 ? 125  VAL C CG1 1 
ATOM   6047 C CG2 . VAL C 1 124 ? 22.132  93.231  9.418   1.00 17.81 ? 125  VAL C CG2 1 
ATOM   6048 N N   . LEU C 1 125 ? 24.228  97.192  7.514   1.00 23.88 ? 126  LEU C N   1 
ATOM   6049 C CA  . LEU C 1 125 ? 25.150  97.834  6.569   1.00 25.88 ? 126  LEU C CA  1 
ATOM   6050 C C   . LEU C 1 125 ? 26.534  97.181  6.613   1.00 27.50 ? 126  LEU C C   1 
ATOM   6051 O O   . LEU C 1 125 ? 27.082  96.839  7.701   1.00 26.87 ? 126  LEU C O   1 
ATOM   6052 C CB  . LEU C 1 125 ? 25.238  99.337  6.843   1.00 23.64 ? 126  LEU C CB  1 
ATOM   6053 C CG  . LEU C 1 125 ? 23.902  100.060 6.652   1.00 23.11 ? 126  LEU C CG  1 
ATOM   6054 C CD1 . LEU C 1 125 ? 24.027  101.548 7.103   1.00 22.58 ? 126  LEU C CD1 1 
ATOM   6055 C CD2 . LEU C 1 125 ? 23.471  99.977  5.145   1.00 22.11 ? 126  LEU C CD2 1 
ATOM   6056 N N   . ALA C 1 126 ? 27.099  96.994  5.427   1.00 25.81 ? 127  ALA C N   1 
ATOM   6057 C CA  . ALA C 1 126 ? 28.395  96.319  5.276   1.00 28.96 ? 127  ALA C CA  1 
ATOM   6058 C C   . ALA C 1 126 ? 28.275  94.980  6.034   1.00 28.82 ? 127  ALA C C   1 
ATOM   6059 O O   . ALA C 1 126 ? 29.124  94.629  6.884   1.00 28.77 ? 127  ALA C O   1 
ATOM   6060 C CB  . ALA C 1 126 ? 29.529  97.184  5.876   1.00 30.95 ? 127  ALA C CB  1 
ATOM   6061 N N   . GLY C 1 127 ? 27.193  94.257  5.732   1.00 24.87 ? 128  GLY C N   1 
ATOM   6062 C CA  . GLY C 1 127 ? 26.934  92.976  6.370   1.00 23.42 ? 128  GLY C CA  1 
ATOM   6063 C C   . GLY C 1 127 ? 27.636  91.771  5.771   1.00 24.87 ? 128  GLY C C   1 
ATOM   6064 O O   . GLY C 1 127 ? 27.365  90.638  6.167   1.00 23.33 ? 128  GLY C O   1 
ATOM   6065 N N   . THR C 1 128 ? 28.565  91.967  4.845   1.00 26.11 ? 129  THR C N   1 
ATOM   6066 C CA  . THR C 1 128 ? 29.210  90.784  4.282   1.00 24.88 ? 129  THR C CA  1 
ATOM   6067 C C   . THR C 1 128 ? 30.351  90.229  5.154   1.00 25.23 ? 129  THR C C   1 
ATOM   6068 O O   . THR C 1 128 ? 30.808  89.105  4.935   1.00 23.35 ? 129  THR C O   1 
ATOM   6069 C CB  . THR C 1 128 ? 29.732  91.039  2.868   1.00 25.80 ? 129  THR C CB  1 
ATOM   6070 O OG1 . THR C 1 128 ? 30.852  91.918  2.920   1.00 26.65 ? 129  THR C OG1 1 
ATOM   6071 C CG2 . THR C 1 128 ? 28.634  91.681  2.016   1.00 27.66 ? 129  THR C CG2 1 
ATOM   6072 N N   . GLY C 1 129 ? 30.795  91.010  6.130   1.00 23.30 ? 130  GLY C N   1 
ATOM   6073 C CA  . GLY C 1 129 ? 31.841  90.541  7.027   1.00 23.73 ? 130  GLY C CA  1 
ATOM   6074 C C   . GLY C 1 129 ? 31.340  89.514  8.066   1.00 23.57 ? 130  GLY C C   1 
ATOM   6075 O O   . GLY C 1 129 ? 30.138  89.285  8.183   1.00 24.69 ? 130  GLY C O   1 
ATOM   6076 N N   . PRO C 1 130 ? 32.227  88.940  8.887   1.00 24.98 ? 131  PRO C N   1 
ATOM   6077 C CA  . PRO C 1 130 ? 31.796  87.933  9.877   1.00 25.11 ? 131  PRO C CA  1 
ATOM   6078 C C   . PRO C 1 130 ? 30.687  88.354  10.818  1.00 23.35 ? 131  PRO C C   1 
ATOM   6079 O O   . PRO C 1 130 ? 29.684  87.653  10.950  1.00 21.33 ? 131  PRO C O   1 
ATOM   6080 C CB  . PRO C 1 130 ? 33.086  87.608  10.653  1.00 26.92 ? 131  PRO C CB  1 
ATOM   6081 C CG  . PRO C 1 130 ? 34.192  87.968  9.650   1.00 30.86 ? 131  PRO C CG  1 
ATOM   6082 C CD  . PRO C 1 130 ? 33.674  89.224  8.995   1.00 26.99 ? 131  PRO C CD  1 
ATOM   6083 N N   . VAL C 1 131 ? 30.881  89.488  11.489  1.00 20.98 ? 132  VAL C N   1 
ATOM   6084 C CA  . VAL C 1 131 ? 29.890  89.954  12.448  1.00 22.81 ? 132  VAL C CA  1 
ATOM   6085 C C   . VAL C 1 131 ? 28.569  90.359  11.776  1.00 21.60 ? 132  VAL C C   1 
ATOM   6086 O O   . VAL C 1 131 ? 27.490  90.082  12.297  1.00 20.02 ? 132  VAL C O   1 
ATOM   6087 C CB  . VAL C 1 131 ? 30.490  91.116  13.322  1.00 21.56 ? 132  VAL C CB  1 
ATOM   6088 C CG1 . VAL C 1 131 ? 29.415  91.731  14.245  1.00 20.69 ? 132  VAL C CG1 1 
ATOM   6089 C CG2 . VAL C 1 131 ? 31.636  90.548  14.170  1.00 22.33 ? 132  VAL C CG2 1 
ATOM   6090 N N   . GLY C 1 132 ? 28.654  90.996  10.612  1.00 20.42 ? 133  GLY C N   1 
ATOM   6091 C CA  . GLY C 1 132 ? 27.438  91.367  9.915   1.00 19.13 ? 133  GLY C CA  1 
ATOM   6092 C C   . GLY C 1 132 ? 26.646  90.102  9.540   1.00 19.19 ? 133  GLY C C   1 
ATOM   6093 O O   . GLY C 1 132 ? 25.426  90.007  9.726   1.00 16.85 ? 133  GLY C O   1 
ATOM   6094 N N   . MET C 1 133 ? 27.350  89.089  9.058   1.00 15.83 ? 134  MET C N   1 
ATOM   6095 C CA  . MET C 1 133 ? 26.640  87.895  8.621   1.00 20.44 ? 134  MET C CA  1 
ATOM   6096 C C   . MET C 1 133 ? 25.987  87.204  9.795   1.00 18.88 ? 134  MET C C   1 
ATOM   6097 O O   . MET C 1 133 ? 24.812  86.807  9.738   1.00 17.73 ? 134  MET C O   1 
ATOM   6098 C CB  . MET C 1 133 ? 27.593  86.922  7.906   1.00 20.38 ? 134  MET C CB  1 
ATOM   6099 C CG  . MET C 1 133 ? 27.805  87.265  6.426   1.00 24.77 ? 134  MET C CG  1 
ATOM   6100 S SD  . MET C 1 133 ? 29.151  86.298  5.703   1.00 26.23 ? 134  MET C SD  1 
ATOM   6101 C CE  . MET C 1 133 ? 28.446  84.605  5.629   1.00 25.56 ? 134  MET C CE  1 
ATOM   6102 N N   . ARG C 1 134 ? 26.735  87.083  10.889  1.00 18.99 ? 135  ARG C N   1 
ATOM   6103 C CA  . ARG C 1 134 ? 26.136  86.434  12.031  1.00 18.47 ? 135  ARG C CA  1 
ATOM   6104 C C   . ARG C 1 134 ? 25.012  87.273  12.631  1.00 19.01 ? 135  ARG C C   1 
ATOM   6105 O O   . ARG C 1 134 ? 24.059  86.715  13.173  1.00 17.96 ? 135  ARG C O   1 
ATOM   6106 C CB  . ARG C 1 134 ? 27.215  86.107  13.073  1.00 17.27 ? 135  ARG C CB  1 
ATOM   6107 C CG  . ARG C 1 134 ? 28.086  84.913  12.662  1.00 23.33 ? 135  ARG C CG  1 
ATOM   6108 C CD  . ARG C 1 134 ? 27.239  83.630  12.623  1.00 20.07 ? 135  ARG C CD  1 
ATOM   6109 N NE  . ARG C 1 134 ? 28.033  82.429  12.894  1.00 25.76 ? 135  ARG C NE  1 
ATOM   6110 C CZ  . ARG C 1 134 ? 28.562  81.651  11.958  1.00 26.96 ? 135  ARG C CZ  1 
ATOM   6111 N NH1 . ARG C 1 134 ? 28.382  81.942  10.671  1.00 30.20 ? 135  ARG C NH1 1 
ATOM   6112 N NH2 . ARG C 1 134 ? 29.262  80.577  12.303  1.00 28.46 ? 135  ARG C NH2 1 
ATOM   6113 N N   . SER C 1 135 ? 25.112  88.613  12.573  1.00 18.40 ? 136  SER C N   1 
ATOM   6114 C CA  . SER C 1 135 ? 24.027  89.440  13.109  1.00 17.95 ? 136  SER C CA  1 
ATOM   6115 C C   . SER C 1 135 ? 22.781  89.227  12.258  1.00 18.44 ? 136  SER C C   1 
ATOM   6116 O O   . SER C 1 135 ? 21.654  89.072  12.764  1.00 18.89 ? 136  SER C O   1 
ATOM   6117 C CB  . SER C 1 135 ? 24.410  90.913  13.084  1.00 20.76 ? 136  SER C CB  1 
ATOM   6118 O OG  . SER C 1 135 ? 25.470  91.164  14.015  1.00 23.63 ? 136  SER C OG  1 
ATOM   6119 N N   . ALA C 1 136 ? 22.980  89.225  10.954  1.00 18.06 ? 137  ALA C N   1 
ATOM   6120 C CA  . ALA C 1 136 ? 21.857  88.979  10.039  1.00 19.05 ? 137  ALA C CA  1 
ATOM   6121 C C   . ALA C 1 136 ? 21.167  87.651  10.367  1.00 20.06 ? 137  ALA C C   1 
ATOM   6122 O O   . ALA C 1 136 ? 19.932  87.599  10.412  1.00 20.13 ? 137  ALA C O   1 
ATOM   6123 C CB  . ALA C 1 136 ? 22.361  88.943  8.593   1.00 19.22 ? 137  ALA C CB  1 
ATOM   6124 N N   . ALA C 1 137 ? 21.960  86.606  10.634  1.00 20.18 ? 138  ALA C N   1 
ATOM   6125 C CA  . ALA C 1 137 ? 21.408  85.273  10.909  1.00 20.76 ? 138  ALA C CA  1 
ATOM   6126 C C   . ALA C 1 137 ? 20.566  85.234  12.159  1.00 22.31 ? 138  ALA C C   1 
ATOM   6127 O O   . ALA C 1 137 ? 19.473  84.644  12.170  1.00 21.21 ? 138  ALA C O   1 
ATOM   6128 C CB  . ALA C 1 137 ? 22.535  84.222  11.011  1.00 18.98 ? 138  ALA C CB  1 
ATOM   6129 N N   . LEU C 1 138 ? 21.080  85.847  13.222  1.00 20.58 ? 139  LEU C N   1 
ATOM   6130 C CA  . LEU C 1 138 ? 20.372  85.855  14.498  1.00 19.53 ? 139  LEU C CA  1 
ATOM   6131 C C   . LEU C 1 138 ? 19.118  86.740  14.403  1.00 20.29 ? 139  LEU C C   1 
ATOM   6132 O O   . LEU C 1 138 ? 18.079  86.423  14.965  1.00 17.95 ? 139  LEU C O   1 
ATOM   6133 C CB  . LEU C 1 138 ? 21.324  86.366  15.611  1.00 19.92 ? 139  LEU C CB  1 
ATOM   6134 C CG  . LEU C 1 138 ? 22.541  85.471  15.886  1.00 23.08 ? 139  LEU C CG  1 
ATOM   6135 C CD1 . LEU C 1 138 ? 23.408  86.083  17.021  1.00 22.07 ? 139  LEU C CD1 1 
ATOM   6136 C CD2 . LEU C 1 138 ? 22.037  84.082  16.335  1.00 20.75 ? 139  LEU C CD2 1 
ATOM   6137 N N   . LEU C 1 139 ? 19.207  87.858  13.687  1.00 17.42 ? 140  LEU C N   1 
ATOM   6138 C CA  . LEU C 1 139 ? 18.024  88.690  13.528  1.00 21.52 ? 140  LEU C CA  1 
ATOM   6139 C C   . LEU C 1 139 ? 16.957  87.908  12.726  1.00 20.60 ? 140  LEU C C   1 
ATOM   6140 O O   . LEU C 1 139 ? 15.773  87.951  13.032  1.00 19.82 ? 140  LEU C O   1 
ATOM   6141 C CB  . LEU C 1 139 ? 18.380  89.960  12.758  1.00 19.06 ? 140  LEU C CB  1 
ATOM   6142 C CG  . LEU C 1 139 ? 19.166  90.951  13.602  1.00 18.47 ? 140  LEU C CG  1 
ATOM   6143 C CD1 . LEU C 1 139 ? 19.916  91.873  12.650  1.00 23.50 ? 140  LEU C CD1 1 
ATOM   6144 C CD2 . LEU C 1 139 ? 18.203  91.745  14.504  1.00 17.41 ? 140  LEU C CD2 1 
ATOM   6145 N N   . ALA C 1 140 ? 17.391  87.179  11.708  1.00 21.26 ? 141  ALA C N   1 
ATOM   6146 C CA  . ALA C 1 140 ? 16.410  86.463  10.876  1.00 22.92 ? 141  ALA C CA  1 
ATOM   6147 C C   . ALA C 1 140 ? 15.795  85.348  11.710  1.00 24.46 ? 141  ALA C C   1 
ATOM   6148 O O   . ALA C 1 140 ? 14.611  84.992  11.550  1.00 25.71 ? 141  ALA C O   1 
ATOM   6149 C CB  . ALA C 1 140 ? 17.091  85.914  9.656   1.00 22.22 ? 141  ALA C CB  1 
ATOM   6150 N N   . GLY C 1 141 ? 16.592  84.805  12.627  1.00 24.41 ? 142  GLY C N   1 
ATOM   6151 C CA  . GLY C 1 141 ? 16.084  83.758  13.498  1.00 24.00 ? 142  GLY C CA  1 
ATOM   6152 C C   . GLY C 1 141 ? 15.016  84.325  14.427  1.00 24.12 ? 142  GLY C C   1 
ATOM   6153 O O   . GLY C 1 141 ? 14.115  83.620  14.841  1.00 22.36 ? 142  GLY C O   1 
ATOM   6154 N N   . GLU C 1 142 ? 15.126  85.600  14.773  1.00 23.36 ? 143  GLU C N   1 
ATOM   6155 C CA  . GLU C 1 142 ? 14.150  86.252  15.648  1.00 21.83 ? 143  GLU C CA  1 
ATOM   6156 C C   . GLU C 1 142 ? 12.911  86.682  14.851  1.00 23.29 ? 143  GLU C C   1 
ATOM   6157 O O   . GLU C 1 142 ? 11.981  87.312  15.395  1.00 23.25 ? 143  GLU C O   1 
ATOM   6158 C CB  . GLU C 1 142 ? 14.791  87.478  16.320  1.00 20.91 ? 143  GLU C CB  1 
ATOM   6159 C CG  . GLU C 1 142 ? 15.762  87.122  17.480  1.00 21.82 ? 143  GLU C CG  1 
ATOM   6160 C CD  . GLU C 1 142 ? 15.061  86.759  18.803  1.00 23.94 ? 143  GLU C CD  1 
ATOM   6161 O OE1 . GLU C 1 142 ? 15.772  86.581  19.837  1.00 23.24 ? 143  GLU C OE1 1 
ATOM   6162 O OE2 . GLU C 1 142 ? 13.815  86.661  18.829  1.00 24.86 ? 143  GLU C OE2 1 
ATOM   6163 N N   . GLY C 1 143 ? 12.882  86.342  13.562  1.00 22.75 ? 144  GLY C N   1 
ATOM   6164 C CA  . GLY C 1 143 ? 11.730  86.700  12.752  1.00 24.42 ? 144  GLY C CA  1 
ATOM   6165 C C   . GLY C 1 143 ? 11.730  88.104  12.145  1.00 24.78 ? 144  GLY C C   1 
ATOM   6166 O O   . GLY C 1 143 ? 10.704  88.552  11.607  1.00 25.23 ? 144  GLY C O   1 
ATOM   6167 N N   . ALA C 1 144 ? 12.850  88.821  12.243  1.00 23.05 ? 145  ALA C N   1 
ATOM   6168 C CA  . ALA C 1 144 ? 12.905  90.131  11.616  1.00 24.35 ? 145  ALA C CA  1 
ATOM   6169 C C   . ALA C 1 144 ? 13.080  89.921  10.102  1.00 25.98 ? 145  ALA C C   1 
ATOM   6170 O O   . ALA C 1 144 ? 13.568  88.863  9.646   1.00 23.31 ? 145  ALA C O   1 
ATOM   6171 C CB  . ALA C 1 144 ? 14.081  90.930  12.148  1.00 25.48 ? 145  ALA C CB  1 
ATOM   6172 N N   . GLU C 1 145 ? 12.633  90.899  9.329   1.00 25.85 ? 146  GLU C N   1 
ATOM   6173 C CA  . GLU C 1 145 ? 12.822  90.884  7.884   1.00 27.99 ? 146  GLU C CA  1 
ATOM   6174 C C   . GLU C 1 145 ? 14.204  91.548  7.776   1.00 28.00 ? 146  GLU C C   1 
ATOM   6175 O O   . GLU C 1 145 ? 14.367  92.722  8.114   1.00 27.01 ? 146  GLU C O   1 
ATOM   6176 C CB  . GLU C 1 145 ? 11.775  91.764  7.179   1.00 34.28 ? 146  GLU C CB  1 
ATOM   6177 C CG  . GLU C 1 145 ? 12.055  91.959  5.674   1.00 41.48 ? 146  GLU C CG  1 
ATOM   6178 C CD  . GLU C 1 145 ? 11.430  93.237  5.051   1.00 46.64 ? 146  GLU C CD  1 
ATOM   6179 O OE1 . GLU C 1 145 ? 12.036  93.778  4.083   1.00 49.56 ? 146  GLU C OE1 1 
ATOM   6180 O OE2 . GLU C 1 145 ? 10.353  93.687  5.506   1.00 46.65 ? 146  GLU C OE2 1 
ATOM   6181 N N   . VAL C 1 146 ? 15.182  90.811  7.279   1.00 26.39 ? 147  VAL C N   1 
ATOM   6182 C CA  . VAL C 1 146 ? 16.548  91.315  7.218   1.00 27.15 ? 147  VAL C CA  1 
ATOM   6183 C C   . VAL C 1 146 ? 17.082  91.615  5.831   1.00 26.93 ? 147  VAL C C   1 
ATOM   6184 O O   . VAL C 1 146 ? 16.886  90.837  4.906   1.00 25.90 ? 147  VAL C O   1 
ATOM   6185 C CB  . VAL C 1 146 ? 17.542  90.273  7.834   1.00 27.74 ? 147  VAL C CB  1 
ATOM   6186 C CG1 . VAL C 1 146 ? 18.956  90.845  7.832   1.00 25.31 ? 147  VAL C CG1 1 
ATOM   6187 C CG2 . VAL C 1 146 ? 17.071  89.835  9.222   1.00 26.10 ? 147  VAL C CG2 1 
ATOM   6188 N N   . VAL C 1 147 ? 17.767  92.743  5.700   1.00 24.77 ? 148  VAL C N   1 
ATOM   6189 C CA  . VAL C 1 147 ? 18.416  93.044  4.451   1.00 25.50 ? 148  VAL C CA  1 
ATOM   6190 C C   . VAL C 1 147 ? 19.908  93.159  4.728   1.00 24.33 ? 148  VAL C C   1 
ATOM   6191 O O   . VAL C 1 147 ? 20.351  93.989  5.557   1.00 22.09 ? 148  VAL C O   1 
ATOM   6192 C CB  . VAL C 1 147 ? 17.892  94.359  3.813   1.00 25.12 ? 148  VAL C CB  1 
ATOM   6193 C CG1 . VAL C 1 147 ? 18.730  94.709  2.589   1.00 26.79 ? 148  VAL C CG1 1 
ATOM   6194 C CG2 . VAL C 1 147 ? 16.431  94.155  3.378   1.00 29.09 ? 148  VAL C CG2 1 
ATOM   6195 N N   . LEU C 1 148 ? 20.675  92.311  4.047   1.00 24.03 ? 149  LEU C N   1 
ATOM   6196 C CA  . LEU C 1 148 ? 22.114  92.281  4.192   1.00 25.12 ? 149  LEU C CA  1 
ATOM   6197 C C   . LEU C 1 148 ? 22.756  93.053  3.031   1.00 26.17 ? 149  LEU C C   1 
ATOM   6198 O O   . LEU C 1 148 ? 22.700  92.598  1.884   1.00 24.79 ? 149  LEU C O   1 
ATOM   6199 C CB  . LEU C 1 148 ? 22.606  90.828  4.204   1.00 21.18 ? 149  LEU C CB  1 
ATOM   6200 C CG  . LEU C 1 148 ? 24.042  90.597  4.714   1.00 24.65 ? 149  LEU C CG  1 
ATOM   6201 C CD1 . LEU C 1 148 ? 24.221  89.108  5.093   1.00 21.60 ? 149  LEU C CD1 1 
ATOM   6202 C CD2 . LEU C 1 148 ? 25.085  90.992  3.663   1.00 23.28 ? 149  LEU C CD2 1 
ATOM   6203 N N   . CYS C 1 149 ? 23.356  94.213  3.343   1.00 24.72 ? 150  CYS C N   1 
ATOM   6204 C CA  . CYS C 1 149 ? 24.002  95.045  2.336   1.00 27.17 ? 150  CYS C CA  1 
ATOM   6205 C C   . CYS C 1 149 ? 25.511  94.847  2.154   1.00 27.60 ? 150  CYS C C   1 
ATOM   6206 O O   . CYS C 1 149 ? 26.253  94.632  3.117   1.00 28.93 ? 150  CYS C O   1 
ATOM   6207 C CB  . CYS C 1 149 ? 23.763  96.536  2.638   1.00 26.34 ? 150  CYS C CB  1 
ATOM   6208 S SG  . CYS C 1 149 ? 22.061  96.913  2.941   1.00 29.77 ? 150  CYS C SG  1 
ATOM   6209 N N   . GLY C 1 150 ? 25.961  94.966  0.904   1.00 26.73 ? 151  GLY C N   1 
ATOM   6210 C CA  . GLY C 1 150 ? 27.377  94.851  0.583   1.00 28.43 ? 151  GLY C CA  1 
ATOM   6211 C C   . GLY C 1 150 ? 27.692  95.833  -0.550  1.00 31.03 ? 151  GLY C C   1 
ATOM   6212 O O   . GLY C 1 150 ? 26.786  96.333  -1.221  1.00 30.00 ? 151  GLY C O   1 
ATOM   6213 N N   . ARG C 1 151 ? 28.972  96.088  -0.774  1.00 32.58 ? 152  ARG C N   1 
ATOM   6214 C CA  . ARG C 1 151 ? 29.415  97.001  -1.812  1.00 34.87 ? 152  ARG C CA  1 
ATOM   6215 C C   . ARG C 1 151 ? 29.009  96.505  -3.220  1.00 33.91 ? 152  ARG C C   1 
ATOM   6216 O O   . ARG C 1 151 ? 28.705  97.310  -4.106  1.00 32.88 ? 152  ARG C O   1 
ATOM   6217 C CB  . ARG C 1 151 ? 30.921  97.112  -1.716  1.00 38.81 ? 152  ARG C CB  1 
ATOM   6218 C CG  . ARG C 1 151 ? 31.470  98.473  -1.962  1.00 45.81 ? 152  ARG C CG  1 
ATOM   6219 C CD  . ARG C 1 151 ? 32.746  98.325  -2.781  1.00 50.36 ? 152  ARG C CD  1 
ATOM   6220 N NE  . ARG C 1 151 ? 33.550  99.546  -2.841  1.00 56.42 ? 152  ARG C NE  1 
ATOM   6221 C CZ  . ARG C 1 151 ? 33.052  100.781 -2.890  1.00 58.37 ? 152  ARG C CZ  1 
ATOM   6222 N NH1 . ARG C 1 151 ? 31.735  100.975 -2.873  1.00 58.73 ? 152  ARG C NH1 1 
ATOM   6223 N NH2 . ARG C 1 151 ? 33.876  101.824 -2.989  1.00 60.59 ? 152  ARG C NH2 1 
ATOM   6224 N N   A LYS C 1 152 ? 29.034  95.187  -3.419  0.60 33.34 ? 153  LYS C N   1 
ATOM   6225 N N   B LYS C 1 152 ? 29.022  95.188  -3.421  0.40 32.99 ? 153  LYS C N   1 
ATOM   6226 C CA  A LYS C 1 152 ? 28.659  94.589  -4.704  0.60 32.69 ? 153  LYS C CA  1 
ATOM   6227 C CA  B LYS C 1 152 ? 28.650  94.594  -4.708  0.40 32.01 ? 153  LYS C CA  1 
ATOM   6228 C C   A LYS C 1 152 ? 27.557  93.561  -4.444  0.60 32.23 ? 153  LYS C C   1 
ATOM   6229 C C   B LYS C 1 152 ? 27.601  93.509  -4.489  0.40 31.56 ? 153  LYS C C   1 
ATOM   6230 O O   A LYS C 1 152 ? 27.621  92.811  -3.465  0.60 32.55 ? 153  LYS C O   1 
ATOM   6231 O O   B LYS C 1 152 ? 27.747  92.667  -3.598  0.40 31.38 ? 153  LYS C O   1 
ATOM   6232 C CB  A LYS C 1 152 ? 29.839  93.845  -5.351  0.60 34.32 ? 153  LYS C CB  1 
ATOM   6233 C CB  B LYS C 1 152 ? 29.875  93.988  -5.397  0.40 33.00 ? 153  LYS C CB  1 
ATOM   6234 C CG  A LYS C 1 152 ? 31.063  94.676  -5.712  0.60 37.56 ? 153  LYS C CG  1 
ATOM   6235 C CG  B LYS C 1 152 ? 30.595  94.939  -6.337  0.40 34.21 ? 153  LYS C CG  1 
ATOM   6236 C CD  A LYS C 1 152 ? 32.222  93.736  -6.032  0.60 38.06 ? 153  LYS C CD  1 
ATOM   6237 C CD  B LYS C 1 152 ? 30.035  94.854  -7.745  0.40 33.55 ? 153  LYS C CD  1 
ATOM   6238 C CE  A LYS C 1 152 ? 33.556  94.458  -6.145  0.60 39.97 ? 153  LYS C CE  1 
ATOM   6239 C CE  B LYS C 1 152 ? 30.807  95.765  -8.672  0.40 34.45 ? 153  LYS C CE  1 
ATOM   6240 N NZ  A LYS C 1 152 ? 34.696  93.489  -6.254  0.60 38.56 ? 153  LYS C NZ  1 
ATOM   6241 N NZ  B LYS C 1 152 ? 30.480  95.528  -10.101 0.40 36.07 ? 153  LYS C NZ  1 
ATOM   6242 N N   . LEU C 1 153 ? 26.563  93.504  -5.322  1.00 29.64 ? 154  LEU C N   1 
ATOM   6243 C CA  . LEU C 1 153 ? 25.489  92.529  -5.161  1.00 29.13 ? 154  LEU C CA  1 
ATOM   6244 C C   . LEU C 1 153 ? 25.988  91.077  -5.129  1.00 29.09 ? 154  LEU C C   1 
ATOM   6245 O O   . LEU C 1 153 ? 25.459  90.254  -4.381  1.00 29.66 ? 154  LEU C O   1 
ATOM   6246 C CB  . LEU C 1 153 ? 24.419  92.697  -6.260  1.00 29.24 ? 154  LEU C CB  1 
ATOM   6247 C CG  . LEU C 1 153 ? 23.249  91.726  -6.070  1.00 30.05 ? 154  LEU C CG  1 
ATOM   6248 C CD1 . LEU C 1 153 ? 22.457  92.171  -4.863  1.00 28.58 ? 154  LEU C CD1 1 
ATOM   6249 C CD2 . LEU C 1 153 ? 22.326  91.706  -7.315  1.00 27.40 ? 154  LEU C CD2 1 
ATOM   6250 N N   . ASP C 1 154 ? 27.007  90.734  -5.904  1.00 29.08 ? 155  ASP C N   1 
ATOM   6251 C CA  . ASP C 1 154 ? 27.439  89.335  -5.841  1.00 32.24 ? 155  ASP C CA  1 
ATOM   6252 C C   . ASP C 1 154 ? 27.955  88.947  -4.448  1.00 31.15 ? 155  ASP C C   1 
ATOM   6253 O O   . ASP C 1 154 ? 27.644  87.874  -3.947  1.00 30.53 ? 155  ASP C O   1 
ATOM   6254 C CB  . ASP C 1 154 ? 28.456  88.963  -6.953  1.00 30.99 ? 155  ASP C CB  1 
ATOM   6255 C CG  . ASP C 1 154 ? 29.764  89.767  -6.913  1.00 35.47 ? 155  ASP C CG  1 
ATOM   6256 O OD1 . ASP C 1 154 ? 30.740  89.241  -7.498  1.00 35.85 ? 155  ASP C OD1 1 
ATOM   6257 O OD2 . ASP C 1 154 ? 29.842  90.888  -6.347  1.00 34.43 ? 155  ASP C OD2 1 
ATOM   6258 N N   . LYS C 1 155 ? 28.696  89.830  -3.802  1.00 32.14 ? 156  LYS C N   1 
ATOM   6259 C CA  . LYS C 1 155 ? 29.207  89.503  -2.483  1.00 32.53 ? 156  LYS C CA  1 
ATOM   6260 C C   . LYS C 1 155 ? 28.088  89.528  -1.443  1.00 30.06 ? 156  LYS C C   1 
ATOM   6261 O O   . LYS C 1 155 ? 28.086  88.701  -0.542  1.00 28.83 ? 156  LYS C O   1 
ATOM   6262 C CB  . LYS C 1 155 ? 30.329  90.474  -2.067  1.00 36.52 ? 156  LYS C CB  1 
ATOM   6263 C CG  . LYS C 1 155 ? 31.508  90.565  -3.059  1.00 40.77 ? 156  LYS C CG  1 
ATOM   6264 C CD  . LYS C 1 155 ? 32.101  89.183  -3.382  1.00 45.99 ? 156  LYS C CD  1 
ATOM   6265 C CE  . LYS C 1 155 ? 33.474  89.279  -4.076  1.00 46.81 ? 156  LYS C CE  1 
ATOM   6266 N NZ  . LYS C 1 155 ? 33.451  90.058  -5.358  1.00 49.57 ? 156  LYS C NZ  1 
ATOM   6267 N N   . ALA C 1 156 ? 27.153  90.473  -1.562  1.00 28.39 ? 157  ALA C N   1 
ATOM   6268 C CA  . ALA C 1 156 ? 26.037  90.567  -0.623  1.00 26.69 ? 157  ALA C CA  1 
ATOM   6269 C C   . ALA C 1 156 ? 25.156  89.324  -0.739  1.00 27.40 ? 157  ALA C C   1 
ATOM   6270 O O   . ALA C 1 156 ? 24.739  88.728  0.274   1.00 26.44 ? 157  ALA C O   1 
ATOM   6271 C CB  . ALA C 1 156 ? 25.196  91.849  -0.902  1.00 26.01 ? 157  ALA C CB  1 
ATOM   6272 N N   . GLN C 1 157 ? 24.871  88.912  -1.974  1.00 25.98 ? 158  GLN C N   1 
ATOM   6273 C CA  . GLN C 1 157 ? 24.047  87.739  -2.168  1.00 25.32 ? 158  GLN C CA  1 
ATOM   6274 C C   . GLN C 1 157 ? 24.744  86.441  -1.753  1.00 26.03 ? 158  GLN C C   1 
ATOM   6275 O O   . GLN C 1 157 ? 24.090  85.500  -1.253  1.00 26.46 ? 158  GLN C O   1 
ATOM   6276 C CB  . GLN C 1 157 ? 23.594  87.665  -3.628  1.00 27.21 ? 158  GLN C CB  1 
ATOM   6277 C CG  . GLN C 1 157 ? 22.517  86.619  -3.890  1.00 28.05 ? 158  GLN C CG  1 
ATOM   6278 C CD  . GLN C 1 157 ? 21.241  86.786  -3.041  1.00 28.75 ? 158  GLN C CD  1 
ATOM   6279 O OE1 . GLN C 1 157 ? 20.610  87.860  -2.999  1.00 29.66 ? 158  GLN C OE1 1 
ATOM   6280 N NE2 . GLN C 1 157 ? 20.860  85.709  -2.365  1.00 27.90 ? 158  GLN C NE2 1 
ATOM   6281 N N   . ALA C 1 158 ? 26.055  86.370  -1.973  1.00 24.85 ? 159  ALA C N   1 
ATOM   6282 C CA  . ALA C 1 158 ? 26.809  85.186  -1.571  1.00 27.49 ? 159  ALA C CA  1 
ATOM   6283 C C   . ALA C 1 158 ? 26.783  85.095  -0.026  1.00 28.31 ? 159  ALA C C   1 
ATOM   6284 O O   . ALA C 1 158 ? 26.727  83.985  0.533   1.00 28.63 ? 159  ALA C O   1 
ATOM   6285 C CB  . ALA C 1 158 ? 28.283  85.283  -2.094  1.00 27.74 ? 159  ALA C CB  1 
ATOM   6286 N N   . ALA C 1 159 ? 26.830  86.250  0.653   1.00 25.94 ? 160  ALA C N   1 
ATOM   6287 C CA  . ALA C 1 159 ? 26.784  86.270  2.134   1.00 26.46 ? 160  ALA C CA  1 
ATOM   6288 C C   . ALA C 1 159 ? 25.375  85.880  2.583   1.00 26.05 ? 160  ALA C C   1 
ATOM   6289 O O   . ALA C 1 159 ? 25.186  85.075  3.528   1.00 26.70 ? 160  ALA C O   1 
ATOM   6290 C CB  . ALA C 1 159 ? 27.116  87.647  2.661   1.00 25.50 ? 160  ALA C CB  1 
ATOM   6291 N N   . ALA C 1 160 ? 24.369  86.429  1.915   1.00 24.76 ? 161  ALA C N   1 
ATOM   6292 C CA  . ALA C 1 160 ? 23.006  86.088  2.309   1.00 24.65 ? 161  ALA C CA  1 
ATOM   6293 C C   . ALA C 1 160 ? 22.716  84.589  2.058   1.00 27.06 ? 161  ALA C C   1 
ATOM   6294 O O   . ALA C 1 160 ? 22.004  83.952  2.820   1.00 24.36 ? 161  ALA C O   1 
ATOM   6295 C CB  . ALA C 1 160 ? 22.019  86.938  1.552   1.00 26.73 ? 161  ALA C CB  1 
ATOM   6296 N N   . ASP C 1 161 ? 23.266  84.033  0.987   1.00 27.09 ? 162  ASP C N   1 
ATOM   6297 C CA  . ASP C 1 161 ? 22.992  82.637  0.672   1.00 28.98 ? 162  ASP C CA  1 
ATOM   6298 C C   . ASP C 1 161 ? 23.626  81.768  1.735   1.00 27.44 ? 162  ASP C C   1 
ATOM   6299 O O   . ASP C 1 161 ? 23.015  80.802  2.219   1.00 25.41 ? 162  ASP C O   1 
ATOM   6300 C CB  . ASP C 1 161 ? 23.591  82.230  -0.679  1.00 29.18 ? 162  ASP C CB  1 
ATOM   6301 C CG  . ASP C 1 161 ? 22.773  82.703  -1.873  1.00 33.42 ? 162  ASP C CG  1 
ATOM   6302 O OD1 . ASP C 1 161 ? 23.355  82.721  -2.981  1.00 36.31 ? 162  ASP C OD1 1 
ATOM   6303 O OD2 . ASP C 1 161 ? 21.569  83.029  -1.734  1.00 33.41 ? 162  ASP C OD2 1 
ATOM   6304 N N   . SER C 1 162 ? 24.866  82.097  2.075   1.00 28.53 ? 163  SER C N   1 
ATOM   6305 C CA  . SER C 1 162 ? 25.585  81.322  3.072   1.00 28.81 ? 163  SER C CA  1 
ATOM   6306 C C   . SER C 1 162 ? 24.807  81.329  4.388   1.00 26.30 ? 163  SER C C   1 
ATOM   6307 O O   . SER C 1 162 ? 24.617  80.281  5.020   1.00 26.35 ? 163  SER C O   1 
ATOM   6308 C CB  . SER C 1 162 ? 26.989  81.894  3.281   1.00 29.75 ? 163  SER C CB  1 
ATOM   6309 O OG  . SER C 1 162 ? 27.572  81.342  4.442   1.00 32.47 ? 163  SER C OG  1 
ATOM   6310 N N   . VAL C 1 163 ? 24.381  82.514  4.801   1.00 26.09 ? 164  VAL C N   1 
ATOM   6311 C CA  . VAL C 1 163 ? 23.586  82.654  6.020   1.00 25.25 ? 164  VAL C CA  1 
ATOM   6312 C C   . VAL C 1 163 ? 22.300  81.809  5.937   1.00 25.58 ? 164  VAL C C   1 
ATOM   6313 O O   . VAL C 1 163 ? 21.977  81.039  6.866   1.00 22.85 ? 164  VAL C O   1 
ATOM   6314 C CB  . VAL C 1 163 ? 23.191  84.159  6.281   1.00 25.10 ? 164  VAL C CB  1 
ATOM   6315 C CG1 . VAL C 1 163 ? 22.021  84.260  7.257   1.00 26.01 ? 164  VAL C CG1 1 
ATOM   6316 C CG2 . VAL C 1 163 ? 24.382  84.904  6.887   1.00 25.31 ? 164  VAL C CG2 1 
ATOM   6317 N N   . ASN C 1 164 ? 21.578  81.938  4.819   1.00 23.53 ? 165  ASN C N   1 
ATOM   6318 C CA  . ASN C 1 164 ? 20.311  81.220  4.659   1.00 24.73 ? 165  ASN C CA  1 
ATOM   6319 C C   . ASN C 1 164 ? 20.414  79.716  4.707   1.00 23.80 ? 165  ASN C C   1 
ATOM   6320 O O   . ASN C 1 164 ? 19.552  79.048  5.259   1.00 25.96 ? 165  ASN C O   1 
ATOM   6321 C CB  . ASN C 1 164 ? 19.606  81.682  3.372   1.00 27.48 ? 165  ASN C CB  1 
ATOM   6322 C CG  . ASN C 1 164 ? 19.153  83.125  3.471   1.00 29.93 ? 165  ASN C CG  1 
ATOM   6323 O OD1 . ASN C 1 164 ? 19.079  83.682  4.588   1.00 23.83 ? 165  ASN C OD1 1 
ATOM   6324 N ND2 . ASN C 1 164 ? 18.848  83.743  2.327   1.00 27.63 ? 165  ASN C ND2 1 
ATOM   6325 N N   . LYS C 1 165 ? 21.486  79.188  4.141   1.00 26.18 ? 166  LYS C N   1 
ATOM   6326 C CA  . LYS C 1 165 ? 21.736  77.750  4.080   1.00 28.89 ? 166  LYS C CA  1 
ATOM   6327 C C   . LYS C 1 165 ? 22.133  77.209  5.472   1.00 29.02 ? 166  LYS C C   1 
ATOM   6328 O O   . LYS C 1 165 ? 21.600  76.199  5.952   1.00 30.99 ? 166  LYS C O   1 
ATOM   6329 C CB  . LYS C 1 165 ? 22.866  77.518  3.065   1.00 30.68 ? 166  LYS C CB  1 
ATOM   6330 C CG  . LYS C 1 165 ? 22.827  76.206  2.297   1.00 38.66 ? 166  LYS C CG  1 
ATOM   6331 C CD  . LYS C 1 165 ? 23.554  76.362  0.962   1.00 40.46 ? 166  LYS C CD  1 
ATOM   6332 C CE  . LYS C 1 165 ? 22.710  77.198  -0.028  1.00 44.79 ? 166  LYS C CE  1 
ATOM   6333 N NZ  . LYS C 1 165 ? 23.566  77.982  -1.015  1.00 44.32 ? 166  LYS C NZ  1 
ATOM   6334 N N   . ARG C 1 166 ? 23.057  77.900  6.124   1.00 27.37 ? 167  ARG C N   1 
ATOM   6335 C CA  . ARG C 1 166 ? 23.502  77.482  7.451   1.00 25.21 ? 167  ARG C CA  1 
ATOM   6336 C C   . ARG C 1 166 ? 22.424  77.602  8.481   1.00 25.25 ? 167  ARG C C   1 
ATOM   6337 O O   . ARG C 1 166 ? 22.226  76.676  9.291   1.00 23.95 ? 167  ARG C O   1 
ATOM   6338 C CB  . ARG C 1 166 ? 24.716  78.306  7.880   1.00 25.51 ? 167  ARG C CB  1 
ATOM   6339 C CG  . ARG C 1 166 ? 25.148  78.163  9.354   1.00 24.11 ? 167  ARG C CG  1 
ATOM   6340 C CD  . ARG C 1 166 ? 25.694  76.781  9.765   1.00 28.83 ? 167  ARG C CD  1 
ATOM   6341 N NE  . ARG C 1 166 ? 26.012  76.791  11.198  1.00 24.97 ? 167  ARG C NE  1 
ATOM   6342 C CZ  . ARG C 1 166 ? 25.113  76.812  12.178  1.00 26.83 ? 167  ARG C CZ  1 
ATOM   6343 N NH1 . ARG C 1 166 ? 23.802  76.799  11.918  1.00 25.21 ? 167  ARG C NH1 1 
ATOM   6344 N NH2 . ARG C 1 166 ? 25.526  76.898  13.444  1.00 27.86 ? 167  ARG C NH2 1 
ATOM   6345 N N   . PHE C 1 167 ? 21.715  78.731  8.476   1.00 23.97 ? 168  PHE C N   1 
ATOM   6346 C CA  . PHE C 1 167 ? 20.690  78.947  9.490   1.00 25.56 ? 168  PHE C CA  1 
ATOM   6347 C C   . PHE C 1 167 ? 19.225  78.680  9.134   1.00 27.11 ? 168  PHE C C   1 
ATOM   6348 O O   . PHE C 1 167 ? 18.316  78.900  9.972   1.00 24.67 ? 168  PHE C O   1 
ATOM   6349 C CB  . PHE C 1 167 ? 20.855  80.368  10.071  1.00 24.65 ? 168  PHE C CB  1 
ATOM   6350 C CG  . PHE C 1 167 ? 22.171  80.572  10.740  1.00 24.10 ? 168  PHE C CG  1 
ATOM   6351 C CD1 . PHE C 1 167 ? 23.258  81.098  10.022  1.00 20.99 ? 168  PHE C CD1 1 
ATOM   6352 C CD2 . PHE C 1 167 ? 22.364  80.147  12.071  1.00 24.11 ? 168  PHE C CD2 1 
ATOM   6353 C CE1 . PHE C 1 167 ? 24.507  81.210  10.575  1.00 21.72 ? 168  PHE C CE1 1 
ATOM   6354 C CE2 . PHE C 1 167 ? 23.633  80.246  12.655  1.00 20.05 ? 168  PHE C CE2 1 
ATOM   6355 C CZ  . PHE C 1 167 ? 24.718  80.779  11.914  1.00 19.49 ? 168  PHE C CZ  1 
ATOM   6356 N N   . LYS C 1 168 ? 18.990  78.222  7.898   1.00 26.74 ? 169  LYS C N   1 
ATOM   6357 C CA  . LYS C 1 168 ? 17.625  77.931  7.478   1.00 27.58 ? 169  LYS C CA  1 
ATOM   6358 C C   . LYS C 1 168 ? 16.747  79.173  7.614   1.00 25.69 ? 169  LYS C C   1 
ATOM   6359 O O   . LYS C 1 168 ? 15.660  79.115  8.182   1.00 24.48 ? 169  LYS C O   1 
ATOM   6360 C CB  . LYS C 1 168 ? 17.052  76.819  8.365   1.00 29.50 ? 169  LYS C CB  1 
ATOM   6361 C CG  . LYS C 1 168 ? 17.979  75.601  8.484   1.00 36.36 ? 169  LYS C CG  1 
ATOM   6362 C CD  . LYS C 1 168 ? 17.850  74.665  7.297   1.00 39.05 ? 169  LYS C CD  1 
ATOM   6363 C CE  . LYS C 1 168 ? 18.862  73.495  7.377   1.00 42.01 ? 169  LYS C CE  1 
ATOM   6364 N NZ  . LYS C 1 168 ? 18.617  72.595  8.559   1.00 43.05 ? 169  LYS C NZ  1 
ATOM   6365 N N   . VAL C 1 169 ? 17.232  80.307  7.129   1.00 25.61 ? 170  VAL C N   1 
ATOM   6366 C CA  . VAL C 1 169 ? 16.450  81.530  7.181   1.00 24.66 ? 170  VAL C CA  1 
ATOM   6367 C C   . VAL C 1 169 ? 16.392  82.101  5.771   1.00 25.64 ? 170  VAL C C   1 
ATOM   6368 O O   . VAL C 1 169 ? 16.879  81.476  4.833   1.00 24.51 ? 170  VAL C O   1 
ATOM   6369 C CB  . VAL C 1 169 ? 17.029  82.600  8.150   1.00 24.49 ? 170  VAL C CB  1 
ATOM   6370 C CG1 . VAL C 1 169 ? 16.824  82.107  9.622   1.00 24.43 ? 170  VAL C CG1 1 
ATOM   6371 C CG2 . VAL C 1 169 ? 18.526  82.862  7.843   1.00 21.74 ? 170  VAL C CG2 1 
ATOM   6372 N N   . ASN C 1 170 ? 15.798  83.279  5.647   1.00 26.77 ? 171  ASN C N   1 
ATOM   6373 C CA  . ASN C 1 170 ? 15.628  83.907  4.345   1.00 31.10 ? 171  ASN C CA  1 
ATOM   6374 C C   . ASN C 1 170 ? 16.038  85.383  4.315   1.00 27.83 ? 171  ASN C C   1 
ATOM   6375 O O   . ASN C 1 170 ? 15.215  86.284  4.108   1.00 30.19 ? 171  ASN C O   1 
ATOM   6376 C CB  . ASN C 1 170 ? 14.154  83.750  3.926   1.00 34.56 ? 171  ASN C CB  1 
ATOM   6377 C CG  . ASN C 1 170 ? 13.946  83.896  2.408   1.00 39.69 ? 171  ASN C CG  1 
ATOM   6378 O OD1 . ASN C 1 170 ? 14.871  83.706  1.610   1.00 40.85 ? 171  ASN C OD1 1 
ATOM   6379 N ND2 . ASN C 1 170 ? 12.712  84.217  2.012   1.00 43.22 ? 171  ASN C ND2 1 
ATOM   6380 N N   . VAL C 1 171 ? 17.311  85.634  4.519   1.00 24.13 ? 172  VAL C N   1 
ATOM   6381 C CA  . VAL C 1 171 ? 17.802  86.993  4.504   1.00 24.20 ? 172  VAL C CA  1 
ATOM   6382 C C   . VAL C 1 171 ? 17.842  87.438  3.038   1.00 24.26 ? 172  VAL C C   1 
ATOM   6383 O O   . VAL C 1 171 ? 18.081  86.613  2.165   1.00 24.71 ? 172  VAL C O   1 
ATOM   6384 C CB  . VAL C 1 171 ? 19.205  86.999  5.154   1.00 26.02 ? 172  VAL C CB  1 
ATOM   6385 C CG1 . VAL C 1 171 ? 19.929  88.283  4.856   1.00 26.18 ? 172  VAL C CG1 1 
ATOM   6386 C CG2 . VAL C 1 171 ? 19.043  86.751  6.669   1.00 22.38 ? 172  VAL C CG2 1 
ATOM   6387 N N   . THR C 1 172 ? 17.562  88.724  2.802   1.00 24.79 ? 173  THR C N   1 
ATOM   6388 C CA  . THR C 1 172 ? 17.589  89.371  1.478   1.00 26.89 ? 173  THR C CA  1 
ATOM   6389 C C   . THR C 1 172 ? 18.906  90.158  1.288   1.00 26.59 ? 173  THR C C   1 
ATOM   6390 O O   . THR C 1 172 ? 19.404  90.779  2.243   1.00 27.84 ? 173  THR C O   1 
ATOM   6391 C CB  . THR C 1 172 ? 16.434  90.368  1.381   1.00 24.53 ? 173  THR C CB  1 
ATOM   6392 O OG1 . THR C 1 172 ? 15.200  89.644  1.430   1.00 27.18 ? 173  THR C OG1 1 
ATOM   6393 C CG2 . THR C 1 172 ? 16.530  91.176  0.103   1.00 30.23 ? 173  THR C CG2 1 
ATOM   6394 N N   . ALA C 1 173 ? 19.483  90.131  0.093   1.00 24.18 ? 174  ALA C N   1 
ATOM   6395 C CA  . ALA C 1 173 ? 20.730  90.873  -0.140  1.00 28.40 ? 174  ALA C CA  1 
ATOM   6396 C C   . ALA C 1 173 ? 20.424  92.174  -0.859  1.00 30.23 ? 174  ALA C C   1 
ATOM   6397 O O   . ALA C 1 173 ? 19.406  92.276  -1.538  1.00 30.32 ? 174  ALA C O   1 
ATOM   6398 C CB  . ALA C 1 173 ? 21.703  90.046  -0.990  1.00 23.89 ? 174  ALA C CB  1 
ATOM   6399 N N   . ALA C 1 174 ? 21.300  93.164  -0.715  1.00 30.63 ? 175  ALA C N   1 
ATOM   6400 C CA  . ALA C 1 174 ? 21.119  94.431  -1.414  1.00 32.08 ? 175  ALA C CA  1 
ATOM   6401 C C   . ALA C 1 174 ? 22.502  95.032  -1.657  1.00 34.74 ? 175  ALA C C   1 
ATOM   6402 O O   . ALA C 1 174 ? 23.431  94.861  -0.848  1.00 31.48 ? 175  ALA C O   1 
ATOM   6403 C CB  . ALA C 1 174 ? 20.258  95.380  -0.592  1.00 33.14 ? 175  ALA C CB  1 
ATOM   6404 N N   . GLU C 1 175 ? 22.656  95.706  -2.787  1.00 33.27 ? 176  GLU C N   1 
ATOM   6405 C CA  . GLU C 1 175 ? 23.918  96.355  -3.086  1.00 32.92 ? 176  GLU C CA  1 
ATOM   6406 C C   . GLU C 1 175 ? 23.814  97.843  -2.710  1.00 33.26 ? 176  GLU C C   1 
ATOM   6407 O O   . GLU C 1 175 ? 22.834  98.511  -3.025  1.00 34.08 ? 176  GLU C O   1 
ATOM   6408 C CB  . GLU C 1 175 ? 24.238  96.203  -4.568  1.00 34.35 ? 176  GLU C CB  1 
ATOM   6409 C CG  . GLU C 1 175 ? 25.432  97.016  -5.037  1.00 37.43 ? 176  GLU C CG  1 
ATOM   6410 C CD  . GLU C 1 175 ? 25.667  96.843  -6.528  1.00 39.81 ? 176  GLU C CD  1 
ATOM   6411 O OE1 . GLU C 1 175 ? 25.297  97.746  -7.323  1.00 43.66 ? 176  GLU C OE1 1 
ATOM   6412 O OE2 . GLU C 1 175 ? 26.203  95.784  -6.919  1.00 41.43 ? 176  GLU C OE2 1 
ATOM   6413 N N   . THR C 1 176 ? 24.810  98.336  -1.989  1.00 33.63 ? 177  THR C N   1 
ATOM   6414 C CA  . THR C 1 176 ? 24.876  99.737  -1.588  1.00 35.58 ? 177  THR C CA  1 
ATOM   6415 C C   . THR C 1 176 ? 26.321  100.093 -1.965  1.00 37.15 ? 177  THR C C   1 
ATOM   6416 O O   . THR C 1 176 ? 27.269  99.867  -1.213  1.00 37.38 ? 177  THR C O   1 
ATOM   6417 C CB  . THR C 1 176 ? 24.604  99.898  -0.059  1.00 34.21 ? 177  THR C CB  1 
ATOM   6418 O OG1 . THR C 1 176 ? 25.452  99.003  0.675   1.00 31.79 ? 177  THR C OG1 1 
ATOM   6419 C CG2 . THR C 1 176 ? 23.124  99.560  0.259   1.00 36.50 ? 177  THR C CG2 1 
ATOM   6420 N N   . ALA C 1 177 ? 26.492  100.608 -3.173  1.00 39.09 ? 178  ALA C N   1 
ATOM   6421 C CA  . ALA C 1 177 ? 27.835  100.909 -3.654  1.00 38.99 ? 178  ALA C CA  1 
ATOM   6422 C C   . ALA C 1 177 ? 28.460  102.182 -3.117  1.00 40.24 ? 178  ALA C C   1 
ATOM   6423 O O   . ALA C 1 177 ? 29.683  102.385 -3.234  1.00 38.53 ? 178  ALA C O   1 
ATOM   6424 C CB  . ALA C 1 177 ? 27.833  100.942 -5.174  1.00 39.40 ? 178  ALA C CB  1 
ATOM   6425 N N   . ASP C 1 178 ? 27.644  103.031 -2.506  1.00 40.92 ? 179  ASP C N   1 
ATOM   6426 C CA  . ASP C 1 178 ? 28.147  104.305 -2.003  1.00 41.87 ? 179  ASP C CA  1 
ATOM   6427 C C   . ASP C 1 178 ? 27.325  104.864 -0.848  1.00 40.60 ? 179  ASP C C   1 
ATOM   6428 O O   . ASP C 1 178 ? 26.297  104.296 -0.470  1.00 38.09 ? 179  ASP C O   1 
ATOM   6429 C CB  . ASP C 1 178 ? 28.133  105.325 -3.136  1.00 43.28 ? 179  ASP C CB  1 
ATOM   6430 C CG  . ASP C 1 178 ? 26.767  105.430 -3.782  1.00 44.47 ? 179  ASP C CG  1 
ATOM   6431 O OD1 . ASP C 1 178 ? 25.751  105.263 -3.066  1.00 46.32 ? 179  ASP C OD1 1 
ATOM   6432 O OD2 . ASP C 1 178 ? 26.698  105.673 -5.005  1.00 49.32 ? 179  ASP C OD2 1 
ATOM   6433 N N   . ASP C 1 179 ? 27.771  106.012 -0.337  1.00 41.45 ? 180  ASP C N   1 
ATOM   6434 C CA  . ASP C 1 179 ? 27.124  106.688 0.793   1.00 42.51 ? 180  ASP C CA  1 
ATOM   6435 C C   . ASP C 1 179 ? 25.631  106.878 0.573   1.00 41.45 ? 180  ASP C C   1 
ATOM   6436 O O   . ASP C 1 179 ? 24.810  106.593 1.448   1.00 39.75 ? 180  ASP C O   1 
ATOM   6437 C CB  . ASP C 1 179 ? 27.771  108.061 1.035   1.00 46.43 ? 180  ASP C CB  1 
ATOM   6438 C CG  . ASP C 1 179 ? 29.298  107.986 1.204   1.00 51.54 ? 180  ASP C CG  1 
ATOM   6439 O OD1 . ASP C 1 179 ? 29.924  109.053 1.421   1.00 53.54 ? 180  ASP C OD1 1 
ATOM   6440 O OD2 . ASP C 1 179 ? 29.884  106.875 1.125   1.00 52.94 ? 180  ASP C OD2 1 
ATOM   6441 N N   . ALA C 1 180 ? 25.276  107.359 -0.610  1.00 39.94 ? 181  ALA C N   1 
ATOM   6442 C CA  . ALA C 1 180 ? 23.879  107.608 -0.924  1.00 38.35 ? 181  ALA C CA  1 
ATOM   6443 C C   . ALA C 1 180 ? 23.043  106.336 -0.868  1.00 36.56 ? 181  ALA C C   1 
ATOM   6444 O O   . ALA C 1 180 ? 21.921  106.337 -0.345  1.00 33.76 ? 181  ALA C O   1 
ATOM   6445 C CB  . ALA C 1 180 ? 23.769  108.239 -2.312  1.00 41.34 ? 181  ALA C CB  1 
ATOM   6446 N N   . SER C 1 181 ? 23.579  105.246 -1.402  1.00 36.14 ? 182  SER C N   1 
ATOM   6447 C CA  . SER C 1 181 ? 22.798  104.003 -1.383  1.00 37.88 ? 182  SER C CA  1 
ATOM   6448 C C   . SER C 1 181 ? 22.587  103.503 0.055   1.00 35.81 ? 182  SER C C   1 
ATOM   6449 O O   . SER C 1 181 ? 21.525  102.963 0.377   1.00 36.65 ? 182  SER C O   1 
ATOM   6450 C CB  . SER C 1 181 ? 23.446  102.925 -2.270  1.00 36.89 ? 182  SER C CB  1 
ATOM   6451 O OG  . SER C 1 181 ? 24.755  102.576 -1.854  1.00 42.91 ? 182  SER C OG  1 
ATOM   6452 N N   . ARG C 1 182 ? 23.565  103.705 0.932   1.00 36.61 ? 183  ARG C N   1 
ATOM   6453 C CA  . ARG C 1 182 ? 23.383  103.262 2.314   1.00 35.11 ? 183  ARG C CA  1 
ATOM   6454 C C   . ARG C 1 182 ? 22.335  104.130 3.006   1.00 37.64 ? 183  ARG C C   1 
ATOM   6455 O O   . ARG C 1 182 ? 21.548  103.640 3.824   1.00 37.12 ? 183  ARG C O   1 
ATOM   6456 C CB  . ARG C 1 182 ? 24.701  103.308 3.066   1.00 33.76 ? 183  ARG C CB  1 
ATOM   6457 C CG  . ARG C 1 182 ? 25.721  102.355 2.475   1.00 34.74 ? 183  ARG C CG  1 
ATOM   6458 C CD  . ARG C 1 182 ? 26.881  102.159 3.427   1.00 36.78 ? 183  ARG C CD  1 
ATOM   6459 N NE  . ARG C 1 182 ? 27.596  103.404 3.673   1.00 37.53 ? 183  ARG C NE  1 
ATOM   6460 C CZ  . ARG C 1 182 ? 28.507  103.906 2.846   1.00 39.84 ? 183  ARG C CZ  1 
ATOM   6461 N NH1 . ARG C 1 182 ? 28.807  103.255 1.723   1.00 37.74 ? 183  ARG C NH1 1 
ATOM   6462 N NH2 . ARG C 1 182 ? 29.122  105.054 3.142   1.00 39.15 ? 183  ARG C NH2 1 
ATOM   6463 N N   . ALA C 1 183 ? 22.311  105.425 2.680   1.00 36.97 ? 184  ALA C N   1 
ATOM   6464 C CA  . ALA C 1 183 ? 21.326  106.324 3.281   1.00 37.29 ? 184  ALA C CA  1 
ATOM   6465 C C   . ALA C 1 183 ? 19.940  105.894 2.812   1.00 36.49 ? 184  ALA C C   1 
ATOM   6466 O O   . ALA C 1 183 ? 18.972  105.932 3.579   1.00 38.54 ? 184  ALA C O   1 
ATOM   6467 C CB  . ALA C 1 183 ? 21.604  107.784 2.876   1.00 35.87 ? 184  ALA C CB  1 
ATOM   6468 N N   . GLU C 1 184 ? 19.847  105.440 1.562   1.00 36.27 ? 185  GLU C N   1 
ATOM   6469 C CA  . GLU C 1 184 ? 18.565  104.997 1.035   1.00 35.86 ? 185  GLU C CA  1 
ATOM   6470 C C   . GLU C 1 184 ? 18.089  103.719 1.719   1.00 36.15 ? 185  GLU C C   1 
ATOM   6471 O O   . GLU C 1 184 ? 16.944  103.623 2.191   1.00 33.81 ? 185  GLU C O   1 
ATOM   6472 C CB  . GLU C 1 184 ? 18.649  104.710 -0.476  1.00 38.66 ? 185  GLU C CB  1 
ATOM   6473 C CG  . GLU C 1 184 ? 18.538  105.930 -1.362  1.00 43.90 ? 185  GLU C CG  1 
ATOM   6474 C CD  . GLU C 1 184 ? 17.470  106.910 -0.876  1.00 46.40 ? 185  GLU C CD  1 
ATOM   6475 O OE1 . GLU C 1 184 ? 17.864  107.995 -0.390  1.00 48.41 ? 185  GLU C OE1 1 
ATOM   6476 O OE2 . GLU C 1 184 ? 16.257  106.598 -0.969  1.00 47.14 ? 185  GLU C OE2 1 
ATOM   6477 N N   . ALA C 1 185 ? 18.991  102.744 1.737   1.00 32.67 ? 186  ALA C N   1 
ATOM   6478 C CA  . ALA C 1 185 ? 18.740  101.416 2.276   1.00 32.25 ? 186  ALA C CA  1 
ATOM   6479 C C   . ALA C 1 185 ? 18.085  101.374 3.654   1.00 31.85 ? 186  ALA C C   1 
ATOM   6480 O O   . ALA C 1 185 ? 17.290  100.466 3.944   1.00 31.59 ? 186  ALA C O   1 
ATOM   6481 C CB  . ALA C 1 185 ? 20.064  100.631 2.286   1.00 30.21 ? 186  ALA C CB  1 
ATOM   6482 N N   . VAL C 1 186 ? 18.399  102.348 4.500   1.00 28.94 ? 187  VAL C N   1 
ATOM   6483 C CA  . VAL C 1 186 ? 17.848  102.350 5.835   1.00 31.71 ? 187  VAL C CA  1 
ATOM   6484 C C   . VAL C 1 186 ? 16.475  103.007 5.916   1.00 33.23 ? 187  VAL C C   1 
ATOM   6485 O O   . VAL C 1 186 ? 15.885  103.059 7.001   1.00 32.75 ? 187  VAL C O   1 
ATOM   6486 C CB  . VAL C 1 186 ? 18.801  103.061 6.837   1.00 29.49 ? 187  VAL C CB  1 
ATOM   6487 C CG1 . VAL C 1 186 ? 20.178  102.372 6.819   1.00 28.67 ? 187  VAL C CG1 1 
ATOM   6488 C CG2 . VAL C 1 186 ? 18.927  104.560 6.472   1.00 27.03 ? 187  VAL C CG2 1 
ATOM   6489 N N   . LYS C 1 187 ? 15.952  103.508 4.790   1.00 30.59 ? 188  LYS C N   1 
ATOM   6490 C CA  . LYS C 1 187 ? 14.658  104.155 4.849   1.00 30.83 ? 188  LYS C CA  1 
ATOM   6491 C C   . LYS C 1 187 ? 13.552  103.145 5.097   1.00 29.13 ? 188  LYS C C   1 
ATOM   6492 O O   . LYS C 1 187 ? 13.474  102.108 4.442   1.00 29.40 ? 188  LYS C O   1 
ATOM   6493 C CB  . LYS C 1 187 ? 14.423  104.962 3.555   1.00 34.85 ? 188  LYS C CB  1 
ATOM   6494 C CG  . LYS C 1 187 ? 15.455  106.101 3.403   1.00 38.73 ? 188  LYS C CG  1 
ATOM   6495 C CD  . LYS C 1 187 ? 15.013  107.222 2.448   1.00 42.99 ? 188  LYS C CD  1 
ATOM   6496 C CE  . LYS C 1 187 ? 16.026  108.393 2.486   1.00 43.47 ? 188  LYS C CE  1 
ATOM   6497 N NZ  . LYS C 1 187 ? 15.718  109.505 1.530   1.00 46.39 ? 188  LYS C NZ  1 
ATOM   6498 N N   . GLY C 1 188 ? 12.685  103.436 6.055   1.00 28.11 ? 189  GLY C N   1 
ATOM   6499 C CA  . GLY C 1 188 ? 11.619  102.505 6.351   1.00 30.23 ? 189  GLY C CA  1 
ATOM   6500 C C   . GLY C 1 188 ? 12.029  101.388 7.325   1.00 31.41 ? 189  GLY C C   1 
ATOM   6501 O O   . GLY C 1 188 ? 11.168  100.635 7.794   1.00 33.57 ? 189  GLY C O   1 
ATOM   6502 N N   . ALA C 1 189 ? 13.326  101.270 7.619   1.00 30.61 ? 190  ALA C N   1 
ATOM   6503 C CA  . ALA C 1 189 ? 13.832  100.228 8.527   1.00 27.30 ? 190  ALA C CA  1 
ATOM   6504 C C   . ALA C 1 189 ? 13.555  100.577 9.987   1.00 28.66 ? 190  ALA C C   1 
ATOM   6505 O O   . ALA C 1 189 ? 13.498  101.747 10.343  1.00 26.31 ? 190  ALA C O   1 
ATOM   6506 C CB  . ALA C 1 189 ? 15.342  100.073 8.332   1.00 25.73 ? 190  ALA C CB  1 
ATOM   6507 N N   . HIS C 1 190 ? 13.391  99.554  10.828  1.00 26.59 ? 191  HIS C N   1 
ATOM   6508 C CA  . HIS C 1 190 ? 13.186  99.777  12.254  1.00 27.58 ? 191  HIS C CA  1 
ATOM   6509 C C   . HIS C 1 190 ? 14.493  99.623  13.036  1.00 27.51 ? 191  HIS C C   1 
ATOM   6510 O O   . HIS C 1 190 ? 14.661  100.274 14.068  1.00 29.00 ? 191  HIS C O   1 
ATOM   6511 C CB  . HIS C 1 190 ? 12.174  98.779  12.837  1.00 27.06 ? 191  HIS C CB  1 
ATOM   6512 C CG  . HIS C 1 190 ? 10.857  98.810  12.145  1.00 32.75 ? 191  HIS C CG  1 
ATOM   6513 N ND1 . HIS C 1 190 ? 10.607  98.083  10.999  1.00 33.47 ? 191  HIS C ND1 1 
ATOM   6514 C CD2 . HIS C 1 190 ? 9.745   99.551  12.381  1.00 35.41 ? 191  HIS C CD2 1 
ATOM   6515 C CE1 . HIS C 1 190 ? 9.394   98.379  10.556  1.00 36.47 ? 191  HIS C CE1 1 
ATOM   6516 N NE2 . HIS C 1 190 ? 8.850   99.267  11.375  1.00 35.02 ? 191  HIS C NE2 1 
ATOM   6517 N N   . PHE C 1 191 ? 15.399  98.763  12.548  1.00 25.58 ? 192  PHE C N   1 
ATOM   6518 C CA  . PHE C 1 191 ? 16.660  98.493  13.249  1.00 25.19 ? 192  PHE C CA  1 
ATOM   6519 C C   . PHE C 1 191 ? 17.793  98.540  12.276  1.00 24.08 ? 192  PHE C C   1 
ATOM   6520 O O   . PHE C 1 191 ? 17.739  97.893  11.244  1.00 25.32 ? 192  PHE C O   1 
ATOM   6521 C CB  . PHE C 1 191 ? 16.601  97.101  13.909  1.00 25.41 ? 192  PHE C CB  1 
ATOM   6522 C CG  . PHE C 1 191 ? 15.323  96.864  14.677  1.00 25.90 ? 192  PHE C CG  1 
ATOM   6523 C CD1 . PHE C 1 191 ? 14.443  95.836  14.313  1.00 27.28 ? 192  PHE C CD1 1 
ATOM   6524 C CD2 . PHE C 1 191 ? 14.985  97.696  15.737  1.00 25.43 ? 192  PHE C CD2 1 
ATOM   6525 C CE1 . PHE C 1 191 ? 13.230  95.645  14.995  1.00 26.51 ? 192  PHE C CE1 1 
ATOM   6526 C CE2 . PHE C 1 191 ? 13.789  97.517  16.421  1.00 25.42 ? 192  PHE C CE2 1 
ATOM   6527 C CZ  . PHE C 1 191 ? 12.912  96.496  16.048  1.00 24.82 ? 192  PHE C CZ  1 
ATOM   6528 N N   . VAL C 1 192 ? 18.805  99.334  12.576  1.00 23.01 ? 193  VAL C N   1 
ATOM   6529 C CA  . VAL C 1 192 ? 19.934  99.418  11.674  1.00 25.69 ? 193  VAL C CA  1 
ATOM   6530 C C   . VAL C 1 192 ? 21.207  99.080  12.400  1.00 23.72 ? 193  VAL C C   1 
ATOM   6531 O O   . VAL C 1 192 ? 21.486  99.644  13.481  1.00 23.65 ? 193  VAL C O   1 
ATOM   6532 C CB  . VAL C 1 192 ? 20.106  100.847 11.053  1.00 27.20 ? 193  VAL C CB  1 
ATOM   6533 C CG1 . VAL C 1 192 ? 21.325  100.841 10.093  1.00 25.50 ? 193  VAL C CG1 1 
ATOM   6534 C CG2 . VAL C 1 192 ? 18.838  101.242 10.256  1.00 28.16 ? 193  VAL C CG2 1 
ATOM   6535 N N   . PHE C 1 193 ? 21.969  98.170  11.798  1.00 23.31 ? 194  PHE C N   1 
ATOM   6536 C CA  . PHE C 1 193 ? 23.273  97.720  12.332  1.00 23.35 ? 194  PHE C CA  1 
ATOM   6537 C C   . PHE C 1 193 ? 24.359  98.095  11.291  1.00 22.45 ? 194  PHE C C   1 
ATOM   6538 O O   . PHE C 1 193 ? 24.123  97.967  10.072  1.00 23.05 ? 194  PHE C O   1 
ATOM   6539 C CB  . PHE C 1 193 ? 23.322  96.191  12.458  1.00 19.07 ? 194  PHE C CB  1 
ATOM   6540 C CG  . PHE C 1 193 ? 22.443  95.607  13.537  1.00 18.88 ? 194  PHE C CG  1 
ATOM   6541 C CD1 . PHE C 1 193 ? 21.067  95.590  13.392  1.00 19.54 ? 194  PHE C CD1 1 
ATOM   6542 C CD2 . PHE C 1 193 ? 23.018  95.084  14.718  1.00 18.79 ? 194  PHE C CD2 1 
ATOM   6543 C CE1 . PHE C 1 193 ? 20.208  95.071  14.388  1.00 20.46 ? 194  PHE C CE1 1 
ATOM   6544 C CE2 . PHE C 1 193 ? 22.184  94.551  15.751  1.00 20.70 ? 194  PHE C CE2 1 
ATOM   6545 C CZ  . PHE C 1 193 ? 20.771  94.547  15.584  1.00 20.99 ? 194  PHE C CZ  1 
ATOM   6546 N N   . THR C 1 194 ? 25.522  98.532  11.769  1.00 23.35 ? 195  THR C N   1 
ATOM   6547 C CA  . THR C 1 194 ? 26.699  98.858  10.922  1.00 23.12 ? 195  THR C CA  1 
ATOM   6548 C C   . THR C 1 194 ? 27.836  97.907  11.345  1.00 22.71 ? 195  THR C C   1 
ATOM   6549 O O   . THR C 1 194 ? 28.246  97.886  12.515  1.00 21.52 ? 195  THR C O   1 
ATOM   6550 C CB  . THR C 1 194 ? 27.153  100.348 11.085  1.00 24.73 ? 195  THR C CB  1 
ATOM   6551 O OG1 . THR C 1 194 ? 27.226  100.691 12.478  1.00 28.72 ? 195  THR C OG1 1 
ATOM   6552 C CG2 . THR C 1 194 ? 26.126  101.253 10.470  1.00 25.07 ? 195  THR C CG2 1 
ATOM   6553 N N   . ALA C 1 195 ? 28.345  97.132  10.389  1.00 21.12 ? 196  ALA C N   1 
ATOM   6554 C CA  . ALA C 1 195 ? 29.378  96.125  10.669  1.00 20.80 ? 196  ALA C CA  1 
ATOM   6555 C C   . ALA C 1 195 ? 30.572  96.253  9.742   1.00 23.30 ? 196  ALA C C   1 
ATOM   6556 O O   . ALA C 1 195 ? 31.132  95.254  9.295   1.00 23.21 ? 196  ALA C O   1 
ATOM   6557 C CB  . ALA C 1 195 ? 28.765  94.704  10.553  1.00 22.59 ? 196  ALA C CB  1 
ATOM   6558 N N   . GLY C 1 196 ? 30.972  97.496  9.485   1.00 25.73 ? 197  GLY C N   1 
ATOM   6559 C CA  . GLY C 1 196 ? 32.077  97.772  8.583   1.00 27.22 ? 197  GLY C CA  1 
ATOM   6560 C C   . GLY C 1 196 ? 33.482  97.914  9.134   1.00 29.11 ? 197  GLY C C   1 
ATOM   6561 O O   . GLY C 1 196 ? 33.760  97.639  10.316  1.00 27.92 ? 197  GLY C O   1 
ATOM   6562 N N   . ALA C 1 197 ? 34.390  98.328  8.249   1.00 30.26 ? 198  ALA C N   1 
ATOM   6563 C CA  . ALA C 1 197 ? 35.780  98.469  8.617   1.00 30.99 ? 198  ALA C CA  1 
ATOM   6564 C C   . ALA C 1 197 ? 35.975  99.502  9.719   1.00 34.44 ? 198  ALA C C   1 
ATOM   6565 O O   . ALA C 1 197 ? 35.188  100.442 9.871   1.00 31.66 ? 198  ALA C O   1 
ATOM   6566 C CB  . ALA C 1 197 ? 36.612  98.835  7.409   1.00 33.41 ? 198  ALA C CB  1 
ATOM   6567 N N   . ILE C 1 198 ? 37.032  99.284  10.491  1.00 34.37 ? 199  ILE C N   1 
ATOM   6568 C CA  . ILE C 1 198 ? 37.409  100.147 11.592  1.00 38.91 ? 199  ILE C CA  1 
ATOM   6569 C C   . ILE C 1 198 ? 37.689  101.573 11.105  1.00 39.54 ? 199  ILE C C   1 
ATOM   6570 O O   . ILE C 1 198 ? 38.256  101.763 10.034  1.00 37.23 ? 199  ILE C O   1 
ATOM   6571 C CB  . ILE C 1 198 ? 38.676  99.585  12.245  1.00 42.75 ? 199  ILE C CB  1 
ATOM   6572 C CG1 . ILE C 1 198 ? 38.421  98.140  12.675  1.00 46.41 ? 199  ILE C CG1 1 
ATOM   6573 C CG2 . ILE C 1 198 ? 39.103  100.462 13.411  1.00 44.97 ? 199  ILE C CG2 1 
ATOM   6574 C CD1 . ILE C 1 198 ? 39.691  97.340  12.981  1.00 51.16 ? 199  ILE C CD1 1 
ATOM   6575 N N   . GLY C 1 199 ? 37.268  102.568 11.881  1.00 40.08 ? 200  GLY C N   1 
ATOM   6576 C CA  . GLY C 1 199 ? 37.527  103.954 11.516  1.00 40.12 ? 200  GLY C CA  1 
ATOM   6577 C C   . GLY C 1 199 ? 36.815  104.439 10.266  1.00 41.19 ? 200  GLY C C   1 
ATOM   6578 O O   . GLY C 1 199 ? 37.265  105.394 9.593   1.00 40.56 ? 200  GLY C O   1 
ATOM   6579 N N   . LEU C 1 200 ? 35.691  103.800 9.952   1.00 38.45 ? 201  LEU C N   1 
ATOM   6580 C CA  . LEU C 1 200 ? 34.915  104.182 8.780   1.00 37.11 ? 201  LEU C CA  1 
ATOM   6581 C C   . LEU C 1 200 ? 33.443  104.453 9.114   1.00 37.66 ? 201  LEU C C   1 
ATOM   6582 O O   . LEU C 1 200 ? 32.752  103.608 9.712   1.00 36.64 ? 201  LEU C O   1 
ATOM   6583 C CB  . LEU C 1 200 ? 35.020  103.077 7.730   1.00 37.46 ? 201  LEU C CB  1 
ATOM   6584 C CG  . LEU C 1 200 ? 34.224  103.293 6.454   1.00 39.43 ? 201  LEU C CG  1 
ATOM   6585 C CD1 . LEU C 1 200 ? 34.912  104.397 5.663   1.00 41.97 ? 201  LEU C CD1 1 
ATOM   6586 C CD2 . LEU C 1 200 ? 34.134  101.988 5.649   1.00 39.47 ? 201  LEU C CD2 1 
ATOM   6587 N N   . GLU C 1 201 ? 32.950  105.627 8.729   1.00 36.71 ? 202  GLU C N   1 
ATOM   6588 C CA  . GLU C 1 201 ? 31.545  105.959 8.989   1.00 36.58 ? 202  GLU C CA  1 
ATOM   6589 C C   . GLU C 1 201 ? 30.713  105.446 7.826   1.00 35.26 ? 202  GLU C C   1 
ATOM   6590 O O   . GLU C 1 201 ? 31.061  105.682 6.672   1.00 33.13 ? 202  GLU C O   1 
ATOM   6591 C CB  . GLU C 1 201 ? 31.344  107.472 9.101   1.00 38.04 ? 202  GLU C CB  1 
ATOM   6592 C CG  . GLU C 1 201 ? 29.878  107.863 9.261   1.00 40.31 ? 202  GLU C CG  1 
ATOM   6593 C CD  . GLU C 1 201 ? 29.681  109.359 9.318   1.00 43.98 ? 202  GLU C CD  1 
ATOM   6594 O OE1 . GLU C 1 201 ? 29.626  109.980 8.233   1.00 46.62 ? 202  GLU C OE1 1 
ATOM   6595 O OE2 . GLU C 1 201 ? 29.589  109.906 10.443  1.00 43.15 ? 202  GLU C OE2 1 
ATOM   6596 N N   . LEU C 1 202 ? 29.603  104.777 8.125   1.00 34.37 ? 203  LEU C N   1 
ATOM   6597 C CA  . LEU C 1 202 ? 28.746  104.228 7.067   1.00 34.88 ? 203  LEU C CA  1 
ATOM   6598 C C   . LEU C 1 202 ? 27.390  104.897 7.047   1.00 34.43 ? 203  LEU C C   1 
ATOM   6599 O O   . LEU C 1 202 ? 26.657  104.824 6.056   1.00 32.77 ? 203  LEU C O   1 
ATOM   6600 C CB  . LEU C 1 202 ? 28.498  102.728 7.278   1.00 31.13 ? 203  LEU C CB  1 
ATOM   6601 C CG  . LEU C 1 202 ? 29.697  101.782 7.413   1.00 34.13 ? 203  LEU C CG  1 
ATOM   6602 C CD1 . LEU C 1 202 ? 29.189  100.341 7.466   1.00 35.11 ? 203  LEU C CD1 1 
ATOM   6603 C CD2 . LEU C 1 202 ? 30.651  101.975 6.238   1.00 35.28 ? 203  LEU C CD2 1 
ATOM   6604 N N   . LEU C 1 203 ? 27.048  105.539 8.153   1.00 34.54 ? 204  LEU C N   1 
ATOM   6605 C CA  . LEU C 1 203 ? 25.735  106.151 8.249   1.00 34.81 ? 204  LEU C CA  1 
ATOM   6606 C C   . LEU C 1 203 ? 25.783  107.445 9.030   1.00 34.96 ? 204  LEU C C   1 
ATOM   6607 O O   . LEU C 1 203 ? 25.782  107.446 10.265  1.00 34.92 ? 204  LEU C O   1 
ATOM   6608 C CB  . LEU C 1 203 ? 24.766  105.183 8.929   1.00 35.27 ? 204  LEU C CB  1 
ATOM   6609 C CG  . LEU C 1 203 ? 23.309  105.602 8.824   1.00 35.82 ? 204  LEU C CG  1 
ATOM   6610 C CD1 . LEU C 1 203 ? 22.809  105.369 7.383   1.00 35.42 ? 204  LEU C CD1 1 
ATOM   6611 C CD2 . LEU C 1 203 ? 22.498  104.805 9.820   1.00 39.18 ? 204  LEU C CD2 1 
ATOM   6612 N N   . PRO C 1 204 ? 25.856  108.568 8.316   1.00 33.82 ? 205  PRO C N   1 
ATOM   6613 C CA  . PRO C 1 204 ? 25.902  109.882 8.954   1.00 34.18 ? 205  PRO C CA  1 
ATOM   6614 C C   . PRO C 1 204 ? 24.664  110.129 9.803   1.00 33.90 ? 205  PRO C C   1 
ATOM   6615 O O   . PRO C 1 204 ? 23.585  109.558 9.574   1.00 32.02 ? 205  PRO C O   1 
ATOM   6616 C CB  . PRO C 1 204 ? 25.954  110.847 7.766   1.00 35.42 ? 205  PRO C CB  1 
ATOM   6617 C CG  . PRO C 1 204 ? 26.641  110.032 6.679   1.00 38.93 ? 205  PRO C CG  1 
ATOM   6618 C CD  . PRO C 1 204 ? 25.939  108.682 6.849   1.00 35.66 ? 205  PRO C CD  1 
ATOM   6619 N N   . GLN C 1 205 ? 24.842  111.000 10.779  1.00 34.13 ? 206  GLN C N   1 
ATOM   6620 C CA  . GLN C 1 205 ? 23.798  111.408 11.720  1.00 37.92 ? 206  GLN C CA  1 
ATOM   6621 C C   . GLN C 1 205 ? 22.501  111.752 10.986  1.00 38.81 ? 206  GLN C C   1 
ATOM   6622 O O   . GLN C 1 205 ? 21.405  111.282 11.330  1.00 38.37 ? 206  GLN C O   1 
ATOM   6623 C CB  . GLN C 1 205 ? 24.309  112.641 12.473  1.00 39.83 ? 206  GLN C CB  1 
ATOM   6624 C CG  . GLN C 1 205 ? 23.712  112.898 13.814  1.00 41.74 ? 206  GLN C CG  1 
ATOM   6625 C CD  . GLN C 1 205 ? 24.516  113.961 14.544  1.00 45.49 ? 206  GLN C CD  1 
ATOM   6626 O OE1 . GLN C 1 205 ? 25.692  114.203 14.213  1.00 46.32 ? 206  GLN C OE1 1 
ATOM   6627 N NE2 . GLN C 1 205 ? 23.905  114.587 15.550  1.00 47.27 ? 206  GLN C NE2 1 
ATOM   6628 N N   . ALA C 1 206 ? 22.645  112.575 9.954   1.00 39.67 ? 207  ALA C N   1 
ATOM   6629 C CA  . ALA C 1 206 ? 21.507  113.008 9.169   1.00 39.75 ? 207  ALA C CA  1 
ATOM   6630 C C   . ALA C 1 206 ? 20.818  111.845 8.463   1.00 41.21 ? 207  ALA C C   1 
ATOM   6631 O O   . ALA C 1 206 ? 19.619  111.913 8.178   1.00 41.48 ? 207  ALA C O   1 
ATOM   6632 C CB  . ALA C 1 206 ? 21.955  114.031 8.149   1.00 40.19 ? 207  ALA C CB  1 
ATOM   6633 N N   . ALA C 1 207 ? 21.561  110.771 8.193   1.00 39.87 ? 208  ALA C N   1 
ATOM   6634 C CA  . ALA C 1 207 ? 20.969  109.636 7.481   1.00 37.27 ? 208  ALA C CA  1 
ATOM   6635 C C   . ALA C 1 207 ? 20.103  108.705 8.350   1.00 35.65 ? 208  ALA C C   1 
ATOM   6636 O O   . ALA C 1 207 ? 19.480  107.789 7.817   1.00 36.83 ? 208  ALA C O   1 
ATOM   6637 C CB  . ALA C 1 207 ? 22.069  108.846 6.758   1.00 37.36 ? 208  ALA C CB  1 
ATOM   6638 N N   . TRP C 1 208 ? 20.057  108.918 9.668   1.00 33.32 ? 209  TRP C N   1 
ATOM   6639 C CA  . TRP C 1 208 ? 19.194  108.090 10.518  1.00 33.47 ? 209  TRP C CA  1 
ATOM   6640 C C   . TRP C 1 208 ? 18.306  108.843 11.503  1.00 32.14 ? 209  TRP C C   1 
ATOM   6641 O O   . TRP C 1 208 ? 17.183  108.419 11.790  1.00 31.90 ? 209  TRP C O   1 
ATOM   6642 C CB  . TRP C 1 208 ? 20.010  107.017 11.299  1.00 31.88 ? 209  TRP C CB  1 
ATOM   6643 C CG  . TRP C 1 208 ? 21.013  107.539 12.307  1.00 27.75 ? 209  TRP C CG  1 
ATOM   6644 C CD1 . TRP C 1 208 ? 22.277  107.988 12.054  1.00 28.44 ? 209  TRP C CD1 1 
ATOM   6645 C CD2 . TRP C 1 208 ? 20.829  107.638 13.726  1.00 28.85 ? 209  TRP C CD2 1 
ATOM   6646 N NE1 . TRP C 1 208 ? 22.897  108.353 13.236  1.00 29.26 ? 209  TRP C NE1 1 
ATOM   6647 C CE2 . TRP C 1 208 ? 22.024  108.149 14.273  1.00 28.12 ? 209  TRP C CE2 1 
ATOM   6648 C CE3 . TRP C 1 208 ? 19.768  107.332 14.589  1.00 29.74 ? 209  TRP C CE3 1 
ATOM   6649 C CZ2 . TRP C 1 208 ? 22.187  108.372 15.652  1.00 31.55 ? 209  TRP C CZ2 1 
ATOM   6650 C CZ3 . TRP C 1 208 ? 19.928  107.542 15.966  1.00 28.42 ? 209  TRP C CZ3 1 
ATOM   6651 C CH2 . TRP C 1 208 ? 21.129  108.058 16.481  1.00 31.31 ? 209  TRP C CH2 1 
ATOM   6652 N N   . GLN C 1 209 ? 18.773  109.962 12.024  1.00 32.79 ? 210  GLN C N   1 
ATOM   6653 C CA  . GLN C 1 209 ? 17.965  110.651 13.022  1.00 35.73 ? 210  GLN C CA  1 
ATOM   6654 C C   . GLN C 1 209 ? 16.677  111.252 12.504  1.00 37.86 ? 210  GLN C C   1 
ATOM   6655 O O   . GLN C 1 209 ? 15.812  111.602 13.285  1.00 37.61 ? 210  GLN C O   1 
ATOM   6656 C CB  . GLN C 1 209 ? 18.785  111.724 13.723  1.00 39.14 ? 210  GLN C CB  1 
ATOM   6657 C CG  . GLN C 1 209 ? 19.986  111.151 14.467  1.00 42.93 ? 210  GLN C CG  1 
ATOM   6658 C CD  . GLN C 1 209 ? 20.701  112.197 15.307  1.00 46.14 ? 210  GLN C CD  1 
ATOM   6659 O OE1 . GLN C 1 209 ? 20.804  113.362 14.904  1.00 45.26 ? 210  GLN C OE1 1 
ATOM   6660 N NE2 . GLN C 1 209 ? 21.221  111.783 16.469  1.00 43.67 ? 210  GLN C NE2 1 
ATOM   6661 N N   . ASN C 1 210 ? 16.536  111.334 11.185  1.00 39.35 ? 211  ASN C N   1 
ATOM   6662 C CA  . ASN C 1 210 ? 15.340  111.916 10.604  1.00 40.79 ? 211  ASN C CA  1 
ATOM   6663 C C   . ASN C 1 210 ? 14.361  110.885 10.076  1.00 39.94 ? 211  ASN C C   1 
ATOM   6664 O O   . ASN C 1 210 ? 13.230  111.219 9.706   1.00 41.65 ? 211  ASN C O   1 
ATOM   6665 C CB  . ASN C 1 210 ? 15.748  112.886 9.497   1.00 41.26 ? 211  ASN C CB  1 
ATOM   6666 C CG  . ASN C 1 210 ? 16.479  114.089 10.049  1.00 42.77 ? 211  ASN C CG  1 
ATOM   6667 O OD1 . ASN C 1 210 ? 17.429  114.604 9.440   1.00 42.53 ? 211  ASN C OD1 1 
ATOM   6668 N ND2 . ASN C 1 210 ? 16.043  114.543 11.228  1.00 42.79 ? 211  ASN C ND2 1 
ATOM   6669 N N   . GLU C 1 211 ? 14.795  109.632 10.050  1.00 38.47 ? 212  GLU C N   1 
ATOM   6670 C CA  . GLU C 1 211 ? 13.956  108.544 9.556   1.00 36.37 ? 212  GLU C CA  1 
ATOM   6671 C C   . GLU C 1 211 ? 13.052  108.086 10.684  1.00 36.11 ? 212  GLU C C   1 
ATOM   6672 O O   . GLU C 1 211 ? 13.475  107.384 11.594  1.00 34.17 ? 212  GLU C O   1 
ATOM   6673 C CB  . GLU C 1 211 ? 14.829  107.379 9.068   1.00 34.23 ? 212  GLU C CB  1 
ATOM   6674 C CG  . GLU C 1 211 ? 14.059  106.285 8.387   1.00 34.33 ? 212  GLU C CG  1 
ATOM   6675 C CD  . GLU C 1 211 ? 13.444  106.724 7.056   1.00 37.86 ? 212  GLU C CD  1 
ATOM   6676 O OE1 . GLU C 1 211 ? 13.982  107.675 6.452   1.00 36.85 ? 212  GLU C OE1 1 
ATOM   6677 O OE2 . GLU C 1 211 ? 12.446  106.105 6.600   1.00 35.79 ? 212  GLU C OE2 1 
ATOM   6678 N N   . SER C 1 212 ? 11.791  108.488 10.607  1.00 36.27 ? 213  SER C N   1 
ATOM   6679 C CA  . SER C 1 212 ? 10.801  108.150 11.621  1.00 36.65 ? 213  SER C CA  1 
ATOM   6680 C C   . SER C 1 212 ? 10.711  106.664 12.000  1.00 33.25 ? 213  SER C C   1 
ATOM   6681 O O   . SER C 1 212 ? 10.554  106.336 13.169  1.00 33.68 ? 213  SER C O   1 
ATOM   6682 C CB  . SER C 1 212 ? 9.432   108.644 11.151  1.00 39.01 ? 213  SER C CB  1 
ATOM   6683 O OG  . SER C 1 212 ? 9.599   109.878 10.456  1.00 44.17 ? 213  SER C OG  1 
ATOM   6684 N N   . SER C 1 213 ? 10.799  105.777 11.021  1.00 31.49 ? 214  SER C N   1 
ATOM   6685 C CA  . SER C 1 213 ? 10.692  104.342 11.298  1.00 32.23 ? 214  SER C CA  1 
ATOM   6686 C C   . SER C 1 213 ? 11.794  103.784 12.202  1.00 31.39 ? 214  SER C C   1 
ATOM   6687 O O   . SER C 1 213 ? 11.537  102.878 12.989  1.00 32.85 ? 214  SER C O   1 
ATOM   6688 C CB  . SER C 1 213 ? 10.697  103.528 10.000  1.00 30.84 ? 214  SER C CB  1 
ATOM   6689 O OG  . SER C 1 213 ? 11.910  103.730 9.266   1.00 33.05 ? 214  SER C OG  1 
ATOM   6690 N N   . ILE C 1 214 ? 13.004  104.317 12.082  1.00 30.07 ? 215  ILE C N   1 
ATOM   6691 C CA  . ILE C 1 214 ? 14.125  103.813 12.856  1.00 30.32 ? 215  ILE C CA  1 
ATOM   6692 C C   . ILE C 1 214 ? 13.915  103.910 14.352  1.00 30.62 ? 215  ILE C C   1 
ATOM   6693 O O   . ILE C 1 214 ? 13.626  104.981 14.912  1.00 31.74 ? 215  ILE C O   1 
ATOM   6694 C CB  . ILE C 1 214 ? 15.438  104.485 12.438  1.00 29.15 ? 215  ILE C CB  1 
ATOM   6695 C CG1 . ILE C 1 214 ? 15.778  104.073 11.001  1.00 29.36 ? 215  ILE C CG1 1 
ATOM   6696 C CG2 . ILE C 1 214 ? 16.566  104.046 13.353  1.00 29.68 ? 215  ILE C CG2 1 
ATOM   6697 C CD1 . ILE C 1 214 ? 17.090  104.689 10.464  1.00 30.12 ? 215  ILE C CD1 1 
ATOM   6698 N N   . GLU C 1 215 ? 14.043  102.762 14.999  1.00 27.47 ? 216  GLU C N   1 
ATOM   6699 C CA  . GLU C 1 215 ? 13.840  102.668 16.438  1.00 28.67 ? 216  GLU C CA  1 
ATOM   6700 C C   . GLU C 1 215 ? 15.140  102.505 17.229  1.00 27.67 ? 216  GLU C C   1 
ATOM   6701 O O   . GLU C 1 215 ? 15.307  103.085 18.306  1.00 28.61 ? 216  GLU C O   1 
ATOM   6702 C CB  . GLU C 1 215 ? 12.937  101.467 16.738  1.00 28.47 ? 216  GLU C CB  1 
ATOM   6703 C CG  . GLU C 1 215 ? 11.480  101.642 16.369  1.00 32.37 ? 216  GLU C CG  1 
ATOM   6704 C CD  . GLU C 1 215 ? 10.696  100.333 16.494  1.00 34.47 ? 216  GLU C CD  1 
ATOM   6705 O OE1 . GLU C 1 215 ? 11.036  99.505  17.375  1.00 34.26 ? 216  GLU C OE1 1 
ATOM   6706 O OE2 . GLU C 1 215 ? 9.743   100.131 15.703  1.00 36.43 ? 216  GLU C OE2 1 
ATOM   6707 N N   . ILE C 1 216 ? 16.054  101.705 16.684  1.00 25.09 ? 217  ILE C N   1 
ATOM   6708 C CA  . ILE C 1 216 ? 17.300  101.413 17.347  1.00 24.28 ? 217  ILE C CA  1 
ATOM   6709 C C   . ILE C 1 216 ? 18.449  101.243 16.373  1.00 23.91 ? 217  ILE C C   1 
ATOM   6710 O O   . ILE C 1 216 ? 18.298  100.594 15.321  1.00 23.40 ? 217  ILE C O   1 
ATOM   6711 C CB  . ILE C 1 216 ? 17.173  100.075 18.162  1.00 27.04 ? 217  ILE C CB  1 
ATOM   6712 C CG1 . ILE C 1 216 ? 16.012  100.185 19.155  1.00 27.78 ? 217  ILE C CG1 1 
ATOM   6713 C CG2 . ILE C 1 216 ? 18.484  99.776  18.852  1.00 24.44 ? 217  ILE C CG2 1 
ATOM   6714 C CD1 . ILE C 1 216 ? 15.529  98.852  19.738  1.00 29.97 ? 217  ILE C CD1 1 
ATOM   6715 N N   . VAL C 1 217 ? 19.589  101.848 16.690  1.00 23.14 ? 218  VAL C N   1 
ATOM   6716 C CA  . VAL C 1 217 ? 20.772  101.666 15.856  1.00 22.82 ? 218  VAL C CA  1 
ATOM   6717 C C   . VAL C 1 217 ? 21.882  100.966 16.644  1.00 24.93 ? 218  VAL C C   1 
ATOM   6718 O O   . VAL C 1 217 ? 22.004  101.173 17.860  1.00 25.77 ? 218  VAL C O   1 
ATOM   6719 C CB  . VAL C 1 217 ? 21.300  103.006 15.312  1.00 24.14 ? 218  VAL C CB  1 
ATOM   6720 C CG1 . VAL C 1 217 ? 20.266  103.610 14.349  1.00 25.92 ? 218  VAL C CG1 1 
ATOM   6721 C CG2 . VAL C 1 217 ? 21.622  103.971 16.484  1.00 22.74 ? 218  VAL C CG2 1 
ATOM   6722 N N   . ALA C 1 218 ? 22.704  100.149 15.964  1.00 24.22 ? 219  ALA C N   1 
ATOM   6723 C CA  . ALA C 1 218 ? 23.800  99.438  16.638  1.00 24.97 ? 219  ALA C CA  1 
ATOM   6724 C C   . ALA C 1 218 ? 25.025  99.485  15.735  1.00 23.83 ? 219  ALA C C   1 
ATOM   6725 O O   . ALA C 1 218 ? 24.928  99.226  14.528  1.00 21.83 ? 219  ALA C O   1 
ATOM   6726 C CB  . ALA C 1 218 ? 23.385  97.947  16.941  1.00 21.39 ? 219  ALA C CB  1 
ATOM   6727 N N   . ASP C 1 219 ? 26.175  99.820  16.315  1.00 22.96 ? 220  ASP C N   1 
ATOM   6728 C CA  . ASP C 1 219 ? 27.434  99.933  15.570  1.00 24.53 ? 220  ASP C CA  1 
ATOM   6729 C C   . ASP C 1 219 ? 28.581  99.091  16.169  1.00 23.35 ? 220  ASP C C   1 
ATOM   6730 O O   . ASP C 1 219 ? 28.894  99.231  17.354  1.00 23.77 ? 220  ASP C O   1 
ATOM   6731 C CB  . ASP C 1 219 ? 27.817  101.419 15.517  1.00 22.93 ? 220  ASP C CB  1 
ATOM   6732 C CG  . ASP C 1 219 ? 29.169  101.669 14.838  1.00 31.45 ? 220  ASP C CG  1 
ATOM   6733 O OD1 . ASP C 1 219 ? 29.612  100.828 14.017  1.00 29.31 ? 220  ASP C OD1 1 
ATOM   6734 O OD2 . ASP C 1 219 ? 29.784  102.732 15.120  1.00 33.03 ? 220  ASP C OD2 1 
ATOM   6735 N N   . TYR C 1 220 ? 29.197  98.220  15.354  1.00 22.01 ? 221  TYR C N   1 
ATOM   6736 C CA  . TYR C 1 220 ? 30.311  97.366  15.804  1.00 21.60 ? 221  TYR C CA  1 
ATOM   6737 C C   . TYR C 1 220 ? 31.730  97.931  15.551  1.00 23.43 ? 221  TYR C C   1 
ATOM   6738 O O   . TYR C 1 220 ? 32.726  97.227  15.756  1.00 23.08 ? 221  TYR C O   1 
ATOM   6739 C CB  . TYR C 1 220 ? 30.260  95.993  15.107  1.00 22.47 ? 221  TYR C CB  1 
ATOM   6740 C CG  . TYR C 1 220 ? 28.997  95.215  15.370  1.00 23.54 ? 221  TYR C CG  1 
ATOM   6741 C CD1 . TYR C 1 220 ? 28.080  94.969  14.344  1.00 21.82 ? 221  TYR C CD1 1 
ATOM   6742 C CD2 . TYR C 1 220 ? 28.746  94.678  16.636  1.00 22.80 ? 221  TYR C CD2 1 
ATOM   6743 C CE1 . TYR C 1 220 ? 26.928  94.190  14.583  1.00 19.32 ? 221  TYR C CE1 1 
ATOM   6744 C CE2 . TYR C 1 220 ? 27.629  93.917  16.885  1.00 19.61 ? 221  TYR C CE2 1 
ATOM   6745 C CZ  . TYR C 1 220 ? 26.733  93.672  15.864  1.00 21.59 ? 221  TYR C CZ  1 
ATOM   6746 O OH  . TYR C 1 220 ? 25.675  92.857  16.135  1.00 18.68 ? 221  TYR C OH  1 
ATOM   6747 N N   . ASN C 1 221 ? 31.830  99.153  15.047  1.00 22.12 ? 222  ASN C N   1 
ATOM   6748 C CA  . ASN C 1 221 ? 33.167  99.745  14.797  1.00 25.48 ? 222  ASN C CA  1 
ATOM   6749 C C   . ASN C 1 221 ? 33.490  100.616 15.995  1.00 26.19 ? 222  ASN C C   1 
ATOM   6750 O O   . ASN C 1 221 ? 32.791  101.598 16.280  1.00 27.04 ? 222  ASN C O   1 
ATOM   6751 C CB  . ASN C 1 221 ? 33.168  100.582 13.524  1.00 26.74 ? 222  ASN C CB  1 
ATOM   6752 C CG  . ASN C 1 221 ? 34.349  101.543 13.455  1.00 31.16 ? 222  ASN C CG  1 
ATOM   6753 O OD1 . ASN C 1 221 ? 35.463  101.243 13.904  1.00 31.23 ? 222  ASN C OD1 1 
ATOM   6754 N ND2 . ASN C 1 221 ? 34.104  102.706 12.873  1.00 31.67 ? 222  ASN C ND2 1 
ATOM   6755 N N   . ALA C 1 222 ? 34.515  100.220 16.731  1.00 27.14 ? 223  ALA C N   1 
ATOM   6756 C CA  . ALA C 1 222 ? 34.894  100.953 17.949  1.00 29.84 ? 223  ALA C CA  1 
ATOM   6757 C C   . ALA C 1 222 ? 35.840  102.138 17.720  1.00 30.98 ? 223  ALA C C   1 
ATOM   6758 O O   . ALA C 1 222 ? 36.092  102.932 18.637  1.00 31.72 ? 223  ALA C O   1 
ATOM   6759 C CB  . ALA C 1 222 ? 35.516  99.985  18.960  1.00 28.48 ? 223  ALA C CB  1 
ATOM   6760 N N   . GLN C 1 223 ? 36.346  102.292 16.507  1.00 32.93 ? 224  GLN C N   1 
ATOM   6761 C CA  . GLN C 1 223 ? 37.278  103.382 16.297  1.00 35.43 ? 224  GLN C CA  1 
ATOM   6762 C C   . GLN C 1 223 ? 36.784  104.502 15.389  1.00 34.40 ? 224  GLN C C   1 
ATOM   6763 O O   . GLN C 1 223 ? 36.465  104.276 14.219  1.00 33.55 ? 224  GLN C O   1 
ATOM   6764 C CB  . GLN C 1 223 ? 38.604  102.821 15.799  1.00 40.79 ? 224  GLN C CB  1 
ATOM   6765 C CG  . GLN C 1 223 ? 39.542  103.886 15.256  1.00 47.26 ? 224  GLN C CG  1 
ATOM   6766 C CD  . GLN C 1 223 ? 40.922  103.347 15.012  1.00 52.47 ? 224  GLN C CD  1 
ATOM   6767 O OE1 . GLN C 1 223 ? 41.091  102.280 14.406  1.00 53.87 ? 224  GLN C OE1 1 
ATOM   6768 N NE2 . GLN C 1 223 ? 41.936  104.083 15.479  1.00 55.50 ? 224  GLN C NE2 1 
ATOM   6769 N N   . PRO C 1 224 ? 36.736  105.736 15.932  1.00 35.55 ? 225  PRO C N   1 
ATOM   6770 C CA  . PRO C 1 224 ? 36.301  106.976 15.280  1.00 35.59 ? 225  PRO C CA  1 
ATOM   6771 C C   . PRO C 1 224 ? 37.106  107.225 14.023  1.00 36.49 ? 225  PRO C C   1 
ATOM   6772 O O   . PRO C 1 224 ? 38.321  106.988 14.020  1.00 39.27 ? 225  PRO C O   1 
ATOM   6773 C CB  . PRO C 1 224 ? 36.578  108.034 16.338  1.00 37.51 ? 225  PRO C CB  1 
ATOM   6774 C CG  . PRO C 1 224 ? 36.376  107.296 17.616  1.00 38.32 ? 225  PRO C CG  1 
ATOM   6775 C CD  . PRO C 1 224 ? 37.157  106.023 17.315  1.00 36.94 ? 225  PRO C CD  1 
ATOM   6776 N N   . PRO C 1 225 ? 36.449  107.675 12.934  1.00 35.78 ? 226  PRO C N   1 
ATOM   6777 C CA  . PRO C 1 225 ? 35.000  107.916 12.888  1.00 35.38 ? 226  PRO C CA  1 
ATOM   6778 C C   . PRO C 1 225 ? 34.216  106.609 13.051  1.00 36.18 ? 226  PRO C C   1 
ATOM   6779 O O   . PRO C 1 225 ? 34.599  105.566 12.486  1.00 35.01 ? 226  PRO C O   1 
ATOM   6780 C CB  . PRO C 1 225 ? 34.785  108.594 11.527  1.00 36.07 ? 226  PRO C CB  1 
ATOM   6781 C CG  . PRO C 1 225 ? 36.030  108.316 10.745  1.00 36.56 ? 226  PRO C CG  1 
ATOM   6782 C CD  . PRO C 1 225 ? 37.120  108.294 11.781  1.00 36.84 ? 226  PRO C CD  1 
ATOM   6783 N N   . LEU C 1 226 ? 33.144  106.659 13.838  1.00 34.23 ? 227  LEU C N   1 
ATOM   6784 C CA  . LEU C 1 226 ? 32.352  105.465 14.093  1.00 31.28 ? 227  LEU C CA  1 
ATOM   6785 C C   . LEU C 1 226 ? 31.510  105.102 12.875  1.00 30.91 ? 227  LEU C C   1 
ATOM   6786 O O   . LEU C 1 226 ? 31.303  105.924 11.963  1.00 29.35 ? 227  LEU C O   1 
ATOM   6787 C CB  . LEU C 1 226 ? 31.457  105.667 15.331  1.00 34.52 ? 227  LEU C CB  1 
ATOM   6788 C CG  . LEU C 1 226 ? 32.098  106.169 16.641  1.00 34.72 ? 227  LEU C CG  1 
ATOM   6789 C CD1 . LEU C 1 226 ? 31.067  106.123 17.758  1.00 33.12 ? 227  LEU C CD1 1 
ATOM   6790 C CD2 . LEU C 1 226 ? 33.314  105.321 17.015  1.00 36.30 ? 227  LEU C CD2 1 
ATOM   6791 N N   . GLY C 1 227 ? 31.016  103.863 12.840  1.00 30.51 ? 228  GLY C N   1 
ATOM   6792 C CA  . GLY C 1 227 ? 30.186  103.462 11.719  1.00 27.40 ? 228  GLY C CA  1 
ATOM   6793 C C   . GLY C 1 227 ? 28.917  104.293 11.672  1.00 27.55 ? 228  GLY C C   1 
ATOM   6794 O O   . GLY C 1 227 ? 28.383  104.576 10.606  1.00 28.79 ? 228  GLY C O   1 
ATOM   6795 N N   . ILE C 1 228 ? 28.401  104.672 12.836  1.00 29.46 ? 229  ILE C N   1 
ATOM   6796 C CA  . ILE C 1 228 ? 27.177  105.482 12.895  1.00 30.11 ? 229  ILE C CA  1 
ATOM   6797 C C   . ILE C 1 228 ? 27.496  106.873 13.413  1.00 30.60 ? 229  ILE C C   1 
ATOM   6798 O O   . ILE C 1 228 ? 28.035  107.031 14.506  1.00 28.04 ? 229  ILE C O   1 
ATOM   6799 C CB  . ILE C 1 228 ? 26.100  104.858 13.824  1.00 30.45 ? 229  ILE C CB  1 
ATOM   6800 C CG1 . ILE C 1 228 ? 25.625  103.518 13.228  1.00 29.49 ? 229  ILE C CG1 1 
ATOM   6801 C CG2 . ILE C 1 228 ? 24.956  105.867 14.034  1.00 25.89 ? 229  ILE C CG2 1 
ATOM   6802 C CD1 . ILE C 1 228 ? 24.525  102.826 13.951  1.00 30.32 ? 229  ILE C CD1 1 
ATOM   6803 N N   . GLY C 1 229 ? 27.160  107.892 12.631  1.00 32.54 ? 230  GLY C N   1 
ATOM   6804 C CA  . GLY C 1 229 ? 27.445  109.246 13.087  1.00 33.15 ? 230  GLY C CA  1 
ATOM   6805 C C   . GLY C 1 229 ? 26.467  109.729 14.145  1.00 34.09 ? 230  GLY C C   1 
ATOM   6806 O O   . GLY C 1 229 ? 25.295  109.322 14.168  1.00 32.06 ? 230  GLY C O   1 
ATOM   6807 N N   . GLY C 1 230 ? 26.953  110.581 15.049  1.00 34.80 ? 231  GLY C N   1 
ATOM   6808 C CA  . GLY C 1 230 ? 26.097  111.133 16.085  1.00 35.76 ? 231  GLY C CA  1 
ATOM   6809 C C   . GLY C 1 230 ? 26.024  110.387 17.402  1.00 36.83 ? 231  GLY C C   1 
ATOM   6810 O O   . GLY C 1 230 ? 25.298  110.804 18.313  1.00 37.78 ? 231  GLY C O   1 
ATOM   6811 N N   . ILE C 1 231 ? 26.725  109.267 17.520  1.00 35.30 ? 232  ILE C N   1 
ATOM   6812 C CA  . ILE C 1 231 ? 26.691  108.532 18.791  1.00 32.26 ? 232  ILE C CA  1 
ATOM   6813 C C   . ILE C 1 231 ? 28.076  108.415 19.354  1.00 30.68 ? 232  ILE C C   1 
ATOM   6814 O O   . ILE C 1 231 ? 29.020  108.848 18.743  1.00 30.16 ? 232  ILE C O   1 
ATOM   6815 C CB  . ILE C 1 231 ? 26.170  107.075 18.650  1.00 32.42 ? 232  ILE C CB  1 
ATOM   6816 C CG1 . ILE C 1 231 ? 27.123  106.250 17.769  1.00 30.38 ? 232  ILE C CG1 1 
ATOM   6817 C CG2 . ILE C 1 231 ? 24.785  107.079 18.110  1.00 30.85 ? 232  ILE C CG2 1 
ATOM   6818 C CD1 . ILE C 1 231 ? 26.787  104.757 17.764  1.00 31.16 ? 232  ILE C CD1 1 
ATOM   6819 N N   . ASP C 1 232 ? 28.167  107.826 20.541  1.00 32.14 ? 233  ASP C N   1 
ATOM   6820 C CA  . ASP C 1 232 ? 29.433  107.557 21.183  1.00 31.87 ? 233  ASP C CA  1 
ATOM   6821 C C   . ASP C 1 232 ? 29.592  106.015 21.269  1.00 30.56 ? 233  ASP C C   1 
ATOM   6822 O O   . ASP C 1 232 ? 28.627  105.276 21.488  1.00 25.62 ? 233  ASP C O   1 
ATOM   6823 C CB  . ASP C 1 232 ? 29.477  108.149 22.585  1.00 36.60 ? 233  ASP C CB  1 
ATOM   6824 C CG  . ASP C 1 232 ? 30.890  108.153 23.148  1.00 46.33 ? 233  ASP C CG  1 
ATOM   6825 O OD1 . ASP C 1 232 ? 31.310  107.122 23.757  1.00 45.60 ? 233  ASP C OD1 1 
ATOM   6826 O OD2 . ASP C 1 232 ? 31.601  109.187 22.943  1.00 50.29 ? 233  ASP C OD2 1 
ATOM   6827 N N   . ALA C 1 233 ? 30.817  105.554 21.106  1.00 28.03 ? 234  ALA C N   1 
ATOM   6828 C CA  . ALA C 1 233 ? 31.103  104.132 21.154  1.00 30.91 ? 234  ALA C CA  1 
ATOM   6829 C C   . ALA C 1 233 ? 30.595  103.447 22.421  1.00 31.73 ? 234  ALA C C   1 
ATOM   6830 O O   . ALA C 1 233 ? 30.190  102.271 22.366  1.00 29.81 ? 234  ALA C O   1 
ATOM   6831 C CB  . ALA C 1 233 ? 32.623  103.910 20.992  1.00 31.95 ? 234  ALA C CB  1 
ATOM   6832 N N   . THR C 1 234 ? 30.616  104.165 23.551  1.00 29.16 ? 235  THR C N   1 
ATOM   6833 C CA  . THR C 1 234 ? 30.149  103.604 24.819  1.00 30.44 ? 235  THR C CA  1 
ATOM   6834 C C   . THR C 1 234 ? 28.619  103.621 24.957  1.00 29.68 ? 235  THR C C   1 
ATOM   6835 O O   . THR C 1 234 ? 28.094  103.088 25.922  1.00 29.10 ? 235  THR C O   1 
ATOM   6836 C CB  . THR C 1 234 ? 30.737  104.356 26.072  1.00 31.45 ? 235  THR C CB  1 
ATOM   6837 O OG1 . THR C 1 234 ? 30.365  105.738 26.007  1.00 32.59 ? 235  THR C OG1 1 
ATOM   6838 C CG2 . THR C 1 234 ? 32.272  104.227 26.148  1.00 29.65 ? 235  THR C CG2 1 
ATOM   6839 N N   . ASP C 1 235 ? 27.889  104.222 24.016  1.00 28.54 ? 236  ASP C N   1 
ATOM   6840 C CA  . ASP C 1 235 ? 26.417  104.216 24.145  1.00 28.42 ? 236  ASP C CA  1 
ATOM   6841 C C   . ASP C 1 235 ? 25.879  102.772 24.284  1.00 28.90 ? 236  ASP C C   1 
ATOM   6842 O O   . ASP C 1 235 ? 26.340  101.847 23.593  1.00 28.49 ? 236  ASP C O   1 
ATOM   6843 C CB  . ASP C 1 235 ? 25.716  104.871 22.929  1.00 28.78 ? 236  ASP C CB  1 
ATOM   6844 C CG  . ASP C 1 235 ? 25.937  106.379 22.862  1.00 31.77 ? 236  ASP C CG  1 
ATOM   6845 O OD1 . ASP C 1 235 ? 26.313  106.958 23.898  1.00 27.27 ? 236  ASP C OD1 1 
ATOM   6846 O OD2 . ASP C 1 235 ? 25.718  106.974 21.792  1.00 28.56 ? 236  ASP C OD2 1 
ATOM   6847 N N   . LYS C 1 236 ? 24.890  102.609 25.149  1.00 28.07 ? 237  LYS C N   1 
ATOM   6848 C CA  . LYS C 1 236 ? 24.257  101.325 25.393  1.00 29.06 ? 237  LYS C CA  1 
ATOM   6849 C C   . LYS C 1 236 ? 22.765  101.578 25.661  1.00 29.55 ? 237  LYS C C   1 
ATOM   6850 O O   . LYS C 1 236 ? 22.322  101.553 26.803  1.00 29.35 ? 237  LYS C O   1 
ATOM   6851 C CB  . LYS C 1 236 ? 24.901  100.658 26.610  1.00 29.42 ? 237  LYS C CB  1 
ATOM   6852 C CG  . LYS C 1 236 ? 24.711  99.164  26.632  1.00 28.14 ? 237  LYS C CG  1 
ATOM   6853 C CD  . LYS C 1 236 ? 25.205  98.557  27.906  1.00 29.76 ? 237  LYS C CD  1 
ATOM   6854 C CE  . LYS C 1 236 ? 24.903  97.085  27.842  1.00 30.71 ? 237  LYS C CE  1 
ATOM   6855 N NZ  . LYS C 1 236 ? 25.098  96.494  29.139  1.00 32.48 ? 237  LYS C NZ  1 
ATOM   6856 N N   . GLY C 1 237 ? 21.999  101.830 24.606  1.00 29.29 ? 238  GLY C N   1 
ATOM   6857 C CA  . GLY C 1 237 ? 20.584  102.114 24.793  1.00 31.37 ? 238  GLY C CA  1 
ATOM   6858 C C   . GLY C 1 237 ? 20.375  103.601 25.050  1.00 32.25 ? 238  GLY C C   1 
ATOM   6859 O O   . GLY C 1 237 ? 19.298  104.022 25.468  1.00 33.53 ? 238  GLY C O   1 
ATOM   6860 N N   . LYS C 1 238 ? 21.403  104.411 24.818  1.00 30.98 ? 239  LYS C N   1 
ATOM   6861 C CA  . LYS C 1 238 ? 21.254  105.838 25.042  1.00 30.56 ? 239  LYS C CA  1 
ATOM   6862 C C   . LYS C 1 238 ? 20.191  106.385 24.096  1.00 33.14 ? 239  LYS C C   1 
ATOM   6863 O O   . LYS C 1 238 ? 20.109  105.981 22.928  1.00 30.52 ? 239  LYS C O   1 
ATOM   6864 C CB  . LYS C 1 238 ? 22.555  106.602 24.762  1.00 29.78 ? 239  LYS C CB  1 
ATOM   6865 C CG  . LYS C 1 238 ? 22.323  108.105 24.922  1.00 33.70 ? 239  LYS C CG  1 
ATOM   6866 C CD  . LYS C 1 238 ? 23.608  108.885 24.844  1.00 37.27 ? 239  LYS C CD  1 
ATOM   6867 C CE  . LYS C 1 238 ? 23.362  110.364 25.125  1.00 35.49 ? 239  LYS C CE  1 
ATOM   6868 N NZ  . LYS C 1 238 ? 24.639  111.081 24.884  1.00 37.29 ? 239  LYS C NZ  1 
ATOM   6869 N N   . GLU C 1 239 ? 19.412  107.340 24.588  1.00 32.90 ? 240  GLU C N   1 
ATOM   6870 C CA  . GLU C 1 239 ? 18.368  107.929 23.781  1.00 35.47 ? 240  GLU C CA  1 
ATOM   6871 C C   . GLU C 1 239 ? 18.783  109.146 22.966  1.00 35.63 ? 240  GLU C C   1 
ATOM   6872 O O   . GLU C 1 239 ? 19.440  110.075 23.457  1.00 33.34 ? 240  GLU C O   1 
ATOM   6873 C CB  . GLU C 1 239 ? 17.168  108.293 24.652  1.00 38.47 ? 240  GLU C CB  1 
ATOM   6874 C CG  . GLU C 1 239 ? 16.427  107.088 25.210  1.00 47.65 ? 240  GLU C CG  1 
ATOM   6875 C CD  . GLU C 1 239 ? 15.485  107.457 26.357  1.00 52.33 ? 240  GLU C CD  1 
ATOM   6876 O OE1 . GLU C 1 239 ? 15.936  107.474 27.530  1.00 55.79 ? 240  GLU C OE1 1 
ATOM   6877 O OE2 . GLU C 1 239 ? 14.293  107.744 26.081  1.00 55.73 ? 240  GLU C OE2 1 
ATOM   6878 N N   . TYR C 1 240 ? 18.372  109.112 21.711  1.00 33.59 ? 241  TYR C N   1 
ATOM   6879 C CA  . TYR C 1 240 ? 18.590  110.186 20.761  1.00 36.54 ? 241  TYR C CA  1 
ATOM   6880 C C   . TYR C 1 240 ? 17.184  110.403 20.182  1.00 37.43 ? 241  TYR C C   1 
ATOM   6881 O O   . TYR C 1 240 ? 16.744  109.698 19.247  1.00 34.16 ? 241  TYR C O   1 
ATOM   6882 C CB  . TYR C 1 240 ? 19.590  109.770 19.669  1.00 34.46 ? 241  TYR C CB  1 
ATOM   6883 C CG  . TYR C 1 240 ? 21.004  109.677 20.191  1.00 35.80 ? 241  TYR C CG  1 
ATOM   6884 C CD1 . TYR C 1 240 ? 21.524  108.454 20.660  1.00 36.58 ? 241  TYR C CD1 1 
ATOM   6885 C CD2 . TYR C 1 240 ? 21.816  110.817 20.259  1.00 35.19 ? 241  TYR C CD2 1 
ATOM   6886 C CE1 . TYR C 1 240 ? 22.805  108.366 21.173  1.00 34.68 ? 241  TYR C CE1 1 
ATOM   6887 C CE2 . TYR C 1 240 ? 23.107  110.744 20.775  1.00 36.04 ? 241  TYR C CE2 1 
ATOM   6888 C CZ  . TYR C 1 240 ? 23.597  109.522 21.226  1.00 36.32 ? 241  TYR C CZ  1 
ATOM   6889 O OH  . TYR C 1 240 ? 24.872  109.462 21.701  1.00 32.44 ? 241  TYR C OH  1 
ATOM   6890 N N   . GLY C 1 241 ? 16.470  111.357 20.783  1.00 38.55 ? 242  GLY C N   1 
ATOM   6891 C CA  . GLY C 1 241 ? 15.112  111.636 20.353  1.00 40.12 ? 242  GLY C CA  1 
ATOM   6892 C C   . GLY C 1 241 ? 14.293  110.464 20.853  1.00 41.25 ? 242  GLY C C   1 
ATOM   6893 O O   . GLY C 1 241 ? 14.312  110.138 22.044  1.00 43.74 ? 242  GLY C O   1 
ATOM   6894 N N   . GLY C 1 242 ? 13.583  109.803 19.961  1.00 42.14 ? 243  GLY C N   1 
ATOM   6895 C CA  . GLY C 1 242 ? 12.831  108.645 20.412  1.00 41.99 ? 243  GLY C CA  1 
ATOM   6896 C C   . GLY C 1 242 ? 13.551  107.361 20.006  1.00 41.30 ? 243  GLY C C   1 
ATOM   6897 O O   . GLY C 1 242 ? 12.983  106.275 20.113  1.00 42.53 ? 243  GLY C O   1 
ATOM   6898 N N   . LYS C 1 243 ? 14.800  107.490 19.555  1.00 37.59 ? 244  LYS C N   1 
ATOM   6899 C CA  . LYS C 1 243 ? 15.587  106.353 19.100  1.00 35.59 ? 244  LYS C CA  1 
ATOM   6900 C C   . LYS C 1 243 ? 16.631  105.985 20.148  1.00 35.65 ? 244  LYS C C   1 
ATOM   6901 O O   . LYS C 1 243 ? 16.953  106.796 21.020  1.00 36.24 ? 244  LYS C O   1 
ATOM   6902 C CB  . LYS C 1 243 ? 16.264  106.707 17.767  1.00 35.47 ? 244  LYS C CB  1 
ATOM   6903 C CG  . LYS C 1 243 ? 15.307  107.364 16.736  1.00 34.48 ? 244  LYS C CG  1 
ATOM   6904 C CD  . LYS C 1 243 ? 15.893  107.327 15.334  1.00 33.00 ? 244  LYS C CD  1 
ATOM   6905 C CE  . LYS C 1 243 ? 15.062  108.141 14.314  1.00 29.65 ? 244  LYS C CE  1 
ATOM   6906 N NZ  . LYS C 1 243 ? 13.643  107.750 14.337  1.00 22.89 ? 244  LYS C NZ  1 
ATOM   6907 N N   . ARG C 1 244 ? 17.143  104.756 20.086  1.00 34.34 ? 245  ARG C N   1 
ATOM   6908 C CA  . ARG C 1 244 ? 18.162  104.305 21.047  1.00 32.73 ? 245  ARG C CA  1 
ATOM   6909 C C   . ARG C 1 244 ? 19.407  103.835 20.320  1.00 29.42 ? 245  ARG C C   1 
ATOM   6910 O O   . ARG C 1 244 ? 19.324  103.177 19.281  1.00 28.95 ? 245  ARG C O   1 
ATOM   6911 C CB  . ARG C 1 244 ? 17.636  103.162 21.902  1.00 36.64 ? 245  ARG C CB  1 
ATOM   6912 C CG  . ARG C 1 244 ? 16.411  103.514 22.729  1.00 41.25 ? 245  ARG C CG  1 
ATOM   6913 C CD  . ARG C 1 244 ? 16.256  102.524 23.858  1.00 47.84 ? 245  ARG C CD  1 
ATOM   6914 N NE  . ARG C 1 244 ? 15.062  101.692 23.723  1.00 53.43 ? 245  ARG C NE  1 
ATOM   6915 C CZ  . ARG C 1 244 ? 14.592  100.896 24.688  1.00 55.75 ? 245  ARG C CZ  1 
ATOM   6916 N NH1 . ARG C 1 244 ? 15.216  100.812 25.865  1.00 59.49 ? 245  ARG C NH1 1 
ATOM   6917 N NH2 . ARG C 1 244 ? 13.482  100.201 24.498  1.00 55.81 ? 245  ARG C NH2 1 
ATOM   6918 N N   . ALA C 1 245 ? 20.570  104.153 20.851  1.00 27.54 ? 246  ALA C N   1 
ATOM   6919 C CA  . ALA C 1 245 ? 21.795  103.729 20.174  1.00 24.74 ? 246  ALA C CA  1 
ATOM   6920 C C   . ALA C 1 245 ? 22.666  102.811 21.025  1.00 25.60 ? 246  ALA C C   1 
ATOM   6921 O O   . ALA C 1 245 ? 22.760  102.943 22.254  1.00 24.99 ? 246  ALA C O   1 
ATOM   6922 C CB  . ALA C 1 245 ? 22.624  104.952 19.735  1.00 24.00 ? 246  ALA C CB  1 
ATOM   6923 N N   . PHE C 1 246 ? 23.318  101.897 20.329  1.00 26.49 ? 247  PHE C N   1 
ATOM   6924 C CA  . PHE C 1 246 ? 24.235  100.945 20.934  1.00 25.95 ? 247  PHE C CA  1 
ATOM   6925 C C   . PHE C 1 246 ? 25.572  101.091 20.208  1.00 23.56 ? 247  PHE C C   1 
ATOM   6926 O O   . PHE C 1 246 ? 25.677  100.741 19.047  1.00 25.74 ? 247  PHE C O   1 
ATOM   6927 C CB  . PHE C 1 246 ? 23.700  99.514  20.775  1.00 25.12 ? 247  PHE C CB  1 
ATOM   6928 C CG  . PHE C 1 246 ? 22.575  99.189  21.734  1.00 25.62 ? 247  PHE C CG  1 
ATOM   6929 C CD1 . PHE C 1 246 ? 21.257  99.354  21.364  1.00 23.44 ? 247  PHE C CD1 1 
ATOM   6930 C CD2 . PHE C 1 246 ? 22.853  98.789  23.032  1.00 24.56 ? 247  PHE C CD2 1 
ATOM   6931 C CE1 . PHE C 1 246 ? 20.226  99.133  22.279  1.00 28.70 ? 247  PHE C CE1 1 
ATOM   6932 C CE2 . PHE C 1 246 ? 21.823  98.566  23.949  1.00 27.63 ? 247  PHE C CE2 1 
ATOM   6933 C CZ  . PHE C 1 246 ? 20.520  98.738  23.586  1.00 26.03 ? 247  PHE C CZ  1 
ATOM   6934 N N   . GLY C 1 247 ? 26.563  101.645 20.885  1.00 22.43 ? 248  GLY C N   1 
ATOM   6935 C CA  . GLY C 1 247 ? 27.892  101.822 20.311  1.00 21.62 ? 248  GLY C CA  1 
ATOM   6936 C C   . GLY C 1 247 ? 28.709  100.556 20.469  1.00 19.95 ? 248  GLY C C   1 
ATOM   6937 O O   . GLY C 1 247 ? 28.369  99.676  21.276  1.00 21.51 ? 248  GLY C O   1 
ATOM   6938 N N   . ALA C 1 248 ? 29.817  100.469 19.754  1.00 21.88 ? 249  ALA C N   1 
ATOM   6939 C CA  . ALA C 1 248 ? 30.649  99.267  19.774  1.00 21.43 ? 249  ALA C CA  1 
ATOM   6940 C C   . ALA C 1 248 ? 31.210  98.856  21.139  1.00 24.01 ? 249  ALA C C   1 
ATOM   6941 O O   . ALA C 1 248 ? 31.415  97.664  21.391  1.00 21.27 ? 249  ALA C O   1 
ATOM   6942 C CB  . ALA C 1 248 ? 31.770  99.411  18.789  1.00 21.25 ? 249  ALA C CB  1 
ATOM   6943 N N   . LEU C 1 249 ? 31.442  99.826  22.024  1.00 24.50 ? 250  LEU C N   1 
ATOM   6944 C CA  . LEU C 1 249 ? 31.997  99.500  23.321  1.00 22.79 ? 250  LEU C CA  1 
ATOM   6945 C C   . LEU C 1 249 ? 30.934  99.000  24.273  1.00 23.78 ? 250  LEU C C   1 
ATOM   6946 O O   . LEU C 1 249 ? 31.198  98.099  25.083  1.00 24.32 ? 250  LEU C O   1 
ATOM   6947 C CB  . LEU C 1 249 ? 32.779  100.707 23.893  1.00 26.47 ? 250  LEU C CB  1 
ATOM   6948 C CG  . LEU C 1 249 ? 34.046  101.028 23.082  1.00 29.92 ? 250  LEU C CG  1 
ATOM   6949 C CD1 . LEU C 1 249 ? 34.688  102.313 23.603  1.00 33.66 ? 250  LEU C CD1 1 
ATOM   6950 C CD2 . LEU C 1 249 ? 35.039  99.851  23.169  1.00 31.45 ? 250  LEU C CD2 1 
ATOM   6951 N N   . GLY C 1 250 ? 29.739  99.583  24.183  1.00 22.85 ? 251  GLY C N   1 
ATOM   6952 C CA  . GLY C 1 250 ? 28.625  99.121  24.991  1.00 24.99 ? 251  GLY C CA  1 
ATOM   6953 C C   . GLY C 1 250 ? 28.345  97.653  24.655  1.00 27.56 ? 251  GLY C C   1 
ATOM   6954 O O   . GLY C 1 250 ? 28.141  96.828  25.550  1.00 28.15 ? 251  GLY C O   1 
ATOM   6955 N N   . ILE C 1 251 ? 28.339  97.323  23.360  1.00 25.55 ? 252  ILE C N   1 
ATOM   6956 C CA  . ILE C 1 251 ? 28.110  95.947  22.902  1.00 21.50 ? 252  ILE C CA  1 
ATOM   6957 C C   . ILE C 1 251 ? 29.313  95.102  23.344  1.00 22.70 ? 252  ILE C C   1 
ATOM   6958 O O   . ILE C 1 251 ? 29.154  93.995  23.862  1.00 21.36 ? 252  ILE C O   1 
ATOM   6959 C CB  . ILE C 1 251 ? 27.965  95.915  21.341  1.00 21.60 ? 252  ILE C CB  1 
ATOM   6960 C CG1 . ILE C 1 251 ? 26.676  96.656  20.947  1.00 21.05 ? 252  ILE C CG1 1 
ATOM   6961 C CG2 . ILE C 1 251 ? 27.948  94.453  20.802  1.00 19.87 ? 252  ILE C CG2 1 
ATOM   6962 C CD1 . ILE C 1 251 ? 26.482  96.767  19.435  1.00 23.58 ? 252  ILE C CD1 1 
ATOM   6963 N N   . GLY C 1 252 ? 30.517  95.666  23.203  1.00 22.78 ? 253  GLY C N   1 
ATOM   6964 C CA  . GLY C 1 252 ? 31.730  94.946  23.570  1.00 23.62 ? 253  GLY C CA  1 
ATOM   6965 C C   . GLY C 1 252 ? 31.813  94.507  25.023  1.00 25.05 ? 253  GLY C C   1 
ATOM   6966 O O   . GLY C 1 252 ? 32.381  93.458  25.331  1.00 23.16 ? 253  GLY C O   1 
ATOM   6967 N N   . GLY C 1 253 ? 31.250  95.293  25.928  1.00 25.61 ? 254  GLY C N   1 
ATOM   6968 C CA  . GLY C 1 253 ? 31.280  94.909  27.338  1.00 25.12 ? 254  GLY C CA  1 
ATOM   6969 C C   . GLY C 1 253 ? 30.449  93.645  27.563  1.00 25.06 ? 254  GLY C C   1 
ATOM   6970 O O   . GLY C 1 253 ? 30.849  92.762  28.336  1.00 23.06 ? 254  GLY C O   1 
ATOM   6971 N N   . LEU C 1 254 ? 29.295  93.539  26.887  1.00 23.30 ? 255  LEU C N   1 
ATOM   6972 C CA  . LEU C 1 254 ? 28.462  92.346  27.047  1.00 22.62 ? 255  LEU C CA  1 
ATOM   6973 C C   . LEU C 1 254 ? 29.172  91.172  26.385  1.00 23.33 ? 255  LEU C C   1 
ATOM   6974 O O   . LEU C 1 254 ? 29.200  90.070  26.947  1.00 24.46 ? 255  LEU C O   1 
ATOM   6975 C CB  . LEU C 1 254 ? 27.064  92.530  26.432  1.00 20.23 ? 255  LEU C CB  1 
ATOM   6976 C CG  . LEU C 1 254 ? 26.216  91.239  26.364  1.00 21.54 ? 255  LEU C CG  1 
ATOM   6977 C CD1 . LEU C 1 254 ? 25.985  90.700  27.817  1.00 21.06 ? 255  LEU C CD1 1 
ATOM   6978 C CD2 . LEU C 1 254 ? 24.833  91.550  25.741  1.00 21.25 ? 255  LEU C CD2 1 
ATOM   6979 N N   . LYS C 1 255 ? 29.737  91.410  25.201  1.00 21.48 ? 256  LYS C N   1 
ATOM   6980 C CA  . LYS C 1 255 ? 30.457  90.360  24.473  1.00 22.31 ? 256  LYS C CA  1 
ATOM   6981 C C   . LYS C 1 255 ? 31.570  89.756  25.353  1.00 22.91 ? 256  LYS C C   1 
ATOM   6982 O O   . LYS C 1 255 ? 31.788  88.554  25.352  1.00 20.34 ? 256  LYS C O   1 
ATOM   6983 C CB  . LYS C 1 255 ? 31.067  90.899  23.164  1.00 20.71 ? 256  LYS C CB  1 
ATOM   6984 C CG  . LYS C 1 255 ? 32.073  89.941  22.470  1.00 18.85 ? 256  LYS C CG  1 
ATOM   6985 C CD  . LYS C 1 255 ? 33.477  90.189  22.979  1.00 22.87 ? 256  LYS C CD  1 
ATOM   6986 C CE  . LYS C 1 255 ? 34.561  89.493  22.150  1.00 28.24 ? 256  LYS C CE  1 
ATOM   6987 N NZ  . LYS C 1 255 ? 34.436  87.995  22.091  1.00 27.08 ? 256  LYS C NZ  1 
ATOM   6988 N N   . LEU C 1 256 ? 32.276  90.594  26.098  1.00 23.27 ? 257  LEU C N   1 
ATOM   6989 C CA  . LEU C 1 256 ? 33.346  90.060  26.939  1.00 23.41 ? 257  LEU C CA  1 
ATOM   6990 C C   . LEU C 1 256 ? 32.779  89.177  28.045  1.00 20.85 ? 257  LEU C C   1 
ATOM   6991 O O   . LEU C 1 256 ? 33.301  88.077  28.288  1.00 22.58 ? 257  LEU C O   1 
ATOM   6992 C CB  . LEU C 1 256 ? 34.185  91.217  27.497  1.00 22.70 ? 257  LEU C CB  1 
ATOM   6993 C CG  . LEU C 1 256 ? 35.602  90.926  27.984  1.00 29.93 ? 257  LEU C CG  1 
ATOM   6994 C CD1 . LEU C 1 256 ? 36.387  90.096  26.940  1.00 29.14 ? 257  LEU C CD1 1 
ATOM   6995 C CD2 . LEU C 1 256 ? 36.306  92.276  28.237  1.00 29.63 ? 257  LEU C CD2 1 
ATOM   6996 N N   . LYS C 1 257 ? 31.714  89.619  28.715  1.00 21.09 ? 258  LYS C N   1 
ATOM   6997 C CA  . LYS C 1 257 ? 31.099  88.817  29.775  1.00 21.26 ? 258  LYS C CA  1 
ATOM   6998 C C   . LYS C 1 257 ? 30.498  87.538  29.190  1.00 22.70 ? 258  LYS C C   1 
ATOM   6999 O O   . LYS C 1 257 ? 30.515  86.457  29.812  1.00 18.17 ? 258  LYS C O   1 
ATOM   7000 C CB  . LYS C 1 257 ? 29.996  89.600  30.494  1.00 22.07 ? 258  LYS C CB  1 
ATOM   7001 C CG  . LYS C 1 257 ? 30.492  90.767  31.395  1.00 23.73 ? 258  LYS C CG  1 
ATOM   7002 C CD  . LYS C 1 257 ? 29.267  91.641  31.793  1.00 28.07 ? 258  LYS C CD  1 
ATOM   7003 C CE  . LYS C 1 257 ? 29.665  92.933  32.518  1.00 33.79 ? 258  LYS C CE  1 
ATOM   7004 N NZ  . LYS C 1 257 ? 30.152  92.591  33.868  1.00 38.85 ? 258  LYS C NZ  1 
ATOM   7005 N N   . LEU C 1 258 ? 29.961  87.669  27.972  1.00 19.31 ? 259  LEU C N   1 
ATOM   7006 C CA  . LEU C 1 258 ? 29.360  86.529  27.304  1.00 16.42 ? 259  LEU C CA  1 
ATOM   7007 C C   . LEU C 1 258 ? 30.434  85.506  26.884  1.00 15.50 ? 259  LEU C C   1 
ATOM   7008 O O   . LEU C 1 258 ? 30.258  84.290  27.078  1.00 17.40 ? 259  LEU C O   1 
ATOM   7009 C CB  . LEU C 1 258 ? 28.612  87.009  26.048  1.00 15.79 ? 259  LEU C CB  1 
ATOM   7010 C CG  . LEU C 1 258 ? 28.205  85.884  25.098  1.00 15.72 ? 259  LEU C CG  1 
ATOM   7011 C CD1 . LEU C 1 258 ? 27.008  85.117  25.722  1.00 15.57 ? 259  LEU C CD1 1 
ATOM   7012 C CD2 . LEU C 1 258 ? 27.746  86.513  23.743  1.00 20.73 ? 259  LEU C CD2 1 
ATOM   7013 N N   . HIS C 1 259 ? 31.539  85.979  26.307  1.00 12.46 ? 260  HIS C N   1 
ATOM   7014 C CA  . HIS C 1 259 ? 32.586  85.048  25.847  1.00 15.92 ? 260  HIS C CA  1 
ATOM   7015 C C   . HIS C 1 259 ? 33.076  84.255  27.083  1.00 18.11 ? 260  HIS C C   1 
ATOM   7016 O O   . HIS C 1 259 ? 33.144  82.984  27.084  1.00 17.73 ? 260  HIS C O   1 
ATOM   7017 C CB  . HIS C 1 259 ? 33.681  85.886  25.173  1.00 14.50 ? 260  HIS C CB  1 
ATOM   7018 C CG  . HIS C 1 259 ? 34.745  85.112  24.462  1.00 18.89 ? 260  HIS C CG  1 
ATOM   7019 N ND1 . HIS C 1 259 ? 35.650  85.727  23.606  1.00 19.29 ? 260  HIS C ND1 1 
ATOM   7020 C CD2 . HIS C 1 259 ? 35.154  83.826  24.574  1.00 19.56 ? 260  HIS C CD2 1 
ATOM   7021 C CE1 . HIS C 1 259 ? 36.567  84.854  23.232  1.00 18.68 ? 260  HIS C CE1 1 
ATOM   7022 N NE2 . HIS C 1 259 ? 36.294  83.693  23.808  1.00 21.81 ? 260  HIS C NE2 1 
ATOM   7023 N N   . ARG C 1 260 ? 33.381  84.990  28.156  1.00 15.17 ? 261  ARG C N   1 
ATOM   7024 C CA  . ARG C 1 260 ? 33.791  84.299  29.391  1.00 17.64 ? 261  ARG C CA  1 
ATOM   7025 C C   . ARG C 1 260 ? 32.793  83.226  29.835  1.00 16.57 ? 261  ARG C C   1 
ATOM   7026 O O   . ARG C 1 260 ? 33.178  82.077  30.124  1.00 19.00 ? 261  ARG C O   1 
ATOM   7027 C CB  . ARG C 1 260 ? 33.903  85.286  30.529  1.00 18.77 ? 261  ARG C CB  1 
ATOM   7028 C CG  . ARG C 1 260 ? 35.058  86.239  30.363  1.00 20.73 ? 261  ARG C CG  1 
ATOM   7029 C CD  . ARG C 1 260 ? 35.051  87.212  31.515  1.00 22.95 ? 261  ARG C CD  1 
ATOM   7030 N NE  . ARG C 1 260 ? 36.126  88.179  31.364  1.00 25.71 ? 261  ARG C NE  1 
ATOM   7031 C CZ  . ARG C 1 260 ? 36.076  89.409  31.864  1.00 35.58 ? 261  ARG C CZ  1 
ATOM   7032 N NH1 . ARG C 1 260 ? 34.997  89.802  32.544  1.00 35.09 ? 261  ARG C NH1 1 
ATOM   7033 N NH2 . ARG C 1 260 ? 37.084  90.255  31.669  1.00 37.09 ? 261  ARG C NH2 1 
ATOM   7034 N N   . ALA C 1 261 ? 31.531  83.624  29.961  1.00 19.04 ? 262  ALA C N   1 
ATOM   7035 C CA  . ALA C 1 261 ? 30.486  82.707  30.382  1.00 16.36 ? 262  ALA C CA  1 
ATOM   7036 C C   . ALA C 1 261 ? 30.380  81.490  29.489  1.00 18.88 ? 262  ALA C C   1 
ATOM   7037 O O   . ALA C 1 261 ? 30.097  80.393  29.987  1.00 21.34 ? 262  ALA C O   1 
ATOM   7038 C CB  . ALA C 1 261 ? 29.158  83.418  30.423  1.00 19.66 ? 262  ALA C CB  1 
ATOM   7039 N N   . CYS C 1 262 ? 30.569  81.658  28.178  1.00 17.88 ? 263  CYS C N   1 
ATOM   7040 C CA  . CYS C 1 262 ? 30.498  80.505  27.286  1.00 18.88 ? 263  CYS C CA  1 
ATOM   7041 C C   . CYS C 1 262 ? 31.578  79.477  27.593  1.00 21.48 ? 263  CYS C C   1 
ATOM   7042 O O   . CYS C 1 262 ? 31.313  78.269  27.583  1.00 19.68 ? 263  CYS C O   1 
ATOM   7043 C CB  . CYS C 1 262 ? 30.652  80.892  25.804  1.00 18.77 ? 263  CYS C CB  1 
ATOM   7044 S SG  . CYS C 1 262 ? 29.268  81.856  25.108  1.00 23.87 ? 263  CYS C SG  1 
ATOM   7045 N N   . ILE C 1 263 ? 32.805  79.946  27.805  1.00 20.67 ? 264  ILE C N   1 
ATOM   7046 C CA  . ILE C 1 263 ? 33.898  79.033  28.098  1.00 21.05 ? 264  ILE C CA  1 
ATOM   7047 C C   . ILE C 1 263 ? 33.488  78.228  29.347  1.00 21.72 ? 264  ILE C C   1 
ATOM   7048 O O   . ILE C 1 263 ? 33.657  77.026  29.393  1.00 19.15 ? 264  ILE C O   1 
ATOM   7049 C CB  . ILE C 1 263 ? 35.203  79.813  28.434  1.00 20.57 ? 264  ILE C CB  1 
ATOM   7050 C CG1 . ILE C 1 263 ? 35.738  80.562  27.210  1.00 17.92 ? 264  ILE C CG1 1 
ATOM   7051 C CG2 . ILE C 1 263 ? 36.201  78.893  29.050  1.00 20.53 ? 264  ILE C CG2 1 
ATOM   7052 C CD1 . ILE C 1 263 ? 36.146  79.666  26.034  1.00 19.73 ? 264  ILE C CD1 1 
ATOM   7053 N N   . ALA C 1 264 ? 32.957  78.903  30.360  1.00 20.94 ? 265  ALA C N   1 
ATOM   7054 C CA  . ALA C 1 264 ? 32.570  78.187  31.571  1.00 24.09 ? 265  ALA C CA  1 
ATOM   7055 C C   . ALA C 1 264 ? 31.532  77.112  31.257  1.00 24.80 ? 265  ALA C C   1 
ATOM   7056 O O   . ALA C 1 264 ? 31.572  76.015  31.815  1.00 26.43 ? 265  ALA C O   1 
ATOM   7057 C CB  . ALA C 1 264 ? 32.035  79.152  32.633  1.00 23.65 ? 265  ALA C CB  1 
ATOM   7058 N N   . LYS C 1 265 ? 30.623  77.407  30.343  1.00 22.88 ? 266  LYS C N   1 
ATOM   7059 C CA  . LYS C 1 265 ? 29.584  76.427  29.963  1.00 22.76 ? 266  LYS C CA  1 
ATOM   7060 C C   . LYS C 1 265 ? 30.142  75.177  29.301  1.00 19.32 ? 266  LYS C C   1 
ATOM   7061 O O   . LYS C 1 265 ? 29.537  74.119  29.386  1.00 18.22 ? 266  LYS C O   1 
ATOM   7062 C CB  . LYS C 1 265 ? 28.577  77.076  29.012  1.00 24.78 ? 266  LYS C CB  1 
ATOM   7063 C CG  . LYS C 1 265 ? 27.697  78.131  29.671  1.00 32.91 ? 266  LYS C CG  1 
ATOM   7064 C CD  . LYS C 1 265 ? 26.569  77.507  30.507  1.00 37.44 ? 266  LYS C CD  1 
ATOM   7065 C CE  . LYS C 1 265 ? 25.803  78.556  31.327  1.00 40.91 ? 266  LYS C CE  1 
ATOM   7066 N NZ  . LYS C 1 265 ? 24.733  77.890  32.153  1.00 42.09 ? 266  LYS C NZ  1 
ATOM   7067 N N   . LEU C 1 266 ? 31.290  75.302  28.636  1.00 16.95 ? 267  LEU C N   1 
ATOM   7068 C CA  . LEU C 1 266 ? 31.912  74.162  27.945  1.00 16.81 ? 267  LEU C CA  1 
ATOM   7069 C C   . LEU C 1 266 ? 32.259  73.037  28.904  1.00 19.54 ? 267  LEU C C   1 
ATOM   7070 O O   . LEU C 1 266 ? 32.333  71.882  28.510  1.00 19.21 ? 267  LEU C O   1 
ATOM   7071 C CB  . LEU C 1 266 ? 33.198  74.583  27.220  1.00 16.00 ? 267  LEU C CB  1 
ATOM   7072 C CG  . LEU C 1 266 ? 33.039  75.641  26.116  1.00 19.59 ? 267  LEU C CG  1 
ATOM   7073 C CD1 . LEU C 1 266 ? 34.405  76.090  25.571  1.00 17.29 ? 267  LEU C CD1 1 
ATOM   7074 C CD2 . LEU C 1 266 ? 32.159  75.018  24.973  1.00 20.47 ? 267  LEU C CD2 1 
ATOM   7075 N N   . PHE C 1 267 ? 32.508  73.395  30.155  1.00 19.76 ? 268  PHE C N   1 
ATOM   7076 C CA  . PHE C 1 267 ? 32.892  72.406  31.128  1.00 21.63 ? 268  PHE C CA  1 
ATOM   7077 C C   . PHE C 1 267 ? 31.769  71.848  31.998  1.00 24.41 ? 268  PHE C C   1 
ATOM   7078 O O   . PHE C 1 267 ? 32.042  71.050  32.909  1.00 22.56 ? 268  PHE C O   1 
ATOM   7079 C CB  . PHE C 1 267 ? 34.021  72.977  32.001  1.00 19.25 ? 268  PHE C CB  1 
ATOM   7080 C CG  . PHE C 1 267 ? 35.275  73.351  31.207  1.00 20.36 ? 268  PHE C CG  1 
ATOM   7081 C CD1 . PHE C 1 267 ? 35.632  74.680  31.023  1.00 20.67 ? 268  PHE C CD1 1 
ATOM   7082 C CD2 . PHE C 1 267 ? 36.069  72.379  30.651  1.00 17.14 ? 268  PHE C CD2 1 
ATOM   7083 C CE1 . PHE C 1 267 ? 36.789  75.016  30.280  1.00 19.27 ? 268  PHE C CE1 1 
ATOM   7084 C CE2 . PHE C 1 267 ? 37.224  72.685  29.917  1.00 16.21 ? 268  PHE C CE2 1 
ATOM   7085 C CZ  . PHE C 1 267 ? 37.590  74.016  29.728  1.00 18.81 ? 268  PHE C CZ  1 
ATOM   7086 N N   . GLU C 1 268 ? 30.524  72.240  31.716  1.00 23.98 ? 269  GLU C N   1 
ATOM   7087 C CA  . GLU C 1 268 ? 29.385  71.742  32.490  1.00 25.34 ? 269  GLU C CA  1 
ATOM   7088 C C   . GLU C 1 268 ? 28.746  70.533  31.851  1.00 26.77 ? 269  GLU C C   1 
ATOM   7089 O O   . GLU C 1 268 ? 27.794  69.977  32.408  1.00 25.43 ? 269  GLU C O   1 
ATOM   7090 C CB  . GLU C 1 268 ? 28.341  72.844  32.676  1.00 26.06 ? 269  GLU C CB  1 
ATOM   7091 C CG  . GLU C 1 268 ? 28.956  74.055  33.377  1.00 33.94 ? 269  GLU C CG  1 
ATOM   7092 C CD  . GLU C 1 268 ? 28.000  75.230  33.572  1.00 39.81 ? 269  GLU C CD  1 
ATOM   7093 O OE1 . GLU C 1 268 ? 26.909  75.259  32.954  1.00 39.77 ? 269  GLU C OE1 1 
ATOM   7094 O OE2 . GLU C 1 268 ? 28.368  76.142  34.350  1.00 43.85 ? 269  GLU C OE2 1 
ATOM   7095 N N   . SER C 1 269 ? 29.243  70.139  30.675  1.00 26.74 ? 270  SER C N   1 
ATOM   7096 C CA  . SER C 1 269 ? 28.741  68.958  29.977  1.00 23.78 ? 270  SER C CA  1 
ATOM   7097 C C   . SER C 1 269 ? 29.754  68.585  28.910  1.00 21.68 ? 270  SER C C   1 
ATOM   7098 O O   . SER C 1 269 ? 30.652  69.382  28.598  1.00 21.85 ? 270  SER C O   1 
ATOM   7099 C CB  . SER C 1 269 ? 27.376  69.220  29.339  1.00 28.84 ? 270  SER C CB  1 
ATOM   7100 O OG  . SER C 1 269 ? 27.486  69.663  28.001  1.00 30.45 ? 270  SER C OG  1 
ATOM   7101 N N   . SER C 1 270 ? 29.632  67.398  28.330  1.00 17.91 ? 271  SER C N   1 
ATOM   7102 C CA  . SER C 1 270 ? 30.605  67.012  27.312  1.00 23.81 ? 271  SER C CA  1 
ATOM   7103 C C   . SER C 1 270 ? 29.947  66.967  25.939  1.00 24.30 ? 271  SER C C   1 
ATOM   7104 O O   . SER C 1 270 ? 30.474  66.357  25.009  1.00 23.11 ? 271  SER C O   1 
ATOM   7105 C CB  . SER C 1 270 ? 31.239  65.636  27.641  1.00 22.87 ? 271  SER C CB  1 
ATOM   7106 O OG  . SER C 1 270 ? 30.249  64.640  27.845  1.00 25.14 ? 271  SER C OG  1 
ATOM   7107 N N   . GLU C 1 271 ? 28.798  67.619  25.817  1.00 24.64 ? 272  GLU C N   1 
ATOM   7108 C CA  . GLU C 1 271 ? 28.089  67.585  24.535  1.00 28.94 ? 272  GLU C CA  1 
ATOM   7109 C C   . GLU C 1 271 ? 27.658  68.948  24.025  1.00 30.11 ? 272  GLU C C   1 
ATOM   7110 O O   . GLU C 1 271 ? 26.858  69.029  23.090  1.00 30.07 ? 272  GLU C O   1 
ATOM   7111 C CB  . GLU C 1 271 ? 26.830  66.725  24.668  1.00 33.74 ? 272  GLU C CB  1 
ATOM   7112 C CG  . GLU C 1 271 ? 27.017  65.495  25.535  1.00 39.03 ? 272  GLU C CG  1 
ATOM   7113 C CD  . GLU C 1 271 ? 25.801  64.581  25.492  1.00 42.79 ? 272  GLU C CD  1 
ATOM   7114 O OE1 . GLU C 1 271 ? 24.660  65.104  25.527  1.00 43.62 ? 272  GLU C OE1 1 
ATOM   7115 O OE2 . GLU C 1 271 ? 25.999  63.351  25.423  1.00 42.59 ? 272  GLU C OE2 1 
ATOM   7116 N N   . GLY C 1 272 ? 28.158  70.014  24.646  1.00 27.96 ? 273  GLY C N   1 
ATOM   7117 C CA  . GLY C 1 272 ? 27.777  71.339  24.198  1.00 25.30 ? 273  GLY C CA  1 
ATOM   7118 C C   . GLY C 1 272 ? 28.402  71.685  22.865  1.00 22.42 ? 273  GLY C C   1 
ATOM   7119 O O   . GLY C 1 272 ? 29.510  71.277  22.589  1.00 20.95 ? 273  GLY C O   1 
ATOM   7120 N N   . VAL C 1 273 ? 27.671  72.430  22.039  1.00 21.52 ? 274  VAL C N   1 
ATOM   7121 C CA  . VAL C 1 273 ? 28.153  72.895  20.761  1.00 20.36 ? 274  VAL C CA  1 
ATOM   7122 C C   . VAL C 1 273 ? 27.755  74.376  20.747  1.00 21.86 ? 274  VAL C C   1 
ATOM   7123 O O   . VAL C 1 273 ? 26.556  74.735  20.580  1.00 22.74 ? 274  VAL C O   1 
ATOM   7124 C CB  . VAL C 1 273 ? 27.466  72.164  19.598  1.00 24.92 ? 274  VAL C CB  1 
ATOM   7125 C CG1 . VAL C 1 273 ? 28.003  72.701  18.288  1.00 21.22 ? 274  VAL C CG1 1 
ATOM   7126 C CG2 . VAL C 1 273 ? 27.706  70.638  19.722  1.00 22.48 ? 274  VAL C CG2 1 
ATOM   7127 N N   . PHE C 1 274 ? 28.745  75.228  20.981  1.00 18.21 ? 275  PHE C N   1 
ATOM   7128 C CA  . PHE C 1 274 ? 28.505  76.665  21.030  1.00 18.83 ? 275  PHE C CA  1 
ATOM   7129 C C   . PHE C 1 274 ? 28.917  77.391  19.767  1.00 19.49 ? 275  PHE C C   1 
ATOM   7130 O O   . PHE C 1 274 ? 30.070  77.807  19.592  1.00 18.19 ? 275  PHE C O   1 
ATOM   7131 C CB  . PHE C 1 274 ? 29.222  77.268  22.256  1.00 22.79 ? 275  PHE C CB  1 
ATOM   7132 C CG  . PHE C 1 274 ? 28.511  76.994  23.553  1.00 27.35 ? 275  PHE C CG  1 
ATOM   7133 C CD1 . PHE C 1 274 ? 28.495  75.712  24.096  1.00 30.11 ? 275  PHE C CD1 1 
ATOM   7134 C CD2 . PHE C 1 274 ? 27.794  78.014  24.211  1.00 30.51 ? 275  PHE C CD2 1 
ATOM   7135 C CE1 . PHE C 1 274 ? 27.781  75.429  25.277  1.00 29.03 ? 275  PHE C CE1 1 
ATOM   7136 C CE2 . PHE C 1 274 ? 27.063  77.745  25.405  1.00 27.67 ? 275  PHE C CE2 1 
ATOM   7137 C CZ  . PHE C 1 274 ? 27.061  76.449  25.935  1.00 26.79 ? 275  PHE C CZ  1 
ATOM   7138 N N   . ASP C 1 275 ? 27.964  77.482  18.852  1.00 18.91 ? 276  ASP C N   1 
ATOM   7139 C CA  . ASP C 1 275 ? 28.148  78.226  17.626  1.00 18.41 ? 276  ASP C CA  1 
ATOM   7140 C C   . ASP C 1 275 ? 27.127  79.375  17.816  1.00 19.12 ? 276  ASP C C   1 
ATOM   7141 O O   . ASP C 1 275 ? 26.656  79.618  18.926  1.00 19.87 ? 276  ASP C O   1 
ATOM   7142 C CB  . ASP C 1 275 ? 27.784  77.390  16.415  1.00 18.10 ? 276  ASP C CB  1 
ATOM   7143 C CG  . ASP C 1 275 ? 28.345  77.965  15.072  1.00 22.27 ? 276  ASP C CG  1 
ATOM   7144 O OD1 . ASP C 1 275 ? 28.730  79.167  14.951  1.00 20.44 ? 276  ASP C OD1 1 
ATOM   7145 O OD2 . ASP C 1 275 ? 28.392  77.164  14.121  1.00 25.84 ? 276  ASP C OD2 1 
ATOM   7146 N N   . ALA C 1 276 ? 26.762  80.042  16.727  1.00 21.59 ? 277  ALA C N   1 
ATOM   7147 C CA  . ALA C 1 276 ? 25.863  81.177  16.816  1.00 20.65 ? 277  ALA C CA  1 
ATOM   7148 C C   . ALA C 1 276 ? 24.609  81.008  17.669  1.00 21.63 ? 277  ALA C C   1 
ATOM   7149 O O   . ALA C 1 276 ? 24.369  81.778  18.599  1.00 20.27 ? 277  ALA C O   1 
ATOM   7150 C CB  . ALA C 1 276 ? 25.461  81.618  15.429  1.00 22.18 ? 277  ALA C CB  1 
ATOM   7151 N N   . GLU C 1 277 ? 23.815  79.999  17.381  1.00 20.54 ? 278  GLU C N   1 
ATOM   7152 C CA  . GLU C 1 277 ? 22.556  79.850  18.102  1.00 22.24 ? 278  GLU C CA  1 
ATOM   7153 C C   . GLU C 1 277 ? 22.677  79.702  19.629  1.00 23.78 ? 278  GLU C C   1 
ATOM   7154 O O   . GLU C 1 277 ? 21.950  80.375  20.373  1.00 20.44 ? 278  GLU C O   1 
ATOM   7155 C CB  . GLU C 1 277 ? 21.802  78.647  17.561  1.00 25.31 ? 278  GLU C CB  1 
ATOM   7156 C CG  . GLU C 1 277 ? 21.598  78.671  16.018  1.00 28.72 ? 278  GLU C CG  1 
ATOM   7157 C CD  . GLU C 1 277 ? 22.658  77.870  15.238  1.00 31.17 ? 278  GLU C CD  1 
ATOM   7158 O OE1 . GLU C 1 277 ? 22.254  77.304  14.206  1.00 29.89 ? 278  GLU C OE1 1 
ATOM   7159 O OE2 . GLU C 1 277 ? 23.871  77.817  15.614  1.00 26.35 ? 278  GLU C OE2 1 
ATOM   7160 N N   . GLU C 1 278 ? 23.543  78.792  20.075  1.00 20.73 ? 279  GLU C N   1 
ATOM   7161 C CA  . GLU C 1 278 ? 23.688  78.550  21.506  1.00 24.34 ? 279  GLU C CA  1 
ATOM   7162 C C   . GLU C 1 278 ? 24.290  79.759  22.207  1.00 23.67 ? 279  GLU C C   1 
ATOM   7163 O O   . GLU C 1 278 ? 23.912  80.088  23.341  1.00 24.37 ? 279  GLU C O   1 
ATOM   7164 C CB  . GLU C 1 278 ? 24.547  77.304  21.772  1.00 25.88 ? 279  GLU C CB  1 
ATOM   7165 C CG  . GLU C 1 278 ? 23.786  75.979  21.696  1.00 31.98 ? 279  GLU C CG  1 
ATOM   7166 C CD  . GLU C 1 278 ? 22.525  75.974  22.553  1.00 35.88 ? 279  GLU C CD  1 
ATOM   7167 O OE1 . GLU C 1 278 ? 21.455  75.634  22.004  1.00 39.15 ? 279  GLU C OE1 1 
ATOM   7168 O OE2 . GLU C 1 278 ? 22.592  76.313  23.756  1.00 36.16 ? 279  GLU C OE2 1 
ATOM   7169 N N   . ILE C 1 279 ? 25.247  80.404  21.550  1.00 22.15 ? 280  ILE C N   1 
ATOM   7170 C CA  . ILE C 1 279 ? 25.885  81.590  22.131  1.00 19.39 ? 280  ILE C CA  1 
ATOM   7171 C C   . ILE C 1 279 ? 24.822  82.681  22.268  1.00 19.64 ? 280  ILE C C   1 
ATOM   7172 O O   . ILE C 1 279 ? 24.729  83.382  23.291  1.00 18.77 ? 280  ILE C O   1 
ATOM   7173 C CB  . ILE C 1 279 ? 27.056  82.014  21.233  1.00 15.23 ? 280  ILE C CB  1 
ATOM   7174 C CG1 . ILE C 1 279 ? 28.146  80.957  21.361  1.00 15.55 ? 280  ILE C CG1 1 
ATOM   7175 C CG2 . ILE C 1 279 ? 27.592  83.412  21.565  1.00 16.39 ? 280  ILE C CG2 1 
ATOM   7176 C CD1 . ILE C 1 279 ? 29.316  81.164  20.400  1.00 13.73 ? 280  ILE C CD1 1 
ATOM   7177 N N   . TYR C 1 280 ? 24.000  82.819  21.242  1.00 17.93 ? 281  TYR C N   1 
ATOM   7178 C CA  . TYR C 1 280 ? 22.932  83.814  21.282  1.00 19.30 ? 281  TYR C CA  1 
ATOM   7179 C C   . TYR C 1 280 ? 21.932  83.537  22.388  1.00 19.74 ? 281  TYR C C   1 
ATOM   7180 O O   . TYR C 1 280 ? 21.435  84.472  23.019  1.00 19.21 ? 281  TYR C O   1 
ATOM   7181 C CB  . TYR C 1 280 ? 22.165  83.855  19.949  1.00 19.80 ? 281  TYR C CB  1 
ATOM   7182 C CG  . TYR C 1 280 ? 21.094  84.945  19.907  1.00 19.39 ? 281  TYR C CG  1 
ATOM   7183 C CD1 . TYR C 1 280 ? 21.419  86.275  20.168  1.00 17.18 ? 281  TYR C CD1 1 
ATOM   7184 C CD2 . TYR C 1 280 ? 19.772  84.633  19.628  1.00 21.10 ? 281  TYR C CD2 1 
ATOM   7185 C CE1 . TYR C 1 280 ? 20.438  87.266  20.160  1.00 19.46 ? 281  TYR C CE1 1 
ATOM   7186 C CE2 . TYR C 1 280 ? 18.787  85.598  19.623  1.00 23.58 ? 281  TYR C CE2 1 
ATOM   7187 C CZ  . TYR C 1 280 ? 19.128  86.919  19.897  1.00 21.58 ? 281  TYR C CZ  1 
ATOM   7188 O OH  . TYR C 1 280 ? 18.128  87.856  19.938  1.00 24.87 ? 281  TYR C OH  1 
ATOM   7189 N N   . LYS C 1 281 ? 21.617  82.263  22.618  1.00 18.84 ? 282  LYS C N   1 
ATOM   7190 C CA  . LYS C 1 281 ? 20.643  81.958  23.664  1.00 22.55 ? 282  LYS C CA  1 
ATOM   7191 C C   . LYS C 1 281 ? 21.214  82.439  25.000  1.00 21.16 ? 282  LYS C C   1 
ATOM   7192 O O   . LYS C 1 281 ? 20.491  83.010  25.811  1.00 22.69 ? 282  LYS C O   1 
ATOM   7193 C CB  . LYS C 1 281 ? 20.337  80.452  23.722  1.00 25.45 ? 282  LYS C CB  1 
ATOM   7194 C CG  . LYS C 1 281 ? 19.413  79.971  22.597  1.00 32.46 ? 282  LYS C CG  1 
ATOM   7195 C CD  . LYS C 1 281 ? 19.147  78.431  22.678  1.00 37.19 ? 282  LYS C CD  1 
ATOM   7196 C CE  . LYS C 1 281 ? 18.106  77.960  21.620  1.00 37.69 ? 282  LYS C CE  1 
ATOM   7197 N NZ  . LYS C 1 281 ? 18.436  78.278  20.177  1.00 37.08 ? 282  LYS C NZ  1 
ATOM   7198 N N   . LEU C 1 282 ? 22.507  82.223  25.206  1.00 20.72 ? 283  LEU C N   1 
ATOM   7199 C CA  . LEU C 1 282 ? 23.136  82.664  26.451  1.00 19.56 ? 283  LEU C CA  1 
ATOM   7200 C C   . LEU C 1 282 ? 23.188  84.187  26.504  1.00 21.58 ? 283  LEU C C   1 
ATOM   7201 O O   . LEU C 1 282 ? 22.967  84.763  27.564  1.00 21.45 ? 283  LEU C O   1 
ATOM   7202 C CB  . LEU C 1 282 ? 24.548  82.064  26.610  1.00 18.08 ? 283  LEU C CB  1 
ATOM   7203 C CG  . LEU C 1 282 ? 25.352  82.398  27.890  1.00 21.51 ? 283  LEU C CG  1 
ATOM   7204 C CD1 . LEU C 1 282 ? 24.525  82.107  29.151  1.00 24.31 ? 283  LEU C CD1 1 
ATOM   7205 C CD2 . LEU C 1 282 ? 26.678  81.571  27.906  1.00 18.43 ? 283  LEU C CD2 1 
ATOM   7206 N N   . ALA C 1 283 ? 23.440  84.828  25.363  1.00 21.58 ? 284  ALA C N   1 
ATOM   7207 C CA  . ALA C 1 283 ? 23.507  86.297  25.289  1.00 20.64 ? 284  ALA C CA  1 
ATOM   7208 C C   . ALA C 1 283 ? 22.153  86.897  25.735  1.00 21.11 ? 284  ALA C C   1 
ATOM   7209 O O   . ALA C 1 283 ? 22.124  87.906  26.442  1.00 23.84 ? 284  ALA C O   1 
ATOM   7210 C CB  . ALA C 1 283 ? 23.822  86.734  23.881  1.00 17.22 ? 284  ALA C CB  1 
ATOM   7211 N N   . LYS C 1 284 ? 21.038  86.291  25.329  1.00 19.07 ? 285  LYS C N   1 
ATOM   7212 C CA  . LYS C 1 284 ? 19.740  86.801  25.771  1.00 21.64 ? 285  LYS C CA  1 
ATOM   7213 C C   . LYS C 1 284 ? 19.553  86.619  27.297  1.00 23.22 ? 285  LYS C C   1 
ATOM   7214 O O   . LYS C 1 284 ? 18.879  87.426  27.941  1.00 22.09 ? 285  LYS C O   1 
ATOM   7215 C CB  . LYS C 1 284 ? 18.599  86.121  25.023  1.00 22.52 ? 285  LYS C CB  1 
ATOM   7216 C CG  . LYS C 1 284 ? 18.590  86.453  23.488  1.00 24.94 ? 285  LYS C CG  1 
ATOM   7217 C CD  . LYS C 1 284 ? 17.373  85.853  22.799  1.00 24.33 ? 285  LYS C CD  1 
ATOM   7218 C CE  . LYS C 1 284 ? 16.156  86.732  23.047  1.00 28.85 ? 285  LYS C CE  1 
ATOM   7219 N NZ  . LYS C 1 284 ? 14.925  86.174  22.397  1.00 28.12 ? 285  LYS C NZ  1 
ATOM   7220 N N   . GLU C 1 285 ? 20.106  85.558  27.867  1.00 23.94 ? 286  GLU C N   1 
ATOM   7221 C CA  . GLU C 1 285 ? 19.974  85.395  29.307  1.00 27.79 ? 286  GLU C CA  1 
ATOM   7222 C C   . GLU C 1 285 ? 20.809  86.455  30.029  1.00 27.05 ? 286  GLU C C   1 
ATOM   7223 O O   . GLU C 1 285 ? 20.445  86.881  31.119  1.00 29.13 ? 286  GLU C O   1 
ATOM   7224 C CB  . GLU C 1 285 ? 20.489  84.046  29.773  1.00 27.68 ? 286  GLU C CB  1 
ATOM   7225 C CG  . GLU C 1 285 ? 19.687  82.843  29.401  1.00 34.75 ? 286  GLU C CG  1 
ATOM   7226 C CD  . GLU C 1 285 ? 20.464  81.596  29.767  1.00 37.83 ? 286  GLU C CD  1 
ATOM   7227 O OE1 . GLU C 1 285 ? 20.858  81.454  30.960  1.00 42.73 ? 286  GLU C OE1 1 
ATOM   7228 O OE2 . GLU C 1 285 ? 20.706  80.777  28.869  1.00 39.40 ? 286  GLU C OE2 1 
ATOM   7229 N N   . MET C 1 286 ? 21.923  86.876  29.428  1.00 26.00 ? 287  MET C N   1 
ATOM   7230 C CA  . MET C 1 286 ? 22.818  87.855  30.064  1.00 25.91 ? 287  MET C CA  1 
ATOM   7231 C C   . MET C 1 286 ? 22.634  89.351  29.738  1.00 28.86 ? 287  MET C C   1 
ATOM   7232 O O   . MET C 1 286 ? 23.064  90.209  30.532  1.00 27.83 ? 287  MET C O   1 
ATOM   7233 C CB  . MET C 1 286 ? 24.281  87.479  29.760  1.00 24.48 ? 287  MET C CB  1 
ATOM   7234 C CG  . MET C 1 286 ? 24.634  86.026  30.112  1.00 27.30 ? 287  MET C CG  1 
ATOM   7235 S SD  . MET C 1 286 ? 26.349  85.662  29.665  1.00 25.96 ? 287  MET C SD  1 
ATOM   7236 C CE  . MET C 1 286 ? 27.223  86.856  30.786  1.00 28.55 ? 287  MET C CE  1 
ATOM   7237 N N   . ALA C 1 287 ? 22.027  89.668  28.591  1.00 26.47 ? 288  ALA C N   1 
ATOM   7238 C CA  . ALA C 1 287 ? 21.858  91.064  28.182  1.00 26.30 ? 288  ALA C CA  1 
ATOM   7239 C C   . ALA C 1 287 ? 21.200  91.929  29.280  1.00 27.74 ? 288  ALA C C   1 
ATOM   7240 O O   . ALA C 1 287 ? 21.687  93.071  29.518  1.00 27.70 ? 288  ALA C O   1 
ATOM   7241 C CB  . ALA C 1 287 ? 21.051  91.128  26.895  1.00 25.89 ? 288  ALA C CB  1 
ATOM   7242 O OXT . ALA C 1 287 ? 20.219  91.461  29.897  1.00 26.14 ? 288  ALA C OXT 1 
HETATM 7243 O O   . HOH D 2 .   ? 51.821  71.015  24.886  1.00 18.03 ? 3002 HOH A O   1 
HETATM 7244 O O   . HOH D 2 .   ? 63.680  79.345  38.715  1.00 18.12 ? 3003 HOH A O   1 
HETATM 7245 O O   . HOH D 2 .   ? 58.747  60.319  18.619  1.00 19.74 ? 3005 HOH A O   1 
HETATM 7246 O O   . HOH D 2 .   ? 45.468  49.284  23.666  1.00 25.70 ? 3008 HOH A O   1 
HETATM 7247 O O   . HOH D 2 .   ? 57.211  74.074  18.481  1.00 21.72 ? 3009 HOH A O   1 
HETATM 7248 O O   . HOH D 2 .   ? 62.733  65.521  37.706  1.00 24.68 ? 3010 HOH A O   1 
HETATM 7249 O O   . HOH D 2 .   ? 59.504  51.479  37.348  1.00 21.79 ? 3012 HOH A O   1 
HETATM 7250 O O   . HOH D 2 .   ? 49.362  53.476  21.783  1.00 23.52 ? 3014 HOH A O   1 
HETATM 7251 O O   . HOH D 2 .   ? 53.737  60.572  21.823  1.00 19.19 ? 3017 HOH A O   1 
HETATM 7252 O O   . HOH D 2 .   ? 47.525  65.504  18.843  1.00 19.89 ? 3020 HOH A O   1 
HETATM 7253 O O   . HOH D 2 .   ? 46.115  50.215  21.320  1.00 21.43 ? 3021 HOH A O   1 
HETATM 7254 O O   . HOH D 2 .   ? 60.245  56.612  20.834  1.00 22.79 ? 3022 HOH A O   1 
HETATM 7255 O O   . HOH D 2 .   ? 45.970  44.472  15.495  1.00 18.67 ? 3025 HOH A O   1 
HETATM 7256 O O   . HOH D 2 .   ? 63.560  52.647  31.427  1.00 27.30 ? 3027 HOH A O   1 
HETATM 7257 O O   . HOH D 2 .   ? 52.900  57.134  40.267  1.00 22.93 ? 3029 HOH A O   1 
HETATM 7258 O O   . HOH D 2 .   ? 67.398  73.072  37.198  1.00 21.88 ? 3031 HOH A O   1 
HETATM 7259 O O   . HOH D 2 .   ? 58.988  35.406  32.074  1.00 28.67 ? 3035 HOH A O   1 
HETATM 7260 O O   . HOH D 2 .   ? 46.157  28.957  12.705  1.00 24.42 ? 3037 HOH A O   1 
HETATM 7261 O O   . HOH D 2 .   ? 56.851  77.209  40.978  1.00 29.57 ? 3038 HOH A O   1 
HETATM 7262 O O   . HOH D 2 .   ? 44.946  45.311  13.206  1.00 24.90 ? 3040 HOH A O   1 
HETATM 7263 O O   . HOH D 2 .   ? 52.189  62.559  28.648  1.00 26.16 ? 3041 HOH A O   1 
HETATM 7264 O O   . HOH D 2 .   ? 54.176  63.403  41.445  1.00 23.82 ? 3042 HOH A O   1 
HETATM 7265 O O   . HOH D 2 .   ? 52.455  49.076  16.390  1.00 27.44 ? 3043 HOH A O   1 
HETATM 7266 O O   . HOH D 2 .   ? 46.791  51.468  24.848  1.00 24.06 ? 3048 HOH A O   1 
HETATM 7267 O O   . HOH D 2 .   ? 57.281  77.494  25.041  1.00 24.02 ? 3049 HOH A O   1 
HETATM 7268 O O   . HOH D 2 .   ? 54.728  73.114  17.320  1.00 29.09 ? 3057 HOH A O   1 
HETATM 7269 O O   . HOH D 2 .   ? 52.515  74.191  25.298  1.00 26.98 ? 3058 HOH A O   1 
HETATM 7270 O O   . HOH D 2 .   ? 44.100  61.140  31.208  1.00 25.49 ? 3060 HOH A O   1 
HETATM 7271 O O   . HOH D 2 .   ? 64.021  73.441  36.042  1.00 19.55 ? 3061 HOH A O   1 
HETATM 7272 O O   . HOH D 2 .   ? 61.670  46.039  33.106  1.00 25.45 ? 3062 HOH A O   1 
HETATM 7273 O O   . HOH D 2 .   ? 61.247  66.619  14.547  1.00 24.80 ? 3066 HOH A O   1 
HETATM 7274 O O   . HOH D 2 .   ? 70.695  60.787  19.634  1.00 25.58 ? 3070 HOH A O   1 
HETATM 7275 O O   . HOH D 2 .   ? 54.186  64.349  22.743  1.00 25.06 ? 3072 HOH A O   1 
HETATM 7276 O O   . HOH D 2 .   ? 48.477  45.826  9.481   1.00 32.85 ? 3073 HOH A O   1 
HETATM 7277 O O   . HOH D 2 .   ? 52.321  58.405  24.219  1.00 26.67 ? 3074 HOH A O   1 
HETATM 7278 O O   . HOH D 2 .   ? 52.698  41.114  34.929  1.00 25.46 ? 3075 HOH A O   1 
HETATM 7279 O O   . HOH D 2 .   ? 67.057  48.235  11.947  1.00 31.30 ? 3080 HOH A O   1 
HETATM 7280 O O   . HOH D 2 .   ? 37.965  40.838  13.719  1.00 28.42 ? 3087 HOH A O   1 
HETATM 7281 O O   . HOH D 2 .   ? 34.871  45.237  20.239  1.00 27.62 ? 3091 HOH A O   1 
HETATM 7282 O O   . HOH D 2 .   ? 48.863  73.661  28.682  1.00 29.48 ? 3094 HOH A O   1 
HETATM 7283 O O   . HOH D 2 .   ? 55.571  70.813  44.220  1.00 29.21 ? 3096 HOH A O   1 
HETATM 7284 O O   . HOH D 2 .   ? 60.105  70.487  44.526  1.00 31.85 ? 3100 HOH A O   1 
HETATM 7285 O O   . HOH D 2 .   ? 66.758  61.444  34.229  1.00 23.36 ? 3101 HOH A O   1 
HETATM 7286 O O   . HOH D 2 .   ? 61.756  72.690  18.357  1.00 26.93 ? 3104 HOH A O   1 
HETATM 7287 O O   . HOH D 2 .   ? 46.221  39.668  33.465  1.00 27.52 ? 3108 HOH A O   1 
HETATM 7288 O O   . HOH D 2 .   ? 51.983  39.922  10.442  1.00 22.68 ? 3110 HOH A O   1 
HETATM 7289 O O   . HOH D 2 .   ? 40.958  44.540  20.306  1.00 22.30 ? 3111 HOH A O   1 
HETATM 7290 O O   . HOH D 2 .   ? 64.930  53.775  23.676  1.00 22.97 ? 3115 HOH A O   1 
HETATM 7291 O O   . HOH D 2 .   ? 59.522  54.372  22.316  1.00 24.53 ? 3116 HOH A O   1 
HETATM 7292 O O   . HOH D 2 .   ? 57.946  67.686  42.711  1.00 27.22 ? 3125 HOH A O   1 
HETATM 7293 O O   . HOH D 2 .   ? 41.451  48.183  31.622  1.00 29.77 ? 3131 HOH A O   1 
HETATM 7294 O O   . HOH D 2 .   ? 35.625  42.862  15.347  1.00 31.07 ? 3133 HOH A O   1 
HETATM 7295 O O   . HOH D 2 .   ? 56.396  76.220  22.664  1.00 25.77 ? 3134 HOH A O   1 
HETATM 7296 O O   . HOH D 2 .   ? 53.073  44.286  8.503   1.00 28.86 ? 3135 HOH A O   1 
HETATM 7297 O O   . HOH D 2 .   ? 52.441  63.945  18.213  1.00 27.90 ? 3136 HOH A O   1 
HETATM 7298 O O   . HOH D 2 .   ? 52.192  64.687  40.188  1.00 28.23 ? 3141 HOH A O   1 
HETATM 7299 O O   . HOH D 2 .   ? 50.481  60.519  22.132  1.00 32.00 ? 3143 HOH A O   1 
HETATM 7300 O O   . HOH D 2 .   ? 69.864  47.182  26.572  1.00 27.37 ? 3147 HOH A O   1 
HETATM 7301 O O   . HOH D 2 .   ? 57.655  62.093  14.614  1.00 24.30 ? 3150 HOH A O   1 
HETATM 7302 O O   . HOH D 2 .   ? 47.279  56.036  37.430  1.00 27.89 ? 3151 HOH A O   1 
HETATM 7303 O O   . HOH D 2 .   ? 72.403  60.964  31.457  1.00 28.88 ? 3153 HOH A O   1 
HETATM 7304 O O   . HOH D 2 .   ? 61.398  48.574  20.176  1.00 25.79 ? 3158 HOH A O   1 
HETATM 7305 O O   . HOH D 2 .   ? 66.432  54.821  27.780  1.00 25.72 ? 3161 HOH A O   1 
HETATM 7306 O O   . HOH D 2 .   ? 50.991  66.131  17.214  1.00 27.40 ? 3162 HOH A O   1 
HETATM 7307 O O   . HOH D 2 .   ? 65.413  36.809  11.680  1.00 34.20 ? 3169 HOH A O   1 
HETATM 7308 O O   . HOH D 2 .   ? 50.393  62.506  18.764  1.00 36.48 ? 3170 HOH A O   1 
HETATM 7309 O O   . HOH D 2 .   ? 52.904  74.769  22.596  1.00 28.79 ? 3171 HOH A O   1 
HETATM 7310 O O   . HOH D 2 .   ? 58.780  74.419  16.180  1.00 36.56 ? 3184 HOH A O   1 
HETATM 7311 O O   . HOH D 2 .   ? 38.877  49.352  8.604   1.00 31.48 ? 3186 HOH A O   1 
HETATM 7312 O O   . HOH D 2 .   ? 70.422  72.695  21.143  1.00 29.91 ? 3187 HOH A O   1 
HETATM 7313 O O   . HOH D 2 .   ? 73.003  73.612  22.363  1.00 38.09 ? 3200 HOH A O   1 
HETATM 7314 O O   . HOH D 2 .   ? 68.296  49.563  18.039  1.00 29.09 ? 3201 HOH A O   1 
HETATM 7315 O O   . HOH D 2 .   ? 62.601  33.431  17.825  1.00 37.14 ? 3202 HOH A O   1 
HETATM 7316 O O   . HOH D 2 .   ? 39.599  43.412  8.297   1.00 27.57 ? 3204 HOH A O   1 
HETATM 7317 O O   . HOH D 2 .   ? 33.213  39.458  24.931  1.00 37.23 ? 3205 HOH A O   1 
HETATM 7318 O O   . HOH D 2 .   ? 56.144  73.392  31.649  1.00 31.31 ? 3206 HOH A O   1 
HETATM 7319 O O   . HOH D 2 .   ? 44.430  57.199  36.861  1.00 36.85 ? 3209 HOH A O   1 
HETATM 7320 O O   . HOH D 2 .   ? 45.054  34.934  9.076   1.00 37.27 ? 3210 HOH A O   1 
HETATM 7321 O O   . HOH D 2 .   ? 47.371  47.615  16.647  1.00 25.51 ? 3216 HOH A O   1 
HETATM 7322 O O   . HOH D 2 .   ? 41.619  53.443  32.666  1.00 30.72 ? 3223 HOH A O   1 
HETATM 7323 O O   . HOH D 2 .   ? 34.845  41.778  28.127  1.00 40.96 ? 3227 HOH A O   1 
HETATM 7324 O O   . HOH D 2 .   ? 47.887  72.393  39.179  1.00 37.43 ? 3228 HOH A O   1 
HETATM 7325 O O   . HOH D 2 .   ? 56.038  33.258  8.140   1.00 41.65 ? 3229 HOH A O   1 
HETATM 7326 O O   . HOH D 2 .   ? 67.002  46.294  28.816  1.00 33.15 ? 3232 HOH A O   1 
HETATM 7327 O O   . HOH D 2 .   ? 69.441  60.433  34.141  1.00 30.80 ? 3235 HOH A O   1 
HETATM 7328 O O   . HOH D 2 .   ? 36.783  40.312  17.150  1.00 29.46 ? 3236 HOH A O   1 
HETATM 7329 O O   . HOH D 2 .   ? 67.680  56.002  14.955  1.00 38.14 ? 3239 HOH A O   1 
HETATM 7330 O O   . HOH D 2 .   ? 54.424  35.023  3.409   1.00 43.24 ? 3243 HOH A O   1 
HETATM 7331 O O   . HOH D 2 .   ? 66.638  74.997  20.765  1.00 28.26 ? 3245 HOH A O   1 
HETATM 7332 O O   . HOH D 2 .   ? 57.833  54.887  14.285  1.00 32.16 ? 3250 HOH A O   1 
HETATM 7333 O O   . HOH D 2 .   ? 66.845  38.284  14.281  1.00 40.53 ? 3252 HOH A O   1 
HETATM 7334 O O   . HOH D 2 .   ? 71.281  52.456  15.725  1.00 38.33 ? 3254 HOH A O   1 
HETATM 7335 O O   . HOH D 2 .   ? 50.631  40.419  6.332   1.00 35.88 ? 3258 HOH A O   1 
HETATM 7336 O O   . HOH D 2 .   ? 42.958  27.648  15.200  1.00 41.01 ? 3259 HOH A O   1 
HETATM 7337 O O   . HOH D 2 .   ? 64.654  55.490  36.566  1.00 34.50 ? 3260 HOH A O   1 
HETATM 7338 O O   . HOH D 2 .   ? 57.598  45.235  38.675  1.00 35.81 ? 3261 HOH A O   1 
HETATM 7339 O O   . HOH D 2 .   ? 52.112  47.320  12.179  1.00 37.54 ? 3262 HOH A O   1 
HETATM 7340 O O   . HOH D 2 .   ? 45.497  26.560  13.735  1.00 36.22 ? 3263 HOH A O   1 
HETATM 7341 O O   . HOH D 2 .   ? 69.373  58.730  36.185  1.00 30.32 ? 3266 HOH A O   1 
HETATM 7342 O O   . HOH D 2 .   ? 36.957  36.542  10.048  1.00 39.41 ? 3268 HOH A O   1 
HETATM 7343 O O   . HOH D 2 .   ? 66.278  44.091  6.847   1.00 40.88 ? 3276 HOH A O   1 
HETATM 7344 O O   . HOH D 2 .   ? 53.783  31.608  7.949   1.00 31.48 ? 3277 HOH A O   1 
HETATM 7345 O O   . HOH D 2 .   ? 62.140  59.584  45.304  1.00 50.20 ? 3281 HOH A O   1 
HETATM 7346 O O   . HOH D 2 .   ? 46.600  23.062  14.846  1.00 45.87 ? 3282 HOH A O   1 
HETATM 7347 O O   . HOH D 2 .   ? 51.669  61.445  15.457  1.00 29.40 ? 3285 HOH A O   1 
HETATM 7348 O O   . HOH D 2 .   ? 61.045  47.932  9.608   1.00 38.57 ? 3290 HOH A O   1 
HETATM 7349 O O   . HOH D 2 .   ? 46.420  52.286  11.678  1.00 38.36 ? 3296 HOH A O   1 
HETATM 7350 O O   . HOH D 2 .   ? 53.653  45.303  10.775  1.00 32.41 ? 3299 HOH A O   1 
HETATM 7351 O O   . HOH D 2 .   ? 50.447  23.221  14.989  1.00 41.19 ? 3300 HOH A O   1 
HETATM 7352 O O   . HOH D 2 .   ? 65.965  38.035  7.521   1.00 47.38 ? 3303 HOH A O   1 
HETATM 7353 O O   . HOH D 2 .   ? 49.110  23.602  18.683  1.00 34.09 ? 3304 HOH A O   1 
HETATM 7354 O O   . HOH D 2 .   ? 46.594  68.145  36.996  1.00 44.78 ? 3306 HOH A O   1 
HETATM 7355 O O   . HOH D 2 .   ? 66.667  56.179  23.200  1.00 31.01 ? 3308 HOH A O   1 
HETATM 7356 O O   . HOH D 2 .   ? 56.918  47.126  7.402   1.00 47.20 ? 3310 HOH A O   1 
HETATM 7357 O O   . HOH D 2 .   ? 63.847  49.041  19.082  1.00 33.73 ? 3312 HOH A O   1 
HETATM 7358 O O   . HOH D 2 .   ? 71.856  76.521  26.070  1.00 29.89 ? 3313 HOH A O   1 
HETATM 7359 O O   . HOH D 2 .   ? 34.920  33.689  20.047  1.00 41.43 ? 3314 HOH A O   1 
HETATM 7360 O O   . HOH D 2 .   ? 61.622  59.952  38.714  1.00 35.97 ? 3316 HOH A O   1 
HETATM 7361 O O   . HOH D 2 .   ? 43.264  38.346  8.548   1.00 45.05 ? 3322 HOH A O   1 
HETATM 7362 O O   . HOH D 2 .   ? 70.905  44.296  15.858  1.00 34.34 ? 3326 HOH A O   1 
HETATM 7363 O O   . HOH D 2 .   ? 54.410  73.490  13.573  1.00 47.78 ? 3331 HOH A O   1 
HETATM 7364 O O   . HOH D 2 .   ? 34.323  29.088  27.032  1.00 48.00 ? 3332 HOH A O   1 
HETATM 7365 O O   . HOH D 2 .   ? 37.179  32.579  11.474  1.00 36.28 ? 3333 HOH A O   1 
HETATM 7366 O O   . HOH D 2 .   ? 65.596  76.456  43.092  1.00 39.54 ? 3338 HOH A O   1 
HETATM 7367 O O   . HOH D 2 .   ? 51.441  42.200  37.404  1.00 34.37 ? 3342 HOH A O   1 
HETATM 7368 O O   . HOH D 2 .   ? 33.194  37.785  21.758  1.00 45.02 ? 3344 HOH A O   1 
HETATM 7369 O O   . HOH D 2 .   ? 48.522  58.377  38.637  1.00 39.08 ? 3346 HOH A O   1 
HETATM 7370 O O   . HOH D 2 .   ? 54.092  57.237  43.083  1.00 50.31 ? 3347 HOH A O   1 
HETATM 7371 O O   . HOH D 2 .   ? 43.251  66.573  36.254  1.00 34.49 ? 3348 HOH A O   1 
HETATM 7372 O O   . HOH D 2 .   ? 56.108  38.076  36.453  1.00 39.23 ? 3353 HOH A O   1 
HETATM 7373 O O   . HOH D 2 .   ? 60.653  34.121  34.386  1.00 42.91 ? 3354 HOH A O   1 
HETATM 7374 O O   . HOH D 2 .   ? 42.501  51.321  23.343  1.00 39.38 ? 3355 HOH A O   1 
HETATM 7375 O O   . HOH D 2 .   ? 75.377  61.751  32.612  1.00 32.60 ? 3357 HOH A O   1 
HETATM 7376 O O   . HOH D 2 .   ? 56.856  72.248  46.146  1.00 37.31 ? 3358 HOH A O   1 
HETATM 7377 O O   . HOH D 2 .   ? 72.602  59.299  25.467  1.00 30.43 ? 3359 HOH A O   1 
HETATM 7378 O O   . HOH D 2 .   ? 63.222  35.693  20.976  1.00 47.86 ? 3361 HOH A O   1 
HETATM 7379 O O   . HOH D 2 .   ? 54.679  61.132  12.898  1.00 37.59 ? 3363 HOH A O   1 
HETATM 7380 O O   . HOH D 2 .   ? 36.884  40.858  30.526  1.00 41.15 ? 3364 HOH A O   1 
HETATM 7381 O O   . HOH D 2 .   ? 45.971  22.396  17.336  1.00 40.53 ? 3367 HOH A O   1 
HETATM 7382 O O   . HOH D 2 .   ? 44.930  46.219  34.981  1.00 33.07 ? 3369 HOH A O   1 
HETATM 7383 O O   . HOH D 2 .   ? 72.031  43.321  18.011  1.00 37.80 ? 3370 HOH A O   1 
HETATM 7384 O O   . HOH D 2 .   ? 71.431  68.695  21.719  1.00 36.82 ? 3372 HOH A O   1 
HETATM 7385 O O   . HOH D 2 .   ? 43.292  51.120  18.414  1.00 35.21 ? 3373 HOH A O   1 
HETATM 7386 O O   . HOH D 2 .   ? 60.483  49.014  12.017  1.00 42.58 ? 3377 HOH A O   1 
HETATM 7387 O O   . HOH D 2 .   ? 35.070  38.674  15.056  1.00 44.82 ? 3382 HOH A O   1 
HETATM 7388 O O   . HOH D 2 .   ? 53.714  31.385  34.595  1.00 39.85 ? 3388 HOH A O   1 
HETATM 7389 O O   . HOH D 2 .   ? 63.144  58.637  11.742  1.00 35.57 ? 3390 HOH A O   1 
HETATM 7390 O O   . HOH D 2 .   ? 48.348  74.498  37.503  1.00 45.27 ? 3394 HOH A O   1 
HETATM 7391 O O   . HOH D 2 .   ? 50.225  35.705  37.915  1.00 38.58 ? 3398 HOH A O   1 
HETATM 7392 O O   . HOH D 2 .   ? 49.600  57.033  23.973  1.00 37.85 ? 3400 HOH A O   1 
HETATM 7393 O O   . HOH D 2 .   ? 51.683  30.099  31.376  1.00 39.30 ? 3401 HOH A O   1 
HETATM 7394 O O   . HOH D 2 .   ? 74.731  72.129  29.060  1.00 33.75 ? 3404 HOH A O   1 
HETATM 7395 O O   . HOH D 2 .   ? 69.312  66.787  14.782  1.00 44.22 ? 3406 HOH A O   1 
HETATM 7396 O O   . HOH D 2 .   ? 63.732  43.605  27.236  1.00 38.98 ? 3408 HOH A O   1 
HETATM 7397 O O   . HOH D 2 .   ? 67.579  70.800  14.373  1.00 34.73 ? 3409 HOH A O   1 
HETATM 7398 O O   . HOH D 2 .   ? 72.635  66.157  23.565  1.00 36.58 ? 3411 HOH A O   1 
HETATM 7399 O O   . HOH D 2 .   ? 56.613  76.426  20.166  1.00 25.27 ? 3415 HOH A O   1 
HETATM 7400 O O   . HOH D 2 .   ? 48.207  51.414  20.164  1.00 28.25 ? 3416 HOH A O   1 
HETATM 7401 O O   . HOH D 2 .   ? 53.269  38.814  36.178  1.00 28.75 ? 3418 HOH A O   1 
HETATM 7402 O O   . HOH D 2 .   ? 48.489  65.398  16.179  1.00 32.31 ? 3423 HOH A O   1 
HETATM 7403 O O   . HOH D 2 .   ? 50.561  47.167  9.892   1.00 33.97 ? 3425 HOH A O   1 
HETATM 7404 O O   . HOH D 2 .   ? 59.890  43.653  37.323  1.00 39.29 ? 3430 HOH A O   1 
HETATM 7405 O O   . HOH D 2 .   ? 70.083  59.529  31.783  1.00 30.20 ? 3432 HOH A O   1 
HETATM 7406 O O   . HOH D 2 .   ? 43.020  33.360  8.253   1.00 31.37 ? 3436 HOH A O   1 
HETATM 7407 O O   . HOH D 2 .   ? 61.891  74.060  16.205  1.00 33.22 ? 3444 HOH A O   1 
HETATM 7408 O O   . HOH D 2 .   ? 68.610  56.421  19.310  1.00 38.34 ? 3446 HOH A O   1 
HETATM 7409 O O   . HOH D 2 .   ? 36.687  35.705  12.839  1.00 47.37 ? 3447 HOH A O   1 
HETATM 7410 O O   . HOH D 2 .   ? 52.117  78.316  38.635  1.00 38.51 ? 3451 HOH A O   1 
HETATM 7411 O O   . HOH D 2 .   ? 48.696  62.540  16.739  1.00 35.93 ? 3455 HOH A O   1 
HETATM 7412 O O   . HOH D 2 .   ? 45.213  53.883  24.305  1.00 41.12 ? 3457 HOH A O   1 
HETATM 7413 O O   . HOH D 2 .   ? 71.306  46.726  14.044  1.00 43.28 ? 3458 HOH A O   1 
HETATM 7414 O O   . HOH D 2 .   ? 53.635  46.741  15.242  1.00 33.06 ? 3461 HOH A O   1 
HETATM 7415 O O   . HOH D 2 .   ? 62.454  49.474  7.810   1.00 42.77 ? 3462 HOH A O   1 
HETATM 7416 O O   . HOH D 2 .   ? 62.093  68.082  12.566  1.00 34.22 ? 3463 HOH A O   1 
HETATM 7417 O O   . HOH D 2 .   ? 45.554  50.403  16.919  1.00 37.18 ? 3465 HOH A O   1 
HETATM 7418 O O   . HOH D 2 .   ? 64.858  50.241  11.246  1.00 41.62 ? 3472 HOH A O   1 
HETATM 7419 O O   . HOH D 2 .   ? 68.032  54.207  21.241  1.00 31.01 ? 3473 HOH A O   1 
HETATM 7420 O O   . HOH D 2 .   ? 50.078  57.389  40.855  1.00 41.12 ? 3477 HOH A O   1 
HETATM 7421 O O   . HOH D 2 .   ? 51.934  50.805  14.724  1.00 38.62 ? 3482 HOH A O   1 
HETATM 7422 O O   . HOH D 2 .   ? 34.126  43.883  17.729  1.00 33.13 ? 3485 HOH A O   1 
HETATM 7423 O O   . HOH D 2 .   ? 41.426  40.460  6.821   1.00 40.30 ? 3490 HOH A O   1 
HETATM 7424 O O   . HOH D 2 .   ? 39.980  53.477  30.223  1.00 43.79 ? 3491 HOH A O   1 
HETATM 7425 O O   . HOH D 2 .   ? 43.138  52.048  9.309   1.00 36.55 ? 3493 HOH A O   1 
HETATM 7426 O O   . HOH D 2 .   ? 43.606  51.680  21.104  1.00 45.24 ? 3494 HOH A O   1 
HETATM 7427 O O   . HOH D 2 .   ? 37.113  42.258  8.256   1.00 34.55 ? 3495 HOH A O   1 
HETATM 7428 O O   . HOH D 2 .   ? 70.835  57.891  19.176  1.00 39.36 ? 3497 HOH A O   1 
HETATM 7429 O O   . HOH D 2 .   ? 59.837  57.123  42.665  1.00 50.78 ? 3500 HOH A O   1 
HETATM 7430 O O   . HOH D 2 .   ? 51.178  41.806  8.590   1.00 35.56 ? 3501 HOH A O   1 
HETATM 7431 O O   . HOH D 2 .   ? 45.175  37.375  35.020  1.00 38.27 ? 3508 HOH A O   1 
HETATM 7432 O O   . HOH D 2 .   ? 54.160  66.281  12.021  1.00 35.73 ? 3509 HOH A O   1 
HETATM 7433 O O   . HOH D 2 .   ? 46.917  63.246  20.073  1.00 33.02 ? 3510 HOH A O   1 
HETATM 7434 O O   . HOH D 2 .   ? 63.538  64.280  15.225  1.00 32.37 ? 3511 HOH A O   1 
HETATM 7435 O O   . HOH D 2 .   ? 55.070  40.909  0.811   1.00 44.39 ? 3523 HOH A O   1 
HETATM 7436 O O   . HOH D 2 .   ? 56.003  31.969  13.735  1.00 35.71 ? 3525 HOH A O   1 
HETATM 7437 O O   . HOH D 2 .   ? 39.054  55.938  29.844  1.00 45.29 ? 3527 HOH A O   1 
HETATM 7438 O O   . HOH D 2 .   ? 66.823  54.618  17.629  1.00 36.28 ? 3531 HOH A O   1 
HETATM 7439 O O   . HOH D 2 .   ? 51.519  67.151  14.320  1.00 42.89 ? 3532 HOH A O   1 
HETATM 7440 O O   . HOH D 2 .   ? 42.041  49.379  34.084  1.00 36.23 ? 3534 HOH A O   1 
HETATM 7441 O O   . HOH D 2 .   ? 75.129  62.457  30.026  1.00 35.99 ? 3536 HOH A O   1 
HETATM 7442 O O   . HOH D 2 .   ? 70.689  57.060  31.538  1.00 38.06 ? 3538 HOH A O   1 
HETATM 7443 O O   . HOH D 2 .   ? 69.323  51.757  27.560  1.00 44.86 ? 3539 HOH A O   1 
HETATM 7444 O O   . HOH D 2 .   ? 50.178  49.401  13.635  1.00 38.91 ? 3542 HOH A O   1 
HETATM 7445 O O   . HOH D 2 .   ? 63.851  46.175  34.555  1.00 44.07 ? 3543 HOH A O   1 
HETATM 7446 O O   . HOH D 2 .   ? 69.307  75.033  19.724  1.00 39.69 ? 3544 HOH A O   1 
HETATM 7447 O O   . HOH D 2 .   ? 64.304  75.427  16.655  1.00 47.98 ? 3548 HOH A O   1 
HETATM 7448 O O   . HOH E 2 .   ? 65.559  88.806  21.714  1.00 23.81 ? 3004 HOH B O   1 
HETATM 7449 O O   . HOH E 2 .   ? 44.731  90.995  29.802  1.00 19.62 ? 3015 HOH B O   1 
HETATM 7450 O O   . HOH E 2 .   ? 50.726  94.330  34.304  1.00 23.93 ? 3019 HOH B O   1 
HETATM 7451 O O   . HOH E 2 .   ? 70.054  81.504  42.942  1.00 28.32 ? 3023 HOH B O   1 
HETATM 7452 O O   . HOH E 2 .   ? 50.222  92.913  14.633  1.00 27.65 ? 3030 HOH B O   1 
HETATM 7453 O O   . HOH E 2 .   ? 53.207  78.177  25.694  1.00 29.34 ? 3033 HOH B O   1 
HETATM 7454 O O   . HOH E 2 .   ? 43.277  94.147  29.213  1.00 22.12 ? 3034 HOH B O   1 
HETATM 7455 O O   . HOH E 2 .   ? 61.691  83.979  26.042  1.00 28.24 ? 3045 HOH B O   1 
HETATM 7456 O O   . HOH E 2 .   ? 41.650  84.593  35.804  1.00 25.54 ? 3047 HOH B O   1 
HETATM 7457 O O   . HOH E 2 .   ? 49.582  92.640  43.028  1.00 33.95 ? 3052 HOH B O   1 
HETATM 7458 O O   . HOH E 2 .   ? 65.162  76.814  25.368  1.00 23.91 ? 3054 HOH B O   1 
HETATM 7459 O O   . HOH E 2 .   ? 65.563  85.367  26.594  1.00 21.57 ? 3067 HOH B O   1 
HETATM 7460 O O   . HOH E 2 .   ? 48.140  90.946  40.195  1.00 22.24 ? 3069 HOH B O   1 
HETATM 7461 O O   . HOH E 2 .   ? 54.637  85.121  16.233  1.00 22.79 ? 3071 HOH B O   1 
HETATM 7462 O O   . HOH E 2 .   ? 59.638  90.679  43.491  1.00 25.41 ? 3077 HOH B O   1 
HETATM 7463 O O   . HOH E 2 .   ? 68.919  102.130 37.062  1.00 30.02 ? 3078 HOH B O   1 
HETATM 7464 O O   . HOH E 2 .   ? 54.051  103.065 26.062  1.00 32.19 ? 3081 HOH B O   1 
HETATM 7465 O O   A HOH E 2 .   ? 91.664  99.602  18.995  0.70 24.40 ? 3085 HOH B O   1 
HETATM 7466 O O   B HOH E 2 .   ? 91.106  102.360 20.055  0.30 47.49 ? 3085 HOH B O   1 
HETATM 7467 O O   . HOH E 2 .   ? 50.038  88.498  15.498  1.00 25.26 ? 3088 HOH B O   1 
HETATM 7468 O O   . HOH E 2 .   ? 61.594  86.857  15.444  1.00 27.29 ? 3090 HOH B O   1 
HETATM 7469 O O   . HOH E 2 .   ? 79.254  92.094  46.103  1.00 30.45 ? 3097 HOH B O   1 
HETATM 7470 O O   . HOH E 2 .   ? 49.130  80.805  22.256  1.00 27.26 ? 3102 HOH B O   1 
HETATM 7471 O O   . HOH E 2 .   ? 60.551  98.444  16.977  1.00 31.29 ? 3103 HOH B O   1 
HETATM 7472 O O   . HOH E 2 .   ? 64.150  99.950  32.733  1.00 29.21 ? 3106 HOH B O   1 
HETATM 7473 O O   . HOH E 2 .   ? 55.163  81.211  15.351  1.00 27.00 ? 3107 HOH B O   1 
HETATM 7474 O O   . HOH E 2 .   ? 54.358  98.902  30.789  1.00 22.52 ? 3109 HOH B O   1 
HETATM 7475 O O   . HOH E 2 .   ? 73.734  85.004  34.870  1.00 27.22 ? 3112 HOH B O   1 
HETATM 7476 O O   . HOH E 2 .   ? 63.811  85.951  43.978  1.00 22.44 ? 3119 HOH B O   1 
HETATM 7477 O O   . HOH E 2 .   ? 54.094  101.482 30.051  1.00 25.42 ? 3122 HOH B O   1 
HETATM 7478 O O   . HOH E 2 .   ? 60.818  84.707  32.241  1.00 21.56 ? 3123 HOH B O   1 
HETATM 7479 O O   . HOH E 2 .   ? 66.382  85.814  29.833  1.00 28.19 ? 3126 HOH B O   1 
HETATM 7480 O O   . HOH E 2 .   ? 53.379  76.440  30.307  1.00 31.20 ? 3128 HOH B O   1 
HETATM 7481 O O   . HOH E 2 .   ? 55.779  102.005 27.871  1.00 26.99 ? 3130 HOH B O   1 
HETATM 7482 O O   . HOH E 2 .   ? 44.800  89.211  20.375  1.00 36.83 ? 3132 HOH B O   1 
HETATM 7483 O O   . HOH E 2 .   ? 68.353  93.262  25.982  1.00 31.26 ? 3139 HOH B O   1 
HETATM 7484 O O   . HOH E 2 .   ? 46.896  84.663  41.317  1.00 30.33 ? 3142 HOH B O   1 
HETATM 7485 O O   . HOH E 2 .   ? 64.830  81.507  22.983  1.00 30.68 ? 3145 HOH B O   1 
HETATM 7486 O O   . HOH E 2 .   ? 76.832  84.324  32.472  1.00 30.20 ? 3154 HOH B O   1 
HETATM 7487 O O   . HOH E 2 .   ? 54.987  80.444  17.902  1.00 26.08 ? 3156 HOH B O   1 
HETATM 7488 O O   . HOH E 2 .   ? 53.659  90.733  44.562  1.00 32.07 ? 3159 HOH B O   1 
HETATM 7489 O O   . HOH E 2 .   ? 66.308  98.644  25.166  1.00 33.35 ? 3164 HOH B O   1 
HETATM 7490 O O   . HOH E 2 .   ? 83.451  82.292  35.398  1.00 31.77 ? 3172 HOH B O   1 
HETATM 7491 O O   . HOH E 2 .   ? 37.393  94.251  24.322  1.00 26.03 ? 3173 HOH B O   1 
HETATM 7492 O O   . HOH E 2 .   ? 57.293  78.773  18.440  1.00 29.20 ? 3174 HOH B O   1 
HETATM 7493 O O   . HOH E 2 .   ? 56.189  79.247  26.603  1.00 23.58 ? 3176 HOH B O   1 
HETATM 7494 O O   . HOH E 2 .   ? 64.220  78.340  19.356  1.00 36.59 ? 3182 HOH B O   1 
HETATM 7495 O O   . HOH E 2 .   ? 54.821  102.865 32.115  1.00 26.11 ? 3191 HOH B O   1 
HETATM 7496 O O   . HOH E 2 .   ? 57.872  85.983  12.139  1.00 31.76 ? 3195 HOH B O   1 
HETATM 7497 O O   . HOH E 2 .   ? 76.456  84.760  35.112  1.00 31.25 ? 3197 HOH B O   1 
HETATM 7498 O O   . HOH E 2 .   ? 66.939  92.516  23.983  1.00 32.15 ? 3198 HOH B O   1 
HETATM 7499 O O   . HOH E 2 .   ? 65.573  80.172  16.312  1.00 30.68 ? 3203 HOH B O   1 
HETATM 7500 O O   . HOH E 2 .   ? 85.086  83.054  27.738  1.00 38.95 ? 3208 HOH B O   1 
HETATM 7501 O O   . HOH E 2 .   ? 68.220  100.442 43.932  1.00 28.75 ? 3211 HOH B O   1 
HETATM 7502 O O   . HOH E 2 .   ? 75.091  83.561  43.620  1.00 32.53 ? 3212 HOH B O   1 
HETATM 7503 O O   . HOH E 2 .   ? 37.529  93.112  33.107  1.00 31.58 ? 3213 HOH B O   1 
HETATM 7504 O O   . HOH E 2 .   ? 50.951  86.384  14.475  1.00 36.28 ? 3218 HOH B O   1 
HETATM 7505 O O   A HOH E 2 .   ? 94.577  93.853  18.566  0.70 37.28 ? 3222 HOH B O   1 
HETATM 7506 O O   B HOH E 2 .   ? 95.973  94.692  18.547  0.30 51.03 ? 3222 HOH B O   1 
HETATM 7507 O O   . HOH E 2 .   ? 54.965  96.579  37.596  1.00 31.84 ? 3226 HOH B O   1 
HETATM 7508 O O   . HOH E 2 .   ? 62.095  89.535  15.303  1.00 41.53 ? 3233 HOH B O   1 
HETATM 7509 O O   . HOH E 2 .   ? 72.784  85.740  30.562  1.00 33.12 ? 3238 HOH B O   1 
HETATM 7510 O O   . HOH E 2 .   ? 49.005  79.120  40.006  1.00 46.62 ? 3242 HOH B O   1 
HETATM 7511 O O   . HOH E 2 .   ? 48.989  100.019 37.749  1.00 28.44 ? 3244 HOH B O   1 
HETATM 7512 O O   . HOH E 2 .   ? 78.434  89.595  46.907  1.00 31.91 ? 3246 HOH B O   1 
HETATM 7513 O O   . HOH E 2 .   ? 71.883  103.127 43.154  1.00 47.22 ? 3249 HOH B O   1 
HETATM 7514 O O   . HOH E 2 .   ? 73.693  88.525  46.131  1.00 32.86 ? 3251 HOH B O   1 
HETATM 7515 O O   . HOH E 2 .   ? 62.988  98.644  39.807  1.00 34.75 ? 3253 HOH B O   1 
HETATM 7516 O O   . HOH E 2 .   ? 53.381  89.546  42.140  1.00 31.04 ? 3257 HOH B O   1 
HETATM 7517 O O   . HOH E 2 .   ? 62.343  76.956  42.258  1.00 40.00 ? 3264 HOH B O   1 
HETATM 7518 O O   . HOH E 2 .   ? 95.194  92.051  51.374  1.00 44.10 ? 3265 HOH B O   1 
HETATM 7519 O O   . HOH E 2 .   ? 68.882  82.979  18.177  1.00 40.03 ? 3271 HOH B O   1 
HETATM 7520 O O   . HOH E 2 .   ? 58.541  100.585 35.484  1.00 34.30 ? 3272 HOH B O   1 
HETATM 7521 O O   . HOH E 2 .   ? 82.539  105.462 29.783  1.00 41.83 ? 3275 HOH B O   1 
HETATM 7522 O O   . HOH E 2 .   ? 102.153 94.571  36.284  1.00 37.85 ? 3280 HOH B O   1 
HETATM 7523 O O   . HOH E 2 .   ? 46.223  97.933  36.701  1.00 40.82 ? 3283 HOH B O   1 
HETATM 7524 O O   . HOH E 2 .   ? 71.679  92.115  18.787  1.00 38.33 ? 3286 HOH B O   1 
HETATM 7525 O O   . HOH E 2 .   ? 74.635  80.032  39.386  1.00 40.77 ? 3288 HOH B O   1 
HETATM 7526 O O   . HOH E 2 .   ? 63.104  100.236 27.720  1.00 34.86 ? 3289 HOH B O   1 
HETATM 7527 O O   . HOH E 2 .   ? 67.927  80.345  43.856  1.00 35.81 ? 3295 HOH B O   1 
HETATM 7528 O O   . HOH E 2 .   ? 49.583  83.553  29.773  1.00 29.17 ? 3297 HOH B O   1 
HETATM 7529 O O   . HOH E 2 .   ? 64.105  83.261  44.365  1.00 29.57 ? 3298 HOH B O   1 
HETATM 7530 O O   . HOH E 2 .   ? 58.390  102.575 21.693  1.00 37.55 ? 3301 HOH B O   1 
HETATM 7531 O O   . HOH E 2 .   ? 51.573  99.897  16.650  1.00 39.68 ? 3307 HOH B O   1 
HETATM 7532 O O   . HOH E 2 .   ? 62.129  101.683 32.375  1.00 41.86 ? 3311 HOH B O   1 
HETATM 7533 O O   . HOH E 2 .   ? 64.045  98.930  23.294  1.00 34.79 ? 3321 HOH B O   1 
HETATM 7534 O O   . HOH E 2 .   ? 51.644  105.685 25.650  1.00 38.34 ? 3323 HOH B O   1 
HETATM 7535 O O   . HOH E 2 .   ? 64.344  79.046  22.005  1.00 30.01 ? 3329 HOH B O   1 
HETATM 7536 O O   . HOH E 2 .   ? 88.433  91.208  23.548  1.00 35.03 ? 3334 HOH B O   1 
HETATM 7537 O O   . HOH E 2 .   ? 38.790  88.300  39.279  1.00 38.15 ? 3336 HOH B O   1 
HETATM 7538 O O   . HOH E 2 .   ? 58.812  93.217  11.580  1.00 37.19 ? 3341 HOH B O   1 
HETATM 7539 O O   . HOH E 2 .   ? 85.109  77.069  37.745  1.00 47.31 ? 3351 HOH B O   1 
HETATM 7540 O O   . HOH E 2 .   ? 54.004  79.721  40.076  1.00 35.82 ? 3352 HOH B O   1 
HETATM 7541 O O   . HOH E 2 .   ? 54.072  77.677  23.142  1.00 33.64 ? 3356 HOH B O   1 
HETATM 7542 O O   . HOH E 2 .   ? 66.234  86.005  18.433  1.00 31.82 ? 3365 HOH B O   1 
HETATM 7543 O O   . HOH E 2 .   ? 66.710  82.413  28.226  1.00 38.71 ? 3374 HOH B O   1 
HETATM 7544 O O   . HOH E 2 .   ? 51.475  79.827  21.259  1.00 29.56 ? 3375 HOH B O   1 
HETATM 7545 O O   . HOH E 2 .   ? 66.447  77.805  27.421  1.00 37.18 ? 3379 HOH B O   1 
HETATM 7546 O O   . HOH E 2 .   ? 48.380  77.994  37.803  1.00 33.37 ? 3381 HOH B O   1 
HETATM 7547 O O   . HOH E 2 .   ? 71.094  102.068 20.409  1.00 45.61 ? 3383 HOH B O   1 
HETATM 7548 O O   . HOH E 2 .   ? 92.499  101.872 27.063  1.00 44.82 ? 3384 HOH B O   1 
HETATM 7549 O O   . HOH E 2 .   ? 72.748  99.231  23.632  1.00 44.88 ? 3387 HOH B O   1 
HETATM 7550 O O   . HOH E 2 .   ? 75.573  101.929 44.936  1.00 48.48 ? 3389 HOH B O   1 
HETATM 7551 O O   . HOH E 2 .   ? 98.665  82.792  33.574  1.00 47.37 ? 3391 HOH B O   1 
HETATM 7552 O O   . HOH E 2 .   ? 82.781  90.125  21.951  1.00 46.13 ? 3395 HOH B O   1 
HETATM 7553 O O   . HOH E 2 .   ? 94.939  96.966  20.201  1.00 46.51 ? 3396 HOH B O   1 
HETATM 7554 O O   . HOH E 2 .   ? 44.577  92.162  39.329  1.00 23.54 ? 3422 HOH B O   1 
HETATM 7555 O O   . HOH E 2 .   ? 62.652  102.105 29.994  1.00 33.44 ? 3426 HOH B O   1 
HETATM 7556 O O   . HOH E 2 .   ? 52.686  79.406  18.656  1.00 28.91 ? 3427 HOH B O   1 
HETATM 7557 O O   . HOH E 2 .   ? 76.028  99.274  45.704  1.00 37.08 ? 3428 HOH B O   1 
HETATM 7558 O O   . HOH E 2 .   ? 66.070  77.063  22.659  1.00 28.53 ? 3431 HOH B O   1 
HETATM 7559 O O   . HOH E 2 .   ? 57.756  103.651 28.578  1.00 34.44 ? 3433 HOH B O   1 
HETATM 7560 O O   . HOH E 2 .   ? 43.483  79.122  35.670  1.00 34.36 ? 3434 HOH B O   1 
HETATM 7561 O O   . HOH E 2 .   ? 38.067  87.434  36.950  1.00 41.39 ? 3435 HOH B O   1 
HETATM 7562 O O   . HOH E 2 .   ? 101.381 96.544  38.134  1.00 40.51 ? 3441 HOH B O   1 
HETATM 7563 O O   . HOH E 2 .   ? 50.118  101.765 17.755  1.00 41.79 ? 3443 HOH B O   1 
HETATM 7564 O O   . HOH E 2 .   ? 69.085  88.354  46.502  1.00 30.21 ? 3445 HOH B O   1 
HETATM 7565 O O   . HOH E 2 .   ? 72.792  84.422  45.075  1.00 39.07 ? 3448 HOH B O   1 
HETATM 7566 O O   . HOH E 2 .   ? 80.185  92.808  48.690  1.00 39.30 ? 3450 HOH B O   1 
HETATM 7567 O O   . HOH E 2 .   ? 49.369  90.490  13.478  1.00 38.36 ? 3452 HOH B O   1 
HETATM 7568 O O   . HOH E 2 .   ? 39.506  83.046  37.212  1.00 42.28 ? 3453 HOH B O   1 
HETATM 7569 O O   . HOH E 2 .   ? 97.292  96.563  44.128  1.00 38.74 ? 3460 HOH B O   1 
HETATM 7570 O O   . HOH E 2 .   ? 58.482  77.549  15.257  1.00 47.70 ? 3464 HOH B O   1 
HETATM 7571 O O   . HOH E 2 .   ? 84.497  85.466  28.920  1.00 37.76 ? 3468 HOH B O   1 
HETATM 7572 O O   . HOH E 2 .   ? 83.096  83.086  46.741  1.00 36.67 ? 3471 HOH B O   1 
HETATM 7573 O O   A HOH E 2 .   ? 98.620  98.662  37.449  0.70 25.44 ? 3474 HOH B O   1 
HETATM 7574 O O   B HOH E 2 .   ? 100.977 99.934  38.018  0.30 50.63 ? 3474 HOH B O   1 
HETATM 7575 O O   . HOH E 2 .   ? 74.904  97.297  44.210  1.00 34.10 ? 3475 HOH B O   1 
HETATM 7576 O O   . HOH E 2 .   ? 72.607  89.589  20.154  1.00 36.68 ? 3476 HOH B O   1 
HETATM 7577 O O   . HOH E 2 .   ? 84.939  89.901  20.047  1.00 44.13 ? 3479 HOH B O   1 
HETATM 7578 O O   . HOH E 2 .   ? 61.016  86.586  44.164  1.00 36.44 ? 3481 HOH B O   1 
HETATM 7579 O O   . HOH E 2 .   ? 54.455  84.045  14.057  1.00 37.13 ? 3489 HOH B O   1 
HETATM 7580 O O   . HOH E 2 .   ? 53.536  98.368  17.658  1.00 30.75 ? 3502 HOH B O   1 
HETATM 7581 O O   . HOH E 2 .   ? 84.291  79.785  44.846  1.00 36.24 ? 3506 HOH B O   1 
HETATM 7582 O O   . HOH E 2 .   ? 52.761  86.089  12.472  1.00 46.18 ? 3512 HOH B O   1 
HETATM 7583 O O   . HOH E 2 .   ? 64.950  98.833  19.000  1.00 35.59 ? 3513 HOH B O   1 
HETATM 7584 O O   . HOH E 2 .   ? 58.149  100.323 17.197  1.00 34.58 ? 3515 HOH B O   1 
HETATM 7585 O O   . HOH E 2 .   ? 66.906  87.935  47.755  1.00 35.94 ? 3519 HOH B O   1 
HETATM 7586 O O   . HOH E 2 .   ? 65.694  100.672 21.131  1.00 43.93 ? 3524 HOH B O   1 
HETATM 7587 O O   . HOH E 2 .   ? 52.985  95.520  15.946  1.00 42.99 ? 3529 HOH B O   1 
HETATM 7588 O O   . HOH E 2 .   ? 75.576  84.978  30.191  1.00 38.59 ? 3535 HOH B O   1 
HETATM 7589 O O   . HOH E 2 .   ? 80.553  107.043 32.283  1.00 36.26 ? 3540 HOH B O   1 
HETATM 7590 O O   . HOH E 2 .   ? 53.674  86.916  41.555  1.00 42.05 ? 3546 HOH B O   1 
HETATM 7591 O O   . HOH E 2 .   ? 87.913  88.888  22.250  1.00 41.59 ? 3547 HOH B O   1 
HETATM 7592 O O   . HOH E 2 .   ? 85.688  104.126 20.338  1.00 41.15 ? 3554 HOH B O   1 
HETATM 7593 O O   . HOH E 2 .   ? 78.343  98.488  49.577  1.00 37.30 ? 3558 HOH B O   1 
HETATM 7594 O O   . HOH F 2 .   ? 38.852  80.961  12.348  1.00 16.02 ? 3001 HOH C O   1 
HETATM 7595 O O   . HOH F 2 .   ? 50.909  75.561  16.286  1.00 19.40 ? 3006 HOH C O   1 
HETATM 7596 O O   . HOH F 2 .   ? 46.744  87.738  19.412  1.00 19.50 ? 3007 HOH C O   1 
HETATM 7597 O O   . HOH F 2 .   ? 17.621  89.836  24.280  1.00 23.70 ? 3011 HOH C O   1 
HETATM 7598 O O   . HOH F 2 .   ? 49.582  76.923  24.400  1.00 22.31 ? 3013 HOH C O   1 
HETATM 7599 O O   . HOH F 2 .   ? 38.729  88.295  30.171  1.00 24.94 ? 3016 HOH C O   1 
HETATM 7600 O O   . HOH F 2 .   ? 46.877  84.986  16.261  1.00 25.38 ? 3018 HOH C O   1 
HETATM 7601 O O   . HOH F 2 .   ? 18.305  88.641  -1.858  1.00 21.46 ? 3024 HOH C O   1 
HETATM 7602 O O   . HOH F 2 .   ? 33.365  69.055  27.608  1.00 22.43 ? 3026 HOH C O   1 
HETATM 7603 O O   . HOH F 2 .   ? 24.779  74.275  18.558  1.00 27.04 ? 3028 HOH C O   1 
HETATM 7604 O O   . HOH F 2 .   ? 48.792  79.118  28.845  1.00 29.49 ? 3032 HOH C O   1 
HETATM 7605 O O   . HOH F 2 .   ? 18.066  86.141  -0.427  1.00 21.89 ? 3036 HOH C O   1 
HETATM 7606 O O   . HOH F 2 .   ? 30.197  68.727  21.362  1.00 24.42 ? 3039 HOH C O   1 
HETATM 7607 O O   . HOH F 2 .   ? 38.450  81.910  24.336  1.00 19.30 ? 3044 HOH C O   1 
HETATM 7608 O O   . HOH F 2 .   ? 33.128  95.336  17.468  1.00 28.32 ? 3046 HOH C O   1 
HETATM 7609 O O   . HOH F 2 .   ? 37.352  65.208  11.030  1.00 29.28 ? 3050 HOH C O   1 
HETATM 7610 O O   . HOH F 2 .   ? 30.922  86.613  32.354  1.00 20.35 ? 3051 HOH C O   1 
HETATM 7611 O O   . HOH F 2 .   ? 17.780  82.804  26.171  1.00 27.49 ? 3053 HOH C O   1 
HETATM 7612 O O   . HOH F 2 .   ? 44.275  84.404  15.857  1.00 22.46 ? 3055 HOH C O   1 
HETATM 7613 O O   . HOH F 2 .   ? 47.282  79.362  23.603  1.00 23.07 ? 3056 HOH C O   1 
HETATM 7614 O O   . HOH F 2 .   ? 34.417  90.772  17.225  1.00 27.53 ? 3059 HOH C O   1 
HETATM 7615 O O   . HOH F 2 .   ? 36.114  64.567  36.791  1.00 31.49 ? 3063 HOH C O   1 
HETATM 7616 O O   . HOH F 2 .   ? 40.062  64.499  27.308  1.00 18.23 ? 3064 HOH C O   1 
HETATM 7617 O O   . HOH F 2 .   ? 28.947  64.950  32.264  1.00 34.48 ? 3065 HOH C O   1 
HETATM 7618 O O   . HOH F 2 .   ? 24.907  76.947  18.175  1.00 22.29 ? 3068 HOH C O   1 
HETATM 7619 O O   . HOH F 2 .   ? 34.222  80.807  12.326  1.00 25.13 ? 3076 HOH C O   1 
HETATM 7620 O O   . HOH F 2 .   ? 47.507  66.742  13.921  1.00 29.26 ? 3079 HOH C O   1 
HETATM 7621 O O   . HOH F 2 .   ? 32.638  100.915 10.188  1.00 28.22 ? 3082 HOH C O   1 
HETATM 7622 O O   . HOH F 2 .   ? 28.606  67.107  19.894  1.00 22.53 ? 3083 HOH C O   1 
HETATM 7623 O O   . HOH F 2 .   ? 11.852  88.321  17.837  1.00 24.79 ? 3084 HOH C O   1 
HETATM 7624 O O   . HOH F 2 .   ? 39.263  83.997  17.451  1.00 29.98 ? 3086 HOH C O   1 
HETATM 7625 O O   . HOH F 2 .   ? 44.918  77.238  9.334   1.00 29.34 ? 3089 HOH C O   1 
HETATM 7626 O O   . HOH F 2 .   ? 28.498  96.783  27.896  1.00 30.33 ? 3092 HOH C O   1 
HETATM 7627 O O   . HOH F 2 .   ? 32.532  75.606  34.162  1.00 27.60 ? 3093 HOH C O   1 
HETATM 7628 O O   . HOH F 2 .   ? 24.508  104.787 27.027  1.00 39.65 ? 3095 HOH C O   1 
HETATM 7629 O O   . HOH F 2 .   ? 32.476  92.797  20.767  1.00 30.50 ? 3098 HOH C O   1 
HETATM 7630 O O   . HOH F 2 .   ? 27.764  74.254  14.542  1.00 26.90 ? 3099 HOH C O   1 
HETATM 7631 O O   . HOH F 2 .   ? 13.269  88.003  23.847  1.00 27.98 ? 3105 HOH C O   1 
HETATM 7632 O O   . HOH F 2 .   ? 30.491  102.464 17.638  1.00 26.32 ? 3113 HOH C O   1 
HETATM 7633 O O   . HOH F 2 .   ? 28.694  80.079  32.380  1.00 32.26 ? 3114 HOH C O   1 
HETATM 7634 O O   . HOH F 2 .   ? 48.260  72.779  13.575  1.00 23.30 ? 3117 HOH C O   1 
HETATM 7635 O O   . HOH F 2 .   ? 32.668  93.652  30.230  1.00 27.17 ? 3118 HOH C O   1 
HETATM 7636 O O   . HOH F 2 .   ? 27.389  81.733  -0.741  1.00 29.59 ? 3120 HOH C O   1 
HETATM 7637 O O   . HOH F 2 .   ? 40.617  65.937  10.409  1.00 33.66 ? 3121 HOH C O   1 
HETATM 7638 O O   . HOH F 2 .   ? 43.494  85.894  9.641   1.00 26.86 ? 3124 HOH C O   1 
HETATM 7639 O O   . HOH F 2 .   ? 14.932  87.764  6.810   1.00 35.56 ? 3127 HOH C O   1 
HETATM 7640 O O   . HOH F 2 .   ? 28.830  77.309  11.746  1.00 27.94 ? 3129 HOH C O   1 
HETATM 7641 O O   . HOH F 2 .   ? 44.719  72.271  27.790  1.00 26.77 ? 3137 HOH C O   1 
HETATM 7642 O O   . HOH F 2 .   ? 19.299  80.850  19.569  1.00 27.37 ? 3138 HOH C O   1 
HETATM 7643 O O   . HOH F 2 .   ? 19.423  82.049  13.372  1.00 31.33 ? 3140 HOH C O   1 
HETATM 7644 O O   . HOH F 2 .   ? 49.640  68.334  13.352  1.00 36.24 ? 3144 HOH C O   1 
HETATM 7645 O O   . HOH F 2 .   ? 50.661  71.607  22.646  1.00 28.20 ? 3146 HOH C O   1 
HETATM 7646 O O   . HOH F 2 .   ? 42.237  82.404  9.936   1.00 23.67 ? 3148 HOH C O   1 
HETATM 7647 O O   . HOH F 2 .   ? 31.312  95.277  19.671  1.00 33.99 ? 3149 HOH C O   1 
HETATM 7648 O O   . HOH F 2 .   ? 30.364  87.491  0.198   1.00 27.86 ? 3152 HOH C O   1 
HETATM 7649 O O   . HOH F 2 .   ? 35.995  97.967  16.085  1.00 31.66 ? 3155 HOH C O   1 
HETATM 7650 O O   . HOH F 2 .   ? 32.703  88.286  33.600  1.00 30.31 ? 3157 HOH C O   1 
HETATM 7651 O O   . HOH F 2 .   ? 35.428  84.183  5.765   1.00 35.97 ? 3160 HOH C O   1 
HETATM 7652 O O   . HOH F 2 .   ? 26.328  78.032  4.499   1.00 33.81 ? 3163 HOH C O   1 
HETATM 7653 O O   . HOH F 2 .   ? 24.042  93.810  29.001  1.00 28.19 ? 3165 HOH C O   1 
HETATM 7654 O O   . HOH F 2 .   ? 42.392  76.631  7.960   1.00 33.41 ? 3166 HOH C O   1 
HETATM 7655 O O   . HOH F 2 .   ? 31.601  92.288  9.857   1.00 38.37 ? 3167 HOH C O   1 
HETATM 7656 O O   . HOH F 2 .   ? 19.131  96.258  25.631  1.00 25.13 ? 3168 HOH C O   1 
HETATM 7657 O O   . HOH F 2 .   ? 35.131  70.855  7.299   1.00 27.69 ? 3175 HOH C O   1 
HETATM 7658 O O   . HOH F 2 .   ? 30.513  99.746  11.389  1.00 31.55 ? 3177 HOH C O   1 
HETATM 7659 O O   . HOH F 2 .   ? 35.997  86.382  11.874  1.00 28.29 ? 3178 HOH C O   1 
HETATM 7660 O O   . HOH F 2 .   ? 37.407  58.086  26.443  1.00 39.00 ? 3179 HOH C O   1 
HETATM 7661 O O   . HOH F 2 .   ? 51.556  78.415  16.349  1.00 30.40 ? 3180 HOH C O   1 
HETATM 7662 O O   . HOH F 2 .   ? 36.753  85.269  19.625  1.00 26.69 ? 3181 HOH C O   1 
HETATM 7663 O O   . HOH F 2 .   ? 32.000  81.941  13.329  1.00 31.32 ? 3183 HOH C O   1 
HETATM 7664 O O   . HOH F 2 .   ? 17.773  89.715  27.041  1.00 35.84 ? 3185 HOH C O   1 
HETATM 7665 O O   . HOH F 2 .   ? 7.629   87.339  19.035  1.00 37.30 ? 3188 HOH C O   1 
HETATM 7666 O O   . HOH F 2 .   ? 18.322  79.647  12.793  1.00 35.02 ? 3189 HOH C O   1 
HETATM 7667 O O   . HOH F 2 .   ? 31.151  108.662 12.604  1.00 32.97 ? 3190 HOH C O   1 
HETATM 7668 O O   . HOH F 2 .   ? 41.522  86.078  16.267  1.00 38.79 ? 3192 HOH C O   1 
HETATM 7669 O O   . HOH F 2 .   ? 10.512  106.273 8.500   1.00 33.68 ? 3193 HOH C O   1 
HETATM 7670 O O   . HOH F 2 .   ? 26.571  89.100  33.590  1.00 32.95 ? 3194 HOH C O   1 
HETATM 7671 O O   . HOH F 2 .   ? 44.153  64.612  11.599  1.00 23.93 ? 3196 HOH C O   1 
HETATM 7672 O O   . HOH F 2 .   ? 29.156  65.306  16.211  1.00 26.51 ? 3199 HOH C O   1 
HETATM 7673 O O   . HOH F 2 .   ? 41.665  81.387  18.995  1.00 25.28 ? 3207 HOH C O   1 
HETATM 7674 O O   . HOH F 2 .   ? 26.334  67.170  21.014  1.00 28.40 ? 3214 HOH C O   1 
HETATM 7675 O O   . HOH F 2 .   ? 28.511  62.162  16.083  1.00 32.51 ? 3215 HOH C O   1 
HETATM 7676 O O   . HOH F 2 .   ? 19.702  77.094  13.346  1.00 31.77 ? 3217 HOH C O   1 
HETATM 7677 O O   . HOH F 2 .   ? 34.585  107.715 7.561   1.00 41.78 ? 3219 HOH C O   1 
HETATM 7678 O O   . HOH F 2 .   ? 26.583  98.778  3.192   1.00 27.21 ? 3220 HOH C O   1 
HETATM 7679 O O   . HOH F 2 .   ? 9.761   97.289  18.353  1.00 35.42 ? 3221 HOH C O   1 
HETATM 7680 O O   . HOH F 2 .   ? 48.846  84.840  14.105  1.00 31.53 ? 3224 HOH C O   1 
HETATM 7681 O O   . HOH F 2 .   ? 51.014  73.780  20.712  1.00 30.09 ? 3225 HOH C O   1 
HETATM 7682 O O   . HOH F 2 .   ? 30.702  63.517  30.306  1.00 38.44 ? 3230 HOH C O   1 
HETATM 7683 O O   . HOH F 2 .   ? 20.205  75.519  10.867  1.00 39.20 ? 3231 HOH C O   1 
HETATM 7684 O O   . HOH F 2 .   ? 28.643  72.089  27.335  1.00 32.10 ? 3234 HOH C O   1 
HETATM 7685 O O   . HOH F 2 .   ? 18.400  107.845 5.471   1.00 29.26 ? 3237 HOH C O   1 
HETATM 7686 O O   . HOH F 2 .   ? 47.941  78.808  26.061  1.00 29.37 ? 3240 HOH C O   1 
HETATM 7687 O O   . HOH F 2 .   ? 48.298  84.205  10.359  1.00 37.93 ? 3241 HOH C O   1 
HETATM 7688 O O   . HOH F 2 .   ? 38.594  61.520  26.215  1.00 32.23 ? 3247 HOH C O   1 
HETATM 7689 O O   . HOH F 2 .   ? 16.555  78.892  3.985   1.00 38.77 ? 3248 HOH C O   1 
HETATM 7690 O O   . HOH F 2 .   ? 38.646  59.025  16.143  1.00 33.52 ? 3255 HOH C O   1 
HETATM 7691 O O   . HOH F 2 .   ? 37.361  62.497  10.546  1.00 35.78 ? 3256 HOH C O   1 
HETATM 7692 O O   . HOH F 2 .   ? 19.062  82.156  -0.088  1.00 39.44 ? 3267 HOH C O   1 
HETATM 7693 O O   . HOH F 2 .   ? 42.715  77.483  37.809  1.00 28.28 ? 3269 HOH C O   1 
HETATM 7694 O O   . HOH F 2 .   ? 24.119  61.544  26.367  1.00 37.28 ? 3270 HOH C O   1 
HETATM 7695 O O   . HOH F 2 .   ? 34.263  83.962  34.667  1.00 36.54 ? 3273 HOH C O   1 
HETATM 7696 O O   . HOH F 2 .   ? 17.444  110.461 8.671   1.00 37.06 ? 3274 HOH C O   1 
HETATM 7697 O O   . HOH F 2 .   ? 19.933  101.732 -1.415  1.00 37.95 ? 3278 HOH C O   1 
HETATM 7698 O O   . HOH F 2 .   ? 24.791  72.762  23.008  1.00 26.26 ? 3279 HOH C O   1 
HETATM 7699 O O   . HOH F 2 .   ? 26.546  94.483  -9.012  1.00 41.14 ? 3284 HOH C O   1 
HETATM 7700 O O   . HOH F 2 .   ? 48.579  73.509  8.661   1.00 50.68 ? 3287 HOH C O   1 
HETATM 7701 O O   . HOH F 2 .   ? 50.941  77.358  21.730  1.00 29.71 ? 3291 HOH C O   1 
HETATM 7702 O O   . HOH F 2 .   ? 26.998  83.720  9.219   1.00 31.94 ? 3292 HOH C O   1 
HETATM 7703 O O   . HOH F 2 .   ? 29.043  100.853 0.684   1.00 33.08 ? 3293 HOH C O   1 
HETATM 7704 O O   . HOH F 2 .   ? 20.568  108.535 -0.090  1.00 46.86 ? 3294 HOH C O   1 
HETATM 7705 O O   . HOH F 2 .   ? 17.814  83.902  16.366  1.00 31.88 ? 3302 HOH C O   1 
HETATM 7706 O O   . HOH F 2 .   ? 28.359  78.427  34.309  1.00 41.09 ? 3305 HOH C O   1 
HETATM 7707 O O   . HOH F 2 .   ? 44.870  60.239  15.931  1.00 40.04 ? 3309 HOH C O   1 
HETATM 7708 O O   . HOH F 2 .   ? 27.059  81.596  7.307   1.00 33.78 ? 3315 HOH C O   1 
HETATM 7709 O O   . HOH F 2 .   ? 34.454  70.469  34.459  1.00 45.61 ? 3317 HOH C O   1 
HETATM 7710 O O   . HOH F 2 .   ? 26.484  111.303 20.697  1.00 42.56 ? 3318 HOH C O   1 
HETATM 7711 O O   . HOH F 2 .   ? 14.239  84.670  7.262   1.00 39.45 ? 3319 HOH C O   1 
HETATM 7712 O O   . HOH F 2 .   ? 40.211  68.300  40.269  1.00 37.58 ? 3320 HOH C O   1 
HETATM 7713 O O   . HOH F 2 .   ? 33.230  107.062 21.041  1.00 43.90 ? 3324 HOH C O   1 
HETATM 7714 O O   . HOH F 2 .   ? 22.940  98.903  -7.177  1.00 38.42 ? 3325 HOH C O   1 
HETATM 7715 O O   . HOH F 2 .   ? 29.641  108.919 16.046  1.00 35.32 ? 3327 HOH C O   1 
HETATM 7716 O O   . HOH F 2 .   ? 9.508   94.871  17.685  1.00 27.37 ? 3328 HOH C O   1 
HETATM 7717 O O   . HOH F 2 .   ? 25.698  71.382  15.128  1.00 37.96 ? 3330 HOH C O   1 
HETATM 7718 O O   . HOH F 2 .   ? 25.960  79.435  0.339   1.00 45.32 ? 3335 HOH C O   1 
HETATM 7719 O O   . HOH F 2 .   ? 28.067  62.034  24.780  1.00 37.92 ? 3337 HOH C O   1 
HETATM 7720 O O   . HOH F 2 .   ? 41.338  77.953  40.856  1.00 50.99 ? 3339 HOH C O   1 
HETATM 7721 O O   . HOH F 2 .   ? 45.742  75.968  36.601  1.00 42.77 ? 3340 HOH C O   1 
HETATM 7722 O O   . HOH F 2 .   ? 38.708  97.129  9.789   1.00 48.04 ? 3343 HOH C O   1 
HETATM 7723 O O   . HOH F 2 .   ? 27.923  65.651  29.797  1.00 33.30 ? 3345 HOH C O   1 
HETATM 7724 O O   . HOH F 2 .   ? 28.636  99.456  29.362  1.00 37.54 ? 3349 HOH C O   1 
HETATM 7725 O O   . HOH F 2 .   ? 22.048  93.798  32.043  1.00 42.40 ? 3350 HOH C O   1 
HETATM 7726 O O   . HOH F 2 .   ? 30.494  68.156  10.870  1.00 35.53 ? 3360 HOH C O   1 
HETATM 7727 O O   . HOH F 2 .   ? 30.654  95.671  1.993   1.00 39.87 ? 3362 HOH C O   1 
HETATM 7728 O O   . HOH F 2 .   ? 31.077  87.221  2.636   1.00 33.75 ? 3366 HOH C O   1 
HETATM 7729 O O   . HOH F 2 .   ? 27.851  79.469  8.151   1.00 37.63 ? 3368 HOH C O   1 
HETATM 7730 O O   . HOH F 2 .   ? 9.102   102.531 14.275  1.00 32.42 ? 3371 HOH C O   1 
HETATM 7731 O O   . HOH F 2 .   ? 27.601  106.653 25.949  1.00 37.85 ? 3376 HOH C O   1 
HETATM 7732 O O   . HOH F 2 .   ? 33.556  98.918  5.499   1.00 39.08 ? 3378 HOH C O   1 
HETATM 7733 O O   . HOH F 2 .   ? 42.785  55.751  24.738  1.00 34.22 ? 3380 HOH C O   1 
HETATM 7734 O O   . HOH F 2 .   ? 30.477  94.133  3.693   1.00 38.67 ? 3385 HOH C O   1 
HETATM 7735 O O   . HOH F 2 .   ? 24.495  96.994  -9.884  1.00 43.08 ? 3386 HOH C O   1 
HETATM 7736 O O   . HOH F 2 .   ? 20.053  89.414  -5.293  1.00 35.27 ? 3392 HOH C O   1 
HETATM 7737 O O   . HOH F 2 .   ? 15.413  82.785  22.812  1.00 49.23 ? 3393 HOH C O   1 
HETATM 7738 O O   . HOH F 2 .   ? 32.350  96.801  12.514  1.00 41.24 ? 3397 HOH C O   1 
HETATM 7739 O O   . HOH F 2 .   ? 23.330  78.342  25.504  1.00 30.78 ? 3399 HOH C O   1 
HETATM 7740 O O   . HOH F 2 .   ? 12.870  110.227 13.437  1.00 43.12 ? 3402 HOH C O   1 
HETATM 7741 O O   . HOH F 2 .   ? 12.847  93.537  26.744  1.00 33.27 ? 3403 HOH C O   1 
HETATM 7742 O O   . HOH F 2 .   ? 26.756  85.844  -5.605  1.00 38.23 ? 3405 HOH C O   1 
HETATM 7743 O O   . HOH F 2 .   ? 30.604  75.239  10.846  1.00 35.66 ? 3407 HOH C O   1 
HETATM 7744 O O   . HOH F 2 .   ? 34.917  77.134  34.419  1.00 33.70 ? 3410 HOH C O   1 
HETATM 7745 O O   . HOH F 2 .   ? 38.257  64.806  39.587  1.00 38.07 ? 3412 HOH C O   1 
HETATM 7746 O O   . HOH F 2 .   ? 36.344  86.112  7.654   1.00 33.55 ? 3413 HOH C O   1 
HETATM 7747 O O   . HOH F 2 .   ? 52.339  74.331  18.200  1.00 26.90 ? 3414 HOH C O   1 
HETATM 7748 O O   . HOH F 2 .   ? 51.696  74.680  13.772  1.00 27.21 ? 3417 HOH C O   1 
HETATM 7749 O O   . HOH F 2 .   ? 14.994  89.937  24.690  1.00 21.41 ? 3419 HOH C O   1 
HETATM 7750 O O   . HOH F 2 .   ? 28.627  67.763  17.340  1.00 26.70 ? 3420 HOH C O   1 
HETATM 7751 O O   . HOH F 2 .   ? 47.498  87.677  16.518  1.00 22.26 ? 3421 HOH C O   1 
HETATM 7752 O O   . HOH F 2 .   ? 26.177  93.092  30.549  1.00 31.98 ? 3424 HOH C O   1 
HETATM 7753 O O   . HOH F 2 .   ? 42.457  66.663  40.008  1.00 39.50 ? 3429 HOH C O   1 
HETATM 7754 O O   . HOH F 2 .   ? 20.967  97.189  27.520  1.00 33.30 ? 3437 HOH C O   1 
HETATM 7755 O O   . HOH F 2 .   ? 34.999  93.658  21.473  1.00 36.27 ? 3438 HOH C O   1 
HETATM 7756 O O   . HOH F 2 .   ? 50.481  72.711  12.185  1.00 28.62 ? 3439 HOH C O   1 
HETATM 7757 O O   . HOH F 2 .   ? 13.584  91.205  27.063  1.00 32.28 ? 3440 HOH C O   1 
HETATM 7758 O O   . HOH F 2 .   ? 41.525  63.747  9.034   1.00 36.99 ? 3442 HOH C O   1 
HETATM 7759 O O   . HOH F 2 .   ? 43.439  87.550  13.493  1.00 34.30 ? 3449 HOH C O   1 
HETATM 7760 O O   . HOH F 2 .   ? 36.685  66.476  7.926   1.00 40.53 ? 3454 HOH C O   1 
HETATM 7761 O O   . HOH F 2 .   ? 16.376  89.638  -3.424  1.00 41.55 ? 3456 HOH C O   1 
HETATM 7762 O O   . HOH F 2 .   ? 15.901  90.827  28.847  1.00 36.81 ? 3459 HOH C O   1 
HETATM 7763 O O   . HOH F 2 .   ? 20.609  79.699  0.256   1.00 37.74 ? 3466 HOH C O   1 
HETATM 7764 O O   . HOH F 2 .   ? 25.509  74.288  15.868  1.00 36.79 ? 3467 HOH C O   1 
HETATM 7765 O O   . HOH F 2 .   ? 43.267  88.384  11.090  1.00 43.83 ? 3469 HOH C O   1 
HETATM 7766 O O   . HOH F 2 .   ? 39.025  76.561  37.141  1.00 45.09 ? 3470 HOH C O   1 
HETATM 7767 O O   . HOH F 2 .   ? 32.553  58.887  35.054  1.00 39.15 ? 3478 HOH C O   1 
HETATM 7768 O O   . HOH F 2 .   ? 14.639  99.800  4.381   1.00 44.37 ? 3480 HOH C O   1 
HETATM 7769 O O   . HOH F 2 .   ? 26.228  69.049  16.653  1.00 33.05 ? 3483 HOH C O   1 
HETATM 7770 O O   . HOH F 2 .   ? 29.860  82.072  34.084  1.00 28.95 ? 3484 HOH C O   1 
HETATM 7771 O O   . HOH F 2 .   ? 33.038  72.100  6.117   1.00 33.45 ? 3486 HOH C O   1 
HETATM 7772 O O   . HOH F 2 .   ? 50.658  70.103  11.140  1.00 41.86 ? 3487 HOH C O   1 
HETATM 7773 O O   . HOH F 2 .   ? 14.367  90.258  3.839   1.00 36.24 ? 3488 HOH C O   1 
HETATM 7774 O O   . HOH F 2 .   ? 16.924  82.269  20.697  1.00 48.81 ? 3492 HOH C O   1 
HETATM 7775 O O   . HOH F 2 .   ? 34.986  93.047  24.122  1.00 42.69 ? 3496 HOH C O   1 
HETATM 7776 O O   . HOH F 2 .   ? 47.309  65.040  11.852  1.00 33.85 ? 3498 HOH C O   1 
HETATM 7777 O O   . HOH F 2 .   ? 25.130  114.004 9.436   1.00 44.32 ? 3499 HOH C O   1 
HETATM 7778 O O   . HOH F 2 .   ? 11.791  99.951  19.853  1.00 37.50 ? 3503 HOH C O   1 
HETATM 7779 O O   . HOH F 2 .   ? 25.890  90.132  31.424  1.00 34.81 ? 3504 HOH C O   1 
HETATM 7780 O O   . HOH F 2 .   ? 29.620  75.069  8.287   1.00 44.84 ? 3505 HOH C O   1 
HETATM 7781 O O   . HOH F 2 .   ? 39.876  75.572  7.860   1.00 36.75 ? 3507 HOH C O   1 
HETATM 7782 O O   . HOH F 2 .   ? 47.000  76.782  7.368   1.00 43.07 ? 3514 HOH C O   1 
HETATM 7783 O O   . HOH F 2 .   ? 47.740  86.374  11.977  1.00 44.36 ? 3516 HOH C O   1 
HETATM 7784 O O   . HOH F 2 .   ? 26.115  81.760  32.819  1.00 45.73 ? 3517 HOH C O   1 
HETATM 7785 O O   . HOH F 2 .   ? 32.177  74.809  6.951   1.00 38.10 ? 3518 HOH C O   1 
HETATM 7786 O O   . HOH F 2 .   ? 29.356  99.178  2.659   1.00 39.81 ? 3520 HOH C O   1 
HETATM 7787 O O   . HOH F 2 .   ? 45.414  88.667  15.102  1.00 30.24 ? 3521 HOH C O   1 
HETATM 7788 O O   . HOH F 2 .   ? 47.133  71.025  36.800  1.00 37.10 ? 3522 HOH C O   1 
HETATM 7789 O O   . HOH F 2 .   ? 14.091  94.573  29.341  1.00 37.69 ? 3526 HOH C O   1 
HETATM 7790 O O   . HOH F 2 .   ? 18.498  86.341  -6.084  1.00 43.76 ? 3528 HOH C O   1 
HETATM 7791 O O   . HOH F 2 .   ? 28.299  59.073  16.332  1.00 41.23 ? 3530 HOH C O   1 
HETATM 7792 O O   . HOH F 2 .   ? 19.185  81.713  16.563  1.00 34.50 ? 3533 HOH C O   1 
HETATM 7793 O O   . HOH F 2 .   ? 30.874  62.918  25.543  1.00 41.23 ? 3537 HOH C O   1 
HETATM 7794 O O   . HOH F 2 .   ? 42.885  81.449  7.343   1.00 36.88 ? 3541 HOH C O   1 
HETATM 7795 O O   . HOH F 2 .   ? 28.599  87.161  34.079  1.00 39.38 ? 3545 HOH C O   1 
HETATM 7796 O O   . HOH F 2 .   ? 28.188  94.767  30.077  1.00 33.13 ? 3549 HOH C O   1 
HETATM 7797 O O   . HOH F 2 .   ? 17.158  98.173  2.538   1.00 38.61 ? 3550 HOH C O   1 
HETATM 7798 O O   . HOH F 2 .   ? 16.073  109.051 6.340   1.00 45.98 ? 3551 HOH C O   1 
HETATM 7799 O O   . HOH F 2 .   ? 29.862  111.947 14.509  1.00 50.33 ? 3552 HOH C O   1 
HETATM 7800 O O   . HOH F 2 .   ? 24.557  100.991 -5.078  1.00 45.71 ? 3553 HOH C O   1 
HETATM 7801 O O   . HOH F 2 .   ? 20.297  95.696  -4.370  1.00 45.27 ? 3555 HOH C O   1 
HETATM 7802 O O   . HOH F 2 .   ? 34.622  97.031  22.097  1.00 53.59 ? 3556 HOH C O   1 
HETATM 7803 O O   . HOH F 2 .   ? 38.732  88.819  11.506  1.00 45.95 ? 3557 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   2   SER SER A . n 
A 1 2   LYS 2   3   3   LYS LYS A . n 
A 1 3   LYS 3   4   4   LYS LYS A . n 
A 1 4   LEU 4   5   5   LEU LEU A . n 
A 1 5   LEU 5   6   6   LEU LEU A . n 
A 1 6   PHE 6   7   7   PHE PHE A . n 
A 1 7   GLN 7   8   8   GLN GLN A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   ASP 9   10  10  ASP ASP A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  ASP 11  12  12  ASP ASP A . n 
A 1 12  ALA 12  13  13  ALA ALA A . n 
A 1 13  THR 13  14  14  THR THR A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  SER 15  16  16  SER SER A . n 
A 1 16  VAL 16  17  17  VAL VAL A . n 
A 1 17  PHE 17  18  18  PHE PHE A . n 
A 1 18  ASP 18  19  19  ASP ASP A . n 
A 1 19  VAL 19  20  20  VAL VAL A . n 
A 1 20  VAL 20  21  21  VAL VAL A . n 
A 1 21  VAL 21  22  22  VAL VAL A . n 
A 1 22  GLY 22  23  23  GLY GLY A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  ASP 24  25  25  ASP ASP A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  ALA 27  28  28  ALA ALA A . n 
A 1 28  ASP 28  29  29  ASP ASP A . n 
A 1 29  HIS 29  30  30  HIS HIS A . n 
A 1 30  ILE 30  31  31  ILE ILE A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  GLY 32  33  33  GLY GLY A . n 
A 1 33  TYR 33  34  34  TYR TYR A . n 
A 1 34  GLY 34  35  35  GLY GLY A . n 
A 1 35  ASN 35  36  36  ASN ASN A . n 
A 1 36  VAL 36  37  37  VAL VAL A . n 
A 1 37  THR 37  38  38  THR THR A . n 
A 1 38  PRO 38  39  39  PRO PRO A . n 
A 1 39  ASP 39  40  40  ASP ASP A . n 
A 1 40  ASN 40  41  41  ASN ASN A . n 
A 1 41  VAL 41  42  42  VAL VAL A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  ALA 43  44  44  ALA ALA A . n 
A 1 44  TYR 44  45  45  TYR TYR A . n 
A 1 45  VAL 45  46  46  VAL VAL A . n 
A 1 46  ASP 46  47  47  ASP ASP A . n 
A 1 47  GLY 47  48  48  GLY GLY A . n 
A 1 48  THR 48  49  49  THR THR A . n 
A 1 49  ILE 49  50  50  ILE ILE A . n 
A 1 50  TYR 50  51  51  TYR TYR A . n 
A 1 51  THR 51  52  52  THR THR A . n 
A 1 52  ARG 52  53  53  ARG ARG A . n 
A 1 53  GLY 53  54  54  GLY GLY A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  LYS 55  56  56  LYS LYS A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  LYS 57  58  58  LYS LYS A . n 
A 1 58  GLN 58  59  59  GLN GLN A . n 
A 1 59  SER 59  60  60  SER SER A . n 
A 1 60  THR 60  61  61  THR THR A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  PHE 63  64  64  PHE PHE A . n 
A 1 64  VAL 64  65  65  VAL VAL A . n 
A 1 65  GLY 65  66  66  GLY GLY A . n 
A 1 66  GLY 66  67  67  GLY GLY A . n 
A 1 67  GLY 67  68  68  GLY GLY A . n 
A 1 68  ASP 68  69  69  ASP ASP A . n 
A 1 69  MET 69  70  70  MET MET A . n 
A 1 70  ALA 70  71  71  ALA ALA A . n 
A 1 71  ALA 71  72  72  ALA ALA A . n 
A 1 72  GLY 72  73  73  GLY GLY A . n 
A 1 73  GLU 73  74  74  GLU GLU A . n 
A 1 74  ARG 74  75  75  ARG ARG A . n 
A 1 75  VAL 75  76  76  VAL VAL A . n 
A 1 76  PHE 76  77  77  PHE PHE A . n 
A 1 77  GLU 77  78  78  GLU GLU A . n 
A 1 78  ALA 78  79  79  ALA ALA A . n 
A 1 79  VAL 79  80  80  VAL VAL A . n 
A 1 80  LYS 80  81  81  LYS LYS A . n 
A 1 81  LYS 81  82  82  LYS LYS A . n 
A 1 82  ARG 82  83  83  ARG ARG A . n 
A 1 83  PHE 83  84  84  PHE PHE A . n 
A 1 84  PHE 84  85  85  PHE PHE A . n 
A 1 85  GLY 85  86  86  GLY GLY A . n 
A 1 86  PRO 86  87  87  PRO PRO A . n 
A 1 87  PHE 87  88  88  PHE PHE A . n 
A 1 88  ARG 88  89  89  ARG ARG A . n 
A 1 89  VAL 89  90  90  VAL VAL A . n 
A 1 90  SER 90  91  91  SER SER A . n 
A 1 91  CYS 91  92  92  CYS CYS A . n 
A 1 92  MET 92  93  93  MET MET A . n 
A 1 93  LEU 93  94  94  LEU LEU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  SER 95  96  96  SER SER A . n 
A 1 96  ASN 96  97  97  ASN ASN A . n 
A 1 97  GLY 97  98  98  GLY GLY A . n 
A 1 98  SER 98  99  99  SER SER A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 THR 100 101 101 THR THR A . n 
A 1 101 THR 101 102 102 THR THR A . n 
A 1 102 ALA 102 103 103 ALA ALA A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 ALA 104 105 105 ALA ALA A . n 
A 1 105 GLY 105 106 106 GLY GLY A . n 
A 1 106 VAL 106 107 107 VAL VAL A . n 
A 1 107 ALA 107 108 108 ALA ALA A . n 
A 1 108 LEU 108 109 109 LEU LEU A . n 
A 1 109 VAL 109 110 110 VAL VAL A . n 
A 1 110 VAL 110 111 111 VAL VAL A . n 
A 1 111 LYS 111 112 112 LYS LYS A . n 
A 1 112 ALA 112 113 113 ALA ALA A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 GLY 114 115 115 GLY GLY A . n 
A 1 115 GLY 115 116 116 GLY GLY A . n 
A 1 116 SER 116 117 117 SER SER A . n 
A 1 117 VAL 117 118 118 VAL VAL A . n 
A 1 118 LYS 118 119 119 LYS LYS A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 LYS 120 121 121 LYS LYS A . n 
A 1 121 LYS 121 122 122 LYS LYS A . n 
A 1 122 ALA 122 123 123 ALA ALA A . n 
A 1 123 VAL 123 124 124 VAL VAL A . n 
A 1 124 VAL 124 125 125 VAL VAL A . n 
A 1 125 LEU 125 126 126 LEU LEU A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 GLY 127 128 128 GLY GLY A . n 
A 1 128 THR 128 129 129 THR THR A . n 
A 1 129 GLY 129 130 130 GLY GLY A . n 
A 1 130 PRO 130 131 131 PRO PRO A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 GLY 132 133 133 GLY GLY A . n 
A 1 133 MET 133 134 134 MET MET A . n 
A 1 134 ARG 134 135 135 ARG ARG A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ALA 136 137 137 ALA ALA A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 LEU 138 139 139 LEU LEU A . n 
A 1 139 LEU 139 140 140 LEU LEU A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLY 141 142 142 GLY GLY A . n 
A 1 142 GLU 142 143 143 GLU GLU A . n 
A 1 143 GLY 143 144 144 GLY GLY A . n 
A 1 144 ALA 144 145 145 ALA ALA A . n 
A 1 145 GLU 145 146 146 GLU GLU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 VAL 147 148 148 VAL VAL A . n 
A 1 148 LEU 148 149 149 LEU LEU A . n 
A 1 149 CYS 149 150 150 CYS CYS A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 LYS 152 153 153 LYS LYS A . n 
A 1 153 LEU 153 154 154 LEU LEU A . n 
A 1 154 ASP 154 155 155 ASP ASP A . n 
A 1 155 LYS 155 156 156 LYS LYS A . n 
A 1 156 ALA 156 157 157 ALA ALA A . n 
A 1 157 GLN 157 158 158 GLN GLN A . n 
A 1 158 ALA 158 159 159 ALA ALA A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 ALA 160 161 161 ALA ALA A . n 
A 1 161 ASP 161 162 162 ASP ASP A . n 
A 1 162 SER 162 163 163 SER SER A . n 
A 1 163 VAL 163 164 164 VAL VAL A . n 
A 1 164 ASN 164 165 165 ASN ASN A . n 
A 1 165 LYS 165 166 166 LYS LYS A . n 
A 1 166 ARG 166 167 167 ARG ARG A . n 
A 1 167 PHE 167 168 168 PHE PHE A . n 
A 1 168 LYS 168 169 169 LYS LYS A . n 
A 1 169 VAL 169 170 170 VAL VAL A . n 
A 1 170 ASN 170 171 171 ASN ASN A . n 
A 1 171 VAL 171 172 172 VAL VAL A . n 
A 1 172 THR 172 173 173 THR THR A . n 
A 1 173 ALA 173 174 174 ALA ALA A . n 
A 1 174 ALA 174 175 175 ALA ALA A . n 
A 1 175 GLU 175 176 176 GLU GLU A . n 
A 1 176 THR 176 177 177 THR THR A . n 
A 1 177 ALA 177 178 178 ALA ALA A . n 
A 1 178 ASP 178 179 179 ASP ASP A . n 
A 1 179 ASP 179 180 180 ASP ASP A . n 
A 1 180 ALA 180 181 181 ALA ALA A . n 
A 1 181 SER 181 182 182 SER SER A . n 
A 1 182 ARG 182 183 183 ARG ARG A . n 
A 1 183 ALA 183 184 184 ALA ALA A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ALA 185 186 186 ALA ALA A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 LYS 187 188 188 LYS LYS A . n 
A 1 188 GLY 188 189 189 GLY GLY A . n 
A 1 189 ALA 189 190 190 ALA ALA A . n 
A 1 190 HIS 190 191 191 HIS HIS A . n 
A 1 191 PHE 191 192 192 PHE PHE A . n 
A 1 192 VAL 192 193 193 VAL VAL A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 ALA 195 196 196 ALA ALA A . n 
A 1 196 GLY 196 197 197 GLY GLY A . n 
A 1 197 ALA 197 198 198 ALA ALA A . n 
A 1 198 ILE 198 199 199 ILE ILE A . n 
A 1 199 GLY 199 200 200 GLY GLY A . n 
A 1 200 LEU 200 201 201 LEU LEU A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 LEU 202 203 203 LEU LEU A . n 
A 1 203 LEU 203 204 204 LEU LEU A . n 
A 1 204 PRO 204 205 205 PRO PRO A . n 
A 1 205 GLN 205 206 206 GLN GLN A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 ALA 207 208 208 ALA ALA A . n 
A 1 208 TRP 208 209 209 TRP TRP A . n 
A 1 209 GLN 209 210 210 GLN GLN A . n 
A 1 210 ASN 210 211 211 ASN ASN A . n 
A 1 211 GLU 211 212 212 GLU GLU A . n 
A 1 212 SER 212 213 213 SER SER A . n 
A 1 213 SER 213 214 214 SER SER A . n 
A 1 214 ILE 214 215 215 ILE ILE A . n 
A 1 215 GLU 215 216 216 GLU GLU A . n 
A 1 216 ILE 216 217 217 ILE ILE A . n 
A 1 217 VAL 217 218 218 VAL VAL A . n 
A 1 218 ALA 218 219 219 ALA ALA A . n 
A 1 219 ASP 219 220 220 ASP ASP A . n 
A 1 220 TYR 220 221 221 TYR TYR A . n 
A 1 221 ASN 221 222 222 ASN ASN A . n 
A 1 222 ALA 222 223 223 ALA ALA A . n 
A 1 223 GLN 223 224 224 GLN GLN A . n 
A 1 224 PRO 224 225 225 PRO PRO A . n 
A 1 225 PRO 225 226 226 PRO PRO A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLY 227 228 228 GLY GLY A . n 
A 1 228 ILE 228 229 229 ILE ILE A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 GLY 230 231 231 GLY GLY A . n 
A 1 231 ILE 231 232 232 ILE ILE A . n 
A 1 232 ASP 232 233 233 ASP ASP A . n 
A 1 233 ALA 233 234 234 ALA ALA A . n 
A 1 234 THR 234 235 235 THR THR A . n 
A 1 235 ASP 235 236 236 ASP ASP A . n 
A 1 236 LYS 236 237 237 LYS LYS A . n 
A 1 237 GLY 237 238 238 GLY GLY A . n 
A 1 238 LYS 238 239 239 LYS LYS A . n 
A 1 239 GLU 239 240 240 GLU GLU A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLY 242 243 243 GLY GLY A . n 
A 1 243 LYS 243 244 244 LYS LYS A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ALA 245 246 246 ALA ALA A . n 
A 1 246 PHE 246 247 247 PHE PHE A . n 
A 1 247 GLY 247 248 248 GLY GLY A . n 
A 1 248 ALA 248 249 249 ALA ALA A . n 
A 1 249 LEU 249 250 250 LEU LEU A . n 
A 1 250 GLY 250 251 251 GLY GLY A . n 
A 1 251 ILE 251 252 252 ILE ILE A . n 
A 1 252 GLY 252 253 253 GLY GLY A . n 
A 1 253 GLY 253 254 254 GLY GLY A . n 
A 1 254 LEU 254 255 255 LEU LEU A . n 
A 1 255 LYS 255 256 256 LYS LYS A . n 
A 1 256 LEU 256 257 257 LEU LEU A . n 
A 1 257 LYS 257 258 258 LYS LYS A . n 
A 1 258 LEU 258 259 259 LEU LEU A . n 
A 1 259 HIS 259 260 260 HIS HIS A . n 
A 1 260 ARG 260 261 261 ARG ARG A . n 
A 1 261 ALA 261 262 262 ALA ALA A . n 
A 1 262 CYS 262 263 263 CYS CYS A . n 
A 1 263 ILE 263 264 264 ILE ILE A . n 
A 1 264 ALA 264 265 265 ALA ALA A . n 
A 1 265 LYS 265 266 266 LYS LYS A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 PHE 267 268 268 PHE PHE A . n 
A 1 268 GLU 268 269 269 GLU GLU A . n 
A 1 269 SER 269 270 270 SER SER A . n 
A 1 270 SER 270 271 271 SER SER A . n 
A 1 271 GLU 271 272 272 GLU GLU A . n 
A 1 272 GLY 272 273 273 GLY GLY A . n 
A 1 273 VAL 273 274 274 VAL VAL A . n 
A 1 274 PHE 274 275 275 PHE PHE A . n 
A 1 275 ASP 275 276 276 ASP ASP A . n 
A 1 276 ALA 276 277 277 ALA ALA A . n 
A 1 277 GLU 277 278 278 GLU GLU A . n 
A 1 278 GLU 278 279 279 GLU GLU A . n 
A 1 279 ILE 279 280 280 ILE ILE A . n 
A 1 280 TYR 280 281 281 TYR TYR A . n 
A 1 281 LYS 281 282 282 LYS LYS A . n 
A 1 282 LEU 282 283 283 LEU LEU A . n 
A 1 283 ALA 283 284 284 ALA ALA A . n 
A 1 284 LYS 284 285 285 LYS LYS A . n 
A 1 285 GLU 285 286 286 GLU GLU A . n 
A 1 286 MET 286 287 287 MET MET A . n 
A 1 287 ALA 287 288 288 ALA ALA A . n 
B 1 1   SER 1   2   2   SER SER B . n 
B 1 2   LYS 2   3   3   LYS LYS B . n 
B 1 3   LYS 3   4   4   LYS LYS B . n 
B 1 4   LEU 4   5   5   LEU LEU B . n 
B 1 5   LEU 5   6   6   LEU LEU B . n 
B 1 6   PHE 6   7   7   PHE PHE B . n 
B 1 7   GLN 7   8   8   GLN GLN B . n 
B 1 8   PHE 8   9   9   PHE PHE B . n 
B 1 9   ASP 9   10  10  ASP ASP B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  ASP 11  12  12  ASP ASP B . n 
B 1 12  ALA 12  13  13  ALA ALA B . n 
B 1 13  THR 13  14  14  THR THR B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  SER 15  16  16  SER SER B . n 
B 1 16  VAL 16  17  17  VAL VAL B . n 
B 1 17  PHE 17  18  18  PHE PHE B . n 
B 1 18  ASP 18  19  19  ASP ASP B . n 
B 1 19  VAL 19  20  20  VAL VAL B . n 
B 1 20  VAL 20  21  21  VAL VAL B . n 
B 1 21  VAL 21  22  22  VAL VAL B . n 
B 1 22  GLY 22  23  23  GLY GLY B . n 
B 1 23  TYR 23  24  24  TYR TYR B . n 
B 1 24  ASP 24  25  25  ASP ASP B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  ALA 27  28  28  ALA ALA B . n 
B 1 28  ASP 28  29  29  ASP ASP B . n 
B 1 29  HIS 29  30  30  HIS HIS B . n 
B 1 30  ILE 30  31  31  ILE ILE B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  GLY 32  33  33  GLY GLY B . n 
B 1 33  TYR 33  34  34  TYR TYR B . n 
B 1 34  GLY 34  35  35  GLY GLY B . n 
B 1 35  ASN 35  36  36  ASN ASN B . n 
B 1 36  VAL 36  37  37  VAL VAL B . n 
B 1 37  THR 37  38  38  THR THR B . n 
B 1 38  PRO 38  39  39  PRO PRO B . n 
B 1 39  ASP 39  40  40  ASP ASP B . n 
B 1 40  ASN 40  41  41  ASN ASN B . n 
B 1 41  VAL 41  42  42  VAL VAL B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  ALA 43  44  44  ALA ALA B . n 
B 1 44  TYR 44  45  45  TYR TYR B . n 
B 1 45  VAL 45  46  46  VAL VAL B . n 
B 1 46  ASP 46  47  47  ASP ASP B . n 
B 1 47  GLY 47  48  48  GLY GLY B . n 
B 1 48  THR 48  49  49  THR THR B . n 
B 1 49  ILE 49  50  50  ILE ILE B . n 
B 1 50  TYR 50  51  51  TYR TYR B . n 
B 1 51  THR 51  52  52  THR THR B . n 
B 1 52  ARG 52  53  53  ARG ARG B . n 
B 1 53  GLY 53  54  54  GLY GLY B . n 
B 1 54  GLY 54  55  55  GLY GLY B . n 
B 1 55  LYS 55  56  56  LYS LYS B . n 
B 1 56  GLU 56  57  57  GLU GLU B . n 
B 1 57  LYS 57  58  58  LYS LYS B . n 
B 1 58  GLN 58  59  59  GLN GLN B . n 
B 1 59  SER 59  60  60  SER SER B . n 
B 1 60  THR 60  61  61  THR THR B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  PHE 63  64  64  PHE PHE B . n 
B 1 64  VAL 64  65  65  VAL VAL B . n 
B 1 65  GLY 65  66  66  GLY GLY B . n 
B 1 66  GLY 66  67  67  GLY GLY B . n 
B 1 67  GLY 67  68  68  GLY GLY B . n 
B 1 68  ASP 68  69  69  ASP ASP B . n 
B 1 69  MET 69  70  70  MET MET B . n 
B 1 70  ALA 70  71  71  ALA ALA B . n 
B 1 71  ALA 71  72  72  ALA ALA B . n 
B 1 72  GLY 72  73  73  GLY GLY B . n 
B 1 73  GLU 73  74  74  GLU GLU B . n 
B 1 74  ARG 74  75  75  ARG ARG B . n 
B 1 75  VAL 75  76  76  VAL VAL B . n 
B 1 76  PHE 76  77  77  PHE PHE B . n 
B 1 77  GLU 77  78  78  GLU GLU B . n 
B 1 78  ALA 78  79  79  ALA ALA B . n 
B 1 79  VAL 79  80  80  VAL VAL B . n 
B 1 80  LYS 80  81  81  LYS LYS B . n 
B 1 81  LYS 81  82  82  LYS LYS B . n 
B 1 82  ARG 82  83  83  ARG ARG B . n 
B 1 83  PHE 83  84  84  PHE PHE B . n 
B 1 84  PHE 84  85  85  PHE PHE B . n 
B 1 85  GLY 85  86  86  GLY GLY B . n 
B 1 86  PRO 86  87  87  PRO PRO B . n 
B 1 87  PHE 87  88  88  PHE PHE B . n 
B 1 88  ARG 88  89  89  ARG ARG B . n 
B 1 89  VAL 89  90  90  VAL VAL B . n 
B 1 90  SER 90  91  91  SER SER B . n 
B 1 91  CYS 91  92  92  CYS CYS B . n 
B 1 92  MET 92  93  93  MET MET B . n 
B 1 93  LEU 93  94  94  LEU LEU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  SER 95  96  96  SER SER B . n 
B 1 96  ASN 96  97  97  ASN ASN B . n 
B 1 97  GLY 97  98  98  GLY GLY B . n 
B 1 98  SER 98  99  99  SER SER B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 THR 100 101 101 THR THR B . n 
B 1 101 THR 101 102 102 THR THR B . n 
B 1 102 ALA 102 103 103 ALA ALA B . n 
B 1 103 ALA 103 104 104 ALA ALA B . n 
B 1 104 ALA 104 105 105 ALA ALA B . n 
B 1 105 GLY 105 106 106 GLY GLY B . n 
B 1 106 VAL 106 107 107 VAL VAL B . n 
B 1 107 ALA 107 108 108 ALA ALA B . n 
B 1 108 LEU 108 109 109 LEU LEU B . n 
B 1 109 VAL 109 110 110 VAL VAL B . n 
B 1 110 VAL 110 111 111 VAL VAL B . n 
B 1 111 LYS 111 112 112 LYS LYS B . n 
B 1 112 ALA 112 113 113 ALA ALA B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 GLY 114 115 115 GLY GLY B . n 
B 1 115 GLY 115 116 116 GLY GLY B . n 
B 1 116 SER 116 117 117 SER SER B . n 
B 1 117 VAL 117 118 118 VAL VAL B . n 
B 1 118 LYS 118 119 119 LYS LYS B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 LYS 120 121 121 LYS LYS B . n 
B 1 121 LYS 121 122 122 LYS LYS B . n 
B 1 122 ALA 122 123 123 ALA ALA B . n 
B 1 123 VAL 123 124 124 VAL VAL B . n 
B 1 124 VAL 124 125 125 VAL VAL B . n 
B 1 125 LEU 125 126 126 LEU LEU B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 GLY 127 128 128 GLY GLY B . n 
B 1 128 THR 128 129 129 THR THR B . n 
B 1 129 GLY 129 130 130 GLY GLY B . n 
B 1 130 PRO 130 131 131 PRO PRO B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 GLY 132 133 133 GLY GLY B . n 
B 1 133 MET 133 134 134 MET MET B . n 
B 1 134 ARG 134 135 135 ARG ARG B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ALA 136 137 137 ALA ALA B . n 
B 1 137 ALA 137 138 138 ALA ALA B . n 
B 1 138 LEU 138 139 139 LEU LEU B . n 
B 1 139 LEU 139 140 140 LEU LEU B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLY 141 142 142 GLY GLY B . n 
B 1 142 GLU 142 143 143 GLU GLU B . n 
B 1 143 GLY 143 144 144 GLY GLY B . n 
B 1 144 ALA 144 145 145 ALA ALA B . n 
B 1 145 GLU 145 146 146 GLU GLU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 VAL 147 148 148 VAL VAL B . n 
B 1 148 LEU 148 149 149 LEU LEU B . n 
B 1 149 CYS 149 150 150 CYS CYS B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 LYS 152 153 153 LYS LYS B . n 
B 1 153 LEU 153 154 154 LEU LEU B . n 
B 1 154 ASP 154 155 155 ASP ASP B . n 
B 1 155 LYS 155 156 156 LYS LYS B . n 
B 1 156 ALA 156 157 157 ALA ALA B . n 
B 1 157 GLN 157 158 158 GLN GLN B . n 
B 1 158 ALA 158 159 159 ALA ALA B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 ALA 160 161 161 ALA ALA B . n 
B 1 161 ASP 161 162 162 ASP ASP B . n 
B 1 162 SER 162 163 163 SER SER B . n 
B 1 163 VAL 163 164 164 VAL VAL B . n 
B 1 164 ASN 164 165 165 ASN ASN B . n 
B 1 165 LYS 165 166 166 LYS LYS B . n 
B 1 166 ARG 166 167 167 ARG ARG B . n 
B 1 167 PHE 167 168 168 PHE PHE B . n 
B 1 168 LYS 168 169 169 LYS LYS B . n 
B 1 169 VAL 169 170 170 VAL VAL B . n 
B 1 170 ASN 170 171 171 ASN ASN B . n 
B 1 171 VAL 171 172 172 VAL VAL B . n 
B 1 172 THR 172 173 173 THR THR B . n 
B 1 173 ALA 173 174 174 ALA ALA B . n 
B 1 174 ALA 174 175 175 ALA ALA B . n 
B 1 175 GLU 175 176 176 GLU GLU B . n 
B 1 176 THR 176 177 177 THR THR B . n 
B 1 177 ALA 177 178 178 ALA ALA B . n 
B 1 178 ASP 178 179 179 ASP ASP B . n 
B 1 179 ASP 179 180 180 ASP ASP B . n 
B 1 180 ALA 180 181 181 ALA ALA B . n 
B 1 181 SER 181 182 182 SER SER B . n 
B 1 182 ARG 182 183 183 ARG ARG B . n 
B 1 183 ALA 183 184 184 ALA ALA B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ALA 185 186 186 ALA ALA B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 LYS 187 188 188 LYS LYS B . n 
B 1 188 GLY 188 189 189 GLY GLY B . n 
B 1 189 ALA 189 190 190 ALA ALA B . n 
B 1 190 HIS 190 191 191 HIS HIS B . n 
B 1 191 PHE 191 192 192 PHE PHE B . n 
B 1 192 VAL 192 193 193 VAL VAL B . n 
B 1 193 PHE 193 194 194 PHE PHE B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 ALA 195 196 196 ALA ALA B . n 
B 1 196 GLY 196 197 197 GLY GLY B . n 
B 1 197 ALA 197 198 198 ALA ALA B . n 
B 1 198 ILE 198 199 199 ILE ILE B . n 
B 1 199 GLY 199 200 200 GLY GLY B . n 
B 1 200 LEU 200 201 201 LEU LEU B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 LEU 202 203 203 LEU LEU B . n 
B 1 203 LEU 203 204 204 LEU LEU B . n 
B 1 204 PRO 204 205 205 PRO PRO B . n 
B 1 205 GLN 205 206 206 GLN GLN B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 ALA 207 208 208 ALA ALA B . n 
B 1 208 TRP 208 209 209 TRP TRP B . n 
B 1 209 GLN 209 210 210 GLN GLN B . n 
B 1 210 ASN 210 211 211 ASN ASN B . n 
B 1 211 GLU 211 212 212 GLU GLU B . n 
B 1 212 SER 212 213 213 SER SER B . n 
B 1 213 SER 213 214 214 SER SER B . n 
B 1 214 ILE 214 215 215 ILE ILE B . n 
B 1 215 GLU 215 216 216 GLU GLU B . n 
B 1 216 ILE 216 217 217 ILE ILE B . n 
B 1 217 VAL 217 218 218 VAL VAL B . n 
B 1 218 ALA 218 219 219 ALA ALA B . n 
B 1 219 ASP 219 220 220 ASP ASP B . n 
B 1 220 TYR 220 221 221 TYR TYR B . n 
B 1 221 ASN 221 222 222 ASN ASN B . n 
B 1 222 ALA 222 223 223 ALA ALA B . n 
B 1 223 GLN 223 224 224 GLN GLN B . n 
B 1 224 PRO 224 225 225 PRO PRO B . n 
B 1 225 PRO 225 226 226 PRO PRO B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLY 227 228 228 GLY GLY B . n 
B 1 228 ILE 228 229 229 ILE ILE B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 GLY 230 231 231 GLY GLY B . n 
B 1 231 ILE 231 232 232 ILE ILE B . n 
B 1 232 ASP 232 233 233 ASP ASP B . n 
B 1 233 ALA 233 234 234 ALA ALA B . n 
B 1 234 THR 234 235 235 THR THR B . n 
B 1 235 ASP 235 236 236 ASP ASP B . n 
B 1 236 LYS 236 237 237 LYS LYS B . n 
B 1 237 GLY 237 238 238 GLY GLY B . n 
B 1 238 LYS 238 239 239 LYS LYS B . n 
B 1 239 GLU 239 240 240 GLU GLU B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLY 242 243 243 GLY GLY B . n 
B 1 243 LYS 243 244 244 LYS LYS B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ALA 245 246 246 ALA ALA B . n 
B 1 246 PHE 246 247 247 PHE PHE B . n 
B 1 247 GLY 247 248 248 GLY GLY B . n 
B 1 248 ALA 248 249 249 ALA ALA B . n 
B 1 249 LEU 249 250 250 LEU LEU B . n 
B 1 250 GLY 250 251 251 GLY GLY B . n 
B 1 251 ILE 251 252 252 ILE ILE B . n 
B 1 252 GLY 252 253 253 GLY GLY B . n 
B 1 253 GLY 253 254 254 GLY GLY B . n 
B 1 254 LEU 254 255 255 LEU LEU B . n 
B 1 255 LYS 255 256 256 LYS LYS B . n 
B 1 256 LEU 256 257 257 LEU LEU B . n 
B 1 257 LYS 257 258 258 LYS LYS B . n 
B 1 258 LEU 258 259 259 LEU LEU B . n 
B 1 259 HIS 259 260 260 HIS HIS B . n 
B 1 260 ARG 260 261 261 ARG ARG B . n 
B 1 261 ALA 261 262 262 ALA ALA B . n 
B 1 262 CYS 262 263 263 CYS CYS B . n 
B 1 263 ILE 263 264 264 ILE ILE B . n 
B 1 264 ALA 264 265 265 ALA ALA B . n 
B 1 265 LYS 265 266 266 LYS LYS B . n 
B 1 266 LEU 266 267 267 LEU LEU B . n 
B 1 267 PHE 267 268 268 PHE PHE B . n 
B 1 268 GLU 268 269 269 GLU GLU B . n 
B 1 269 SER 269 270 270 SER SER B . n 
B 1 270 SER 270 271 271 SER SER B . n 
B 1 271 GLU 271 272 272 GLU GLU B . n 
B 1 272 GLY 272 273 273 GLY GLY B . n 
B 1 273 VAL 273 274 274 VAL VAL B . n 
B 1 274 PHE 274 275 275 PHE PHE B . n 
B 1 275 ASP 275 276 276 ASP ASP B . n 
B 1 276 ALA 276 277 277 ALA ALA B . n 
B 1 277 GLU 277 278 278 GLU GLU B . n 
B 1 278 GLU 278 279 279 GLU GLU B . n 
B 1 279 ILE 279 280 280 ILE ILE B . n 
B 1 280 TYR 280 281 281 TYR TYR B . n 
B 1 281 LYS 281 282 282 LYS LYS B . n 
B 1 282 LEU 282 283 283 LEU LEU B . n 
B 1 283 ALA 283 284 284 ALA ALA B . n 
B 1 284 LYS 284 285 285 LYS LYS B . n 
B 1 285 GLU 285 286 286 GLU GLU B . n 
B 1 286 MET 286 287 287 MET MET B . n 
B 1 287 ALA 287 288 288 ALA ALA B . n 
C 1 1   SER 1   2   2   SER SER C . n 
C 1 2   LYS 2   3   3   LYS LYS C . n 
C 1 3   LYS 3   4   4   LYS LYS C . n 
C 1 4   LEU 4   5   5   LEU LEU C . n 
C 1 5   LEU 5   6   6   LEU LEU C . n 
C 1 6   PHE 6   7   7   PHE PHE C . n 
C 1 7   GLN 7   8   8   GLN GLN C . n 
C 1 8   PHE 8   9   9   PHE PHE C . n 
C 1 9   ASP 9   10  10  ASP ASP C . n 
C 1 10  THR 10  11  11  THR THR C . n 
C 1 11  ASP 11  12  12  ASP ASP C . n 
C 1 12  ALA 12  13  13  ALA ALA C . n 
C 1 13  THR 13  14  14  THR THR C . n 
C 1 14  PRO 14  15  15  PRO PRO C . n 
C 1 15  SER 15  16  16  SER SER C . n 
C 1 16  VAL 16  17  17  VAL VAL C . n 
C 1 17  PHE 17  18  18  PHE PHE C . n 
C 1 18  ASP 18  19  19  ASP ASP C . n 
C 1 19  VAL 19  20  20  VAL VAL C . n 
C 1 20  VAL 20  21  21  VAL VAL C . n 
C 1 21  VAL 21  22  22  VAL VAL C . n 
C 1 22  GLY 22  23  23  GLY GLY C . n 
C 1 23  TYR 23  24  24  TYR TYR C . n 
C 1 24  ASP 24  25  25  ASP ASP C . n 
C 1 25  GLY 25  26  26  GLY GLY C . n 
C 1 26  GLY 26  27  27  GLY GLY C . n 
C 1 27  ALA 27  28  28  ALA ALA C . n 
C 1 28  ASP 28  29  29  ASP ASP C . n 
C 1 29  HIS 29  30  30  HIS HIS C . n 
C 1 30  ILE 30  31  31  ILE ILE C . n 
C 1 31  THR 31  32  32  THR THR C . n 
C 1 32  GLY 32  33  33  GLY GLY C . n 
C 1 33  TYR 33  34  34  TYR TYR C . n 
C 1 34  GLY 34  35  35  GLY GLY C . n 
C 1 35  ASN 35  36  36  ASN ASN C . n 
C 1 36  VAL 36  37  37  VAL VAL C . n 
C 1 37  THR 37  38  38  THR THR C . n 
C 1 38  PRO 38  39  39  PRO PRO C . n 
C 1 39  ASP 39  40  40  ASP ASP C . n 
C 1 40  ASN 40  41  41  ASN ASN C . n 
C 1 41  VAL 41  42  42  VAL VAL C . n 
C 1 42  GLY 42  43  43  GLY GLY C . n 
C 1 43  ALA 43  44  44  ALA ALA C . n 
C 1 44  TYR 44  45  45  TYR TYR C . n 
C 1 45  VAL 45  46  46  VAL VAL C . n 
C 1 46  ASP 46  47  47  ASP ASP C . n 
C 1 47  GLY 47  48  48  GLY GLY C . n 
C 1 48  THR 48  49  49  THR THR C . n 
C 1 49  ILE 49  50  50  ILE ILE C . n 
C 1 50  TYR 50  51  51  TYR TYR C . n 
C 1 51  THR 51  52  52  THR THR C . n 
C 1 52  ARG 52  53  53  ARG ARG C . n 
C 1 53  GLY 53  54  54  GLY GLY C . n 
C 1 54  GLY 54  55  55  GLY GLY C . n 
C 1 55  LYS 55  56  56  LYS LYS C . n 
C 1 56  GLU 56  57  57  GLU GLU C . n 
C 1 57  LYS 57  58  58  LYS LYS C . n 
C 1 58  GLN 58  59  59  GLN GLN C . n 
C 1 59  SER 59  60  60  SER SER C . n 
C 1 60  THR 60  61  61  THR THR C . n 
C 1 61  ALA 61  62  62  ALA ALA C . n 
C 1 62  ILE 62  63  63  ILE ILE C . n 
C 1 63  PHE 63  64  64  PHE PHE C . n 
C 1 64  VAL 64  65  65  VAL VAL C . n 
C 1 65  GLY 65  66  66  GLY GLY C . n 
C 1 66  GLY 66  67  67  GLY GLY C . n 
C 1 67  GLY 67  68  68  GLY GLY C . n 
C 1 68  ASP 68  69  69  ASP ASP C . n 
C 1 69  MET 69  70  70  MET MET C . n 
C 1 70  ALA 70  71  71  ALA ALA C . n 
C 1 71  ALA 71  72  72  ALA ALA C . n 
C 1 72  GLY 72  73  73  GLY GLY C . n 
C 1 73  GLU 73  74  74  GLU GLU C . n 
C 1 74  ARG 74  75  75  ARG ARG C . n 
C 1 75  VAL 75  76  76  VAL VAL C . n 
C 1 76  PHE 76  77  77  PHE PHE C . n 
C 1 77  GLU 77  78  78  GLU GLU C . n 
C 1 78  ALA 78  79  79  ALA ALA C . n 
C 1 79  VAL 79  80  80  VAL VAL C . n 
C 1 80  LYS 80  81  81  LYS LYS C . n 
C 1 81  LYS 81  82  82  LYS LYS C . n 
C 1 82  ARG 82  83  83  ARG ARG C . n 
C 1 83  PHE 83  84  84  PHE PHE C . n 
C 1 84  PHE 84  85  85  PHE PHE C . n 
C 1 85  GLY 85  86  86  GLY GLY C . n 
C 1 86  PRO 86  87  87  PRO PRO C . n 
C 1 87  PHE 87  88  88  PHE PHE C . n 
C 1 88  ARG 88  89  89  ARG ARG C . n 
C 1 89  VAL 89  90  90  VAL VAL C . n 
C 1 90  SER 90  91  91  SER SER C . n 
C 1 91  CYS 91  92  92  CYS CYS C . n 
C 1 92  MET 92  93  93  MET MET C . n 
C 1 93  LEU 93  94  94  LEU LEU C . n 
C 1 94  ASP 94  95  95  ASP ASP C . n 
C 1 95  SER 95  96  96  SER SER C . n 
C 1 96  ASN 96  97  97  ASN ASN C . n 
C 1 97  GLY 97  98  98  GLY GLY C . n 
C 1 98  SER 98  99  99  SER SER C . n 
C 1 99  ASN 99  100 100 ASN ASN C . n 
C 1 100 THR 100 101 101 THR THR C . n 
C 1 101 THR 101 102 102 THR THR C . n 
C 1 102 ALA 102 103 103 ALA ALA C . n 
C 1 103 ALA 103 104 104 ALA ALA C . n 
C 1 104 ALA 104 105 105 ALA ALA C . n 
C 1 105 GLY 105 106 106 GLY GLY C . n 
C 1 106 VAL 106 107 107 VAL VAL C . n 
C 1 107 ALA 107 108 108 ALA ALA C . n 
C 1 108 LEU 108 109 109 LEU LEU C . n 
C 1 109 VAL 109 110 110 VAL VAL C . n 
C 1 110 VAL 110 111 111 VAL VAL C . n 
C 1 111 LYS 111 112 112 LYS LYS C . n 
C 1 112 ALA 112 113 113 ALA ALA C . n 
C 1 113 ALA 113 114 114 ALA ALA C . n 
C 1 114 GLY 114 115 115 GLY GLY C . n 
C 1 115 GLY 115 116 116 GLY GLY C . n 
C 1 116 SER 116 117 117 SER SER C . n 
C 1 117 VAL 117 118 118 VAL VAL C . n 
C 1 118 LYS 118 119 119 LYS LYS C . n 
C 1 119 GLY 119 120 120 GLY GLY C . n 
C 1 120 LYS 120 121 121 LYS LYS C . n 
C 1 121 LYS 121 122 122 LYS LYS C . n 
C 1 122 ALA 122 123 123 ALA ALA C . n 
C 1 123 VAL 123 124 124 VAL VAL C . n 
C 1 124 VAL 124 125 125 VAL VAL C . n 
C 1 125 LEU 125 126 126 LEU LEU C . n 
C 1 126 ALA 126 127 127 ALA ALA C . n 
C 1 127 GLY 127 128 128 GLY GLY C . n 
C 1 128 THR 128 129 129 THR THR C . n 
C 1 129 GLY 129 130 130 GLY GLY C . n 
C 1 130 PRO 130 131 131 PRO PRO C . n 
C 1 131 VAL 131 132 132 VAL VAL C . n 
C 1 132 GLY 132 133 133 GLY GLY C . n 
C 1 133 MET 133 134 134 MET MET C . n 
C 1 134 ARG 134 135 135 ARG ARG C . n 
C 1 135 SER 135 136 136 SER SER C . n 
C 1 136 ALA 136 137 137 ALA ALA C . n 
C 1 137 ALA 137 138 138 ALA ALA C . n 
C 1 138 LEU 138 139 139 LEU LEU C . n 
C 1 139 LEU 139 140 140 LEU LEU C . n 
C 1 140 ALA 140 141 141 ALA ALA C . n 
C 1 141 GLY 141 142 142 GLY GLY C . n 
C 1 142 GLU 142 143 143 GLU GLU C . n 
C 1 143 GLY 143 144 144 GLY GLY C . n 
C 1 144 ALA 144 145 145 ALA ALA C . n 
C 1 145 GLU 145 146 146 GLU GLU C . n 
C 1 146 VAL 146 147 147 VAL VAL C . n 
C 1 147 VAL 147 148 148 VAL VAL C . n 
C 1 148 LEU 148 149 149 LEU LEU C . n 
C 1 149 CYS 149 150 150 CYS CYS C . n 
C 1 150 GLY 150 151 151 GLY GLY C . n 
C 1 151 ARG 151 152 152 ARG ARG C . n 
C 1 152 LYS 152 153 153 LYS LYS C . n 
C 1 153 LEU 153 154 154 LEU LEU C . n 
C 1 154 ASP 154 155 155 ASP ASP C . n 
C 1 155 LYS 155 156 156 LYS LYS C . n 
C 1 156 ALA 156 157 157 ALA ALA C . n 
C 1 157 GLN 157 158 158 GLN GLN C . n 
C 1 158 ALA 158 159 159 ALA ALA C . n 
C 1 159 ALA 159 160 160 ALA ALA C . n 
C 1 160 ALA 160 161 161 ALA ALA C . n 
C 1 161 ASP 161 162 162 ASP ASP C . n 
C 1 162 SER 162 163 163 SER SER C . n 
C 1 163 VAL 163 164 164 VAL VAL C . n 
C 1 164 ASN 164 165 165 ASN ASN C . n 
C 1 165 LYS 165 166 166 LYS LYS C . n 
C 1 166 ARG 166 167 167 ARG ARG C . n 
C 1 167 PHE 167 168 168 PHE PHE C . n 
C 1 168 LYS 168 169 169 LYS LYS C . n 
C 1 169 VAL 169 170 170 VAL VAL C . n 
C 1 170 ASN 170 171 171 ASN ASN C . n 
C 1 171 VAL 171 172 172 VAL VAL C . n 
C 1 172 THR 172 173 173 THR THR C . n 
C 1 173 ALA 173 174 174 ALA ALA C . n 
C 1 174 ALA 174 175 175 ALA ALA C . n 
C 1 175 GLU 175 176 176 GLU GLU C . n 
C 1 176 THR 176 177 177 THR THR C . n 
C 1 177 ALA 177 178 178 ALA ALA C . n 
C 1 178 ASP 178 179 179 ASP ASP C . n 
C 1 179 ASP 179 180 180 ASP ASP C . n 
C 1 180 ALA 180 181 181 ALA ALA C . n 
C 1 181 SER 181 182 182 SER SER C . n 
C 1 182 ARG 182 183 183 ARG ARG C . n 
C 1 183 ALA 183 184 184 ALA ALA C . n 
C 1 184 GLU 184 185 185 GLU GLU C . n 
C 1 185 ALA 185 186 186 ALA ALA C . n 
C 1 186 VAL 186 187 187 VAL VAL C . n 
C 1 187 LYS 187 188 188 LYS LYS C . n 
C 1 188 GLY 188 189 189 GLY GLY C . n 
C 1 189 ALA 189 190 190 ALA ALA C . n 
C 1 190 HIS 190 191 191 HIS HIS C . n 
C 1 191 PHE 191 192 192 PHE PHE C . n 
C 1 192 VAL 192 193 193 VAL VAL C . n 
C 1 193 PHE 193 194 194 PHE PHE C . n 
C 1 194 THR 194 195 195 THR THR C . n 
C 1 195 ALA 195 196 196 ALA ALA C . n 
C 1 196 GLY 196 197 197 GLY GLY C . n 
C 1 197 ALA 197 198 198 ALA ALA C . n 
C 1 198 ILE 198 199 199 ILE ILE C . n 
C 1 199 GLY 199 200 200 GLY GLY C . n 
C 1 200 LEU 200 201 201 LEU LEU C . n 
C 1 201 GLU 201 202 202 GLU GLU C . n 
C 1 202 LEU 202 203 203 LEU LEU C . n 
C 1 203 LEU 203 204 204 LEU LEU C . n 
C 1 204 PRO 204 205 205 PRO PRO C . n 
C 1 205 GLN 205 206 206 GLN GLN C . n 
C 1 206 ALA 206 207 207 ALA ALA C . n 
C 1 207 ALA 207 208 208 ALA ALA C . n 
C 1 208 TRP 208 209 209 TRP TRP C . n 
C 1 209 GLN 209 210 210 GLN GLN C . n 
C 1 210 ASN 210 211 211 ASN ASN C . n 
C 1 211 GLU 211 212 212 GLU GLU C . n 
C 1 212 SER 212 213 213 SER SER C . n 
C 1 213 SER 213 214 214 SER SER C . n 
C 1 214 ILE 214 215 215 ILE ILE C . n 
C 1 215 GLU 215 216 216 GLU GLU C . n 
C 1 216 ILE 216 217 217 ILE ILE C . n 
C 1 217 VAL 217 218 218 VAL VAL C . n 
C 1 218 ALA 218 219 219 ALA ALA C . n 
C 1 219 ASP 219 220 220 ASP ASP C . n 
C 1 220 TYR 220 221 221 TYR TYR C . n 
C 1 221 ASN 221 222 222 ASN ASN C . n 
C 1 222 ALA 222 223 223 ALA ALA C . n 
C 1 223 GLN 223 224 224 GLN GLN C . n 
C 1 224 PRO 224 225 225 PRO PRO C . n 
C 1 225 PRO 225 226 226 PRO PRO C . n 
C 1 226 LEU 226 227 227 LEU LEU C . n 
C 1 227 GLY 227 228 228 GLY GLY C . n 
C 1 228 ILE 228 229 229 ILE ILE C . n 
C 1 229 GLY 229 230 230 GLY GLY C . n 
C 1 230 GLY 230 231 231 GLY GLY C . n 
C 1 231 ILE 231 232 232 ILE ILE C . n 
C 1 232 ASP 232 233 233 ASP ASP C . n 
C 1 233 ALA 233 234 234 ALA ALA C . n 
C 1 234 THR 234 235 235 THR THR C . n 
C 1 235 ASP 235 236 236 ASP ASP C . n 
C 1 236 LYS 236 237 237 LYS LYS C . n 
C 1 237 GLY 237 238 238 GLY GLY C . n 
C 1 238 LYS 238 239 239 LYS LYS C . n 
C 1 239 GLU 239 240 240 GLU GLU C . n 
C 1 240 TYR 240 241 241 TYR TYR C . n 
C 1 241 GLY 241 242 242 GLY GLY C . n 
C 1 242 GLY 242 243 243 GLY GLY C . n 
C 1 243 LYS 243 244 244 LYS LYS C . n 
C 1 244 ARG 244 245 245 ARG ARG C . n 
C 1 245 ALA 245 246 246 ALA ALA C . n 
C 1 246 PHE 246 247 247 PHE PHE C . n 
C 1 247 GLY 247 248 248 GLY GLY C . n 
C 1 248 ALA 248 249 249 ALA ALA C . n 
C 1 249 LEU 249 250 250 LEU LEU C . n 
C 1 250 GLY 250 251 251 GLY GLY C . n 
C 1 251 ILE 251 252 252 ILE ILE C . n 
C 1 252 GLY 252 253 253 GLY GLY C . n 
C 1 253 GLY 253 254 254 GLY GLY C . n 
C 1 254 LEU 254 255 255 LEU LEU C . n 
C 1 255 LYS 255 256 256 LYS LYS C . n 
C 1 256 LEU 256 257 257 LEU LEU C . n 
C 1 257 LYS 257 258 258 LYS LYS C . n 
C 1 258 LEU 258 259 259 LEU LEU C . n 
C 1 259 HIS 259 260 260 HIS HIS C . n 
C 1 260 ARG 260 261 261 ARG ARG C . n 
C 1 261 ALA 261 262 262 ALA ALA C . n 
C 1 262 CYS 262 263 263 CYS CYS C . n 
C 1 263 ILE 263 264 264 ILE ILE C . n 
C 1 264 ALA 264 265 265 ALA ALA C . n 
C 1 265 LYS 265 266 266 LYS LYS C . n 
C 1 266 LEU 266 267 267 LEU LEU C . n 
C 1 267 PHE 267 268 268 PHE PHE C . n 
C 1 268 GLU 268 269 269 GLU GLU C . n 
C 1 269 SER 269 270 270 SER SER C . n 
C 1 270 SER 270 271 271 SER SER C . n 
C 1 271 GLU 271 272 272 GLU GLU C . n 
C 1 272 GLY 272 273 273 GLY GLY C . n 
C 1 273 VAL 273 274 274 VAL VAL C . n 
C 1 274 PHE 274 275 275 PHE PHE C . n 
C 1 275 ASP 275 276 276 ASP ASP C . n 
C 1 276 ALA 276 277 277 ALA ALA C . n 
C 1 277 GLU 277 278 278 GLU GLU C . n 
C 1 278 GLU 278 279 279 GLU GLU C . n 
C 1 279 ILE 279 280 280 ILE ILE C . n 
C 1 280 TYR 280 281 281 TYR TYR C . n 
C 1 281 LYS 281 282 282 LYS LYS C . n 
C 1 282 LEU 282 283 283 LEU LEU C . n 
C 1 283 ALA 283 284 284 ALA ALA C . n 
C 1 284 LYS 284 285 285 LYS LYS C . n 
C 1 285 GLU 285 286 286 GLU GLU C . n 
C 1 286 MET 286 287 287 MET MET C . n 
C 1 287 ALA 287 288 288 ALA ALA C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3410  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  32840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-09-11 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          .   ? 1 
SHARP     phasing          .   ? 2 
DM        'model building' .   ? 3 
CNS       refinement       1.1 ? 4 
DENZO     'data reduction' .   ? 5 
SCALEPACK 'data scaling'   .   ? 6 
DM        phasing          .   ? 7 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B ALA 198 ? B O B HOH 3208 ? ? 1.95 
2 1 O B VAL 147 ? B O B HOH 3275 ? ? 2.01 
3 1 O B LYS 112 ? B O B HOH 3558 ? ? 2.09 
4 1 O B ALA 108 ? B O B HOH 3475 ? ? 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 95  ? ? -164.89 105.06  
2 1 ASP A 276 ? ? -119.47 -162.68 
3 1 ASP B 95  ? ? -165.79 101.79  
4 1 ASP B 276 ? ? -121.77 -166.99 
5 1 ASP C 95  ? ? -168.37 100.13  
6 1 TRP C 209 ? ? -131.59 -33.49  
7 1 ASP C 276 ? ? -113.96 -161.82 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1   3002 3002 HOH WAT A . 
D 2 HOH 2   3003 3003 HOH WAT A . 
D 2 HOH 3   3005 3005 HOH WAT A . 
D 2 HOH 4   3008 3008 HOH WAT A . 
D 2 HOH 5   3009 3009 HOH WAT A . 
D 2 HOH 6   3010 3010 HOH WAT A . 
D 2 HOH 7   3012 3012 HOH WAT A . 
D 2 HOH 8   3014 3014 HOH WAT A . 
D 2 HOH 9   3017 3017 HOH WAT A . 
D 2 HOH 10  3020 3020 HOH WAT A . 
D 2 HOH 11  3021 3021 HOH WAT A . 
D 2 HOH 12  3022 3022 HOH WAT A . 
D 2 HOH 13  3025 3025 HOH WAT A . 
D 2 HOH 14  3027 3027 HOH WAT A . 
D 2 HOH 15  3029 3029 HOH WAT A . 
D 2 HOH 16  3031 3031 HOH WAT A . 
D 2 HOH 17  3035 3035 HOH WAT A . 
D 2 HOH 18  3037 3037 HOH WAT A . 
D 2 HOH 19  3038 3038 HOH WAT A . 
D 2 HOH 20  3040 3040 HOH WAT A . 
D 2 HOH 21  3041 3041 HOH WAT A . 
D 2 HOH 22  3042 3042 HOH WAT A . 
D 2 HOH 23  3043 3043 HOH WAT A . 
D 2 HOH 24  3048 3048 HOH WAT A . 
D 2 HOH 25  3049 3049 HOH WAT A . 
D 2 HOH 26  3057 3057 HOH WAT A . 
D 2 HOH 27  3058 3058 HOH WAT A . 
D 2 HOH 28  3060 3060 HOH WAT A . 
D 2 HOH 29  3061 3061 HOH WAT A . 
D 2 HOH 30  3062 3062 HOH WAT A . 
D 2 HOH 31  3066 3066 HOH WAT A . 
D 2 HOH 32  3070 3070 HOH WAT A . 
D 2 HOH 33  3072 3072 HOH WAT A . 
D 2 HOH 34  3073 3073 HOH WAT A . 
D 2 HOH 35  3074 3074 HOH WAT A . 
D 2 HOH 36  3075 3075 HOH WAT A . 
D 2 HOH 37  3080 3080 HOH WAT A . 
D 2 HOH 38  3087 3087 HOH WAT A . 
D 2 HOH 39  3091 3091 HOH WAT A . 
D 2 HOH 40  3094 3094 HOH WAT A . 
D 2 HOH 41  3096 3096 HOH WAT A . 
D 2 HOH 42  3100 3100 HOH WAT A . 
D 2 HOH 43  3101 3101 HOH WAT A . 
D 2 HOH 44  3104 3104 HOH WAT A . 
D 2 HOH 45  3108 3108 HOH WAT A . 
D 2 HOH 46  3110 3110 HOH WAT A . 
D 2 HOH 47  3111 3111 HOH WAT A . 
D 2 HOH 48  3115 3115 HOH WAT A . 
D 2 HOH 49  3116 3116 HOH WAT A . 
D 2 HOH 50  3125 3125 HOH WAT A . 
D 2 HOH 51  3131 3131 HOH WAT A . 
D 2 HOH 52  3133 3133 HOH WAT A . 
D 2 HOH 53  3134 3134 HOH WAT A . 
D 2 HOH 54  3135 3135 HOH WAT A . 
D 2 HOH 55  3136 3136 HOH WAT A . 
D 2 HOH 56  3141 3141 HOH WAT A . 
D 2 HOH 57  3143 3143 HOH WAT A . 
D 2 HOH 58  3147 3147 HOH WAT A . 
D 2 HOH 59  3150 3150 HOH WAT A . 
D 2 HOH 60  3151 3151 HOH WAT A . 
D 2 HOH 61  3153 3153 HOH WAT A . 
D 2 HOH 62  3158 3158 HOH WAT A . 
D 2 HOH 63  3161 3161 HOH WAT A . 
D 2 HOH 64  3162 3162 HOH WAT A . 
D 2 HOH 65  3169 3169 HOH WAT A . 
D 2 HOH 66  3170 3170 HOH WAT A . 
D 2 HOH 67  3171 3171 HOH WAT A . 
D 2 HOH 68  3184 3184 HOH WAT A . 
D 2 HOH 69  3186 3186 HOH WAT A . 
D 2 HOH 70  3187 3187 HOH WAT A . 
D 2 HOH 71  3200 3200 HOH WAT A . 
D 2 HOH 72  3201 3201 HOH WAT A . 
D 2 HOH 73  3202 3202 HOH WAT A . 
D 2 HOH 74  3204 3204 HOH WAT A . 
D 2 HOH 75  3205 3205 HOH WAT A . 
D 2 HOH 76  3206 3206 HOH WAT A . 
D 2 HOH 77  3209 3209 HOH WAT A . 
D 2 HOH 78  3210 3210 HOH WAT A . 
D 2 HOH 79  3216 3216 HOH WAT A . 
D 2 HOH 80  3223 3223 HOH WAT A . 
D 2 HOH 81  3227 3227 HOH WAT A . 
D 2 HOH 82  3228 3228 HOH WAT A . 
D 2 HOH 83  3229 3229 HOH WAT A . 
D 2 HOH 84  3232 3232 HOH WAT A . 
D 2 HOH 85  3235 3235 HOH WAT A . 
D 2 HOH 86  3236 3236 HOH WAT A . 
D 2 HOH 87  3239 3239 HOH WAT A . 
D 2 HOH 88  3243 3243 HOH WAT A . 
D 2 HOH 89  3245 3245 HOH WAT A . 
D 2 HOH 90  3250 3250 HOH WAT A . 
D 2 HOH 91  3252 3252 HOH WAT A . 
D 2 HOH 92  3254 3254 HOH WAT A . 
D 2 HOH 93  3258 3258 HOH WAT A . 
D 2 HOH 94  3259 3259 HOH WAT A . 
D 2 HOH 95  3260 3260 HOH WAT A . 
D 2 HOH 96  3261 3261 HOH WAT A . 
D 2 HOH 97  3262 3262 HOH WAT A . 
D 2 HOH 98  3263 3263 HOH WAT A . 
D 2 HOH 99  3266 3266 HOH WAT A . 
D 2 HOH 100 3268 3268 HOH WAT A . 
D 2 HOH 101 3276 3276 HOH WAT A . 
D 2 HOH 102 3277 3277 HOH WAT A . 
D 2 HOH 103 3281 3281 HOH WAT A . 
D 2 HOH 104 3282 3282 HOH WAT A . 
D 2 HOH 105 3285 3285 HOH WAT A . 
D 2 HOH 106 3290 3290 HOH WAT A . 
D 2 HOH 107 3296 3296 HOH WAT A . 
D 2 HOH 108 3299 3299 HOH WAT A . 
D 2 HOH 109 3300 3300 HOH WAT A . 
D 2 HOH 110 3303 3303 HOH WAT A . 
D 2 HOH 111 3304 3304 HOH WAT A . 
D 2 HOH 112 3306 3306 HOH WAT A . 
D 2 HOH 113 3308 3308 HOH WAT A . 
D 2 HOH 114 3310 3310 HOH WAT A . 
D 2 HOH 115 3312 3312 HOH WAT A . 
D 2 HOH 116 3313 3313 HOH WAT A . 
D 2 HOH 117 3314 3314 HOH WAT A . 
D 2 HOH 118 3316 3316 HOH WAT A . 
D 2 HOH 119 3322 3322 HOH WAT A . 
D 2 HOH 120 3326 3326 HOH WAT A . 
D 2 HOH 121 3331 3331 HOH WAT A . 
D 2 HOH 122 3332 3332 HOH WAT A . 
D 2 HOH 123 3333 3333 HOH WAT A . 
D 2 HOH 124 3338 3338 HOH WAT A . 
D 2 HOH 125 3342 3342 HOH WAT A . 
D 2 HOH 126 3344 3344 HOH WAT A . 
D 2 HOH 127 3346 3346 HOH WAT A . 
D 2 HOH 128 3347 3347 HOH WAT A . 
D 2 HOH 129 3348 3348 HOH WAT A . 
D 2 HOH 130 3353 3353 HOH WAT A . 
D 2 HOH 131 3354 3354 HOH WAT A . 
D 2 HOH 132 3355 3355 HOH WAT A . 
D 2 HOH 133 3357 3357 HOH WAT A . 
D 2 HOH 134 3358 3358 HOH WAT A . 
D 2 HOH 135 3359 3359 HOH WAT A . 
D 2 HOH 136 3361 3361 HOH WAT A . 
D 2 HOH 137 3363 3363 HOH WAT A . 
D 2 HOH 138 3364 3364 HOH WAT A . 
D 2 HOH 139 3367 3367 HOH WAT A . 
D 2 HOH 140 3369 3369 HOH WAT A . 
D 2 HOH 141 3370 3370 HOH WAT A . 
D 2 HOH 142 3372 3372 HOH WAT A . 
D 2 HOH 143 3373 3373 HOH WAT A . 
D 2 HOH 144 3377 3377 HOH WAT A . 
D 2 HOH 145 3382 3382 HOH WAT A . 
D 2 HOH 146 3388 3388 HOH WAT A . 
D 2 HOH 147 3390 3390 HOH WAT A . 
D 2 HOH 148 3394 3394 HOH WAT A . 
D 2 HOH 149 3398 3398 HOH WAT A . 
D 2 HOH 150 3400 3400 HOH WAT A . 
D 2 HOH 151 3401 3401 HOH WAT A . 
D 2 HOH 152 3404 3404 HOH WAT A . 
D 2 HOH 153 3406 3406 HOH WAT A . 
D 2 HOH 154 3408 3408 HOH WAT A . 
D 2 HOH 155 3409 3409 HOH WAT A . 
D 2 HOH 156 3411 3411 HOH WAT A . 
D 2 HOH 157 3415 3415 HOH WAT A . 
D 2 HOH 158 3416 3416 HOH WAT A . 
D 2 HOH 159 3418 3418 HOH WAT A . 
D 2 HOH 160 3423 3423 HOH WAT A . 
D 2 HOH 161 3425 3425 HOH WAT A . 
D 2 HOH 162 3430 3430 HOH WAT A . 
D 2 HOH 163 3432 3432 HOH WAT A . 
D 2 HOH 164 3436 3436 HOH WAT A . 
D 2 HOH 165 3444 3444 HOH WAT A . 
D 2 HOH 166 3446 3446 HOH WAT A . 
D 2 HOH 167 3447 3447 HOH WAT A . 
D 2 HOH 168 3451 3451 HOH WAT A . 
D 2 HOH 169 3455 3455 HOH WAT A . 
D 2 HOH 170 3457 3457 HOH WAT A . 
D 2 HOH 171 3458 3458 HOH WAT A . 
D 2 HOH 172 3461 3461 HOH WAT A . 
D 2 HOH 173 3462 3462 HOH WAT A . 
D 2 HOH 174 3463 3463 HOH WAT A . 
D 2 HOH 175 3465 3465 HOH WAT A . 
D 2 HOH 176 3472 3472 HOH WAT A . 
D 2 HOH 177 3473 3473 HOH WAT A . 
D 2 HOH 178 3477 3477 HOH WAT A . 
D 2 HOH 179 3482 3482 HOH WAT A . 
D 2 HOH 180 3485 3485 HOH WAT A . 
D 2 HOH 181 3490 3490 HOH WAT A . 
D 2 HOH 182 3491 3491 HOH WAT A . 
D 2 HOH 183 3493 3493 HOH WAT A . 
D 2 HOH 184 3494 3494 HOH WAT A . 
D 2 HOH 185 3495 3495 HOH WAT A . 
D 2 HOH 186 3497 3497 HOH WAT A . 
D 2 HOH 187 3500 3500 HOH WAT A . 
D 2 HOH 188 3501 3501 HOH WAT A . 
D 2 HOH 189 3508 3508 HOH WAT A . 
D 2 HOH 190 3509 3509 HOH WAT A . 
D 2 HOH 191 3510 3510 HOH WAT A . 
D 2 HOH 192 3511 3511 HOH WAT A . 
D 2 HOH 193 3523 3523 HOH WAT A . 
D 2 HOH 194 3525 3525 HOH WAT A . 
D 2 HOH 195 3527 3527 HOH WAT A . 
D 2 HOH 196 3531 3531 HOH WAT A . 
D 2 HOH 197 3532 3532 HOH WAT A . 
D 2 HOH 198 3534 3534 HOH WAT A . 
D 2 HOH 199 3536 3536 HOH WAT A . 
D 2 HOH 200 3538 3538 HOH WAT A . 
D 2 HOH 201 3539 3539 HOH WAT A . 
D 2 HOH 202 3542 3542 HOH WAT A . 
D 2 HOH 203 3543 3543 HOH WAT A . 
D 2 HOH 204 3544 3544 HOH WAT A . 
D 2 HOH 205 3548 3548 HOH WAT A . 
E 2 HOH 1   3004 3004 HOH WAT B . 
E 2 HOH 2   3015 3015 HOH WAT B . 
E 2 HOH 3   3019 3019 HOH WAT B . 
E 2 HOH 4   3023 3023 HOH WAT B . 
E 2 HOH 5   3030 3030 HOH WAT B . 
E 2 HOH 6   3033 3033 HOH WAT B . 
E 2 HOH 7   3034 3034 HOH WAT B . 
E 2 HOH 8   3045 3045 HOH WAT B . 
E 2 HOH 9   3047 3047 HOH WAT B . 
E 2 HOH 10  3052 3052 HOH WAT B . 
E 2 HOH 11  3054 3054 HOH WAT B . 
E 2 HOH 12  3067 3067 HOH WAT B . 
E 2 HOH 13  3069 3069 HOH WAT B . 
E 2 HOH 14  3071 3071 HOH WAT B . 
E 2 HOH 15  3077 3077 HOH WAT B . 
E 2 HOH 16  3078 3078 HOH WAT B . 
E 2 HOH 17  3081 3081 HOH WAT B . 
E 2 HOH 18  3085 3085 HOH WAT B . 
E 2 HOH 19  3088 3088 HOH WAT B . 
E 2 HOH 20  3090 3090 HOH WAT B . 
E 2 HOH 21  3097 3097 HOH WAT B . 
E 2 HOH 22  3102 3102 HOH WAT B . 
E 2 HOH 23  3103 3103 HOH WAT B . 
E 2 HOH 24  3106 3106 HOH WAT B . 
E 2 HOH 25  3107 3107 HOH WAT B . 
E 2 HOH 26  3109 3109 HOH WAT B . 
E 2 HOH 27  3112 3112 HOH WAT B . 
E 2 HOH 28  3119 3119 HOH WAT B . 
E 2 HOH 29  3122 3122 HOH WAT B . 
E 2 HOH 30  3123 3123 HOH WAT B . 
E 2 HOH 31  3126 3126 HOH WAT B . 
E 2 HOH 32  3128 3128 HOH WAT B . 
E 2 HOH 33  3130 3130 HOH WAT B . 
E 2 HOH 34  3132 3132 HOH WAT B . 
E 2 HOH 35  3139 3139 HOH WAT B . 
E 2 HOH 36  3142 3142 HOH WAT B . 
E 2 HOH 37  3145 3145 HOH WAT B . 
E 2 HOH 38  3154 3154 HOH WAT B . 
E 2 HOH 39  3156 3156 HOH WAT B . 
E 2 HOH 40  3159 3159 HOH WAT B . 
E 2 HOH 41  3164 3164 HOH WAT B . 
E 2 HOH 42  3172 3172 HOH WAT B . 
E 2 HOH 43  3173 3173 HOH WAT B . 
E 2 HOH 44  3174 3174 HOH WAT B . 
E 2 HOH 45  3176 3176 HOH WAT B . 
E 2 HOH 46  3182 3182 HOH WAT B . 
E 2 HOH 47  3191 3191 HOH WAT B . 
E 2 HOH 48  3195 3195 HOH WAT B . 
E 2 HOH 49  3197 3197 HOH WAT B . 
E 2 HOH 50  3198 3198 HOH WAT B . 
E 2 HOH 51  3203 3203 HOH WAT B . 
E 2 HOH 52  3208 3208 HOH WAT B . 
E 2 HOH 53  3211 3211 HOH WAT B . 
E 2 HOH 54  3212 3212 HOH WAT B . 
E 2 HOH 55  3213 3213 HOH WAT B . 
E 2 HOH 56  3218 3218 HOH WAT B . 
E 2 HOH 57  3222 3222 HOH WAT B . 
E 2 HOH 58  3226 3226 HOH WAT B . 
E 2 HOH 59  3233 3233 HOH WAT B . 
E 2 HOH 60  3238 3238 HOH WAT B . 
E 2 HOH 61  3242 3242 HOH WAT B . 
E 2 HOH 62  3244 3244 HOH WAT B . 
E 2 HOH 63  3246 3246 HOH WAT B . 
E 2 HOH 64  3249 3249 HOH WAT B . 
E 2 HOH 65  3251 3251 HOH WAT B . 
E 2 HOH 66  3253 3253 HOH WAT B . 
E 2 HOH 67  3257 3257 HOH WAT B . 
E 2 HOH 68  3264 3264 HOH WAT B . 
E 2 HOH 69  3265 3265 HOH WAT B . 
E 2 HOH 70  3271 3271 HOH WAT B . 
E 2 HOH 71  3272 3272 HOH WAT B . 
E 2 HOH 72  3275 3275 HOH WAT B . 
E 2 HOH 73  3280 3280 HOH WAT B . 
E 2 HOH 74  3283 3283 HOH WAT B . 
E 2 HOH 75  3286 3286 HOH WAT B . 
E 2 HOH 76  3288 3288 HOH WAT B . 
E 2 HOH 77  3289 3289 HOH WAT B . 
E 2 HOH 78  3295 3295 HOH WAT B . 
E 2 HOH 79  3297 3297 HOH WAT B . 
E 2 HOH 80  3298 3298 HOH WAT B . 
E 2 HOH 81  3301 3301 HOH WAT B . 
E 2 HOH 82  3307 3307 HOH WAT B . 
E 2 HOH 83  3311 3311 HOH WAT B . 
E 2 HOH 84  3321 3321 HOH WAT B . 
E 2 HOH 85  3323 3323 HOH WAT B . 
E 2 HOH 86  3329 3329 HOH WAT B . 
E 2 HOH 87  3334 3334 HOH WAT B . 
E 2 HOH 88  3336 3336 HOH WAT B . 
E 2 HOH 89  3341 3341 HOH WAT B . 
E 2 HOH 90  3351 3351 HOH WAT B . 
E 2 HOH 91  3352 3352 HOH WAT B . 
E 2 HOH 92  3356 3356 HOH WAT B . 
E 2 HOH 93  3365 3365 HOH WAT B . 
E 2 HOH 94  3374 3374 HOH WAT B . 
E 2 HOH 95  3375 3375 HOH WAT B . 
E 2 HOH 96  3379 3379 HOH WAT B . 
E 2 HOH 97  3381 3381 HOH WAT B . 
E 2 HOH 98  3383 3383 HOH WAT B . 
E 2 HOH 99  3384 3384 HOH WAT B . 
E 2 HOH 100 3387 3387 HOH WAT B . 
E 2 HOH 101 3389 3389 HOH WAT B . 
E 2 HOH 102 3391 3391 HOH WAT B . 
E 2 HOH 103 3395 3395 HOH WAT B . 
E 2 HOH 104 3396 3396 HOH WAT B . 
E 2 HOH 105 3422 3422 HOH WAT B . 
E 2 HOH 106 3426 3426 HOH WAT B . 
E 2 HOH 107 3427 3427 HOH WAT B . 
E 2 HOH 108 3428 3428 HOH WAT B . 
E 2 HOH 109 3431 3431 HOH WAT B . 
E 2 HOH 110 3433 3433 HOH WAT B . 
E 2 HOH 111 3434 3434 HOH WAT B . 
E 2 HOH 112 3435 3435 HOH WAT B . 
E 2 HOH 113 3441 3441 HOH WAT B . 
E 2 HOH 114 3443 3443 HOH WAT B . 
E 2 HOH 115 3445 3445 HOH WAT B . 
E 2 HOH 116 3448 3448 HOH WAT B . 
E 2 HOH 117 3450 3450 HOH WAT B . 
E 2 HOH 118 3452 3452 HOH WAT B . 
E 2 HOH 119 3453 3453 HOH WAT B . 
E 2 HOH 120 3460 3460 HOH WAT B . 
E 2 HOH 121 3464 3464 HOH WAT B . 
E 2 HOH 122 3468 3468 HOH WAT B . 
E 2 HOH 123 3471 3471 HOH WAT B . 
E 2 HOH 124 3474 3474 HOH WAT B . 
E 2 HOH 125 3475 3475 HOH WAT B . 
E 2 HOH 126 3476 3476 HOH WAT B . 
E 2 HOH 127 3479 3479 HOH WAT B . 
E 2 HOH 128 3481 3481 HOH WAT B . 
E 2 HOH 129 3489 3489 HOH WAT B . 
E 2 HOH 130 3502 3502 HOH WAT B . 
E 2 HOH 131 3506 3506 HOH WAT B . 
E 2 HOH 132 3512 3512 HOH WAT B . 
E 2 HOH 133 3513 3513 HOH WAT B . 
E 2 HOH 134 3515 3515 HOH WAT B . 
E 2 HOH 135 3519 3519 HOH WAT B . 
E 2 HOH 136 3524 3524 HOH WAT B . 
E 2 HOH 137 3529 3529 HOH WAT B . 
E 2 HOH 138 3535 3535 HOH WAT B . 
E 2 HOH 139 3540 3540 HOH WAT B . 
E 2 HOH 140 3546 3546 HOH WAT B . 
E 2 HOH 141 3547 3547 HOH WAT B . 
E 2 HOH 142 3554 3554 HOH WAT B . 
E 2 HOH 143 3558 3558 HOH WAT B . 
F 2 HOH 1   3001 3001 HOH WAT C . 
F 2 HOH 2   3006 3006 HOH WAT C . 
F 2 HOH 3   3007 3007 HOH WAT C . 
F 2 HOH 4   3011 3011 HOH WAT C . 
F 2 HOH 5   3013 3013 HOH WAT C . 
F 2 HOH 6   3016 3016 HOH WAT C . 
F 2 HOH 7   3018 3018 HOH WAT C . 
F 2 HOH 8   3024 3024 HOH WAT C . 
F 2 HOH 9   3026 3026 HOH WAT C . 
F 2 HOH 10  3028 3028 HOH WAT C . 
F 2 HOH 11  3032 3032 HOH WAT C . 
F 2 HOH 12  3036 3036 HOH WAT C . 
F 2 HOH 13  3039 3039 HOH WAT C . 
F 2 HOH 14  3044 3044 HOH WAT C . 
F 2 HOH 15  3046 3046 HOH WAT C . 
F 2 HOH 16  3050 3050 HOH WAT C . 
F 2 HOH 17  3051 3051 HOH WAT C . 
F 2 HOH 18  3053 3053 HOH WAT C . 
F 2 HOH 19  3055 3055 HOH WAT C . 
F 2 HOH 20  3056 3056 HOH WAT C . 
F 2 HOH 21  3059 3059 HOH WAT C . 
F 2 HOH 22  3063 3063 HOH WAT C . 
F 2 HOH 23  3064 3064 HOH WAT C . 
F 2 HOH 24  3065 3065 HOH WAT C . 
F 2 HOH 25  3068 3068 HOH WAT C . 
F 2 HOH 26  3076 3076 HOH WAT C . 
F 2 HOH 27  3079 3079 HOH WAT C . 
F 2 HOH 28  3082 3082 HOH WAT C . 
F 2 HOH 29  3083 3083 HOH WAT C . 
F 2 HOH 30  3084 3084 HOH WAT C . 
F 2 HOH 31  3086 3086 HOH WAT C . 
F 2 HOH 32  3089 3089 HOH WAT C . 
F 2 HOH 33  3092 3092 HOH WAT C . 
F 2 HOH 34  3093 3093 HOH WAT C . 
F 2 HOH 35  3095 3095 HOH WAT C . 
F 2 HOH 36  3098 3098 HOH WAT C . 
F 2 HOH 37  3099 3099 HOH WAT C . 
F 2 HOH 38  3105 3105 HOH WAT C . 
F 2 HOH 39  3113 3113 HOH WAT C . 
F 2 HOH 40  3114 3114 HOH WAT C . 
F 2 HOH 41  3117 3117 HOH WAT C . 
F 2 HOH 42  3118 3118 HOH WAT C . 
F 2 HOH 43  3120 3120 HOH WAT C . 
F 2 HOH 44  3121 3121 HOH WAT C . 
F 2 HOH 45  3124 3124 HOH WAT C . 
F 2 HOH 46  3127 3127 HOH WAT C . 
F 2 HOH 47  3129 3129 HOH WAT C . 
F 2 HOH 48  3137 3137 HOH WAT C . 
F 2 HOH 49  3138 3138 HOH WAT C . 
F 2 HOH 50  3140 3140 HOH WAT C . 
F 2 HOH 51  3144 3144 HOH WAT C . 
F 2 HOH 52  3146 3146 HOH WAT C . 
F 2 HOH 53  3148 3148 HOH WAT C . 
F 2 HOH 54  3149 3149 HOH WAT C . 
F 2 HOH 55  3152 3152 HOH WAT C . 
F 2 HOH 56  3155 3155 HOH WAT C . 
F 2 HOH 57  3157 3157 HOH WAT C . 
F 2 HOH 58  3160 3160 HOH WAT C . 
F 2 HOH 59  3163 3163 HOH WAT C . 
F 2 HOH 60  3165 3165 HOH WAT C . 
F 2 HOH 61  3166 3166 HOH WAT C . 
F 2 HOH 62  3167 3167 HOH WAT C . 
F 2 HOH 63  3168 3168 HOH WAT C . 
F 2 HOH 64  3175 3175 HOH WAT C . 
F 2 HOH 65  3177 3177 HOH WAT C . 
F 2 HOH 66  3178 3178 HOH WAT C . 
F 2 HOH 67  3179 3179 HOH WAT C . 
F 2 HOH 68  3180 3180 HOH WAT C . 
F 2 HOH 69  3181 3181 HOH WAT C . 
F 2 HOH 70  3183 3183 HOH WAT C . 
F 2 HOH 71  3185 3185 HOH WAT C . 
F 2 HOH 72  3188 3188 HOH WAT C . 
F 2 HOH 73  3189 3189 HOH WAT C . 
F 2 HOH 74  3190 3190 HOH WAT C . 
F 2 HOH 75  3192 3192 HOH WAT C . 
F 2 HOH 76  3193 3193 HOH WAT C . 
F 2 HOH 77  3194 3194 HOH WAT C . 
F 2 HOH 78  3196 3196 HOH WAT C . 
F 2 HOH 79  3199 3199 HOH WAT C . 
F 2 HOH 80  3207 3207 HOH WAT C . 
F 2 HOH 81  3214 3214 HOH WAT C . 
F 2 HOH 82  3215 3215 HOH WAT C . 
F 2 HOH 83  3217 3217 HOH WAT C . 
F 2 HOH 84  3219 3219 HOH WAT C . 
F 2 HOH 85  3220 3220 HOH WAT C . 
F 2 HOH 86  3221 3221 HOH WAT C . 
F 2 HOH 87  3224 3224 HOH WAT C . 
F 2 HOH 88  3225 3225 HOH WAT C . 
F 2 HOH 89  3230 3230 HOH WAT C . 
F 2 HOH 90  3231 3231 HOH WAT C . 
F 2 HOH 91  3234 3234 HOH WAT C . 
F 2 HOH 92  3237 3237 HOH WAT C . 
F 2 HOH 93  3240 3240 HOH WAT C . 
F 2 HOH 94  3241 3241 HOH WAT C . 
F 2 HOH 95  3247 3247 HOH WAT C . 
F 2 HOH 96  3248 3248 HOH WAT C . 
F 2 HOH 97  3255 3255 HOH WAT C . 
F 2 HOH 98  3256 3256 HOH WAT C . 
F 2 HOH 99  3267 3267 HOH WAT C . 
F 2 HOH 100 3269 3269 HOH WAT C . 
F 2 HOH 101 3270 3270 HOH WAT C . 
F 2 HOH 102 3273 3273 HOH WAT C . 
F 2 HOH 103 3274 3274 HOH WAT C . 
F 2 HOH 104 3278 3278 HOH WAT C . 
F 2 HOH 105 3279 3279 HOH WAT C . 
F 2 HOH 106 3284 3284 HOH WAT C . 
F 2 HOH 107 3287 3287 HOH WAT C . 
F 2 HOH 108 3291 3291 HOH WAT C . 
F 2 HOH 109 3292 3292 HOH WAT C . 
F 2 HOH 110 3293 3293 HOH WAT C . 
F 2 HOH 111 3294 3294 HOH WAT C . 
F 2 HOH 112 3302 3302 HOH WAT C . 
F 2 HOH 113 3305 3305 HOH WAT C . 
F 2 HOH 114 3309 3309 HOH WAT C . 
F 2 HOH 115 3315 3315 HOH WAT C . 
F 2 HOH 116 3317 3317 HOH WAT C . 
F 2 HOH 117 3318 3318 HOH WAT C . 
F 2 HOH 118 3319 3319 HOH WAT C . 
F 2 HOH 119 3320 3320 HOH WAT C . 
F 2 HOH 120 3324 3324 HOH WAT C . 
F 2 HOH 121 3325 3325 HOH WAT C . 
F 2 HOH 122 3327 3327 HOH WAT C . 
F 2 HOH 123 3328 3328 HOH WAT C . 
F 2 HOH 124 3330 3330 HOH WAT C . 
F 2 HOH 125 3335 3335 HOH WAT C . 
F 2 HOH 126 3337 3337 HOH WAT C . 
F 2 HOH 127 3339 3339 HOH WAT C . 
F 2 HOH 128 3340 3340 HOH WAT C . 
F 2 HOH 129 3343 3343 HOH WAT C . 
F 2 HOH 130 3345 3345 HOH WAT C . 
F 2 HOH 131 3349 3349 HOH WAT C . 
F 2 HOH 132 3350 3350 HOH WAT C . 
F 2 HOH 133 3360 3360 HOH WAT C . 
F 2 HOH 134 3362 3362 HOH WAT C . 
F 2 HOH 135 3366 3366 HOH WAT C . 
F 2 HOH 136 3368 3368 HOH WAT C . 
F 2 HOH 137 3371 3371 HOH WAT C . 
F 2 HOH 138 3376 3376 HOH WAT C . 
F 2 HOH 139 3378 3378 HOH WAT C . 
F 2 HOH 140 3380 3380 HOH WAT C . 
F 2 HOH 141 3385 3385 HOH WAT C . 
F 2 HOH 142 3386 3386 HOH WAT C . 
F 2 HOH 143 3392 3392 HOH WAT C . 
F 2 HOH 144 3393 3393 HOH WAT C . 
F 2 HOH 145 3397 3397 HOH WAT C . 
F 2 HOH 146 3399 3399 HOH WAT C . 
F 2 HOH 147 3402 3402 HOH WAT C . 
F 2 HOH 148 3403 3403 HOH WAT C . 
F 2 HOH 149 3405 3405 HOH WAT C . 
F 2 HOH 150 3407 3407 HOH WAT C . 
F 2 HOH 151 3410 3410 HOH WAT C . 
F 2 HOH 152 3412 3412 HOH WAT C . 
F 2 HOH 153 3413 3413 HOH WAT C . 
F 2 HOH 154 3414 3414 HOH WAT C . 
F 2 HOH 155 3417 3417 HOH WAT C . 
F 2 HOH 156 3419 3419 HOH WAT C . 
F 2 HOH 157 3420 3420 HOH WAT C . 
F 2 HOH 158 3421 3421 HOH WAT C . 
F 2 HOH 159 3424 3424 HOH WAT C . 
F 2 HOH 160 3429 3429 HOH WAT C . 
F 2 HOH 161 3437 3437 HOH WAT C . 
F 2 HOH 162 3438 3438 HOH WAT C . 
F 2 HOH 163 3439 3439 HOH WAT C . 
F 2 HOH 164 3440 3440 HOH WAT C . 
F 2 HOH 165 3442 3442 HOH WAT C . 
F 2 HOH 166 3449 3449 HOH WAT C . 
F 2 HOH 167 3454 3454 HOH WAT C . 
F 2 HOH 168 3456 3456 HOH WAT C . 
F 2 HOH 169 3459 3459 HOH WAT C . 
F 2 HOH 170 3466 3466 HOH WAT C . 
F 2 HOH 171 3467 3467 HOH WAT C . 
F 2 HOH 172 3469 3469 HOH WAT C . 
F 2 HOH 173 3470 3470 HOH WAT C . 
F 2 HOH 174 3478 3478 HOH WAT C . 
F 2 HOH 175 3480 3480 HOH WAT C . 
F 2 HOH 176 3483 3483 HOH WAT C . 
F 2 HOH 177 3484 3484 HOH WAT C . 
F 2 HOH 178 3486 3486 HOH WAT C . 
F 2 HOH 179 3487 3487 HOH WAT C . 
F 2 HOH 180 3488 3488 HOH WAT C . 
F 2 HOH 181 3492 3492 HOH WAT C . 
F 2 HOH 182 3496 3496 HOH WAT C . 
F 2 HOH 183 3498 3498 HOH WAT C . 
F 2 HOH 184 3499 3499 HOH WAT C . 
F 2 HOH 185 3503 3503 HOH WAT C . 
F 2 HOH 186 3504 3504 HOH WAT C . 
F 2 HOH 187 3505 3505 HOH WAT C . 
F 2 HOH 188 3507 3507 HOH WAT C . 
F 2 HOH 189 3514 3514 HOH WAT C . 
F 2 HOH 190 3516 3516 HOH WAT C . 
F 2 HOH 191 3517 3517 HOH WAT C . 
F 2 HOH 192 3518 3518 HOH WAT C . 
F 2 HOH 193 3520 3520 HOH WAT C . 
F 2 HOH 194 3521 3521 HOH WAT C . 
F 2 HOH 195 3522 3522 HOH WAT C . 
F 2 HOH 196 3526 3526 HOH WAT C . 
F 2 HOH 197 3528 3528 HOH WAT C . 
F 2 HOH 198 3530 3530 HOH WAT C . 
F 2 HOH 199 3533 3533 HOH WAT C . 
F 2 HOH 200 3537 3537 HOH WAT C . 
F 2 HOH 201 3541 3541 HOH WAT C . 
F 2 HOH 202 3545 3545 HOH WAT C . 
F 2 HOH 203 3549 3549 HOH WAT C . 
F 2 HOH 204 3550 3550 HOH WAT C . 
F 2 HOH 205 3551 3551 HOH WAT C . 
F 2 HOH 206 3552 3552 HOH WAT C . 
F 2 HOH 207 3553 3553 HOH WAT C . 
F 2 HOH 208 3555 3555 HOH WAT C . 
F 2 HOH 209 3556 3556 HOH WAT C . 
F 2 HOH 210 3557 3557 HOH WAT C . 
#