data_1LUA
# 
_entry.id   1LUA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LUA         
RCSB  RCSB016276   
WWPDB D_1000016276 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1LU9 
_pdbx_database_related.details        '1LU9 contains the same protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LUA 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ermler, U.'      1 
'Hagemeier, C.H.' 2 
'Roth, A.'        3 
'Demmer, U.'      4 
'Grabarse, W.'    5 
'Warkentin, E.'   6 
'Vorholt, J.A.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of methylene-tetrahydromethanopterin dehydrogenase from methylobacterium extorquens AM1.'    Structure    10  
1127 1137 2002 STRUE6 UK 0969-2126 2005 ? 12176390 '10.1016/S0969-2126(02)00802-X' 
1       'The NADP-Dependent Methylene Tetrahydromethanopterin Dehydrogenase in Methylobacterium extorquens AM1' J.BACTERIOL. 180 
5351 5356 1998 JOBAAY US 0021-9193 0767 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ermler, U.'        1  
primary 'Hagemeier, C.H.'   2  
primary 'Roth, A.'          3  
primary 'Demmer, U.'        4  
primary 'Grabarse, W.'      5  
primary 'Warkentin, E.'     6  
primary 'Vorholt, J.A.'     7  
1       'Vorholt, J.A.'     8  
1       'Chistoserdova, L.' 9  
1       'Lidstrom, M.E.'    10 
1       'Thauer, R.K.'      11 
# 
_cell.entry_id           1LUA 
_cell.length_a           75.9 
_cell.length_b           79.86 
_cell.length_c           154.29 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LUA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methylene Tetrahydromethanopterin Dehydrogenase'  29640.609 3   1.5.1.5 ? ? ? 
2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   3   ?       ? ? ? 
3 water       nat water                                              18.015    712 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Methylenetetrahydrofolate dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   LYS n 
1 4   LEU n 
1 5   LEU n 
1 6   PHE n 
1 7   GLN n 
1 8   PHE n 
1 9   ASP n 
1 10  THR n 
1 11  ASP n 
1 12  ALA n 
1 13  THR n 
1 14  PRO n 
1 15  SER n 
1 16  VAL n 
1 17  PHE n 
1 18  ASP n 
1 19  VAL n 
1 20  VAL n 
1 21  VAL n 
1 22  GLY n 
1 23  TYR n 
1 24  ASP n 
1 25  GLY n 
1 26  GLY n 
1 27  ALA n 
1 28  ASP n 
1 29  HIS n 
1 30  ILE n 
1 31  THR n 
1 32  GLY n 
1 33  TYR n 
1 34  GLY n 
1 35  ASN n 
1 36  VAL n 
1 37  THR n 
1 38  PRO n 
1 39  ASP n 
1 40  ASN n 
1 41  VAL n 
1 42  GLY n 
1 43  ALA n 
1 44  TYR n 
1 45  VAL n 
1 46  ASP n 
1 47  GLY n 
1 48  THR n 
1 49  ILE n 
1 50  TYR n 
1 51  THR n 
1 52  ARG n 
1 53  GLY n 
1 54  GLY n 
1 55  LYS n 
1 56  GLU n 
1 57  LYS n 
1 58  GLN n 
1 59  SER n 
1 60  THR n 
1 61  ALA n 
1 62  ILE n 
1 63  PHE n 
1 64  VAL n 
1 65  GLY n 
1 66  GLY n 
1 67  GLY n 
1 68  ASP n 
1 69  MET n 
1 70  ALA n 
1 71  ALA n 
1 72  GLY n 
1 73  GLU n 
1 74  ARG n 
1 75  VAL n 
1 76  PHE n 
1 77  GLU n 
1 78  ALA n 
1 79  VAL n 
1 80  LYS n 
1 81  LYS n 
1 82  ARG n 
1 83  PHE n 
1 84  PHE n 
1 85  GLY n 
1 86  PRO n 
1 87  PHE n 
1 88  ARG n 
1 89  VAL n 
1 90  SER n 
1 91  CYS n 
1 92  MET n 
1 93  LEU n 
1 94  ASP n 
1 95  SER n 
1 96  ASN n 
1 97  GLY n 
1 98  SER n 
1 99  ASN n 
1 100 THR n 
1 101 THR n 
1 102 ALA n 
1 103 ALA n 
1 104 ALA n 
1 105 GLY n 
1 106 VAL n 
1 107 ALA n 
1 108 LEU n 
1 109 VAL n 
1 110 VAL n 
1 111 LYS n 
1 112 ALA n 
1 113 ALA n 
1 114 GLY n 
1 115 GLY n 
1 116 SER n 
1 117 VAL n 
1 118 LYS n 
1 119 GLY n 
1 120 LYS n 
1 121 LYS n 
1 122 ALA n 
1 123 VAL n 
1 124 VAL n 
1 125 LEU n 
1 126 ALA n 
1 127 GLY n 
1 128 THR n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 GLY n 
1 133 MET n 
1 134 ARG n 
1 135 SER n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 GLY n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 GLU n 
1 146 VAL n 
1 147 VAL n 
1 148 LEU n 
1 149 CYS n 
1 150 GLY n 
1 151 ARG n 
1 152 LYS n 
1 153 LEU n 
1 154 ASP n 
1 155 LYS n 
1 156 ALA n 
1 157 GLN n 
1 158 ALA n 
1 159 ALA n 
1 160 ALA n 
1 161 ASP n 
1 162 SER n 
1 163 VAL n 
1 164 ASN n 
1 165 LYS n 
1 166 ARG n 
1 167 PHE n 
1 168 LYS n 
1 169 VAL n 
1 170 ASN n 
1 171 VAL n 
1 172 THR n 
1 173 ALA n 
1 174 ALA n 
1 175 GLU n 
1 176 THR n 
1 177 ALA n 
1 178 ASP n 
1 179 ASP n 
1 180 ALA n 
1 181 SER n 
1 182 ARG n 
1 183 ALA n 
1 184 GLU n 
1 185 ALA n 
1 186 VAL n 
1 187 LYS n 
1 188 GLY n 
1 189 ALA n 
1 190 HIS n 
1 191 PHE n 
1 192 VAL n 
1 193 PHE n 
1 194 THR n 
1 195 ALA n 
1 196 GLY n 
1 197 ALA n 
1 198 ILE n 
1 199 GLY n 
1 200 LEU n 
1 201 GLU n 
1 202 LEU n 
1 203 LEU n 
1 204 PRO n 
1 205 GLN n 
1 206 ALA n 
1 207 ALA n 
1 208 TRP n 
1 209 GLN n 
1 210 ASN n 
1 211 GLU n 
1 212 SER n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 ILE n 
1 217 VAL n 
1 218 ALA n 
1 219 ASP n 
1 220 TYR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLN n 
1 224 PRO n 
1 225 PRO n 
1 226 LEU n 
1 227 GLY n 
1 228 ILE n 
1 229 GLY n 
1 230 GLY n 
1 231 ILE n 
1 232 ASP n 
1 233 ALA n 
1 234 THR n 
1 235 ASP n 
1 236 LYS n 
1 237 GLY n 
1 238 LYS n 
1 239 GLU n 
1 240 TYR n 
1 241 GLY n 
1 242 GLY n 
1 243 LYS n 
1 244 ARG n 
1 245 ALA n 
1 246 PHE n 
1 247 GLY n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 ILE n 
1 252 GLY n 
1 253 GLY n 
1 254 LEU n 
1 255 LYS n 
1 256 LEU n 
1 257 LYS n 
1 258 LEU n 
1 259 HIS n 
1 260 ARG n 
1 261 ALA n 
1 262 CYS n 
1 263 ILE n 
1 264 ALA n 
1 265 LYS n 
1 266 LEU n 
1 267 PHE n 
1 268 GLU n 
1 269 SER n 
1 270 SER n 
1 271 GLU n 
1 272 GLY n 
1 273 VAL n 
1 274 PHE n 
1 275 ASP n 
1 276 ALA n 
1 277 GLU n 
1 278 GLU n 
1 279 ILE n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ALA n 
1 284 LYS n 
1 285 GLU n 
1 286 MET n 
1 287 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Methylobacterium 
_entity_src_gen.pdbx_gene_src_gene                 mtdA 
_entity_src_gen.gene_src_species                   'Methylobacterium extorquens' 
_entity_src_gen.gene_src_strain                    AM1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Methylobacterium extorquens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 17b CH1' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MTDA_METEX 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVK
KRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKGKKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAA
DSVNKRFKVNVTAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEY
GGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P55818 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LUA A 1 ? 287 ? P55818 1 ? 287 ? 2 288 
2 1 1LUA B 1 ? 287 ? P55818 1 ? 287 ? 2 288 
3 1 1LUA C 1 ? 287 ? P55818 1 ? 287 ? 2 288 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1LUA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.21 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG8000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-09-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.81 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.81 
# 
_reflns.entry_id                     1LUA 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   82475 
_reflns.number_all                   82475 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            0.0910000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19 
_reflns.B_iso_Wilson_estimate        17.6 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              2.0 
_reflns_shell.percent_possible_all   97.4 
_reflns_shell.Rmerge_I_obs           0.2700000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      9753 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1LUA 
_refine.ls_number_reflns_obs                     68017 
_refine.ls_number_reflns_all                     68017 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               931083.76 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             29.13 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    91.8 
_refine.ls_R_factor_obs                          0.1850000 
_refine.ls_R_factor_all                          0.1850000 
_refine.ls_R_factor_R_work                       0.1850000 
_refine.ls_R_factor_R_free                       0.2220000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3446 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.1 
_refine.aniso_B[1][1]                            1.10 
_refine.aniso_B[2][2]                            -2.36 
_refine.aniso_B[3][3]                            1.26 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.324197 
_refine.solvent_model_param_bsol                 45.4155 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Methylene Tetrahydromethanopterin Dehydrogenase' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LUA 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6252 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         144 
_refine_hist.number_atoms_solvent             712 
_refine_hist.number_atoms_total               7108 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.13 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.3  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.91  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             9487 
_refine_ls_shell.R_factor_R_work                  0.2130000 
_refine_ls_shell.percent_reflns_obs               81.3 
_refine_ls_shell.R_factor_R_free                  0.2630000 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             462 
_refine_ls_shell.number_reflns_obs                9482 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 NAP_F42.PARAM     NAP_F42.TOP 'X-RAY DIFFRACTION' 
4 MTDAP21_CIS.PARAM ION.TOP     'X-RAY DIFFRACTION' 
5 ION.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LUA 
_struct.title                     
'Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1 complexed with NADP' 
_struct.pdbx_descriptor           
'Methylene Tetrahydromethanopterin Dehydrogenase(E.C.1.5.1.5)/ NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LUA 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'alpha/beta twisted open sheet structure, Oxidoreductase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 15  ? GLY A 25  ? SER A 16  GLY A 26  1 ? 11 
HELX_P HELX_P2  2  ASN A 40  ? TYR A 50  ? ASN A 41  TYR A 51  1 ? 11 
HELX_P HELX_P3  3  GLY A 53  ? GLN A 58  ? GLY A 54  GLN A 59  5 ? 6  
HELX_P HELX_P4  4  ASP A 68  ? PHE A 83  ? ASP A 69  PHE A 84  1 ? 16 
HELX_P HELX_P5  5  GLY A 97  ? ALA A 113 ? GLY A 98  ALA A 114 1 ? 17 
HELX_P HELX_P6  6  GLY A 129 ? GLU A 142 ? GLY A 130 GLU A 143 1 ? 14 
HELX_P HELX_P7  7  LYS A 152 ? LYS A 168 ? LYS A 153 LYS A 169 1 ? 17 
HELX_P HELX_P8  8  ASP A 178 ? VAL A 186 ? ASP A 179 VAL A 187 1 ? 9  
HELX_P HELX_P9  9  PRO A 204 ? ASN A 210 ? PRO A 205 ASN A 211 1 ? 7  
HELX_P HELX_P10 10 GLY A 247 ? PHE A 267 ? GLY A 248 PHE A 268 1 ? 21 
HELX_P HELX_P11 11 ASP A 275 ? ALA A 287 ? ASP A 276 ALA A 288 1 ? 13 
HELX_P HELX_P12 12 SER B 15  ? GLY B 25  ? SER B 16  GLY B 26  1 ? 11 
HELX_P HELX_P13 13 ASN B 40  ? TYR B 50  ? ASN B 41  TYR B 51  1 ? 11 
HELX_P HELX_P14 14 GLY B 53  ? GLN B 58  ? GLY B 54  GLN B 59  5 ? 6  
HELX_P HELX_P15 15 ASP B 68  ? PHE B 83  ? ASP B 69  PHE B 84  1 ? 16 
HELX_P HELX_P16 16 GLY B 97  ? ALA B 113 ? GLY B 98  ALA B 114 1 ? 17 
HELX_P HELX_P17 17 GLY B 129 ? GLU B 142 ? GLY B 130 GLU B 143 1 ? 14 
HELX_P HELX_P18 18 LYS B 152 ? LYS B 168 ? LYS B 153 LYS B 169 1 ? 17 
HELX_P HELX_P19 19 ASP B 178 ? VAL B 186 ? ASP B 179 VAL B 187 1 ? 9  
HELX_P HELX_P20 20 PRO B 204 ? TRP B 208 ? PRO B 205 TRP B 209 5 ? 5  
HELX_P HELX_P21 21 GLY B 247 ? PHE B 267 ? GLY B 248 PHE B 268 1 ? 21 
HELX_P HELX_P22 22 ASP B 275 ? ALA B 287 ? ASP B 276 ALA B 288 1 ? 13 
HELX_P HELX_P23 23 SER C 15  ? GLY C 25  ? SER C 16  GLY C 26  1 ? 11 
HELX_P HELX_P24 24 ASN C 40  ? TYR C 50  ? ASN C 41  TYR C 51  1 ? 11 
HELX_P HELX_P25 25 GLY C 53  ? GLN C 58  ? GLY C 54  GLN C 59  5 ? 6  
HELX_P HELX_P26 26 ASP C 68  ? PHE C 83  ? ASP C 69  PHE C 84  1 ? 16 
HELX_P HELX_P27 27 GLY C 97  ? ALA C 113 ? GLY C 98  ALA C 114 1 ? 17 
HELX_P HELX_P28 28 GLY C 129 ? GLU C 142 ? GLY C 130 GLU C 143 1 ? 14 
HELX_P HELX_P29 29 LYS C 152 ? LYS C 168 ? LYS C 153 LYS C 169 1 ? 17 
HELX_P HELX_P30 30 ASP C 178 ? VAL C 186 ? ASP C 179 VAL C 187 1 ? 9  
HELX_P HELX_P31 31 PRO C 204 ? TRP C 208 ? PRO C 205 TRP C 209 5 ? 5  
HELX_P HELX_P32 32 GLY C 247 ? PHE C 267 ? GLY C 248 PHE C 268 1 ? 21 
HELX_P HELX_P33 33 ASP C 275 ? ALA C 287 ? ASP C 276 ALA C 288 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 224 A . ? PRO 225 A PRO 225 A ? PRO 226 A 1 -0.23 
2 PRO 224 B . ? PRO 225 B PRO 225 B ? PRO 226 B 1 0.22  
3 PRO 224 C . ? PRO 225 C PRO 225 C ? PRO 226 C 1 -0.47 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 5 ? 
D ? 7 ? 
E ? 5 ? 
F ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 29  ? TYR A 33  ? HIS A 30  TYR A 34  
A 2 LEU A 4   ? ASP A 9   ? LEU A 5   ASP A 10  
A 3 THR A 60  ? GLY A 65  ? THR A 61  GLY A 66  
A 4 SER A 90  ? LEU A 93  ? SER A 91  LEU A 94  
A 5 VAL A 273 ? PHE A 274 ? VAL A 274 PHE A 275 
B 1 THR A 172 ? GLU A 175 ? THR A 173 GLU A 176 
B 2 GLU A 145 ? GLY A 150 ? GLU A 146 GLY A 151 
B 3 LYS A 121 ? LEU A 125 ? LYS A 122 LEU A 126 
B 4 PHE A 191 ? THR A 194 ? PHE A 192 THR A 195 
B 5 ILE A 216 ? ASP A 219 ? ILE A 217 ASP A 220 
B 6 LYS A 243 ? PHE A 246 ? LYS A 244 PHE A 247 
B 7 LYS A 236 ? TYR A 240 ? LYS A 237 TYR A 241 
C 1 HIS B 29  ? TYR B 33  ? HIS B 30  TYR B 34  
C 2 LEU B 4   ? ASP B 9   ? LEU B 5   ASP B 10  
C 3 THR B 60  ? GLY B 65  ? THR B 61  GLY B 66  
C 4 SER B 90  ? LEU B 93  ? SER B 91  LEU B 94  
C 5 VAL B 273 ? PHE B 274 ? VAL B 274 PHE B 275 
D 1 THR B 172 ? GLU B 175 ? THR B 173 GLU B 176 
D 2 GLU B 145 ? GLY B 150 ? GLU B 146 GLY B 151 
D 3 LYS B 121 ? LEU B 125 ? LYS B 122 LEU B 126 
D 4 PHE B 191 ? THR B 194 ? PHE B 192 THR B 195 
D 5 ILE B 216 ? ASP B 219 ? ILE B 217 ASP B 220 
D 6 LYS B 243 ? PHE B 246 ? LYS B 244 PHE B 247 
D 7 LYS B 236 ? TYR B 240 ? LYS B 237 TYR B 241 
E 1 HIS C 29  ? TYR C 33  ? HIS C 30  TYR C 34  
E 2 LEU C 4   ? ASP C 9   ? LEU C 5   ASP C 10  
E 3 THR C 60  ? GLY C 65  ? THR C 61  GLY C 66  
E 4 SER C 90  ? LEU C 93  ? SER C 91  LEU C 94  
E 5 VAL C 273 ? PHE C 274 ? VAL C 274 PHE C 275 
F 1 THR C 172 ? GLU C 175 ? THR C 173 GLU C 176 
F 2 GLU C 145 ? GLY C 150 ? GLU C 146 GLY C 151 
F 3 LYS C 121 ? LEU C 125 ? LYS C 122 LEU C 126 
F 4 PHE C 191 ? THR C 194 ? PHE C 192 THR C 195 
F 5 ILE C 216 ? ASP C 219 ? ILE C 217 ASP C 220 
F 6 LYS C 243 ? PHE C 246 ? LYS C 244 PHE C 247 
F 7 LYS C 236 ? TYR C 240 ? LYS C 237 TYR C 241 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 29  ? O HIS A 30  N LEU A 5   ? N LEU A 6   
A 2 3 N PHE A 8   ? N PHE A 9   O PHE A 63  ? O PHE A 64  
A 3 4 N VAL A 64  ? N VAL A 65  O MET A 92  ? O MET A 93  
A 4 5 N CYS A 91  ? N CYS A 92  O PHE A 274 ? O PHE A 275 
B 1 2 O THR A 172 ? O THR A 173 N LEU A 148 ? N LEU A 149 
B 2 3 O GLU A 145 ? O GLU A 146 N ALA A 122 ? N ALA A 123 
B 3 4 N LEU A 125 ? N LEU A 126 O PHE A 193 ? O PHE A 194 
B 4 5 N VAL A 192 ? N VAL A 193 O ALA A 218 ? O ALA A 219 
B 5 6 N VAL A 217 ? N VAL A 218 O ARG A 244 ? O ARG A 245 
B 6 7 O LYS A 243 ? O LYS A 244 N TYR A 240 ? N TYR A 241 
C 1 2 O HIS B 29  ? O HIS B 30  N LEU B 5   ? N LEU B 6   
C 2 3 N PHE B 8   ? N PHE B 9   O PHE B 63  ? O PHE B 64  
C 3 4 N VAL B 64  ? N VAL B 65  O MET B 92  ? O MET B 93  
C 4 5 N CYS B 91  ? N CYS B 92  O PHE B 274 ? O PHE B 275 
D 1 2 O THR B 172 ? O THR B 173 N LEU B 148 ? N LEU B 149 
D 2 3 O GLU B 145 ? O GLU B 146 N ALA B 122 ? N ALA B 123 
D 3 4 N VAL B 123 ? N VAL B 124 O PHE B 193 ? O PHE B 194 
D 4 5 N VAL B 192 ? N VAL B 193 O ALA B 218 ? O ALA B 219 
D 5 6 N VAL B 217 ? N VAL B 218 O ARG B 244 ? O ARG B 245 
D 6 7 O LYS B 243 ? O LYS B 244 N TYR B 240 ? N TYR B 241 
E 1 2 O HIS C 29  ? O HIS C 30  N LEU C 5   ? N LEU C 6   
E 2 3 N PHE C 8   ? N PHE C 9   O PHE C 63  ? O PHE C 64  
E 3 4 N VAL C 64  ? N VAL C 65  O MET C 92  ? O MET C 93  
E 4 5 N CYS C 91  ? N CYS C 92  O PHE C 274 ? O PHE C 275 
F 1 2 O THR C 172 ? O THR C 173 N LEU C 148 ? N LEU C 149 
F 2 3 O GLU C 145 ? O GLU C 146 N ALA C 122 ? N ALA C 123 
F 3 4 N LEU C 125 ? N LEU C 126 O PHE C 193 ? O PHE C 194 
F 4 5 N VAL C 192 ? N VAL C 193 O ALA C 218 ? O ALA C 219 
F 5 6 N VAL C 217 ? N VAL C 218 O ARG C 244 ? O ARG C 245 
F 6 7 O LYS C 243 ? O LYS C 244 N TYR C 240 ? N TYR C 241 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAP A 456'  
AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAP B 1456' 
AC3 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAP C 2456' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 28 ASN A 96  ? ASN A 97   . ? 1_555 ? 
2  AC1 28 THR A 101 ? THR A 102  . ? 1_555 ? 
3  AC1 28 ALA A 126 ? ALA A 127  . ? 1_555 ? 
4  AC1 28 THR A 128 ? THR A 129  . ? 1_555 ? 
5  AC1 28 GLY A 129 ? GLY A 130  . ? 1_555 ? 
6  AC1 28 PRO A 130 ? PRO A 131  . ? 1_555 ? 
7  AC1 28 VAL A 131 ? VAL A 132  . ? 1_555 ? 
8  AC1 28 GLY A 150 ? GLY A 151  . ? 1_555 ? 
9  AC1 28 ARG A 151 ? ARG A 152  . ? 1_555 ? 
10 AC1 28 LYS A 155 ? LYS A 156  . ? 1_555 ? 
11 AC1 28 ALA A 195 ? ALA A 196  . ? 1_555 ? 
12 AC1 28 GLY A 196 ? GLY A 197  . ? 1_555 ? 
13 AC1 28 ALA A 197 ? ALA A 198  . ? 1_555 ? 
14 AC1 28 ILE A 198 ? ILE A 199  . ? 1_555 ? 
15 AC1 28 LEU A 200 ? LEU A 201  . ? 1_555 ? 
16 AC1 28 TYR A 220 ? TYR A 221  . ? 1_555 ? 
17 AC1 28 ASN A 221 ? ASN A 222  . ? 1_555 ? 
18 AC1 28 LYS A 255 ? LYS A 256  . ? 1_555 ? 
19 AC1 28 HOH G .   ? HOH A 3270 . ? 1_555 ? 
20 AC1 28 HOH G .   ? HOH A 3395 . ? 1_555 ? 
21 AC1 28 HOH G .   ? HOH A 3456 . ? 1_555 ? 
22 AC1 28 HOH G .   ? HOH A 3474 . ? 1_555 ? 
23 AC1 28 HOH G .   ? HOH A 3515 . ? 1_555 ? 
24 AC1 28 HOH G .   ? HOH A 3644 . ? 1_555 ? 
25 AC1 28 HOH G .   ? HOH A 3687 . ? 1_555 ? 
26 AC1 28 HOH G .   ? HOH A 3813 . ? 1_555 ? 
27 AC1 28 HOH G .   ? HOH A 3875 . ? 1_555 ? 
28 AC1 28 HOH G .   ? HOH A 3893 . ? 1_555 ? 
29 AC2 23 ASN B 96  ? ASN B 97   . ? 1_555 ? 
30 AC2 23 THR B 101 ? THR B 102  . ? 1_555 ? 
31 AC2 23 THR B 128 ? THR B 129  . ? 1_555 ? 
32 AC2 23 GLY B 129 ? GLY B 130  . ? 1_555 ? 
33 AC2 23 PRO B 130 ? PRO B 131  . ? 1_555 ? 
34 AC2 23 VAL B 131 ? VAL B 132  . ? 1_555 ? 
35 AC2 23 GLY B 150 ? GLY B 151  . ? 1_555 ? 
36 AC2 23 ARG B 151 ? ARG B 152  . ? 1_555 ? 
37 AC2 23 LYS B 155 ? LYS B 156  . ? 1_555 ? 
38 AC2 23 ALA B 195 ? ALA B 196  . ? 1_555 ? 
39 AC2 23 GLY B 196 ? GLY B 197  . ? 1_555 ? 
40 AC2 23 ALA B 197 ? ALA B 198  . ? 1_555 ? 
41 AC2 23 ILE B 198 ? ILE B 199  . ? 1_555 ? 
42 AC2 23 LEU B 200 ? LEU B 201  . ? 1_555 ? 
43 AC2 23 TYR B 220 ? TYR B 221  . ? 1_555 ? 
44 AC2 23 ASN B 221 ? ASN B 222  . ? 1_555 ? 
45 AC2 23 LYS B 255 ? LYS B 256  . ? 1_555 ? 
46 AC2 23 HOH H .   ? HOH B 3352 . ? 1_555 ? 
47 AC2 23 HOH H .   ? HOH B 3537 . ? 1_555 ? 
48 AC2 23 HOH H .   ? HOH B 3579 . ? 1_555 ? 
49 AC2 23 HOH H .   ? HOH B 3684 . ? 1_555 ? 
50 AC2 23 HOH H .   ? HOH B 3696 . ? 1_555 ? 
51 AC2 23 HOH H .   ? HOH B 3896 . ? 1_555 ? 
52 AC3 29 ASN C 96  ? ASN C 97   . ? 1_555 ? 
53 AC3 29 THR C 101 ? THR C 102  . ? 1_555 ? 
54 AC3 29 ALA C 126 ? ALA C 127  . ? 1_555 ? 
55 AC3 29 THR C 128 ? THR C 129  . ? 1_555 ? 
56 AC3 29 GLY C 129 ? GLY C 130  . ? 1_555 ? 
57 AC3 29 PRO C 130 ? PRO C 131  . ? 1_555 ? 
58 AC3 29 VAL C 131 ? VAL C 132  . ? 1_555 ? 
59 AC3 29 GLY C 150 ? GLY C 151  . ? 1_555 ? 
60 AC3 29 ARG C 151 ? ARG C 152  . ? 1_555 ? 
61 AC3 29 LYS C 155 ? LYS C 156  . ? 1_555 ? 
62 AC3 29 ALA C 195 ? ALA C 196  . ? 1_555 ? 
63 AC3 29 GLY C 196 ? GLY C 197  . ? 1_555 ? 
64 AC3 29 ALA C 197 ? ALA C 198  . ? 1_555 ? 
65 AC3 29 ILE C 198 ? ILE C 199  . ? 1_555 ? 
66 AC3 29 LEU C 200 ? LEU C 201  . ? 1_555 ? 
67 AC3 29 TYR C 220 ? TYR C 221  . ? 1_555 ? 
68 AC3 29 ASN C 221 ? ASN C 222  . ? 1_555 ? 
69 AC3 29 LYS C 255 ? LYS C 256  . ? 1_555 ? 
70 AC3 29 HOH I .   ? HOH C 3243 . ? 1_555 ? 
71 AC3 29 HOH I .   ? HOH C 3433 . ? 1_555 ? 
72 AC3 29 HOH I .   ? HOH C 3445 . ? 1_555 ? 
73 AC3 29 HOH I .   ? HOH C 3603 . ? 1_555 ? 
74 AC3 29 HOH I .   ? HOH C 3646 . ? 1_555 ? 
75 AC3 29 HOH I .   ? HOH C 3709 . ? 1_555 ? 
76 AC3 29 HOH I .   ? HOH C 3731 . ? 1_555 ? 
77 AC3 29 HOH I .   ? HOH C 3764 . ? 1_555 ? 
78 AC3 29 HOH I .   ? HOH C 3766 . ? 1_555 ? 
79 AC3 29 HOH I .   ? HOH C 3842 . ? 1_555 ? 
80 AC3 29 HOH I .   ? HOH C 3855 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LUA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LUA 
_atom_sites.fract_transf_matrix[1][1]   0.013175 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012522 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006481 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 8.022  22.388 71.606  1.00 33.79 ? 2    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 9.211  23.229 71.896  1.00 33.24 ? 2    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 9.450  24.146 70.703  1.00 32.00 ? 2    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 9.121  23.798 69.559  1.00 31.80 ? 2    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 10.444 22.338 72.112  1.00 36.93 ? 2    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 10.186 21.294 73.046  1.00 42.12 ? 2    SER A OG  1 
ATOM   7    N N   . LYS A 1 2   ? 9.991  25.330 70.975  1.00 28.30 ? 3    LYS A N   1 
ATOM   8    C CA  . LYS A 1 2   ? 10.316 26.286 69.929  1.00 23.63 ? 3    LYS A CA  1 
ATOM   9    C C   . LYS A 1 2   ? 11.545 25.765 69.176  1.00 21.37 ? 3    LYS A C   1 
ATOM   10   O O   . LYS A 1 2   ? 12.449 25.153 69.781  1.00 20.44 ? 3    LYS A O   1 
ATOM   11   C CB  . LYS A 1 2   ? 10.641 27.649 70.539  1.00 25.97 ? 3    LYS A CB  1 
ATOM   12   C CG  . LYS A 1 2   ? 9.450  28.334 71.207  1.00 29.44 ? 3    LYS A CG  1 
ATOM   13   C CD  . LYS A 1 2   ? 8.402  28.670 70.152  1.00 32.90 ? 3    LYS A CD  1 
ATOM   14   C CE  . LYS A 1 2   ? 7.125  29.233 70.772  1.00 36.64 ? 3    LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 2   ? 6.216  29.674 69.685  1.00 38.23 ? 3    LYS A NZ  1 
ATOM   16   N N   A LYS A 1 3   ? 11.570 25.999 67.870  0.60 19.78 ? 4    LYS A N   1 
ATOM   17   N N   B LYS A 1 3   ? 11.577 25.992 67.867  0.40 20.44 ? 4    LYS A N   1 
ATOM   18   C CA  A LYS A 1 3   ? 12.691 25.572 67.038  0.60 19.68 ? 4    LYS A CA  1 
ATOM   19   C CA  B LYS A 1 3   ? 12.701 25.552 67.043  0.40 20.25 ? 4    LYS A CA  1 
ATOM   20   C C   A LYS A 1 3   ? 13.810 26.607 67.177  0.60 19.49 ? 4    LYS A C   1 
ATOM   21   C C   B LYS A 1 3   ? 13.822 26.587 67.146  0.40 19.68 ? 4    LYS A C   1 
ATOM   22   O O   A LYS A 1 3   ? 13.672 27.747 66.731  0.60 20.32 ? 4    LYS A O   1 
ATOM   23   O O   B LYS A 1 3   ? 13.705 27.701 66.631  0.40 20.27 ? 4    LYS A O   1 
ATOM   24   C CB  A LYS A 1 3   ? 12.231 25.452 65.581  0.60 20.37 ? 4    LYS A CB  1 
ATOM   25   C CB  B LYS A 1 3   ? 12.242 25.377 65.593  0.40 21.58 ? 4    LYS A CB  1 
ATOM   26   C CG  A LYS A 1 3   ? 11.335 24.245 65.322  0.60 19.74 ? 4    LYS A CG  1 
ATOM   27   C CG  B LYS A 1 3   ? 11.182 24.291 65.428  0.40 22.17 ? 4    LYS A CG  1 
ATOM   28   C CD  A LYS A 1 3   ? 10.746 24.264 63.921  0.60 21.38 ? 4    LYS A CD  1 
ATOM   29   C CD  B LYS A 1 3   ? 10.792 24.085 63.974  0.40 24.61 ? 4    LYS A CD  1 
ATOM   30   C CE  A LYS A 1 3   ? 9.636  25.288 63.795  0.60 19.90 ? 4    LYS A CE  1 
ATOM   31   C CE  B LYS A 1 3   ? 9.820  22.920 63.830  0.40 23.87 ? 4    LYS A CE  1 
ATOM   32   N NZ  A LYS A 1 3   ? 9.151  25.388 62.377  0.60 22.50 ? 4    LYS A NZ  1 
ATOM   33   N NZ  B LYS A 1 3   ? 8.510  23.188 64.505  0.40 28.59 ? 4    LYS A NZ  1 
ATOM   34   N N   . LEU A 1 4   ? 14.901 26.206 67.823  1.00 17.60 ? 5    LEU A N   1 
ATOM   35   C CA  . LEU A 1 4   ? 16.043 27.096 68.051  1.00 18.10 ? 5    LEU A CA  1 
ATOM   36   C C   . LEU A 1 4   ? 17.240 26.751 67.187  1.00 20.29 ? 5    LEU A C   1 
ATOM   37   O O   . LEU A 1 4   ? 17.760 25.625 67.268  1.00 18.63 ? 5    LEU A O   1 
ATOM   38   C CB  . LEU A 1 4   ? 16.486 26.995 69.511  1.00 16.33 ? 5    LEU A CB  1 
ATOM   39   C CG  . LEU A 1 4   ? 15.394 27.066 70.584  1.00 18.16 ? 5    LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 4   ? 16.033 26.849 71.979  1.00 17.16 ? 5    LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 4   ? 14.694 28.420 70.516  1.00 16.85 ? 5    LEU A CD2 1 
ATOM   42   N N   . LEU A 1 5   ? 17.674 27.711 66.374  1.00 16.82 ? 6    LEU A N   1 
ATOM   43   C CA  . LEU A 1 5   ? 18.838 27.521 65.509  1.00 18.52 ? 6    LEU A CA  1 
ATOM   44   C C   . LEU A 1 5   ? 20.025 28.286 66.108  1.00 18.00 ? 6    LEU A C   1 
ATOM   45   O O   . LEU A 1 5   ? 19.902 29.478 66.405  1.00 17.72 ? 6    LEU A O   1 
ATOM   46   C CB  . LEU A 1 5   ? 18.574 28.074 64.084  1.00 17.97 ? 6    LEU A CB  1 
ATOM   47   C CG  . LEU A 1 5   ? 19.735 27.823 63.100  1.00 19.77 ? 6    LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 5   ? 19.842 26.332 62.781  1.00 16.80 ? 6    LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 5   ? 19.536 28.618 61.821  1.00 16.42 ? 6    LEU A CD2 1 
ATOM   50   N N   . PHE A 1 6   ? 21.152 27.599 66.318  1.00 15.14 ? 7    PHE A N   1 
ATOM   51   C CA  . PHE A 1 6   ? 22.355 28.261 66.802  1.00 17.65 ? 7    PHE A CA  1 
ATOM   52   C C   . PHE A 1 6   ? 23.316 28.410 65.607  1.00 17.65 ? 7    PHE A C   1 
ATOM   53   O O   . PHE A 1 6   ? 23.740 27.424 65.005  1.00 18.78 ? 7    PHE A O   1 
ATOM   54   C CB  . PHE A 1 6   ? 22.975 27.477 67.981  1.00 16.25 ? 7    PHE A CB  1 
ATOM   55   C CG  . PHE A 1 6   ? 22.193 27.643 69.257  1.00 18.40 ? 7    PHE A CG  1 
ATOM   56   C CD1 . PHE A 1 6   ? 21.099 26.812 69.530  1.00 18.40 ? 7    PHE A CD1 1 
ATOM   57   C CD2 . PHE A 1 6   ? 22.485 28.698 70.140  1.00 16.58 ? 7    PHE A CD2 1 
ATOM   58   C CE1 . PHE A 1 6   ? 20.289 27.022 70.667  1.00 19.37 ? 7    PHE A CE1 1 
ATOM   59   C CE2 . PHE A 1 6   ? 21.684 28.928 71.285  1.00 17.62 ? 7    PHE A CE2 1 
ATOM   60   C CZ  . PHE A 1 6   ? 20.577 28.084 71.548  1.00 17.35 ? 7    PHE A CZ  1 
ATOM   61   N N   . GLN A 1 7   ? 23.622 29.666 65.273  1.00 16.65 ? 8    GLN A N   1 
ATOM   62   C CA  . GLN A 1 7   ? 24.472 30.064 64.148  1.00 16.23 ? 8    GLN A CA  1 
ATOM   63   C C   . GLN A 1 7   ? 25.900 30.342 64.607  1.00 16.64 ? 8    GLN A C   1 
ATOM   64   O O   . GLN A 1 7   ? 26.131 31.270 65.377  1.00 13.35 ? 8    GLN A O   1 
ATOM   65   C CB  . GLN A 1 7   ? 23.856 31.326 63.503  1.00 18.05 ? 8    GLN A CB  1 
ATOM   66   C CG  . GLN A 1 7   ? 24.669 31.989 62.397  1.00 16.43 ? 8    GLN A CG  1 
ATOM   67   C CD  . GLN A 1 7   ? 24.058 33.323 61.971  1.00 18.44 ? 8    GLN A CD  1 
ATOM   68   O OE1 . GLN A 1 7   ? 23.243 33.888 62.692  1.00 18.03 ? 8    GLN A OE1 1 
ATOM   69   N NE2 . GLN A 1 7   ? 24.480 33.842 60.821  1.00 17.84 ? 8    GLN A NE2 1 
ATOM   70   N N   . PHE A 1 8   ? 26.845 29.512 64.153  1.00 17.21 ? 9    PHE A N   1 
ATOM   71   C CA  . PHE A 1 8   ? 28.262 29.652 64.508  1.00 16.76 ? 9    PHE A CA  1 
ATOM   72   C C   . PHE A 1 8   ? 28.976 30.162 63.248  1.00 17.45 ? 9    PHE A C   1 
ATOM   73   O O   . PHE A 1 8   ? 29.108 29.432 62.254  1.00 18.97 ? 9    PHE A O   1 
ATOM   74   C CB  . PHE A 1 8   ? 28.860 28.296 64.923  1.00 15.19 ? 9    PHE A CB  1 
ATOM   75   C CG  . PHE A 1 8   ? 28.203 27.660 66.132  1.00 17.83 ? 9    PHE A CG  1 
ATOM   76   C CD1 . PHE A 1 8   ? 28.157 26.266 66.244  1.00 15.89 ? 9    PHE A CD1 1 
ATOM   77   C CD2 . PHE A 1 8   ? 27.613 28.441 67.145  1.00 17.36 ? 9    PHE A CD2 1 
ATOM   78   C CE1 . PHE A 1 8   ? 27.519 25.650 67.352  1.00 17.78 ? 9    PHE A CE1 1 
ATOM   79   C CE2 . PHE A 1 8   ? 26.967 27.851 68.262  1.00 17.60 ? 9    PHE A CE2 1 
ATOM   80   C CZ  . PHE A 1 8   ? 26.916 26.454 68.371  1.00 19.18 ? 9    PHE A CZ  1 
ATOM   81   N N   . ASP A 1 9   ? 29.429 31.413 63.283  1.00 16.23 ? 10   ASP A N   1 
ATOM   82   C CA  . ASP A 1 9   ? 30.077 32.049 62.130  1.00 17.49 ? 10   ASP A CA  1 
ATOM   83   C C   . ASP A 1 9   ? 31.567 32.265 62.479  1.00 15.81 ? 10   ASP A C   1 
ATOM   84   O O   . ASP A 1 9   ? 31.902 32.707 63.575  1.00 14.80 ? 10   ASP A O   1 
ATOM   85   C CB  . ASP A 1 9   ? 29.380 33.402 61.831  1.00 17.31 ? 10   ASP A CB  1 
ATOM   86   C CG  . ASP A 1 9   ? 29.737 33.980 60.458  1.00 15.36 ? 10   ASP A CG  1 
ATOM   87   O OD1 . ASP A 1 9   ? 30.942 34.092 60.137  1.00 17.49 ? 10   ASP A OD1 1 
ATOM   88   O OD2 . ASP A 1 9   ? 28.792 34.339 59.696  1.00 18.94 ? 10   ASP A OD2 1 
ATOM   89   N N   . THR A 1 10  ? 32.447 31.949 61.542  1.00 16.62 ? 11   THR A N   1 
ATOM   90   C CA  . THR A 1 10  ? 33.871 32.096 61.758  1.00 15.91 ? 11   THR A CA  1 
ATOM   91   C C   . THR A 1 10  ? 34.359 33.518 61.599  1.00 19.05 ? 11   THR A C   1 
ATOM   92   O O   . THR A 1 10  ? 35.506 33.820 61.954  1.00 18.79 ? 11   THR A O   1 
ATOM   93   C CB  . THR A 1 10  ? 34.675 31.196 60.804  1.00 17.86 ? 11   THR A CB  1 
ATOM   94   O OG1 . THR A 1 10  ? 34.241 31.420 59.446  1.00 17.64 ? 11   THR A OG1 1 
ATOM   95   C CG2 . THR A 1 10  ? 34.454 29.736 61.173  1.00 17.85 ? 11   THR A CG2 1 
ATOM   96   N N   . ASP A 1 11  ? 33.519 34.387 61.050  1.00 17.21 ? 12   ASP A N   1 
ATOM   97   C CA  . ASP A 1 11  ? 33.926 35.790 60.898  1.00 20.32 ? 12   ASP A CA  1 
ATOM   98   C C   . ASP A 1 11  ? 33.660 36.523 62.213  1.00 18.38 ? 12   ASP A C   1 
ATOM   99   O O   . ASP A 1 11  ? 33.092 35.967 63.141  1.00 21.52 ? 12   ASP A O   1 
ATOM   100  C CB  . ASP A 1 11  ? 33.160 36.481 59.748  1.00 17.13 ? 12   ASP A CB  1 
ATOM   101  C CG  . ASP A 1 11  ? 33.544 35.933 58.358  1.00 20.12 ? 12   ASP A CG  1 
ATOM   102  O OD1 . ASP A 1 11  ? 34.726 35.588 58.148  1.00 18.52 ? 12   ASP A OD1 1 
ATOM   103  O OD2 . ASP A 1 11  ? 32.662 35.861 57.479  1.00 18.28 ? 12   ASP A OD2 1 
ATOM   104  N N   . ALA A 1 12  ? 34.043 37.790 62.283  1.00 22.32 ? 13   ALA A N   1 
ATOM   105  C CA  . ALA A 1 12  ? 33.859 38.561 63.519  1.00 20.94 ? 13   ALA A CA  1 
ATOM   106  C C   . ALA A 1 12  ? 32.414 38.677 64.016  1.00 21.29 ? 13   ALA A C   1 
ATOM   107  O O   . ALA A 1 12  ? 32.186 38.730 65.236  1.00 21.00 ? 13   ALA A O   1 
ATOM   108  C CB  . ALA A 1 12  ? 34.467 39.961 63.341  1.00 23.44 ? 13   ALA A CB  1 
ATOM   109  N N   . THR A 1 13  ? 31.450 38.745 63.092  1.00 18.63 ? 14   THR A N   1 
ATOM   110  C CA  . THR A 1 13  ? 30.030 38.854 63.444  1.00 17.67 ? 14   THR A CA  1 
ATOM   111  C C   . THR A 1 13  ? 29.240 37.950 62.488  1.00 17.34 ? 14   THR A C   1 
ATOM   112  O O   . THR A 1 13  ? 29.671 37.726 61.369  1.00 16.89 ? 14   THR A O   1 
ATOM   113  C CB  . THR A 1 13  ? 29.514 40.306 63.304  1.00 19.43 ? 14   THR A CB  1 
ATOM   114  O OG1 . THR A 1 13  ? 29.663 40.717 61.950  1.00 17.43 ? 14   THR A OG1 1 
ATOM   115  C CG2 . THR A 1 13  ? 30.295 41.279 64.258  1.00 18.38 ? 14   THR A CG2 1 
ATOM   116  N N   . PRO A 1 14  ? 28.062 37.434 62.911  1.00 16.87 ? 15   PRO A N   1 
ATOM   117  C CA  . PRO A 1 14  ? 27.268 36.545 62.051  1.00 17.01 ? 15   PRO A CA  1 
ATOM   118  C C   . PRO A 1 14  ? 26.670 37.174 60.802  1.00 18.69 ? 15   PRO A C   1 
ATOM   119  O O   . PRO A 1 14  ? 26.143 38.287 60.854  1.00 18.91 ? 15   PRO A O   1 
ATOM   120  C CB  . PRO A 1 14  ? 26.141 36.049 62.979  1.00 17.36 ? 15   PRO A CB  1 
ATOM   121  C CG  . PRO A 1 14  ? 26.621 36.321 64.366  1.00 15.37 ? 15   PRO A CG  1 
ATOM   122  C CD  . PRO A 1 14  ? 27.374 37.646 64.195  1.00 16.12 ? 15   PRO A CD  1 
ATOM   123  N N   . SER A 1 15  ? 26.686 36.417 59.707  1.00 18.79 ? 16   SER A N   1 
ATOM   124  C CA  . SER A 1 15  ? 26.139 36.864 58.428  1.00 20.10 ? 16   SER A CA  1 
ATOM   125  C C   . SER A 1 15  ? 24.652 37.215 58.485  1.00 21.26 ? 16   SER A C   1 
ATOM   126  O O   . SER A 1 15  ? 23.849 36.384 58.897  1.00 19.93 ? 16   SER A O   1 
ATOM   127  C CB  . SER A 1 15  ? 26.306 35.768 57.369  1.00 20.87 ? 16   SER A CB  1 
ATOM   128  O OG  . SER A 1 15  ? 25.366 35.947 56.294  1.00 17.45 ? 16   SER A OG  1 
ATOM   129  N N   . VAL A 1 16  ? 24.296 38.432 58.052  1.00 19.09 ? 17   VAL A N   1 
ATOM   130  C CA  . VAL A 1 16  ? 22.895 38.865 57.996  1.00 18.38 ? 17   VAL A CA  1 
ATOM   131  C C   . VAL A 1 16  ? 22.084 38.002 57.020  1.00 17.62 ? 17   VAL A C   1 
ATOM   132  O O   . VAL A 1 16  ? 20.943 37.638 57.299  1.00 17.85 ? 17   VAL A O   1 
ATOM   133  C CB  . VAL A 1 16  ? 22.779 40.328 57.527  1.00 17.11 ? 17   VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 16  ? 21.316 40.666 57.167  1.00 19.34 ? 17   VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 16  ? 23.264 41.259 58.635  1.00 19.58 ? 17   VAL A CG2 1 
ATOM   136  N N   . PHE A 1 17  ? 22.691 37.677 55.878  1.00 19.20 ? 18   PHE A N   1 
ATOM   137  C CA  . PHE A 1 17  ? 22.051 36.856 54.848  1.00 18.56 ? 18   PHE A CA  1 
ATOM   138  C C   . PHE A 1 17  ? 21.606 35.516 55.470  1.00 18.54 ? 18   PHE A C   1 
ATOM   139  O O   . PHE A 1 17  ? 20.482 35.079 55.271  1.00 16.60 ? 18   PHE A O   1 
ATOM   140  C CB  . PHE A 1 17  ? 23.056 36.623 53.689  1.00 19.93 ? 18   PHE A CB  1 
ATOM   141  C CG  . PHE A 1 17  ? 22.486 35.902 52.493  1.00 25.15 ? 18   PHE A CG  1 
ATOM   142  C CD1 . PHE A 1 17  ? 22.263 36.580 51.295  1.00 24.59 ? 18   PHE A CD1 1 
ATOM   143  C CD2 . PHE A 1 17  ? 22.173 34.538 52.556  1.00 25.23 ? 18   PHE A CD2 1 
ATOM   144  C CE1 . PHE A 1 17  ? 21.729 35.913 50.175  1.00 26.81 ? 18   PHE A CE1 1 
ATOM   145  C CE2 . PHE A 1 17  ? 21.643 33.868 51.445  1.00 24.56 ? 18   PHE A CE2 1 
ATOM   146  C CZ  . PHE A 1 17  ? 21.421 34.562 50.253  1.00 25.36 ? 18   PHE A CZ  1 
ATOM   147  N N   . ASP A 1 18  ? 22.478 34.875 56.248  1.00 17.17 ? 19   ASP A N   1 
ATOM   148  C CA  . ASP A 1 18  ? 22.117 33.587 56.836  1.00 16.03 ? 19   ASP A CA  1 
ATOM   149  C C   . ASP A 1 18  ? 20.990 33.675 57.867  1.00 17.40 ? 19   ASP A C   1 
ATOM   150  O O   . ASP A 1 18  ? 20.241 32.716 58.064  1.00 18.37 ? 19   ASP A O   1 
ATOM   151  C CB  . ASP A 1 18  ? 23.373 32.910 57.434  1.00 16.86 ? 19   ASP A CB  1 
ATOM   152  C CG  . ASP A 1 18  ? 24.404 32.525 56.339  1.00 20.39 ? 19   ASP A CG  1 
ATOM   153  O OD1 . ASP A 1 18  ? 23.982 32.321 55.175  1.00 21.30 ? 19   ASP A OD1 1 
ATOM   154  O OD2 . ASP A 1 18  ? 25.617 32.415 56.626  1.00 18.28 ? 19   ASP A OD2 1 
ATOM   155  N N   . VAL A 1 19  ? 20.864 34.818 58.530  1.00 17.62 ? 20   VAL A N   1 
ATOM   156  C CA  . VAL A 1 19  ? 19.799 35.015 59.511  1.00 17.75 ? 20   VAL A CA  1 
ATOM   157  C C   . VAL A 1 19  ? 18.429 35.069 58.824  1.00 18.36 ? 20   VAL A C   1 
ATOM   158  O O   . VAL A 1 19  ? 17.500 34.374 59.237  1.00 18.64 ? 20   VAL A O   1 
ATOM   159  C CB  . VAL A 1 19  ? 20.020 36.314 60.291  1.00 20.30 ? 20   VAL A CB  1 
ATOM   160  C CG1 . VAL A 1 19  ? 18.754 36.668 61.127  1.00 18.66 ? 20   VAL A CG1 1 
ATOM   161  C CG2 . VAL A 1 19  ? 21.245 36.132 61.218  1.00 19.72 ? 20   VAL A CG2 1 
ATOM   162  N N   . VAL A 1 20  ? 18.302 35.883 57.782  1.00 18.02 ? 21   VAL A N   1 
ATOM   163  C CA  . VAL A 1 20  ? 17.016 35.987 57.082  1.00 19.88 ? 21   VAL A CA  1 
ATOM   164  C C   . VAL A 1 20  ? 16.573 34.624 56.529  1.00 19.46 ? 21   VAL A C   1 
ATOM   165  O O   . VAL A 1 20  ? 15.450 34.181 56.782  1.00 20.61 ? 21   VAL A O   1 
ATOM   166  C CB  . VAL A 1 20  ? 17.074 37.009 55.934  1.00 19.42 ? 21   VAL A CB  1 
ATOM   167  C CG1 . VAL A 1 20  ? 15.754 37.008 55.154  1.00 16.86 ? 21   VAL A CG1 1 
ATOM   168  C CG2 . VAL A 1 20  ? 17.327 38.424 56.505  1.00 20.20 ? 21   VAL A CG2 1 
ATOM   169  N N   . VAL A 1 21  ? 17.461 33.952 55.800  1.00 20.33 ? 22   VAL A N   1 
ATOM   170  C CA  . VAL A 1 21  ? 17.109 32.663 55.221  1.00 21.06 ? 22   VAL A CA  1 
ATOM   171  C C   . VAL A 1 21  ? 16.782 31.630 56.275  1.00 19.59 ? 22   VAL A C   1 
ATOM   172  O O   . VAL A 1 21  ? 15.914 30.791 56.064  1.00 21.28 ? 22   VAL A O   1 
ATOM   173  C CB  . VAL A 1 21  ? 18.214 32.132 54.298  1.00 24.32 ? 22   VAL A CB  1 
ATOM   174  C CG1 . VAL A 1 21  ? 17.763 30.800 53.687  1.00 25.29 ? 22   VAL A CG1 1 
ATOM   175  C CG2 . VAL A 1 21  ? 18.474 33.160 53.187  1.00 23.13 ? 22   VAL A CG2 1 
ATOM   176  N N   . GLY A 1 22  ? 17.478 31.681 57.406  1.00 18.14 ? 23   GLY A N   1 
ATOM   177  C CA  . GLY A 1 22  ? 17.196 30.764 58.495  1.00 17.47 ? 23   GLY A CA  1 
ATOM   178  C C   . GLY A 1 22  ? 15.770 30.929 59.007  1.00 21.60 ? 23   GLY A C   1 
ATOM   179  O O   . GLY A 1 22  ? 15.064 29.941 59.236  1.00 21.31 ? 23   GLY A O   1 
ATOM   180  N N   . TYR A 1 23  ? 15.342 32.173 59.216  1.00 17.86 ? 24   TYR A N   1 
ATOM   181  C CA  . TYR A 1 23  ? 13.985 32.410 59.681  1.00 19.75 ? 24   TYR A CA  1 
ATOM   182  C C   . TYR A 1 23  ? 12.948 32.009 58.622  1.00 20.96 ? 24   TYR A C   1 
ATOM   183  O O   . TYR A 1 23  ? 11.909 31.451 58.962  1.00 19.89 ? 24   TYR A O   1 
ATOM   184  C CB  . TYR A 1 23  ? 13.778 33.892 60.028  1.00 21.42 ? 24   TYR A CB  1 
ATOM   185  C CG  . TYR A 1 23  ? 14.259 34.238 61.421  1.00 22.62 ? 24   TYR A CG  1 
ATOM   186  C CD1 . TYR A 1 23  ? 15.297 35.145 61.613  1.00 21.92 ? 24   TYR A CD1 1 
ATOM   187  C CD2 . TYR A 1 23  ? 13.691 33.629 62.545  1.00 21.65 ? 24   TYR A CD2 1 
ATOM   188  C CE1 . TYR A 1 23  ? 15.770 35.449 62.911  1.00 21.60 ? 24   TYR A CE1 1 
ATOM   189  C CE2 . TYR A 1 23  ? 14.162 33.917 63.845  1.00 22.78 ? 24   TYR A CE2 1 
ATOM   190  C CZ  . TYR A 1 23  ? 15.201 34.828 64.008  1.00 20.85 ? 24   TYR A CZ  1 
ATOM   191  O OH  . TYR A 1 23  ? 15.690 35.084 65.266  1.00 21.21 ? 24   TYR A OH  1 
ATOM   192  N N   . ASP A 1 24  ? 13.224 32.300 57.353  1.00 21.28 ? 25   ASP A N   1 
ATOM   193  C CA  . ASP A 1 24  ? 12.259 31.958 56.300  1.00 24.89 ? 25   ASP A CA  1 
ATOM   194  C C   . ASP A 1 24  ? 12.179 30.446 56.105  1.00 26.69 ? 25   ASP A C   1 
ATOM   195  O O   . ASP A 1 24  ? 11.206 29.940 55.544  1.00 24.52 ? 25   ASP A O   1 
ATOM   196  C CB  . ASP A 1 24  ? 12.588 32.678 54.981  1.00 23.37 ? 25   ASP A CB  1 
ATOM   197  C CG  . ASP A 1 24  ? 12.111 34.133 54.987  1.00 26.12 ? 25   ASP A CG  1 
ATOM   198  O OD1 . ASP A 1 24  ? 11.207 34.444 55.797  1.00 24.47 ? 25   ASP A OD1 1 
ATOM   199  O OD2 . ASP A 1 24  ? 12.611 34.964 54.196  1.00 23.74 ? 25   ASP A OD2 1 
ATOM   200  N N   . GLY A 1 25  ? 13.203 29.742 56.596  1.00 25.86 ? 26   GLY A N   1 
ATOM   201  C CA  . GLY A 1 25  ? 13.242 28.294 56.532  1.00 25.42 ? 26   GLY A CA  1 
ATOM   202  C C   . GLY A 1 25  ? 12.506 27.651 57.707  1.00 28.00 ? 26   GLY A C   1 
ATOM   203  O O   . GLY A 1 25  ? 12.370 26.426 57.775  1.00 28.74 ? 26   GLY A O   1 
ATOM   204  N N   . GLY A 1 26  ? 12.041 28.447 58.665  1.00 26.03 ? 27   GLY A N   1 
ATOM   205  C CA  . GLY A 1 26  ? 11.296 27.837 59.749  1.00 27.25 ? 27   GLY A CA  1 
ATOM   206  C C   . GLY A 1 26  ? 11.823 27.925 61.165  1.00 25.60 ? 27   GLY A C   1 
ATOM   207  O O   . GLY A 1 26  ? 11.158 27.432 62.090  1.00 26.75 ? 27   GLY A O   1 
ATOM   208  N N   . ALA A 1 27  ? 12.989 28.536 61.363  1.00 24.55 ? 28   ALA A N   1 
ATOM   209  C CA  . ALA A 1 27  ? 13.519 28.674 62.725  1.00 23.49 ? 28   ALA A CA  1 
ATOM   210  C C   . ALA A 1 27  ? 12.585 29.600 63.504  1.00 23.16 ? 28   ALA A C   1 
ATOM   211  O O   . ALA A 1 27  ? 12.111 30.579 62.955  1.00 24.38 ? 28   ALA A O   1 
ATOM   212  C CB  . ALA A 1 27  ? 14.934 29.279 62.696  1.00 22.34 ? 28   ALA A CB  1 
ATOM   213  N N   . ASP A 1 28  ? 12.308 29.292 64.766  1.00 23.81 ? 29   ASP A N   1 
ATOM   214  C CA  . ASP A 1 28  ? 11.468 30.171 65.583  1.00 23.15 ? 29   ASP A CA  1 
ATOM   215  C C   . ASP A 1 28  ? 12.387 31.241 66.190  1.00 23.45 ? 29   ASP A C   1 
ATOM   216  O O   . ASP A 1 28  ? 11.984 32.385 66.401  1.00 22.49 ? 29   ASP A O   1 
ATOM   217  C CB  . ASP A 1 28  ? 10.771 29.386 66.708  1.00 21.96 ? 29   ASP A CB  1 
ATOM   218  C CG  . ASP A 1 28  ? 9.623  28.512 66.201  1.00 25.92 ? 29   ASP A CG  1 
ATOM   219  O OD1 . ASP A 1 28  ? 8.838  28.991 65.350  1.00 26.04 ? 29   ASP A OD1 1 
ATOM   220  O OD2 . ASP A 1 28  ? 9.489  27.353 66.674  1.00 22.38 ? 29   ASP A OD2 1 
ATOM   221  N N   . HIS A 1 29  ? 13.622 30.853 66.492  1.00 19.51 ? 30   HIS A N   1 
ATOM   222  C CA  . HIS A 1 29  ? 14.592 31.787 67.046  1.00 19.19 ? 30   HIS A CA  1 
ATOM   223  C C   . HIS A 1 29  ? 15.988 31.445 66.537  1.00 20.22 ? 30   HIS A C   1 
ATOM   224  O O   . HIS A 1 29  ? 16.341 30.268 66.419  1.00 19.58 ? 30   HIS A O   1 
ATOM   225  C CB  . HIS A 1 29  ? 14.616 31.729 68.583  1.00 21.98 ? 30   HIS A CB  1 
ATOM   226  C CG  . HIS A 1 29  ? 13.419 32.353 69.226  1.00 26.32 ? 30   HIS A CG  1 
ATOM   227  N ND1 . HIS A 1 29  ? 12.455 31.616 69.883  1.00 30.80 ? 30   HIS A ND1 1 
ATOM   228  C CD2 . HIS A 1 29  ? 12.999 33.641 69.264  1.00 27.36 ? 30   HIS A CD2 1 
ATOM   229  C CE1 . HIS A 1 29  ? 11.490 32.421 70.292  1.00 27.18 ? 30   HIS A CE1 1 
ATOM   230  N NE2 . HIS A 1 29  ? 11.795 33.655 69.928  1.00 31.57 ? 30   HIS A NE2 1 
ATOM   231  N N   . ILE A 1 30  ? 16.785 32.468 66.243  1.00 17.11 ? 31   ILE A N   1 
ATOM   232  C CA  . ILE A 1 30  ? 18.172 32.219 65.811  1.00 18.71 ? 31   ILE A CA  1 
ATOM   233  C C   . ILE A 1 30  ? 19.114 32.966 66.753  1.00 18.21 ? 31   ILE A C   1 
ATOM   234  O O   . ILE A 1 30  ? 18.977 34.170 66.942  1.00 19.08 ? 31   ILE A O   1 
ATOM   235  C CB  . ILE A 1 30  ? 18.414 32.702 64.377  1.00 18.13 ? 31   ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 30  ? 17.573 31.870 63.407  1.00 20.59 ? 31   ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 30  ? 19.916 32.608 64.024  1.00 21.49 ? 31   ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 30  ? 17.716 32.317 61.958  1.00 22.88 ? 31   ILE A CD1 1 
ATOM   239  N N   . THR A 1 31  ? 20.056 32.254 67.364  1.00 18.35 ? 32   THR A N   1 
ATOM   240  C CA  . THR A 1 31  ? 21.017 32.897 68.259  1.00 18.01 ? 32   THR A CA  1 
ATOM   241  C C   . THR A 1 31  ? 22.388 32.753 67.579  1.00 18.92 ? 32   THR A C   1 
ATOM   242  O O   . THR A 1 31  ? 22.863 31.628 67.389  1.00 16.64 ? 32   THR A O   1 
ATOM   243  C CB  . THR A 1 31  ? 21.028 32.208 69.617  1.00 18.92 ? 32   THR A CB  1 
ATOM   244  O OG1 . THR A 1 31  ? 19.692 32.206 70.142  1.00 18.61 ? 32   THR A OG1 1 
ATOM   245  C CG2 . THR A 1 31  ? 21.946 32.955 70.592  1.00 18.77 ? 32   THR A CG2 1 
ATOM   246  N N   . GLY A 1 32  ? 23.022 33.882 67.254  1.00 14.97 ? 33   GLY A N   1 
ATOM   247  C CA  . GLY A 1 32  ? 24.293 33.836 66.537  1.00 16.10 ? 33   GLY A CA  1 
ATOM   248  C C   . GLY A 1 32  ? 25.556 34.232 67.280  1.00 17.57 ? 33   GLY A C   1 
ATOM   249  O O   . GLY A 1 32  ? 25.551 35.128 68.153  1.00 15.95 ? 33   GLY A O   1 
ATOM   250  N N   . TYR A 1 33  ? 26.649 33.568 66.921  1.00 14.48 ? 34   TYR A N   1 
ATOM   251  C CA  . TYR A 1 33  ? 27.949 33.807 67.544  1.00 15.29 ? 34   TYR A CA  1 
ATOM   252  C C   . TYR A 1 33  ? 29.001 34.071 66.451  1.00 17.22 ? 34   TYR A C   1 
ATOM   253  O O   . TYR A 1 33  ? 29.002 33.382 65.426  1.00 16.13 ? 34   TYR A O   1 
ATOM   254  C CB  . TYR A 1 33  ? 28.385 32.540 68.341  1.00 13.60 ? 34   TYR A CB  1 
ATOM   255  C CG  . TYR A 1 33  ? 27.541 32.219 69.580  1.00 13.79 ? 34   TYR A CG  1 
ATOM   256  C CD1 . TYR A 1 33  ? 26.279 31.639 69.470  1.00 12.87 ? 34   TYR A CD1 1 
ATOM   257  C CD2 . TYR A 1 33  ? 27.978 32.590 70.857  1.00 16.01 ? 34   TYR A CD2 1 
ATOM   258  C CE1 . TYR A 1 33  ? 25.463 31.443 70.613  1.00 15.76 ? 34   TYR A CE1 1 
ATOM   259  C CE2 . TYR A 1 33  ? 27.172 32.410 71.997  1.00 15.30 ? 34   TYR A CE2 1 
ATOM   260  C CZ  . TYR A 1 33  ? 25.916 31.832 71.859  1.00 16.98 ? 34   TYR A CZ  1 
ATOM   261  O OH  . TYR A 1 33  ? 25.134 31.629 72.982  1.00 15.97 ? 34   TYR A OH  1 
ATOM   262  N N   . GLY A 1 34  ? 29.892 35.048 66.672  1.00 16.94 ? 35   GLY A N   1 
ATOM   263  C CA  . GLY A 1 34  ? 30.976 35.290 65.730  1.00 17.01 ? 35   GLY A CA  1 
ATOM   264  C C   . GLY A 1 34  ? 32.270 34.737 66.338  1.00 18.40 ? 35   GLY A C   1 
ATOM   265  O O   . GLY A 1 34  ? 32.228 34.208 67.454  1.00 20.64 ? 35   GLY A O   1 
ATOM   266  N N   . ASN A 1 35  ? 33.405 34.862 65.635  1.00 17.08 ? 36   ASN A N   1 
ATOM   267  C CA  . ASN A 1 35  ? 34.712 34.378 66.116  1.00 19.13 ? 36   ASN A CA  1 
ATOM   268  C C   . ASN A 1 35  ? 34.745 32.926 66.600  1.00 18.53 ? 36   ASN A C   1 
ATOM   269  O O   . ASN A 1 35  ? 35.563 32.553 67.468  1.00 16.67 ? 36   ASN A O   1 
ATOM   270  C CB  . ASN A 1 35  ? 35.272 35.274 67.238  1.00 21.32 ? 36   ASN A CB  1 
ATOM   271  C CG  . ASN A 1 35  ? 35.294 36.744 66.862  1.00 22.87 ? 36   ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 35  ? 35.940 37.154 65.894  1.00 20.79 ? 36   ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 35  ? 34.593 37.553 67.648  1.00 26.44 ? 36   ASN A ND2 1 
ATOM   274  N N   . VAL A 1 36  ? 33.888 32.093 66.024  1.00 17.83 ? 37   VAL A N   1 
ATOM   275  C CA  . VAL A 1 36  ? 33.859 30.689 66.434  1.00 16.85 ? 37   VAL A CA  1 
ATOM   276  C C   . VAL A 1 36  ? 35.064 29.917 65.875  1.00 17.54 ? 37   VAL A C   1 
ATOM   277  O O   . VAL A 1 36  ? 35.415 30.024 64.680  1.00 18.33 ? 37   VAL A O   1 
ATOM   278  C CB  . VAL A 1 36  ? 32.565 30.005 65.980  1.00 14.34 ? 37   VAL A CB  1 
ATOM   279  C CG1 . VAL A 1 36  ? 32.549 28.562 66.483  1.00 17.57 ? 37   VAL A CG1 1 
ATOM   280  C CG2 . VAL A 1 36  ? 31.333 30.767 66.506  1.00 14.75 ? 37   VAL A CG2 1 
ATOM   281  N N   . THR A 1 37  ? 35.708 29.156 66.751  1.00 18.10 ? 38   THR A N   1 
ATOM   282  C CA  . THR A 1 37  ? 36.880 28.359 66.387  1.00 21.40 ? 38   THR A CA  1 
ATOM   283  C C   . THR A 1 37  ? 36.733 26.917 66.844  1.00 19.95 ? 38   THR A C   1 
ATOM   284  O O   . THR A 1 37  ? 35.829 26.579 67.618  1.00 17.14 ? 38   THR A O   1 
ATOM   285  C CB  . THR A 1 37  ? 38.188 28.887 67.048  1.00 19.82 ? 38   THR A CB  1 
ATOM   286  O OG1 . THR A 1 37  ? 38.160 28.616 68.451  1.00 21.69 ? 38   THR A OG1 1 
ATOM   287  C CG2 . THR A 1 37  ? 38.357 30.374 66.800  1.00 22.97 ? 38   THR A CG2 1 
ATOM   288  N N   . PRO A 1 38  ? 37.611 26.031 66.340  1.00 19.51 ? 39   PRO A N   1 
ATOM   289  C CA  . PRO A 1 38  ? 37.534 24.632 66.753  1.00 21.31 ? 39   PRO A CA  1 
ATOM   290  C C   . PRO A 1 38  ? 37.729 24.512 68.274  1.00 22.24 ? 39   PRO A C   1 
ATOM   291  O O   . PRO A 1 38  ? 37.198 23.596 68.896  1.00 23.76 ? 39   PRO A O   1 
ATOM   292  C CB  . PRO A 1 38  ? 38.682 23.966 65.965  1.00 21.42 ? 39   PRO A CB  1 
ATOM   293  C CG  . PRO A 1 38  ? 38.710 24.742 64.715  1.00 21.64 ? 39   PRO A CG  1 
ATOM   294  C CD  . PRO A 1 38  ? 38.532 26.196 65.199  1.00 18.76 ? 39   PRO A CD  1 
ATOM   295  N N   . ASP A 1 39  ? 38.474 25.435 68.884  1.00 23.16 ? 40   ASP A N   1 
ATOM   296  C CA  . ASP A 1 39  ? 38.687 25.340 70.333  1.00 26.11 ? 40   ASP A CA  1 
ATOM   297  C C   . ASP A 1 39  ? 37.527 25.845 71.190  1.00 26.72 ? 40   ASP A C   1 
ATOM   298  O O   . ASP A 1 39  ? 37.290 25.290 72.271  1.00 27.23 ? 40   ASP A O   1 
ATOM   299  C CB  . ASP A 1 39  ? 39.979 26.058 70.765  1.00 28.85 ? 40   ASP A CB  1 
ATOM   300  C CG  . ASP A 1 39  ? 41.257 25.348 70.263  1.00 33.45 ? 40   ASP A CG  1 
ATOM   301  O OD1 . ASP A 1 39  ? 42.116 26.015 69.645  1.00 37.53 ? 40   ASP A OD1 1 
ATOM   302  O OD2 . ASP A 1 39  ? 41.416 24.130 70.489  1.00 34.14 ? 40   ASP A OD2 1 
ATOM   303  N N   . ASN A 1 40  ? 36.791 26.866 70.739  1.00 22.91 ? 41   ASN A N   1 
ATOM   304  C CA  . ASN A 1 40  ? 35.691 27.358 71.564  1.00 20.61 ? 41   ASN A CA  1 
ATOM   305  C C   . ASN A 1 40  ? 34.303 26.830 71.229  1.00 20.47 ? 41   ASN A C   1 
ATOM   306  O O   . ASN A 1 40  ? 33.367 27.073 71.984  1.00 21.54 ? 41   ASN A O   1 
ATOM   307  C CB  . ASN A 1 40  ? 35.666 28.903 71.613  1.00 20.49 ? 41   ASN A CB  1 
ATOM   308  C CG  . ASN A 1 40  ? 35.332 29.548 70.262  1.00 24.99 ? 41   ASN A CG  1 
ATOM   309  O OD1 . ASN A 1 40  ? 34.711 28.933 69.381  1.00 19.62 ? 41   ASN A OD1 1 
ATOM   310  N ND2 . ASN A 1 40  ? 35.739 30.808 70.107  1.00 21.89 ? 41   ASN A ND2 1 
ATOM   311  N N   . VAL A 1 41  ? 34.150 26.080 70.136  1.00 18.51 ? 42   VAL A N   1 
ATOM   312  C CA  . VAL A 1 41  ? 32.820 25.593 69.781  1.00 18.48 ? 42   VAL A CA  1 
ATOM   313  C C   . VAL A 1 41  ? 32.308 24.436 70.647  1.00 19.63 ? 42   VAL A C   1 
ATOM   314  O O   . VAL A 1 41  ? 31.110 24.259 70.798  1.00 18.98 ? 42   VAL A O   1 
ATOM   315  C CB  . VAL A 1 41  ? 32.727 25.234 68.244  1.00 18.16 ? 42   VAL A CB  1 
ATOM   316  C CG1 . VAL A 1 41  ? 33.421 23.908 67.935  1.00 15.71 ? 42   VAL A CG1 1 
ATOM   317  C CG2 . VAL A 1 41  ? 31.271 25.199 67.805  1.00 16.90 ? 42   VAL A CG2 1 
ATOM   318  N N   . GLY A 1 42  ? 33.204 23.670 71.263  1.00 18.83 ? 43   GLY A N   1 
ATOM   319  C CA  . GLY A 1 42  ? 32.717 22.571 72.088  1.00 20.38 ? 43   GLY A CA  1 
ATOM   320  C C   . GLY A 1 42  ? 31.765 22.965 73.213  1.00 19.88 ? 43   GLY A C   1 
ATOM   321  O O   . GLY A 1 42  ? 30.744 22.311 73.456  1.00 21.39 ? 43   GLY A O   1 
ATOM   322  N N   . ALA A 1 43  ? 32.086 24.039 73.917  1.00 20.60 ? 44   ALA A N   1 
ATOM   323  C CA  . ALA A 1 43  ? 31.235 24.491 75.013  1.00 21.26 ? 44   ALA A CA  1 
ATOM   324  C C   . ALA A 1 43  ? 29.861 24.912 74.480  1.00 20.27 ? 44   ALA A C   1 
ATOM   325  O O   . ALA A 1 43  ? 28.826 24.690 75.130  1.00 17.27 ? 44   ALA A O   1 
ATOM   326  C CB  . ALA A 1 43  ? 31.917 25.667 75.755  1.00 21.20 ? 44   ALA A CB  1 
ATOM   327  N N   . TYR A 1 44  ? 29.844 25.500 73.284  1.00 20.32 ? 45   TYR A N   1 
ATOM   328  C CA  . TYR A 1 44  ? 28.561 25.922 72.705  1.00 19.61 ? 45   TYR A CA  1 
ATOM   329  C C   . TYR A 1 44  ? 27.737 24.686 72.360  1.00 19.50 ? 45   TYR A C   1 
ATOM   330  O O   . TYR A 1 44  ? 26.534 24.661 72.569  1.00 16.63 ? 45   TYR A O   1 
ATOM   331  C CB  . TYR A 1 44  ? 28.768 26.730 71.431  1.00 17.18 ? 45   TYR A CB  1 
ATOM   332  C CG  . TYR A 1 44  ? 29.535 28.038 71.567  1.00 16.53 ? 45   TYR A CG  1 
ATOM   333  C CD1 . TYR A 1 44  ? 30.284 28.529 70.487  1.00 19.44 ? 45   TYR A CD1 1 
ATOM   334  C CD2 . TYR A 1 44  ? 29.446 28.820 72.708  1.00 18.43 ? 45   TYR A CD2 1 
ATOM   335  C CE1 . TYR A 1 44  ? 30.923 29.774 70.546  1.00 16.20 ? 45   TYR A CE1 1 
ATOM   336  C CE2 . TYR A 1 44  ? 30.076 30.083 72.778  1.00 15.73 ? 45   TYR A CE2 1 
ATOM   337  C CZ  . TYR A 1 44  ? 30.808 30.539 71.697  1.00 17.24 ? 45   TYR A CZ  1 
ATOM   338  O OH  . TYR A 1 44  ? 31.464 31.747 71.770  1.00 18.56 ? 45   TYR A OH  1 
ATOM   339  N N   . VAL A 1 45  ? 28.387 23.663 71.801  1.00 18.09 ? 46   VAL A N   1 
ATOM   340  C CA  . VAL A 1 45  ? 27.670 22.441 71.453  1.00 18.81 ? 46   VAL A CA  1 
ATOM   341  C C   . VAL A 1 45  ? 27.097 21.767 72.688  1.00 17.94 ? 46   VAL A C   1 
ATOM   342  O O   . VAL A 1 45  ? 25.982 21.241 72.645  1.00 17.86 ? 46   VAL A O   1 
ATOM   343  C CB  . VAL A 1 45  ? 28.586 21.426 70.711  1.00 17.76 ? 46   VAL A CB  1 
ATOM   344  C CG1 . VAL A 1 45  ? 27.878 20.067 70.581  1.00 20.17 ? 46   VAL A CG1 1 
ATOM   345  C CG2 . VAL A 1 45  ? 28.916 21.958 69.348  1.00 18.66 ? 46   VAL A CG2 1 
ATOM   346  N N   . ASP A 1 46  ? 27.848 21.759 73.789  1.00 20.23 ? 47   ASP A N   1 
ATOM   347  C CA  . ASP A 1 46  ? 27.339 21.135 75.023  1.00 19.61 ? 47   ASP A CA  1 
ATOM   348  C C   . ASP A 1 46  ? 25.982 21.743 75.398  1.00 19.39 ? 47   ASP A C   1 
ATOM   349  O O   . ASP A 1 46  ? 25.078 21.039 75.886  1.00 19.29 ? 47   ASP A O   1 
ATOM   350  C CB  . ASP A 1 46  ? 28.292 21.364 76.211  1.00 20.20 ? 47   ASP A CB  1 
ATOM   351  C CG  . ASP A 1 46  ? 29.600 20.593 76.105  1.00 22.14 ? 47   ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 46  ? 29.742 19.720 75.233  1.00 21.64 ? 47   ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 46  ? 30.497 20.868 76.937  1.00 22.95 ? 47   ASP A OD2 1 
ATOM   354  N N   . GLY A 1 47  ? 25.840 23.051 75.183  1.00 17.87 ? 48   GLY A N   1 
ATOM   355  C CA  . GLY A 1 47  ? 24.593 23.726 75.519  1.00 17.95 ? 48   GLY A CA  1 
ATOM   356  C C   . GLY A 1 47  ? 23.410 23.265 74.674  1.00 19.59 ? 48   GLY A C   1 
ATOM   357  O O   . GLY A 1 47  ? 22.251 23.464 75.071  1.00 18.91 ? 48   GLY A O   1 
ATOM   358  N N   . THR A 1 48  ? 23.686 22.659 73.515  1.00 19.40 ? 49   THR A N   1 
ATOM   359  C CA  . THR A 1 48  ? 22.609 22.173 72.653  1.00 16.51 ? 49   THR A CA  1 
ATOM   360  C C   . THR A 1 48  ? 22.255 20.719 72.893  1.00 18.18 ? 49   THR A C   1 
ATOM   361  O O   . THR A 1 48  ? 21.153 20.294 72.539  1.00 19.02 ? 49   THR A O   1 
ATOM   362  C CB  . THR A 1 48  ? 22.945 22.283 71.140  1.00 18.61 ? 49   THR A CB  1 
ATOM   363  O OG1 . THR A 1 48  ? 24.025 21.381 70.805  1.00 17.23 ? 49   THR A OG1 1 
ATOM   364  C CG2 . THR A 1 48  ? 23.345 23.716 70.805  1.00 16.13 ? 49   THR A CG2 1 
ATOM   365  N N   . ILE A 1 49  ? 23.172 19.954 73.476  1.00 18.63 ? 50   ILE A N   1 
ATOM   366  C CA  . ILE A 1 49  ? 22.895 18.530 73.714  1.00 19.31 ? 50   ILE A CA  1 
ATOM   367  C C   . ILE A 1 49  ? 22.510 18.128 75.138  1.00 22.22 ? 50   ILE A C   1 
ATOM   368  O O   . ILE A 1 49  ? 22.089 16.981 75.365  1.00 20.96 ? 50   ILE A O   1 
ATOM   369  C CB  . ILE A 1 49  ? 24.092 17.650 73.262  1.00 21.45 ? 50   ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 49  ? 25.357 18.017 74.060  1.00 21.32 ? 50   ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 49  ? 24.353 17.871 71.785  1.00 19.84 ? 50   ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 49  ? 26.605 17.191 73.718  1.00 22.38 ? 50   ILE A CD1 1 
ATOM   373  N N   . TYR A 1 50  ? 22.659 19.023 76.111  1.00 19.51 ? 51   TYR A N   1 
ATOM   374  C CA  . TYR A 1 50  ? 22.280 18.633 77.477  1.00 20.26 ? 51   TYR A CA  1 
ATOM   375  C C   . TYR A 1 50  ? 21.089 19.422 78.022  1.00 20.61 ? 51   TYR A C   1 
ATOM   376  O O   . TYR A 1 50  ? 20.783 19.347 79.216  1.00 22.55 ? 51   TYR A O   1 
ATOM   377  C CB  . TYR A 1 50  ? 23.448 18.817 78.437  1.00 24.33 ? 51   TYR A CB  1 
ATOM   378  C CG  . TYR A 1 50  ? 24.689 18.045 78.066  1.00 26.07 ? 51   TYR A CG  1 
ATOM   379  C CD1 . TYR A 1 50  ? 25.897 18.704 77.897  1.00 26.25 ? 51   TYR A CD1 1 
ATOM   380  C CD2 . TYR A 1 50  ? 24.664 16.662 77.920  1.00 27.45 ? 51   TYR A CD2 1 
ATOM   381  C CE1 . TYR A 1 50  ? 27.055 18.025 77.592  1.00 27.47 ? 51   TYR A CE1 1 
ATOM   382  C CE2 . TYR A 1 50  ? 25.836 15.954 77.617  1.00 27.24 ? 51   TYR A CE2 1 
ATOM   383  C CZ  . TYR A 1 50  ? 27.023 16.650 77.455  1.00 29.53 ? 51   TYR A CZ  1 
ATOM   384  O OH  . TYR A 1 50  ? 28.198 16.006 77.136  1.00 31.46 ? 51   TYR A OH  1 
ATOM   385  N N   . THR A 1 51  ? 20.408 20.157 77.153  1.00 18.42 ? 52   THR A N   1 
ATOM   386  C CA  . THR A 1 51  ? 19.271 20.985 77.588  1.00 19.01 ? 52   THR A CA  1 
ATOM   387  C C   . THR A 1 51  ? 17.880 20.436 77.225  1.00 18.97 ? 52   THR A C   1 
ATOM   388  O O   . THR A 1 51  ? 16.871 20.867 77.791  1.00 20.66 ? 52   THR A O   1 
ATOM   389  C CB  . THR A 1 51  ? 19.401 22.411 77.012  1.00 19.59 ? 52   THR A CB  1 
ATOM   390  O OG1 . THR A 1 51  ? 19.756 22.339 75.635  1.00 19.53 ? 52   THR A OG1 1 
ATOM   391  C CG2 . THR A 1 51  ? 20.470 23.198 77.758  1.00 19.74 ? 52   THR A CG2 1 
ATOM   392  N N   . ARG A 1 52  ? 17.821 19.498 76.288  1.00 18.21 ? 53   ARG A N   1 
ATOM   393  C CA  . ARG A 1 52  ? 16.536 18.919 75.861  1.00 21.33 ? 53   ARG A CA  1 
ATOM   394  C C   . ARG A 1 52  ? 16.695 17.412 75.636  1.00 22.89 ? 53   ARG A C   1 
ATOM   395  O O   . ARG A 1 52  ? 17.808 16.925 75.381  1.00 22.62 ? 53   ARG A O   1 
ATOM   396  C CB  . ARG A 1 52  ? 16.047 19.580 74.562  1.00 21.92 ? 53   ARG A CB  1 
ATOM   397  C CG  . ARG A 1 52  ? 15.565 21.039 74.718  1.00 21.95 ? 53   ARG A CG  1 
ATOM   398  C CD  . ARG A 1 52  ? 15.299 21.672 73.358  1.00 20.92 ? 53   ARG A CD  1 
ATOM   399  N NE  . ARG A 1 52  ? 14.495 22.878 73.497  1.00 20.37 ? 53   ARG A NE  1 
ATOM   400  C CZ  . ARG A 1 52  ? 14.077 23.618 72.479  1.00 21.73 ? 53   ARG A CZ  1 
ATOM   401  N NH1 . ARG A 1 52  ? 14.395 23.280 71.231  1.00 21.49 ? 53   ARG A NH1 1 
ATOM   402  N NH2 . ARG A 1 52  ? 13.318 24.682 72.712  1.00 19.29 ? 53   ARG A NH2 1 
ATOM   403  N N   . GLY A 1 53  ? 15.595 16.673 75.730  1.00 21.47 ? 54   GLY A N   1 
ATOM   404  C CA  . GLY A 1 53  ? 15.684 15.230 75.534  1.00 22.85 ? 54   GLY A CA  1 
ATOM   405  C C   . GLY A 1 53  ? 14.663 14.632 74.583  1.00 24.06 ? 54   GLY A C   1 
ATOM   406  O O   . GLY A 1 53  ? 13.663 15.268 74.240  1.00 26.23 ? 54   GLY A O   1 
ATOM   407  N N   . GLY A 1 54  ? 14.918 13.400 74.148  1.00 25.46 ? 55   GLY A N   1 
ATOM   408  C CA  . GLY A 1 54  ? 13.993 12.709 73.258  1.00 27.88 ? 55   GLY A CA  1 
ATOM   409  C C   . GLY A 1 54  ? 13.585 13.504 72.033  1.00 28.61 ? 55   GLY A C   1 
ATOM   410  O O   . GLY A 1 54  ? 14.434 14.085 71.375  1.00 30.06 ? 55   GLY A O   1 
ATOM   411  N N   . LYS A 1 55  ? 12.288 13.549 71.738  1.00 27.14 ? 56   LYS A N   1 
ATOM   412  C CA  . LYS A 1 55  ? 11.798 14.271 70.569  1.00 30.15 ? 56   LYS A CA  1 
ATOM   413  C C   . LYS A 1 55  ? 12.004 15.790 70.689  1.00 30.89 ? 56   LYS A C   1 
ATOM   414  O O   . LYS A 1 55  ? 11.931 16.512 69.686  1.00 31.06 ? 56   LYS A O   1 
ATOM   415  C CB  . LYS A 1 55  ? 10.317 13.946 70.340  1.00 34.03 ? 56   LYS A CB  1 
ATOM   416  C CG  . LYS A 1 55  ? 9.861  14.097 68.888  1.00 40.51 ? 56   LYS A CG  1 
ATOM   417  C CD  . LYS A 1 55  ? 8.376  13.757 68.735  1.00 45.21 ? 56   LYS A CD  1 
ATOM   418  C CE  . LYS A 1 55  ? 7.884  13.982 67.312  1.00 47.56 ? 56   LYS A CE  1 
ATOM   419  N NZ  . LYS A 1 55  ? 8.590  13.104 66.320  1.00 51.42 ? 56   LYS A NZ  1 
ATOM   420  N N   . GLU A 1 56  ? 12.255 16.269 71.911  1.00 29.24 ? 57   GLU A N   1 
ATOM   421  C CA  . GLU A 1 56  ? 12.518 17.691 72.152  1.00 28.84 ? 57   GLU A CA  1 
ATOM   422  C C   . GLU A 1 56  ? 13.834 18.063 71.454  1.00 28.27 ? 57   GLU A C   1 
ATOM   423  O O   . GLU A 1 56  ? 13.966 19.150 70.891  1.00 29.31 ? 57   GLU A O   1 
ATOM   424  C CB  . GLU A 1 56  ? 12.702 17.975 73.650  1.00 31.02 ? 57   GLU A CB  1 
ATOM   425  C CG  . GLU A 1 56  ? 11.597 17.475 74.568  1.00 35.81 ? 57   GLU A CG  1 
ATOM   426  C CD  . GLU A 1 56  ? 11.998 17.478 76.063  1.00 40.74 ? 57   GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 56  ? 11.218 16.903 76.866  1.00 42.28 ? 57   GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 56  ? 13.074 18.038 76.441  1.00 34.42 ? 57   GLU A OE2 1 
ATOM   429  N N   . LYS A 1 57  ? 14.811 17.162 71.510  1.00 26.81 ? 58   LYS A N   1 
ATOM   430  C CA  . LYS A 1 57  ? 16.112 17.423 70.909  1.00 26.51 ? 58   LYS A CA  1 
ATOM   431  C C   . LYS A 1 57  ? 16.055 17.895 69.463  1.00 26.31 ? 58   LYS A C   1 
ATOM   432  O O   . LYS A 1 57  ? 16.835 18.739 69.075  1.00 21.96 ? 58   LYS A O   1 
ATOM   433  C CB  . LYS A 1 57  ? 17.006 16.184 70.963  1.00 29.66 ? 58   LYS A CB  1 
ATOM   434  C CG  . LYS A 1 57  ? 17.915 16.105 72.172  1.00 29.86 ? 58   LYS A CG  1 
ATOM   435  C CD  . LYS A 1 57  ? 18.864 14.908 72.062  1.00 32.66 ? 58   LYS A CD  1 
ATOM   436  C CE  . LYS A 1 57  ? 18.083 13.608 71.943  1.00 37.68 ? 58   LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 57  ? 18.978 12.425 72.026  1.00 40.55 ? 58   LYS A NZ  1 
ATOM   438  N N   . GLN A 1 58  ? 15.143 17.355 68.654  1.00 23.95 ? 59   GLN A N   1 
ATOM   439  C CA  . GLN A 1 58  ? 15.119 17.775 67.269  1.00 23.39 ? 59   GLN A CA  1 
ATOM   440  C C   . GLN A 1 58  ? 14.695 19.221 67.066  1.00 24.53 ? 59   GLN A C   1 
ATOM   441  O O   . GLN A 1 58  ? 14.761 19.731 65.953  1.00 26.51 ? 59   GLN A O   1 
ATOM   442  C CB  . GLN A 1 58  ? 14.222 16.855 66.452  1.00 27.18 ? 59   GLN A CB  1 
ATOM   443  C CG  . GLN A 1 58  ? 12.767 16.976 66.734  1.00 29.35 ? 59   GLN A CG  1 
ATOM   444  C CD  . GLN A 1 58  ? 11.965 15.982 65.901  1.00 34.79 ? 59   GLN A CD  1 
ATOM   445  O OE1 . GLN A 1 58  ? 12.210 14.766 65.964  1.00 32.00 ? 59   GLN A OE1 1 
ATOM   446  N NE2 . GLN A 1 58  ? 11.009 16.494 65.110  1.00 32.81 ? 59   GLN A NE2 1 
ATOM   447  N N   . SER A 1 59  ? 14.258 19.890 68.124  1.00 22.58 ? 60   SER A N   1 
ATOM   448  C CA  . SER A 1 59  ? 13.865 21.286 67.967  1.00 22.91 ? 60   SER A CA  1 
ATOM   449  C C   . SER A 1 59  ? 15.027 22.242 68.175  1.00 19.86 ? 60   SER A C   1 
ATOM   450  O O   . SER A 1 59  ? 14.830 23.451 68.196  1.00 19.16 ? 60   SER A O   1 
ATOM   451  C CB  . SER A 1 59  ? 12.692 21.648 68.887  1.00 23.31 ? 60   SER A CB  1 
ATOM   452  O OG  . SER A 1 59  ? 11.508 21.028 68.405  1.00 25.89 ? 60   SER A OG  1 
ATOM   453  N N   . THR A 1 60  ? 16.232 21.705 68.352  1.00 19.82 ? 61   THR A N   1 
ATOM   454  C CA  . THR A 1 60  ? 17.439 22.561 68.458  1.00 17.89 ? 61   THR A CA  1 
ATOM   455  C C   . THR A 1 60  ? 18.347 22.093 67.318  1.00 19.38 ? 61   THR A C   1 
ATOM   456  O O   . THR A 1 60  ? 18.408 20.879 67.046  1.00 18.49 ? 61   THR A O   1 
ATOM   457  C CB  . THR A 1 60  ? 18.204 22.382 69.794  1.00 17.70 ? 61   THR A CB  1 
ATOM   458  O OG1 . THR A 1 60  ? 17.384 22.852 70.877  1.00 17.94 ? 61   THR A OG1 1 
ATOM   459  C CG2 . THR A 1 60  ? 19.541 23.209 69.763  1.00 14.60 ? 61   THR A CG2 1 
ATOM   460  N N   . ALA A 1 61  ? 19.012 23.029 66.625  1.00 16.75 ? 62   ALA A N   1 
ATOM   461  C CA  . ALA A 1 61  ? 19.906 22.647 65.517  1.00 17.46 ? 62   ALA A CA  1 
ATOM   462  C C   . ALA A 1 61  ? 21.059 23.634 65.375  1.00 18.00 ? 62   ALA A C   1 
ATOM   463  O O   . ALA A 1 61  ? 21.000 24.752 65.904  1.00 16.54 ? 62   ALA A O   1 
ATOM   464  C CB  . ALA A 1 61  ? 19.128 22.551 64.214  1.00 17.24 ? 62   ALA A CB  1 
ATOM   465  N N   . ILE A 1 62  ? 22.095 23.232 64.639  1.00 15.36 ? 63   ILE A N   1 
ATOM   466  C CA  . ILE A 1 62  ? 23.306 24.042 64.483  1.00 16.17 ? 63   ILE A CA  1 
ATOM   467  C C   . ILE A 1 62  ? 23.590 24.360 63.009  1.00 17.17 ? 63   ILE A C   1 
ATOM   468  O O   . ILE A 1 62  ? 23.467 23.492 62.158  1.00 17.19 ? 63   ILE A O   1 
ATOM   469  C CB  . ILE A 1 62  ? 24.534 23.251 65.068  1.00 15.86 ? 63   ILE A CB  1 
ATOM   470  C CG1 . ILE A 1 62  ? 24.468 23.251 66.602  1.00 17.57 ? 63   ILE A CG1 1 
ATOM   471  C CG2 . ILE A 1 62  ? 25.851 23.811 64.535  1.00 17.23 ? 63   ILE A CG2 1 
ATOM   472  C CD1 . ILE A 1 62  ? 25.442 22.276 67.280  1.00 19.77 ? 63   ILE A CD1 1 
ATOM   473  N N   . PHE A 1 63  ? 23.968 25.604 62.723  1.00 16.57 ? 64   PHE A N   1 
ATOM   474  C CA  . PHE A 1 63  ? 24.309 26.020 61.360  1.00 16.24 ? 64   PHE A CA  1 
ATOM   475  C C   . PHE A 1 63  ? 25.697 26.660 61.433  1.00 16.55 ? 64   PHE A C   1 
ATOM   476  O O   . PHE A 1 63  ? 25.918 27.535 62.273  1.00 17.22 ? 64   PHE A O   1 
ATOM   477  C CB  . PHE A 1 63  ? 23.292 27.053 60.837  1.00 17.70 ? 64   PHE A CB  1 
ATOM   478  C CG  . PHE A 1 63  ? 23.666 27.672 59.483  1.00 18.06 ? 64   PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 63  ? 23.177 27.133 58.292  1.00 19.29 ? 64   PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 63  ? 24.489 28.796 59.418  1.00 19.29 ? 64   PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 63  ? 23.490 27.705 57.045  1.00 20.04 ? 64   PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 63  ? 24.823 29.393 58.174  1.00 20.76 ? 64   PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 63  ? 24.314 28.839 56.980  1.00 19.97 ? 64   PHE A CZ  1 
ATOM   484  N N   . VAL A 1 64  ? 26.629 26.225 60.581  1.00 14.48 ? 65   VAL A N   1 
ATOM   485  C CA  . VAL A 1 64  ? 27.979 26.786 60.557  1.00 16.97 ? 65   VAL A CA  1 
ATOM   486  C C   . VAL A 1 64  ? 28.172 27.570 59.261  1.00 16.99 ? 65   VAL A C   1 
ATOM   487  O O   . VAL A 1 64  ? 27.866 27.056 58.180  1.00 16.53 ? 65   VAL A O   1 
ATOM   488  C CB  . VAL A 1 64  ? 29.067 25.672 60.641  1.00 18.65 ? 65   VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 64  ? 30.489 26.291 60.524  1.00 16.27 ? 65   VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 64  ? 28.933 24.927 61.990  1.00 18.35 ? 65   VAL A CG2 1 
ATOM   491  N N   . GLY A 1 65  ? 28.661 28.812 59.386  1.00 15.84 ? 66   GLY A N   1 
ATOM   492  C CA  . GLY A 1 65  ? 28.889 29.685 58.239  1.00 16.26 ? 66   GLY A CA  1 
ATOM   493  C C   . GLY A 1 65  ? 30.102 30.609 58.367  1.00 16.88 ? 66   GLY A C   1 
ATOM   494  O O   . GLY A 1 65  ? 30.923 30.460 59.303  1.00 15.61 ? 66   GLY A O   1 
ATOM   495  N N   . GLY A 1 66  ? 30.223 31.561 57.434  1.00 15.22 ? 67   GLY A N   1 
ATOM   496  C CA  . GLY A 1 66  ? 31.367 32.461 57.448  1.00 18.50 ? 67   GLY A CA  1 
ATOM   497  C C   . GLY A 1 66  ? 31.937 32.569 56.044  1.00 19.50 ? 67   GLY A C   1 
ATOM   498  O O   . GLY A 1 66  ? 31.527 31.817 55.173  1.00 21.58 ? 67   GLY A O   1 
ATOM   499  N N   . GLY A 1 67  ? 32.900 33.464 55.835  1.00 21.50 ? 68   GLY A N   1 
ATOM   500  C CA  . GLY A 1 67  ? 33.463 33.692 54.504  1.00 19.81 ? 68   GLY A CA  1 
ATOM   501  C C   . GLY A 1 67  ? 34.571 32.791 54.010  1.00 22.28 ? 68   GLY A C   1 
ATOM   502  O O   . GLY A 1 67  ? 34.884 32.806 52.813  1.00 24.26 ? 68   GLY A O   1 
ATOM   503  N N   . ASP A 1 68  ? 35.185 32.038 54.918  1.00 22.30 ? 69   ASP A N   1 
ATOM   504  C CA  . ASP A 1 68  ? 36.262 31.118 54.565  1.00 22.97 ? 69   ASP A CA  1 
ATOM   505  C C   . ASP A 1 68  ? 35.780 29.686 54.781  1.00 23.05 ? 69   ASP A C   1 
ATOM   506  O O   . ASP A 1 68  ? 35.517 29.275 55.912  1.00 21.12 ? 69   ASP A O   1 
ATOM   507  C CB  . ASP A 1 68  ? 37.497 31.401 55.430  1.00 24.22 ? 69   ASP A CB  1 
ATOM   508  C CG  . ASP A 1 68  ? 38.696 30.557 55.027  1.00 29.48 ? 69   ASP A CG  1 
ATOM   509  O OD1 . ASP A 1 68  ? 38.808 29.406 55.482  1.00 26.79 ? 69   ASP A OD1 1 
ATOM   510  O OD2 . ASP A 1 68  ? 39.517 31.048 54.229  1.00 32.34 ? 69   ASP A OD2 1 
ATOM   511  N N   . MET A 1 69  ? 35.657 28.932 53.692  1.00 21.26 ? 70   MET A N   1 
ATOM   512  C CA  . MET A 1 69  ? 35.200 27.546 53.762  1.00 21.34 ? 70   MET A CA  1 
ATOM   513  C C   . MET A 1 69  ? 36.074 26.637 54.633  1.00 21.11 ? 70   MET A C   1 
ATOM   514  O O   . MET A 1 69  ? 35.559 25.863 55.446  1.00 20.87 ? 70   MET A O   1 
ATOM   515  C CB  . MET A 1 69  ? 35.122 26.950 52.355  1.00 22.97 ? 70   MET A CB  1 
ATOM   516  C CG  . MET A 1 69  ? 34.780 25.460 52.311  1.00 22.75 ? 70   MET A CG  1 
ATOM   517  S SD  . MET A 1 69  ? 33.159 25.054 53.019  1.00 26.94 ? 70   MET A SD  1 
ATOM   518  C CE  . MET A 1 69  ? 32.044 25.296 51.564  1.00 23.64 ? 70   MET A CE  1 
ATOM   519  N N   . ALA A 1 70  ? 37.388 26.690 54.433  1.00 21.98 ? 71   ALA A N   1 
ATOM   520  C CA  . ALA A 1 70  ? 38.298 25.840 55.219  1.00 20.47 ? 71   ALA A CA  1 
ATOM   521  C C   . ALA A 1 70  ? 38.091 26.057 56.714  1.00 20.64 ? 71   ALA A C   1 
ATOM   522  O O   . ALA A 1 70  ? 38.142 25.109 57.511  1.00 19.61 ? 71   ALA A O   1 
ATOM   523  C CB  . ALA A 1 70  ? 39.750 26.145 54.854  1.00 23.59 ? 71   ALA A CB  1 
ATOM   524  N N   . ALA A 1 71  ? 37.887 27.313 57.098  1.00 18.75 ? 72   ALA A N   1 
ATOM   525  C CA  . ALA A 1 71  ? 37.679 27.630 58.505  1.00 19.94 ? 72   ALA A CA  1 
ATOM   526  C C   . ALA A 1 71  ? 36.358 27.027 58.983  1.00 18.73 ? 72   ALA A C   1 
ATOM   527  O O   . ALA A 1 71  ? 36.278 26.476 60.083  1.00 20.17 ? 72   ALA A O   1 
ATOM   528  C CB  . ALA A 1 71  ? 37.686 29.155 58.712  1.00 19.55 ? 72   ALA A CB  1 
ATOM   529  N N   . GLY A 1 72  ? 35.315 27.144 58.165  1.00 20.06 ? 73   GLY A N   1 
ATOM   530  C CA  . GLY A 1 72  ? 34.029 26.572 58.539  1.00 20.20 ? 73   GLY A CA  1 
ATOM   531  C C   . GLY A 1 72  ? 34.126 25.054 58.651  1.00 21.89 ? 73   GLY A C   1 
ATOM   532  O O   . GLY A 1 72  ? 33.529 24.423 59.543  1.00 19.76 ? 73   GLY A O   1 
ATOM   533  N N   . GLU A 1 73  ? 34.901 24.450 57.757  1.00 21.84 ? 74   GLU A N   1 
ATOM   534  C CA  . GLU A 1 73  ? 35.059 23.005 57.775  1.00 21.21 ? 74   GLU A CA  1 
ATOM   535  C C   . GLU A 1 73  ? 35.740 22.554 59.075  1.00 20.61 ? 74   GLU A C   1 
ATOM   536  O O   . GLU A 1 73  ? 35.376 21.532 59.643  1.00 21.67 ? 74   GLU A O   1 
ATOM   537  C CB  . GLU A 1 73  ? 35.850 22.551 56.530  1.00 21.07 ? 74   GLU A CB  1 
ATOM   538  C CG  . GLU A 1 73  ? 34.967 22.367 55.312  1.00 20.55 ? 74   GLU A CG  1 
ATOM   539  C CD  . GLU A 1 73  ? 35.733 22.065 54.007  1.00 24.98 ? 74   GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 73  ? 35.208 21.299 53.171  1.00 23.22 ? 74   GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 73  ? 36.833 22.606 53.819  1.00 22.39 ? 74   GLU A OE2 1 
ATOM   542  N N   . ARG A 1 74  ? 36.720 23.319 59.555  1.00 19.58 ? 75   ARG A N   1 
ATOM   543  C CA  . ARG A 1 74  ? 37.377 22.958 60.808  1.00 20.52 ? 75   ARG A CA  1 
ATOM   544  C C   . ARG A 1 74  ? 36.408 23.079 61.971  1.00 19.20 ? 75   ARG A C   1 
ATOM   545  O O   . ARG A 1 74  ? 36.442 22.279 62.902  1.00 19.16 ? 75   ARG A O   1 
ATOM   546  C CB  . ARG A 1 74  ? 38.596 23.844 61.073  1.00 23.55 ? 75   ARG A CB  1 
ATOM   547  C CG  . ARG A 1 74  ? 39.867 23.348 60.387  1.00 30.62 ? 75   ARG A CG  1 
ATOM   548  C CD  . ARG A 1 74  ? 41.043 24.270 60.666  1.00 35.37 ? 75   ARG A CD  1 
ATOM   549  N NE  . ARG A 1 74  ? 41.298 25.081 59.479  1.00 40.01 ? 75   ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 74  ? 41.217 26.407 59.433  1.00 38.50 ? 75   ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 74  ? 40.887 27.107 60.522  1.00 36.12 ? 75   ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 74  ? 41.454 27.021 58.286  1.00 32.45 ? 75   ARG A NH2 1 
ATOM   553  N N   . VAL A 1 75  ? 35.521 24.064 61.929  1.00 18.25 ? 76   VAL A N   1 
ATOM   554  C CA  . VAL A 1 75  ? 34.570 24.206 63.041  1.00 15.07 ? 76   VAL A CA  1 
ATOM   555  C C   . VAL A 1 75  ? 33.532 23.081 62.947  1.00 17.66 ? 76   VAL A C   1 
ATOM   556  O O   . VAL A 1 75  ? 33.147 22.471 63.951  1.00 18.51 ? 76   VAL A O   1 
ATOM   557  C CB  . VAL A 1 75  ? 33.847 25.596 62.975  1.00 16.03 ? 76   VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 75  ? 32.581 25.574 63.845  1.00 16.43 ? 76   VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 75  ? 34.829 26.722 63.437  1.00 17.01 ? 76   VAL A CG2 1 
ATOM   560  N N   . PHE A 1 76  ? 33.074 22.807 61.736  1.00 16.73 ? 77   PHE A N   1 
ATOM   561  C CA  . PHE A 1 76  ? 32.063 21.768 61.511  1.00 17.51 ? 77   PHE A CA  1 
ATOM   562  C C   . PHE A 1 76  ? 32.566 20.408 62.021  1.00 17.93 ? 77   PHE A C   1 
ATOM   563  O O   . PHE A 1 76  ? 31.826 19.659 62.662  1.00 20.77 ? 77   PHE A O   1 
ATOM   564  C CB  . PHE A 1 76  ? 31.720 21.708 59.998  1.00 19.16 ? 77   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 76  ? 30.449 20.961 59.681  1.00 18.54 ? 77   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 76  ? 29.227 21.421 60.155  1.00 17.86 ? 77   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 76  ? 30.469 19.821 58.881  1.00 20.38 ? 77   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 76  ? 28.037 20.770 59.839  1.00 18.23 ? 77   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 76  ? 29.278 19.151 58.561  1.00 19.91 ? 77   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 76  ? 28.054 19.635 59.045  1.00 21.33 ? 77   PHE A CZ  1 
ATOM   571  N N   . GLU A 1 77  ? 33.826 20.095 61.760  1.00 20.42 ? 78   GLU A N   1 
ATOM   572  C CA  . GLU A 1 77  ? 34.398 18.837 62.237  1.00 21.03 ? 78   GLU A CA  1 
ATOM   573  C C   . GLU A 1 77  ? 34.480 18.804 63.777  1.00 21.13 ? 78   GLU A C   1 
ATOM   574  O O   . GLU A 1 77  ? 34.222 17.781 64.406  1.00 19.19 ? 78   GLU A O   1 
ATOM   575  C CB  . GLU A 1 77  ? 35.789 18.640 61.609  1.00 25.71 ? 78   GLU A CB  1 
ATOM   576  C CG  . GLU A 1 77  ? 35.714 18.297 60.110  1.00 27.95 ? 78   GLU A CG  1 
ATOM   577  C CD  . GLU A 1 77  ? 34.894 17.041 59.862  1.00 30.49 ? 78   GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 77  ? 35.125 16.055 60.593  1.00 34.91 ? 78   GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 77  ? 34.027 17.025 58.955  1.00 27.40 ? 78   GLU A OE2 1 
ATOM   580  N N   . ALA A 1 78  ? 34.820 19.934 64.382  1.00 18.32 ? 79   ALA A N   1 
ATOM   581  C CA  . ALA A 1 78  ? 34.898 20.015 65.830  1.00 18.61 ? 79   ALA A CA  1 
ATOM   582  C C   . ALA A 1 78  ? 33.499 19.873 66.452  1.00 18.63 ? 79   ALA A C   1 
ATOM   583  O O   . ALA A 1 78  ? 33.360 19.414 67.579  1.00 19.21 ? 79   ALA A O   1 
ATOM   584  C CB  . ALA A 1 78  ? 35.527 21.346 66.240  1.00 17.51 ? 79   ALA A CB  1 
ATOM   585  N N   . VAL A 1 79  ? 32.474 20.301 65.731  1.00 19.37 ? 80   VAL A N   1 
ATOM   586  C CA  . VAL A 1 79  ? 31.093 20.162 66.219  1.00 18.99 ? 80   VAL A CA  1 
ATOM   587  C C   . VAL A 1 79  ? 30.738 18.673 66.259  1.00 21.49 ? 80   VAL A C   1 
ATOM   588  O O   . VAL A 1 79  ? 30.282 18.153 67.295  1.00 21.67 ? 80   VAL A O   1 
ATOM   589  C CB  . VAL A 1 79  ? 30.082 20.895 65.277  1.00 19.57 ? 80   VAL A CB  1 
ATOM   590  C CG1 . VAL A 1 79  ? 28.685 20.373 65.480  1.00 17.76 ? 80   VAL A CG1 1 
ATOM   591  C CG2 . VAL A 1 79  ? 30.109 22.419 65.542  1.00 15.93 ? 80   VAL A CG2 1 
ATOM   592  N N   . LYS A 1 80  ? 30.960 17.987 65.139  1.00 20.12 ? 81   LYS A N   1 
ATOM   593  C CA  . LYS A 1 80  ? 30.624 16.570 65.056  1.00 21.81 ? 81   LYS A CA  1 
ATOM   594  C C   . LYS A 1 80  ? 31.422 15.758 66.071  1.00 21.47 ? 81   LYS A C   1 
ATOM   595  O O   . LYS A 1 80  ? 30.928 14.767 66.594  1.00 23.24 ? 81   LYS A O   1 
ATOM   596  C CB  . LYS A 1 80  ? 30.854 16.036 63.628  1.00 22.10 ? 81   LYS A CB  1 
ATOM   597  C CG  . LYS A 1 80  ? 29.885 16.622 62.606  1.00 24.17 ? 81   LYS A CG  1 
ATOM   598  C CD  . LYS A 1 80  ? 30.060 16.032 61.208  1.00 29.69 ? 81   LYS A CD  1 
ATOM   599  C CE  . LYS A 1 80  ? 31.409 16.390 60.607  1.00 29.69 ? 81   LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 80  ? 31.555 15.894 59.215  1.00 28.36 ? 81   LYS A NZ  1 
ATOM   601  N N   . LYS A 1 81  ? 32.648 16.189 66.353  1.00 21.10 ? 82   LYS A N   1 
ATOM   602  C CA  . LYS A 1 81  ? 33.490 15.488 67.319  1.00 23.97 ? 82   LYS A CA  1 
ATOM   603  C C   . LYS A 1 81  ? 32.992 15.612 68.754  1.00 22.57 ? 82   LYS A C   1 
ATOM   604  O O   . LYS A 1 81  ? 33.264 14.747 69.588  1.00 21.06 ? 82   LYS A O   1 
ATOM   605  C CB  . LYS A 1 81  ? 34.937 16.002 67.226  1.00 25.73 ? 82   LYS A CB  1 
ATOM   606  C CG  . LYS A 1 81  ? 35.650 15.493 65.993  1.00 34.73 ? 82   LYS A CG  1 
ATOM   607  C CD  . LYS A 1 81  ? 36.956 16.226 65.731  1.00 37.06 ? 82   LYS A CD  1 
ATOM   608  C CE  . LYS A 1 81  ? 37.532 15.815 64.378  1.00 38.99 ? 82   LYS A CE  1 
ATOM   609  N NZ  . LYS A 1 81  ? 38.817 16.505 64.093  1.00 39.55 ? 82   LYS A NZ  1 
ATOM   610  N N   . ARG A 1 82  ? 32.235 16.668 69.043  1.00 20.46 ? 83   ARG A N   1 
ATOM   611  C CA  . ARG A 1 82  ? 31.733 16.889 70.403  1.00 19.42 ? 83   ARG A CA  1 
ATOM   612  C C   . ARG A 1 82  ? 30.537 15.997 70.717  1.00 21.08 ? 83   ARG A C   1 
ATOM   613  O O   . ARG A 1 82  ? 30.279 15.677 71.884  1.00 22.75 ? 83   ARG A O   1 
ATOM   614  C CB  . ARG A 1 82  ? 31.335 18.360 70.586  1.00 21.44 ? 83   ARG A CB  1 
ATOM   615  C CG  . ARG A 1 82  ? 31.099 18.772 72.030  1.00 22.07 ? 83   ARG A CG  1 
ATOM   616  C CD  . ARG A 1 82  ? 32.439 18.821 72.782  1.00 24.57 ? 83   ARG A CD  1 
ATOM   617  N NE  . ARG A 1 82  ? 32.316 19.505 74.070  1.00 24.17 ? 83   ARG A NE  1 
ATOM   618  C CZ  . ARG A 1 82  ? 33.352 19.940 74.776  1.00 27.33 ? 83   ARG A CZ  1 
ATOM   619  N NH1 . ARG A 1 82  ? 34.583 19.754 74.314  1.00 27.19 ? 83   ARG A NH1 1 
ATOM   620  N NH2 . ARG A 1 82  ? 33.161 20.577 75.930  1.00 25.47 ? 83   ARG A NH2 1 
ATOM   621  N N   . PHE A 1 83  ? 29.802 15.610 69.681  1.00 19.84 ? 84   PHE A N   1 
ATOM   622  C CA  . PHE A 1 83  ? 28.650 14.743 69.850  1.00 20.29 ? 84   PHE A CA  1 
ATOM   623  C C   . PHE A 1 83  ? 29.141 13.364 70.310  1.00 24.49 ? 84   PHE A C   1 
ATOM   624  O O   . PHE A 1 83  ? 30.287 12.975 70.050  1.00 24.31 ? 84   PHE A O   1 
ATOM   625  C CB  . PHE A 1 83  ? 27.921 14.510 68.520  1.00 17.82 ? 84   PHE A CB  1 
ATOM   626  C CG  . PHE A 1 83  ? 27.318 15.742 67.885  1.00 20.58 ? 84   PHE A CG  1 
ATOM   627  C CD1 . PHE A 1 83  ? 26.805 16.793 68.656  1.00 20.91 ? 84   PHE A CD1 1 
ATOM   628  C CD2 . PHE A 1 83  ? 27.164 15.796 66.506  1.00 19.15 ? 84   PHE A CD2 1 
ATOM   629  C CE1 . PHE A 1 83  ? 26.132 17.889 68.048  1.00 20.17 ? 84   PHE A CE1 1 
ATOM   630  C CE2 . PHE A 1 83  ? 26.498 16.880 65.880  1.00 22.55 ? 84   PHE A CE2 1 
ATOM   631  C CZ  . PHE A 1 83  ? 25.974 17.932 66.661  1.00 19.01 ? 84   PHE A CZ  1 
ATOM   632  N N   . PHE A 1 84  ? 28.279 12.620 70.983  1.00 24.92 ? 85   PHE A N   1 
ATOM   633  C CA  . PHE A 1 84  ? 28.649 11.265 71.382  1.00 26.19 ? 85   PHE A CA  1 
ATOM   634  C C   . PHE A 1 84  ? 27.390 10.510 71.767  1.00 25.61 ? 85   PHE A C   1 
ATOM   635  O O   . PHE A 1 84  ? 26.510 11.060 72.431  1.00 21.71 ? 85   PHE A O   1 
ATOM   636  C CB  . PHE A 1 84  ? 29.646 11.279 72.546  1.00 27.30 ? 85   PHE A CB  1 
ATOM   637  C CG  . PHE A 1 84  ? 29.062 11.757 73.838  1.00 28.83 ? 85   PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 84  ? 28.620 10.849 74.794  1.00 30.06 ? 85   PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 84  ? 28.947 13.119 74.096  1.00 29.54 ? 85   PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 84  ? 28.069 11.287 75.998  1.00 28.83 ? 85   PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 84  ? 28.400 13.578 75.292  1.00 29.27 ? 85   PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 84  ? 27.958 12.658 76.251  1.00 31.00 ? 85   PHE A CZ  1 
ATOM   643  N N   . GLY A 1 85  ? 27.302 9.262  71.323  1.00 23.69 ? 86   GLY A N   1 
ATOM   644  C CA  . GLY A 1 85  ? 26.140 8.458  71.651  1.00 23.40 ? 86   GLY A CA  1 
ATOM   645  C C   . GLY A 1 85  ? 24.880 9.161  71.194  1.00 24.78 ? 86   GLY A C   1 
ATOM   646  O O   . GLY A 1 85  ? 24.844 9.723  70.106  1.00 24.20 ? 86   GLY A O   1 
ATOM   647  N N   . PRO A 1 86  ? 23.832 9.162  72.019  1.00 22.67 ? 87   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? 22.564 9.807  71.675  1.00 24.12 ? 87   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? 22.562 11.324 71.867  1.00 22.88 ? 87   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? 21.588 11.982 71.517  1.00 23.97 ? 87   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? 21.578 9.114  72.613  1.00 25.14 ? 87   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? 22.424 8.939  73.855  1.00 25.13 ? 87   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? 23.710 8.397  73.275  1.00 23.82 ? 87   PRO A CD  1 
ATOM   654  N N   . PHE A 1 87  ? 23.646 11.872 72.412  1.00 22.47 ? 88   PHE A N   1 
ATOM   655  C CA  . PHE A 1 87  ? 23.721 13.313 72.666  1.00 21.43 ? 88   PHE A CA  1 
ATOM   656  C C   . PHE A 1 87  ? 24.199 14.061 71.430  1.00 21.19 ? 88   PHE A C   1 
ATOM   657  O O   . PHE A 1 87  ? 25.402 14.260 71.249  1.00 20.00 ? 88   PHE A O   1 
ATOM   658  C CB  . PHE A 1 87  ? 24.654 13.593 73.870  1.00 24.84 ? 88   PHE A CB  1 
ATOM   659  C CG  . PHE A 1 87  ? 24.195 12.939 75.161  1.00 26.26 ? 88   PHE A CG  1 
ATOM   660  C CD1 . PHE A 1 87  ? 24.589 11.639 75.483  1.00 27.00 ? 88   PHE A CD1 1 
ATOM   661  C CD2 . PHE A 1 87  ? 23.349 13.614 76.032  1.00 25.65 ? 88   PHE A CD2 1 
ATOM   662  C CE1 . PHE A 1 87  ? 24.149 11.024 76.652  1.00 26.99 ? 88   PHE A CE1 1 
ATOM   663  C CE2 . PHE A 1 87  ? 22.900 13.005 77.205  1.00 28.72 ? 88   PHE A CE2 1 
ATOM   664  C CZ  . PHE A 1 87  ? 23.302 11.709 77.513  1.00 27.96 ? 88   PHE A CZ  1 
ATOM   665  N N   . ARG A 1 88  ? 23.254 14.419 70.557  1.00 18.51 ? 89   ARG A N   1 
ATOM   666  C CA  . ARG A 1 88  ? 23.567 15.152 69.324  1.00 20.19 ? 89   ARG A CA  1 
ATOM   667  C C   . ARG A 1 88  ? 22.334 15.890 68.803  1.00 20.56 ? 89   ARG A C   1 
ATOM   668  O O   . ARG A 1 88  ? 21.223 15.663 69.282  1.00 21.05 ? 89   ARG A O   1 
ATOM   669  C CB  . ARG A 1 88  ? 24.085 14.185 68.229  1.00 23.42 ? 89   ARG A CB  1 
ATOM   670  C CG  . ARG A 1 88  ? 23.044 13.182 67.688  1.00 22.60 ? 89   ARG A CG  1 
ATOM   671  C CD  . ARG A 1 88  ? 23.680 12.121 66.764  1.00 22.99 ? 89   ARG A CD  1 
ATOM   672  N NE  . ARG A 1 88  ? 24.664 11.347 67.521  1.00 25.32 ? 89   ARG A NE  1 
ATOM   673  C CZ  . ARG A 1 88  ? 25.965 11.299 67.252  1.00 23.10 ? 89   ARG A CZ  1 
ATOM   674  N NH1 . ARG A 1 88  ? 26.466 11.971 66.216  1.00 20.89 ? 89   ARG A NH1 1 
ATOM   675  N NH2 . ARG A 1 88  ? 26.774 10.612 68.064  1.00 20.75 ? 89   ARG A NH2 1 
ATOM   676  N N   . VAL A 1 89  ? 22.533 16.808 67.855  1.00 20.20 ? 90   VAL A N   1 
ATOM   677  C CA  . VAL A 1 89  ? 21.410 17.523 67.233  1.00 20.04 ? 90   VAL A CA  1 
ATOM   678  C C   . VAL A 1 89  ? 21.801 17.644 65.762  1.00 20.02 ? 90   VAL A C   1 
ATOM   679  O O   . VAL A 1 89  ? 22.952 17.352 65.411  1.00 19.15 ? 90   VAL A O   1 
ATOM   680  C CB  . VAL A 1 89  ? 21.166 18.944 67.842  1.00 17.81 ? 90   VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 89  ? 20.738 18.814 69.329  1.00 20.31 ? 90   VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 89  ? 22.418 19.794 67.737  1.00 17.62 ? 90   VAL A CG2 1 
ATOM   683  N N   . SER A 1 90  ? 20.869 18.034 64.890  1.00 19.37 ? 91   SER A N   1 
ATOM   684  C CA  . SER A 1 90  ? 21.219 18.161 63.465  1.00 17.29 ? 91   SER A CA  1 
ATOM   685  C C   . SER A 1 90  ? 22.122 19.371 63.253  1.00 18.83 ? 91   SER A C   1 
ATOM   686  O O   . SER A 1 90  ? 22.057 20.345 64.012  1.00 17.31 ? 91   SER A O   1 
ATOM   687  C CB  . SER A 1 90  ? 19.956 18.312 62.605  1.00 19.26 ? 91   SER A CB  1 
ATOM   688  O OG  . SER A 1 90  ? 19.188 17.109 62.600  1.00 21.63 ? 91   SER A OG  1 
ATOM   689  N N   . CYS A 1 91  ? 22.973 19.304 62.235  1.00 17.69 ? 92   CYS A N   1 
ATOM   690  C CA  . CYS A 1 91  ? 23.882 20.411 61.929  1.00 18.68 ? 92   CYS A CA  1 
ATOM   691  C C   . CYS A 1 91  ? 24.021 20.589 60.410  1.00 20.02 ? 92   CYS A C   1 
ATOM   692  O O   . CYS A 1 91  ? 23.783 19.648 59.642  1.00 19.67 ? 92   CYS A O   1 
ATOM   693  C CB  . CYS A 1 91  ? 25.251 20.154 62.570  1.00 15.85 ? 92   CYS A CB  1 
ATOM   694  S SG  . CYS A 1 91  ? 26.134 18.642 62.044  1.00 19.72 ? 92   CYS A SG  1 
ATOM   695  N N   . MET A 1 92  ? 24.405 21.792 59.984  1.00 17.72 ? 93   MET A N   1 
ATOM   696  C CA  . MET A 1 92  ? 24.562 22.090 58.560  1.00 17.01 ? 93   MET A CA  1 
ATOM   697  C C   . MET A 1 92  ? 25.752 23.015 58.378  1.00 16.27 ? 93   MET A C   1 
ATOM   698  O O   . MET A 1 92  ? 26.051 23.812 59.275  1.00 18.35 ? 93   MET A O   1 
ATOM   699  C CB  . MET A 1 92  ? 23.274 22.763 58.047  1.00 16.57 ? 93   MET A CB  1 
ATOM   700  C CG  . MET A 1 92  ? 23.309 23.300 56.595  1.00 20.16 ? 93   MET A CG  1 
ATOM   701  S SD  . MET A 1 92  ? 21.721 24.195 56.216  1.00 19.77 ? 93   MET A SD  1 
ATOM   702  C CE  . MET A 1 92  ? 22.022 24.835 54.542  1.00 21.27 ? 93   MET A CE  1 
ATOM   703  N N   . LEU A 1 93  ? 26.456 22.882 57.246  1.00 17.14 ? 94   LEU A N   1 
ATOM   704  C CA  . LEU A 1 93  ? 27.597 23.743 56.897  1.00 17.88 ? 94   LEU A CA  1 
ATOM   705  C C   . LEU A 1 93  ? 27.298 24.434 55.547  1.00 19.47 ? 94   LEU A C   1 
ATOM   706  O O   . LEU A 1 93  ? 26.967 23.759 54.575  1.00 20.62 ? 94   LEU A O   1 
ATOM   707  C CB  . LEU A 1 93  ? 28.889 22.912 56.716  1.00 17.89 ? 94   LEU A CB  1 
ATOM   708  C CG  . LEU A 1 93  ? 30.092 23.645 56.104  1.00 18.06 ? 94   LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 93  ? 30.599 24.750 57.036  1.00 17.23 ? 94   LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 93  ? 31.212 22.617 55.827  1.00 19.49 ? 94   LEU A CD2 1 
ATOM   711  N N   . ASP A 1 94  ? 27.404 25.758 55.478  1.00 19.29 ? 95   ASP A N   1 
ATOM   712  C CA  . ASP A 1 94  ? 27.156 26.445 54.213  1.00 20.71 ? 95   ASP A CA  1 
ATOM   713  C C   . ASP A 1 94  ? 27.855 27.799 54.146  1.00 19.58 ? 95   ASP A C   1 
ATOM   714  O O   . ASP A 1 94  ? 27.254 28.803 53.764  1.00 18.98 ? 95   ASP A O   1 
ATOM   715  C CB  . ASP A 1 94  ? 25.633 26.594 53.949  1.00 18.43 ? 95   ASP A CB  1 
ATOM   716  C CG  . ASP A 1 94  ? 25.308 26.921 52.473  1.00 21.84 ? 95   ASP A CG  1 
ATOM   717  O OD1 . ASP A 1 94  ? 26.054 26.499 51.573  1.00 17.60 ? 95   ASP A OD1 1 
ATOM   718  O OD2 . ASP A 1 94  ? 24.284 27.590 52.191  1.00 21.50 ? 95   ASP A OD2 1 
ATOM   719  N N   . SER A 1 95  ? 29.129 27.812 54.535  1.00 19.32 ? 96   SER A N   1 
ATOM   720  C CA  . SER A 1 95  ? 29.941 29.022 54.489  1.00 20.32 ? 96   SER A CA  1 
ATOM   721  C C   . SER A 1 95  ? 29.782 29.776 53.166  1.00 22.66 ? 96   SER A C   1 
ATOM   722  O O   . SER A 1 95  ? 30.090 29.245 52.093  1.00 20.40 ? 96   SER A O   1 
ATOM   723  C CB  . SER A 1 95  ? 31.413 28.670 54.679  1.00 20.80 ? 96   SER A CB  1 
ATOM   724  O OG  . SER A 1 95  ? 31.613 28.087 55.958  1.00 22.57 ? 96   SER A OG  1 
ATOM   725  N N   . ASN A 1 96  ? 29.323 31.024 53.262  1.00 23.44 ? 97   ASN A N   1 
ATOM   726  C CA  . ASN A 1 96  ? 29.130 31.894 52.093  1.00 24.83 ? 97   ASN A CA  1 
ATOM   727  C C   . ASN A 1 96  ? 28.165 31.321 51.061  1.00 22.98 ? 97   ASN A C   1 
ATOM   728  O O   . ASN A 1 96  ? 28.175 31.738 49.909  1.00 23.98 ? 97   ASN A O   1 
ATOM   729  C CB  . ASN A 1 96  ? 30.485 32.184 51.429  1.00 26.27 ? 97   ASN A CB  1 
ATOM   730  C CG  . ASN A 1 96  ? 30.556 33.569 50.829  1.00 32.52 ? 97   ASN A CG  1 
ATOM   731  O OD1 . ASN A 1 96  ? 30.197 34.555 51.473  1.00 35.47 ? 97   ASN A OD1 1 
ATOM   732  N ND2 . ASN A 1 96  ? 31.031 33.658 49.599  1.00 30.50 ? 97   ASN A ND2 1 
ATOM   733  N N   . GLY A 1 97  ? 27.349 30.350 51.469  1.00 19.70 ? 98   GLY A N   1 
ATOM   734  C CA  . GLY A 1 97  ? 26.383 29.765 50.556  1.00 20.09 ? 98   GLY A CA  1 
ATOM   735  C C   . GLY A 1 97  ? 26.995 28.914 49.449  1.00 20.14 ? 98   GLY A C   1 
ATOM   736  O O   . GLY A 1 97  ? 26.343 28.644 48.439  1.00 20.53 ? 98   GLY A O   1 
ATOM   737  N N   . SER A 1 98  ? 28.226 28.449 49.639  1.00 19.85 ? 99   SER A N   1 
ATOM   738  C CA  . SER A 1 98  ? 28.871 27.662 48.580  1.00 21.33 ? 99   SER A CA  1 
ATOM   739  C C   . SER A 1 98  ? 28.315 26.266 48.348  1.00 20.95 ? 99   SER A C   1 
ATOM   740  O O   . SER A 1 98  ? 28.283 25.799 47.194  1.00 21.02 ? 99   SER A O   1 
ATOM   741  C CB  . SER A 1 98  ? 30.372 27.583 48.813  1.00 19.74 ? 99   SER A CB  1 
ATOM   742  O OG  . SER A 1 98  ? 30.940 28.872 48.712  1.00 23.59 ? 99   SER A OG  1 
ATOM   743  N N   . ASN A 1 99  ? 27.878 25.596 49.414  1.00 18.21 ? 100  ASN A N   1 
ATOM   744  C CA  . ASN A 1 99  ? 27.330 24.258 49.269  1.00 18.26 ? 100  ASN A CA  1 
ATOM   745  C C   . ASN A 1 99  ? 25.957 24.366 48.583  1.00 18.41 ? 100  ASN A C   1 
ATOM   746  O O   . ASN A 1 99  ? 25.666 23.605 47.656  1.00 17.00 ? 100  ASN A O   1 
ATOM   747  C CB  . ASN A 1 99  ? 27.146 23.572 50.625  1.00 18.37 ? 100  ASN A CB  1 
ATOM   748  C CG  . ASN A 1 99  ? 28.371 22.772 51.072  1.00 23.49 ? 100  ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 99  ? 29.168 22.275 50.243  1.00 18.75 ? 100  ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 99  ? 28.502 22.598 52.399  1.00 19.07 ? 100  ASN A ND2 1 
ATOM   751  N N   . THR A 1 100 ? 25.111 25.290 49.040  1.00 18.91 ? 101  THR A N   1 
ATOM   752  C CA  . THR A 1 100 ? 23.791 25.419 48.425  1.00 19.42 ? 101  THR A CA  1 
ATOM   753  C C   . THR A 1 100 ? 23.819 25.947 46.996  1.00 20.75 ? 101  THR A C   1 
ATOM   754  O O   . THR A 1 100 ? 22.979 25.560 46.177  1.00 21.60 ? 101  THR A O   1 
ATOM   755  C CB  . THR A 1 100 ? 22.797 26.279 49.269  1.00 18.10 ? 101  THR A CB  1 
ATOM   756  O OG1 . THR A 1 100 ? 23.379 27.546 49.593  1.00 20.85 ? 101  THR A OG1 1 
ATOM   757  C CG2 . THR A 1 100 ? 22.397 25.526 50.539  1.00 20.98 ? 101  THR A CG2 1 
ATOM   758  N N   . THR A 1 101 ? 24.772 26.820 46.686  1.00 20.50 ? 102  THR A N   1 
ATOM   759  C CA  . THR A 1 101 ? 24.878 27.346 45.332  1.00 20.10 ? 102  THR A CA  1 
ATOM   760  C C   . THR A 1 101 ? 25.429 26.244 44.420  1.00 19.90 ? 102  THR A C   1 
ATOM   761  O O   . THR A 1 101 ? 24.865 25.967 43.372  1.00 21.11 ? 102  THR A O   1 
ATOM   762  C CB  . THR A 1 101 ? 25.789 28.602 45.297  1.00 22.66 ? 102  THR A CB  1 
ATOM   763  O OG1 . THR A 1 101 ? 25.157 29.661 46.027  1.00 21.55 ? 102  THR A OG1 1 
ATOM   764  C CG2 . THR A 1 101 ? 26.042 29.056 43.843  1.00 22.04 ? 102  THR A CG2 1 
ATOM   765  N N   . ALA A 1 102 ? 26.519 25.591 44.814  1.00 17.62 ? 103  ALA A N   1 
ATOM   766  C CA  . ALA A 1 102 ? 27.064 24.528 43.967  1.00 19.38 ? 103  ALA A CA  1 
ATOM   767  C C   . ALA A 1 102 ? 26.067 23.383 43.774  1.00 21.19 ? 103  ALA A C   1 
ATOM   768  O O   . ALA A 1 102 ? 25.950 22.823 42.676  1.00 23.17 ? 103  ALA A O   1 
ATOM   769  C CB  . ALA A 1 102 ? 28.390 23.985 44.554  1.00 18.14 ? 103  ALA A CB  1 
ATOM   770  N N   . ALA A 1 103 ? 25.336 23.025 44.823  1.00 19.75 ? 104  ALA A N   1 
ATOM   771  C CA  . ALA A 1 103 ? 24.362 21.944 44.703  1.00 17.08 ? 104  ALA A CA  1 
ATOM   772  C C   . ALA A 1 103 ? 23.212 22.308 43.767  1.00 20.73 ? 104  ALA A C   1 
ATOM   773  O O   . ALA A 1 103 ? 22.739 21.464 42.994  1.00 19.28 ? 104  ALA A O   1 
ATOM   774  C CB  . ALA A 1 103 ? 23.823 21.577 46.080  1.00 17.87 ? 104  ALA A CB  1 
ATOM   775  N N   . ALA A 1 104 ? 22.741 23.553 43.835  1.00 21.43 ? 105  ALA A N   1 
ATOM   776  C CA  . ALA A 1 104 ? 21.631 23.953 42.968  1.00 22.35 ? 105  ALA A CA  1 
ATOM   777  C C   . ALA A 1 104 ? 22.078 23.949 41.512  1.00 23.84 ? 105  ALA A C   1 
ATOM   778  O O   . ALA A 1 104 ? 21.365 23.431 40.646  1.00 25.97 ? 105  ALA A O   1 
ATOM   779  C CB  . ALA A 1 104 ? 21.091 25.360 43.369  1.00 21.11 ? 105  ALA A CB  1 
ATOM   780  N N   . GLY A 1 105 ? 23.262 24.507 41.257  1.00 21.74 ? 106  GLY A N   1 
ATOM   781  C CA  . GLY A 1 105 ? 23.801 24.560 39.908  1.00 21.15 ? 106  GLY A CA  1 
ATOM   782  C C   . GLY A 1 105 ? 24.027 23.208 39.260  1.00 23.51 ? 106  GLY A C   1 
ATOM   783  O O   . GLY A 1 105 ? 23.636 22.980 38.100  1.00 22.86 ? 106  GLY A O   1 
ATOM   784  N N   . VAL A 1 106 ? 24.674 22.297 39.980  1.00 20.50 ? 107  VAL A N   1 
ATOM   785  C CA  . VAL A 1 106 ? 24.917 20.972 39.428  1.00 21.88 ? 107  VAL A CA  1 
ATOM   786  C C   . VAL A 1 106 ? 23.613 20.170 39.263  1.00 23.92 ? 107  VAL A C   1 
ATOM   787  O O   . VAL A 1 106 ? 23.455 19.439 38.285  1.00 25.18 ? 107  VAL A O   1 
ATOM   788  C CB  . VAL A 1 106 ? 25.936 20.194 40.298  1.00 21.68 ? 107  VAL A CB  1 
ATOM   789  C CG1 . VAL A 1 106 ? 26.103 18.772 39.783  1.00 22.38 ? 107  VAL A CG1 1 
ATOM   790  C CG2 . VAL A 1 106 ? 27.283 20.902 40.233  1.00 21.53 ? 107  VAL A CG2 1 
ATOM   791  N N   . ALA A 1 107 ? 22.666 20.314 40.185  1.00 23.32 ? 108  ALA A N   1 
ATOM   792  C CA  . ALA A 1 107 ? 21.406 19.584 40.076  1.00 24.99 ? 108  ALA A CA  1 
ATOM   793  C C   . ALA A 1 107 ? 20.599 20.036 38.855  1.00 27.31 ? 108  ALA A C   1 
ATOM   794  O O   . ALA A 1 107 ? 19.953 19.221 38.183  1.00 27.76 ? 108  ALA A O   1 
ATOM   795  C CB  . ALA A 1 107 ? 20.581 19.774 41.340  1.00 25.06 ? 108  ALA A CB  1 
ATOM   796  N N   . LEU A 1 108 ? 20.622 21.333 38.577  1.00 26.72 ? 109  LEU A N   1 
ATOM   797  C CA  . LEU A 1 108 ? 19.883 21.852 37.429  1.00 28.39 ? 109  LEU A CA  1 
ATOM   798  C C   . LEU A 1 108 ? 20.500 21.350 36.117  1.00 29.20 ? 109  LEU A C   1 
ATOM   799  O O   . LEU A 1 108 ? 19.770 20.973 35.187  1.00 29.61 ? 109  LEU A O   1 
ATOM   800  C CB  . LEU A 1 108 ? 19.847 23.389 37.467  1.00 23.38 ? 109  LEU A CB  1 
ATOM   801  C CG  . LEU A 1 108 ? 18.825 23.943 38.472  1.00 23.22 ? 109  LEU A CG  1 
ATOM   802  C CD1 . LEU A 1 108 ? 19.094 25.414 38.790  1.00 23.41 ? 109  LEU A CD1 1 
ATOM   803  C CD2 . LEU A 1 108 ? 17.404 23.743 37.894  1.00 24.63 ? 109  LEU A CD2 1 
ATOM   804  N N   . VAL A 1 109 ? 21.829 21.323 36.048  1.00 27.01 ? 110  VAL A N   1 
ATOM   805  C CA  . VAL A 1 109 ? 22.518 20.874 34.830  1.00 28.07 ? 110  VAL A CA  1 
ATOM   806  C C   . VAL A 1 109 ? 22.313 19.389 34.607  1.00 30.31 ? 110  VAL A C   1 
ATOM   807  O O   . VAL A 1 109 ? 22.004 18.964 33.490  1.00 31.24 ? 110  VAL A O   1 
ATOM   808  C CB  . VAL A 1 109 ? 24.021 21.181 34.883  1.00 24.74 ? 110  VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 109 ? 24.747 20.502 33.736  1.00 25.53 ? 110  VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 109 ? 24.231 22.676 34.785  1.00 20.22 ? 110  VAL A CG2 1 
ATOM   811  N N   . VAL A 1 110 ? 22.461 18.598 35.663  1.00 30.51 ? 111  VAL A N   1 
ATOM   812  C CA  . VAL A 1 110 ? 22.270 17.153 35.542  1.00 32.07 ? 111  VAL A CA  1 
ATOM   813  C C   . VAL A 1 110 ? 20.820 16.829 35.134  1.00 33.70 ? 111  VAL A C   1 
ATOM   814  O O   . VAL A 1 110 ? 20.580 15.902 34.358  1.00 34.85 ? 111  VAL A O   1 
ATOM   815  C CB  . VAL A 1 110 ? 22.633 16.433 36.866  1.00 32.08 ? 111  VAL A CB  1 
ATOM   816  C CG1 . VAL A 1 110 ? 22.196 14.971 36.827  1.00 30.78 ? 111  VAL A CG1 1 
ATOM   817  C CG2 . VAL A 1 110 ? 24.144 16.510 37.090  1.00 32.33 ? 111  VAL A CG2 1 
ATOM   818  N N   . LYS A 1 111 ? 19.855 17.589 35.643  1.00 33.62 ? 112  LYS A N   1 
ATOM   819  C CA  . LYS A 1 111 ? 18.464 17.342 35.278  1.00 35.18 ? 112  LYS A CA  1 
ATOM   820  C C   . LYS A 1 111 ? 18.276 17.675 33.803  1.00 35.83 ? 112  LYS A C   1 
ATOM   821  O O   . LYS A 1 111 ? 17.743 16.868 33.040  1.00 35.38 ? 112  LYS A O   1 
ATOM   822  C CB  . LYS A 1 111 ? 17.501 18.196 36.118  1.00 35.01 ? 112  LYS A CB  1 
ATOM   823  C CG  . LYS A 1 111 ? 16.020 17.799 35.949  1.00 35.53 ? 112  LYS A CG  1 
ATOM   824  C CD  . LYS A 1 111 ? 15.058 18.794 36.596  1.00 35.66 ? 112  LYS A CD  1 
ATOM   825  C CE  . LYS A 1 111 ? 13.628 18.276 36.531  1.00 38.10 ? 112  LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 111 ? 12.634 19.354 36.801  1.00 40.23 ? 112  LYS A NZ  1 
ATOM   827  N N   . ALA A 1 112 ? 18.729 18.860 33.400  1.00 36.44 ? 113  ALA A N   1 
ATOM   828  C CA  . ALA A 1 112 ? 18.604 19.293 32.009  1.00 36.29 ? 113  ALA A CA  1 
ATOM   829  C C   . ALA A 1 112 ? 19.362 18.366 31.056  1.00 37.67 ? 113  ALA A C   1 
ATOM   830  O O   . ALA A 1 112 ? 19.049 18.283 29.866  1.00 38.26 ? 113  ALA A O   1 
ATOM   831  C CB  . ALA A 1 112 ? 19.116 20.721 31.863  1.00 34.04 ? 113  ALA A CB  1 
ATOM   832  N N   . ALA A 1 113 ? 20.365 17.672 31.579  1.00 38.06 ? 114  ALA A N   1 
ATOM   833  C CA  . ALA A 1 113 ? 21.163 16.758 30.773  1.00 38.45 ? 114  ALA A CA  1 
ATOM   834  C C   . ALA A 1 113 ? 20.445 15.427 30.537  1.00 38.14 ? 114  ALA A C   1 
ATOM   835  O O   . ALA A 1 113 ? 20.931 14.576 29.789  1.00 38.00 ? 114  ALA A O   1 
ATOM   836  C CB  . ALA A 1 113 ? 22.515 16.515 31.444  1.00 39.16 ? 114  ALA A CB  1 
ATOM   837  N N   . GLY A 1 114 ? 19.292 15.252 31.175  1.00 37.66 ? 115  GLY A N   1 
ATOM   838  C CA  . GLY A 1 114 ? 18.549 14.020 31.005  1.00 39.41 ? 115  GLY A CA  1 
ATOM   839  C C   . GLY A 1 114 ? 18.551 13.149 32.242  1.00 41.14 ? 115  GLY A C   1 
ATOM   840  O O   . GLY A 1 114 ? 17.792 12.183 32.327  1.00 41.15 ? 115  GLY A O   1 
ATOM   841  N N   . GLY A 1 115 ? 19.404 13.482 33.208  1.00 40.96 ? 116  GLY A N   1 
ATOM   842  C CA  . GLY A 1 115 ? 19.454 12.699 34.431  1.00 39.57 ? 116  GLY A CA  1 
ATOM   843  C C   . GLY A 1 115 ? 20.803 12.065 34.722  1.00 39.21 ? 116  GLY A C   1 
ATOM   844  O O   . GLY A 1 115 ? 21.020 11.562 35.824  1.00 39.00 ? 116  GLY A O   1 
ATOM   845  N N   . SER A 1 116 ? 21.704 12.076 33.743  1.00 38.41 ? 117  SER A N   1 
ATOM   846  C CA  . SER A 1 116 ? 23.038 11.510 33.930  1.00 38.69 ? 117  SER A CA  1 
ATOM   847  C C   . SER A 1 116 ? 24.077 12.270 33.129  1.00 39.72 ? 117  SER A C   1 
ATOM   848  O O   . SER A 1 116 ? 23.776 12.823 32.070  1.00 39.56 ? 117  SER A O   1 
ATOM   849  C CB  . SER A 1 116 ? 23.086 10.042 33.507  1.00 38.60 ? 117  SER A CB  1 
ATOM   850  O OG  . SER A 1 116 ? 24.440 9.622  33.378  1.00 39.63 ? 117  SER A OG  1 
ATOM   851  N N   . VAL A 1 117 ? 25.303 12.288 33.643  1.00 39.24 ? 118  VAL A N   1 
ATOM   852  C CA  . VAL A 1 117 ? 26.402 12.974 32.986  1.00 39.11 ? 118  VAL A CA  1 
ATOM   853  C C   . VAL A 1 117 ? 27.623 12.069 33.036  1.00 39.26 ? 118  VAL A C   1 
ATOM   854  O O   . VAL A 1 117 ? 28.737 12.487 32.716  1.00 40.20 ? 118  VAL A O   1 
ATOM   855  C CB  . VAL A 1 117 ? 26.725 14.323 33.688  1.00 38.55 ? 118  VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 117 ? 25.492 15.228 33.687  1.00 35.80 ? 118  VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 117 ? 27.190 14.068 35.117  1.00 35.60 ? 118  VAL A CG2 1 
ATOM   858  N N   . LYS A 1 118 ? 27.407 10.818 33.422  1.00 41.73 ? 119  LYS A N   1 
ATOM   859  C CA  . LYS A 1 118 ? 28.506 9.860  33.522  1.00 43.59 ? 119  LYS A CA  1 
ATOM   860  C C   . LYS A 1 118 ? 29.289 9.701  32.223  1.00 45.72 ? 119  LYS A C   1 
ATOM   861  O O   . LYS A 1 118 ? 28.721 9.723  31.130  1.00 46.86 ? 119  LYS A O   1 
ATOM   862  C CB  . LYS A 1 118 ? 27.982 8.493  33.966  1.00 46.42 ? 119  LYS A CB  1 
ATOM   863  C CG  . LYS A 1 118 ? 29.085 7.446  34.145  1.00 49.14 ? 119  LYS A CG  1 
ATOM   864  C CD  . LYS A 1 118 ? 28.568 6.186  34.823  1.00 51.97 ? 119  LYS A CD  1 
ATOM   865  C CE  . LYS A 1 118 ? 29.730 5.314  35.313  1.00 54.82 ? 119  LYS A CE  1 
ATOM   866  N NZ  . LYS A 1 118 ? 29.302 4.256  36.296  1.00 56.19 ? 119  LYS A NZ  1 
ATOM   867  N N   . GLY A 1 119 ? 30.601 9.549  32.348  1.00 45.49 ? 120  GLY A N   1 
ATOM   868  C CA  . GLY A 1 119 ? 31.440 9.383  31.180  1.00 45.53 ? 120  GLY A CA  1 
ATOM   869  C C   . GLY A 1 119 ? 31.626 10.629 30.338  1.00 45.96 ? 120  GLY A C   1 
ATOM   870  O O   . GLY A 1 119 ? 32.514 10.662 29.483  1.00 47.30 ? 120  GLY A O   1 
ATOM   871  N N   . LYS A 1 120 ? 30.804 11.652 30.557  1.00 44.80 ? 121  LYS A N   1 
ATOM   872  C CA  . LYS A 1 120 ? 30.927 12.885 29.783  1.00 43.35 ? 121  LYS A CA  1 
ATOM   873  C C   . LYS A 1 120 ? 32.005 13.776 30.389  1.00 42.60 ? 121  LYS A C   1 
ATOM   874  O O   . LYS A 1 120 ? 32.329 13.661 31.572  1.00 41.08 ? 121  LYS A O   1 
ATOM   875  C CB  . LYS A 1 120 ? 29.594 13.637 29.753  1.00 46.27 ? 121  LYS A CB  1 
ATOM   876  C CG  . LYS A 1 120 ? 28.414 12.830 29.205  1.00 48.12 ? 121  LYS A CG  1 
ATOM   877  C CD  . LYS A 1 120 ? 28.425 12.773 27.693  1.00 50.25 ? 121  LYS A CD  1 
ATOM   878  C CE  . LYS A 1 120 ? 27.219 12.006 27.147  1.00 52.47 ? 121  LYS A CE  1 
ATOM   879  N NZ  . LYS A 1 120 ? 25.913 12.692 27.376  1.00 53.66 ? 121  LYS A NZ  1 
ATOM   880  N N   . LYS A 1 121 ? 32.556 14.661 29.566  1.00 39.83 ? 122  LYS A N   1 
ATOM   881  C CA  . LYS A 1 121 ? 33.609 15.580 29.976  1.00 39.11 ? 122  LYS A CA  1 
ATOM   882  C C   . LYS A 1 121 ? 32.994 16.879 30.491  1.00 37.39 ? 122  LYS A C   1 
ATOM   883  O O   . LYS A 1 121 ? 32.100 17.430 29.859  1.00 35.56 ? 122  LYS A O   1 
ATOM   884  C CB  . LYS A 1 121 ? 34.516 15.859 28.772  1.00 42.27 ? 122  LYS A CB  1 
ATOM   885  C CG  . LYS A 1 121 ? 35.816 16.612 29.056  1.00 48.08 ? 122  LYS A CG  1 
ATOM   886  C CD  . LYS A 1 121 ? 36.760 16.505 27.842  1.00 50.59 ? 122  LYS A CD  1 
ATOM   887  C CE  . LYS A 1 121 ? 38.067 17.296 28.011  1.00 52.75 ? 122  LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 121 ? 37.975 18.713 27.535  1.00 51.93 ? 122  LYS A NZ  1 
ATOM   889  N N   . ALA A 1 122 ? 33.469 17.351 31.644  1.00 33.79 ? 123  ALA A N   1 
ATOM   890  C CA  . ALA A 1 122 ? 32.973 18.584 32.238  1.00 34.00 ? 123  ALA A CA  1 
ATOM   891  C C   . ALA A 1 122 ? 34.132 19.499 32.583  1.00 33.91 ? 123  ALA A C   1 
ATOM   892  O O   . ALA A 1 122 ? 35.160 19.060 33.091  1.00 36.86 ? 123  ALA A O   1 
ATOM   893  C CB  . ALA A 1 122 ? 32.161 18.279 33.473  1.00 34.30 ? 123  ALA A CB  1 
ATOM   894  N N   . VAL A 1 123 ? 33.971 20.777 32.292  1.00 31.94 ? 124  VAL A N   1 
ATOM   895  C CA  . VAL A 1 123 ? 35.016 21.744 32.544  1.00 32.55 ? 124  VAL A CA  1 
ATOM   896  C C   . VAL A 1 123 ? 34.558 22.876 33.449  1.00 31.39 ? 124  VAL A C   1 
ATOM   897  O O   . VAL A 1 123 ? 33.585 23.574 33.163  1.00 31.57 ? 124  VAL A O   1 
ATOM   898  C CB  . VAL A 1 123 ? 35.519 22.361 31.226  1.00 33.23 ? 124  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 123 ? 36.576 23.405 31.502  1.00 33.08 ? 124  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 123 ? 36.076 21.258 30.319  1.00 35.74 ? 124  VAL A CG2 1 
ATOM   901  N N   . VAL A 1 124 ? 35.263 23.052 34.554  1.00 30.73 ? 125  VAL A N   1 
ATOM   902  C CA  . VAL A 1 124 ? 34.930 24.127 35.465  1.00 28.50 ? 125  VAL A CA  1 
ATOM   903  C C   . VAL A 1 124 ? 36.010 25.175 35.346  1.00 29.25 ? 125  VAL A C   1 
ATOM   904  O O   . VAL A 1 124 ? 37.153 24.937 35.738  1.00 29.46 ? 125  VAL A O   1 
ATOM   905  C CB  . VAL A 1 124 ? 34.869 23.645 36.917  1.00 28.80 ? 125  VAL A CB  1 
ATOM   906  C CG1 . VAL A 1 124 ? 34.565 24.835 37.832  1.00 26.55 ? 125  VAL A CG1 1 
ATOM   907  C CG2 . VAL A 1 124 ? 33.839 22.553 37.053  1.00 25.00 ? 125  VAL A CG2 1 
ATOM   908  N N   . LEU A 1 125 ? 35.645 26.332 34.807  1.00 27.16 ? 126  LEU A N   1 
ATOM   909  C CA  . LEU A 1 125 ? 36.590 27.424 34.626  1.00 30.67 ? 126  LEU A CA  1 
ATOM   910  C C   . LEU A 1 125 ? 36.644 28.222 35.915  1.00 30.84 ? 126  LEU A C   1 
ATOM   911  O O   . LEU A 1 125 ? 35.617 28.418 36.573  1.00 31.28 ? 126  LEU A O   1 
ATOM   912  C CB  . LEU A 1 125 ? 36.170 28.311 33.438  1.00 30.15 ? 126  LEU A CB  1 
ATOM   913  C CG  . LEU A 1 125 ? 36.119 27.606 32.061  1.00 32.81 ? 126  LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 125 ? 35.700 28.596 30.957  1.00 33.51 ? 126  LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 125 ? 37.488 27.012 31.731  1.00 32.45 ? 126  LEU A CD2 1 
ATOM   916  N N   . ALA A 1 126 ? 37.848 28.669 36.270  1.00 30.45 ? 127  ALA A N   1 
ATOM   917  C CA  . ALA A 1 126 ? 38.068 29.419 37.498  1.00 29.23 ? 127  ALA A CA  1 
ATOM   918  C C   . ALA A 1 126 ? 37.479 28.569 38.615  1.00 29.51 ? 127  ALA A C   1 
ATOM   919  O O   . ALA A 1 126 ? 36.818 29.081 39.523  1.00 28.73 ? 127  ALA A O   1 
ATOM   920  C CB  . ALA A 1 126 ? 37.372 30.770 37.427  1.00 27.83 ? 127  ALA A CB  1 
ATOM   921  N N   . GLY A 1 127 ? 37.749 27.264 38.548  1.00 28.18 ? 128  GLY A N   1 
ATOM   922  C CA  . GLY A 1 127 ? 37.198 26.338 39.524  1.00 27.00 ? 128  GLY A CA  1 
ATOM   923  C C   . GLY A 1 127 ? 37.949 26.181 40.839  1.00 23.90 ? 128  GLY A C   1 
ATOM   924  O O   . GLY A 1 127 ? 37.680 25.234 41.571  1.00 22.91 ? 128  GLY A O   1 
ATOM   925  N N   . THR A 1 128 ? 38.850 27.114 41.138  1.00 24.97 ? 129  THR A N   1 
ATOM   926  C CA  . THR A 1 128 ? 39.669 27.068 42.356  1.00 24.42 ? 129  THR A CA  1 
ATOM   927  C C   . THR A 1 128 ? 39.037 27.665 43.612  1.00 25.04 ? 129  THR A C   1 
ATOM   928  O O   . THR A 1 128 ? 39.609 27.559 44.703  1.00 26.50 ? 129  THR A O   1 
ATOM   929  C CB  . THR A 1 128 ? 41.032 27.767 42.135  1.00 22.54 ? 129  THR A CB  1 
ATOM   930  O OG1 . THR A 1 128 ? 40.827 29.086 41.605  1.00 26.24 ? 129  THR A OG1 1 
ATOM   931  C CG2 . THR A 1 128 ? 41.885 26.963 41.193  1.00 24.53 ? 129  THR A CG2 1 
ATOM   932  N N   . GLY A 1 129 ? 37.887 28.314 43.461  1.00 25.12 ? 130  GLY A N   1 
ATOM   933  C CA  . GLY A 1 129 ? 37.190 28.883 44.612  1.00 23.77 ? 130  GLY A CA  1 
ATOM   934  C C   . GLY A 1 129 ? 36.264 27.829 45.219  1.00 22.24 ? 130  GLY A C   1 
ATOM   935  O O   . GLY A 1 129 ? 36.108 26.751 44.651  1.00 20.89 ? 130  GLY A O   1 
ATOM   936  N N   . PRO A 1 130 ? 35.617 28.113 46.366  1.00 22.36 ? 131  PRO A N   1 
ATOM   937  C CA  . PRO A 1 130 ? 34.719 27.154 47.006  1.00 19.37 ? 131  PRO A CA  1 
ATOM   938  C C   . PRO A 1 130 ? 33.543 26.653 46.140  1.00 17.56 ? 131  PRO A C   1 
ATOM   939  O O   . PRO A 1 130 ? 33.199 25.488 46.187  1.00 18.92 ? 131  PRO A O   1 
ATOM   940  C CB  . PRO A 1 130 ? 34.252 27.902 48.278  1.00 21.56 ? 131  PRO A CB  1 
ATOM   941  C CG  . PRO A 1 130 ? 34.386 29.325 47.929  1.00 19.30 ? 131  PRO A CG  1 
ATOM   942  C CD  . PRO A 1 130 ? 35.658 29.386 47.109  1.00 20.70 ? 131  PRO A CD  1 
ATOM   943  N N   . VAL A 1 131 ? 32.914 27.526 45.368  1.00 18.78 ? 132  VAL A N   1 
ATOM   944  C CA  . VAL A 1 131 ? 31.799 27.078 44.532  1.00 18.49 ? 132  VAL A CA  1 
ATOM   945  C C   . VAL A 1 131 ? 32.293 26.173 43.399  1.00 17.56 ? 132  VAL A C   1 
ATOM   946  O O   . VAL A 1 131 ? 31.684 25.149 43.094  1.00 19.63 ? 132  VAL A O   1 
ATOM   947  C CB  . VAL A 1 131 ? 31.025 28.292 43.955  1.00 19.48 ? 132  VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 131 ? 29.991 27.821 42.949  1.00 23.11 ? 132  VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 131 ? 30.313 29.016 45.091  1.00 19.61 ? 132  VAL A CG2 1 
ATOM   950  N N   . GLY A 1 132 ? 33.416 26.538 42.806  1.00 20.08 ? 133  GLY A N   1 
ATOM   951  C CA  . GLY A 1 132 ? 33.970 25.720 41.734  1.00 20.17 ? 133  GLY A CA  1 
ATOM   952  C C   . GLY A 1 132 ? 34.429 24.361 42.244  1.00 20.88 ? 133  GLY A C   1 
ATOM   953  O O   . GLY A 1 132 ? 34.192 23.335 41.602  1.00 21.50 ? 133  GLY A O   1 
ATOM   954  N N   . MET A 1 133 ? 35.093 24.342 43.403  1.00 20.30 ? 134  MET A N   1 
ATOM   955  C CA  . MET A 1 133 ? 35.568 23.075 43.980  1.00 19.36 ? 134  MET A CA  1 
ATOM   956  C C   . MET A 1 133 ? 34.402 22.170 44.372  1.00 19.37 ? 134  MET A C   1 
ATOM   957  O O   . MET A 1 133 ? 34.402 20.971 44.072  1.00 20.19 ? 134  MET A O   1 
ATOM   958  C CB  . MET A 1 133 ? 36.486 23.351 45.192  1.00 20.38 ? 134  MET A CB  1 
ATOM   959  C CG  . MET A 1 133 ? 37.752 24.151 44.828  1.00 22.99 ? 134  MET A CG  1 
ATOM   960  S SD  . MET A 1 133 ? 38.830 24.563 46.254  1.00 25.47 ? 134  MET A SD  1 
ATOM   961  C CE  . MET A 1 133 ? 38.913 22.948 47.025  1.00 23.30 ? 134  MET A CE  1 
ATOM   962  N N   . ARG A 1 134 ? 33.396 22.722 45.052  1.00 22.07 ? 135  ARG A N   1 
ATOM   963  C CA  . ARG A 1 134 ? 32.236 21.908 45.399  1.00 18.57 ? 135  ARG A CA  1 
ATOM   964  C C   . ARG A 1 134 ? 31.531 21.471 44.087  1.00 18.65 ? 135  ARG A C   1 
ATOM   965  O O   . ARG A 1 134 ? 30.975 20.377 44.020  1.00 20.25 ? 135  ARG A O   1 
ATOM   966  C CB  . ARG A 1 134 ? 31.236 22.687 46.282  1.00 21.56 ? 135  ARG A CB  1 
ATOM   967  C CG  . ARG A 1 134 ? 31.620 22.833 47.796  1.00 20.65 ? 135  ARG A CG  1 
ATOM   968  C CD  . ARG A 1 134 ? 31.989 21.486 48.441  1.00 23.80 ? 135  ARG A CD  1 
ATOM   969  N NE  . ARG A 1 134 ? 31.789 21.430 49.900  1.00 21.91 ? 135  ARG A NE  1 
ATOM   970  C CZ  . ARG A 1 134 ? 32.773 21.476 50.806  1.00 23.16 ? 135  ARG A CZ  1 
ATOM   971  N NH1 . ARG A 1 134 ? 34.047 21.596 50.435  1.00 26.28 ? 135  ARG A NH1 1 
ATOM   972  N NH2 . ARG A 1 134 ? 32.492 21.341 52.094  1.00 21.23 ? 135  ARG A NH2 1 
ATOM   973  N N   . SER A 1 135 ? 31.522 22.324 43.061  1.00 20.09 ? 136  SER A N   1 
ATOM   974  C CA  . SER A 1 135 ? 30.868 21.926 41.795  1.00 21.72 ? 136  SER A CA  1 
ATOM   975  C C   . SER A 1 135 ? 31.644 20.749 41.165  1.00 22.47 ? 136  SER A C   1 
ATOM   976  O O   . SER A 1 135 ? 31.044 19.753 40.736  1.00 24.07 ? 136  SER A O   1 
ATOM   977  C CB  . SER A 1 135 ? 30.822 23.094 40.823  1.00 20.25 ? 136  SER A CB  1 
ATOM   978  O OG  . SER A 1 135 ? 29.886 24.074 41.253  1.00 20.52 ? 136  SER A OG  1 
ATOM   979  N N   . ALA A 1 136 ? 32.968 20.868 41.130  1.00 22.60 ? 137  ALA A N   1 
ATOM   980  C CA  . ALA A 1 136 ? 33.821 19.803 40.582  1.00 25.09 ? 137  ALA A CA  1 
ATOM   981  C C   . ALA A 1 136 ? 33.570 18.500 41.320  1.00 25.97 ? 137  ALA A C   1 
ATOM   982  O O   . ALA A 1 136 ? 33.483 17.432 40.708  1.00 27.38 ? 137  ALA A O   1 
ATOM   983  C CB  . ALA A 1 136 ? 35.296 20.195 40.703  1.00 24.44 ? 137  ALA A CB  1 
ATOM   984  N N   . ALA A 1 137 ? 33.451 18.593 42.649  1.00 26.13 ? 138  ALA A N   1 
ATOM   985  C CA  . ALA A 1 137 ? 33.213 17.431 43.497  1.00 25.23 ? 138  ALA A CA  1 
ATOM   986  C C   . ALA A 1 137 ? 31.900 16.717 43.202  1.00 26.36 ? 138  ALA A C   1 
ATOM   987  O O   . ALA A 1 137 ? 31.872 15.489 43.112  1.00 25.72 ? 138  ALA A O   1 
ATOM   988  C CB  . ALA A 1 137 ? 33.232 17.840 44.977  1.00 24.35 ? 138  ALA A CB  1 
ATOM   989  N N   . LEU A 1 138 ? 30.818 17.480 43.054  1.00 24.21 ? 139  LEU A N   1 
ATOM   990  C CA  . LEU A 1 138 ? 29.511 16.879 42.805  1.00 26.82 ? 139  LEU A CA  1 
ATOM   991  C C   . LEU A 1 138 ? 29.422 16.296 41.387  1.00 27.67 ? 139  LEU A C   1 
ATOM   992  O O   . LEU A 1 138 ? 28.792 15.255 41.178  1.00 30.52 ? 139  LEU A O   1 
ATOM   993  C CB  . LEU A 1 138 ? 28.396 17.909 43.046  1.00 26.80 ? 139  LEU A CB  1 
ATOM   994  C CG  . LEU A 1 138 ? 28.314 18.476 44.478  1.00 25.69 ? 139  LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 138 ? 27.230 19.539 44.526  1.00 24.38 ? 139  LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 138 ? 28.026 17.352 45.495  1.00 23.05 ? 139  LEU A CD2 1 
ATOM   997  N N   . LEU A 1 139 ? 30.044 16.963 40.421  1.00 27.43 ? 140  LEU A N   1 
ATOM   998  C CA  . LEU A 1 139 ? 30.064 16.449 39.045  1.00 27.44 ? 140  LEU A CA  1 
ATOM   999  C C   . LEU A 1 139 ? 30.855 15.127 39.032  1.00 29.51 ? 140  LEU A C   1 
ATOM   1000 O O   . LEU A 1 139 ? 30.399 14.124 38.470  1.00 29.33 ? 140  LEU A O   1 
ATOM   1001 C CB  . LEU A 1 139 ? 30.732 17.461 38.129  1.00 26.47 ? 140  LEU A CB  1 
ATOM   1002 C CG  . LEU A 1 139 ? 29.859 18.675 37.831  1.00 26.43 ? 140  LEU A CG  1 
ATOM   1003 C CD1 . LEU A 1 139 ? 30.719 19.771 37.205  1.00 26.20 ? 140  LEU A CD1 1 
ATOM   1004 C CD2 . LEU A 1 139 ? 28.682 18.246 36.914  1.00 26.41 ? 140  LEU A CD2 1 
ATOM   1005 N N   . ALA A 1 140 ? 32.027 15.126 39.676  1.00 27.37 ? 141  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 140 ? 32.866 13.926 39.730  1.00 29.32 ? 141  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 140 ? 32.105 12.788 40.394  1.00 30.77 ? 141  ALA A C   1 
ATOM   1008 O O   . ALA A 1 140 ? 32.204 11.626 39.988  1.00 33.34 ? 141  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 140 ? 34.153 14.210 40.490  1.00 28.15 ? 141  ALA A CB  1 
ATOM   1010 N N   . GLY A 1 141 ? 31.342 13.121 41.425  1.00 32.02 ? 142  GLY A N   1 
ATOM   1011 C CA  . GLY A 1 141 ? 30.558 12.114 42.111  1.00 32.71 ? 142  GLY A CA  1 
ATOM   1012 C C   . GLY A 1 141 ? 29.490 11.558 41.189  1.00 34.52 ? 142  GLY A C   1 
ATOM   1013 O O   . GLY A 1 141 ? 28.997 10.444 41.392  1.00 34.20 ? 142  GLY A O   1 
ATOM   1014 N N   . GLU A 1 142 ? 29.112 12.330 40.176  1.00 35.36 ? 143  GLU A N   1 
ATOM   1015 C CA  . GLU A 1 142 ? 28.101 11.864 39.229  1.00 37.18 ? 143  GLU A CA  1 
ATOM   1016 C C   . GLU A 1 142 ? 28.725 11.045 38.083  1.00 38.00 ? 143  GLU A C   1 
ATOM   1017 O O   . GLU A 1 142 ? 28.013 10.564 37.203  1.00 39.67 ? 143  GLU A O   1 
ATOM   1018 C CB  . GLU A 1 142 ? 27.308 13.056 38.670  1.00 35.38 ? 143  GLU A CB  1 
ATOM   1019 C CG  . GLU A 1 142 ? 26.278 13.648 39.653  1.00 34.87 ? 143  GLU A CG  1 
ATOM   1020 C CD  . GLU A 1 142 ? 24.923 12.950 39.599  1.00 34.84 ? 143  GLU A CD  1 
ATOM   1021 O OE1 . GLU A 1 142 ? 24.821 11.901 38.930  1.00 33.97 ? 143  GLU A OE1 1 
ATOM   1022 O OE2 . GLU A 1 142 ? 23.955 13.450 40.222  1.00 31.70 ? 143  GLU A OE2 1 
ATOM   1023 N N   . GLY A 1 143 ? 30.053 10.907 38.089  1.00 39.39 ? 144  GLY A N   1 
ATOM   1024 C CA  . GLY A 1 143 ? 30.734 10.130 37.059  1.00 39.18 ? 144  GLY A CA  1 
ATOM   1025 C C   . GLY A 1 143 ? 31.391 10.900 35.924  1.00 39.30 ? 144  GLY A C   1 
ATOM   1026 O O   . GLY A 1 143 ? 32.106 10.324 35.099  1.00 39.98 ? 144  GLY A O   1 
ATOM   1027 N N   . ALA A 1 144 ? 31.161 12.203 35.860  1.00 38.34 ? 145  ALA A N   1 
ATOM   1028 C CA  . ALA A 1 144 ? 31.755 13.002 34.795  1.00 38.89 ? 145  ALA A CA  1 
ATOM   1029 C C   . ALA A 1 144 ? 33.265 13.129 34.920  1.00 39.82 ? 145  ALA A C   1 
ATOM   1030 O O   . ALA A 1 144 ? 33.823 13.071 36.018  1.00 39.13 ? 145  ALA A O   1 
ATOM   1031 C CB  . ALA A 1 144 ? 31.134 14.385 34.773  1.00 36.63 ? 145  ALA A CB  1 
ATOM   1032 N N   . GLU A 1 145 ? 33.925 13.291 33.780  1.00 39.55 ? 146  GLU A N   1 
ATOM   1033 C CA  . GLU A 1 145 ? 35.365 13.484 33.751  1.00 42.23 ? 146  GLU A CA  1 
ATOM   1034 C C   . GLU A 1 145 ? 35.499 14.985 33.955  1.00 40.09 ? 146  GLU A C   1 
ATOM   1035 O O   . GLU A 1 145 ? 35.117 15.765 33.093  1.00 39.98 ? 146  GLU A O   1 
ATOM   1036 C CB  . GLU A 1 145 ? 35.941 13.097 32.388  1.00 44.42 ? 146  GLU A CB  1 
ATOM   1037 C CG  . GLU A 1 145 ? 35.940 11.613 32.093  1.00 49.77 ? 146  GLU A CG  1 
ATOM   1038 C CD  . GLU A 1 145 ? 36.517 11.320 30.714  1.00 52.72 ? 146  GLU A CD  1 
ATOM   1039 O OE1 . GLU A 1 145 ? 37.537 11.956 30.351  1.00 52.60 ? 146  GLU A OE1 1 
ATOM   1040 O OE2 . GLU A 1 145 ? 35.955 10.459 30.000  1.00 55.72 ? 146  GLU A OE2 1 
ATOM   1041 N N   . VAL A 1 146 ? 36.031 15.389 35.099  1.00 37.30 ? 147  VAL A N   1 
ATOM   1042 C CA  . VAL A 1 146 ? 36.145 16.801 35.399  1.00 34.07 ? 147  VAL A CA  1 
ATOM   1043 C C   . VAL A 1 146 ? 37.551 17.351 35.303  1.00 33.69 ? 147  VAL A C   1 
ATOM   1044 O O   . VAL A 1 146 ? 38.509 16.721 35.760  1.00 35.38 ? 147  VAL A O   1 
ATOM   1045 C CB  . VAL A 1 146 ? 35.608 17.081 36.819  1.00 33.09 ? 147  VAL A CB  1 
ATOM   1046 C CG1 . VAL A 1 146 ? 35.435 18.567 37.038  1.00 31.81 ? 147  VAL A CG1 1 
ATOM   1047 C CG2 . VAL A 1 146 ? 34.309 16.344 37.023  1.00 29.90 ? 147  VAL A CG2 1 
ATOM   1048 N N   . VAL A 1 147 ? 37.663 18.530 34.703  1.00 32.29 ? 148  VAL A N   1 
ATOM   1049 C CA  . VAL A 1 147 ? 38.933 19.222 34.563  1.00 33.27 ? 148  VAL A CA  1 
ATOM   1050 C C   . VAL A 1 147 ? 38.721 20.565 35.250  1.00 33.83 ? 148  VAL A C   1 
ATOM   1051 O O   . VAL A 1 147 ? 37.897 21.370 34.796  1.00 32.75 ? 148  VAL A O   1 
ATOM   1052 C CB  . VAL A 1 147 ? 39.294 19.492 33.072  1.00 34.26 ? 148  VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 147 ? 40.576 20.308 32.983  1.00 31.43 ? 148  VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 147 ? 39.444 18.180 32.318  1.00 35.38 ? 148  VAL A CG2 1 
ATOM   1055 N N   . LEU A 1 148 ? 39.449 20.798 36.345  1.00 32.14 ? 149  LEU A N   1 
ATOM   1056 C CA  . LEU A 1 148 ? 39.348 22.043 37.104  1.00 30.59 ? 149  LEU A CA  1 
ATOM   1057 C C   . LEU A 1 148 ? 40.467 22.973 36.639  1.00 31.75 ? 149  LEU A C   1 
ATOM   1058 O O   . LEU A 1 148 ? 41.658 22.650 36.771  1.00 31.53 ? 149  LEU A O   1 
ATOM   1059 C CB  . LEU A 1 148 ? 39.465 21.742 38.615  1.00 29.66 ? 149  LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 148 ? 39.043 22.785 39.664  1.00 28.09 ? 149  LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 148 ? 38.851 22.067 41.010  1.00 25.97 ? 149  LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 148 ? 40.074 23.906 39.780  1.00 24.97 ? 149  LEU A CD2 1 
ATOM   1063 N N   . CYS A 1 149 ? 40.070 24.120 36.090  1.00 32.17 ? 150  CYS A N   1 
ATOM   1064 C CA  . CYS A 1 149 ? 40.998 25.113 35.551  1.00 32.19 ? 150  CYS A CA  1 
ATOM   1065 C C   . CYS A 1 149 ? 41.184 26.365 36.369  1.00 31.16 ? 150  CYS A C   1 
ATOM   1066 O O   . CYS A 1 149 ? 40.306 26.781 37.129  1.00 28.82 ? 150  CYS A O   1 
ATOM   1067 C CB  . CYS A 1 149 ? 40.545 25.561 34.155  1.00 33.96 ? 150  CYS A CB  1 
ATOM   1068 S SG  . CYS A 1 149 ? 40.137 24.205 33.108  1.00 35.15 ? 150  CYS A SG  1 
ATOM   1069 N N   . GLY A 1 150 ? 42.335 26.986 36.154  1.00 31.03 ? 151  GLY A N   1 
ATOM   1070 C CA  . GLY A 1 150 ? 42.674 28.221 36.824  1.00 32.75 ? 151  GLY A CA  1 
ATOM   1071 C C   . GLY A 1 150 ? 43.856 28.817 36.092  1.00 36.49 ? 151  GLY A C   1 
ATOM   1072 O O   . GLY A 1 150 ? 44.516 28.123 35.296  1.00 37.15 ? 151  GLY A O   1 
ATOM   1073 N N   . ARG A 1 151 ? 44.133 30.087 36.348  1.00 36.37 ? 152  ARG A N   1 
ATOM   1074 C CA  . ARG A 1 151 ? 45.246 30.759 35.699  1.00 38.92 ? 152  ARG A CA  1 
ATOM   1075 C C   . ARG A 1 151 ? 46.611 30.098 35.961  1.00 40.58 ? 152  ARG A C   1 
ATOM   1076 O O   . ARG A 1 151 ? 47.457 30.051 35.065  1.00 40.81 ? 152  ARG A O   1 
ATOM   1077 C CB  . ARG A 1 151 ? 45.277 32.224 36.134  1.00 36.95 ? 152  ARG A CB  1 
ATOM   1078 C CG  . ARG A 1 151 ? 44.122 33.039 35.567  1.00 39.46 ? 152  ARG A CG  1 
ATOM   1079 C CD  . ARG A 1 151 ? 44.002 34.379 36.256  1.00 37.09 ? 152  ARG A CD  1 
ATOM   1080 N NE  . ARG A 1 151 ? 43.695 34.210 37.673  1.00 37.30 ? 152  ARG A NE  1 
ATOM   1081 C CZ  . ARG A 1 151 ? 43.549 35.209 38.536  1.00 34.93 ? 152  ARG A CZ  1 
ATOM   1082 N NH1 . ARG A 1 151 ? 43.682 36.460 38.127  1.00 34.18 ? 152  ARG A NH1 1 
ATOM   1083 N NH2 . ARG A 1 151 ? 43.261 34.955 39.812  1.00 34.22 ? 152  ARG A NH2 1 
ATOM   1084 N N   . LYS A 1 152 ? 46.825 29.587 37.174  1.00 40.37 ? 153  LYS A N   1 
ATOM   1085 C CA  . LYS A 1 152 ? 48.096 28.950 37.512  1.00 39.72 ? 153  LYS A CA  1 
ATOM   1086 C C   . LYS A 1 152 ? 47.930 27.489 37.862  1.00 38.55 ? 153  LYS A C   1 
ATOM   1087 O O   . LYS A 1 152 ? 47.132 27.138 38.726  1.00 40.02 ? 153  LYS A O   1 
ATOM   1088 C CB  . LYS A 1 152 ? 48.763 29.671 38.679  1.00 41.24 ? 153  LYS A CB  1 
ATOM   1089 C CG  . LYS A 1 152 ? 49.718 30.770 38.267  1.00 46.44 ? 153  LYS A CG  1 
ATOM   1090 C CD  . LYS A 1 152 ? 50.578 31.198 39.448  1.00 50.17 ? 153  LYS A CD  1 
ATOM   1091 C CE  . LYS A 1 152 ? 51.633 32.210 39.038  1.00 50.75 ? 153  LYS A CE  1 
ATOM   1092 N NZ  . LYS A 1 152 ? 52.278 32.814 40.236  1.00 54.64 ? 153  LYS A NZ  1 
ATOM   1093 N N   . LEU A 1 153 ? 48.704 26.634 37.205  1.00 38.35 ? 154  LEU A N   1 
ATOM   1094 C CA  . LEU A 1 153 ? 48.622 25.198 37.445  1.00 37.29 ? 154  LEU A CA  1 
ATOM   1095 C C   . LEU A 1 153 ? 48.770 24.737 38.907  1.00 36.52 ? 154  LEU A C   1 
ATOM   1096 O O   . LEU A 1 153 ? 48.078 23.810 39.336  1.00 36.21 ? 154  LEU A O   1 
ATOM   1097 C CB  . LEU A 1 153 ? 49.656 24.463 36.581  1.00 38.71 ? 154  LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 153 ? 49.593 22.938 36.708  1.00 39.71 ? 154  LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 153 ? 48.215 22.461 36.282  1.00 41.34 ? 154  LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 153 ? 50.668 22.282 35.851  1.00 41.87 ? 154  LEU A CD2 1 
ATOM   1101 N N   . ASP A 1 154 ? 49.669 25.350 39.674  1.00 36.76 ? 155  ASP A N   1 
ATOM   1102 C CA  . ASP A 1 154 ? 49.844 24.902 41.059  1.00 38.02 ? 155  ASP A CA  1 
ATOM   1103 C C   . ASP A 1 154 ? 48.583 25.066 41.903  1.00 36.14 ? 155  ASP A C   1 
ATOM   1104 O O   . ASP A 1 154 ? 48.198 24.150 42.626  1.00 35.90 ? 155  ASP A O   1 
ATOM   1105 C CB  . ASP A 1 154 ? 51.024 25.606 41.749  1.00 39.25 ? 155  ASP A CB  1 
ATOM   1106 C CG  . ASP A 1 154 ? 51.056 27.096 41.495  1.00 42.97 ? 155  ASP A CG  1 
ATOM   1107 O OD1 . ASP A 1 154 ? 50.002 27.675 41.155  1.00 45.88 ? 155  ASP A OD1 1 
ATOM   1108 O OD2 . ASP A 1 154 ? 52.147 27.692 41.650  1.00 45.24 ? 155  ASP A OD2 1 
ATOM   1109 N N   . LYS A 1 155 ? 47.942 26.225 41.800  1.00 35.90 ? 156  LYS A N   1 
ATOM   1110 C CA  . LYS A 1 155 ? 46.718 26.485 42.556  1.00 35.31 ? 156  LYS A CA  1 
ATOM   1111 C C   . LYS A 1 155 ? 45.606 25.570 42.062  1.00 35.20 ? 156  LYS A C   1 
ATOM   1112 O O   . LYS A 1 155 ? 44.806 25.049 42.853  1.00 34.58 ? 156  LYS A O   1 
ATOM   1113 C CB  . LYS A 1 155 ? 46.314 27.944 42.389  1.00 33.71 ? 156  LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 155 ? 45.060 28.375 43.132  1.00 32.73 ? 156  LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 155 ? 44.876 29.888 42.942  1.00 30.34 ? 156  LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 155 ? 43.679 30.436 43.715  1.00 27.72 ? 156  LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 155 ? 43.537 31.900 43.526  1.00 24.71 ? 156  LYS A NZ  1 
ATOM   1118 N N   . ALA A 1 156 ? 45.564 25.360 40.749  1.00 33.48 ? 157  ALA A N   1 
ATOM   1119 C CA  . ALA A 1 156 ? 44.544 24.507 40.157  1.00 31.22 ? 157  ALA A CA  1 
ATOM   1120 C C   . ALA A 1 156 ? 44.713 23.073 40.617  1.00 30.89 ? 157  ALA A C   1 
ATOM   1121 O O   . ALA A 1 156 ? 43.736 22.394 40.933  1.00 29.70 ? 157  ALA A O   1 
ATOM   1122 C CB  . ALA A 1 156 ? 44.610 24.591 38.619  1.00 33.02 ? 157  ALA A CB  1 
ATOM   1123 N N   . GLN A 1 157 ? 45.960 22.609 40.669  1.00 30.97 ? 158  GLN A N   1 
ATOM   1124 C CA  . GLN A 1 157 ? 46.228 21.244 41.104  1.00 30.93 ? 158  GLN A CA  1 
ATOM   1125 C C   . GLN A 1 157 ? 45.967 21.086 42.603  1.00 28.09 ? 158  GLN A C   1 
ATOM   1126 O O   . GLN A 1 157 ? 45.525 20.035 43.048  1.00 29.90 ? 158  GLN A O   1 
ATOM   1127 C CB  . GLN A 1 157 ? 47.681 20.848 40.798  1.00 32.68 ? 158  GLN A CB  1 
ATOM   1128 C CG  . GLN A 1 157 ? 47.989 19.390 41.110  1.00 34.84 ? 158  GLN A CG  1 
ATOM   1129 C CD  . GLN A 1 157 ? 47.252 18.434 40.200  1.00 36.42 ? 158  GLN A CD  1 
ATOM   1130 O OE1 . GLN A 1 157 ? 47.316 18.556 38.972  1.00 42.71 ? 158  GLN A OE1 1 
ATOM   1131 N NE2 . GLN A 1 157 ? 46.559 17.473 40.784  1.00 32.92 ? 158  GLN A NE2 1 
ATOM   1132 N N   . ALA A 1 158 ? 46.260 22.124 43.378  1.00 27.83 ? 159  ALA A N   1 
ATOM   1133 C CA  . ALA A 1 158 ? 46.029 22.053 44.821  1.00 26.53 ? 159  ALA A CA  1 
ATOM   1134 C C   . ALA A 1 158 ? 44.526 21.870 45.062  1.00 26.56 ? 159  ALA A C   1 
ATOM   1135 O O   . ALA A 1 158 ? 44.104 21.058 45.895  1.00 26.46 ? 159  ALA A O   1 
ATOM   1136 C CB  . ALA A 1 158 ? 46.538 23.325 45.494  1.00 25.11 ? 159  ALA A CB  1 
ATOM   1137 N N   . ALA A 1 159 ? 43.718 22.601 44.295  1.00 27.21 ? 160  ALA A N   1 
ATOM   1138 C CA  . ALA A 1 159 ? 42.269 22.514 44.435  1.00 24.96 ? 160  ALA A CA  1 
ATOM   1139 C C   . ALA A 1 159 ? 41.768 21.125 44.103  1.00 25.86 ? 160  ALA A C   1 
ATOM   1140 O O   . ALA A 1 159 ? 40.927 20.584 44.812  1.00 22.87 ? 160  ALA A O   1 
ATOM   1141 C CB  . ALA A 1 159 ? 41.594 23.546 43.543  1.00 26.94 ? 160  ALA A CB  1 
ATOM   1142 N N   . ALA A 1 160 ? 42.270 20.535 43.018  1.00 26.88 ? 161  ALA A N   1 
ATOM   1143 C CA  . ALA A 1 160 ? 41.830 19.196 42.649  1.00 27.18 ? 161  ALA A CA  1 
ATOM   1144 C C   . ALA A 1 160 ? 42.251 18.170 43.702  1.00 26.56 ? 161  ALA A C   1 
ATOM   1145 O O   . ALA A 1 160 ? 41.488 17.265 44.034  1.00 28.47 ? 161  ALA A O   1 
ATOM   1146 C CB  . ALA A 1 160 ? 42.392 18.812 41.261  1.00 28.59 ? 161  ALA A CB  1 
ATOM   1147 N N   . ASP A 1 161 ? 43.468 18.306 44.222  1.00 28.21 ? 162  ASP A N   1 
ATOM   1148 C CA  . ASP A 1 161 ? 43.968 17.395 45.262  1.00 28.30 ? 162  ASP A CA  1 
ATOM   1149 C C   . ASP A 1 161 ? 43.047 17.501 46.491  1.00 27.72 ? 162  ASP A C   1 
ATOM   1150 O O   . ASP A 1 161 ? 42.679 16.499 47.108  1.00 26.76 ? 162  ASP A O   1 
ATOM   1151 C CB  . ASP A 1 161 ? 45.403 17.786 45.678  1.00 29.26 ? 162  ASP A CB  1 
ATOM   1152 C CG  . ASP A 1 161 ? 46.458 17.463 44.605  1.00 33.83 ? 162  ASP A CG  1 
ATOM   1153 O OD1 . ASP A 1 161 ? 47.527 18.118 44.609  1.00 35.66 ? 162  ASP A OD1 1 
ATOM   1154 O OD2 . ASP A 1 161 ? 46.239 16.565 43.767  1.00 32.45 ? 162  ASP A OD2 1 
ATOM   1155 N N   . SER A 1 162 ? 42.674 18.723 46.847  1.00 26.97 ? 163  SER A N   1 
ATOM   1156 C CA  . SER A 1 162 ? 41.802 18.930 48.017  1.00 25.75 ? 163  SER A CA  1 
ATOM   1157 C C   . SER A 1 162 ? 40.456 18.259 47.810  1.00 25.60 ? 163  SER A C   1 
ATOM   1158 O O   . SER A 1 162 ? 39.965 17.517 48.669  1.00 23.41 ? 163  SER A O   1 
ATOM   1159 C CB  . SER A 1 162 ? 41.594 20.421 48.267  1.00 26.29 ? 163  SER A CB  1 
ATOM   1160 O OG  . SER A 1 162 ? 40.694 20.620 49.360  1.00 29.45 ? 163  SER A OG  1 
ATOM   1161 N N   . VAL A 1 163 ? 39.848 18.529 46.654  1.00 24.69 ? 164  VAL A N   1 
ATOM   1162 C CA  . VAL A 1 163 ? 38.575 17.928 46.313  1.00 24.64 ? 164  VAL A CA  1 
ATOM   1163 C C   . VAL A 1 163 ? 38.675 16.407 46.278  1.00 26.04 ? 164  VAL A C   1 
ATOM   1164 O O   . VAL A 1 163 ? 37.811 15.698 46.795  1.00 24.50 ? 164  VAL A O   1 
ATOM   1165 C CB  . VAL A 1 163 ? 38.093 18.416 44.923  1.00 24.30 ? 164  VAL A CB  1 
ATOM   1166 C CG1 . VAL A 1 163 ? 36.963 17.537 44.431  1.00 22.06 ? 164  VAL A CG1 1 
ATOM   1167 C CG2 . VAL A 1 163 ? 37.662 19.879 45.023  1.00 24.23 ? 164  VAL A CG2 1 
ATOM   1168 N N   . ASN A 1 164 ? 39.732 15.904 45.650  1.00 27.87 ? 165  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 164 ? 39.904 14.459 45.553  1.00 29.92 ? 165  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 164 ? 39.973 13.749 46.894  1.00 29.78 ? 165  ASN A C   1 
ATOM   1171 O O   . ASN A 1 164 ? 39.332 12.724 47.089  1.00 32.87 ? 165  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 164 ? 41.155 14.132 44.725  1.00 31.37 ? 165  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 164 ? 40.939 14.371 43.248  1.00 34.67 ? 165  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 164 ? 39.805 14.306 42.766  1.00 33.62 ? 165  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 164 ? 42.021 14.638 42.517  1.00 31.90 ? 165  ASN A ND2 1 
ATOM   1176 N N   . LYS A 1 165 ? 40.743 14.293 47.827  1.00 31.40 ? 166  LYS A N   1 
ATOM   1177 C CA  . LYS A 1 165 ? 40.874 13.664 49.145  1.00 30.60 ? 166  LYS A CA  1 
ATOM   1178 C C   . LYS A 1 165 ? 39.552 13.692 49.929  1.00 29.66 ? 166  LYS A C   1 
ATOM   1179 O O   . LYS A 1 165 ? 39.105 12.669 50.459  1.00 24.42 ? 166  LYS A O   1 
ATOM   1180 C CB  . LYS A 1 165 ? 41.986 14.366 49.927  1.00 34.59 ? 166  LYS A CB  1 
ATOM   1181 C CG  . LYS A 1 165 ? 42.423 13.650 51.206  1.00 39.57 ? 166  LYS A CG  1 
ATOM   1182 C CD  . LYS A 1 165 ? 43.505 14.438 51.950  1.00 42.99 ? 166  LYS A CD  1 
ATOM   1183 C CE  . LYS A 1 165 ? 43.879 13.772 53.274  1.00 44.94 ? 166  LYS A CE  1 
ATOM   1184 N NZ  . LYS A 1 165 ? 42.725 13.658 54.222  1.00 46.92 ? 166  LYS A NZ  1 
ATOM   1185 N N   . ARG A 1 166 ? 38.896 14.853 49.959  1.00 28.19 ? 167  ARG A N   1 
ATOM   1186 C CA  . ARG A 1 166 ? 37.636 14.990 50.696  1.00 26.07 ? 167  ARG A CA  1 
ATOM   1187 C C   . ARG A 1 166 ? 36.473 14.164 50.155  1.00 28.01 ? 167  ARG A C   1 
ATOM   1188 O O   . ARG A 1 166 ? 35.680 13.607 50.929  1.00 23.90 ? 167  ARG A O   1 
ATOM   1189 C CB  . ARG A 1 166 ? 37.210 16.465 50.740  1.00 27.25 ? 167  ARG A CB  1 
ATOM   1190 C CG  . ARG A 1 166 ? 35.777 16.713 51.206  1.00 25.25 ? 167  ARG A CG  1 
ATOM   1191 C CD  . ARG A 1 166 ? 35.543 16.355 52.703  1.00 25.95 ? 167  ARG A CD  1 
ATOM   1192 N NE  . ARG A 1 166 ? 34.163 16.647 53.123  1.00 25.14 ? 167  ARG A NE  1 
ATOM   1193 C CZ  . ARG A 1 166 ? 33.090 15.946 52.741  1.00 28.75 ? 167  ARG A CZ  1 
ATOM   1194 N NH1 . ARG A 1 166 ? 33.228 14.898 51.937  1.00 28.80 ? 167  ARG A NH1 1 
ATOM   1195 N NH2 . ARG A 1 166 ? 31.868 16.301 53.128  1.00 24.07 ? 167  ARG A NH2 1 
ATOM   1196 N N   . PHE A 1 167 ? 36.348 14.110 48.828  1.00 28.66 ? 168  PHE A N   1 
ATOM   1197 C CA  . PHE A 1 167 ? 35.238 13.381 48.233  1.00 27.50 ? 168  PHE A CA  1 
ATOM   1198 C C   . PHE A 1 167 ? 35.616 12.072 47.560  1.00 29.94 ? 168  PHE A C   1 
ATOM   1199 O O   . PHE A 1 167 ? 34.757 11.409 46.984  1.00 29.30 ? 168  PHE A O   1 
ATOM   1200 C CB  . PHE A 1 167 ? 34.506 14.287 47.248  1.00 26.18 ? 168  PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 167 ? 33.971 15.524 47.883  1.00 24.14 ? 168  PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 167 ? 34.678 16.719 47.818  1.00 25.25 ? 168  PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 167 ? 32.783 15.484 48.586  1.00 24.30 ? 168  PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 167 ? 34.195 17.878 48.453  1.00 25.29 ? 168  PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 167 ? 32.290 16.626 49.224  1.00 23.32 ? 168  PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 167 ? 33.001 17.819 49.152  1.00 23.85 ? 168  PHE A CZ  1 
ATOM   1207 N N   . LYS A 1 168 ? 36.895 11.706 47.625  1.00 31.24 ? 169  LYS A N   1 
ATOM   1208 C CA  . LYS A 1 168 ? 37.343 10.446 47.037  1.00 32.18 ? 169  LYS A CA  1 
ATOM   1209 C C   . LYS A 1 168 ? 36.947 10.312 45.569  1.00 32.00 ? 169  LYS A C   1 
ATOM   1210 O O   . LYS A 1 168 ? 36.203 9.409  45.184  1.00 31.47 ? 169  LYS A O   1 
ATOM   1211 C CB  . LYS A 1 168 ? 36.762 9.289  47.846  1.00 35.62 ? 169  LYS A CB  1 
ATOM   1212 C CG  . LYS A 1 168 ? 37.086 9.398  49.345  1.00 37.72 ? 169  LYS A CG  1 
ATOM   1213 C CD  . LYS A 1 168 ? 36.670 8.158  50.112  1.00 42.43 ? 169  LYS A CD  1 
ATOM   1214 C CE  . LYS A 1 168 ? 37.078 8.262  51.578  1.00 44.57 ? 169  LYS A CE  1 
ATOM   1215 N NZ  . LYS A 1 168 ? 36.826 6.981  52.317  1.00 50.31 ? 169  LYS A NZ  1 
ATOM   1216 N N   . VAL A 1 169 ? 37.454 11.221 44.754  1.00 31.92 ? 170  VAL A N   1 
ATOM   1217 C CA  . VAL A 1 169 ? 37.156 11.219 43.331  1.00 31.69 ? 170  VAL A CA  1 
ATOM   1218 C C   . VAL A 1 169 ? 38.473 11.498 42.634  1.00 32.82 ? 170  VAL A C   1 
ATOM   1219 O O   . VAL A 1 169 ? 39.507 11.592 43.291  1.00 32.25 ? 170  VAL A O   1 
ATOM   1220 C CB  . VAL A 1 169 ? 36.117 12.318 42.966  1.00 30.64 ? 170  VAL A CB  1 
ATOM   1221 C CG1 . VAL A 1 169 ? 34.744 11.931 43.490  1.00 31.02 ? 170  VAL A CG1 1 
ATOM   1222 C CG2 . VAL A 1 169 ? 36.537 13.674 43.555  1.00 29.93 ? 170  VAL A CG2 1 
ATOM   1223 N N   . ASN A 1 170 ? 38.456 11.612 41.313  1.00 33.23 ? 171  ASN A N   1 
ATOM   1224 C CA  . ASN A 1 170 ? 39.683 11.893 40.607  1.00 37.87 ? 171  ASN A CA  1 
ATOM   1225 C C   . ASN A 1 170 ? 39.500 12.988 39.578  1.00 38.64 ? 171  ASN A C   1 
ATOM   1226 O O   . ASN A 1 170 ? 39.310 12.720 38.394  1.00 39.10 ? 171  ASN A O   1 
ATOM   1227 C CB  . ASN A 1 170 ? 40.243 10.636 39.932  1.00 41.68 ? 171  ASN A CB  1 
ATOM   1228 C CG  . ASN A 1 170 ? 41.659 10.845 39.423  1.00 46.30 ? 171  ASN A CG  1 
ATOM   1229 O OD1 . ASN A 1 170 ? 42.515 11.375 40.147  1.00 49.07 ? 171  ASN A OD1 1 
ATOM   1230 N ND2 . ASN A 1 170 ? 41.922 10.431 38.180  1.00 47.52 ? 171  ASN A ND2 1 
ATOM   1231 N N   . VAL A 1 171 ? 39.564 14.222 40.065  1.00 35.99 ? 172  VAL A N   1 
ATOM   1232 C CA  . VAL A 1 171 ? 39.442 15.422 39.266  1.00 33.45 ? 172  VAL A CA  1 
ATOM   1233 C C   . VAL A 1 171 ? 40.855 15.752 38.813  1.00 35.59 ? 172  VAL A C   1 
ATOM   1234 O O   . VAL A 1 171 ? 41.815 15.493 39.538  1.00 35.29 ? 172  VAL A O   1 
ATOM   1235 C CB  . VAL A 1 171 ? 38.872 16.580 40.138  1.00 31.57 ? 172  VAL A CB  1 
ATOM   1236 C CG1 . VAL A 1 171 ? 39.055 17.926 39.465  1.00 28.68 ? 172  VAL A CG1 1 
ATOM   1237 C CG2 . VAL A 1 171 ? 37.415 16.315 40.414  1.00 27.81 ? 172  VAL A CG2 1 
ATOM   1238 N N   . THR A 1 172 ? 40.995 16.299 37.609  1.00 34.93 ? 173  THR A N   1 
ATOM   1239 C CA  . THR A 1 172 ? 42.313 16.659 37.116  1.00 35.74 ? 173  THR A CA  1 
ATOM   1240 C C   . THR A 1 172 ? 42.309 18.169 36.956  1.00 36.01 ? 173  THR A C   1 
ATOM   1241 O O   . THR A 1 172 ? 41.247 18.788 36.898  1.00 36.56 ? 173  THR A O   1 
ATOM   1242 C CB  . THR A 1 172 ? 42.624 15.962 35.763  1.00 36.49 ? 173  THR A CB  1 
ATOM   1243 O OG1 . THR A 1 172 ? 41.813 16.530 34.735  1.00 35.30 ? 173  THR A OG1 1 
ATOM   1244 C CG2 . THR A 1 172 ? 42.311 14.455 35.851  1.00 36.73 ? 173  THR A CG2 1 
ATOM   1245 N N   . ALA A 1 173 ? 43.485 18.773 36.891  1.00 35.49 ? 174  ALA A N   1 
ATOM   1246 C CA  . ALA A 1 173 ? 43.558 20.216 36.777  1.00 36.60 ? 174  ALA A CA  1 
ATOM   1247 C C   . ALA A 1 173 ? 44.174 20.628 35.463  1.00 39.65 ? 174  ALA A C   1 
ATOM   1248 O O   . ALA A 1 173 ? 44.690 19.790 34.728  1.00 43.09 ? 174  ALA A O   1 
ATOM   1249 C CB  . ALA A 1 173 ? 44.373 20.784 37.935  1.00 35.99 ? 174  ALA A CB  1 
ATOM   1250 N N   . ALA A 1 174 ? 44.129 21.923 35.178  1.00 39.11 ? 175  ALA A N   1 
ATOM   1251 C CA  . ALA A 1 174 ? 44.699 22.459 33.953  1.00 41.47 ? 175  ALA A CA  1 
ATOM   1252 C C   . ALA A 1 174 ? 44.914 23.948 34.137  1.00 41.56 ? 175  ALA A C   1 
ATOM   1253 O O   . ALA A 1 174 ? 44.124 24.625 34.801  1.00 41.75 ? 175  ALA A O   1 
ATOM   1254 C CB  . ALA A 1 174 ? 43.755 22.208 32.765  1.00 40.53 ? 175  ALA A CB  1 
ATOM   1255 N N   . GLU A 1 175 ? 45.998 24.452 33.569  1.00 40.08 ? 176  GLU A N   1 
ATOM   1256 C CA  . GLU A 1 175 ? 46.296 25.861 33.655  1.00 40.56 ? 176  GLU A CA  1 
ATOM   1257 C C   . GLU A 1 175 ? 45.689 26.521 32.427  1.00 43.45 ? 176  GLU A C   1 
ATOM   1258 O O   . GLU A 1 175 ? 45.795 25.992 31.320  1.00 43.52 ? 176  GLU A O   1 
ATOM   1259 C CB  . GLU A 1 175 ? 47.808 26.071 33.665  1.00 43.68 ? 176  GLU A CB  1 
ATOM   1260 C CG  . GLU A 1 175 ? 48.265 27.522 33.657  1.00 43.18 ? 176  GLU A CG  1 
ATOM   1261 C CD  . GLU A 1 175 ? 49.775 27.656 33.881  1.00 46.65 ? 176  GLU A CD  1 
ATOM   1262 O OE1 . GLU A 1 175 ? 50.260 27.242 34.960  1.00 45.43 ? 176  GLU A OE1 1 
ATOM   1263 O OE2 . GLU A 1 175 ? 50.480 28.173 32.980  1.00 45.38 ? 176  GLU A OE2 1 
ATOM   1264 N N   . THR A 1 176 ? 45.031 27.656 32.632  1.00 43.29 ? 177  THR A N   1 
ATOM   1265 C CA  . THR A 1 176 ? 44.432 28.425 31.549  1.00 44.90 ? 177  THR A CA  1 
ATOM   1266 C C   . THR A 1 176 ? 44.655 29.865 31.975  1.00 46.62 ? 177  THR A C   1 
ATOM   1267 O O   . THR A 1 176 ? 43.855 30.435 32.716  1.00 46.58 ? 177  THR A O   1 
ATOM   1268 C CB  . THR A 1 176 ? 42.908 28.146 31.397  1.00 45.11 ? 177  THR A CB  1 
ATOM   1269 O OG1 . THR A 1 176 ? 42.231 28.455 32.621  1.00 45.99 ? 177  THR A OG1 1 
ATOM   1270 C CG2 . THR A 1 176 ? 42.660 26.684 31.043  1.00 42.75 ? 177  THR A CG2 1 
ATOM   1271 N N   . ALA A 1 177 ? 45.755 30.453 31.510  1.00 47.62 ? 178  ALA A N   1 
ATOM   1272 C CA  . ALA A 1 177 ? 46.107 31.820 31.891  1.00 49.22 ? 178  ALA A CA  1 
ATOM   1273 C C   . ALA A 1 177 ? 45.323 32.923 31.212  1.00 50.96 ? 178  ALA A C   1 
ATOM   1274 O O   . ALA A 1 177 ? 45.224 34.026 31.747  1.00 50.67 ? 178  ALA A O   1 
ATOM   1275 C CB  . ALA A 1 177 ? 47.591 32.048 31.658  1.00 50.65 ? 178  ALA A CB  1 
ATOM   1276 N N   . ASP A 1 178 ? 44.764 32.624 30.042  1.00 52.66 ? 179  ASP A N   1 
ATOM   1277 C CA  . ASP A 1 178 ? 44.023 33.612 29.263  1.00 53.79 ? 179  ASP A CA  1 
ATOM   1278 C C   . ASP A 1 178 ? 42.725 33.067 28.674  1.00 52.83 ? 179  ASP A C   1 
ATOM   1279 O O   . ASP A 1 178 ? 42.393 31.895 28.857  1.00 52.59 ? 179  ASP A O   1 
ATOM   1280 C CB  . ASP A 1 178 ? 44.924 34.119 28.127  1.00 55.77 ? 179  ASP A CB  1 
ATOM   1281 C CG  . ASP A 1 178 ? 45.547 32.979 27.321  1.00 57.23 ? 179  ASP A CG  1 
ATOM   1282 O OD1 . ASP A 1 178 ? 46.535 33.217 26.592  1.00 58.60 ? 179  ASP A OD1 1 
ATOM   1283 O OD2 . ASP A 1 178 ? 45.045 31.842 27.414  1.00 58.52 ? 179  ASP A OD2 1 
ATOM   1284 N N   . ASP A 1 179 ? 42.006 33.928 27.955  1.00 52.47 ? 180  ASP A N   1 
ATOM   1285 C CA  . ASP A 1 179 ? 40.750 33.546 27.309  1.00 51.52 ? 180  ASP A CA  1 
ATOM   1286 C C   . ASP A 1 179 ? 41.017 32.455 26.277  1.00 50.81 ? 180  ASP A C   1 
ATOM   1287 O O   . ASP A 1 179 ? 40.250 31.503 26.150  1.00 50.05 ? 180  ASP A O   1 
ATOM   1288 C CB  . ASP A 1 179 ? 40.140 34.745 26.594  1.00 52.70 ? 180  ASP A CB  1 
ATOM   1289 C CG  . ASP A 1 179 ? 40.727 36.051 27.056  1.00 55.45 ? 180  ASP A CG  1 
ATOM   1290 O OD1 . ASP A 1 179 ? 40.407 36.462 28.193  1.00 56.77 ? 180  ASP A OD1 1 
ATOM   1291 O OD2 . ASP A 1 179 ? 41.516 36.659 26.290  1.00 54.30 ? 180  ASP A OD2 1 
ATOM   1292 N N   . ALA A 1 180 ? 42.111 32.612 25.538  1.00 49.27 ? 181  ALA A N   1 
ATOM   1293 C CA  . ALA A 1 180 ? 42.486 31.659 24.508  1.00 49.79 ? 181  ALA A CA  1 
ATOM   1294 C C   . ALA A 1 180 ? 42.632 30.247 25.064  1.00 49.14 ? 181  ALA A C   1 
ATOM   1295 O O   . ALA A 1 180 ? 42.031 29.296 24.549  1.00 49.27 ? 181  ALA A O   1 
ATOM   1296 C CB  . ALA A 1 180 ? 43.794 32.099 23.844  1.00 51.34 ? 181  ALA A CB  1 
ATOM   1297 N N   . SER A 1 181 ? 43.433 30.105 26.114  1.00 48.19 ? 182  SER A N   1 
ATOM   1298 C CA  . SER A 1 181 ? 43.620 28.791 26.708  1.00 48.47 ? 182  SER A CA  1 
ATOM   1299 C C   . SER A 1 181 ? 42.262 28.303 27.197  1.00 47.80 ? 182  SER A C   1 
ATOM   1300 O O   . SER A 1 181 ? 41.933 27.126 27.043  1.00 48.85 ? 182  SER A O   1 
ATOM   1301 C CB  . SER A 1 181 ? 44.634 28.851 27.859  1.00 48.50 ? 182  SER A CB  1 
ATOM   1302 O OG  . SER A 1 181 ? 44.285 29.846 28.807  1.00 51.52 ? 182  SER A OG  1 
ATOM   1303 N N   . ARG A 1 182 ? 41.465 29.210 27.758  1.00 46.48 ? 183  ARG A N   1 
ATOM   1304 C CA  . ARG A 1 182 ? 40.134 28.836 28.242  1.00 47.53 ? 183  ARG A CA  1 
ATOM   1305 C C   . ARG A 1 182 ? 39.241 28.313 27.115  1.00 47.32 ? 183  ARG A C   1 
ATOM   1306 O O   . ARG A 1 182 ? 38.390 27.457 27.340  1.00 47.94 ? 183  ARG A O   1 
ATOM   1307 C CB  . ARG A 1 182 ? 39.452 30.024 28.941  1.00 46.27 ? 183  ARG A CB  1 
ATOM   1308 C CG  . ARG A 1 182 ? 40.070 30.362 30.301  1.00 45.23 ? 183  ARG A CG  1 
ATOM   1309 C CD  . ARG A 1 182 ? 39.101 31.096 31.207  1.00 43.27 ? 183  ARG A CD  1 
ATOM   1310 N NE  . ARG A 1 182 ? 38.898 32.494 30.838  1.00 42.64 ? 183  ARG A NE  1 
ATOM   1311 C CZ  . ARG A 1 182 ? 39.724 33.484 31.160  1.00 45.02 ? 183  ARG A CZ  1 
ATOM   1312 N NH1 . ARG A 1 182 ? 40.825 33.235 31.862  1.00 44.20 ? 183  ARG A NH1 1 
ATOM   1313 N NH2 . ARG A 1 182 ? 39.443 34.731 30.798  1.00 44.57 ? 183  ARG A NH2 1 
ATOM   1314 N N   . ALA A 1 183 ? 39.443 28.822 25.901  1.00 47.94 ? 184  ALA A N   1 
ATOM   1315 C CA  . ALA A 1 183 ? 38.650 28.388 24.755  1.00 47.02 ? 184  ALA A CA  1 
ATOM   1316 C C   . ALA A 1 183 ? 39.056 26.970 24.365  1.00 47.33 ? 184  ALA A C   1 
ATOM   1317 O O   . ALA A 1 183 ? 38.217 26.154 23.980  1.00 47.41 ? 184  ALA A O   1 
ATOM   1318 C CB  . ALA A 1 183 ? 38.861 29.338 23.591  1.00 48.35 ? 184  ALA A CB  1 
ATOM   1319 N N   . GLU A 1 184 ? 40.345 26.680 24.477  1.00 46.59 ? 185  GLU A N   1 
ATOM   1320 C CA  . GLU A 1 184 ? 40.863 25.359 24.145  1.00 47.82 ? 185  GLU A CA  1 
ATOM   1321 C C   . GLU A 1 184 ? 40.409 24.278 25.118  1.00 46.93 ? 185  GLU A C   1 
ATOM   1322 O O   . GLU A 1 184 ? 40.004 23.182 24.706  1.00 46.13 ? 185  GLU A O   1 
ATOM   1323 C CB  . GLU A 1 184 ? 42.395 25.380 24.129  1.00 50.66 ? 185  GLU A CB  1 
ATOM   1324 C CG  . GLU A 1 184 ? 43.006 26.005 22.894  1.00 55.51 ? 185  GLU A CG  1 
ATOM   1325 C CD  . GLU A 1 184 ? 42.789 25.168 21.634  1.00 56.94 ? 185  GLU A CD  1 
ATOM   1326 O OE1 . GLU A 1 184 ? 43.069 25.691 20.537  1.00 58.06 ? 185  GLU A OE1 1 
ATOM   1327 O OE2 . GLU A 1 184 ? 42.356 23.994 21.738  1.00 57.17 ? 185  GLU A OE2 1 
ATOM   1328 N N   . ALA A 1 185 ? 40.499 24.584 26.414  1.00 45.97 ? 186  ALA A N   1 
ATOM   1329 C CA  . ALA A 1 185 ? 40.127 23.630 27.458  1.00 43.35 ? 186  ALA A CA  1 
ATOM   1330 C C   . ALA A 1 185 ? 38.695 23.152 27.321  1.00 41.97 ? 186  ALA A C   1 
ATOM   1331 O O   . ALA A 1 185 ? 38.357 22.022 27.696  1.00 39.09 ? 186  ALA A O   1 
ATOM   1332 C CB  . ALA A 1 185 ? 40.338 24.254 28.833  1.00 45.31 ? 186  ALA A CB  1 
ATOM   1333 N N   . VAL A 1 186 ? 37.862 24.029 26.779  1.00 41.91 ? 187  VAL A N   1 
ATOM   1334 C CA  . VAL A 1 186 ? 36.444 23.762 26.564  1.00 42.78 ? 187  VAL A CA  1 
ATOM   1335 C C   . VAL A 1 186 ? 36.142 22.826 25.378  1.00 43.83 ? 187  VAL A C   1 
ATOM   1336 O O   . VAL A 1 186 ? 35.053 22.243 25.286  1.00 43.31 ? 187  VAL A O   1 
ATOM   1337 C CB  . VAL A 1 186 ? 35.704 25.107 26.371  1.00 43.30 ? 187  VAL A CB  1 
ATOM   1338 C CG1 . VAL A 1 186 ? 34.418 24.903 25.618  1.00 45.56 ? 187  VAL A CG1 1 
ATOM   1339 C CG2 . VAL A 1 186 ? 35.440 25.745 27.725  1.00 42.59 ? 187  VAL A CG2 1 
ATOM   1340 N N   . LYS A 1 187 ? 37.102 22.669 24.473  1.00 43.95 ? 188  LYS A N   1 
ATOM   1341 C CA  . LYS A 1 187 ? 36.889 21.808 23.317  1.00 42.89 ? 188  LYS A CA  1 
ATOM   1342 C C   . LYS A 1 187 ? 36.758 20.322 23.673  1.00 42.76 ? 188  LYS A C   1 
ATOM   1343 O O   . LYS A 1 187 ? 37.608 19.744 24.360  1.00 42.37 ? 188  LYS A O   1 
ATOM   1344 C CB  . LYS A 1 187 ? 38.019 22.023 22.299  1.00 45.21 ? 188  LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 187 ? 38.042 23.442 21.731  1.00 44.78 ? 188  LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 187 ? 39.136 23.658 20.695  1.00 46.33 ? 188  LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 187 ? 39.061 25.081 20.140  1.00 46.78 ? 188  LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 187 ? 40.190 25.434 19.228  1.00 51.09 ? 188  LYS A NZ  1 
ATOM   1349 N N   . GLY A 1 188 ? 35.675 19.709 23.213  1.00 40.13 ? 189  GLY A N   1 
ATOM   1350 C CA  . GLY A 1 188 ? 35.453 18.300 23.489  1.00 41.64 ? 189  GLY A CA  1 
ATOM   1351 C C   . GLY A 1 188 ? 34.596 18.060 24.721  1.00 40.43 ? 189  GLY A C   1 
ATOM   1352 O O   . GLY A 1 188 ? 34.204 16.932 25.002  1.00 41.99 ? 189  GLY A O   1 
ATOM   1353 N N   . ALA A 1 189 ? 34.315 19.125 25.459  1.00 41.15 ? 190  ALA A N   1 
ATOM   1354 C CA  . ALA A 1 189 ? 33.505 19.030 26.670  1.00 40.89 ? 190  ALA A CA  1 
ATOM   1355 C C   . ALA A 1 189 ? 32.026 19.090 26.343  1.00 41.71 ? 190  ALA A C   1 
ATOM   1356 O O   . ALA A 1 189 ? 31.615 19.713 25.354  1.00 41.46 ? 190  ALA A O   1 
ATOM   1357 C CB  . ALA A 1 189 ? 33.856 20.160 27.625  1.00 40.94 ? 190  ALA A CB  1 
ATOM   1358 N N   . HIS A 1 190 ? 31.234 18.452 27.196  1.00 40.75 ? 191  HIS A N   1 
ATOM   1359 C CA  . HIS A 1 190 ? 29.792 18.418 27.046  1.00 40.88 ? 191  HIS A CA  1 
ATOM   1360 C C   . HIS A 1 190 ? 29.107 19.388 28.010  1.00 41.60 ? 191  HIS A C   1 
ATOM   1361 O O   . HIS A 1 190 ? 27.984 19.830 27.756  1.00 40.69 ? 191  HIS A O   1 
ATOM   1362 C CB  . HIS A 1 190 ? 29.284 16.996 27.289  1.00 43.31 ? 191  HIS A CB  1 
ATOM   1363 C CG  . HIS A 1 190 ? 29.730 16.017 26.249  1.00 44.90 ? 191  HIS A CG  1 
ATOM   1364 N ND1 . HIS A 1 190 ? 28.855 15.173 25.600  1.00 46.54 ? 191  HIS A ND1 1 
ATOM   1365 C CD2 . HIS A 1 190 ? 30.952 15.772 25.721  1.00 46.07 ? 191  HIS A CD2 1 
ATOM   1366 C CE1 . HIS A 1 190 ? 29.520 14.450 24.715  1.00 46.81 ? 191  HIS A CE1 1 
ATOM   1367 N NE2 . HIS A 1 190 ? 30.794 14.796 24.768  1.00 46.25 ? 191  HIS A NE2 1 
ATOM   1368 N N   . PHE A 1 191 ? 29.785 19.718 29.111  1.00 38.93 ? 192  PHE A N   1 
ATOM   1369 C CA  . PHE A 1 191 ? 29.229 20.645 30.109  1.00 37.52 ? 192  PHE A CA  1 
ATOM   1370 C C   . PHE A 1 191 ? 30.289 21.644 30.567  1.00 35.92 ? 192  PHE A C   1 
ATOM   1371 O O   . PHE A 1 191 ? 31.424 21.265 30.868  1.00 36.55 ? 192  PHE A O   1 
ATOM   1372 C CB  . PHE A 1 191 ? 28.711 19.858 31.307  1.00 37.29 ? 192  PHE A CB  1 
ATOM   1373 C CG  . PHE A 1 191 ? 27.832 18.702 30.933  1.00 37.25 ? 192  PHE A CG  1 
ATOM   1374 C CD1 . PHE A 1 191 ? 28.250 17.392 31.160  1.00 34.91 ? 192  PHE A CD1 1 
ATOM   1375 C CD2 . PHE A 1 191 ? 26.600 18.920 30.325  1.00 36.64 ? 192  PHE A CD2 1 
ATOM   1376 C CE1 . PHE A 1 191 ? 27.461 16.321 30.786  1.00 36.04 ? 192  PHE A CE1 1 
ATOM   1377 C CE2 . PHE A 1 191 ? 25.799 17.853 29.946  1.00 35.60 ? 192  PHE A CE2 1 
ATOM   1378 C CZ  . PHE A 1 191 ? 26.229 16.552 30.174  1.00 37.95 ? 192  PHE A CZ  1 
ATOM   1379 N N   . VAL A 1 192 ? 29.922 22.919 30.629  1.00 33.32 ? 193  VAL A N   1 
ATOM   1380 C CA  . VAL A 1 192 ? 30.871 23.951 31.020  1.00 31.26 ? 193  VAL A CA  1 
ATOM   1381 C C   . VAL A 1 192 ? 30.330 24.885 32.103  1.00 32.11 ? 193  VAL A C   1 
ATOM   1382 O O   . VAL A 1 192 ? 29.272 25.517 31.936  1.00 29.27 ? 193  VAL A O   1 
ATOM   1383 C CB  . VAL A 1 192 ? 31.286 24.806 29.789  1.00 32.61 ? 193  VAL A CB  1 
ATOM   1384 C CG1 . VAL A 1 192 ? 32.160 25.986 30.219  1.00 32.35 ? 193  VAL A CG1 1 
ATOM   1385 C CG2 . VAL A 1 192 ? 32.033 23.936 28.786  1.00 32.36 ? 193  VAL A CG2 1 
ATOM   1386 N N   . PHE A 1 193 ? 31.060 24.968 33.217  1.00 29.61 ? 194  PHE A N   1 
ATOM   1387 C CA  . PHE A 1 193 ? 30.673 25.850 34.310  1.00 27.42 ? 194  PHE A CA  1 
ATOM   1388 C C   . PHE A 1 193 ? 31.713 26.934 34.453  1.00 27.76 ? 194  PHE A C   1 
ATOM   1389 O O   . PHE A 1 193 ? 32.916 26.678 34.336  1.00 28.15 ? 194  PHE A O   1 
ATOM   1390 C CB  . PHE A 1 193 ? 30.625 25.119 35.657  1.00 26.13 ? 194  PHE A CB  1 
ATOM   1391 C CG  . PHE A 1 193 ? 29.570 24.073 35.761  1.00 22.87 ? 194  PHE A CG  1 
ATOM   1392 C CD1 . PHE A 1 193 ? 29.667 22.889 35.054  1.00 25.08 ? 194  PHE A CD1 1 
ATOM   1393 C CD2 . PHE A 1 193 ? 28.512 24.237 36.644  1.00 23.87 ? 194  PHE A CD2 1 
ATOM   1394 C CE1 . PHE A 1 193 ? 28.725 21.871 35.230  1.00 24.51 ? 194  PHE A CE1 1 
ATOM   1395 C CE2 . PHE A 1 193 ? 27.567 23.222 36.828  1.00 18.47 ? 194  PHE A CE2 1 
ATOM   1396 C CZ  . PHE A 1 193 ? 27.677 22.043 36.120  1.00 24.28 ? 194  PHE A CZ  1 
ATOM   1397 N N   . THR A 1 194 ? 31.247 28.146 34.704  1.00 25.96 ? 195  THR A N   1 
ATOM   1398 C CA  . THR A 1 194 ? 32.135 29.258 34.947  1.00 27.26 ? 195  THR A CA  1 
ATOM   1399 C C   . THR A 1 194 ? 31.863 29.625 36.407  1.00 28.35 ? 195  THR A C   1 
ATOM   1400 O O   . THR A 1 194 ? 30.759 30.049 36.753  1.00 27.15 ? 195  THR A O   1 
ATOM   1401 C CB  . THR A 1 194 ? 31.838 30.445 34.006  1.00 29.19 ? 195  THR A CB  1 
ATOM   1402 O OG1 . THR A 1 194 ? 30.426 30.678 33.949  1.00 28.53 ? 195  THR A OG1 1 
ATOM   1403 C CG2 . THR A 1 194 ? 32.379 30.135 32.584  1.00 27.66 ? 195  THR A CG2 1 
ATOM   1404 N N   . ALA A 1 195 ? 32.854 29.392 37.267  1.00 28.13 ? 196  ALA A N   1 
ATOM   1405 C CA  . ALA A 1 195 ? 32.725 29.694 38.694  1.00 27.58 ? 196  ALA A CA  1 
ATOM   1406 C C   . ALA A 1 195 ? 33.686 30.797 39.087  1.00 28.15 ? 196  ALA A C   1 
ATOM   1407 O O   . ALA A 1 195 ? 34.317 30.734 40.146  1.00 27.13 ? 196  ALA A O   1 
ATOM   1408 C CB  . ALA A 1 195 ? 33.007 28.440 39.526  1.00 26.72 ? 196  ALA A CB  1 
ATOM   1409 N N   . GLY A 1 196 ? 33.791 31.813 38.234  1.00 26.47 ? 197  GLY A N   1 
ATOM   1410 C CA  . GLY A 1 196 ? 34.688 32.912 38.517  1.00 27.87 ? 197  GLY A CA  1 
ATOM   1411 C C   . GLY A 1 196 ? 34.208 33.926 39.542  1.00 28.18 ? 197  GLY A C   1 
ATOM   1412 O O   . GLY A 1 196 ? 33.026 33.988 39.876  1.00 27.78 ? 197  GLY A O   1 
ATOM   1413 N N   . ALA A 1 197 ? 35.151 34.719 40.043  1.00 28.36 ? 198  ALA A N   1 
ATOM   1414 C CA  . ALA A 1 197 ? 34.861 35.758 41.015  1.00 29.31 ? 198  ALA A CA  1 
ATOM   1415 C C   . ALA A 1 197 ? 33.833 36.708 40.425  1.00 30.66 ? 198  ALA A C   1 
ATOM   1416 O O   . ALA A 1 197 ? 33.643 36.761 39.209  1.00 30.96 ? 198  ALA A O   1 
ATOM   1417 C CB  . ALA A 1 197 ? 36.123 36.501 41.376  1.00 29.03 ? 198  ALA A CB  1 
ATOM   1418 N N   . ILE A 1 198 ? 33.180 37.469 41.290  1.00 30.73 ? 199  ILE A N   1 
ATOM   1419 C CA  . ILE A 1 198 ? 32.132 38.375 40.865  1.00 35.90 ? 199  ILE A CA  1 
ATOM   1420 C C   . ILE A 1 198 ? 32.533 39.479 39.870  1.00 37.81 ? 199  ILE A C   1 
ATOM   1421 O O   . ILE A 1 198 ? 33.558 40.151 40.040  1.00 38.89 ? 199  ILE A O   1 
ATOM   1422 C CB  . ILE A 1 198 ? 31.461 39.010 42.102  1.00 35.83 ? 199  ILE A CB  1 
ATOM   1423 C CG1 . ILE A 1 198 ? 30.294 39.899 41.663  1.00 40.31 ? 199  ILE A CG1 1 
ATOM   1424 C CG2 . ILE A 1 198 ? 32.491 39.801 42.902  1.00 38.74 ? 199  ILE A CG2 1 
ATOM   1425 C CD1 . ILE A 1 198 ? 29.499 40.516 42.822  1.00 41.85 ? 199  ILE A CD1 1 
ATOM   1426 N N   . GLY A 1 199 ? 31.714 39.647 38.829  1.00 38.35 ? 200  GLY A N   1 
ATOM   1427 C CA  . GLY A 1 199 ? 31.946 40.679 37.827  1.00 39.11 ? 200  GLY A CA  1 
ATOM   1428 C C   . GLY A 1 199 ? 33.036 40.480 36.786  1.00 39.59 ? 200  GLY A C   1 
ATOM   1429 O O   . GLY A 1 199 ? 33.633 41.456 36.337  1.00 42.39 ? 200  GLY A O   1 
ATOM   1430 N N   . LEU A 1 200 ? 33.288 39.238 36.387  1.00 39.57 ? 201  LEU A N   1 
ATOM   1431 C CA  . LEU A 1 200 ? 34.316 38.918 35.390  1.00 40.66 ? 201  LEU A CA  1 
ATOM   1432 C C   . LEU A 1 200 ? 33.787 37.965 34.323  1.00 40.86 ? 201  LEU A C   1 
ATOM   1433 O O   . LEU A 1 200 ? 32.950 37.100 34.615  1.00 39.34 ? 201  LEU A O   1 
ATOM   1434 C CB  . LEU A 1 200 ? 35.519 38.246 36.059  1.00 41.20 ? 201  LEU A CB  1 
ATOM   1435 C CG  . LEU A 1 200 ? 36.718 39.025 36.607  1.00 44.52 ? 201  LEU A CG  1 
ATOM   1436 C CD1 . LEU A 1 200 ? 36.378 40.492 36.900  1.00 46.74 ? 201  LEU A CD1 1 
ATOM   1437 C CD2 . LEU A 1 200 ? 37.189 38.299 37.863  1.00 43.82 ? 201  LEU A CD2 1 
ATOM   1438 N N   . GLU A 1 201 ? 34.286 38.108 33.094  1.00 39.40 ? 202  GLU A N   1 
ATOM   1439 C CA  . GLU A 1 201 ? 33.872 37.233 32.001  1.00 39.86 ? 202  GLU A CA  1 
ATOM   1440 C C   . GLU A 1 201 ? 34.951 36.190 31.781  1.00 39.56 ? 202  GLU A C   1 
ATOM   1441 O O   . GLU A 1 201 ? 36.139 36.485 31.914  1.00 38.74 ? 202  GLU A O   1 
ATOM   1442 C CB  . GLU A 1 201 ? 33.655 38.029 30.708  1.00 41.87 ? 202  GLU A CB  1 
ATOM   1443 C CG  . GLU A 1 201 ? 33.226 37.162 29.525  1.00 44.49 ? 202  GLU A CG  1 
ATOM   1444 C CD  . GLU A 1 201 ? 32.926 37.977 28.277  1.00 49.23 ? 202  GLU A CD  1 
ATOM   1445 O OE1 . GLU A 1 201 ? 32.102 38.921 28.361  1.00 51.31 ? 202  GLU A OE1 1 
ATOM   1446 O OE2 . GLU A 1 201 ? 33.513 37.671 27.217  1.00 50.60 ? 202  GLU A OE2 1 
ATOM   1447 N N   . LEU A 1 202 ? 34.547 34.976 31.425  1.00 38.84 ? 203  LEU A N   1 
ATOM   1448 C CA  . LEU A 1 202 ? 35.511 33.905 31.222  1.00 40.28 ? 203  LEU A CA  1 
ATOM   1449 C C   . LEU A 1 202 ? 35.352 33.160 29.910  1.00 40.12 ? 203  LEU A C   1 
ATOM   1450 O O   . LEU A 1 202 ? 36.317 32.602 29.403  1.00 40.72 ? 203  LEU A O   1 
ATOM   1451 C CB  . LEU A 1 202 ? 35.418 32.881 32.366  1.00 38.75 ? 203  LEU A CB  1 
ATOM   1452 C CG  . LEU A 1 202 ? 35.728 33.354 33.788  1.00 39.95 ? 203  LEU A CG  1 
ATOM   1453 C CD1 . LEU A 1 202 ? 35.475 32.211 34.777  1.00 39.10 ? 203  LEU A CD1 1 
ATOM   1454 C CD2 . LEU A 1 202 ? 37.172 33.844 33.863  1.00 37.70 ? 203  LEU A CD2 1 
ATOM   1455 N N   . LEU A 1 203 ? 34.140 33.149 29.363  1.00 40.30 ? 204  LEU A N   1 
ATOM   1456 C CA  . LEU A 1 203 ? 33.893 32.412 28.137  1.00 40.80 ? 204  LEU A CA  1 
ATOM   1457 C C   . LEU A 1 203 ? 32.929 33.139 27.211  1.00 41.22 ? 204  LEU A C   1 
ATOM   1458 O O   . LEU A 1 203 ? 31.718 33.023 27.369  1.00 41.24 ? 204  LEU A O   1 
ATOM   1459 C CB  . LEU A 1 203 ? 33.312 31.049 28.497  1.00 40.44 ? 204  LEU A CB  1 
ATOM   1460 C CG  . LEU A 1 203 ? 33.367 29.947 27.451  1.00 40.50 ? 204  LEU A CG  1 
ATOM   1461 C CD1 . LEU A 1 203 ? 34.809 29.552 27.222  1.00 42.45 ? 204  LEU A CD1 1 
ATOM   1462 C CD2 . LEU A 1 203 ? 32.562 28.755 27.930  1.00 40.94 ? 204  LEU A CD2 1 
ATOM   1463 N N   . PRO A 1 204 ? 33.450 33.911 26.241  1.00 42.43 ? 205  PRO A N   1 
ATOM   1464 C CA  . PRO A 1 204 ? 32.595 34.649 25.296  1.00 42.74 ? 205  PRO A CA  1 
ATOM   1465 C C   . PRO A 1 204 ? 31.693 33.719 24.480  1.00 40.56 ? 205  PRO A C   1 
ATOM   1466 O O   . PRO A 1 204 ? 31.944 32.517 24.403  1.00 41.78 ? 205  PRO A O   1 
ATOM   1467 C CB  . PRO A 1 204 ? 33.610 35.392 24.432  1.00 42.64 ? 205  PRO A CB  1 
ATOM   1468 C CG  . PRO A 1 204 ? 34.719 35.666 25.409  1.00 43.43 ? 205  PRO A CG  1 
ATOM   1469 C CD  . PRO A 1 204 ? 34.857 34.323 26.090  1.00 43.20 ? 205  PRO A CD  1 
ATOM   1470 N N   . GLN A 1 205 ? 30.657 34.279 23.861  1.00 42.81 ? 206  GLN A N   1 
ATOM   1471 C CA  . GLN A 1 205 ? 29.694 33.495 23.076  1.00 43.03 ? 206  GLN A CA  1 
ATOM   1472 C C   . GLN A 1 205 ? 30.303 32.591 21.999  1.00 43.77 ? 206  GLN A C   1 
ATOM   1473 O O   . GLN A 1 205 ? 29.847 31.459 21.796  1.00 45.58 ? 206  GLN A O   1 
ATOM   1474 C CB  . GLN A 1 205 ? 28.651 34.424 22.445  1.00 42.10 ? 206  GLN A CB  1 
ATOM   1475 C CG  . GLN A 1 205 ? 27.577 33.688 21.652  1.00 40.57 ? 206  GLN A CG  1 
ATOM   1476 C CD  . GLN A 1 205 ? 26.415 34.581 21.224  1.00 41.88 ? 206  GLN A CD  1 
ATOM   1477 O OE1 . GLN A 1 205 ? 25.593 34.190 20.382  1.00 43.78 ? 206  GLN A OE1 1 
ATOM   1478 N NE2 . GLN A 1 205 ? 26.333 35.771 21.800  1.00 34.52 ? 206  GLN A NE2 1 
ATOM   1479 N N   . ALA A 1 206 ? 31.332 33.084 21.319  1.00 44.29 ? 207  ALA A N   1 
ATOM   1480 C CA  . ALA A 1 206 ? 31.983 32.307 20.272  1.00 44.69 ? 207  ALA A CA  1 
ATOM   1481 C C   . ALA A 1 206 ? 32.557 31.030 20.877  1.00 45.09 ? 207  ALA A C   1 
ATOM   1482 O O   . ALA A 1 206 ? 32.230 29.908 20.447  1.00 42.08 ? 207  ALA A O   1 
ATOM   1483 C CB  . ALA A 1 206 ? 33.091 33.119 19.646  1.00 43.30 ? 207  ALA A CB  1 
ATOM   1484 N N   . ALA A 1 207 ? 33.391 31.235 21.898  1.00 43.77 ? 208  ALA A N   1 
ATOM   1485 C CA  . ALA A 1 207 ? 34.079 30.170 22.606  1.00 43.66 ? 208  ALA A CA  1 
ATOM   1486 C C   . ALA A 1 207 ? 33.253 28.941 22.960  1.00 43.67 ? 208  ALA A C   1 
ATOM   1487 O O   . ALA A 1 207 ? 33.819 27.850 23.097  1.00 45.56 ? 208  ALA A O   1 
ATOM   1488 C CB  . ALA A 1 207 ? 34.732 30.731 23.859  1.00 45.87 ? 208  ALA A CB  1 
ATOM   1489 N N   . TRP A 1 208 ? 31.936 29.084 23.115  1.00 41.48 ? 209  TRP A N   1 
ATOM   1490 C CA  . TRP A 1 208 ? 31.123 27.920 23.459  1.00 40.39 ? 209  TRP A CA  1 
ATOM   1491 C C   . TRP A 1 208 ? 30.113 27.526 22.395  1.00 41.17 ? 209  TRP A C   1 
ATOM   1492 O O   . TRP A 1 208 ? 29.742 26.355 22.276  1.00 40.62 ? 209  TRP A O   1 
ATOM   1493 C CB  . TRP A 1 208 ? 30.380 28.114 24.797  1.00 40.27 ? 209  TRP A CB  1 
ATOM   1494 C CG  . TRP A 1 208 ? 29.466 29.323 24.909  1.00 37.88 ? 209  TRP A CG  1 
ATOM   1495 C CD1 . TRP A 1 208 ? 29.823 30.590 25.270  1.00 39.83 ? 209  TRP A CD1 1 
ATOM   1496 C CD2 . TRP A 1 208 ? 28.051 29.358 24.695  1.00 39.09 ? 209  TRP A CD2 1 
ATOM   1497 N NE1 . TRP A 1 208 ? 28.720 31.412 25.300  1.00 35.77 ? 209  TRP A NE1 1 
ATOM   1498 C CE2 . TRP A 1 208 ? 27.621 30.683 24.948  1.00 37.00 ? 209  TRP A CE2 1 
ATOM   1499 C CE3 . TRP A 1 208 ? 27.102 28.398 24.316  1.00 40.62 ? 209  TRP A CE3 1 
ATOM   1500 C CZ2 . TRP A 1 208 ? 26.289 31.073 24.832  1.00 39.53 ? 209  TRP A CZ2 1 
ATOM   1501 C CZ3 . TRP A 1 208 ? 25.773 28.787 24.202  1.00 41.55 ? 209  TRP A CZ3 1 
ATOM   1502 C CH2 . TRP A 1 208 ? 25.380 30.117 24.459  1.00 41.55 ? 209  TRP A CH2 1 
ATOM   1503 N N   . GLN A 1 209 ? 29.684 28.501 21.613  1.00 40.73 ? 210  GLN A N   1 
ATOM   1504 C CA  . GLN A 1 209 ? 28.683 28.244 20.591  1.00 43.44 ? 210  GLN A CA  1 
ATOM   1505 C C   . GLN A 1 209 ? 29.135 27.397 19.420  1.00 43.02 ? 210  GLN A C   1 
ATOM   1506 O O   . GLN A 1 209 ? 28.329 26.662 18.840  1.00 43.71 ? 210  GLN A O   1 
ATOM   1507 C CB  . GLN A 1 209 ? 28.149 29.557 20.066  1.00 43.55 ? 210  GLN A CB  1 
ATOM   1508 C CG  . GLN A 1 209 ? 26.726 29.455 19.624  1.00 46.82 ? 210  GLN A CG  1 
ATOM   1509 C CD  . GLN A 1 209 ? 26.044 30.782 19.724  1.00 46.46 ? 210  GLN A CD  1 
ATOM   1510 O OE1 . GLN A 1 209 ? 24.941 30.883 20.243  1.00 47.17 ? 210  GLN A OE1 1 
ATOM   1511 N NE2 . GLN A 1 209 ? 26.707 31.823 19.231  1.00 50.05 ? 210  GLN A NE2 1 
ATOM   1512 N N   . ASN A 1 210 ? 30.412 27.492 19.067  1.00 41.60 ? 211  ASN A N   1 
ATOM   1513 C CA  . ASN A 1 210 ? 30.917 26.739 17.932  1.00 41.19 ? 211  ASN A CA  1 
ATOM   1514 C C   . ASN A 1 210 ? 31.586 25.431 18.304  1.00 43.34 ? 211  ASN A C   1 
ATOM   1515 O O   . ASN A 1 210 ? 32.388 24.901 17.528  1.00 44.25 ? 211  ASN A O   1 
ATOM   1516 C CB  . ASN A 1 210 ? 31.889 27.593 17.144  1.00 42.20 ? 211  ASN A CB  1 
ATOM   1517 C CG  . ASN A 1 210 ? 31.359 28.983 16.913  1.00 43.79 ? 211  ASN A CG  1 
ATOM   1518 O OD1 . ASN A 1 210 ? 30.165 29.167 16.684  1.00 41.74 ? 211  ASN A OD1 1 
ATOM   1519 N ND2 . ASN A 1 210 ? 32.239 29.970 16.971  1.00 44.94 ? 211  ASN A ND2 1 
ATOM   1520 N N   . GLU A 1 211 ? 31.268 24.909 19.482  1.00 41.63 ? 212  GLU A N   1 
ATOM   1521 C CA  . GLU A 1 211 ? 31.856 23.647 19.905  1.00 43.52 ? 212  GLU A CA  1 
ATOM   1522 C C   . GLU A 1 211 ? 30.759 22.591 19.929  1.00 43.12 ? 212  GLU A C   1 
ATOM   1523 O O   . GLU A 1 211 ? 30.050 22.428 20.909  1.00 43.20 ? 212  GLU A O   1 
ATOM   1524 C CB  . GLU A 1 211 ? 32.500 23.793 21.286  1.00 43.00 ? 212  GLU A CB  1 
ATOM   1525 C CG  . GLU A 1 211 ? 33.301 22.580 21.733  1.00 43.52 ? 212  GLU A CG  1 
ATOM   1526 C CD  . GLU A 1 211 ? 34.515 22.315 20.850  1.00 44.17 ? 212  GLU A CD  1 
ATOM   1527 O OE1 . GLU A 1 211 ? 35.136 23.296 20.387  1.00 42.42 ? 212  GLU A OE1 1 
ATOM   1528 O OE2 . GLU A 1 211 ? 34.856 21.128 20.639  1.00 44.43 ? 212  GLU A OE2 1 
ATOM   1529 N N   . SER A 1 212 ? 30.616 21.884 18.821  1.00 43.96 ? 213  SER A N   1 
ATOM   1530 C CA  . SER A 1 212 ? 29.594 20.856 18.697  1.00 44.08 ? 213  SER A CA  1 
ATOM   1531 C C   . SER A 1 212 ? 29.310 20.060 19.976  1.00 42.54 ? 213  SER A C   1 
ATOM   1532 O O   . SER A 1 212 ? 28.152 19.782 20.296  1.00 40.95 ? 213  SER A O   1 
ATOM   1533 C CB  . SER A 1 212 ? 29.982 19.881 17.581  1.00 44.33 ? 213  SER A CB  1 
ATOM   1534 O OG  . SER A 1 212 ? 29.127 18.750 17.588  1.00 48.98 ? 213  SER A OG  1 
ATOM   1535 N N   . SER A 1 213 ? 30.362 19.690 20.698  1.00 41.01 ? 214  SER A N   1 
ATOM   1536 C CA  . SER A 1 213 ? 30.206 18.884 21.907  1.00 41.13 ? 214  SER A CA  1 
ATOM   1537 C C   . SER A 1 213 ? 29.409 19.504 23.054  1.00 38.87 ? 214  SER A C   1 
ATOM   1538 O O   . SER A 1 213 ? 28.684 18.802 23.749  1.00 40.64 ? 214  SER A O   1 
ATOM   1539 C CB  . SER A 1 213 ? 31.588 18.444 22.426  1.00 40.99 ? 214  SER A CB  1 
ATOM   1540 O OG  . SER A 1 213 ? 32.418 19.557 22.730  1.00 40.81 ? 214  SER A OG  1 
ATOM   1541 N N   . ILE A 1 214 ? 29.507 20.814 23.235  1.00 39.62 ? 215  ILE A N   1 
ATOM   1542 C CA  . ILE A 1 214 ? 28.817 21.473 24.348  1.00 38.62 ? 215  ILE A CA  1 
ATOM   1543 C C   . ILE A 1 214 ? 27.292 21.354 24.383  1.00 39.00 ? 215  ILE A C   1 
ATOM   1544 O O   . ILE A 1 214 ? 26.589 21.792 23.464  1.00 39.39 ? 215  ILE A O   1 
ATOM   1545 C CB  . ILE A 1 214 ? 29.195 22.961 24.424  1.00 38.17 ? 215  ILE A CB  1 
ATOM   1546 C CG1 . ILE A 1 214 ? 30.715 23.103 24.571  1.00 38.13 ? 215  ILE A CG1 1 
ATOM   1547 C CG2 . ILE A 1 214 ? 28.510 23.604 25.627  1.00 38.69 ? 215  ILE A CG2 1 
ATOM   1548 C CD1 . ILE A 1 214 ? 31.196 24.547 24.588  1.00 35.86 ? 215  ILE A CD1 1 
ATOM   1549 N N   . GLU A 1 215 ? 26.786 20.759 25.459  1.00 36.35 ? 216  GLU A N   1 
ATOM   1550 C CA  . GLU A 1 215 ? 25.351 20.586 25.640  1.00 34.95 ? 216  GLU A CA  1 
ATOM   1551 C C   . GLU A 1 215 ? 24.750 21.681 26.524  1.00 34.22 ? 216  GLU A C   1 
ATOM   1552 O O   . GLU A 1 215 ? 23.728 22.280 26.182  1.00 32.15 ? 216  GLU A O   1 
ATOM   1553 C CB  . GLU A 1 215 ? 25.051 19.234 26.282  1.00 34.55 ? 216  GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 215 ? 25.473 18.031 25.474  1.00 37.48 ? 216  GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 215 ? 25.227 16.742 26.223  1.00 40.49 ? 216  GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 215 ? 24.141 16.602 26.826  1.00 40.91 ? 216  GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 215 ? 26.117 15.864 26.209  1.00 45.45 ? 216  GLU A OE2 1 
ATOM   1558 N N   . ILE A 1 216 ? 25.397 21.949 27.656  1.00 32.66 ? 217  ILE A N   1 
ATOM   1559 C CA  . ILE A 1 216 ? 24.897 22.933 28.619  1.00 31.10 ? 217  ILE A CA  1 
ATOM   1560 C C   . ILE A 1 216 ? 25.983 23.832 29.190  1.00 31.06 ? 217  ILE A C   1 
ATOM   1561 O O   . ILE A 1 216 ? 27.117 23.391 29.412  1.00 27.88 ? 217  ILE A O   1 
ATOM   1562 C CB  . ILE A 1 216 ? 24.222 22.195 29.791  1.00 30.66 ? 217  ILE A CB  1 
ATOM   1563 C CG1 . ILE A 1 216 ? 23.239 21.171 29.224  1.00 32.79 ? 217  ILE A CG1 1 
ATOM   1564 C CG2 . ILE A 1 216 ? 23.519 23.186 30.737  1.00 30.73 ? 217  ILE A CG2 1 
ATOM   1565 C CD1 . ILE A 1 216 ? 22.611 20.249 30.246  1.00 29.35 ? 217  ILE A CD1 1 
ATOM   1566 N N   . VAL A 1 217 ? 25.634 25.096 29.403  1.00 29.68 ? 218  VAL A N   1 
ATOM   1567 C CA  . VAL A 1 217 ? 26.543 26.058 30.014  1.00 31.01 ? 218  VAL A CA  1 
ATOM   1568 C C   . VAL A 1 217 ? 25.845 26.570 31.283  1.00 31.12 ? 218  VAL A C   1 
ATOM   1569 O O   . VAL A 1 217 ? 24.617 26.734 31.311  1.00 31.85 ? 218  VAL A O   1 
ATOM   1570 C CB  . VAL A 1 217 ? 26.871 27.263 29.082  1.00 30.73 ? 218  VAL A CB  1 
ATOM   1571 C CG1 . VAL A 1 217 ? 27.820 26.822 27.970  1.00 32.10 ? 218  VAL A CG1 1 
ATOM   1572 C CG2 . VAL A 1 217 ? 25.593 27.826 28.491  1.00 30.87 ? 218  VAL A CG2 1 
ATOM   1573 N N   . ALA A 1 218 ? 26.628 26.807 32.334  1.00 30.20 ? 219  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 218 ? 26.091 27.289 33.612  1.00 28.79 ? 219  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 218 ? 27.053 28.315 34.202  1.00 28.23 ? 219  ALA A C   1 
ATOM   1576 O O   . ALA A 1 218 ? 28.255 28.067 34.259  1.00 28.71 ? 219  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 218 ? 25.923 26.128 34.553  1.00 28.10 ? 219  ALA A CB  1 
ATOM   1578 N N   . ASP A 1 219 ? 26.521 29.451 34.646  1.00 25.55 ? 220  ASP A N   1 
ATOM   1579 C CA  . ASP A 1 219 ? 27.336 30.533 35.183  1.00 26.20 ? 220  ASP A CA  1 
ATOM   1580 C C   . ASP A 1 219 ? 26.909 30.926 36.606  1.00 25.45 ? 220  ASP A C   1 
ATOM   1581 O O   . ASP A 1 219 ? 25.733 31.162 36.864  1.00 25.21 ? 220  ASP A O   1 
ATOM   1582 C CB  . ASP A 1 219 ? 27.222 31.721 34.218  1.00 27.44 ? 220  ASP A CB  1 
ATOM   1583 C CG  . ASP A 1 219 ? 28.024 32.930 34.643  1.00 28.65 ? 220  ASP A CG  1 
ATOM   1584 O OD1 . ASP A 1 219 ? 28.956 32.802 35.452  1.00 29.43 ? 220  ASP A OD1 1 
ATOM   1585 O OD2 . ASP A 1 219 ? 27.712 34.026 34.135  1.00 29.91 ? 220  ASP A OD2 1 
ATOM   1586 N N   . TYR A 1 220 ? 27.869 31.003 37.523  1.00 24.50 ? 221  TYR A N   1 
ATOM   1587 C CA  . TYR A 1 220 ? 27.564 31.361 38.905  1.00 23.69 ? 221  TYR A CA  1 
ATOM   1588 C C   . TYR A 1 220 ? 27.699 32.855 39.194  1.00 27.54 ? 221  TYR A C   1 
ATOM   1589 O O   . TYR A 1 220 ? 27.296 33.314 40.256  1.00 25.69 ? 221  TYR A O   1 
ATOM   1590 C CB  . TYR A 1 220 ? 28.466 30.578 39.876  1.00 24.29 ? 221  TYR A CB  1 
ATOM   1591 C CG  . TYR A 1 220 ? 28.167 29.097 39.951  1.00 23.71 ? 221  TYR A CG  1 
ATOM   1592 C CD1 . TYR A 1 220 ? 29.028 28.154 39.392  1.00 22.18 ? 221  TYR A CD1 1 
ATOM   1593 C CD2 . TYR A 1 220 ? 27.014 28.636 40.581  1.00 24.29 ? 221  TYR A CD2 1 
ATOM   1594 C CE1 . TYR A 1 220 ? 28.747 26.772 39.468  1.00 22.51 ? 221  TYR A CE1 1 
ATOM   1595 C CE2 . TYR A 1 220 ? 26.727 27.277 40.658  1.00 22.40 ? 221  TYR A CE2 1 
ATOM   1596 C CZ  . TYR A 1 220 ? 27.590 26.348 40.113  1.00 19.97 ? 221  TYR A CZ  1 
ATOM   1597 O OH  . TYR A 1 220 ? 27.303 24.998 40.264  1.00 19.73 ? 221  TYR A OH  1 
ATOM   1598 N N   . ASN A 1 221 ? 28.264 33.613 38.252  1.00 29.13 ? 222  ASN A N   1 
ATOM   1599 C CA  . ASN A 1 221 ? 28.434 35.060 38.421  1.00 30.81 ? 222  ASN A CA  1 
ATOM   1600 C C   . ASN A 1 221 ? 27.186 35.836 37.983  1.00 33.63 ? 222  ASN A C   1 
ATOM   1601 O O   . ASN A 1 221 ? 26.770 35.739 36.828  1.00 35.11 ? 222  ASN A O   1 
ATOM   1602 C CB  . ASN A 1 221 ? 29.654 35.521 37.614  1.00 30.30 ? 222  ASN A CB  1 
ATOM   1603 C CG  . ASN A 1 221 ? 29.774 37.037 37.539  1.00 31.85 ? 222  ASN A CG  1 
ATOM   1604 O OD1 . ASN A 1 221 ? 29.394 37.743 38.468  1.00 30.56 ? 222  ASN A OD1 1 
ATOM   1605 N ND2 . ASN A 1 221 ? 30.323 37.539 36.428  1.00 28.90 ? 222  ASN A ND2 1 
ATOM   1606 N N   . ALA A 1 222 ? 26.592 36.606 38.900  1.00 34.28 ? 223  ALA A N   1 
ATOM   1607 C CA  . ALA A 1 222 ? 25.384 37.375 38.595  1.00 34.66 ? 223  ALA A CA  1 
ATOM   1608 C C   . ALA A 1 222 ? 25.632 38.851 38.274  1.00 36.27 ? 223  ALA A C   1 
ATOM   1609 O O   . ALA A 1 222 ? 24.696 39.576 37.946  1.00 35.39 ? 223  ALA A O   1 
ATOM   1610 C CB  . ALA A 1 222 ? 24.401 37.276 39.758  1.00 33.11 ? 223  ALA A CB  1 
ATOM   1611 N N   . GLN A 1 223 ? 26.882 39.291 38.377  1.00 37.85 ? 224  GLN A N   1 
ATOM   1612 C CA  . GLN A 1 223 ? 27.243 40.686 38.126  1.00 39.44 ? 224  GLN A CA  1 
ATOM   1613 C C   . GLN A 1 223 ? 27.951 40.882 36.784  1.00 39.84 ? 224  GLN A C   1 
ATOM   1614 O O   . GLN A 1 223 ? 29.028 40.338 36.554  1.00 38.92 ? 224  GLN A O   1 
ATOM   1615 C CB  . GLN A 1 223 ? 28.142 41.200 39.266  1.00 41.13 ? 224  GLN A CB  1 
ATOM   1616 C CG  . GLN A 1 223 ? 28.631 42.625 39.093  1.00 42.58 ? 224  GLN A CG  1 
ATOM   1617 C CD  . GLN A 1 223 ? 29.529 43.082 40.237  1.00 46.28 ? 224  GLN A CD  1 
ATOM   1618 O OE1 . GLN A 1 223 ? 29.100 43.147 41.399  1.00 46.75 ? 224  GLN A OE1 1 
ATOM   1619 N NE2 . GLN A 1 223 ? 30.783 43.399 39.916  1.00 44.33 ? 224  GLN A NE2 1 
ATOM   1620 N N   . PRO A 1 224 ? 27.345 41.670 35.877  1.00 41.56 ? 225  PRO A N   1 
ATOM   1621 C CA  . PRO A 1 224 ? 27.897 41.961 34.544  1.00 40.87 ? 225  PRO A CA  1 
ATOM   1622 C C   . PRO A 1 224 ? 29.257 42.661 34.637  1.00 39.72 ? 225  PRO A C   1 
ATOM   1623 O O   . PRO A 1 224 ? 29.458 43.518 35.494  1.00 39.54 ? 225  PRO A O   1 
ATOM   1624 C CB  . PRO A 1 224 ? 26.836 42.870 33.920  1.00 42.98 ? 225  PRO A CB  1 
ATOM   1625 C CG  . PRO A 1 224 ? 25.566 42.437 34.595  1.00 43.06 ? 225  PRO A CG  1 
ATOM   1626 C CD  . PRO A 1 224 ? 26.012 42.283 36.035  1.00 42.37 ? 225  PRO A CD  1 
ATOM   1627 N N   . PRO A 1 225 ? 30.209 42.299 33.763  1.00 37.90 ? 226  PRO A N   1 
ATOM   1628 C CA  . PRO A 1 225 ? 30.092 41.285 32.711  1.00 38.17 ? 226  PRO A CA  1 
ATOM   1629 C C   . PRO A 1 225 ? 29.978 39.863 33.283  1.00 37.48 ? 226  PRO A C   1 
ATOM   1630 O O   . PRO A 1 225 ? 30.747 39.464 34.159  1.00 35.28 ? 226  PRO A O   1 
ATOM   1631 C CB  . PRO A 1 225 ? 31.356 41.499 31.888  1.00 38.86 ? 226  PRO A CB  1 
ATOM   1632 C CG  . PRO A 1 225 ? 32.344 41.981 32.905  1.00 41.22 ? 226  PRO A CG  1 
ATOM   1633 C CD  . PRO A 1 225 ? 31.534 42.940 33.737  1.00 39.67 ? 226  PRO A CD  1 
ATOM   1634 N N   . LEU A 1 226 ? 29.002 39.115 32.786  1.00 36.08 ? 227  LEU A N   1 
ATOM   1635 C CA  . LEU A 1 226 ? 28.760 37.772 33.264  1.00 35.00 ? 227  LEU A CA  1 
ATOM   1636 C C   . LEU A 1 226 ? 29.865 36.805 32.849  1.00 36.35 ? 227  LEU A C   1 
ATOM   1637 O O   . LEU A 1 226 ? 30.598 37.039 31.879  1.00 37.64 ? 227  LEU A O   1 
ATOM   1638 C CB  . LEU A 1 226 ? 27.391 37.292 32.771  1.00 34.73 ? 227  LEU A CB  1 
ATOM   1639 C CG  . LEU A 1 226 ? 26.172 38.201 33.028  1.00 34.30 ? 227  LEU A CG  1 
ATOM   1640 C CD1 . LEU A 1 226 ? 24.913 37.492 32.543  1.00 35.97 ? 227  LEU A CD1 1 
ATOM   1641 C CD2 . LEU A 1 226 ? 26.030 38.535 34.493  1.00 34.19 ? 227  LEU A CD2 1 
ATOM   1642 N N   . GLY A 1 227 ? 29.992 35.718 33.601  1.00 35.37 ? 228  GLY A N   1 
ATOM   1643 C CA  . GLY A 1 227 ? 31.018 34.732 33.309  1.00 35.49 ? 228  GLY A CA  1 
ATOM   1644 C C   . GLY A 1 227 ? 30.856 34.139 31.928  1.00 36.20 ? 228  GLY A C   1 
ATOM   1645 O O   . GLY A 1 227 ? 31.834 33.753 31.285  1.00 36.56 ? 228  GLY A O   1 
ATOM   1646 N N   . ILE A 1 228 ? 29.612 34.044 31.473  1.00 36.86 ? 229  ILE A N   1 
ATOM   1647 C CA  . ILE A 1 228 ? 29.352 33.511 30.146  1.00 37.35 ? 229  ILE A CA  1 
ATOM   1648 C C   . ILE A 1 228 ? 28.688 34.559 29.263  1.00 38.58 ? 229  ILE A C   1 
ATOM   1649 O O   . ILE A 1 228 ? 27.661 35.145 29.625  1.00 38.99 ? 229  ILE A O   1 
ATOM   1650 C CB  . ILE A 1 228 ? 28.454 32.259 30.195  1.00 35.05 ? 229  ILE A CB  1 
ATOM   1651 C CG1 . ILE A 1 228 ? 29.216 31.106 30.849  1.00 32.73 ? 229  ILE A CG1 1 
ATOM   1652 C CG2 . ILE A 1 228 ? 28.026 31.860 28.781  1.00 32.83 ? 229  ILE A CG2 1 
ATOM   1653 C CD1 . ILE A 1 228 ? 28.432 29.827 30.908  1.00 27.93 ? 229  ILE A CD1 1 
ATOM   1654 N N   . GLY A 1 229 ? 29.291 34.796 28.102  1.00 40.61 ? 230  GLY A N   1 
ATOM   1655 C CA  . GLY A 1 229 ? 28.741 35.772 27.180  1.00 41.05 ? 230  GLY A CA  1 
ATOM   1656 C C   . GLY A 1 229 ? 27.615 35.208 26.339  1.00 39.98 ? 230  GLY A C   1 
ATOM   1657 O O   . GLY A 1 229 ? 27.607 34.016 26.013  1.00 39.81 ? 230  GLY A O   1 
ATOM   1658 N N   . GLY A 1 230 ? 26.655 36.067 26.002  1.00 41.09 ? 231  GLY A N   1 
ATOM   1659 C CA  . GLY A 1 230 ? 25.528 35.651 25.185  1.00 40.02 ? 231  GLY A CA  1 
ATOM   1660 C C   . GLY A 1 230 ? 24.289 35.149 25.908  1.00 40.97 ? 231  GLY A C   1 
ATOM   1661 O O   . GLY A 1 230 ? 23.365 34.647 25.259  1.00 41.02 ? 231  GLY A O   1 
ATOM   1662 N N   . ILE A 1 231 ? 24.249 35.273 27.235  1.00 38.32 ? 232  ILE A N   1 
ATOM   1663 C CA  . ILE A 1 231 ? 23.095 34.812 28.002  1.00 36.38 ? 232  ILE A CA  1 
ATOM   1664 C C   . ILE A 1 231 ? 22.714 35.855 29.033  1.00 36.50 ? 232  ILE A C   1 
ATOM   1665 O O   . ILE A 1 231 ? 23.418 36.849 29.201  1.00 36.46 ? 232  ILE A O   1 
ATOM   1666 C CB  . ILE A 1 231 ? 23.404 33.477 28.756  1.00 35.91 ? 232  ILE A CB  1 
ATOM   1667 C CG1 . ILE A 1 231 ? 24.428 33.715 29.880  1.00 34.65 ? 232  ILE A CG1 1 
ATOM   1668 C CG2 . ILE A 1 231 ? 23.967 32.460 27.791  1.00 35.86 ? 232  ILE A CG2 1 
ATOM   1669 C CD1 . ILE A 1 231 ? 24.714 32.474 30.726  1.00 33.71 ? 232  ILE A CD1 1 
ATOM   1670 N N   A ASP A 1 232 ? 21.595 35.629 29.714  0.60 37.89 ? 233  ASP A N   1 
ATOM   1671 N N   B ASP A 1 232 ? 21.589 35.635 29.708  0.40 37.11 ? 233  ASP A N   1 
ATOM   1672 C CA  A ASP A 1 232 ? 21.147 36.537 30.760  0.60 38.29 ? 233  ASP A CA  1 
ATOM   1673 C CA  B ASP A 1 232 ? 21.118 36.541 30.751  0.40 37.12 ? 233  ASP A CA  1 
ATOM   1674 C C   A ASP A 1 232 ? 21.108 35.772 32.079  0.60 37.31 ? 233  ASP A C   1 
ATOM   1675 C C   B ASP A 1 232 ? 21.047 35.786 32.081  0.40 36.80 ? 233  ASP A C   1 
ATOM   1676 O O   A ASP A 1 232 ? 20.874 34.565 32.096  0.60 36.49 ? 233  ASP A O   1 
ATOM   1677 O O   B ASP A 1 232 ? 20.739 34.596 32.107  0.40 36.42 ? 233  ASP A O   1 
ATOM   1678 C CB  A ASP A 1 232 ? 19.751 37.078 30.470  0.60 40.17 ? 233  ASP A CB  1 
ATOM   1679 C CB  B ASP A 1 232 ? 19.738 37.106 30.398  0.40 37.34 ? 233  ASP A CB  1 
ATOM   1680 C CG  A ASP A 1 232 ? 19.501 38.415 31.142  0.60 41.52 ? 233  ASP A CG  1 
ATOM   1681 C CG  B ASP A 1 232 ? 19.759 37.953 29.134  0.40 37.06 ? 233  ASP A CG  1 
ATOM   1682 O OD1 A ASP A 1 232 ? 19.743 38.542 32.365  0.60 43.41 ? 233  ASP A OD1 1 
ATOM   1683 O OD1 B ASP A 1 232 ? 20.658 38.810 29.000  0.40 36.81 ? 233  ASP A OD1 1 
ATOM   1684 O OD2 A ASP A 1 232 ? 19.063 39.348 30.439  0.60 43.33 ? 233  ASP A OD2 1 
ATOM   1685 O OD2 B ASP A 1 232 ? 18.872 37.766 28.278  0.40 37.06 ? 233  ASP A OD2 1 
ATOM   1686 N N   . ALA A 1 233 ? 21.330 36.484 33.177  1.00 37.42 ? 234  ALA A N   1 
ATOM   1687 C CA  . ALA A 1 233 ? 21.323 35.878 34.517  1.00 37.35 ? 234  ALA A CA  1 
ATOM   1688 C C   . ALA A 1 233 ? 20.064 35.059 34.846  1.00 36.95 ? 234  ALA A C   1 
ATOM   1689 O O   . ALA A 1 233 ? 20.137 34.020 35.519  1.00 35.45 ? 234  ALA A O   1 
ATOM   1690 C CB  . ALA A 1 233 ? 21.532 36.974 35.580  1.00 38.03 ? 234  ALA A CB  1 
ATOM   1691 N N   . THR A 1 234 ? 18.913 35.524 34.372  1.00 34.80 ? 235  THR A N   1 
ATOM   1692 C CA  . THR A 1 234 ? 17.654 34.838 34.616  1.00 34.12 ? 235  THR A CA  1 
ATOM   1693 C C   . THR A 1 234 ? 17.507 33.548 33.829  1.00 32.95 ? 235  THR A C   1 
ATOM   1694 O O   . THR A 1 234 ? 16.607 32.755 34.103  1.00 33.14 ? 235  THR A O   1 
ATOM   1695 C CB  . THR A 1 234 ? 16.454 35.735 34.260  1.00 33.98 ? 235  THR A CB  1 
ATOM   1696 O OG1 . THR A 1 234 ? 16.689 36.354 32.990  1.00 36.74 ? 235  THR A OG1 1 
ATOM   1697 C CG2 . THR A 1 234 ? 16.248 36.797 35.318  1.00 35.69 ? 235  THR A CG2 1 
ATOM   1698 N N   . ASP A 1 235 ? 18.372 33.334 32.845  1.00 32.81 ? 236  ASP A N   1 
ATOM   1699 C CA  . ASP A 1 235 ? 18.266 32.135 32.030  1.00 33.32 ? 236  ASP A CA  1 
ATOM   1700 C C   . ASP A 1 235 ? 18.206 30.871 32.860  1.00 34.29 ? 236  ASP A C   1 
ATOM   1701 O O   . ASP A 1 235 ? 18.970 30.694 33.799  1.00 32.83 ? 236  ASP A O   1 
ATOM   1702 C CB  . ASP A 1 235 ? 19.426 32.048 31.039  1.00 34.47 ? 236  ASP A CB  1 
ATOM   1703 C CG  . ASP A 1 235 ? 19.295 33.053 29.904  1.00 36.88 ? 236  ASP A CG  1 
ATOM   1704 O OD1 . ASP A 1 235 ? 18.287 33.801 29.871  1.00 35.89 ? 236  ASP A OD1 1 
ATOM   1705 O OD2 . ASP A 1 235 ? 20.196 33.091 29.048  1.00 35.34 ? 236  ASP A OD2 1 
ATOM   1706 N N   . LYS A 1 236 ? 17.291 29.982 32.514  1.00 34.31 ? 237  LYS A N   1 
ATOM   1707 C CA  . LYS A 1 236 ? 17.179 28.756 33.275  1.00 35.09 ? 237  LYS A CA  1 
ATOM   1708 C C   . LYS A 1 236 ? 16.749 27.630 32.345  1.00 35.46 ? 237  LYS A C   1 
ATOM   1709 O O   . LYS A 1 236 ? 15.626 27.131 32.424  1.00 36.20 ? 237  LYS A O   1 
ATOM   1710 C CB  . LYS A 1 236 ? 16.184 28.963 34.440  1.00 35.46 ? 237  LYS A CB  1 
ATOM   1711 C CG  . LYS A 1 236 ? 16.105 27.790 35.414  1.00 34.64 ? 237  LYS A CG  1 
ATOM   1712 C CD  . LYS A 1 236 ? 15.244 28.106 36.626  1.00 37.62 ? 237  LYS A CD  1 
ATOM   1713 C CE  . LYS A 1 236 ? 15.075 26.864 37.486  1.00 36.78 ? 237  LYS A CE  1 
ATOM   1714 N NZ  . LYS A 1 236 ? 14.263 27.101 38.689  1.00 40.22 ? 237  LYS A NZ  1 
ATOM   1715 N N   . GLY A 1 237 ? 17.665 27.232 31.466  1.00 35.71 ? 238  GLY A N   1 
ATOM   1716 C CA  . GLY A 1 237 ? 17.379 26.179 30.507  1.00 36.92 ? 238  GLY A CA  1 
ATOM   1717 C C   . GLY A 1 237 ? 17.098 26.746 29.119  1.00 38.21 ? 238  GLY A C   1 
ATOM   1718 O O   . GLY A 1 237 ? 16.811 25.995 28.187  1.00 39.38 ? 238  GLY A O   1 
ATOM   1719 N N   A LYS A 1 238 ? 17.214 28.063 28.985  0.60 38.29 ? 239  LYS A N   1 
ATOM   1720 N N   B LYS A 1 238 ? 17.162 28.068 28.986  0.40 38.35 ? 239  LYS A N   1 
ATOM   1721 C CA  A LYS A 1 238 ? 16.980 28.765 27.719  0.60 39.23 ? 239  LYS A CA  1 
ATOM   1722 C CA  B LYS A 1 238 ? 16.895 28.719 27.703  0.40 39.01 ? 239  LYS A CA  1 
ATOM   1723 C C   A LYS A 1 238 ? 17.787 28.170 26.571  0.60 39.64 ? 239  LYS A C   1 
ATOM   1724 C C   B LYS A 1 238 ? 17.754 28.146 26.588  0.40 39.63 ? 239  LYS A C   1 
ATOM   1725 O O   A LYS A 1 238 ? 18.988 27.944 26.710  0.60 38.15 ? 239  LYS A O   1 
ATOM   1726 O O   B LYS A 1 238 ? 18.949 27.915 26.766  0.40 38.72 ? 239  LYS A O   1 
ATOM   1727 C CB  A LYS A 1 238 ? 17.365 30.240 27.864  0.60 39.56 ? 239  LYS A CB  1 
ATOM   1728 C CB  B LYS A 1 238 ? 17.132 30.231 27.790  0.40 38.97 ? 239  LYS A CB  1 
ATOM   1729 C CG  A LYS A 1 238 ? 16.871 31.129 26.735  0.60 40.51 ? 239  LYS A CG  1 
ATOM   1730 C CG  B LYS A 1 238 ? 16.807 30.964 26.487  0.40 38.54 ? 239  LYS A CG  1 
ATOM   1731 C CD  A LYS A 1 238 ? 15.363 31.205 26.772  0.60 41.33 ? 239  LYS A CD  1 
ATOM   1732 C CD  B LYS A 1 238 ? 17.049 32.464 26.586  0.40 38.23 ? 239  LYS A CD  1 
ATOM   1733 C CE  A LYS A 1 238 ? 14.803 32.110 25.692  0.60 41.84 ? 239  LYS A CE  1 
ATOM   1734 C CE  B LYS A 1 238 ? 16.771 33.149 25.252  0.40 37.97 ? 239  LYS A CE  1 
ATOM   1735 N NZ  A LYS A 1 238 ? 13.322 32.182 25.826  0.60 40.77 ? 239  LYS A NZ  1 
ATOM   1736 N NZ  B LYS A 1 238 ? 17.082 34.607 25.290  0.40 36.59 ? 239  LYS A NZ  1 
ATOM   1737 N N   . GLU A 1 239 ? 17.130 27.938 25.433  1.00 40.26 ? 240  GLU A N   1 
ATOM   1738 C CA  . GLU A 1 239 ? 17.798 27.379 24.254  1.00 42.34 ? 240  GLU A CA  1 
ATOM   1739 C C   . GLU A 1 239 ? 18.606 28.374 23.416  1.00 40.81 ? 240  GLU A C   1 
ATOM   1740 O O   . GLU A 1 239 ? 18.136 29.465 23.105  1.00 40.91 ? 240  GLU A O   1 
ATOM   1741 C CB  . GLU A 1 239 ? 16.766 26.690 23.359  1.00 44.84 ? 240  GLU A CB  1 
ATOM   1742 C CG  . GLU A 1 239 ? 16.831 25.173 23.412  1.00 50.29 ? 240  GLU A CG  1 
ATOM   1743 C CD  . GLU A 1 239 ? 18.047 24.611 22.678  1.00 53.24 ? 240  GLU A CD  1 
ATOM   1744 O OE1 . GLU A 1 239 ? 18.480 23.489 23.027  1.00 56.24 ? 240  GLU A OE1 1 
ATOM   1745 O OE2 . GLU A 1 239 ? 18.563 25.277 21.744  1.00 55.87 ? 240  GLU A OE2 1 
ATOM   1746 N N   . TYR A 1 240 ? 19.824 27.985 23.053  1.00 40.70 ? 241  TYR A N   1 
ATOM   1747 C CA  . TYR A 1 240 ? 20.698 28.825 22.244  1.00 42.06 ? 241  TYR A CA  1 
ATOM   1748 C C   . TYR A 1 240 ? 21.342 28.047 21.094  1.00 44.10 ? 241  TYR A C   1 
ATOM   1749 O O   . TYR A 1 240 ? 22.557 27.826 21.089  1.00 44.47 ? 241  TYR A O   1 
ATOM   1750 C CB  . TYR A 1 240 ? 21.804 29.466 23.094  1.00 40.90 ? 241  TYR A CB  1 
ATOM   1751 C CG  . TYR A 1 240 ? 21.354 30.617 23.980  1.00 41.84 ? 241  TYR A CG  1 
ATOM   1752 C CD1 . TYR A 1 240 ? 20.857 30.393 25.265  1.00 40.55 ? 241  TYR A CD1 1 
ATOM   1753 C CD2 . TYR A 1 240 ? 21.416 31.932 23.523  1.00 41.92 ? 241  TYR A CD2 1 
ATOM   1754 C CE1 . TYR A 1 240 ? 20.439 31.453 26.074  1.00 40.34 ? 241  TYR A CE1 1 
ATOM   1755 C CE2 . TYR A 1 240 ? 20.994 32.998 24.319  1.00 41.74 ? 241  TYR A CE2 1 
ATOM   1756 C CZ  . TYR A 1 240 ? 20.509 32.753 25.596  1.00 42.02 ? 241  TYR A CZ  1 
ATOM   1757 O OH  . TYR A 1 240 ? 20.107 33.814 26.384  1.00 36.99 ? 241  TYR A OH  1 
ATOM   1758 N N   . GLY A 1 241 ? 20.522 27.639 20.123  1.00 45.58 ? 242  GLY A N   1 
ATOM   1759 C CA  . GLY A 1 241 ? 21.025 26.916 18.967  1.00 46.66 ? 242  GLY A CA  1 
ATOM   1760 C C   . GLY A 1 241 ? 21.881 25.718 19.335  1.00 48.32 ? 242  GLY A C   1 
ATOM   1761 O O   . GLY A 1 241 ? 23.086 25.659 19.026  1.00 48.18 ? 242  GLY A O   1 
ATOM   1762 N N   . GLY A 1 242 ? 21.238 24.753 19.981  1.00 48.10 ? 243  GLY A N   1 
ATOM   1763 C CA  . GLY A 1 242 ? 21.926 23.557 20.416  1.00 49.50 ? 243  GLY A CA  1 
ATOM   1764 C C   . GLY A 1 242 ? 22.061 23.594 21.927  1.00 49.51 ? 243  GLY A C   1 
ATOM   1765 O O   . GLY A 1 242 ? 21.320 22.915 22.651  1.00 50.45 ? 243  GLY A O   1 
ATOM   1766 N N   . LYS A 1 243 ? 22.987 24.429 22.397  1.00 47.66 ? 244  LYS A N   1 
ATOM   1767 C CA  . LYS A 1 243 ? 23.259 24.575 23.822  1.00 44.26 ? 244  LYS A CA  1 
ATOM   1768 C C   . LYS A 1 243 ? 22.162 25.242 24.670  1.00 42.38 ? 244  LYS A C   1 
ATOM   1769 O O   . LYS A 1 243 ? 21.481 26.160 24.213  1.00 43.69 ? 244  LYS A O   1 
ATOM   1770 C CB  . LYS A 1 243 ? 24.568 25.357 24.011  1.00 44.37 ? 244  LYS A CB  1 
ATOM   1771 C CG  . LYS A 1 243 ? 25.777 24.782 23.275  1.00 43.61 ? 244  LYS A CG  1 
ATOM   1772 C CD  . LYS A 1 243 ? 25.967 25.387 21.887  1.00 40.14 ? 244  LYS A CD  1 
ATOM   1773 C CE  . LYS A 1 243 ? 27.198 24.809 21.223  1.00 38.01 ? 244  LYS A CE  1 
ATOM   1774 N NZ  . LYS A 1 243 ? 27.042 23.345 21.053  1.00 34.92 ? 244  LYS A NZ  1 
ATOM   1775 N N   A ARG A 1 244 ? 22.002 24.770 25.906  0.60 40.77 ? 245  ARG A N   1 
ATOM   1776 N N   B ARG A 1 244 ? 22.008 24.765 25.905  0.40 40.27 ? 245  ARG A N   1 
ATOM   1777 C CA  A ARG A 1 244 ? 21.025 25.334 26.837  0.60 38.11 ? 245  ARG A CA  1 
ATOM   1778 C CA  B ARG A 1 244 ? 21.031 25.307 26.851  0.40 37.33 ? 245  ARG A CA  1 
ATOM   1779 C C   A ARG A 1 244 ? 21.801 26.024 27.957  0.60 36.49 ? 245  ARG A C   1 
ATOM   1780 C C   B ARG A 1 244 ? 21.799 26.014 27.971  0.40 36.09 ? 245  ARG A C   1 
ATOM   1781 O O   A ARG A 1 244 ? 22.852 25.542 28.369  0.60 34.69 ? 245  ARG A O   1 
ATOM   1782 O O   B ARG A 1 244 ? 22.846 25.534 28.398  0.40 34.97 ? 245  ARG A O   1 
ATOM   1783 C CB  A ARG A 1 244 ? 20.141 24.235 27.416  0.60 39.23 ? 245  ARG A CB  1 
ATOM   1784 C CB  B ARG A 1 244 ? 20.175 24.176 27.428  0.40 37.06 ? 245  ARG A CB  1 
ATOM   1785 C CG  A ARG A 1 244 ? 19.333 23.514 26.362  0.60 41.09 ? 245  ARG A CG  1 
ATOM   1786 C CG  B ARG A 1 244 ? 19.165 23.608 26.443  0.40 36.35 ? 245  ARG A CG  1 
ATOM   1787 C CD  A ARG A 1 244 ? 18.683 22.279 26.921  0.60 42.32 ? 245  ARG A CD  1 
ATOM   1788 C CD  B ARG A 1 244 ? 18.651 22.249 26.881  0.40 35.79 ? 245  ARG A CD  1 
ATOM   1789 N NE  A ARG A 1 244 ? 17.488 22.573 27.706  0.60 44.24 ? 245  ARG A NE  1 
ATOM   1790 N NE  B ARG A 1 244 ? 19.686 21.221 26.810  0.40 34.54 ? 245  ARG A NE  1 
ATOM   1791 C CZ  A ARG A 1 244 ? 16.778 21.639 28.328  0.60 44.56 ? 245  ARG A CZ  1 
ATOM   1792 C CZ  B ARG A 1 244 ? 19.482 19.933 27.076  0.40 35.38 ? 245  ARG A CZ  1 
ATOM   1793 N NH1 A ARG A 1 244 ? 17.160 20.370 28.254  0.60 43.78 ? 245  ARG A NH1 1 
ATOM   1794 N NH1 B ARG A 1 244 ? 18.275 19.510 27.434  0.40 35.26 ? 245  ARG A NH1 1 
ATOM   1795 N NH2 A ARG A 1 244 ? 15.681 21.964 28.999  0.60 44.41 ? 245  ARG A NH2 1 
ATOM   1796 N NH2 B ARG A 1 244 ? 20.481 19.067 26.979  0.40 34.53 ? 245  ARG A NH2 1 
ATOM   1797 N N   . ALA A 1 245 ? 21.283 27.149 28.441  1.00 34.72 ? 246  ALA A N   1 
ATOM   1798 C CA  . ALA A 1 245 ? 21.957 27.908 29.490  1.00 32.91 ? 246  ALA A CA  1 
ATOM   1799 C C   . ALA A 1 245 ? 21.233 28.200 30.797  1.00 32.07 ? 246  ALA A C   1 
ATOM   1800 O O   . ALA A 1 245 ? 20.024 28.458 30.837  1.00 31.16 ? 246  ALA A O   1 
ATOM   1801 C CB  . ALA A 1 245 ? 22.459 29.211 28.915  1.00 31.91 ? 246  ALA A CB  1 
ATOM   1802 N N   . PHE A 1 246 ? 22.025 28.199 31.868  1.00 31.45 ? 247  PHE A N   1 
ATOM   1803 C CA  . PHE A 1 246 ? 21.548 28.502 33.212  1.00 28.72 ? 247  PHE A CA  1 
ATOM   1804 C C   . PHE A 1 246 ? 22.387 29.667 33.737  1.00 28.55 ? 247  PHE A C   1 
ATOM   1805 O O   . PHE A 1 246 ? 23.599 29.524 33.932  1.00 26.56 ? 247  PHE A O   1 
ATOM   1806 C CB  . PHE A 1 246 ? 21.718 27.281 34.139  1.00 28.57 ? 247  PHE A CB  1 
ATOM   1807 C CG  . PHE A 1 246 ? 20.793 26.133 33.815  1.00 26.60 ? 247  PHE A CG  1 
ATOM   1808 C CD1 . PHE A 1 246 ? 21.089 25.248 32.786  1.00 27.24 ? 247  PHE A CD1 1 
ATOM   1809 C CD2 . PHE A 1 246 ? 19.606 25.962 34.516  1.00 27.61 ? 247  PHE A CD2 1 
ATOM   1810 C CE1 . PHE A 1 246 ? 20.219 24.215 32.461  1.00 26.85 ? 247  PHE A CE1 1 
ATOM   1811 C CE2 . PHE A 1 246 ? 18.713 24.913 34.192  1.00 26.55 ? 247  PHE A CE2 1 
ATOM   1812 C CZ  . PHE A 1 246 ? 19.027 24.048 33.167  1.00 26.74 ? 247  PHE A CZ  1 
ATOM   1813 N N   . GLY A 1 247 ? 21.745 30.815 33.957  1.00 27.31 ? 248  GLY A N   1 
ATOM   1814 C CA  . GLY A 1 247 ? 22.447 31.985 34.474  1.00 27.68 ? 248  GLY A CA  1 
ATOM   1815 C C   . GLY A 1 247 ? 22.462 31.985 35.998  1.00 28.52 ? 248  GLY A C   1 
ATOM   1816 O O   . GLY A 1 247 ? 21.748 31.198 36.632  1.00 29.06 ? 248  GLY A O   1 
ATOM   1817 N N   . ALA A 1 248 ? 23.241 32.887 36.590  1.00 28.83 ? 249  ALA A N   1 
ATOM   1818 C CA  . ALA A 1 248 ? 23.380 32.949 38.041  1.00 28.11 ? 249  ALA A CA  1 
ATOM   1819 C C   . ALA A 1 248 ? 22.077 33.156 38.828  1.00 30.38 ? 249  ALA A C   1 
ATOM   1820 O O   . ALA A 1 248 ? 21.896 32.597 39.927  1.00 26.95 ? 249  ALA A O   1 
ATOM   1821 C CB  . ALA A 1 248 ? 24.394 34.036 38.409  1.00 26.77 ? 249  ALA A CB  1 
ATOM   1822 N N   . LEU A 1 249 ? 21.165 33.961 38.292  1.00 29.41 ? 250  LEU A N   1 
ATOM   1823 C CA  . LEU A 1 249 ? 19.910 34.190 38.992  1.00 30.09 ? 250  LEU A CA  1 
ATOM   1824 C C   . LEU A 1 249 ? 18.937 33.019 38.823  1.00 28.78 ? 250  LEU A C   1 
ATOM   1825 O O   . LEU A 1 249 ? 18.093 32.760 39.683  1.00 29.47 ? 250  LEU A O   1 
ATOM   1826 C CB  . LEU A 1 249 ? 19.278 35.502 38.518  1.00 32.20 ? 250  LEU A CB  1 
ATOM   1827 C CG  . LEU A 1 249 ? 20.006 36.778 38.955  1.00 33.57 ? 250  LEU A CG  1 
ATOM   1828 C CD1 . LEU A 1 249 ? 19.279 38.011 38.377  1.00 35.20 ? 250  LEU A CD1 1 
ATOM   1829 C CD2 . LEU A 1 249 ? 20.031 36.845 40.481  1.00 33.48 ? 250  LEU A CD2 1 
ATOM   1830 N N   . GLY A 1 250 ? 19.047 32.304 37.719  1.00 25.70 ? 251  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 250 ? 18.184 31.155 37.533  1.00 28.05 ? 251  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 250 ? 18.624 30.079 38.517  1.00 29.27 ? 251  GLY A C   1 
ATOM   1833 O O   . GLY A 1 250 ? 17.811 29.290 39.015  1.00 29.63 ? 251  GLY A O   1 
ATOM   1834 N N   . ILE A 1 251 ? 19.930 30.039 38.777  1.00 28.95 ? 252  ILE A N   1 
ATOM   1835 C CA  . ILE A 1 251 ? 20.502 29.078 39.716  1.00 28.32 ? 252  ILE A CA  1 
ATOM   1836 C C   . ILE A 1 251 ? 20.158 29.571 41.114  1.00 27.81 ? 252  ILE A C   1 
ATOM   1837 O O   . ILE A 1 251 ? 19.767 28.794 41.981  1.00 29.55 ? 252  ILE A O   1 
ATOM   1838 C CB  . ILE A 1 251 ? 22.057 29.003 39.577  1.00 28.46 ? 252  ILE A CB  1 
ATOM   1839 C CG1 . ILE A 1 251 ? 22.430 28.450 38.207  1.00 31.84 ? 252  ILE A CG1 1 
ATOM   1840 C CG2 . ILE A 1 251 ? 22.666 28.104 40.670  1.00 26.24 ? 252  ILE A CG2 1 
ATOM   1841 C CD1 . ILE A 1 251 ? 21.828 27.096 37.929  1.00 39.18 ? 252  ILE A CD1 1 
ATOM   1842 N N   . GLY A 1 252 ? 20.284 30.880 41.313  1.00 29.49 ? 253  GLY A N   1 
ATOM   1843 C CA  . GLY A 1 252 ? 19.998 31.480 42.606  1.00 30.67 ? 253  GLY A CA  1 
ATOM   1844 C C   . GLY A 1 252 ? 18.600 31.220 43.142  1.00 32.07 ? 253  GLY A C   1 
ATOM   1845 O O   . GLY A 1 252 ? 18.421 31.050 44.355  1.00 31.31 ? 253  GLY A O   1 
ATOM   1846 N N   . GLY A 1 253 ? 17.610 31.192 42.258  1.00 31.20 ? 254  GLY A N   1 
ATOM   1847 C CA  . GLY A 1 253 ? 16.245 30.951 42.700  1.00 31.70 ? 254  GLY A CA  1 
ATOM   1848 C C   . GLY A 1 253 ? 16.109 29.625 43.419  1.00 31.18 ? 254  GLY A C   1 
ATOM   1849 O O   . GLY A 1 253 ? 15.445 29.533 44.461  1.00 30.54 ? 254  GLY A O   1 
ATOM   1850 N N   . LEU A 1 254 ? 16.754 28.596 42.878  1.00 30.09 ? 255  LEU A N   1 
ATOM   1851 C CA  . LEU A 1 254 ? 16.724 27.265 43.483  1.00 29.52 ? 255  LEU A CA  1 
ATOM   1852 C C   . LEU A 1 254 ? 17.563 27.229 44.762  1.00 28.85 ? 255  LEU A C   1 
ATOM   1853 O O   . LEU A 1 254 ? 17.140 26.641 45.763  1.00 28.68 ? 255  LEU A O   1 
ATOM   1854 C CB  . LEU A 1 254 ? 17.238 26.217 42.501  1.00 29.62 ? 255  LEU A CB  1 
ATOM   1855 C CG  . LEU A 1 254 ? 17.277 24.781 43.035  1.00 29.75 ? 255  LEU A CG  1 
ATOM   1856 C CD1 . LEU A 1 254 ? 15.887 24.356 43.508  1.00 28.89 ? 255  LEU A CD1 1 
ATOM   1857 C CD2 . LEU A 1 254 ? 17.792 23.844 41.958  1.00 26.81 ? 255  LEU A CD2 1 
ATOM   1858 N N   A LYS A 1 255 ? 18.736 27.863 44.727  0.60 28.22 ? 256  LYS A N   1 
ATOM   1859 N N   B LYS A 1 255 ? 18.737 27.859 44.728  0.40 28.39 ? 256  LYS A N   1 
ATOM   1860 C CA  A LYS A 1 255 ? 19.615 27.923 45.897  0.60 28.36 ? 256  LYS A CA  1 
ATOM   1861 C CA  B LYS A 1 255 ? 19.611 27.909 45.899  0.40 28.37 ? 256  LYS A CA  1 
ATOM   1862 C C   A LYS A 1 255 ? 18.846 28.448 47.111  0.60 28.48 ? 256  LYS A C   1 
ATOM   1863 C C   B LYS A 1 255 ? 18.848 28.447 47.112  0.40 28.44 ? 256  LYS A C   1 
ATOM   1864 O O   A LYS A 1 255 ? 18.948 27.907 48.218  0.60 28.98 ? 256  LYS A O   1 
ATOM   1865 O O   B LYS A 1 255 ? 18.954 27.910 48.219  0.40 28.72 ? 256  LYS A O   1 
ATOM   1866 C CB  A LYS A 1 255 ? 20.809 28.841 45.617  0.60 27.61 ? 256  LYS A CB  1 
ATOM   1867 C CB  B LYS A 1 255 ? 20.824 28.800 45.612  0.40 27.84 ? 256  LYS A CB  1 
ATOM   1868 C CG  A LYS A 1 255 ? 21.704 29.163 46.824  0.60 28.27 ? 256  LYS A CG  1 
ATOM   1869 C CG  B LYS A 1 255 ? 21.703 29.129 46.821  0.40 28.09 ? 256  LYS A CG  1 
ATOM   1870 C CD  A LYS A 1 255 ? 21.223 30.391 47.585  0.60 29.19 ? 256  LYS A CD  1 
ATOM   1871 C CD  B LYS A 1 255 ? 21.261 30.415 47.496  0.40 28.04 ? 256  LYS A CD  1 
ATOM   1872 C CE  A LYS A 1 255 ? 22.033 30.654 48.856  0.60 32.34 ? 256  LYS A CE  1 
ATOM   1873 C CE  B LYS A 1 255 ? 22.177 30.805 48.648  0.40 29.94 ? 256  LYS A CE  1 
ATOM   1874 N NZ  A LYS A 1 255 ? 23.439 31.114 48.611  0.60 31.01 ? 256  LYS A NZ  1 
ATOM   1875 N NZ  B LYS A 1 255 ? 22.120 29.867 49.811  0.40 27.10 ? 256  LYS A NZ  1 
ATOM   1876 N N   . LEU A 1 256 ? 18.075 29.508 46.903  1.00 27.40 ? 257  LEU A N   1 
ATOM   1877 C CA  . LEU A 1 256 ? 17.304 30.112 47.988  1.00 29.24 ? 257  LEU A CA  1 
ATOM   1878 C C   . LEU A 1 256 ? 16.256 29.138 48.536  1.00 27.57 ? 257  LEU A C   1 
ATOM   1879 O O   . LEU A 1 256 ? 16.115 28.981 49.759  1.00 28.75 ? 257  LEU A O   1 
ATOM   1880 C CB  . LEU A 1 256 ? 16.633 31.397 47.490  1.00 32.48 ? 257  LEU A CB  1 
ATOM   1881 C CG  . LEU A 1 256 ? 16.725 32.624 48.392  1.00 36.96 ? 257  LEU A CG  1 
ATOM   1882 C CD1 . LEU A 1 256 ? 15.942 32.350 49.662  1.00 39.52 ? 257  LEU A CD1 1 
ATOM   1883 C CD2 . LEU A 1 256 ? 18.190 32.951 48.717  1.00 37.30 ? 257  LEU A CD2 1 
ATOM   1884 N N   . LYS A 1 257 ? 15.516 28.487 47.646  1.00 27.67 ? 258  LYS A N   1 
ATOM   1885 C CA  . LYS A 1 257 ? 14.515 27.518 48.088  1.00 28.58 ? 258  LYS A CA  1 
ATOM   1886 C C   . LYS A 1 257 ? 15.189 26.332 48.791  1.00 27.90 ? 258  LYS A C   1 
ATOM   1887 O O   . LYS A 1 257 ? 14.678 25.813 49.782  1.00 25.82 ? 258  LYS A O   1 
ATOM   1888 C CB  . LYS A 1 257 ? 13.698 26.998 46.901  1.00 31.78 ? 258  LYS A CB  1 
ATOM   1889 C CG  . LYS A 1 257 ? 12.749 28.025 46.290  1.00 37.26 ? 258  LYS A CG  1 
ATOM   1890 C CD  . LYS A 1 257 ? 11.753 27.338 45.365  1.00 39.92 ? 258  LYS A CD  1 
ATOM   1891 C CE  . LYS A 1 257 ? 10.725 28.332 44.843  1.00 43.06 ? 258  LYS A CE  1 
ATOM   1892 N NZ  . LYS A 1 257 ? 9.714  27.679 43.953  1.00 46.12 ? 258  LYS A NZ  1 
ATOM   1893 N N   . LEU A 1 258 ? 16.333 25.909 48.260  1.00 27.32 ? 259  LEU A N   1 
ATOM   1894 C CA  . LEU A 1 258 ? 17.096 24.788 48.815  1.00 24.94 ? 259  LEU A CA  1 
ATOM   1895 C C   . LEU A 1 258 ? 17.596 25.070 50.239  1.00 24.16 ? 259  LEU A C   1 
ATOM   1896 O O   . LEU A 1 258 ? 17.450 24.233 51.134  1.00 25.81 ? 259  LEU A O   1 
ATOM   1897 C CB  . LEU A 1 258 ? 18.293 24.478 47.902  1.00 24.67 ? 259  LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 258 ? 19.313 23.430 48.386  1.00 22.35 ? 259  LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 258 ? 18.612 22.090 48.586  1.00 20.81 ? 259  LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 258 ? 20.440 23.276 47.353  1.00 23.41 ? 259  LEU A CD2 1 
ATOM   1901 N N   . HIS A 1 259 ? 18.187 26.246 50.436  1.00 23.18 ? 260  HIS A N   1 
ATOM   1902 C CA  . HIS A 1 259 ? 18.719 26.678 51.731  1.00 24.13 ? 260  HIS A CA  1 
ATOM   1903 C C   . HIS A 1 259 ? 17.565 26.651 52.736  1.00 25.50 ? 260  HIS A C   1 
ATOM   1904 O O   . HIS A 1 259 ? 17.686 26.066 53.812  1.00 24.56 ? 260  HIS A O   1 
ATOM   1905 C CB  . HIS A 1 259 ? 19.327 28.082 51.564  1.00 24.09 ? 260  HIS A CB  1 
ATOM   1906 C CG  . HIS A 1 259 ? 20.114 28.576 52.738  1.00 27.22 ? 260  HIS A CG  1 
ATOM   1907 N ND1 . HIS A 1 259 ? 21.117 29.518 52.610  1.00 27.49 ? 260  HIS A ND1 1 
ATOM   1908 C CD2 . HIS A 1 259 ? 20.040 28.284 54.058  1.00 26.04 ? 260  HIS A CD2 1 
ATOM   1909 C CE1 . HIS A 1 259 ? 21.630 29.776 53.801  1.00 27.11 ? 260  HIS A CE1 1 
ATOM   1910 N NE2 . HIS A 1 259 ? 20.995 29.040 54.696  1.00 25.75 ? 260  HIS A NE2 1 
ATOM   1911 N N   . ARG A 1 260 ? 16.428 27.246 52.368  1.00 26.95 ? 261  ARG A N   1 
ATOM   1912 C CA  . ARG A 1 260 ? 15.264 27.248 53.261  1.00 26.92 ? 261  ARG A CA  1 
ATOM   1913 C C   . ARG A 1 260 ? 14.821 25.831 53.613  1.00 27.44 ? 261  ARG A C   1 
ATOM   1914 O O   . ARG A 1 260 ? 14.590 25.524 54.789  1.00 25.75 ? 261  ARG A O   1 
ATOM   1915 C CB  . ARG A 1 260 ? 14.099 28.007 52.627  1.00 28.06 ? 261  ARG A CB  1 
ATOM   1916 C CG  . ARG A 1 260 ? 14.291 29.505 52.574  1.00 27.00 ? 261  ARG A CG  1 
ATOM   1917 C CD  . ARG A 1 260 ? 13.156 30.106 51.774  1.00 31.95 ? 261  ARG A CD  1 
ATOM   1918 N NE  . ARG A 1 260 ? 13.375 31.510 51.451  1.00 36.24 ? 261  ARG A NE  1 
ATOM   1919 C CZ  . ARG A 1 260 ? 12.897 32.081 50.350  1.00 39.21 ? 261  ARG A CZ  1 
ATOM   1920 N NH1 . ARG A 1 260 ? 12.197 31.356 49.483  1.00 38.24 ? 261  ARG A NH1 1 
ATOM   1921 N NH2 . ARG A 1 260 ? 13.088 33.373 50.130  1.00 40.39 ? 261  ARG A NH2 1 
ATOM   1922 N N   . ALA A 1 261 ? 14.709 24.963 52.607  1.00 26.13 ? 262  ALA A N   1 
ATOM   1923 C CA  . ALA A 1 261 ? 14.294 23.582 52.862  1.00 25.44 ? 262  ALA A CA  1 
ATOM   1924 C C   . ALA A 1 261 ? 15.268 22.798 53.768  1.00 25.02 ? 262  ALA A C   1 
ATOM   1925 O O   . ALA A 1 261 ? 14.838 21.955 54.568  1.00 23.91 ? 262  ALA A O   1 
ATOM   1926 C CB  . ALA A 1 261 ? 14.087 22.847 51.537  1.00 27.20 ? 262  ALA A CB  1 
ATOM   1927 N N   . CYS A 1 262 ? 16.569 23.061 53.640  1.00 22.70 ? 263  CYS A N   1 
ATOM   1928 C CA  . CYS A 1 262 ? 17.570 22.390 54.479  1.00 20.66 ? 263  CYS A CA  1 
ATOM   1929 C C   . CYS A 1 262 ? 17.352 22.831 55.928  1.00 20.76 ? 263  CYS A C   1 
ATOM   1930 O O   . CYS A 1 262 ? 17.400 22.013 56.844  1.00 21.77 ? 263  CYS A O   1 
ATOM   1931 C CB  . CYS A 1 262 ? 18.993 22.773 54.076  1.00 20.44 ? 263  CYS A CB  1 
ATOM   1932 S SG  . CYS A 1 262 ? 19.613 22.132 52.504  1.00 21.90 ? 263  CYS A SG  1 
ATOM   1933 N N   . ILE A 1 263 ? 17.128 24.120 56.147  1.00 22.35 ? 264  ILE A N   1 
ATOM   1934 C CA  . ILE A 1 263 ? 16.888 24.575 57.518  1.00 23.15 ? 264  ILE A CA  1 
ATOM   1935 C C   . ILE A 1 263 ? 15.695 23.813 58.133  1.00 22.51 ? 264  ILE A C   1 
ATOM   1936 O O   . ILE A 1 263 ? 15.778 23.303 59.254  1.00 21.67 ? 264  ILE A O   1 
ATOM   1937 C CB  . ILE A 1 263 ? 16.577 26.084 57.565  1.00 24.88 ? 264  ILE A CB  1 
ATOM   1938 C CG1 . ILE A 1 263 ? 17.814 26.890 57.150  1.00 22.09 ? 264  ILE A CG1 1 
ATOM   1939 C CG2 . ILE A 1 263 ? 16.123 26.482 58.991  1.00 23.29 ? 264  ILE A CG2 1 
ATOM   1940 C CD1 . ILE A 1 263 ? 19.002 26.763 58.101  1.00 23.39 ? 264  ILE A CD1 1 
ATOM   1941 N N   . ALA A 1 264 ? 14.585 23.736 57.399  1.00 22.15 ? 265  ALA A N   1 
ATOM   1942 C CA  . ALA A 1 264 ? 13.409 23.046 57.922  1.00 22.55 ? 265  ALA A CA  1 
ATOM   1943 C C   . ALA A 1 264 ? 13.707 21.585 58.247  1.00 20.84 ? 265  ALA A C   1 
ATOM   1944 O O   . ALA A 1 264 ? 13.220 21.044 59.252  1.00 22.01 ? 265  ALA A O   1 
ATOM   1945 C CB  . ALA A 1 264 ? 12.247 23.148 56.924  1.00 26.31 ? 265  ALA A CB  1 
ATOM   1946 N N   . LYS A 1 265 ? 14.533 20.949 57.421  1.00 20.98 ? 266  LYS A N   1 
ATOM   1947 C CA  . LYS A 1 265 ? 14.871 19.553 57.623  1.00 20.82 ? 266  LYS A CA  1 
ATOM   1948 C C   . LYS A 1 265 ? 15.670 19.348 58.912  1.00 20.68 ? 266  LYS A C   1 
ATOM   1949 O O   . LYS A 1 265 ? 15.566 18.291 59.568  1.00 20.09 ? 266  LYS A O   1 
ATOM   1950 C CB  . LYS A 1 265 ? 15.641 19.028 56.399  1.00 27.03 ? 266  LYS A CB  1 
ATOM   1951 C CG  . LYS A 1 265 ? 15.539 17.530 56.243  1.00 35.89 ? 266  LYS A CG  1 
ATOM   1952 C CD  . LYS A 1 265 ? 15.241 17.109 54.805  1.00 38.26 ? 266  LYS A CD  1 
ATOM   1953 C CE  . LYS A 1 265 ? 15.347 15.590 54.693  1.00 41.78 ? 266  LYS A CE  1 
ATOM   1954 N NZ  . LYS A 1 265 ? 14.990 15.056 53.338  1.00 45.24 ? 266  LYS A NZ  1 
ATOM   1955 N N   . LEU A 1 266 ? 16.454 20.356 59.289  1.00 18.64 ? 267  LEU A N   1 
ATOM   1956 C CA  . LEU A 1 266 ? 17.248 20.277 60.514  1.00 19.30 ? 267  LEU A CA  1 
ATOM   1957 C C   . LEU A 1 266 ? 16.382 20.018 61.732  1.00 20.52 ? 267  LEU A C   1 
ATOM   1958 O O   . LEU A 1 266 ? 16.848 19.428 62.710  1.00 21.12 ? 267  LEU A O   1 
ATOM   1959 C CB  . LEU A 1 266 ? 18.028 21.580 60.757  1.00 18.90 ? 267  LEU A CB  1 
ATOM   1960 C CG  . LEU A 1 266 ? 19.144 21.947 59.763  1.00 20.24 ? 267  LEU A CG  1 
ATOM   1961 C CD1 . LEU A 1 266 ? 19.842 23.246 60.242  1.00 17.25 ? 267  LEU A CD1 1 
ATOM   1962 C CD2 . LEU A 1 266 ? 20.163 20.812 59.683  1.00 20.34 ? 267  LEU A CD2 1 
ATOM   1963 N N   . PHE A 1 267 ? 15.127 20.473 61.686  1.00 19.61 ? 268  PHE A N   1 
ATOM   1964 C CA  . PHE A 1 267 ? 14.210 20.327 62.825  1.00 19.84 ? 268  PHE A CA  1 
ATOM   1965 C C   . PHE A 1 267 ? 13.294 19.098 62.780  1.00 22.47 ? 268  PHE A C   1 
ATOM   1966 O O   . PHE A 1 267 ? 12.450 18.909 63.665  1.00 21.81 ? 268  PHE A O   1 
ATOM   1967 C CB  . PHE A 1 267 ? 13.362 21.603 62.984  1.00 18.68 ? 268  PHE A CB  1 
ATOM   1968 C CG  . PHE A 1 267 ? 14.184 22.832 63.280  1.00 19.08 ? 268  PHE A CG  1 
ATOM   1969 C CD1 . PHE A 1 267 ? 14.271 23.868 62.359  1.00 17.06 ? 268  PHE A CD1 1 
ATOM   1970 C CD2 . PHE A 1 267 ? 14.929 22.919 64.471  1.00 17.22 ? 268  PHE A CD2 1 
ATOM   1971 C CE1 . PHE A 1 267 ? 15.089 24.990 62.601  1.00 19.96 ? 268  PHE A CE1 1 
ATOM   1972 C CE2 . PHE A 1 267 ? 15.754 24.043 64.722  1.00 18.07 ? 268  PHE A CE2 1 
ATOM   1973 C CZ  . PHE A 1 267 ? 15.827 25.077 63.781  1.00 17.69 ? 268  PHE A CZ  1 
ATOM   1974 N N   . GLU A 1 268 ? 13.476 18.257 61.771  1.00 23.37 ? 269  GLU A N   1 
ATOM   1975 C CA  . GLU A 1 268 ? 12.652 17.047 61.636  1.00 26.32 ? 269  GLU A CA  1 
ATOM   1976 C C   . GLU A 1 268 ? 13.346 15.824 62.217  1.00 25.65 ? 269  GLU A C   1 
ATOM   1977 O O   . GLU A 1 268 ? 12.739 14.744 62.334  1.00 25.42 ? 269  GLU A O   1 
ATOM   1978 C CB  . GLU A 1 268 ? 12.297 16.815 60.155  1.00 26.11 ? 269  GLU A CB  1 
ATOM   1979 C CG  . GLU A 1 268 ? 11.449 17.954 59.596  1.00 33.60 ? 269  GLU A CG  1 
ATOM   1980 C CD  . GLU A 1 268 ? 11.170 17.850 58.098  1.00 39.69 ? 269  GLU A CD  1 
ATOM   1981 O OE1 . GLU A 1 268 ? 11.857 17.062 57.392  1.00 41.34 ? 269  GLU A OE1 1 
ATOM   1982 O OE2 . GLU A 1 268 ? 10.264 18.587 57.625  1.00 43.65 ? 269  GLU A OE2 1 
ATOM   1983 N N   . SER A 1 269 ? 14.605 16.013 62.612  1.00 25.08 ? 270  SER A N   1 
ATOM   1984 C CA  . SER A 1 269 ? 15.434 14.953 63.174  1.00 25.62 ? 270  SER A CA  1 
ATOM   1985 C C   . SER A 1 269 ? 16.569 15.568 63.992  1.00 24.17 ? 270  SER A C   1 
ATOM   1986 O O   . SER A 1 269 ? 16.907 16.725 63.797  1.00 25.46 ? 270  SER A O   1 
ATOM   1987 C CB  . SER A 1 269 ? 16.056 14.130 62.045  1.00 25.54 ? 270  SER A CB  1 
ATOM   1988 O OG  . SER A 1 269 ? 16.950 13.169 62.551  1.00 29.75 ? 270  SER A OG  1 
ATOM   1989 N N   . SER A 1 270 ? 17.154 14.780 64.885  1.00 23.04 ? 271  SER A N   1 
ATOM   1990 C CA  . SER A 1 270 ? 18.277 15.247 65.695  1.00 26.05 ? 271  SER A CA  1 
ATOM   1991 C C   . SER A 1 270 ? 19.583 14.639 65.195  1.00 25.29 ? 271  SER A C   1 
ATOM   1992 O O   . SER A 1 270 ? 20.587 14.712 65.874  1.00 25.66 ? 271  SER A O   1 
ATOM   1993 C CB  . SER A 1 270 ? 18.076 14.904 67.185  1.00 26.81 ? 271  SER A CB  1 
ATOM   1994 O OG  . SER A 1 270 ? 17.661 13.568 67.347  1.00 30.14 ? 271  SER A OG  1 
ATOM   1995 N N   . GLU A 1 271 ? 19.575 14.000 64.031  1.00 25.83 ? 272  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 271 ? 20.841 13.484 63.532  1.00 28.32 ? 272  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 271 ? 21.195 13.750 62.077  1.00 26.69 ? 272  GLU A C   1 
ATOM   1998 O O   . GLU A 1 271 ? 21.971 13.018 61.469  1.00 25.65 ? 272  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 271 ? 21.022 12.008 63.854  1.00 34.50 ? 272  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 271 ? 19.893 11.090 63.556  1.00 39.81 ? 272  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 271 ? 19.894 9.950  64.553  1.00 43.52 ? 272  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 271 ? 20.993 9.430  64.848  1.00 45.35 ? 272  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 271 ? 18.809 9.577  65.048  1.00 47.43 ? 272  GLU A OE2 1 
ATOM   2004 N N   . GLY A 1 272 ? 20.663 14.835 61.534  1.00 25.09 ? 273  GLY A N   1 
ATOM   2005 C CA  . GLY A 1 272 ? 20.994 15.187 60.167  1.00 22.98 ? 273  GLY A CA  1 
ATOM   2006 C C   . GLY A 1 272 ? 22.359 15.841 60.126  1.00 23.90 ? 273  GLY A C   1 
ATOM   2007 O O   . GLY A 1 272 ? 22.758 16.537 61.069  1.00 24.57 ? 273  GLY A O   1 
ATOM   2008 N N   . VAL A 1 273 ? 23.105 15.580 59.055  1.00 22.32 ? 274  VAL A N   1 
ATOM   2009 C CA  . VAL A 1 273 ? 24.417 16.169 58.856  1.00 19.89 ? 274  VAL A CA  1 
ATOM   2010 C C   . VAL A 1 273 ? 24.364 16.668 57.417  1.00 22.41 ? 274  VAL A C   1 
ATOM   2011 O O   . VAL A 1 273 ? 24.401 15.876 56.469  1.00 21.79 ? 274  VAL A O   1 
ATOM   2012 C CB  . VAL A 1 273 ? 25.568 15.120 59.003  1.00 22.55 ? 274  VAL A CB  1 
ATOM   2013 C CG1 . VAL A 1 273 ? 26.915 15.795 58.781  1.00 20.86 ? 274  VAL A CG1 1 
ATOM   2014 C CG2 . VAL A 1 273 ? 25.529 14.480 60.396  1.00 18.75 ? 274  VAL A CG2 1 
ATOM   2015 N N   . PHE A 1 274 ? 24.252 17.979 57.252  1.00 19.49 ? 275  PHE A N   1 
ATOM   2016 C CA  . PHE A 1 274 ? 24.150 18.549 55.923  1.00 20.98 ? 275  PHE A CA  1 
ATOM   2017 C C   . PHE A 1 274 ? 25.388 19.268 55.417  1.00 22.39 ? 275  PHE A C   1 
ATOM   2018 O O   . PHE A 1 274 ? 25.617 20.422 55.775  1.00 19.73 ? 275  PHE A O   1 
ATOM   2019 C CB  . PHE A 1 274 ? 22.944 19.500 55.857  1.00 21.86 ? 275  PHE A CB  1 
ATOM   2020 C CG  . PHE A 1 274 ? 21.616 18.798 55.912  1.00 26.74 ? 275  PHE A CG  1 
ATOM   2021 C CD1 . PHE A 1 274 ? 21.098 18.342 57.118  1.00 26.11 ? 275  PHE A CD1 1 
ATOM   2022 C CD2 . PHE A 1 274 ? 20.902 18.549 54.739  1.00 29.30 ? 275  PHE A CD2 1 
ATOM   2023 C CE1 . PHE A 1 274 ? 19.894 17.644 57.168  1.00 29.11 ? 275  PHE A CE1 1 
ATOM   2024 C CE2 . PHE A 1 274 ? 19.696 17.854 54.769  1.00 29.90 ? 275  PHE A CE2 1 
ATOM   2025 C CZ  . PHE A 1 274 ? 19.189 17.398 55.988  1.00 30.35 ? 275  PHE A CZ  1 
ATOM   2026 N N   . ASP A 1 275 ? 26.196 18.559 54.622  1.00 21.28 ? 276  ASP A N   1 
ATOM   2027 C CA  . ASP A 1 275 ? 27.380 19.126 53.976  1.00 20.19 ? 276  ASP A CA  1 
ATOM   2028 C C   . ASP A 1 275 ? 27.078 18.916 52.479  1.00 20.46 ? 276  ASP A C   1 
ATOM   2029 O O   . ASP A 1 275 ? 25.940 18.566 52.130  1.00 19.19 ? 276  ASP A O   1 
ATOM   2030 C CB  . ASP A 1 275 ? 28.669 18.398 54.395  1.00 20.04 ? 276  ASP A CB  1 
ATOM   2031 C CG  . ASP A 1 275 ? 29.950 19.196 54.047  1.00 22.11 ? 276  ASP A CG  1 
ATOM   2032 O OD1 . ASP A 1 275 ? 29.891 20.178 53.264  1.00 20.19 ? 276  ASP A OD1 1 
ATOM   2033 O OD2 . ASP A 1 275 ? 31.041 18.829 54.556  1.00 21.78 ? 276  ASP A OD2 1 
ATOM   2034 N N   . ALA A 1 276 ? 28.065 19.084 51.598  1.00 21.62 ? 277  ALA A N   1 
ATOM   2035 C CA  . ALA A 1 276 ? 27.795 18.959 50.160  1.00 20.46 ? 277  ALA A CA  1 
ATOM   2036 C C   . ALA A 1 276 ? 26.994 17.747 49.685  1.00 22.05 ? 277  ALA A C   1 
ATOM   2037 O O   . ALA A 1 276 ? 26.036 17.904 48.936  1.00 22.32 ? 277  ALA A O   1 
ATOM   2038 C CB  . ALA A 1 276 ? 29.092 19.072 49.365  1.00 20.95 ? 277  ALA A CB  1 
ATOM   2039 N N   . GLU A 1 277 ? 27.360 16.543 50.107  1.00 21.54 ? 278  GLU A N   1 
ATOM   2040 C CA  . GLU A 1 277 ? 26.635 15.365 49.655  1.00 24.21 ? 278  GLU A CA  1 
ATOM   2041 C C   . GLU A 1 277 ? 25.143 15.370 49.990  1.00 25.68 ? 278  GLU A C   1 
ATOM   2042 O O   . GLU A 1 277 ? 24.310 15.106 49.120  1.00 24.03 ? 278  GLU A O   1 
ATOM   2043 C CB  . GLU A 1 277 ? 27.257 14.093 50.226  1.00 26.91 ? 278  GLU A CB  1 
ATOM   2044 C CG  . GLU A 1 277 ? 28.731 13.886 49.910  1.00 28.39 ? 278  GLU A CG  1 
ATOM   2045 C CD  . GLU A 1 277 ? 29.655 14.427 50.995  1.00 28.66 ? 278  GLU A CD  1 
ATOM   2046 O OE1 . GLU A 1 277 ? 30.791 13.926 51.101  1.00 27.98 ? 278  GLU A OE1 1 
ATOM   2047 O OE2 . GLU A 1 277 ? 29.251 15.346 51.733  1.00 26.87 ? 278  GLU A OE2 1 
ATOM   2048 N N   . GLU A 1 278 ? 24.791 15.651 51.243  1.00 24.93 ? 279  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 278 ? 23.373 15.649 51.622  1.00 25.50 ? 279  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 278 ? 22.564 16.814 51.051  1.00 24.10 ? 279  GLU A C   1 
ATOM   2051 O O   . GLU A 1 278 ? 21.401 16.644 50.702  1.00 26.12 ? 279  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 278 ? 23.202 15.615 53.153  1.00 27.10 ? 279  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 278 ? 23.195 14.212 53.803  1.00 34.15 ? 279  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 278 ? 22.023 13.330 53.360  1.00 35.84 ? 279  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 278 ? 20.847 13.737 53.521  1.00 40.92 ? 279  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 278 ? 22.281 12.218 52.856  1.00 40.96 ? 279  GLU A OE2 1 
ATOM   2057 N N   . ILE A 1 279 ? 23.159 17.998 50.977  1.00 22.86 ? 280  ILE A N   1 
ATOM   2058 C CA  . ILE A 1 279 ? 22.479 19.164 50.428  1.00 21.12 ? 280  ILE A CA  1 
ATOM   2059 C C   . ILE A 1 279 ? 22.179 18.913 48.927  1.00 23.59 ? 280  ILE A C   1 
ATOM   2060 O O   . ILE A 1 279 ? 21.108 19.260 48.419  1.00 22.24 ? 280  ILE A O   1 
ATOM   2061 C CB  . ILE A 1 279 ? 23.384 20.442 50.625  1.00 22.86 ? 280  ILE A CB  1 
ATOM   2062 C CG1 . ILE A 1 279 ? 23.430 20.796 52.120  1.00 23.71 ? 280  ILE A CG1 1 
ATOM   2063 C CG2 . ILE A 1 279 ? 22.871 21.616 49.781  1.00 20.79 ? 280  ILE A CG2 1 
ATOM   2064 C CD1 . ILE A 1 279 ? 24.422 21.884 52.508  1.00 22.36 ? 280  ILE A CD1 1 
ATOM   2065 N N   . TYR A 1 280 ? 23.129 18.293 48.232  1.00 23.90 ? 281  TYR A N   1 
ATOM   2066 C CA  . TYR A 1 280 ? 22.973 17.990 46.806  1.00 25.20 ? 281  TYR A CA  1 
ATOM   2067 C C   . TYR A 1 280 ? 21.882 16.920 46.580  1.00 26.38 ? 281  TYR A C   1 
ATOM   2068 O O   . TYR A 1 280 ? 21.135 16.969 45.598  1.00 24.45 ? 281  TYR A O   1 
ATOM   2069 C CB  . TYR A 1 280 ? 24.315 17.535 46.227  1.00 25.19 ? 281  TYR A CB  1 
ATOM   2070 C CG  . TYR A 1 280 ? 24.234 17.134 44.764  1.00 28.41 ? 281  TYR A CG  1 
ATOM   2071 C CD1 . TYR A 1 280 ? 23.814 18.049 43.797  1.00 28.62 ? 281  TYR A CD1 1 
ATOM   2072 C CD2 . TYR A 1 280 ? 24.529 15.833 44.358  1.00 28.01 ? 281  TYR A CD2 1 
ATOM   2073 C CE1 . TYR A 1 280 ? 23.685 17.679 42.465  1.00 29.32 ? 281  TYR A CE1 1 
ATOM   2074 C CE2 . TYR A 1 280 ? 24.404 15.449 43.017  1.00 31.77 ? 281  TYR A CE2 1 
ATOM   2075 C CZ  . TYR A 1 280 ? 23.978 16.378 42.079  1.00 31.51 ? 281  TYR A CZ  1 
ATOM   2076 O OH  . TYR A 1 280 ? 23.803 16.012 40.755  1.00 30.24 ? 281  TYR A OH  1 
ATOM   2077 N N   . LYS A 1 281 ? 21.784 15.965 47.499  1.00 27.38 ? 282  LYS A N   1 
ATOM   2078 C CA  . LYS A 1 281 ? 20.760 14.921 47.423  1.00 29.21 ? 282  LYS A CA  1 
ATOM   2079 C C   . LYS A 1 281 ? 19.375 15.573 47.481  1.00 29.53 ? 282  LYS A C   1 
ATOM   2080 O O   . LYS A 1 281 ? 18.458 15.191 46.746  1.00 29.86 ? 282  LYS A O   1 
ATOM   2081 C CB  . LYS A 1 281 ? 20.951 13.930 48.582  1.00 32.39 ? 282  LYS A CB  1 
ATOM   2082 C CG  . LYS A 1 281 ? 19.926 12.812 48.664  1.00 35.36 ? 282  LYS A CG  1 
ATOM   2083 C CD  . LYS A 1 281 ? 20.503 11.644 49.483  1.00 38.54 ? 282  LYS A CD  1 
ATOM   2084 C CE  . LYS A 1 281 ? 19.575 11.188 50.615  1.00 40.45 ? 282  LYS A CE  1 
ATOM   2085 N NZ  . LYS A 1 281 ? 18.306 10.549 50.145  1.00 44.82 ? 282  LYS A NZ  1 
ATOM   2086 N N   . LEU A 1 282 ? 19.230 16.583 48.329  1.00 28.14 ? 283  LEU A N   1 
ATOM   2087 C CA  . LEU A 1 282 ? 17.960 17.310 48.453  1.00 29.25 ? 283  LEU A CA  1 
ATOM   2088 C C   . LEU A 1 282 ? 17.733 18.217 47.242  1.00 29.70 ? 283  LEU A C   1 
ATOM   2089 O O   . LEU A 1 282 ? 16.588 18.429 46.814  1.00 29.52 ? 283  LEU A O   1 
ATOM   2090 C CB  . LEU A 1 282 ? 17.945 18.163 49.738  1.00 28.31 ? 283  LEU A CB  1 
ATOM   2091 C CG  . LEU A 1 282 ? 16.688 18.983 50.060  1.00 30.09 ? 283  LEU A CG  1 
ATOM   2092 C CD1 . LEU A 1 282 ? 15.474 18.067 50.040  1.00 31.82 ? 283  LEU A CD1 1 
ATOM   2093 C CD2 . LEU A 1 282 ? 16.807 19.657 51.434  1.00 31.13 ? 283  LEU A CD2 1 
ATOM   2094 N N   . ALA A 1 283 ? 18.824 18.764 46.703  1.00 29.00 ? 284  ALA A N   1 
ATOM   2095 C CA  . ALA A 1 283 ? 18.753 19.640 45.536  1.00 28.95 ? 284  ALA A CA  1 
ATOM   2096 C C   . ALA A 1 283 ? 18.149 18.892 44.333  1.00 29.96 ? 284  ALA A C   1 
ATOM   2097 O O   . ALA A 1 283 ? 17.360 19.452 43.556  1.00 27.50 ? 284  ALA A O   1 
ATOM   2098 C CB  . ALA A 1 283 ? 20.148 20.139 45.180  1.00 26.90 ? 284  ALA A CB  1 
ATOM   2099 N N   . LYS A 1 284 ? 18.540 17.635 44.182  1.00 30.54 ? 285  LYS A N   1 
ATOM   2100 C CA  . LYS A 1 284 ? 18.042 16.825 43.082  1.00 33.00 ? 285  LYS A CA  1 
ATOM   2101 C C   . LYS A 1 284 ? 16.547 16.553 43.221  1.00 34.00 ? 285  LYS A C   1 
ATOM   2102 O O   . LYS A 1 284 ? 15.861 16.362 42.220  1.00 34.59 ? 285  LYS A O   1 
ATOM   2103 C CB  . LYS A 1 284 ? 18.811 15.501 42.994  1.00 31.43 ? 285  LYS A CB  1 
ATOM   2104 C CG  . LYS A 1 284 ? 20.284 15.667 42.670  1.00 33.21 ? 285  LYS A CG  1 
ATOM   2105 C CD  . LYS A 1 284 ? 20.963 14.346 42.279  1.00 31.19 ? 285  LYS A CD  1 
ATOM   2106 C CE  . LYS A 1 284 ? 20.497 13.844 40.901  1.00 34.58 ? 285  LYS A CE  1 
ATOM   2107 N NZ  . LYS A 1 284 ? 21.242 12.621 40.485  1.00 33.60 ? 285  LYS A NZ  1 
ATOM   2108 N N   . GLU A 1 285 ? 16.040 16.541 44.453  1.00 34.98 ? 286  GLU A N   1 
ATOM   2109 C CA  . GLU A 1 285 ? 14.612 16.289 44.701  1.00 35.39 ? 286  GLU A CA  1 
ATOM   2110 C C   . GLU A 1 285 ? 13.785 17.544 44.455  1.00 36.13 ? 286  GLU A C   1 
ATOM   2111 O O   . GLU A 1 285 ? 12.564 17.473 44.293  1.00 35.78 ? 286  GLU A O   1 
ATOM   2112 C CB  . GLU A 1 285 ? 14.374 15.845 46.155  1.00 38.70 ? 286  GLU A CB  1 
ATOM   2113 C CG  . GLU A 1 285 ? 14.836 14.430 46.500  1.00 40.16 ? 286  GLU A CG  1 
ATOM   2114 C CD  . GLU A 1 285 ? 14.709 14.119 47.995  1.00 43.64 ? 286  GLU A CD  1 
ATOM   2115 O OE1 . GLU A 1 285 ? 13.818 14.699 48.664  1.00 41.86 ? 286  GLU A OE1 1 
ATOM   2116 O OE2 . GLU A 1 285 ? 15.495 13.280 48.495  1.00 42.92 ? 286  GLU A OE2 1 
ATOM   2117 N N   . MET A 1 286 ? 14.460 18.690 44.426  1.00 33.16 ? 287  MET A N   1 
ATOM   2118 C CA  . MET A 1 286 ? 13.804 19.976 44.243  1.00 34.21 ? 287  MET A CA  1 
ATOM   2119 C C   . MET A 1 286 ? 13.994 20.674 42.883  1.00 33.57 ? 287  MET A C   1 
ATOM   2120 O O   . MET A 1 286 ? 13.211 21.554 42.540  1.00 34.13 ? 287  MET A O   1 
ATOM   2121 C CB  . MET A 1 286 ? 14.269 20.947 45.339  1.00 32.57 ? 287  MET A CB  1 
ATOM   2122 C CG  . MET A 1 286 ? 13.912 20.545 46.771  1.00 30.90 ? 287  MET A CG  1 
ATOM   2123 S SD  . MET A 1 286 ? 14.508 21.746 48.000  1.00 29.39 ? 287  MET A SD  1 
ATOM   2124 C CE  . MET A 1 286 ? 13.249 23.046 47.884  1.00 28.53 ? 287  MET A CE  1 
ATOM   2125 N N   . ALA A 1 287 ? 15.029 20.299 42.127  1.00 34.02 ? 288  ALA A N   1 
ATOM   2126 C CA  . ALA A 1 287 ? 15.332 20.938 40.839  1.00 33.46 ? 288  ALA A CA  1 
ATOM   2127 C C   . ALA A 1 287 ? 14.196 20.900 39.808  1.00 35.33 ? 288  ALA A C   1 
ATOM   2128 O O   . ALA A 1 287 ? 13.907 21.966 39.226  1.00 35.71 ? 288  ALA A O   1 
ATOM   2129 C CB  . ALA A 1 287 ? 16.580 20.327 40.245  1.00 32.86 ? 288  ALA A CB  1 
ATOM   2130 O OXT . ALA A 1 287 ? 13.629 19.814 39.582  1.00 35.19 ? 288  ALA A OXT 1 
ATOM   2131 N N   . SER B 1 1   ? 2.007  42.107 75.834  1.00 33.83 ? 2    SER B N   1 
ATOM   2132 C CA  . SER B 1 1   ? 3.411  42.424 75.429  1.00 33.43 ? 2    SER B CA  1 
ATOM   2133 C C   . SER B 1 1   ? 4.257  41.149 75.436  1.00 29.87 ? 2    SER B C   1 
ATOM   2134 O O   . SER B 1 1   ? 4.026  40.251 76.243  1.00 32.21 ? 2    SER B O   1 
ATOM   2135 C CB  . SER B 1 1   ? 4.027  43.411 76.410  1.00 36.04 ? 2    SER B CB  1 
ATOM   2136 O OG  . SER B 1 1   ? 3.039  44.270 76.959  1.00 44.71 ? 2    SER B OG  1 
ATOM   2137 N N   . LYS B 1 2   ? 5.236  41.068 74.545  1.00 27.44 ? 3    LYS B N   1 
ATOM   2138 C CA  . LYS B 1 2   ? 6.109  39.899 74.499  1.00 25.38 ? 3    LYS B CA  1 
ATOM   2139 C C   . LYS B 1 2   ? 7.000  39.840 75.748  1.00 23.64 ? 3    LYS B C   1 
ATOM   2140 O O   . LYS B 1 2   ? 7.408  40.877 76.291  1.00 19.65 ? 3    LYS B O   1 
ATOM   2141 C CB  . LYS B 1 2   ? 6.969  39.952 73.239  1.00 29.39 ? 3    LYS B CB  1 
ATOM   2142 C CG  . LYS B 1 2   ? 6.173  39.796 71.967  1.00 32.77 ? 3    LYS B CG  1 
ATOM   2143 C CD  . LYS B 1 2   ? 5.428  38.456 72.013  1.00 39.77 ? 3    LYS B CD  1 
ATOM   2144 C CE  . LYS B 1 2   ? 4.885  38.030 70.653  1.00 41.47 ? 3    LYS B CE  1 
ATOM   2145 N NZ  . LYS B 1 2   ? 4.891  36.532 70.566  1.00 42.31 ? 3    LYS B NZ  1 
ATOM   2146 N N   . LYS B 1 3   ? 7.277  38.621 76.208  1.00 21.36 ? 4    LYS B N   1 
ATOM   2147 C CA  . LYS B 1 3   ? 8.124  38.390 77.377  1.00 19.98 ? 4    LYS B CA  1 
ATOM   2148 C C   . LYS B 1 3   ? 9.578  38.451 76.888  1.00 19.61 ? 4    LYS B C   1 
ATOM   2149 O O   . LYS B 1 3   ? 10.039 37.573 76.144  1.00 19.19 ? 4    LYS B O   1 
ATOM   2150 C CB  . LYS B 1 3   ? 7.788  37.014 78.002  1.00 20.65 ? 4    LYS B CB  1 
ATOM   2151 C CG  . LYS B 1 3   ? 6.481  37.048 78.840  1.00 17.96 ? 4    LYS B CG  1 
ATOM   2152 C CD  . LYS B 1 3   ? 6.015  35.643 79.297  1.00 22.80 ? 4    LYS B CD  1 
ATOM   2153 C CE  . LYS B 1 3   ? 5.550  34.778 78.104  1.00 23.67 ? 4    LYS B CE  1 
ATOM   2154 N NZ  . LYS B 1 3   ? 5.267  33.321 78.482  1.00 26.01 ? 4    LYS B NZ  1 
ATOM   2155 N N   . LEU B 1 4   ? 10.277 39.514 77.286  1.00 18.86 ? 5    LEU B N   1 
ATOM   2156 C CA  . LEU B 1 4   ? 11.656 39.742 76.854  1.00 18.16 ? 5    LEU B CA  1 
ATOM   2157 C C   . LEU B 1 4   ? 12.663 39.508 77.982  1.00 18.59 ? 5    LEU B C   1 
ATOM   2158 O O   . LEU B 1 4   ? 12.588 40.154 79.034  1.00 16.66 ? 5    LEU B O   1 
ATOM   2159 C CB  . LEU B 1 4   ? 11.802 41.185 76.346  1.00 18.91 ? 5    LEU B CB  1 
ATOM   2160 C CG  . LEU B 1 4   ? 10.779 41.735 75.346  1.00 17.68 ? 5    LEU B CG  1 
ATOM   2161 C CD1 . LEU B 1 4   ? 11.068 43.251 75.126  1.00 17.43 ? 5    LEU B CD1 1 
ATOM   2162 C CD2 . LEU B 1 4   ? 10.831 40.947 74.020  1.00 18.03 ? 5    LEU B CD2 1 
ATOM   2163 N N   . LEU B 1 5   ? 13.584 38.563 77.776  1.00 17.03 ? 6    LEU B N   1 
ATOM   2164 C CA  . LEU B 1 5   ? 14.621 38.267 78.770  1.00 14.36 ? 6    LEU B CA  1 
ATOM   2165 C C   . LEU B 1 5   ? 15.945 38.879 78.288  1.00 16.27 ? 6    LEU B C   1 
ATOM   2166 O O   . LEU B 1 5   ? 16.326 38.727 77.113  1.00 14.99 ? 6    LEU B O   1 
ATOM   2167 C CB  . LEU B 1 5   ? 14.802 36.749 78.919  1.00 17.01 ? 6    LEU B CB  1 
ATOM   2168 C CG  . LEU B 1 5   ? 15.808 36.285 79.975  1.00 16.75 ? 6    LEU B CG  1 
ATOM   2169 C CD1 . LEU B 1 5   ? 15.212 36.513 81.387  1.00 15.73 ? 6    LEU B CD1 1 
ATOM   2170 C CD2 . LEU B 1 5   ? 16.128 34.775 79.769  1.00 18.52 ? 6    LEU B CD2 1 
ATOM   2171 N N   . PHE B 1 6   ? 16.618 39.610 79.169  1.00 16.58 ? 7    PHE B N   1 
ATOM   2172 C CA  . PHE B 1 6   ? 17.925 40.166 78.831  1.00 15.89 ? 7    PHE B CA  1 
ATOM   2173 C C   . PHE B 1 6   ? 18.962 39.381 79.629  1.00 15.74 ? 7    PHE B C   1 
ATOM   2174 O O   . PHE B 1 6   ? 18.951 39.367 80.860  1.00 16.44 ? 7    PHE B O   1 
ATOM   2175 C CB  . PHE B 1 6   ? 17.971 41.667 79.115  1.00 16.17 ? 7    PHE B CB  1 
ATOM   2176 C CG  . PHE B 1 6   ? 17.194 42.469 78.106  1.00 15.87 ? 7    PHE B CG  1 
ATOM   2177 C CD1 . PHE B 1 6   ? 15.852 42.744 78.306  1.00 15.60 ? 7    PHE B CD1 1 
ATOM   2178 C CD2 . PHE B 1 6   ? 17.778 42.811 76.882  1.00 16.99 ? 7    PHE B CD2 1 
ATOM   2179 C CE1 . PHE B 1 6   ? 15.068 43.341 77.290  1.00 14.27 ? 7    PHE B CE1 1 
ATOM   2180 C CE2 . PHE B 1 6   ? 17.020 43.413 75.855  1.00 15.26 ? 7    PHE B CE2 1 
ATOM   2181 C CZ  . PHE B 1 6   ? 15.661 43.675 76.062  1.00 15.93 ? 7    PHE B CZ  1 
ATOM   2182 N N   . GLN B 1 7   ? 19.831 38.682 78.896  1.00 14.94 ? 8    GLN B N   1 
ATOM   2183 C CA  . GLN B 1 7   ? 20.866 37.820 79.464  1.00 13.97 ? 8    GLN B CA  1 
ATOM   2184 C C   . GLN B 1 7   ? 22.215 38.542 79.543  1.00 14.31 ? 8    GLN B C   1 
ATOM   2185 O O   . GLN B 1 7   ? 22.767 38.918 78.524  1.00 15.82 ? 8    GLN B O   1 
ATOM   2186 C CB  . GLN B 1 7   ? 20.984 36.570 78.576  1.00 15.07 ? 8    GLN B CB  1 
ATOM   2187 C CG  . GLN B 1 7   ? 22.176 35.687 78.841  1.00 14.18 ? 8    GLN B CG  1 
ATOM   2188 C CD  . GLN B 1 7   ? 22.267 34.522 77.837  1.00 15.42 ? 8    GLN B CD  1 
ATOM   2189 O OE1 . GLN B 1 7   ? 21.716 34.602 76.743  1.00 16.52 ? 8    GLN B OE1 1 
ATOM   2190 N NE2 . GLN B 1 7   ? 23.000 33.446 78.209  1.00 14.85 ? 8    GLN B NE2 1 
ATOM   2191 N N   . PHE B 1 8   ? 22.726 38.726 80.755  1.00 14.63 ? 9    PHE B N   1 
ATOM   2192 C CA  . PHE B 1 8   ? 24.004 39.416 80.995  1.00 14.65 ? 9    PHE B CA  1 
ATOM   2193 C C   . PHE B 1 8   ? 25.010 38.369 81.465  1.00 15.02 ? 9    PHE B C   1 
ATOM   2194 O O   . PHE B 1 8   ? 24.896 37.888 82.588  1.00 15.77 ? 9    PHE B O   1 
ATOM   2195 C CB  . PHE B 1 8   ? 23.841 40.475 82.105  1.00 14.87 ? 9    PHE B CB  1 
ATOM   2196 C CG  . PHE B 1 8   ? 22.834 41.557 81.788  1.00 18.45 ? 9    PHE B CG  1 
ATOM   2197 C CD1 . PHE B 1 8   ? 22.086 42.154 82.817  1.00 16.18 ? 9    PHE B CD1 1 
ATOM   2198 C CD2 . PHE B 1 8   ? 22.615 41.969 80.469  1.00 14.30 ? 9    PHE B CD2 1 
ATOM   2199 C CE1 . PHE B 1 8   ? 21.117 43.144 82.538  1.00 18.10 ? 9    PHE B CE1 1 
ATOM   2200 C CE2 . PHE B 1 8   ? 21.652 42.959 80.176  1.00 17.87 ? 9    PHE B CE2 1 
ATOM   2201 C CZ  . PHE B 1 8   ? 20.898 43.550 81.211  1.00 17.13 ? 9    PHE B CZ  1 
ATOM   2202 N N   . ASP B 1 9   ? 25.985 38.035 80.611  1.00 14.89 ? 10   ASP B N   1 
ATOM   2203 C CA  . ASP B 1 9   ? 27.014 37.015 80.892  1.00 14.20 ? 10   ASP B CA  1 
ATOM   2204 C C   . ASP B 1 9   ? 28.396 37.667 81.122  1.00 17.20 ? 10   ASP B C   1 
ATOM   2205 O O   . ASP B 1 9   ? 28.809 38.570 80.377  1.00 18.54 ? 10   ASP B O   1 
ATOM   2206 C CB  . ASP B 1 9   ? 27.069 36.040 79.703  1.00 15.91 ? 10   ASP B CB  1 
ATOM   2207 C CG  . ASP B 1 9   ? 27.735 34.723 80.042  1.00 17.08 ? 10   ASP B CG  1 
ATOM   2208 O OD1 . ASP B 1 9   ? 28.909 34.730 80.473  1.00 16.28 ? 10   ASP B OD1 1 
ATOM   2209 O OD2 . ASP B 1 9   ? 27.075 33.674 79.856  1.00 18.24 ? 10   ASP B OD2 1 
ATOM   2210 N N   . THR B 1 10  ? 29.101 37.243 82.162  1.00 15.94 ? 11   THR B N   1 
ATOM   2211 C CA  . THR B 1 10  ? 30.412 37.820 82.443  1.00 17.21 ? 11   THR B CA  1 
ATOM   2212 C C   . THR B 1 10  ? 31.531 37.288 81.522  1.00 18.97 ? 11   THR B C   1 
ATOM   2213 O O   . THR B 1 10  ? 32.594 37.903 81.424  1.00 18.99 ? 11   THR B O   1 
ATOM   2214 C CB  . THR B 1 10  ? 30.771 37.626 83.918  1.00 17.05 ? 11   THR B CB  1 
ATOM   2215 O OG1 . THR B 1 10  ? 30.677 36.244 84.270  1.00 18.66 ? 11   THR B OG1 1 
ATOM   2216 C CG2 . THR B 1 10  ? 29.787 38.381 84.786  1.00 17.11 ? 11   THR B CG2 1 
ATOM   2217 N N   . ASP B 1 11  ? 31.281 36.165 80.840  1.00 17.26 ? 12   ASP B N   1 
ATOM   2218 C CA  . ASP B 1 11  ? 32.250 35.594 79.903  1.00 19.28 ? 12   ASP B CA  1 
ATOM   2219 C C   . ASP B 1 11  ? 32.203 36.349 78.577  1.00 19.61 ? 12   ASP B C   1 
ATOM   2220 O O   . ASP B 1 11  ? 31.307 37.158 78.349  1.00 18.50 ? 12   ASP B O   1 
ATOM   2221 C CB  . ASP B 1 11  ? 31.955 34.112 79.642  1.00 20.30 ? 12   ASP B CB  1 
ATOM   2222 C CG  . ASP B 1 11  ? 32.166 33.251 80.876  1.00 20.66 ? 12   ASP B CG  1 
ATOM   2223 O OD1 . ASP B 1 11  ? 33.088 33.533 81.675  1.00 21.34 ? 12   ASP B OD1 1 
ATOM   2224 O OD2 . ASP B 1 11  ? 31.407 32.282 81.044  1.00 20.40 ? 12   ASP B OD2 1 
ATOM   2225 N N   . ALA B 1 12  ? 33.137 36.063 77.680  1.00 19.30 ? 13   ALA B N   1 
ATOM   2226 C CA  . ALA B 1 12  ? 33.181 36.779 76.409  1.00 20.27 ? 13   ALA B CA  1 
ATOM   2227 C C   . ALA B 1 12  ? 31.909 36.705 75.565  1.00 18.54 ? 13   ALA B C   1 
ATOM   2228 O O   . ALA B 1 12  ? 31.555 37.680 74.919  1.00 19.80 ? 13   ALA B O   1 
ATOM   2229 C CB  . ALA B 1 12  ? 34.378 36.307 75.592  1.00 22.21 ? 13   ALA B CB  1 
ATOM   2230 N N   . THR B 1 13  ? 31.220 35.565 75.563  1.00 16.31 ? 14   THR B N   1 
ATOM   2231 C CA  . THR B 1 13  ? 29.968 35.426 74.789  1.00 15.77 ? 14   THR B CA  1 
ATOM   2232 C C   . THR B 1 13  ? 28.933 34.770 75.713  1.00 15.78 ? 14   THR B C   1 
ATOM   2233 O O   . THR B 1 13  ? 29.314 34.091 76.672  1.00 14.75 ? 14   THR B O   1 
ATOM   2234 C CB  . THR B 1 13  ? 30.157 34.533 73.540  1.00 16.48 ? 14   THR B CB  1 
ATOM   2235 O OG1 . THR B 1 13  ? 30.652 33.248 73.947  1.00 17.72 ? 14   THR B OG1 1 
ATOM   2236 C CG2 . THR B 1 13  ? 31.135 35.190 72.545  1.00 16.80 ? 14   THR B CG2 1 
ATOM   2237 N N   . PRO B 1 14  ? 27.626 34.943 75.440  1.00 15.40 ? 15   PRO B N   1 
ATOM   2238 C CA  . PRO B 1 14  ? 26.630 34.330 76.335  1.00 15.65 ? 15   PRO B CA  1 
ATOM   2239 C C   . PRO B 1 14  ? 26.500 32.810 76.228  1.00 16.35 ? 15   PRO B C   1 
ATOM   2240 O O   . PRO B 1 14  ? 26.539 32.249 75.137  1.00 17.82 ? 15   PRO B O   1 
ATOM   2241 C CB  . PRO B 1 14  ? 25.311 34.994 75.926  1.00 13.93 ? 15   PRO B CB  1 
ATOM   2242 C CG  . PRO B 1 14  ? 25.717 36.248 75.206  1.00 14.15 ? 15   PRO B CG  1 
ATOM   2243 C CD  . PRO B 1 14  ? 26.957 35.795 74.438  1.00 15.42 ? 15   PRO B CD  1 
ATOM   2244 N N   . SER B 1 15  ? 26.282 32.178 77.375  1.00 16.12 ? 16   SER B N   1 
ATOM   2245 C CA  . SER B 1 15  ? 26.097 30.730 77.476  1.00 18.12 ? 16   SER B CA  1 
ATOM   2246 C C   . SER B 1 15  ? 24.921 30.189 76.643  1.00 18.64 ? 16   SER B C   1 
ATOM   2247 O O   . SER B 1 15  ? 23.789 30.634 76.795  1.00 17.82 ? 16   SER B O   1 
ATOM   2248 C CB  . SER B 1 15  ? 25.868 30.351 78.951  1.00 19.42 ? 16   SER B CB  1 
ATOM   2249 O OG  . SER B 1 15  ? 25.310 29.052 79.059  1.00 20.71 ? 16   SER B OG  1 
ATOM   2250 N N   . VAL B 1 16  ? 25.203 29.242 75.751  1.00 17.04 ? 17   VAL B N   1 
ATOM   2251 C CA  . VAL B 1 16  ? 24.155 28.597 74.927  1.00 14.74 ? 17   VAL B CA  1 
ATOM   2252 C C   . VAL B 1 16  ? 23.188 27.844 75.846  1.00 14.90 ? 17   VAL B C   1 
ATOM   2253 O O   . VAL B 1 16  ? 21.981 27.851 75.616  1.00 16.47 ? 17   VAL B O   1 
ATOM   2254 C CB  . VAL B 1 16  ? 24.794 27.594 73.950  1.00 16.03 ? 17   VAL B CB  1 
ATOM   2255 C CG1 . VAL B 1 16  ? 23.727 26.659 73.272  1.00 13.14 ? 17   VAL B CG1 1 
ATOM   2256 C CG2 . VAL B 1 16  ? 25.539 28.379 72.864  1.00 13.01 ? 17   VAL B CG2 1 
ATOM   2257 N N   . PHE B 1 17  ? 23.722 27.179 76.878  1.00 16.90 ? 18   PHE B N   1 
ATOM   2258 C CA  . PHE B 1 17  ? 22.883 26.418 77.816  1.00 17.95 ? 18   PHE B CA  1 
ATOM   2259 C C   . PHE B 1 17  ? 21.800 27.348 78.403  1.00 18.96 ? 18   PHE B C   1 
ATOM   2260 O O   . PHE B 1 17  ? 20.601 27.018 78.420  1.00 19.10 ? 18   PHE B O   1 
ATOM   2261 C CB  . PHE B 1 17  ? 23.762 25.826 78.936  1.00 18.47 ? 18   PHE B CB  1 
ATOM   2262 C CG  . PHE B 1 17  ? 23.023 24.899 79.913  1.00 22.12 ? 18   PHE B CG  1 
ATOM   2263 C CD1 . PHE B 1 17  ? 23.202 23.508 79.856  1.00 23.98 ? 18   PHE B CD1 1 
ATOM   2264 C CD2 . PHE B 1 17  ? 22.149 25.409 80.865  1.00 22.49 ? 18   PHE B CD2 1 
ATOM   2265 C CE1 . PHE B 1 17  ? 22.521 22.649 80.730  1.00 21.96 ? 18   PHE B CE1 1 
ATOM   2266 C CE2 . PHE B 1 17  ? 21.453 24.560 81.748  1.00 24.14 ? 18   PHE B CE2 1 
ATOM   2267 C CZ  . PHE B 1 17  ? 21.644 23.172 81.676  1.00 21.73 ? 18   PHE B CZ  1 
ATOM   2268 N N   . ASP B 1 18  ? 22.214 28.520 78.862  1.00 18.14 ? 19   ASP B N   1 
ATOM   2269 C CA  . ASP B 1 18  ? 21.252 29.437 79.478  1.00 16.88 ? 19   ASP B CA  1 
ATOM   2270 C C   . ASP B 1 18  ? 20.190 29.950 78.462  1.00 17.73 ? 19   ASP B C   1 
ATOM   2271 O O   . ASP B 1 18  ? 19.054 30.301 78.844  1.00 15.26 ? 19   ASP B O   1 
ATOM   2272 C CB  . ASP B 1 18  ? 22.013 30.596 80.165  1.00 17.03 ? 19   ASP B CB  1 
ATOM   2273 C CG  . ASP B 1 18  ? 22.850 30.133 81.381  1.00 19.36 ? 19   ASP B CG  1 
ATOM   2274 O OD1 . ASP B 1 18  ? 22.521 29.097 82.018  1.00 18.52 ? 19   ASP B OD1 1 
ATOM   2275 O OD2 . ASP B 1 18  ? 23.831 30.814 81.737  1.00 18.66 ? 19   ASP B OD2 1 
ATOM   2276 N N   . VAL B 1 19  ? 20.535 29.971 77.169  1.00 16.31 ? 20   VAL B N   1 
ATOM   2277 C CA  . VAL B 1 19  ? 19.598 30.425 76.137  1.00 15.88 ? 20   VAL B CA  1 
ATOM   2278 C C   . VAL B 1 19  ? 18.477 29.406 75.910  1.00 16.81 ? 20   VAL B C   1 
ATOM   2279 O O   . VAL B 1 19  ? 17.280 29.750 75.905  1.00 17.09 ? 20   VAL B O   1 
ATOM   2280 C CB  . VAL B 1 19  ? 20.314 30.683 74.761  1.00 15.96 ? 20   VAL B CB  1 
ATOM   2281 C CG1 . VAL B 1 19  ? 19.261 30.949 73.648  1.00 16.22 ? 20   VAL B CG1 1 
ATOM   2282 C CG2 . VAL B 1 19  ? 21.235 31.898 74.866  1.00 17.02 ? 20   VAL B CG2 1 
ATOM   2283 N N   . VAL B 1 20  ? 18.843 28.143 75.729  1.00 17.03 ? 21   VAL B N   1 
ATOM   2284 C CA  . VAL B 1 20  ? 17.809 27.130 75.481  1.00 16.21 ? 21   VAL B CA  1 
ATOM   2285 C C   . VAL B 1 20  ? 16.839 27.044 76.665  1.00 16.15 ? 21   VAL B C   1 
ATOM   2286 O O   . VAL B 1 20  ? 15.618 27.029 76.492  1.00 17.54 ? 21   VAL B O   1 
ATOM   2287 C CB  . VAL B 1 20  ? 18.425 25.720 75.271  1.00 17.05 ? 21   VAL B CB  1 
ATOM   2288 C CG1 . VAL B 1 20  ? 17.310 24.704 75.003  1.00 15.68 ? 21   VAL B CG1 1 
ATOM   2289 C CG2 . VAL B 1 20  ? 19.403 25.729 74.084  1.00 16.25 ? 21   VAL B CG2 1 
ATOM   2290 N N   . VAL B 1 21  ? 17.390 27.011 77.873  1.00 17.36 ? 22   VAL B N   1 
ATOM   2291 C CA  . VAL B 1 21  ? 16.572 26.880 79.075  1.00 14.77 ? 22   VAL B CA  1 
ATOM   2292 C C   . VAL B 1 21  ? 15.657 28.065 79.215  1.00 17.97 ? 22   VAL B C   1 
ATOM   2293 O O   . VAL B 1 21  ? 14.503 27.914 79.621  1.00 16.57 ? 22   VAL B O   1 
ATOM   2294 C CB  . VAL B 1 21  ? 17.446 26.732 80.322  1.00 15.62 ? 22   VAL B CB  1 
ATOM   2295 C CG1 . VAL B 1 21  ? 16.553 26.600 81.556  1.00 17.82 ? 22   VAL B CG1 1 
ATOM   2296 C CG2 . VAL B 1 21  ? 18.318 25.488 80.175  1.00 17.34 ? 22   VAL B CG2 1 
ATOM   2297 N N   . GLY B 1 22  ? 16.176 29.247 78.899  1.00 16.16 ? 23   GLY B N   1 
ATOM   2298 C CA  . GLY B 1 22  ? 15.345 30.441 78.941  1.00 15.06 ? 23   GLY B CA  1 
ATOM   2299 C C   . GLY B 1 22  ? 14.134 30.374 78.014  1.00 17.74 ? 23   GLY B C   1 
ATOM   2300 O O   . GLY B 1 22  ? 13.026 30.792 78.407  1.00 17.72 ? 23   GLY B O   1 
ATOM   2301 N N   . TYR B 1 23  ? 14.304 29.879 76.786  1.00 15.21 ? 24   TYR B N   1 
ATOM   2302 C CA  . TYR B 1 23  ? 13.158 29.795 75.893  1.00 15.85 ? 24   TYR B CA  1 
ATOM   2303 C C   . TYR B 1 23  ? 12.203 28.700 76.398  1.00 17.96 ? 24   TYR B C   1 
ATOM   2304 O O   . TYR B 1 23  ? 10.976 28.858 76.347  1.00 17.23 ? 24   TYR B O   1 
ATOM   2305 C CB  . TYR B 1 23  ? 13.580 29.468 74.437  1.00 16.70 ? 24   TYR B CB  1 
ATOM   2306 C CG  . TYR B 1 23  ? 14.097 30.684 73.692  1.00 17.65 ? 24   TYR B CG  1 
ATOM   2307 C CD1 . TYR B 1 23  ? 15.430 30.762 73.265  1.00 18.22 ? 24   TYR B CD1 1 
ATOM   2308 C CD2 . TYR B 1 23  ? 13.246 31.777 73.432  1.00 17.22 ? 24   TYR B CD2 1 
ATOM   2309 C CE1 . TYR B 1 23  ? 15.910 31.899 72.598  1.00 17.22 ? 24   TYR B CE1 1 
ATOM   2310 C CE2 . TYR B 1 23  ? 13.717 32.917 72.763  1.00 15.54 ? 24   TYR B CE2 1 
ATOM   2311 C CZ  . TYR B 1 23  ? 15.042 32.972 72.354  1.00 20.13 ? 24   TYR B CZ  1 
ATOM   2312 O OH  . TYR B 1 23  ? 15.495 34.116 71.712  1.00 17.19 ? 24   TYR B OH  1 
ATOM   2313 N N   . ASP B 1 24  ? 12.746 27.582 76.877  1.00 18.15 ? 25   ASP B N   1 
ATOM   2314 C CA  . ASP B 1 24  ? 11.849 26.529 77.372  1.00 19.44 ? 25   ASP B CA  1 
ATOM   2315 C C   . ASP B 1 24  ? 11.133 26.965 78.659  1.00 22.36 ? 25   ASP B C   1 
ATOM   2316 O O   . ASP B 1 24  ? 10.135 26.343 79.068  1.00 22.18 ? 25   ASP B O   1 
ATOM   2317 C CB  . ASP B 1 24  ? 12.614 25.217 77.597  1.00 20.48 ? 25   ASP B CB  1 
ATOM   2318 C CG  . ASP B 1 24  ? 12.886 24.470 76.298  1.00 20.13 ? 25   ASP B CG  1 
ATOM   2319 O OD1 . ASP B 1 24  ? 12.131 24.666 75.319  1.00 19.59 ? 25   ASP B OD1 1 
ATOM   2320 O OD2 . ASP B 1 24  ? 13.845 23.658 76.259  1.00 21.65 ? 25   ASP B OD2 1 
ATOM   2321 N N   . GLY B 1 25  ? 11.657 28.006 79.309  1.00 18.33 ? 26   GLY B N   1 
ATOM   2322 C CA  . GLY B 1 25  ? 11.028 28.557 80.497  1.00 20.10 ? 26   GLY B CA  1 
ATOM   2323 C C   . GLY B 1 25  ? 9.919  29.554 80.126  1.00 21.72 ? 26   GLY B C   1 
ATOM   2324 O O   . GLY B 1 25  ? 9.236  30.107 80.996  1.00 24.48 ? 26   GLY B O   1 
ATOM   2325 N N   . GLY B 1 26  ? 9.734  29.814 78.841  1.00 18.58 ? 27   GLY B N   1 
ATOM   2326 C CA  . GLY B 1 26  ? 8.673  30.723 78.431  1.00 20.80 ? 27   GLY B CA  1 
ATOM   2327 C C   . GLY B 1 26  ? 9.023  32.099 77.884  1.00 21.09 ? 27   GLY B C   1 
ATOM   2328 O O   . GLY B 1 26  ? 8.116  32.858 77.477  1.00 20.90 ? 27   GLY B O   1 
ATOM   2329 N N   . ALA B 1 27  ? 10.303 32.472 77.886  1.00 18.70 ? 28   ALA B N   1 
ATOM   2330 C CA  . ALA B 1 27  ? 10.639 33.777 77.315  1.00 19.58 ? 28   ALA B CA  1 
ATOM   2331 C C   . ALA B 1 27  ? 10.253 33.791 75.829  1.00 19.84 ? 28   ALA B C   1 
ATOM   2332 O O   . ALA B 1 27  ? 10.435 32.795 75.129  1.00 18.78 ? 28   ALA B O   1 
ATOM   2333 C CB  . ALA B 1 27  ? 12.143 34.054 77.461  1.00 21.60 ? 28   ALA B CB  1 
ATOM   2334 N N   . ASP B 1 28  ? 9.728  34.916 75.343  1.00 16.96 ? 29   ASP B N   1 
ATOM   2335 C CA  . ASP B 1 28  ? 9.385  35.047 73.923  1.00 18.37 ? 29   ASP B CA  1 
ATOM   2336 C C   . ASP B 1 28  ? 10.634 35.463 73.119  1.00 18.19 ? 29   ASP B C   1 
ATOM   2337 O O   . ASP B 1 28  ? 10.775 35.090 71.957  1.00 18.18 ? 29   ASP B O   1 
ATOM   2338 C CB  . ASP B 1 28  ? 8.260  36.088 73.699  1.00 19.58 ? 29   ASP B CB  1 
ATOM   2339 C CG  . ASP B 1 28  ? 6.901  35.602 74.201  1.00 24.17 ? 29   ASP B CG  1 
ATOM   2340 O OD1 . ASP B 1 28  ? 6.495  34.486 73.820  1.00 24.59 ? 29   ASP B OD1 1 
ATOM   2341 O OD2 . ASP B 1 28  ? 6.238  36.338 74.972  1.00 21.21 ? 29   ASP B OD2 1 
ATOM   2342 N N   . HIS B 1 29  ? 11.559 36.182 73.763  1.00 18.25 ? 30   HIS B N   1 
ATOM   2343 C CA  . HIS B 1 29  ? 12.794 36.624 73.101  1.00 19.78 ? 30   HIS B CA  1 
ATOM   2344 C C   . HIS B 1 29  ? 13.903 36.765 74.133  1.00 19.00 ? 30   HIS B C   1 
ATOM   2345 O O   . HIS B 1 29  ? 13.657 37.201 75.265  1.00 17.03 ? 30   HIS B O   1 
ATOM   2346 C CB  . HIS B 1 29  ? 12.594 37.986 72.407  1.00 21.67 ? 30   HIS B CB  1 
ATOM   2347 C CG  . HIS B 1 29  ? 11.653 37.932 71.239  1.00 24.66 ? 30   HIS B CG  1 
ATOM   2348 N ND1 . HIS B 1 29  ? 10.352 38.386 71.305  1.00 27.81 ? 30   HIS B ND1 1 
ATOM   2349 C CD2 . HIS B 1 29  ? 11.804 37.393 70.003  1.00 23.70 ? 30   HIS B CD2 1 
ATOM   2350 C CE1 . HIS B 1 29  ? 9.736  38.120 70.162  1.00 24.40 ? 30   HIS B CE1 1 
ATOM   2351 N NE2 . HIS B 1 29  ? 10.595 37.517 69.357  1.00 29.70 ? 30   HIS B NE2 1 
ATOM   2352 N N   . ILE B 1 30  ? 15.113 36.373 73.759  1.00 15.67 ? 31   ILE B N   1 
ATOM   2353 C CA  . ILE B 1 30  ? 16.243 36.505 74.683  1.00 14.09 ? 31   ILE B CA  1 
ATOM   2354 C C   . ILE B 1 30  ? 17.314 37.302 73.943  1.00 16.79 ? 31   ILE B C   1 
ATOM   2355 O O   . ILE B 1 30  ? 17.682 36.950 72.816  1.00 17.80 ? 31   ILE B O   1 
ATOM   2356 C CB  . ILE B 1 30  ? 16.818 35.132 75.084  1.00 14.73 ? 31   ILE B CB  1 
ATOM   2357 C CG1 . ILE B 1 30  ? 15.783 34.341 75.901  1.00 16.93 ? 31   ILE B CG1 1 
ATOM   2358 C CG2 . ILE B 1 30  ? 18.053 35.312 75.994  1.00 13.54 ? 31   ILE B CG2 1 
ATOM   2359 C CD1 . ILE B 1 30  ? 16.264 32.969 76.270  1.00 18.39 ? 31   ILE B CD1 1 
ATOM   2360 N N   . THR B 1 31  ? 17.793 38.378 74.563  1.00 16.82 ? 32   THR B N   1 
ATOM   2361 C CA  . THR B 1 31  ? 18.825 39.217 73.963  1.00 15.85 ? 32   THR B CA  1 
ATOM   2362 C C   . THR B 1 31  ? 20.022 39.141 74.913  1.00 16.27 ? 32   THR B C   1 
ATOM   2363 O O   . THR B 1 31  ? 19.916 39.516 76.091  1.00 15.53 ? 32   THR B O   1 
ATOM   2364 C CB  . THR B 1 31  ? 18.334 40.661 73.840  1.00 17.17 ? 32   THR B CB  1 
ATOM   2365 O OG1 . THR B 1 31  ? 17.089 40.668 73.119  1.00 17.02 ? 32   THR B OG1 1 
ATOM   2366 C CG2 . THR B 1 31  ? 19.351 41.514 73.062  1.00 15.67 ? 32   THR B CG2 1 
ATOM   2367 N N   . GLY B 1 32  ? 21.141 38.635 74.410  1.00 15.45 ? 33   GLY B N   1 
ATOM   2368 C CA  . GLY B 1 32  ? 22.316 38.449 75.256  1.00 16.08 ? 33   GLY B CA  1 
ATOM   2369 C C   . GLY B 1 32  ? 23.533 39.320 75.011  1.00 15.31 ? 33   GLY B C   1 
ATOM   2370 O O   . GLY B 1 32  ? 23.815 39.722 73.879  1.00 18.40 ? 33   GLY B O   1 
ATOM   2371 N N   . TYR B 1 33  ? 24.267 39.578 76.090  1.00 15.87 ? 34   TYR B N   1 
ATOM   2372 C CA  . TYR B 1 33  ? 25.475 40.404 76.099  1.00 15.52 ? 34   TYR B CA  1 
ATOM   2373 C C   . TYR B 1 33  ? 26.615 39.680 76.831  1.00 18.26 ? 34   TYR B C   1 
ATOM   2374 O O   . TYR B 1 33  ? 26.391 39.061 77.878  1.00 17.09 ? 34   TYR B O   1 
ATOM   2375 C CB  . TYR B 1 33  ? 25.197 41.724 76.862  1.00 15.97 ? 34   TYR B CB  1 
ATOM   2376 C CG  . TYR B 1 33  ? 24.168 42.608 76.198  1.00 17.86 ? 34   TYR B CG  1 
ATOM   2377 C CD1 . TYR B 1 33  ? 22.791 42.327 76.301  1.00 17.78 ? 34   TYR B CD1 1 
ATOM   2378 C CD2 . TYR B 1 33  ? 24.564 43.698 75.429  1.00 17.99 ? 34   TYR B CD2 1 
ATOM   2379 C CE1 . TYR B 1 33  ? 21.836 43.117 75.638  1.00 17.56 ? 34   TYR B CE1 1 
ATOM   2380 C CE2 . TYR B 1 33  ? 23.626 44.492 74.765  1.00 19.21 ? 34   TYR B CE2 1 
ATOM   2381 C CZ  . TYR B 1 33  ? 22.265 44.191 74.872  1.00 17.54 ? 34   TYR B CZ  1 
ATOM   2382 O OH  . TYR B 1 33  ? 21.342 44.941 74.186  1.00 16.41 ? 34   TYR B OH  1 
ATOM   2383 N N   . GLY B 1 34  ? 27.826 39.752 76.277  1.00 17.13 ? 35   GLY B N   1 
ATOM   2384 C CA  . GLY B 1 34  ? 28.986 39.169 76.923  1.00 17.86 ? 35   GLY B CA  1 
ATOM   2385 C C   . GLY B 1 34  ? 29.866 40.287 77.505  1.00 18.20 ? 35   GLY B C   1 
ATOM   2386 O O   . GLY B 1 34  ? 29.608 41.485 77.264  1.00 16.33 ? 35   GLY B O   1 
ATOM   2387 N N   . ASN B 1 35  ? 30.900 39.905 78.261  1.00 17.23 ? 36   ASN B N   1 
ATOM   2388 C CA  . ASN B 1 35  ? 31.821 40.840 78.923  1.00 19.96 ? 36   ASN B CA  1 
ATOM   2389 C C   . ASN B 1 35  ? 31.109 41.918 79.735  1.00 20.66 ? 36   ASN B C   1 
ATOM   2390 O O   . ASN B 1 35  ? 31.537 43.077 79.750  1.00 19.69 ? 36   ASN B O   1 
ATOM   2391 C CB  . ASN B 1 35  ? 32.773 41.542 77.928  1.00 21.34 ? 36   ASN B CB  1 
ATOM   2392 C CG  . ASN B 1 35  ? 33.878 40.625 77.414  1.00 23.99 ? 36   ASN B CG  1 
ATOM   2393 O OD1 . ASN B 1 35  ? 34.325 39.717 78.098  1.00 25.29 ? 36   ASN B OD1 1 
ATOM   2394 N ND2 . ASN B 1 35  ? 34.330 40.884 76.202  1.00 31.90 ? 36   ASN B ND2 1 
ATOM   2395 N N   . VAL B 1 36  ? 30.035 41.540 80.425  1.00 19.34 ? 37   VAL B N   1 
ATOM   2396 C CA  . VAL B 1 36  ? 29.292 42.484 81.248  1.00 16.47 ? 37   VAL B CA  1 
ATOM   2397 C C   . VAL B 1 36  ? 30.064 42.700 82.566  1.00 19.70 ? 37   VAL B C   1 
ATOM   2398 O O   . VAL B 1 36  ? 30.625 41.755 83.128  1.00 19.87 ? 37   VAL B O   1 
ATOM   2399 C CB  . VAL B 1 36  ? 27.879 41.923 81.525  1.00 18.82 ? 37   VAL B CB  1 
ATOM   2400 C CG1 . VAL B 1 36  ? 27.094 42.855 82.445  1.00 16.21 ? 37   VAL B CG1 1 
ATOM   2401 C CG2 . VAL B 1 36  ? 27.136 41.750 80.182  1.00 13.86 ? 37   VAL B CG2 1 
ATOM   2402 N N   . THR B 1 37  ? 30.134 43.939 83.035  1.00 18.23 ? 38   THR B N   1 
ATOM   2403 C CA  . THR B 1 37  ? 30.827 44.233 84.273  1.00 19.89 ? 38   THR B CA  1 
ATOM   2404 C C   . THR B 1 37  ? 29.926 45.057 85.165  1.00 21.39 ? 38   THR B C   1 
ATOM   2405 O O   . THR B 1 37  ? 28.848 45.481 84.750  1.00 21.87 ? 38   THR B O   1 
ATOM   2406 C CB  . THR B 1 37  ? 32.095 45.062 84.026  1.00 21.00 ? 38   THR B CB  1 
ATOM   2407 O OG1 . THR B 1 37  ? 31.717 46.349 83.515  1.00 19.10 ? 38   THR B OG1 1 
ATOM   2408 C CG2 . THR B 1 37  ? 33.006 44.356 83.014  1.00 20.91 ? 38   THR B CG2 1 
ATOM   2409 N N   . PRO B 1 38  ? 30.345 45.274 86.418  1.00 21.03 ? 39   PRO B N   1 
ATOM   2410 C CA  . PRO B 1 38  ? 29.505 46.073 87.310  1.00 23.59 ? 39   PRO B CA  1 
ATOM   2411 C C   . PRO B 1 38  ? 29.381 47.510 86.799  1.00 24.02 ? 39   PRO B C   1 
ATOM   2412 O O   . PRO B 1 38  ? 28.430 48.220 87.128  1.00 23.58 ? 39   PRO B O   1 
ATOM   2413 C CB  . PRO B 1 38  ? 30.239 45.991 88.656  1.00 22.63 ? 39   PRO B CB  1 
ATOM   2414 C CG  . PRO B 1 38  ? 30.911 44.596 88.591  1.00 20.26 ? 39   PRO B CG  1 
ATOM   2415 C CD  . PRO B 1 38  ? 31.425 44.585 87.158  1.00 22.45 ? 39   PRO B CD  1 
ATOM   2416 N N   . ASP B 1 39  ? 30.346 47.951 86.000  1.00 24.42 ? 40   ASP B N   1 
ATOM   2417 C CA  . ASP B 1 39  ? 30.279 49.316 85.485  1.00 26.49 ? 40   ASP B CA  1 
ATOM   2418 C C   . ASP B 1 39  ? 29.426 49.498 84.241  1.00 24.72 ? 40   ASP B C   1 
ATOM   2419 O O   . ASP B 1 39  ? 28.763 50.529 84.100  1.00 24.48 ? 40   ASP B O   1 
ATOM   2420 C CB  . ASP B 1 39  ? 31.684 49.861 85.214  1.00 30.47 ? 40   ASP B CB  1 
ATOM   2421 C CG  . ASP B 1 39  ? 32.410 50.233 86.495  1.00 36.37 ? 40   ASP B CG  1 
ATOM   2422 O OD1 . ASP B 1 39  ? 33.558 49.782 86.681  1.00 38.12 ? 40   ASP B OD1 1 
ATOM   2423 O OD2 . ASP B 1 39  ? 31.828 50.982 87.322  1.00 37.71 ? 40   ASP B OD2 1 
ATOM   2424 N N   . ASN B 1 40  ? 29.436 48.527 83.330  1.00 23.97 ? 41   ASN B N   1 
ATOM   2425 C CA  . ASN B 1 40  ? 28.652 48.713 82.120  1.00 21.87 ? 41   ASN B CA  1 
ATOM   2426 C C   . ASN B 1 40  ? 27.228 48.205 82.163  1.00 22.60 ? 41   ASN B C   1 
ATOM   2427 O O   . ASN B 1 40  ? 26.440 48.579 81.292  1.00 21.00 ? 41   ASN B O   1 
ATOM   2428 C CB  . ASN B 1 40  ? 29.367 48.170 80.854  1.00 23.08 ? 41   ASN B CB  1 
ATOM   2429 C CG  . ASN B 1 40  ? 29.523 46.644 80.827  1.00 22.31 ? 41   ASN B CG  1 
ATOM   2430 O OD1 . ASN B 1 40  ? 28.760 45.900 81.456  1.00 21.30 ? 41   ASN B OD1 1 
ATOM   2431 N ND2 . ASN B 1 40  ? 30.501 46.177 80.057  1.00 23.08 ? 41   ASN B ND2 1 
ATOM   2432 N N   . VAL B 1 41  ? 26.882 47.409 83.182  1.00 19.99 ? 42   VAL B N   1 
ATOM   2433 C CA  . VAL B 1 41  ? 25.527 46.853 83.287  1.00 19.20 ? 42   VAL B CA  1 
ATOM   2434 C C   . VAL B 1 41  ? 24.458 47.902 83.619  1.00 20.16 ? 42   VAL B C   1 
ATOM   2435 O O   . VAL B 1 41  ? 23.290 47.759 83.245  1.00 17.48 ? 42   VAL B O   1 
ATOM   2436 C CB  . VAL B 1 41  ? 25.472 45.673 84.345  1.00 15.27 ? 42   VAL B CB  1 
ATOM   2437 C CG1 . VAL B 1 41  ? 25.444 46.184 85.791  1.00 15.50 ? 42   VAL B CG1 1 
ATOM   2438 C CG2 . VAL B 1 41  ? 24.256 44.801 84.078  1.00 16.85 ? 42   VAL B CG2 1 
ATOM   2439 N N   . GLY B 1 42  ? 24.856 48.966 84.312  1.00 19.77 ? 43   GLY B N   1 
ATOM   2440 C CA  . GLY B 1 42  ? 23.889 49.992 84.655  1.00 18.73 ? 43   GLY B CA  1 
ATOM   2441 C C   . GLY B 1 42  ? 23.131 50.541 83.453  1.00 18.58 ? 43   GLY B C   1 
ATOM   2442 O O   . GLY B 1 42  ? 21.914 50.695 83.489  1.00 18.53 ? 43   GLY B O   1 
ATOM   2443 N N   . ALA B 1 43  ? 23.840 50.848 82.376  1.00 18.84 ? 44   ALA B N   1 
ATOM   2444 C CA  . ALA B 1 43  ? 23.170 51.373 81.182  1.00 20.64 ? 44   ALA B CA  1 
ATOM   2445 C C   . ALA B 1 43  ? 22.225 50.320 80.579  1.00 20.53 ? 44   ALA B C   1 
ATOM   2446 O O   . ALA B 1 43  ? 21.150 50.660 80.070  1.00 18.75 ? 44   ALA B O   1 
ATOM   2447 C CB  . ALA B 1 43  ? 24.213 51.820 80.145  1.00 24.62 ? 44   ALA B CB  1 
ATOM   2448 N N   . TYR B 1 44  ? 22.602 49.038 80.649  1.00 16.19 ? 45   TYR B N   1 
ATOM   2449 C CA  . TYR B 1 44  ? 21.721 47.999 80.126  1.00 14.72 ? 45   TYR B CA  1 
ATOM   2450 C C   . TYR B 1 44  ? 20.455 47.956 80.987  1.00 15.93 ? 45   TYR B C   1 
ATOM   2451 O O   . TYR B 1 44  ? 19.342 47.863 80.471  1.00 18.39 ? 45   TYR B O   1 
ATOM   2452 C CB  . TYR B 1 44  ? 22.404 46.625 80.174  1.00 15.61 ? 45   TYR B CB  1 
ATOM   2453 C CG  . TYR B 1 44  ? 23.648 46.487 79.293  1.00 17.25 ? 45   TYR B CG  1 
ATOM   2454 C CD1 . TYR B 1 44  ? 24.684 45.627 79.673  1.00 20.42 ? 45   TYR B CD1 1 
ATOM   2455 C CD2 . TYR B 1 44  ? 23.771 47.165 78.067  1.00 17.37 ? 45   TYR B CD2 1 
ATOM   2456 C CE1 . TYR B 1 44  ? 25.815 45.427 78.859  1.00 17.05 ? 45   TYR B CE1 1 
ATOM   2457 C CE2 . TYR B 1 44  ? 24.928 46.969 77.219  1.00 15.90 ? 45   TYR B CE2 1 
ATOM   2458 C CZ  . TYR B 1 44  ? 25.929 46.094 77.636  1.00 16.62 ? 45   TYR B CZ  1 
ATOM   2459 O OH  . TYR B 1 44  ? 27.051 45.832 76.867  1.00 17.49 ? 45   TYR B OH  1 
ATOM   2460 N N   . VAL B 1 45  ? 20.606 48.042 82.307  1.00 15.96 ? 46   VAL B N   1 
ATOM   2461 C CA  . VAL B 1 45  ? 19.409 47.971 83.164  1.00 16.83 ? 46   VAL B CA  1 
ATOM   2462 C C   . VAL B 1 45  ? 18.429 49.123 82.905  1.00 15.23 ? 46   VAL B C   1 
ATOM   2463 O O   . VAL B 1 45  ? 17.212 48.925 82.933  1.00 14.53 ? 46   VAL B O   1 
ATOM   2464 C CB  . VAL B 1 45  ? 19.797 47.922 84.648  1.00 16.74 ? 46   VAL B CB  1 
ATOM   2465 C CG1 . VAL B 1 45  ? 18.535 48.028 85.522  1.00 16.85 ? 46   VAL B CG1 1 
ATOM   2466 C CG2 . VAL B 1 45  ? 20.538 46.574 84.936  1.00 12.16 ? 46   VAL B CG2 1 
ATOM   2467 N N   . ASP B 1 46  ? 18.953 50.316 82.637  1.00 16.33 ? 47   ASP B N   1 
ATOM   2468 C CA  . ASP B 1 46  ? 18.079 51.472 82.341  1.00 16.70 ? 47   ASP B CA  1 
ATOM   2469 C C   . ASP B 1 46  ? 17.156 51.134 81.166  1.00 14.40 ? 47   ASP B C   1 
ATOM   2470 O O   . ASP B 1 46  ? 15.995 51.541 81.114  1.00 14.02 ? 47   ASP B O   1 
ATOM   2471 C CB  . ASP B 1 46  ? 18.914 52.696 81.941  1.00 18.58 ? 47   ASP B CB  1 
ATOM   2472 C CG  . ASP B 1 46  ? 19.692 53.300 83.107  1.00 23.65 ? 47   ASP B CG  1 
ATOM   2473 O OD1 . ASP B 1 46  ? 19.427 52.948 84.277  1.00 23.07 ? 47   ASP B OD1 1 
ATOM   2474 O OD2 . ASP B 1 46  ? 20.584 54.149 82.838  1.00 24.37 ? 47   ASP B OD2 1 
ATOM   2475 N N   . GLY B 1 47  ? 17.690 50.426 80.179  1.00 14.39 ? 48   GLY B N   1 
ATOM   2476 C CA  . GLY B 1 47  ? 16.867 50.065 79.035  1.00 14.18 ? 48   GLY B CA  1 
ATOM   2477 C C   . GLY B 1 47  ? 15.702 49.155 79.398  1.00 16.46 ? 48   GLY B C   1 
ATOM   2478 O O   . GLY B 1 47  ? 14.710 49.080 78.658  1.00 17.38 ? 48   GLY B O   1 
ATOM   2479 N N   . THR B 1 48  ? 15.812 48.441 80.518  1.00 15.12 ? 49   THR B N   1 
ATOM   2480 C CA  . THR B 1 48  ? 14.715 47.542 80.921  1.00 17.04 ? 49   THR B CA  1 
ATOM   2481 C C   . THR B 1 48  ? 13.688 48.222 81.825  1.00 18.52 ? 49   THR B C   1 
ATOM   2482 O O   . THR B 1 48  ? 12.514 47.828 81.848  1.00 16.22 ? 49   THR B O   1 
ATOM   2483 C CB  . THR B 1 48  ? 15.219 46.287 81.676  1.00 18.25 ? 49   THR B CB  1 
ATOM   2484 O OG1 . THR B 1 48  ? 15.734 46.655 82.965  1.00 16.90 ? 49   THR B OG1 1 
ATOM   2485 C CG2 . THR B 1 48  ? 16.315 45.588 80.857  1.00 17.59 ? 49   THR B CG2 1 
ATOM   2486 N N   . ILE B 1 49  ? 14.119 49.269 82.529  1.00 16.78 ? 50   ILE B N   1 
ATOM   2487 C CA  . ILE B 1 49  ? 13.213 49.943 83.449  1.00 19.97 ? 50   ILE B CA  1 
ATOM   2488 C C   . ILE B 1 49  ? 12.512 51.216 82.960  1.00 23.36 ? 50   ILE B C   1 
ATOM   2489 O O   . ILE B 1 49  ? 11.545 51.666 83.588  1.00 22.13 ? 50   ILE B O   1 
ATOM   2490 C CB  . ILE B 1 49  ? 13.937 50.223 84.800  1.00 20.42 ? 50   ILE B CB  1 
ATOM   2491 C CG1 . ILE B 1 49  ? 15.162 51.130 84.594  1.00 20.92 ? 50   ILE B CG1 1 
ATOM   2492 C CG2 . ILE B 1 49  ? 14.380 48.872 85.426  1.00 20.13 ? 50   ILE B CG2 1 
ATOM   2493 C CD1 . ILE B 1 49  ? 15.918 51.454 85.896  1.00 23.53 ? 50   ILE B CD1 1 
ATOM   2494 N N   . TYR B 1 50  ? 12.958 51.784 81.844  1.00 20.61 ? 51   TYR B N   1 
ATOM   2495 C CA  . TYR B 1 50  ? 12.319 53.012 81.351  1.00 23.32 ? 51   TYR B CA  1 
ATOM   2496 C C   . TYR B 1 50  ? 11.591 52.857 80.016  1.00 21.80 ? 51   TYR B C   1 
ATOM   2497 O O   . TYR B 1 50  ? 11.215 53.848 79.396  1.00 20.65 ? 51   TYR B O   1 
ATOM   2498 C CB  . TYR B 1 50  ? 13.358 54.140 81.219  1.00 23.36 ? 51   TYR B CB  1 
ATOM   2499 C CG  . TYR B 1 50  ? 14.101 54.492 82.503  1.00 25.95 ? 51   TYR B CG  1 
ATOM   2500 C CD1 . TYR B 1 50  ? 15.494 54.389 82.574  1.00 26.83 ? 51   TYR B CD1 1 
ATOM   2501 C CD2 . TYR B 1 50  ? 13.419 54.947 83.633  1.00 26.81 ? 51   TYR B CD2 1 
ATOM   2502 C CE1 . TYR B 1 50  ? 16.191 54.733 83.729  1.00 29.51 ? 51   TYR B CE1 1 
ATOM   2503 C CE2 . TYR B 1 50  ? 14.109 55.286 84.809  1.00 28.96 ? 51   TYR B CE2 1 
ATOM   2504 C CZ  . TYR B 1 50  ? 15.494 55.178 84.845  1.00 31.03 ? 51   TYR B CZ  1 
ATOM   2505 O OH  . TYR B 1 50  ? 16.192 55.509 85.988  1.00 32.80 ? 51   TYR B OH  1 
ATOM   2506 N N   . THR B 1 51  ? 11.347 51.623 79.581  1.00 18.07 ? 52   THR B N   1 
ATOM   2507 C CA  . THR B 1 51  ? 10.690 51.406 78.295  1.00 17.44 ? 52   THR B CA  1 
ATOM   2508 C C   . THR B 1 51  ? 9.255  50.851 78.365  1.00 19.04 ? 52   THR B C   1 
ATOM   2509 O O   . THR B 1 51  ? 8.548  50.796 77.368  1.00 16.32 ? 52   THR B O   1 
ATOM   2510 C CB  . THR B 1 51  ? 11.536 50.446 77.447  1.00 20.40 ? 52   THR B CB  1 
ATOM   2511 O OG1 . THR B 1 51  ? 11.963 49.360 78.275  1.00 19.30 ? 52   THR B OG1 1 
ATOM   2512 C CG2 . THR B 1 51  ? 12.784 51.162 76.880  1.00 17.49 ? 52   THR B CG2 1 
ATOM   2513 N N   . ARG B 1 52  ? 8.831  50.424 79.548  1.00 19.06 ? 53   ARG B N   1 
ATOM   2514 C CA  . ARG B 1 52  ? 7.485  49.886 79.707  1.00 19.69 ? 53   ARG B CA  1 
ATOM   2515 C C   . ARG B 1 52  ? 6.948  50.370 81.060  1.00 20.53 ? 53   ARG B C   1 
ATOM   2516 O O   . ARG B 1 52  ? 7.723  50.643 81.978  1.00 21.15 ? 53   ARG B O   1 
ATOM   2517 C CB  . ARG B 1 52  ? 7.538  48.350 79.657  1.00 20.59 ? 53   ARG B CB  1 
ATOM   2518 C CG  . ARG B 1 52  ? 7.820  47.767 78.255  1.00 21.17 ? 53   ARG B CG  1 
ATOM   2519 C CD  . ARG B 1 52  ? 7.982  46.225 78.290  1.00 18.88 ? 53   ARG B CD  1 
ATOM   2520 N NE  . ARG B 1 52  ? 7.781  45.590 76.988  1.00 15.58 ? 53   ARG B NE  1 
ATOM   2521 C CZ  . ARG B 1 52  ? 7.839  44.273 76.784  1.00 18.60 ? 53   ARG B CZ  1 
ATOM   2522 N NH1 . ARG B 1 52  ? 8.118  43.454 77.795  1.00 17.45 ? 53   ARG B NH1 1 
ATOM   2523 N NH2 . ARG B 1 52  ? 7.540  43.759 75.595  1.00 17.00 ? 53   ARG B NH2 1 
ATOM   2524 N N   . GLY B 1 53  ? 5.632  50.473 81.191  1.00 22.31 ? 54   GLY B N   1 
ATOM   2525 C CA  . GLY B 1 53  ? 5.070  50.913 82.457  1.00 25.08 ? 54   GLY B CA  1 
ATOM   2526 C C   . GLY B 1 53  ? 3.926  50.041 82.941  1.00 27.30 ? 54   GLY B C   1 
ATOM   2527 O O   . GLY B 1 53  ? 3.435  49.181 82.206  1.00 28.32 ? 54   GLY B O   1 
ATOM   2528 N N   . GLY B 1 54  ? 3.491  50.262 84.178  1.00 30.07 ? 55   GLY B N   1 
ATOM   2529 C CA  . GLY B 1 54  ? 2.382  49.489 84.728  1.00 31.00 ? 55   GLY B CA  1 
ATOM   2530 C C   . GLY B 1 54  ? 2.486  47.980 84.574  1.00 31.68 ? 55   GLY B C   1 
ATOM   2531 O O   . GLY B 1 54  ? 3.534  47.394 84.823  1.00 30.80 ? 55   GLY B O   1 
ATOM   2532 N N   . LYS B 1 55  ? 1.393  47.362 84.138  1.00 32.01 ? 56   LYS B N   1 
ATOM   2533 C CA  . LYS B 1 55  ? 1.310  45.918 83.948  1.00 31.74 ? 56   LYS B CA  1 
ATOM   2534 C C   . LYS B 1 55  ? 2.322  45.377 82.918  1.00 30.87 ? 56   LYS B C   1 
ATOM   2535 O O   . LYS B 1 55  ? 2.715  44.208 82.995  1.00 30.69 ? 56   LYS B O   1 
ATOM   2536 C CB  . LYS B 1 55  ? -0.130 45.565 83.539  1.00 35.06 ? 56   LYS B CB  1 
ATOM   2537 C CG  . LYS B 1 55  ? -0.383 44.142 82.988  1.00 39.66 ? 56   LYS B CG  1 
ATOM   2538 C CD  . LYS B 1 55  ? -0.421 43.040 84.056  1.00 40.07 ? 56   LYS B CD  1 
ATOM   2539 C CE  . LYS B 1 55  ? -0.801 41.692 83.409  1.00 43.98 ? 56   LYS B CE  1 
ATOM   2540 N NZ  . LYS B 1 55  ? -0.926 40.556 84.371  1.00 44.85 ? 56   LYS B NZ  1 
ATOM   2541 N N   A GLU B 1 56  ? 2.745  46.237 81.985  0.60 29.35 ? 57   GLU B N   1 
ATOM   2542 N N   B GLU B 1 56  ? 2.742  46.206 81.967  0.40 29.41 ? 57   GLU B N   1 
ATOM   2543 C CA  A GLU B 1 56  ? 3.711  45.866 80.934  0.60 27.11 ? 57   GLU B CA  1 
ATOM   2544 C CA  B GLU B 1 56  ? 3.679  45.736 80.950  0.40 27.37 ? 57   GLU B CA  1 
ATOM   2545 C C   A GLU B 1 56  ? 5.062  45.491 81.512  0.60 25.01 ? 57   GLU B C   1 
ATOM   2546 C C   B GLU B 1 56  ? 5.092  45.509 81.485  0.40 25.60 ? 57   GLU B C   1 
ATOM   2547 O O   A GLU B 1 56  ? 5.751  44.627 80.980  0.60 24.92 ? 57   GLU B O   1 
ATOM   2548 O O   B GLU B 1 56  ? 5.852  44.739 80.902  0.40 25.13 ? 57   GLU B O   1 
ATOM   2549 C CB  A GLU B 1 56  ? 4.044  47.023 79.969  0.60 27.89 ? 57   GLU B CB  1 
ATOM   2550 C CB  B GLU B 1 56  ? 3.712  46.696 79.753  0.40 28.11 ? 57   GLU B CB  1 
ATOM   2551 C CG  A GLU B 1 56  ? 2.974  47.702 79.128  0.60 30.04 ? 57   GLU B CG  1 
ATOM   2552 C CG  B GLU B 1 56  ? 2.333  47.154 79.275  0.40 30.09 ? 57   GLU B CG  1 
ATOM   2553 C CD  A GLU B 1 56  ? 3.615  48.765 78.210  0.60 31.11 ? 57   GLU B CD  1 
ATOM   2554 C CD  B GLU B 1 56  ? 1.368  46.013 78.993  0.40 31.52 ? 57   GLU B CD  1 
ATOM   2555 O OE1 A GLU B 1 56  ? 3.923  48.445 77.038  0.60 33.32 ? 57   GLU B OE1 1 
ATOM   2556 O OE1 B GLU B 1 56  ? 0.168  46.294 78.789  0.40 32.52 ? 57   GLU B OE1 1 
ATOM   2557 O OE2 A GLU B 1 56  ? 3.850  49.910 78.670  0.60 28.40 ? 57   GLU B OE2 1 
ATOM   2558 O OE2 B GLU B 1 56  ? 1.794  44.839 78.969  0.40 31.64 ? 57   GLU B OE2 1 
ATOM   2559 N N   . LYS B 1 57  ? 5.454  46.175 82.580  1.00 25.00 ? 58   LYS B N   1 
ATOM   2560 C CA  . LYS B 1 57  ? 6.775  45.976 83.178  1.00 26.01 ? 58   LYS B CA  1 
ATOM   2561 C C   . LYS B 1 57  ? 7.143  44.533 83.517  1.00 26.65 ? 58   LYS B C   1 
ATOM   2562 O O   . LYS B 1 57  ? 8.305  44.111 83.337  1.00 25.11 ? 58   LYS B O   1 
ATOM   2563 C CB  . LYS B 1 57  ? 6.930  46.829 84.440  1.00 31.14 ? 58   LYS B CB  1 
ATOM   2564 C CG  . LYS B 1 57  ? 7.518  48.215 84.195  1.00 35.30 ? 58   LYS B CG  1 
ATOM   2565 C CD  . LYS B 1 57  ? 7.714  48.973 85.514  1.00 36.09 ? 58   LYS B CD  1 
ATOM   2566 C CE  . LYS B 1 57  ? 6.393  49.135 86.239  1.00 37.40 ? 58   LYS B CE  1 
ATOM   2567 N NZ  . LYS B 1 57  ? 6.568  49.710 87.595  1.00 39.54 ? 58   LYS B NZ  1 
ATOM   2568 N N   . GLN B 1 58  ? 6.174  43.771 84.011  1.00 24.51 ? 59   GLN B N   1 
ATOM   2569 C CA  . GLN B 1 58  ? 6.463  42.394 84.384  1.00 23.50 ? 59   GLN B CA  1 
ATOM   2570 C C   . GLN B 1 58  ? 6.835  41.523 83.190  1.00 23.25 ? 59   GLN B C   1 
ATOM   2571 O O   . GLN B 1 58  ? 7.270  40.393 83.370  1.00 25.61 ? 59   GLN B O   1 
ATOM   2572 C CB  . GLN B 1 58  ? 5.274  41.779 85.146  1.00 27.18 ? 59   GLN B CB  1 
ATOM   2573 C CG  . GLN B 1 58  ? 4.074  41.383 84.308  1.00 26.18 ? 59   GLN B CG  1 
ATOM   2574 C CD  . GLN B 1 58  ? 2.971  40.713 85.149  1.00 32.90 ? 59   GLN B CD  1 
ATOM   2575 O OE1 . GLN B 1 58  ? 2.446  41.310 86.090  1.00 32.23 ? 59   GLN B OE1 1 
ATOM   2576 N NE2 . GLN B 1 58  ? 2.620  39.466 84.801  1.00 32.92 ? 59   GLN B NE2 1 
ATOM   2577 N N   . SER B 1 59  ? 6.669  42.041 81.977  1.00 20.43 ? 60   SER B N   1 
ATOM   2578 C CA  . SER B 1 59  ? 6.996  41.275 80.776  1.00 19.10 ? 60   SER B CA  1 
ATOM   2579 C C   . SER B 1 59  ? 8.462  41.438 80.298  1.00 17.95 ? 60   SER B C   1 
ATOM   2580 O O   . SER B 1 59  ? 8.838  40.930 79.246  1.00 18.58 ? 60   SER B O   1 
ATOM   2581 C CB  . SER B 1 59  ? 6.016  41.637 79.655  1.00 22.20 ? 60   SER B CB  1 
ATOM   2582 O OG  . SER B 1 59  ? 4.721  41.129 79.937  1.00 22.18 ? 60   SER B OG  1 
ATOM   2583 N N   . THR B 1 60  ? 9.264  42.170 81.060  1.00 17.55 ? 61   THR B N   1 
ATOM   2584 C CA  . THR B 1 60  ? 10.705 42.312 80.772  1.00 18.95 ? 61   THR B CA  1 
ATOM   2585 C C   . THR B 1 60  ? 11.426 41.759 82.023  1.00 18.52 ? 61   THR B C   1 
ATOM   2586 O O   . THR B 1 60  ? 10.961 41.992 83.129  1.00 17.17 ? 61   THR B O   1 
ATOM   2587 C CB  . THR B 1 60  ? 11.141 43.786 80.581  1.00 18.68 ? 61   THR B CB  1 
ATOM   2588 O OG1 . THR B 1 60  ? 10.532 44.344 79.396  1.00 20.72 ? 61   THR B OG1 1 
ATOM   2589 C CG2 . THR B 1 60  ? 12.662 43.830 80.413  1.00 19.21 ? 61   THR B CG2 1 
ATOM   2590 N N   . ALA B 1 61  ? 12.525 41.010 81.865  1.00 16.67 ? 62   ALA B N   1 
ATOM   2591 C CA  . ALA B 1 61  ? 13.244 40.483 83.042  1.00 17.01 ? 62   ALA B CA  1 
ATOM   2592 C C   . ALA B 1 61  ? 14.737 40.353 82.750  1.00 19.08 ? 62   ALA B C   1 
ATOM   2593 O O   . ALA B 1 61  ? 15.136 40.397 81.595  1.00 17.08 ? 62   ALA B O   1 
ATOM   2594 C CB  . ALA B 1 61  ? 12.680 39.119 83.448  1.00 17.18 ? 62   ALA B CB  1 
ATOM   2595 N N   . ILE B 1 62  ? 15.540 40.126 83.797  1.00 17.43 ? 63   ILE B N   1 
ATOM   2596 C CA  . ILE B 1 62  ? 16.998 40.031 83.679  1.00 14.97 ? 63   ILE B CA  1 
ATOM   2597 C C   . ILE B 1 62  ? 17.576 38.729 84.254  1.00 15.25 ? 63   ILE B C   1 
ATOM   2598 O O   . ILE B 1 62  ? 17.151 38.275 85.320  1.00 14.24 ? 63   ILE B O   1 
ATOM   2599 C CB  . ILE B 1 62  ? 17.652 41.218 84.438  1.00 14.83 ? 63   ILE B CB  1 
ATOM   2600 C CG1 . ILE B 1 62  ? 17.390 42.538 83.678  1.00 16.00 ? 63   ILE B CG1 1 
ATOM   2601 C CG2 . ILE B 1 62  ? 19.173 40.990 84.622  1.00 17.96 ? 63   ILE B CG2 1 
ATOM   2602 C CD1 . ILE B 1 62  ? 17.640 43.799 84.548  1.00 14.13 ? 63   ILE B CD1 1 
ATOM   2603 N N   . PHE B 1 63  ? 18.548 38.142 83.554  1.00 14.32 ? 64   PHE B N   1 
ATOM   2604 C CA  . PHE B 1 63  ? 19.212 36.903 84.004  1.00 14.72 ? 64   PHE B CA  1 
ATOM   2605 C C   . PHE B 1 63  ? 20.724 37.139 83.935  1.00 16.93 ? 64   PHE B C   1 
ATOM   2606 O O   . PHE B 1 63  ? 21.223 37.529 82.876  1.00 17.34 ? 64   PHE B O   1 
ATOM   2607 C CB  . PHE B 1 63  ? 18.852 35.708 83.087  1.00 16.49 ? 64   PHE B CB  1 
ATOM   2608 C CG  . PHE B 1 63  ? 19.631 34.444 83.388  1.00 14.88 ? 64   PHE B CG  1 
ATOM   2609 C CD1 . PHE B 1 63  ? 19.112 33.471 84.247  1.00 16.43 ? 64   PHE B CD1 1 
ATOM   2610 C CD2 . PHE B 1 63  ? 20.879 34.231 82.809  1.00 14.77 ? 64   PHE B CD2 1 
ATOM   2611 C CE1 . PHE B 1 63  ? 19.832 32.299 84.524  1.00 15.65 ? 64   PHE B CE1 1 
ATOM   2612 C CE2 . PHE B 1 63  ? 21.626 33.051 83.073  1.00 15.78 ? 64   PHE B CE2 1 
ATOM   2613 C CZ  . PHE B 1 63  ? 21.100 32.091 83.930  1.00 16.00 ? 64   PHE B CZ  1 
ATOM   2614 N N   . VAL B 1 64  ? 21.434 36.938 85.051  1.00 15.69 ? 65   VAL B N   1 
ATOM   2615 C CA  . VAL B 1 64  ? 22.893 37.110 85.115  1.00 15.54 ? 65   VAL B CA  1 
ATOM   2616 C C   . VAL B 1 64  ? 23.557 35.729 85.225  1.00 16.44 ? 65   VAL B C   1 
ATOM   2617 O O   . VAL B 1 64  ? 23.213 34.941 86.105  1.00 16.01 ? 65   VAL B O   1 
ATOM   2618 C CB  . VAL B 1 64  ? 23.328 37.966 86.343  1.00 17.55 ? 65   VAL B CB  1 
ATOM   2619 C CG1 . VAL B 1 64  ? 24.880 37.990 86.468  1.00 15.54 ? 65   VAL B CG1 1 
ATOM   2620 C CG2 . VAL B 1 64  ? 22.785 39.405 86.202  1.00 18.67 ? 65   VAL B CG2 1 
ATOM   2621 N N   . GLY B 1 65  ? 24.482 35.444 84.314  1.00 15.07 ? 66   GLY B N   1 
ATOM   2622 C CA  . GLY B 1 65  ? 25.180 34.163 84.310  1.00 16.76 ? 66   GLY B CA  1 
ATOM   2623 C C   . GLY B 1 65  ? 26.638 34.298 83.902  1.00 16.42 ? 66   GLY B C   1 
ATOM   2624 O O   . GLY B 1 65  ? 27.157 35.420 83.758  1.00 14.53 ? 66   GLY B O   1 
ATOM   2625 N N   . GLY B 1 66  ? 27.303 33.164 83.688  1.00 14.96 ? 67   GLY B N   1 
ATOM   2626 C CA  . GLY B 1 66  ? 28.722 33.194 83.322  1.00 17.50 ? 67   GLY B CA  1 
ATOM   2627 C C   . GLY B 1 66  ? 29.459 32.136 84.143  1.00 21.09 ? 67   GLY B C   1 
ATOM   2628 O O   . GLY B 1 66  ? 28.877 31.563 85.075  1.00 19.81 ? 67   GLY B O   1 
ATOM   2629 N N   . GLY B 1 67  ? 30.728 31.879 83.833  1.00 21.46 ? 68   GLY B N   1 
ATOM   2630 C CA  . GLY B 1 67  ? 31.459 30.836 84.547  1.00 21.90 ? 68   GLY B CA  1 
ATOM   2631 C C   . GLY B 1 67  ? 32.020 31.142 85.931  1.00 24.21 ? 68   GLY B C   1 
ATOM   2632 O O   . GLY B 1 67  ? 32.258 30.213 86.716  1.00 25.37 ? 68   GLY B O   1 
ATOM   2633 N N   . ASP B 1 68  ? 32.194 32.424 86.245  1.00 23.08 ? 69   ASP B N   1 
ATOM   2634 C CA  . ASP B 1 68  ? 32.769 32.885 87.519  1.00 24.74 ? 69   ASP B CA  1 
ATOM   2635 C C   . ASP B 1 68  ? 31.669 33.408 88.464  1.00 24.65 ? 69   ASP B C   1 
ATOM   2636 O O   . ASP B 1 68  ? 31.111 34.488 88.232  1.00 22.73 ? 69   ASP B O   1 
ATOM   2637 C CB  . ASP B 1 68  ? 33.777 34.013 87.204  1.00 24.67 ? 69   ASP B CB  1 
ATOM   2638 C CG  . ASP B 1 68  ? 34.560 34.493 88.427  1.00 29.68 ? 69   ASP B CG  1 
ATOM   2639 O OD1 . ASP B 1 68  ? 34.010 34.554 89.542  1.00 30.55 ? 69   ASP B OD1 1 
ATOM   2640 O OD2 . ASP B 1 68  ? 35.747 34.843 88.252  1.00 34.37 ? 69   ASP B OD2 1 
ATOM   2641 N N   . MET B 1 69  ? 31.372 32.659 89.530  1.00 24.45 ? 70   MET B N   1 
ATOM   2642 C CA  . MET B 1 69  ? 30.317 33.053 90.481  1.00 24.11 ? 70   MET B CA  1 
ATOM   2643 C C   . MET B 1 69  ? 30.577 34.412 91.132  1.00 23.17 ? 70   MET B C   1 
ATOM   2644 O O   . MET B 1 69  ? 29.667 35.207 91.290  1.00 21.77 ? 70   MET B O   1 
ATOM   2645 C CB  . MET B 1 69  ? 30.167 31.975 91.572  1.00 29.15 ? 70   MET B CB  1 
ATOM   2646 C CG  . MET B 1 69  ? 29.096 32.268 92.617  1.00 31.38 ? 70   MET B CG  1 
ATOM   2647 S SD  . MET B 1 69  ? 27.422 32.154 91.956  1.00 39.42 ? 70   MET B SD  1 
ATOM   2648 C CE  . MET B 1 69  ? 26.968 33.748 91.867  1.00 33.54 ? 70   MET B CE  1 
ATOM   2649 N N   . ALA B 1 70  ? 31.825 34.681 91.512  1.00 23.50 ? 71   ALA B N   1 
ATOM   2650 C CA  . ALA B 1 70  ? 32.180 35.945 92.146  1.00 21.70 ? 71   ALA B CA  1 
ATOM   2651 C C   . ALA B 1 70  ? 31.873 37.116 91.228  1.00 22.47 ? 71   ALA B C   1 
ATOM   2652 O O   . ALA B 1 70  ? 31.374 38.143 91.661  1.00 23.50 ? 71   ALA B O   1 
ATOM   2653 C CB  . ALA B 1 70  ? 33.696 35.955 92.516  1.00 26.00 ? 71   ALA B CB  1 
ATOM   2654 N N   . ALA B 1 71  ? 32.211 36.965 89.955  1.00 20.70 ? 72   ALA B N   1 
ATOM   2655 C CA  . ALA B 1 71  ? 31.978 38.021 88.972  1.00 21.20 ? 72   ALA B CA  1 
ATOM   2656 C C   . ALA B 1 71  ? 30.476 38.223 88.795  1.00 19.18 ? 72   ALA B C   1 
ATOM   2657 O O   . ALA B 1 71  ? 29.988 39.365 88.691  1.00 18.33 ? 72   ALA B O   1 
ATOM   2658 C CB  . ALA B 1 71  ? 32.638 37.629 87.625  1.00 22.60 ? 72   ALA B CB  1 
ATOM   2659 N N   . GLY B 1 72  ? 29.738 37.110 88.751  1.00 18.76 ? 73   GLY B N   1 
ATOM   2660 C CA  . GLY B 1 72  ? 28.293 37.189 88.605  1.00 18.60 ? 73   GLY B CA  1 
ATOM   2661 C C   . GLY B 1 72  ? 27.639 37.894 89.782  1.00 19.89 ? 73   GLY B C   1 
ATOM   2662 O O   . GLY B 1 72  ? 26.702 38.690 89.613  1.00 18.43 ? 73   GLY B O   1 
ATOM   2663 N N   . GLU B 1 73  ? 28.115 37.604 90.990  1.00 20.90 ? 74   GLU B N   1 
ATOM   2664 C CA  . GLU B 1 73  ? 27.552 38.249 92.172  1.00 21.96 ? 74   GLU B CA  1 
ATOM   2665 C C   . GLU B 1 73  ? 27.792 39.762 92.133  1.00 21.44 ? 74   GLU B C   1 
ATOM   2666 O O   . GLU B 1 73  ? 26.910 40.537 92.509  1.00 21.22 ? 74   GLU B O   1 
ATOM   2667 C CB  . GLU B 1 73  ? 28.156 37.641 93.447  1.00 24.73 ? 74   GLU B CB  1 
ATOM   2668 C CG  . GLU B 1 73  ? 27.602 36.238 93.750  1.00 25.96 ? 74   GLU B CG  1 
ATOM   2669 C CD  . GLU B 1 73  ? 28.202 35.635 94.995  1.00 32.14 ? 74   GLU B CD  1 
ATOM   2670 O OE1 . GLU B 1 73  ? 27.451 35.007 95.773  1.00 35.42 ? 74   GLU B OE1 1 
ATOM   2671 O OE2 . GLU B 1 73  ? 29.421 35.786 95.187  1.00 30.10 ? 74   GLU B OE2 1 
ATOM   2672 N N   . ARG B 1 74  ? 28.968 40.189 91.673  1.00 21.86 ? 75   ARG B N   1 
ATOM   2673 C CA  . ARG B 1 74  ? 29.260 41.638 91.599  1.00 20.84 ? 75   ARG B CA  1 
ATOM   2674 C C   . ARG B 1 74  ? 28.308 42.302 90.600  1.00 21.69 ? 75   ARG B C   1 
ATOM   2675 O O   . ARG B 1 74  ? 27.777 43.377 90.859  1.00 20.23 ? 75   ARG B O   1 
ATOM   2676 C CB  . ARG B 1 74  ? 30.696 41.895 91.140  1.00 23.82 ? 75   ARG B CB  1 
ATOM   2677 C CG  . ARG B 1 74  ? 31.791 41.659 92.190  1.00 30.84 ? 75   ARG B CG  1 
ATOM   2678 C CD  . ARG B 1 74  ? 33.173 41.867 91.546  1.00 30.01 ? 75   ARG B CD  1 
ATOM   2679 N NE  . ARG B 1 74  ? 33.938 40.624 91.589  1.00 36.80 ? 75   ARG B NE  1 
ATOM   2680 C CZ  . ARG B 1 74  ? 34.558 40.079 90.556  1.00 33.89 ? 75   ARG B CZ  1 
ATOM   2681 N NH1 . ARG B 1 74  ? 34.510 40.658 89.364  1.00 36.57 ? 75   ARG B NH1 1 
ATOM   2682 N NH2 . ARG B 1 74  ? 35.239 38.959 90.728  1.00 37.70 ? 75   ARG B NH2 1 
ATOM   2683 N N   . VAL B 1 75  ? 28.102 41.660 89.451  1.00 19.91 ? 76   VAL B N   1 
ATOM   2684 C CA  . VAL B 1 75  ? 27.200 42.210 88.446  1.00 18.14 ? 76   VAL B CA  1 
ATOM   2685 C C   . VAL B 1 75  ? 25.753 42.227 88.956  1.00 18.55 ? 76   VAL B C   1 
ATOM   2686 O O   . VAL B 1 75  ? 25.036 43.223 88.773  1.00 16.99 ? 76   VAL B O   1 
ATOM   2687 C CB  . VAL B 1 75  ? 27.306 41.403 87.113  1.00 17.93 ? 76   VAL B CB  1 
ATOM   2688 C CG1 . VAL B 1 75  ? 26.208 41.811 86.142  1.00 18.57 ? 76   VAL B CG1 1 
ATOM   2689 C CG2 . VAL B 1 75  ? 28.670 41.666 86.466  1.00 19.16 ? 76   VAL B CG2 1 
ATOM   2690 N N   . PHE B 1 76  ? 25.325 41.149 89.621  1.00 17.63 ? 77   PHE B N   1 
ATOM   2691 C CA  . PHE B 1 76  ? 23.951 41.064 90.152  1.00 18.71 ? 77   PHE B CA  1 
ATOM   2692 C C   . PHE B 1 76  ? 23.696 42.169 91.180  1.00 20.57 ? 77   PHE B C   1 
ATOM   2693 O O   . PHE B 1 76  ? 22.608 42.746 91.238  1.00 19.19 ? 77   PHE B O   1 
ATOM   2694 C CB  . PHE B 1 76  ? 23.715 39.668 90.777  1.00 20.35 ? 77   PHE B CB  1 
ATOM   2695 C CG  . PHE B 1 76  ? 22.253 39.309 91.026  1.00 20.66 ? 77   PHE B CG  1 
ATOM   2696 C CD1 . PHE B 1 76  ? 21.349 39.190 89.971  1.00 20.83 ? 77   PHE B CD1 1 
ATOM   2697 C CD2 . PHE B 1 76  ? 21.798 39.024 92.323  1.00 21.04 ? 77   PHE B CD2 1 
ATOM   2698 C CE1 . PHE B 1 76  ? 20.014 38.797 90.188  1.00 18.80 ? 77   PHE B CE1 1 
ATOM   2699 C CE2 . PHE B 1 76  ? 20.460 38.628 92.551  1.00 21.24 ? 77   PHE B CE2 1 
ATOM   2700 C CZ  . PHE B 1 76  ? 19.571 38.515 91.478  1.00 20.81 ? 77   PHE B CZ  1 
ATOM   2701 N N   . GLU B 1 77  ? 24.686 42.472 92.006  1.00 20.06 ? 78   GLU B N   1 
ATOM   2702 C CA  . GLU B 1 77  ? 24.495 43.544 92.978  1.00 22.54 ? 78   GLU B CA  1 
ATOM   2703 C C   . GLU B 1 77  ? 24.378 44.891 92.261  1.00 21.48 ? 78   GLU B C   1 
ATOM   2704 O O   . GLU B 1 77  ? 23.629 45.770 92.685  1.00 21.14 ? 78   GLU B O   1 
ATOM   2705 C CB  . GLU B 1 77  ? 25.670 43.589 93.963  1.00 24.06 ? 78   GLU B CB  1 
ATOM   2706 C CG  . GLU B 1 77  ? 25.682 42.414 94.906  1.00 28.51 ? 78   GLU B CG  1 
ATOM   2707 C CD  . GLU B 1 77  ? 24.425 42.361 95.774  1.00 29.16 ? 78   GLU B CD  1 
ATOM   2708 O OE1 . GLU B 1 77  ? 24.100 43.391 96.411  1.00 27.64 ? 78   GLU B OE1 1 
ATOM   2709 O OE2 . GLU B 1 77  ? 23.769 41.290 95.815  1.00 28.64 ? 78   GLU B OE2 1 
ATOM   2710 N N   . ALA B 1 78  ? 25.118 45.046 91.166  1.00 20.00 ? 79   ALA B N   1 
ATOM   2711 C CA  . ALA B 1 78  ? 25.074 46.294 90.414  1.00 19.73 ? 79   ALA B CA  1 
ATOM   2712 C C   . ALA B 1 78  ? 23.705 46.436 89.779  1.00 20.32 ? 79   ALA B C   1 
ATOM   2713 O O   . ALA B 1 78  ? 23.179 47.555 89.641  1.00 16.94 ? 79   ALA B O   1 
ATOM   2714 C CB  . ALA B 1 78  ? 26.170 46.315 89.345  1.00 19.15 ? 79   ALA B CB  1 
ATOM   2715 N N   . VAL B 1 79  ? 23.120 45.309 89.365  1.00 18.51 ? 80   VAL B N   1 
ATOM   2716 C CA  . VAL B 1 79  ? 21.785 45.362 88.798  1.00 19.54 ? 80   VAL B CA  1 
ATOM   2717 C C   . VAL B 1 79  ? 20.756 45.854 89.826  1.00 20.45 ? 80   VAL B C   1 
ATOM   2718 O O   . VAL B 1 79  ? 19.999 46.798 89.559  1.00 21.56 ? 80   VAL B O   1 
ATOM   2719 C CB  . VAL B 1 79  ? 21.347 43.990 88.279  1.00 18.07 ? 80   VAL B CB  1 
ATOM   2720 C CG1 . VAL B 1 79  ? 19.859 44.031 87.934  1.00 20.12 ? 80   VAL B CG1 1 
ATOM   2721 C CG2 . VAL B 1 79  ? 22.193 43.628 87.023  1.00 17.88 ? 80   VAL B CG2 1 
ATOM   2722 N N   . LYS B 1 80  ? 20.716 45.212 90.997  1.00 20.33 ? 81   LYS B N   1 
ATOM   2723 C CA  . LYS B 1 80  ? 19.778 45.602 92.043  1.00 18.91 ? 81   LYS B CA  1 
ATOM   2724 C C   . LYS B 1 80  ? 19.998 47.058 92.473  1.00 22.13 ? 81   LYS B C   1 
ATOM   2725 O O   . LYS B 1 80  ? 19.044 47.764 92.785  1.00 22.08 ? 81   LYS B O   1 
ATOM   2726 C CB  . LYS B 1 80  ? 19.913 44.671 93.256  1.00 20.76 ? 81   LYS B CB  1 
ATOM   2727 C CG  . LYS B 1 80  ? 19.477 43.218 92.979  1.00 23.97 ? 81   LYS B CG  1 
ATOM   2728 C CD  . LYS B 1 80  ? 19.618 42.294 94.209  1.00 24.62 ? 81   LYS B CD  1 
ATOM   2729 C CE  . LYS B 1 80  ? 21.064 42.062 94.587  1.00 26.47 ? 81   LYS B CE  1 
ATOM   2730 N NZ  . LYS B 1 80  ? 21.171 41.199 95.838  1.00 26.82 ? 81   LYS B NZ  1 
ATOM   2731 N N   . LYS B 1 81  ? 21.251 47.500 92.473  1.00 20.88 ? 82   LYS B N   1 
ATOM   2732 C CA  . LYS B 1 81  ? 21.585 48.872 92.856  1.00 23.63 ? 82   LYS B CA  1 
ATOM   2733 C C   . LYS B 1 81  ? 21.047 49.911 91.864  1.00 24.95 ? 82   LYS B C   1 
ATOM   2734 O O   . LYS B 1 81  ? 20.749 51.048 92.245  1.00 23.86 ? 82   LYS B O   1 
ATOM   2735 C CB  . LYS B 1 81  ? 23.104 48.998 92.999  1.00 26.89 ? 82   LYS B CB  1 
ATOM   2736 C CG  . LYS B 1 81  ? 23.639 50.401 93.288  1.00 32.14 ? 82   LYS B CG  1 
ATOM   2737 C CD  . LYS B 1 81  ? 25.104 50.301 93.768  1.00 35.98 ? 82   LYS B CD  1 
ATOM   2738 C CE  . LYS B 1 81  ? 25.770 51.666 93.980  1.00 38.44 ? 82   LYS B CE  1 
ATOM   2739 N NZ  . LYS B 1 81  ? 26.381 52.211 92.737  1.00 38.07 ? 82   LYS B NZ  1 
ATOM   2740 N N   . ARG B 1 82  ? 20.869 49.513 90.607  1.00 23.10 ? 83   ARG B N   1 
ATOM   2741 C CA  . ARG B 1 82  ? 20.377 50.435 89.593  1.00 24.20 ? 83   ARG B CA  1 
ATOM   2742 C C   . ARG B 1 82  ? 18.886 50.710 89.744  1.00 23.35 ? 83   ARG B C   1 
ATOM   2743 O O   . ARG B 1 82  ? 18.410 51.786 89.362  1.00 24.97 ? 83   ARG B O   1 
ATOM   2744 C CB  . ARG B 1 82  ? 20.655 49.889 88.181  1.00 22.75 ? 83   ARG B CB  1 
ATOM   2745 C CG  . ARG B 1 82  ? 20.540 50.942 87.075  1.00 20.35 ? 83   ARG B CG  1 
ATOM   2746 C CD  . ARG B 1 82  ? 21.747 51.901 87.136  1.00 19.43 ? 83   ARG B CD  1 
ATOM   2747 N NE  . ARG B 1 82  ? 21.806 52.802 85.991  1.00 20.99 ? 83   ARG B NE  1 
ATOM   2748 C CZ  . ARG B 1 82  ? 22.868 53.546 85.684  1.00 28.35 ? 83   ARG B CZ  1 
ATOM   2749 N NH1 . ARG B 1 82  ? 23.955 53.496 86.451  1.00 23.65 ? 83   ARG B NH1 1 
ATOM   2750 N NH2 . ARG B 1 82  ? 22.854 54.330 84.597  1.00 28.20 ? 83   ARG B NH2 1 
ATOM   2751 N N   . PHE B 1 83  ? 18.133 49.758 90.285  1.00 21.24 ? 84   PHE B N   1 
ATOM   2752 C CA  . PHE B 1 83  ? 16.697 49.990 90.443  1.00 22.94 ? 84   PHE B CA  1 
ATOM   2753 C C   . PHE B 1 83  ? 16.444 51.193 91.356  1.00 22.09 ? 84   PHE B C   1 
ATOM   2754 O O   . PHE B 1 83  ? 17.256 51.495 92.239  1.00 21.84 ? 84   PHE B O   1 
ATOM   2755 C CB  . PHE B 1 83  ? 15.975 48.773 91.039  1.00 21.83 ? 84   PHE B CB  1 
ATOM   2756 C CG  . PHE B 1 83  ? 16.083 47.514 90.216  1.00 21.07 ? 84   PHE B CG  1 
ATOM   2757 C CD1 . PHE B 1 83  ? 16.176 47.561 88.828  1.00 18.09 ? 84   PHE B CD1 1 
ATOM   2758 C CD2 . PHE B 1 83  ? 16.041 46.266 90.842  1.00 21.63 ? 84   PHE B CD2 1 
ATOM   2759 C CE1 . PHE B 1 83  ? 16.229 46.374 88.066  1.00 21.04 ? 84   PHE B CE1 1 
ATOM   2760 C CE2 . PHE B 1 83  ? 16.087 45.082 90.093  1.00 21.51 ? 84   PHE B CE2 1 
ATOM   2761 C CZ  . PHE B 1 83  ? 16.184 45.141 88.700  1.00 21.99 ? 84   PHE B CZ  1 
ATOM   2762 N N   . PHE B 1 84  ? 15.310 51.858 91.144  1.00 23.70 ? 85   PHE B N   1 
ATOM   2763 C CA  . PHE B 1 84  ? 14.937 53.029 91.952  1.00 27.21 ? 85   PHE B CA  1 
ATOM   2764 C C   . PHE B 1 84  ? 13.426 53.146 91.983  1.00 25.08 ? 85   PHE B C   1 
ATOM   2765 O O   . PHE B 1 84  ? 12.791 53.255 90.932  1.00 22.11 ? 85   PHE B O   1 
ATOM   2766 C CB  . PHE B 1 84  ? 15.537 54.300 91.338  1.00 30.65 ? 85   PHE B CB  1 
ATOM   2767 C CG  . PHE B 1 84  ? 15.349 55.539 92.183  1.00 33.70 ? 85   PHE B CG  1 
ATOM   2768 C CD1 . PHE B 1 84  ? 14.192 56.302 92.074  1.00 36.12 ? 85   PHE B CD1 1 
ATOM   2769 C CD2 . PHE B 1 84  ? 16.343 55.951 93.070  1.00 34.01 ? 85   PHE B CD2 1 
ATOM   2770 C CE1 . PHE B 1 84  ? 14.031 57.471 92.844  1.00 36.62 ? 85   PHE B CE1 1 
ATOM   2771 C CE2 . PHE B 1 84  ? 16.190 57.112 93.838  1.00 35.20 ? 85   PHE B CE2 1 
ATOM   2772 C CZ  . PHE B 1 84  ? 15.034 57.869 93.720  1.00 35.47 ? 85   PHE B CZ  1 
ATOM   2773 N N   . GLY B 1 85  ? 12.848 53.090 93.181  1.00 25.15 ? 86   GLY B N   1 
ATOM   2774 C CA  . GLY B 1 85  ? 11.400 53.196 93.304  1.00 23.64 ? 86   GLY B CA  1 
ATOM   2775 C C   . GLY B 1 85  ? 10.656 52.117 92.530  1.00 23.68 ? 86   GLY B C   1 
ATOM   2776 O O   . GLY B 1 85  ? 10.956 50.934 92.673  1.00 27.09 ? 86   GLY B O   1 
ATOM   2777 N N   . PRO B 1 86  ? 9.676  52.485 91.696  1.00 24.10 ? 87   PRO B N   1 
ATOM   2778 C CA  . PRO B 1 86  ? 8.921  51.497 90.926  1.00 22.43 ? 87   PRO B CA  1 
ATOM   2779 C C   . PRO B 1 86  ? 9.646  51.076 89.637  1.00 22.28 ? 87   PRO B C   1 
ATOM   2780 O O   . PRO B 1 86  ? 9.164  50.211 88.889  1.00 23.21 ? 87   PRO B O   1 
ATOM   2781 C CB  . PRO B 1 86  ? 7.627  52.237 90.640  1.00 26.13 ? 87   PRO B CB  1 
ATOM   2782 C CG  . PRO B 1 86  ? 8.163  53.614 90.295  1.00 25.65 ? 87   PRO B CG  1 
ATOM   2783 C CD  . PRO B 1 86  ? 9.218  53.852 91.383  1.00 23.21 ? 87   PRO B CD  1 
ATOM   2784 N N   . PHE B 1 87  ? 10.778 51.710 89.357  1.00 21.26 ? 88   PHE B N   1 
ATOM   2785 C CA  . PHE B 1 87  ? 11.544 51.370 88.156  1.00 19.17 ? 88   PHE B CA  1 
ATOM   2786 C C   . PHE B 1 87  ? 12.421 50.149 88.448  1.00 19.60 ? 88   PHE B C   1 
ATOM   2787 O O   . PHE B 1 87  ? 13.540 50.280 88.931  1.00 17.60 ? 88   PHE B O   1 
ATOM   2788 C CB  . PHE B 1 87  ? 12.399 52.560 87.725  1.00 24.06 ? 88   PHE B CB  1 
ATOM   2789 C CG  . PHE B 1 87  ? 11.588 53.796 87.403  1.00 27.75 ? 88   PHE B CG  1 
ATOM   2790 C CD1 . PHE B 1 87  ? 11.354 54.767 88.374  1.00 32.41 ? 88   PHE B CD1 1 
ATOM   2791 C CD2 . PHE B 1 87  ? 11.019 53.957 86.150  1.00 29.36 ? 88   PHE B CD2 1 
ATOM   2792 C CE1 . PHE B 1 87  ? 10.558 55.887 88.096  1.00 32.17 ? 88   PHE B CE1 1 
ATOM   2793 C CE2 . PHE B 1 87  ? 10.220 55.070 85.852  1.00 29.93 ? 88   PHE B CE2 1 
ATOM   2794 C CZ  . PHE B 1 87  ? 9.988  56.038 86.831  1.00 31.27 ? 88   PHE B CZ  1 
ATOM   2795 N N   . ARG B 1 88  ? 11.879 48.960 88.186  1.00 19.24 ? 89   ARG B N   1 
ATOM   2796 C CA  . ARG B 1 88  ? 12.610 47.709 88.430  1.00 18.74 ? 89   ARG B CA  1 
ATOM   2797 C C   . ARG B 1 88  ? 11.922 46.587 87.674  1.00 19.67 ? 89   ARG B C   1 
ATOM   2798 O O   . ARG B 1 88  ? 10.765 46.730 87.243  1.00 16.74 ? 89   ARG B O   1 
ATOM   2799 C CB  . ARG B 1 88  ? 12.606 47.345 89.946  1.00 23.15 ? 89   ARG B CB  1 
ATOM   2800 C CG  . ARG B 1 88  ? 11.207 47.110 90.552  1.00 24.49 ? 89   ARG B CG  1 
ATOM   2801 C CD  . ARG B 1 88  ? 11.214 46.921 92.100  1.00 25.56 ? 89   ARG B CD  1 
ATOM   2802 N NE  . ARG B 1 88  ? 11.612 48.159 92.771  1.00 24.59 ? 89   ARG B NE  1 
ATOM   2803 C CZ  . ARG B 1 88  ? 12.753 48.325 93.422  1.00 22.89 ? 89   ARG B CZ  1 
ATOM   2804 N NH1 . ARG B 1 88  ? 13.609 47.318 93.515  1.00 21.95 ? 89   ARG B NH1 1 
ATOM   2805 N NH2 . ARG B 1 88  ? 13.076 49.516 93.926  1.00 20.39 ? 89   ARG B NH2 1 
ATOM   2806 N N   . VAL B 1 89  ? 12.634 45.467 87.504  1.00 17.98 ? 90   VAL B N   1 
ATOM   2807 C CA  . VAL B 1 89  ? 12.054 44.293 86.859  1.00 18.23 ? 90   VAL B CA  1 
ATOM   2808 C C   . VAL B 1 89  ? 12.582 43.102 87.646  1.00 17.54 ? 90   VAL B C   1 
ATOM   2809 O O   . VAL B 1 89  ? 13.488 43.253 88.452  1.00 18.65 ? 90   VAL B O   1 
ATOM   2810 C CB  . VAL B 1 89  ? 12.492 44.131 85.381  1.00 19.96 ? 90   VAL B CB  1 
ATOM   2811 C CG1 . VAL B 1 89  ? 11.906 45.282 84.533  1.00 21.92 ? 90   VAL B CG1 1 
ATOM   2812 C CG2 . VAL B 1 89  ? 14.041 44.075 85.288  1.00 18.96 ? 90   VAL B CG2 1 
ATOM   2813 N N   . SER B 1 90  ? 11.999 41.933 87.430  1.00 16.90 ? 91   SER B N   1 
ATOM   2814 C CA  . SER B 1 90  ? 12.461 40.745 88.120  1.00 19.07 ? 91   SER B CA  1 
ATOM   2815 C C   . SER B 1 90  ? 13.852 40.362 87.607  1.00 18.45 ? 91   SER B C   1 
ATOM   2816 O O   . SER B 1 90  ? 14.190 40.625 86.447  1.00 18.19 ? 91   SER B O   1 
ATOM   2817 C CB  . SER B 1 90  ? 11.477 39.603 87.882  1.00 19.38 ? 91   SER B CB  1 
ATOM   2818 O OG  . SER B 1 90  ? 10.237 39.860 88.528  1.00 19.02 ? 91   SER B OG  1 
ATOM   2819 N N   . CYS B 1 91  ? 14.670 39.758 88.461  1.00 19.19 ? 92   CYS B N   1 
ATOM   2820 C CA  . CYS B 1 91  ? 16.012 39.348 88.036  1.00 17.78 ? 92   CYS B CA  1 
ATOM   2821 C C   . CYS B 1 91  ? 16.415 38.015 88.660  1.00 18.20 ? 92   CYS B C   1 
ATOM   2822 O O   . CYS B 1 91  ? 15.909 37.625 89.712  1.00 18.72 ? 92   CYS B O   1 
ATOM   2823 C CB  . CYS B 1 91  ? 17.048 40.423 88.402  1.00 14.99 ? 92   CYS B CB  1 
ATOM   2824 S SG  . CYS B 1 91  ? 17.100 40.929 90.164  1.00 20.74 ? 92   CYS B SG  1 
ATOM   2825 N N   . MET B 1 92  ? 17.337 37.319 88.010  1.00 19.02 ? 93   MET B N   1 
ATOM   2826 C CA  . MET B 1 92  ? 17.803 36.024 88.502  1.00 16.65 ? 93   MET B CA  1 
ATOM   2827 C C   . MET B 1 92  ? 19.295 35.945 88.301  1.00 17.82 ? 93   MET B C   1 
ATOM   2828 O O   . MET B 1 92  ? 19.819 36.528 87.337  1.00 18.58 ? 93   MET B O   1 
ATOM   2829 C CB  . MET B 1 92  ? 17.150 34.898 87.697  1.00 16.81 ? 93   MET B CB  1 
ATOM   2830 C CG  . MET B 1 92  ? 17.606 33.474 88.061  1.00 16.41 ? 93   MET B CG  1 
ATOM   2831 S SD  . MET B 1 92  ? 16.646 32.262 87.081  1.00 17.95 ? 93   MET B SD  1 
ATOM   2832 C CE  . MET B 1 92  ? 17.483 30.685 87.556  1.00 13.62 ? 93   MET B CE  1 
ATOM   2833 N N   . LEU B 1 93  ? 19.967 35.222 89.205  1.00 17.26 ? 94   LEU B N   1 
ATOM   2834 C CA  . LEU B 1 93  ? 21.412 34.995 89.156  1.00 18.09 ? 94   LEU B CA  1 
ATOM   2835 C C   . LEU B 1 93  ? 21.682 33.490 89.136  1.00 18.20 ? 94   LEU B C   1 
ATOM   2836 O O   . LEU B 1 93  ? 21.194 32.770 90.005  1.00 17.87 ? 94   LEU B O   1 
ATOM   2837 C CB  . LEU B 1 93  ? 22.088 35.578 90.403  1.00 16.79 ? 94   LEU B CB  1 
ATOM   2838 C CG  . LEU B 1 93  ? 23.560 35.164 90.611  1.00 18.20 ? 94   LEU B CG  1 
ATOM   2839 C CD1 . LEU B 1 93  ? 24.434 35.809 89.520  1.00 15.92 ? 94   LEU B CD1 1 
ATOM   2840 C CD2 . LEU B 1 93  ? 24.018 35.589 92.037  1.00 17.86 ? 94   LEU B CD2 1 
ATOM   2841 N N   . ASP B 1 94  ? 22.442 33.000 88.157  1.00 17.99 ? 95   ASP B N   1 
ATOM   2842 C CA  . ASP B 1 94  ? 22.760 31.569 88.140  1.00 19.83 ? 95   ASP B CA  1 
ATOM   2843 C C   . ASP B 1 94  ? 24.081 31.235 87.408  1.00 19.93 ? 95   ASP B C   1 
ATOM   2844 O O   . ASP B 1 94  ? 24.142 30.314 86.597  1.00 21.36 ? 95   ASP B O   1 
ATOM   2845 C CB  . ASP B 1 94  ? 21.579 30.764 87.561  1.00 17.97 ? 95   ASP B CB  1 
ATOM   2846 C CG  . ASP B 1 94  ? 21.633 29.290 87.948  1.00 19.09 ? 95   ASP B CG  1 
ATOM   2847 O OD1 . ASP B 1 94  ? 22.107 28.994 89.064  1.00 21.37 ? 95   ASP B OD1 1 
ATOM   2848 O OD2 . ASP B 1 94  ? 21.184 28.427 87.153  1.00 20.36 ? 95   ASP B OD2 1 
ATOM   2849 N N   . SER B 1 95  ? 25.133 31.989 87.730  1.00 18.18 ? 96   SER B N   1 
ATOM   2850 C CA  . SER B 1 95  ? 26.462 31.789 87.141  1.00 20.06 ? 96   SER B CA  1 
ATOM   2851 C C   . SER B 1 95  ? 26.917 30.312 87.272  1.00 21.63 ? 96   SER B C   1 
ATOM   2852 O O   . SER B 1 95  ? 26.894 29.744 88.354  1.00 23.96 ? 96   SER B O   1 
ATOM   2853 C CB  . SER B 1 95  ? 27.460 32.719 87.845  1.00 21.11 ? 96   SER B CB  1 
ATOM   2854 O OG  . SER B 1 95  ? 27.154 34.094 87.605  1.00 21.54 ? 96   SER B OG  1 
ATOM   2855 N N   . ASN B 1 96  ? 27.288 29.712 86.147  1.00 22.72 ? 97   ASN B N   1 
ATOM   2856 C CA  . ASN B 1 96  ? 27.733 28.316 86.062  1.00 25.23 ? 97   ASN B CA  1 
ATOM   2857 C C   . ASN B 1 96  ? 26.717 27.342 86.661  1.00 26.76 ? 97   ASN B C   1 
ATOM   2858 O O   . ASN B 1 96  ? 27.073 26.211 87.013  1.00 29.70 ? 97   ASN B O   1 
ATOM   2859 C CB  . ASN B 1 96  ? 29.069 28.112 86.767  1.00 26.28 ? 97   ASN B CB  1 
ATOM   2860 C CG  . ASN B 1 96  ? 29.804 26.855 86.271  1.00 30.59 ? 97   ASN B CG  1 
ATOM   2861 O OD1 . ASN B 1 96  ? 30.502 26.184 87.036  1.00 32.31 ? 97   ASN B OD1 1 
ATOM   2862 N ND2 . ASN B 1 96  ? 29.652 26.548 84.988  1.00 31.33 ? 97   ASN B ND2 1 
ATOM   2863 N N   . GLY B 1 97  ? 25.468 27.780 86.782  1.00 25.07 ? 98   GLY B N   1 
ATOM   2864 C CA  . GLY B 1 97  ? 24.417 26.930 87.331  1.00 23.32 ? 98   GLY B CA  1 
ATOM   2865 C C   . GLY B 1 97  ? 24.578 26.602 88.804  1.00 21.76 ? 98   GLY B C   1 
ATOM   2866 O O   . GLY B 1 97  ? 23.971 25.647 89.296  1.00 21.80 ? 98   GLY B O   1 
ATOM   2867 N N   . SER B 1 98  ? 25.362 27.395 89.523  1.00 21.34 ? 99   SER B N   1 
ATOM   2868 C CA  . SER B 1 98  ? 25.602 27.126 90.950  1.00 22.91 ? 99   SER B CA  1 
ATOM   2869 C C   . SER B 1 98  ? 24.393 27.206 91.882  1.00 21.47 ? 99   SER B C   1 
ATOM   2870 O O   . SER B 1 98  ? 24.292 26.429 92.855  1.00 19.83 ? 99   SER B O   1 
ATOM   2871 C CB  . SER B 1 98  ? 26.709 28.047 91.487  1.00 24.24 ? 99   SER B CB  1 
ATOM   2872 O OG  . SER B 1 98  ? 27.932 27.759 90.825  1.00 28.95 ? 99   SER B OG  1 
ATOM   2873 N N   . ASN B 1 99  ? 23.490 28.140 91.613  1.00 17.93 ? 100  ASN B N   1 
ATOM   2874 C CA  . ASN B 1 99  ? 22.312 28.289 92.460  1.00 17.94 ? 100  ASN B CA  1 
ATOM   2875 C C   . ASN B 1 99  ? 21.300 27.179 92.199  1.00 18.11 ? 100  ASN B C   1 
ATOM   2876 O O   . ASN B 1 99  ? 20.791 26.560 93.152  1.00 17.16 ? 100  ASN B O   1 
ATOM   2877 C CB  . ASN B 1 99  ? 21.620 29.634 92.222  1.00 18.13 ? 100  ASN B CB  1 
ATOM   2878 C CG  . ASN B 1 99  ? 22.191 30.748 93.073  1.00 21.05 ? 100  ASN B CG  1 
ATOM   2879 O OD1 . ASN B 1 99  ? 22.763 30.504 94.145  1.00 20.23 ? 100  ASN B OD1 1 
ATOM   2880 N ND2 . ASN B 1 99  ? 22.016 31.994 92.614  1.00 17.68 ? 100  ASN B ND2 1 
ATOM   2881 N N   . THR B 1 100 ? 20.999 26.927 90.923  1.00 16.83 ? 101  THR B N   1 
ATOM   2882 C CA  . THR B 1 100 ? 20.008 25.898 90.631  1.00 18.09 ? 101  THR B CA  1 
ATOM   2883 C C   . THR B 1 100 ? 20.518 24.507 90.976  1.00 19.85 ? 101  THR B C   1 
ATOM   2884 O O   . THR B 1 100 ? 19.731 23.612 91.356  1.00 18.32 ? 101  THR B O   1 
ATOM   2885 C CB  . THR B 1 100 ? 19.506 25.957 89.154  1.00 19.74 ? 101  THR B CB  1 
ATOM   2886 O OG1 . THR B 1 100 ? 20.607 25.866 88.239  1.00 18.43 ? 101  THR B OG1 1 
ATOM   2887 C CG2 . THR B 1 100 ? 18.720 27.272 88.912  1.00 22.47 ? 101  THR B CG2 1 
ATOM   2888 N N   . THR B 1 101 ? 21.830 24.311 90.869  1.00 18.20 ? 102  THR B N   1 
ATOM   2889 C CA  . THR B 1 101 ? 22.402 23.003 91.194  1.00 16.75 ? 102  THR B CA  1 
ATOM   2890 C C   . THR B 1 101 ? 22.355 22.725 92.702  1.00 18.02 ? 102  THR B C   1 
ATOM   2891 O O   . THR B 1 101 ? 21.908 21.656 93.144  1.00 18.89 ? 102  THR B O   1 
ATOM   2892 C CB  . THR B 1 101 ? 23.854 22.899 90.695  1.00 18.85 ? 102  THR B CB  1 
ATOM   2893 O OG1 . THR B 1 101 ? 23.862 22.880 89.258  1.00 20.85 ? 102  THR B OG1 1 
ATOM   2894 C CG2 . THR B 1 101 ? 24.515 21.610 91.220  1.00 20.23 ? 102  THR B CG2 1 
ATOM   2895 N N   . ALA B 1 102 ? 22.816 23.686 93.487  1.00 16.97 ? 103  ALA B N   1 
ATOM   2896 C CA  . ALA B 1 102 ? 22.831 23.543 94.932  1.00 19.70 ? 103  ALA B CA  1 
ATOM   2897 C C   . ALA B 1 102 ? 21.410 23.452 95.485  1.00 20.35 ? 103  ALA B C   1 
ATOM   2898 O O   . ALA B 1 102 ? 21.161 22.698 96.424  1.00 20.08 ? 103  ALA B O   1 
ATOM   2899 C CB  . ALA B 1 102 ? 23.583 24.724 95.578  1.00 18.01 ? 103  ALA B CB  1 
ATOM   2900 N N   . ALA B 1 103 ? 20.477 24.204 94.898  1.00 20.74 ? 104  ALA B N   1 
ATOM   2901 C CA  . ALA B 1 103 ? 19.082 24.180 95.361  1.00 20.99 ? 104  ALA B CA  1 
ATOM   2902 C C   . ALA B 1 103 ? 18.388 22.838 95.065  1.00 19.92 ? 104  ALA B C   1 
ATOM   2903 O O   . ALA B 1 103 ? 17.605 22.327 95.893  1.00 19.40 ? 104  ALA B O   1 
ATOM   2904 C CB  . ALA B 1 103 ? 18.300 25.304 94.723  1.00 19.91 ? 104  ALA B CB  1 
ATOM   2905 N N   . ALA B 1 104 ? 18.654 22.270 93.887  1.00 17.99 ? 105  ALA B N   1 
ATOM   2906 C CA  . ALA B 1 104 ? 18.060 20.972 93.548  1.00 18.34 ? 105  ALA B CA  1 
ATOM   2907 C C   . ALA B 1 104 ? 18.636 19.882 94.480  1.00 20.49 ? 105  ALA B C   1 
ATOM   2908 O O   . ALA B 1 104 ? 17.897 19.042 95.011  1.00 18.12 ? 105  ALA B O   1 
ATOM   2909 C CB  . ALA B 1 104 ? 18.350 20.620 92.070  1.00 15.06 ? 105  ALA B CB  1 
ATOM   2910 N N   . GLY B 1 105 ? 19.955 19.908 94.687  1.00 20.36 ? 106  GLY B N   1 
ATOM   2911 C CA  . GLY B 1 105 ? 20.584 18.918 95.550  1.00 21.39 ? 106  GLY B CA  1 
ATOM   2912 C C   . GLY B 1 105 ? 20.062 18.934 96.981  1.00 22.67 ? 106  GLY B C   1 
ATOM   2913 O O   . GLY B 1 105 ? 19.673 17.897 97.540  1.00 23.10 ? 106  GLY B O   1 
ATOM   2914 N N   . VAL B 1 106 ? 20.052 20.103 97.596  1.00 21.48 ? 107  VAL B N   1 
ATOM   2915 C CA  . VAL B 1 106 ? 19.567 20.188 98.966  1.00 21.44 ? 107  VAL B CA  1 
ATOM   2916 C C   . VAL B 1 106 ? 18.079 19.846 99.061  1.00 22.27 ? 107  VAL B C   1 
ATOM   2917 O O   . VAL B 1 106 ? 17.657 19.120 99.986  1.00 19.48 ? 107  VAL B O   1 
ATOM   2918 C CB  . VAL B 1 106 ? 19.858 21.588 99.546  1.00 19.82 ? 107  VAL B CB  1 
ATOM   2919 C CG1 . VAL B 1 106 ? 19.308 21.721 100.970 1.00 20.27 ? 107  VAL B CG1 1 
ATOM   2920 C CG2 . VAL B 1 106 ? 21.370 21.807 99.553  1.00 18.44 ? 107  VAL B CG2 1 
ATOM   2921 N N   . ALA B 1 107 ? 17.288 20.338 98.106  1.00 20.48 ? 108  ALA B N   1 
ATOM   2922 C CA  . ALA B 1 107 ? 15.849 20.072 98.106  1.00 21.08 ? 108  ALA B CA  1 
ATOM   2923 C C   . ALA B 1 107 ? 15.560 18.573 98.045  1.00 21.76 ? 108  ALA B C   1 
ATOM   2924 O O   . ALA B 1 107 ? 14.659 18.080 98.738  1.00 23.09 ? 108  ALA B O   1 
ATOM   2925 C CB  . ALA B 1 107 ? 15.157 20.798 96.923  1.00 17.17 ? 108  ALA B CB  1 
ATOM   2926 N N   . LEU B 1 108 ? 16.319 17.848 97.233  1.00 20.61 ? 109  LEU B N   1 
ATOM   2927 C CA  . LEU B 1 108 ? 16.110 16.404 97.116  1.00 22.63 ? 109  LEU B CA  1 
ATOM   2928 C C   . LEU B 1 108 ? 16.497 15.648 98.395  1.00 23.11 ? 109  LEU B C   1 
ATOM   2929 O O   . LEU B 1 108 ? 15.808 14.713 98.810  1.00 25.08 ? 109  LEU B O   1 
ATOM   2930 C CB  . LEU B 1 108 ? 16.885 15.856 95.916  1.00 21.54 ? 109  LEU B CB  1 
ATOM   2931 C CG  . LEU B 1 108 ? 16.361 16.287 94.541  1.00 19.54 ? 109  LEU B CG  1 
ATOM   2932 C CD1 . LEU B 1 108 ? 17.431 16.020 93.500  1.00 21.15 ? 109  LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 1 108 ? 15.083 15.509 94.172  1.00 21.65 ? 109  LEU B CD2 1 
ATOM   2934 N N   . VAL B 1 109 ? 17.596 16.054 99.011  1.00 21.38 ? 110  VAL B N   1 
ATOM   2935 C CA  . VAL B 1 109 ? 18.052 15.432 100.228 1.00 21.88 ? 110  VAL B CA  1 
ATOM   2936 C C   . VAL B 1 109 ? 17.078 15.733 101.382 1.00 22.13 ? 110  VAL B C   1 
ATOM   2937 O O   . VAL B 1 109 ? 16.729 14.841 102.148 1.00 23.97 ? 110  VAL B O   1 
ATOM   2938 C CB  . VAL B 1 109 ? 19.475 15.923 100.596 1.00 21.82 ? 110  VAL B CB  1 
ATOM   2939 C CG1 . VAL B 1 109 ? 19.872 15.418 101.989 1.00 22.72 ? 110  VAL B CG1 1 
ATOM   2940 C CG2 . VAL B 1 109 ? 20.498 15.371 99.575  1.00 21.68 ? 110  VAL B CG2 1 
ATOM   2941 N N   . VAL B 1 110 ? 16.629 16.970 101.507 1.00 20.90 ? 111  VAL B N   1 
ATOM   2942 C CA  . VAL B 1 110 ? 15.712 17.310 102.593 1.00 23.40 ? 111  VAL B CA  1 
ATOM   2943 C C   . VAL B 1 110 ? 14.390 16.567 102.420 1.00 25.63 ? 111  VAL B C   1 
ATOM   2944 O O   . VAL B 1 110 ? 13.775 16.126 103.403 1.00 25.09 ? 111  VAL B O   1 
ATOM   2945 C CB  . VAL B 1 110 ? 15.432 18.825 102.662 1.00 23.18 ? 111  VAL B CB  1 
ATOM   2946 C CG1 . VAL B 1 110 ? 14.273 19.105 103.653 1.00 23.89 ? 111  VAL B CG1 1 
ATOM   2947 C CG2 . VAL B 1 110 ? 16.679 19.566 103.116 1.00 19.65 ? 111  VAL B CG2 1 
ATOM   2948 N N   . LYS B 1 111 ? 13.942 16.422 101.179 1.00 24.59 ? 112  LYS B N   1 
ATOM   2949 C CA  . LYS B 1 111 ? 12.696 15.704 100.957 1.00 25.31 ? 112  LYS B CA  1 
ATOM   2950 C C   . LYS B 1 111 ? 12.864 14.223 101.323 1.00 25.34 ? 112  LYS B C   1 
ATOM   2951 O O   . LYS B 1 111 ? 12.020 13.644 102.019 1.00 25.24 ? 112  LYS B O   1 
ATOM   2952 C CB  . LYS B 1 111 ? 12.257 15.808 99.501  1.00 23.36 ? 112  LYS B CB  1 
ATOM   2953 C CG  . LYS B 1 111 ? 10.944 15.069 99.219  1.00 27.55 ? 112  LYS B CG  1 
ATOM   2954 C CD  . LYS B 1 111 ? 10.533 15.173 97.756  1.00 29.81 ? 112  LYS B CD  1 
ATOM   2955 C CE  . LYS B 1 111 ? 9.210  14.470 97.529  1.00 33.62 ? 112  LYS B CE  1 
ATOM   2956 N NZ  . LYS B 1 111 ? 9.099  14.020 96.126  1.00 37.18 ? 112  LYS B NZ  1 
ATOM   2957 N N   . ALA B 1 112 ? 13.956 13.609 100.877 1.00 22.82 ? 113  ALA B N   1 
ATOM   2958 C CA  . ALA B 1 112 ? 14.162 12.195 101.159 1.00 23.12 ? 113  ALA B CA  1 
ATOM   2959 C C   . ALA B 1 112 ? 14.400 11.928 102.641 1.00 25.04 ? 113  ALA B C   1 
ATOM   2960 O O   . ALA B 1 112 ? 14.197 10.805 103.109 1.00 24.05 ? 113  ALA B O   1 
ATOM   2961 C CB  . ALA B 1 112 ? 15.312 11.638 100.319 1.00 23.38 ? 113  ALA B CB  1 
ATOM   2962 N N   . ALA B 1 113 ? 14.818 12.955 103.376 1.00 24.50 ? 114  ALA B N   1 
ATOM   2963 C CA  . ALA B 1 113 ? 15.047 12.819 104.813 1.00 26.35 ? 114  ALA B CA  1 
ATOM   2964 C C   . ALA B 1 113 ? 13.722 12.900 105.593 1.00 27.24 ? 114  ALA B C   1 
ATOM   2965 O O   . ALA B 1 113 ? 13.696 12.726 106.812 1.00 30.07 ? 114  ALA B O   1 
ATOM   2966 C CB  . ALA B 1 113 ? 15.980 13.908 105.282 1.00 23.69 ? 114  ALA B CB  1 
ATOM   2967 N N   . GLY B 1 114 ? 12.624 13.165 104.889 1.00 27.56 ? 115  GLY B N   1 
ATOM   2968 C CA  . GLY B 1 114 ? 11.335 13.280 105.554 1.00 28.15 ? 115  GLY B CA  1 
ATOM   2969 C C   . GLY B 1 114 ? 10.774 14.689 105.626 1.00 30.10 ? 115  GLY B C   1 
ATOM   2970 O O   . GLY B 1 114 ? 9.658  14.889 106.125 1.00 32.15 ? 115  GLY B O   1 
ATOM   2971 N N   . GLY B 1 115 ? 11.534 15.676 105.156 1.00 28.23 ? 116  GLY B N   1 
ATOM   2972 C CA  . GLY B 1 115 ? 11.047 17.045 105.178 1.00 27.75 ? 116  GLY B CA  1 
ATOM   2973 C C   . GLY B 1 115 ? 11.663 17.980 106.205 1.00 27.87 ? 116  GLY B C   1 
ATOM   2974 O O   . GLY B 1 115 ? 11.469 19.189 106.113 1.00 28.83 ? 116  GLY B O   1 
ATOM   2975 N N   . SER B 1 116 ? 12.389 17.443 107.186 1.00 30.76 ? 117  SER B N   1 
ATOM   2976 C CA  . SER B 1 116 ? 13.042 18.270 108.211 1.00 32.79 ? 117  SER B CA  1 
ATOM   2977 C C   . SER B 1 116 ? 14.406 17.703 108.580 1.00 33.74 ? 117  SER B C   1 
ATOM   2978 O O   . SER B 1 116 ? 14.550 16.498 108.793 1.00 33.61 ? 117  SER B O   1 
ATOM   2979 C CB  . SER B 1 116 ? 12.189 18.366 109.485 1.00 35.13 ? 117  SER B CB  1 
ATOM   2980 O OG  . SER B 1 116 ? 12.868 19.086 110.512 1.00 37.84 ? 117  SER B OG  1 
ATOM   2981 N N   . VAL B 1 117 ? 15.407 18.579 108.657 1.00 33.66 ? 118  VAL B N   1 
ATOM   2982 C CA  . VAL B 1 117 ? 16.763 18.171 109.004 1.00 32.24 ? 118  VAL B CA  1 
ATOM   2983 C C   . VAL B 1 117 ? 17.250 19.019 110.158 1.00 34.66 ? 118  VAL B C   1 
ATOM   2984 O O   . VAL B 1 117 ? 18.457 19.108 110.439 1.00 32.63 ? 118  VAL B O   1 
ATOM   2985 C CB  . VAL B 1 117 ? 17.730 18.354 107.820 1.00 31.57 ? 118  VAL B CB  1 
ATOM   2986 C CG1 . VAL B 1 117 ? 17.374 17.396 106.714 1.00 29.17 ? 118  VAL B CG1 1 
ATOM   2987 C CG2 . VAL B 1 117 ? 17.680 19.797 107.329 1.00 28.19 ? 118  VAL B CG2 1 
ATOM   2988 N N   . LYS B 1 118 ? 16.295 19.647 110.830 1.00 36.79 ? 119  LYS B N   1 
ATOM   2989 C CA  . LYS B 1 118 ? 16.595 20.506 111.958 1.00 39.08 ? 119  LYS B CA  1 
ATOM   2990 C C   . LYS B 1 118 ? 17.407 19.723 112.988 1.00 40.64 ? 119  LYS B C   1 
ATOM   2991 O O   . LYS B 1 118 ? 17.036 18.611 113.377 1.00 41.45 ? 119  LYS B O   1 
ATOM   2992 C CB  . LYS B 1 118 ? 15.288 21.014 112.571 1.00 41.21 ? 119  LYS B CB  1 
ATOM   2993 C CG  . LYS B 1 118 ? 15.475 21.915 113.774 1.00 44.95 ? 119  LYS B CG  1 
ATOM   2994 C CD  . LYS B 1 118 ? 14.856 23.290 113.543 1.00 48.06 ? 119  LYS B CD  1 
ATOM   2995 C CE  . LYS B 1 118 ? 15.581 24.037 112.419 1.00 49.49 ? 119  LYS B CE  1 
ATOM   2996 N NZ  . LYS B 1 118 ? 15.076 25.430 112.165 1.00 48.51 ? 119  LYS B NZ  1 
ATOM   2997 N N   . GLY B 1 119 ? 18.533 20.294 113.394 1.00 40.43 ? 120  GLY B N   1 
ATOM   2998 C CA  . GLY B 1 119 ? 19.378 19.648 114.380 1.00 41.02 ? 120  GLY B CA  1 
ATOM   2999 C C   . GLY B 1 119 ? 20.185 18.433 113.954 1.00 40.13 ? 120  GLY B C   1 
ATOM   3000 O O   . GLY B 1 119 ? 20.782 17.777 114.804 1.00 40.80 ? 120  GLY B O   1 
ATOM   3001 N N   . LYS B 1 120 ? 20.213 18.112 112.667 1.00 38.51 ? 121  LYS B N   1 
ATOM   3002 C CA  . LYS B 1 120 ? 20.984 16.960 112.216 1.00 37.04 ? 121  LYS B CA  1 
ATOM   3003 C C   . LYS B 1 120 ? 22.335 17.404 111.663 1.00 38.17 ? 121  LYS B C   1 
ATOM   3004 O O   . LYS B 1 120 ? 22.499 18.556 111.261 1.00 37.33 ? 121  LYS B O   1 
ATOM   3005 C CB  . LYS B 1 120 ? 20.187 16.164 111.175 1.00 37.60 ? 121  LYS B CB  1 
ATOM   3006 C CG  . LYS B 1 120 ? 18.891 15.588 111.755 1.00 39.74 ? 121  LYS B CG  1 
ATOM   3007 C CD  . LYS B 1 120 ? 18.303 14.485 110.911 1.00 40.06 ? 121  LYS B CD  1 
ATOM   3008 C CE  . LYS B 1 120 ? 17.150 13.818 111.658 1.00 44.08 ? 121  LYS B CE  1 
ATOM   3009 N NZ  . LYS B 1 120 ? 16.478 12.733 110.890 1.00 45.58 ? 121  LYS B NZ  1 
ATOM   3010 N N   . LYS B 1 121 ? 23.313 16.503 111.660 1.00 35.95 ? 122  LYS B N   1 
ATOM   3011 C CA  . LYS B 1 121 ? 24.636 16.871 111.177 1.00 35.63 ? 122  LYS B CA  1 
ATOM   3012 C C   . LYS B 1 121 ? 24.824 16.608 109.701 1.00 33.25 ? 122  LYS B C   1 
ATOM   3013 O O   . LYS B 1 121 ? 24.602 15.493 109.227 1.00 29.74 ? 122  LYS B O   1 
ATOM   3014 C CB  . LYS B 1 121 ? 25.735 16.124 111.943 1.00 38.14 ? 122  LYS B CB  1 
ATOM   3015 C CG  . LYS B 1 121 ? 27.108 16.737 111.696 1.00 42.51 ? 122  LYS B CG  1 
ATOM   3016 C CD  . LYS B 1 121 ? 28.234 15.915 112.268 1.00 44.65 ? 122  LYS B CD  1 
ATOM   3017 C CE  . LYS B 1 121 ? 29.574 16.551 111.931 1.00 45.51 ? 122  LYS B CE  1 
ATOM   3018 N NZ  . LYS B 1 121 ? 30.704 15.633 112.229 1.00 49.21 ? 122  LYS B NZ  1 
ATOM   3019 N N   . ALA B 1 122 ? 25.254 17.646 108.988 1.00 31.73 ? 123  ALA B N   1 
ATOM   3020 C CA  . ALA B 1 122 ? 25.502 17.555 107.556 1.00 29.45 ? 123  ALA B CA  1 
ATOM   3021 C C   . ALA B 1 122 ? 26.933 17.998 107.281 1.00 30.44 ? 123  ALA B C   1 
ATOM   3022 O O   . ALA B 1 122 ? 27.377 19.039 107.763 1.00 29.78 ? 123  ALA B O   1 
ATOM   3023 C CB  . ALA B 1 122 ? 24.524 18.447 106.803 1.00 28.94 ? 123  ALA B CB  1 
ATOM   3024 N N   . VAL B 1 123 ? 27.643 17.196 106.499 1.00 28.48 ? 124  VAL B N   1 
ATOM   3025 C CA  . VAL B 1 123 ? 29.027 17.473 106.149 1.00 30.07 ? 124  VAL B CA  1 
ATOM   3026 C C   . VAL B 1 123 ? 29.169 17.680 104.643 1.00 29.09 ? 124  VAL B C   1 
ATOM   3027 O O   . VAL B 1 123 ? 28.742 16.841 103.854 1.00 30.96 ? 124  VAL B O   1 
ATOM   3028 C CB  . VAL B 1 123 ? 29.938 16.286 106.578 1.00 30.39 ? 124  VAL B CB  1 
ATOM   3029 C CG1 . VAL B 1 123 ? 31.337 16.455 106.014 1.00 27.48 ? 124  VAL B CG1 1 
ATOM   3030 C CG2 . VAL B 1 123 ? 29.960 16.191 108.109 1.00 32.40 ? 124  VAL B CG2 1 
ATOM   3031 N N   . VAL B 1 124 ? 29.761 18.808 104.249 1.00 29.99 ? 125  VAL B N   1 
ATOM   3032 C CA  . VAL B 1 124 ? 29.982 19.102 102.830 1.00 28.74 ? 125  VAL B CA  1 
ATOM   3033 C C   . VAL B 1 124 ? 31.480 19.057 102.545 1.00 28.34 ? 125  VAL B C   1 
ATOM   3034 O O   . VAL B 1 124 ? 32.217 19.979 102.916 1.00 28.49 ? 125  VAL B O   1 
ATOM   3035 C CB  . VAL B 1 124 ? 29.450 20.518 102.424 1.00 27.20 ? 125  VAL B CB  1 
ATOM   3036 C CG1 . VAL B 1 124 ? 29.669 20.737 100.947 1.00 25.46 ? 125  VAL B CG1 1 
ATOM   3037 C CG2 . VAL B 1 124 ? 27.959 20.653 102.756 1.00 28.26 ? 125  VAL B CG2 1 
ATOM   3038 N N   . LEU B 1 125 ? 31.918 17.983 101.893 1.00 28.76 ? 126  LEU B N   1 
ATOM   3039 C CA  . LEU B 1 125 ? 33.322 17.790 101.544 1.00 29.71 ? 126  LEU B CA  1 
ATOM   3040 C C   . LEU B 1 125 ? 33.674 18.655 100.336 1.00 30.45 ? 126  LEU B C   1 
ATOM   3041 O O   . LEU B 1 125 ? 32.866 18.783 99.410  1.00 30.30 ? 126  LEU B O   1 
ATOM   3042 C CB  . LEU B 1 125 ? 33.583 16.307 101.236 1.00 29.41 ? 126  LEU B CB  1 
ATOM   3043 C CG  . LEU B 1 125 ? 33.435 15.420 102.487 1.00 28.26 ? 126  LEU B CG  1 
ATOM   3044 C CD1 . LEU B 1 125 ? 33.648 13.954 102.138 1.00 31.63 ? 126  LEU B CD1 1 
ATOM   3045 C CD2 . LEU B 1 125 ? 34.438 15.859 103.534 1.00 28.63 ? 126  LEU B CD2 1 
ATOM   3046 N N   . ALA B 1 126 ? 34.878 19.236 100.353 1.00 30.63 ? 127  ALA B N   1 
ATOM   3047 C CA  . ALA B 1 126 ? 35.338 20.127 99.274  1.00 30.86 ? 127  ALA B CA  1 
ATOM   3048 C C   . ALA B 1 126 ? 34.250 21.177 99.062  1.00 30.84 ? 127  ALA B C   1 
ATOM   3049 O O   . ALA B 1 126 ? 33.866 21.495 97.927  1.00 31.59 ? 127  ALA B O   1 
ATOM   3050 C CB  . ALA B 1 126 ? 35.565 19.340 98.003  1.00 29.41 ? 127  ALA B CB  1 
ATOM   3051 N N   . GLY B 1 127 ? 33.757 21.715 100.167 1.00 31.05 ? 128  GLY B N   1 
ATOM   3052 C CA  . GLY B 1 127 ? 32.686 22.688 100.093 1.00 31.45 ? 128  GLY B CA  1 
ATOM   3053 C C   . GLY B 1 127 ? 33.098 24.134 99.920  1.00 30.74 ? 128  GLY B C   1 
ATOM   3054 O O   . GLY B 1 127 ? 32.293 25.026 100.165 1.00 29.26 ? 128  GLY B O   1 
ATOM   3055 N N   . THR B 1 128 ? 34.330 24.372 99.482  1.00 29.96 ? 129  THR B N   1 
ATOM   3056 C CA  . THR B 1 128 ? 34.820 25.739 99.314  1.00 30.26 ? 129  THR B CA  1 
ATOM   3057 C C   . THR B 1 128 ? 34.520 26.383 97.955  1.00 31.54 ? 129  THR B C   1 
ATOM   3058 O O   . THR B 1 128 ? 34.830 27.553 97.737  1.00 32.48 ? 129  THR B O   1 
ATOM   3059 C CB  . THR B 1 128 ? 36.347 25.804 99.591  1.00 30.76 ? 129  THR B CB  1 
ATOM   3060 O OG1 . THR B 1 128 ? 37.006 24.759 98.864  1.00 29.62 ? 129  THR B OG1 1 
ATOM   3061 C CG2 . THR B 1 128 ? 36.629 25.637 101.088 1.00 29.32 ? 129  THR B CG2 1 
ATOM   3062 N N   . GLY B 1 129 ? 33.930 25.622 97.039  1.00 30.95 ? 130  GLY B N   1 
ATOM   3063 C CA  . GLY B 1 129 ? 33.586 26.175 95.741  1.00 29.85 ? 130  GLY B CA  1 
ATOM   3064 C C   . GLY B 1 129 ? 32.184 26.757 95.803  1.00 29.43 ? 130  GLY B C   1 
ATOM   3065 O O   . GLY B 1 129 ? 31.552 26.674 96.857  1.00 25.40 ? 130  GLY B O   1 
ATOM   3066 N N   . PRO B 1 130 ? 31.664 27.358 94.708  1.00 29.39 ? 131  PRO B N   1 
ATOM   3067 C CA  . PRO B 1 130 ? 30.316 27.943 94.694  1.00 27.10 ? 131  PRO B CA  1 
ATOM   3068 C C   . PRO B 1 130 ? 29.190 26.978 95.082  1.00 24.27 ? 131  PRO B C   1 
ATOM   3069 O O   . PRO B 1 130 ? 28.288 27.348 95.831  1.00 22.77 ? 131  PRO B O   1 
ATOM   3070 C CB  . PRO B 1 130 ? 30.150 28.414 93.246  1.00 27.81 ? 131  PRO B CB  1 
ATOM   3071 C CG  . PRO B 1 130 ? 31.541 28.745 92.838  1.00 32.19 ? 131  PRO B CG  1 
ATOM   3072 C CD  . PRO B 1 130 ? 32.355 27.614 93.432  1.00 30.12 ? 131  PRO B CD  1 
ATOM   3073 N N   . VAL B 1 131 ? 29.236 25.756 94.549  1.00 25.27 ? 132  VAL B N   1 
ATOM   3074 C CA  . VAL B 1 131 ? 28.182 24.768 94.822  1.00 25.32 ? 132  VAL B CA  1 
ATOM   3075 C C   . VAL B 1 131 ? 28.209 24.282 96.279  1.00 24.90 ? 132  VAL B C   1 
ATOM   3076 O O   . VAL B 1 131 ? 27.159 24.103 96.903  1.00 24.80 ? 132  VAL B O   1 
ATOM   3077 C CB  . VAL B 1 131 ? 28.294 23.565 93.866  1.00 24.51 ? 132  VAL B CB  1 
ATOM   3078 C CG1 . VAL B 1 131 ? 27.297 22.471 94.267  1.00 26.13 ? 132  VAL B CG1 1 
ATOM   3079 C CG2 . VAL B 1 131 ? 28.006 24.016 92.442  1.00 25.62 ? 132  VAL B CG2 1 
ATOM   3080 N N   . GLY B 1 132 ? 29.412 24.069 96.807  1.00 23.65 ? 133  GLY B N   1 
ATOM   3081 C CA  . GLY B 1 132 ? 29.542 23.630 98.185  1.00 22.24 ? 133  GLY B CA  1 
ATOM   3082 C C   . GLY B 1 132 ? 29.086 24.725 99.128  1.00 22.68 ? 133  GLY B C   1 
ATOM   3083 O O   . GLY B 1 132 ? 28.402 24.471 100.126 1.00 21.57 ? 133  GLY B O   1 
ATOM   3084 N N   . MET B 1 133 ? 29.455 25.961 98.808  1.00 23.20 ? 134  MET B N   1 
ATOM   3085 C CA  . MET B 1 133 ? 29.092 27.086 99.654  1.00 23.08 ? 134  MET B CA  1 
ATOM   3086 C C   . MET B 1 133 ? 27.592 27.314 99.684  1.00 22.96 ? 134  MET B C   1 
ATOM   3087 O O   . MET B 1 133 ? 27.016 27.453 100.758 1.00 24.48 ? 134  MET B O   1 
ATOM   3088 C CB  . MET B 1 133 ? 29.839 28.349 99.204  1.00 25.72 ? 134  MET B CB  1 
ATOM   3089 C CG  . MET B 1 133 ? 31.269 28.406 99.748  1.00 25.56 ? 134  MET B CG  1 
ATOM   3090 S SD  . MET B 1 133 ? 32.236 29.747 99.059  1.00 29.92 ? 134  MET B SD  1 
ATOM   3091 C CE  . MET B 1 133 ? 31.624 31.052 99.937  1.00 26.74 ? 134  MET B CE  1 
ATOM   3092 N N   . ARG B 1 134 ? 26.956 27.333 98.518  1.00 22.97 ? 135  ARG B N   1 
ATOM   3093 C CA  . ARG B 1 134 ? 25.509 27.540 98.464  1.00 24.25 ? 135  ARG B CA  1 
ATOM   3094 C C   . ARG B 1 134 ? 24.789 26.377 99.161  1.00 22.48 ? 135  ARG B C   1 
ATOM   3095 O O   . ARG B 1 134 ? 23.811 26.584 99.869  1.00 22.87 ? 135  ARG B O   1 
ATOM   3096 C CB  . ARG B 1 134 ? 25.023 27.670 97.002  1.00 24.41 ? 135  ARG B CB  1 
ATOM   3097 C CG  . ARG B 1 134 ? 25.410 29.001 96.320  1.00 28.29 ? 135  ARG B CG  1 
ATOM   3098 C CD  . ARG B 1 134 ? 24.866 30.175 97.122  1.00 32.15 ? 135  ARG B CD  1 
ATOM   3099 N NE  . ARG B 1 134 ? 24.463 31.332 96.311  1.00 34.83 ? 135  ARG B NE  1 
ATOM   3100 C CZ  . ARG B 1 134 ? 25.197 32.432 96.147  1.00 37.89 ? 135  ARG B CZ  1 
ATOM   3101 N NH1 . ARG B 1 134 ? 26.391 32.531 96.724  1.00 35.81 ? 135  ARG B NH1 1 
ATOM   3102 N NH2 . ARG B 1 134 ? 24.713 33.459 95.452  1.00 34.19 ? 135  ARG B NH2 1 
ATOM   3103 N N   . SER B 1 135 ? 25.269 25.159 98.967  1.00 23.91 ? 136  SER B N   1 
ATOM   3104 C CA  . SER B 1 135 ? 24.647 24.000 99.622  1.00 23.06 ? 136  SER B CA  1 
ATOM   3105 C C   . SER B 1 135 ? 24.693 24.179 101.142 1.00 25.37 ? 136  SER B C   1 
ATOM   3106 O O   . SER B 1 135 ? 23.680 23.994 101.831 1.00 24.61 ? 136  SER B O   1 
ATOM   3107 C CB  . SER B 1 135 ? 25.379 22.705 99.232  1.00 24.75 ? 136  SER B CB  1 
ATOM   3108 O OG  . SER B 1 135 ? 25.169 22.393 97.865  1.00 18.63 ? 136  SER B OG  1 
ATOM   3109 N N   . ALA B 1 136 ? 25.866 24.538 101.671 1.00 24.96 ? 137  ALA B N   1 
ATOM   3110 C CA  . ALA B 1 136 ? 26.015 24.737 103.114 1.00 25.07 ? 137  ALA B CA  1 
ATOM   3111 C C   . ALA B 1 136 ? 25.021 25.792 103.602 1.00 26.17 ? 137  ALA B C   1 
ATOM   3112 O O   . ALA B 1 136 ? 24.369 25.626 104.645 1.00 25.71 ? 137  ALA B O   1 
ATOM   3113 C CB  . ALA B 1 136 ? 27.448 25.165 103.448 1.00 26.79 ? 137  ALA B CB  1 
ATOM   3114 N N   . ALA B 1 137 ? 24.883 26.872 102.837 1.00 24.89 ? 138  ALA B N   1 
ATOM   3115 C CA  . ALA B 1 137 ? 23.953 27.934 103.211 1.00 25.20 ? 138  ALA B CA  1 
ATOM   3116 C C   . ALA B 1 137 ? 22.523 27.437 103.348 1.00 24.75 ? 138  ALA B C   1 
ATOM   3117 O O   . ALA B 1 137 ? 21.828 27.715 104.338 1.00 24.77 ? 138  ALA B O   1 
ATOM   3118 C CB  . ALA B 1 137 ? 23.988 29.059 102.176 1.00 24.33 ? 138  ALA B CB  1 
ATOM   3119 N N   . LEU B 1 138 ? 22.075 26.707 102.339 1.00 23.07 ? 139  LEU B N   1 
ATOM   3120 C CA  . LEU B 1 138 ? 20.707 26.224 102.335 1.00 22.89 ? 139  LEU B CA  1 
ATOM   3121 C C   . LEU B 1 138 ? 20.445 25.195 103.445 1.00 23.96 ? 139  LEU B C   1 
ATOM   3122 O O   . LEU B 1 138 ? 19.382 25.203 104.062 1.00 23.59 ? 139  LEU B O   1 
ATOM   3123 C CB  . LEU B 1 138 ? 20.370 25.671 100.941 1.00 22.03 ? 139  LEU B CB  1 
ATOM   3124 C CG  . LEU B 1 138 ? 20.438 26.726 99.821  1.00 19.59 ? 139  LEU B CG  1 
ATOM   3125 C CD1 . LEU B 1 138 ? 20.116 26.065 98.466  1.00 18.95 ? 139  LEU B CD1 1 
ATOM   3126 C CD2 . LEU B 1 138 ? 19.444 27.848 100.106 1.00 20.40 ? 139  LEU B CD2 1 
ATOM   3127 N N   . LEU B 1 139 ? 21.414 24.325 103.707 1.00 24.02 ? 140  LEU B N   1 
ATOM   3128 C CA  . LEU B 1 139 ? 21.261 23.337 104.768 1.00 25.00 ? 140  LEU B CA  1 
ATOM   3129 C C   . LEU B 1 139 ? 21.168 24.051 106.115 1.00 26.04 ? 140  LEU B C   1 
ATOM   3130 O O   . LEU B 1 139 ? 20.311 23.721 106.944 1.00 26.24 ? 140  LEU B O   1 
ATOM   3131 C CB  . LEU B 1 139 ? 22.459 22.375 104.752 1.00 25.70 ? 140  LEU B CB  1 
ATOM   3132 C CG  . LEU B 1 139 ? 22.467 21.449 103.536 1.00 24.23 ? 140  LEU B CG  1 
ATOM   3133 C CD1 . LEU B 1 139 ? 23.860 20.941 103.242 1.00 24.92 ? 140  LEU B CD1 1 
ATOM   3134 C CD2 . LEU B 1 139 ? 21.524 20.296 103.824 1.00 24.58 ? 140  LEU B CD2 1 
ATOM   3135 N N   . ALA B 1 140 ? 22.039 25.042 106.324 1.00 26.85 ? 141  ALA B N   1 
ATOM   3136 C CA  . ALA B 1 140 ? 22.057 25.808 107.566 1.00 27.00 ? 141  ALA B CA  1 
ATOM   3137 C C   . ALA B 1 140 ? 20.748 26.560 107.783 1.00 28.51 ? 141  ALA B C   1 
ATOM   3138 O O   . ALA B 1 140 ? 20.273 26.700 108.920 1.00 28.48 ? 141  ALA B O   1 
ATOM   3139 C CB  . ALA B 1 140 ? 23.243 26.789 107.566 1.00 29.95 ? 141  ALA B CB  1 
ATOM   3140 N N   . GLY B 1 141 ? 20.154 27.043 106.699 1.00 27.19 ? 142  GLY B N   1 
ATOM   3141 C CA  . GLY B 1 141 ? 18.894 27.742 106.825 1.00 27.22 ? 142  GLY B CA  1 
ATOM   3142 C C   . GLY B 1 141 ? 17.778 26.779 107.195 1.00 27.88 ? 142  GLY B C   1 
ATOM   3143 O O   . GLY B 1 141 ? 16.743 27.179 107.726 1.00 28.87 ? 142  GLY B O   1 
ATOM   3144 N N   . GLU B 1 142 ? 17.968 25.502 106.909 1.00 26.01 ? 143  GLU B N   1 
ATOM   3145 C CA  . GLU B 1 142 ? 16.944 24.528 107.245 1.00 27.86 ? 143  GLU B CA  1 
ATOM   3146 C C   . GLU B 1 142 ? 17.125 24.061 108.685 1.00 28.95 ? 143  GLU B C   1 
ATOM   3147 O O   . GLU B 1 142 ? 16.323 23.276 109.189 1.00 28.23 ? 143  GLU B O   1 
ATOM   3148 C CB  . GLU B 1 142 ? 17.014 23.330 106.311 1.00 26.60 ? 143  GLU B CB  1 
ATOM   3149 C CG  . GLU B 1 142 ? 16.449 23.573 104.925 1.00 28.42 ? 143  GLU B CG  1 
ATOM   3150 C CD  . GLU B 1 142 ? 14.956 23.367 104.866 1.00 31.07 ? 143  GLU B CD  1 
ATOM   3151 O OE1 . GLU B 1 142 ? 14.422 23.190 103.748 1.00 28.33 ? 143  GLU B OE1 1 
ATOM   3152 O OE2 . GLU B 1 142 ? 14.308 23.371 105.936 1.00 33.10 ? 143  GLU B OE2 1 
ATOM   3153 N N   . GLY B 1 143 ? 18.184 24.544 109.336 1.00 30.02 ? 144  GLY B N   1 
ATOM   3154 C CA  . GLY B 1 143 ? 18.431 24.171 110.720 1.00 31.39 ? 144  GLY B CA  1 
ATOM   3155 C C   . GLY B 1 143 ? 19.457 23.079 110.978 1.00 31.70 ? 144  GLY B C   1 
ATOM   3156 O O   . GLY B 1 143 ? 19.731 22.760 112.135 1.00 33.29 ? 144  GLY B O   1 
ATOM   3157 N N   . ALA B 1 144 ? 20.031 22.500 109.930 1.00 29.16 ? 145  ALA B N   1 
ATOM   3158 C CA  . ALA B 1 144 ? 21.035 21.450 110.108 1.00 29.56 ? 145  ALA B CA  1 
ATOM   3159 C C   . ALA B 1 144 ? 22.355 22.006 110.645 1.00 30.56 ? 145  ALA B C   1 
ATOM   3160 O O   . ALA B 1 144 ? 22.648 23.202 110.496 1.00 29.82 ? 145  ALA B O   1 
ATOM   3161 C CB  . ALA B 1 144 ? 21.282 20.741 108.786 1.00 25.48 ? 145  ALA B CB  1 
ATOM   3162 N N   . GLU B 1 145 ? 23.138 21.138 111.282 1.00 32.24 ? 146  GLU B N   1 
ATOM   3163 C CA  . GLU B 1 145 ? 24.462 21.506 111.801 1.00 35.41 ? 146  GLU B CA  1 
ATOM   3164 C C   . GLU B 1 145 ? 25.410 21.251 110.643 1.00 33.50 ? 146  GLU B C   1 
ATOM   3165 O O   . GLU B 1 145 ? 25.646 20.100 110.294 1.00 34.79 ? 146  GLU B O   1 
ATOM   3166 C CB  . GLU B 1 145 ? 24.887 20.589 112.950 1.00 36.78 ? 146  GLU B CB  1 
ATOM   3167 C CG  . GLU B 1 145 ? 24.274 20.884 114.291 1.00 44.88 ? 146  GLU B CG  1 
ATOM   3168 C CD  . GLU B 1 145 ? 24.824 19.948 115.371 1.00 48.08 ? 146  GLU B CD  1 
ATOM   3169 O OE1 . GLU B 1 145 ? 26.073 19.849 115.503 1.00 45.91 ? 146  GLU B OE1 1 
ATOM   3170 O OE2 . GLU B 1 145 ? 24.000 19.317 116.077 1.00 50.58 ? 146  GLU B OE2 1 
ATOM   3171 N N   . VAL B 1 146 ? 25.980 22.298 110.062 1.00 32.90 ? 147  VAL B N   1 
ATOM   3172 C CA  . VAL B 1 146 ? 26.854 22.095 108.917 1.00 31.36 ? 147  VAL B CA  1 
ATOM   3173 C C   . VAL B 1 146 ? 28.347 22.329 109.136 1.00 31.80 ? 147  VAL B C   1 
ATOM   3174 O O   . VAL B 1 146 ? 28.747 23.325 109.739 1.00 31.09 ? 147  VAL B O   1 
ATOM   3175 C CB  . VAL B 1 146 ? 26.394 22.984 107.726 1.00 29.12 ? 147  VAL B CB  1 
ATOM   3176 C CG1 . VAL B 1 146 ? 27.153 22.604 106.471 1.00 29.07 ? 147  VAL B CG1 1 
ATOM   3177 C CG2 . VAL B 1 146 ? 24.881 22.834 107.518 1.00 26.99 ? 147  VAL B CG2 1 
ATOM   3178 N N   . VAL B 1 147 ? 29.156 21.401 108.615 1.00 31.76 ? 148  VAL B N   1 
ATOM   3179 C CA  . VAL B 1 147 ? 30.617 21.466 108.685 1.00 32.16 ? 148  VAL B CA  1 
ATOM   3180 C C   . VAL B 1 147 ? 31.173 21.505 107.255 1.00 31.80 ? 148  VAL B C   1 
ATOM   3181 O O   . VAL B 1 147 ? 31.091 20.515 106.533 1.00 33.58 ? 148  VAL B O   1 
ATOM   3182 C CB  . VAL B 1 147 ? 31.236 20.216 109.388 1.00 32.70 ? 148  VAL B CB  1 
ATOM   3183 C CG1 . VAL B 1 147 ? 32.752 20.239 109.237 1.00 32.90 ? 148  VAL B CG1 1 
ATOM   3184 C CG2 . VAL B 1 147 ? 30.867 20.185 110.857 1.00 35.04 ? 148  VAL B CG2 1 
ATOM   3185 N N   . LEU B 1 148 ? 31.739 22.642 106.858 1.00 32.26 ? 149  LEU B N   1 
ATOM   3186 C CA  . LEU B 1 148 ? 32.298 22.825 105.519 1.00 31.99 ? 149  LEU B CA  1 
ATOM   3187 C C   . LEU B 1 148 ? 33.794 22.481 105.543 1.00 33.83 ? 149  LEU B C   1 
ATOM   3188 O O   . LEU B 1 148 ? 34.574 23.128 106.245 1.00 34.86 ? 149  LEU B O   1 
ATOM   3189 C CB  . LEU B 1 148 ? 32.075 24.273 105.090 1.00 32.77 ? 149  LEU B CB  1 
ATOM   3190 C CG  . LEU B 1 148 ? 32.360 24.736 103.659 1.00 33.21 ? 149  LEU B CG  1 
ATOM   3191 C CD1 . LEU B 1 148 ? 31.621 26.056 103.438 1.00 34.19 ? 149  LEU B CD1 1 
ATOM   3192 C CD2 . LEU B 1 148 ? 33.867 24.899 103.423 1.00 32.41 ? 149  LEU B CD2 1 
ATOM   3193 N N   . CYS B 1 149 ? 34.178 21.472 104.761 1.00 33.42 ? 150  CYS B N   1 
ATOM   3194 C CA  . CYS B 1 149 ? 35.553 20.979 104.728 1.00 34.98 ? 150  CYS B CA  1 
ATOM   3195 C C   . CYS B 1 149 ? 36.337 21.288 103.459 1.00 36.69 ? 150  CYS B C   1 
ATOM   3196 O O   . CYS B 1 149 ? 35.780 21.396 102.362 1.00 35.27 ? 150  CYS B O   1 
ATOM   3197 C CB  . CYS B 1 149 ? 35.560 19.455 104.934 1.00 33.37 ? 150  CYS B CB  1 
ATOM   3198 S SG  . CYS B 1 149 ? 34.594 18.882 106.355 1.00 34.41 ? 150  CYS B SG  1 
ATOM   3199 N N   . GLY B 1 150 ? 37.650 21.399 103.620 1.00 37.07 ? 151  GLY B N   1 
ATOM   3200 C CA  . GLY B 1 150 ? 38.528 21.664 102.496 1.00 38.60 ? 151  GLY B CA  1 
ATOM   3201 C C   . GLY B 1 150 ? 39.932 21.248 102.892 1.00 41.54 ? 151  GLY B C   1 
ATOM   3202 O O   . GLY B 1 150 ? 40.179 20.947 104.071 1.00 42.14 ? 151  GLY B O   1 
ATOM   3203 N N   . ARG B 1 151 ? 40.852 21.239 101.933 1.00 41.48 ? 152  ARG B N   1 
ATOM   3204 C CA  . ARG B 1 151 ? 42.234 20.848 102.213 1.00 43.46 ? 152  ARG B CA  1 
ATOM   3205 C C   . ARG B 1 151 ? 43.019 21.777 103.141 1.00 43.76 ? 152  ARG B C   1 
ATOM   3206 O O   . ARG B 1 151 ? 44.015 21.361 103.734 1.00 45.23 ? 152  ARG B O   1 
ATOM   3207 C CB  . ARG B 1 151 ? 42.990 20.664 100.902 1.00 41.70 ? 152  ARG B CB  1 
ATOM   3208 C CG  . ARG B 1 151 ? 42.560 19.420 100.140 1.00 41.87 ? 152  ARG B CG  1 
ATOM   3209 C CD  . ARG B 1 151 ? 43.165 19.399 98.759  1.00 41.06 ? 152  ARG B CD  1 
ATOM   3210 N NE  . ARG B 1 151 ? 42.711 20.549 97.976  1.00 44.08 ? 152  ARG B NE  1 
ATOM   3211 C CZ  . ARG B 1 151 ? 43.245 20.931 96.822  1.00 41.96 ? 152  ARG B CZ  1 
ATOM   3212 N NH1 . ARG B 1 151 ? 44.262 20.259 96.305  1.00 42.57 ? 152  ARG B NH1 1 
ATOM   3213 N NH2 . ARG B 1 151 ? 42.762 21.990 96.184  1.00 44.23 ? 152  ARG B NH2 1 
ATOM   3214 N N   . LYS B 1 152 ? 42.569 23.018 103.294 1.00 43.16 ? 153  LYS B N   1 
ATOM   3215 C CA  . LYS B 1 152 ? 43.277 23.965 104.151 1.00 44.39 ? 153  LYS B CA  1 
ATOM   3216 C C   . LYS B 1 152 ? 42.334 24.808 105.010 1.00 44.23 ? 153  LYS B C   1 
ATOM   3217 O O   . LYS B 1 152 ? 41.546 25.604 104.503 1.00 44.83 ? 153  LYS B O   1 
ATOM   3218 C CB  . LYS B 1 152 ? 44.167 24.846 103.274 1.00 44.60 ? 153  LYS B CB  1 
ATOM   3219 C CG  . LYS B 1 152 ? 45.030 24.001 102.354 1.00 47.39 ? 153  LYS B CG  1 
ATOM   3220 C CD  . LYS B 1 152 ? 45.773 24.790 101.301 1.00 50.97 ? 153  LYS B CD  1 
ATOM   3221 C CE  . LYS B 1 152 ? 46.584 23.831 100.425 1.00 53.77 ? 153  LYS B CE  1 
ATOM   3222 N NZ  . LYS B 1 152 ? 47.366 24.517 99.350  1.00 56.17 ? 153  LYS B NZ  1 
ATOM   3223 N N   . LEU B 1 153 ? 42.417 24.615 106.320 1.00 43.65 ? 154  LEU B N   1 
ATOM   3224 C CA  . LEU B 1 153 ? 41.560 25.333 107.261 1.00 44.60 ? 154  LEU B CA  1 
ATOM   3225 C C   . LEU B 1 153 ? 41.364 26.811 106.900 1.00 44.73 ? 154  LEU B C   1 
ATOM   3226 O O   . LEU B 1 153 ? 40.263 27.363 107.037 1.00 43.47 ? 154  LEU B O   1 
ATOM   3227 C CB  . LEU B 1 153 ? 42.143 25.228 108.674 1.00 42.93 ? 154  LEU B CB  1 
ATOM   3228 C CG  . LEU B 1 153 ? 41.250 25.766 109.794 1.00 41.75 ? 154  LEU B CG  1 
ATOM   3229 C CD1 . LEU B 1 153 ? 39.933 24.981 109.833 1.00 41.77 ? 154  LEU B CD1 1 
ATOM   3230 C CD2 . LEU B 1 153 ? 41.984 25.642 111.125 1.00 43.33 ? 154  LEU B CD2 1 
ATOM   3231 N N   A ASP B 1 154 ? 42.450 27.414 106.434 0.60 44.39 ? 155  ASP B N   1 
ATOM   3232 N N   B ASP B 1 154 ? 42.437 27.461 106.455 0.40 44.08 ? 155  ASP B N   1 
ATOM   3233 C CA  A ASP B 1 154 ? 42.508 28.807 106.022 0.60 44.25 ? 155  ASP B CA  1 
ATOM   3234 C CA  B ASP B 1 154 ? 42.376 28.876 106.100 0.40 43.72 ? 155  ASP B CA  1 
ATOM   3235 C C   A ASP B 1 154 ? 41.338 29.146 105.089 0.60 43.94 ? 155  ASP B C   1 
ATOM   3236 C C   B ASP B 1 154 ? 41.283 29.170 105.073 0.40 43.53 ? 155  ASP B C   1 
ATOM   3237 O O   A ASP B 1 154 ? 40.468 29.962 105.407 0.60 42.93 ? 155  ASP B O   1 
ATOM   3238 O O   B ASP B 1 154 ? 40.400 29.997 105.313 0.40 42.73 ? 155  ASP B O   1 
ATOM   3239 C CB  A ASP B 1 154 ? 43.837 29.024 105.288 0.60 45.30 ? 155  ASP B CB  1 
ATOM   3240 C CB  B ASP B 1 154 ? 43.745 29.359 105.587 0.40 44.31 ? 155  ASP B CB  1 
ATOM   3241 C CG  A ASP B 1 154 ? 44.331 30.446 105.369 0.60 46.97 ? 155  ASP B CG  1 
ATOM   3242 C CG  B ASP B 1 154 ? 44.240 28.577 104.379 0.40 44.64 ? 155  ASP B CG  1 
ATOM   3243 O OD1 A ASP B 1 154 ? 44.624 30.908 106.491 0.60 48.90 ? 155  ASP B OD1 1 
ATOM   3244 O OD1 B ASP B 1 154 ? 43.704 28.767 103.270 0.40 45.30 ? 155  ASP B OD1 1 
ATOM   3245 O OD2 A ASP B 1 154 ? 44.436 31.097 104.310 0.60 47.98 ? 155  ASP B OD2 1 
ATOM   3246 O OD2 B ASP B 1 154 ? 45.175 27.767 104.538 0.40 47.17 ? 155  ASP B OD2 1 
ATOM   3247 N N   . LYS B 1 155 ? 41.345 28.494 103.932 1.00 43.20 ? 156  LYS B N   1 
ATOM   3248 C CA  . LYS B 1 155 ? 40.352 28.681 102.882 1.00 42.76 ? 156  LYS B CA  1 
ATOM   3249 C C   . LYS B 1 155 ? 38.954 28.197 103.292 1.00 42.18 ? 156  LYS B C   1 
ATOM   3250 O O   . LYS B 1 155 ? 37.942 28.808 102.919 1.00 42.34 ? 156  LYS B O   1 
ATOM   3251 C CB  . LYS B 1 155 ? 40.836 27.937 101.639 1.00 41.98 ? 156  LYS B CB  1 
ATOM   3252 C CG  . LYS B 1 155 ? 39.920 27.976 100.444 1.00 41.83 ? 156  LYS B CG  1 
ATOM   3253 C CD  . LYS B 1 155 ? 40.526 27.125 99.332  1.00 40.88 ? 156  LYS B CD  1 
ATOM   3254 C CE  . LYS B 1 155 ? 39.669 27.109 98.084  1.00 40.51 ? 156  LYS B CE  1 
ATOM   3255 N NZ  . LYS B 1 155 ? 40.317 26.322 97.005  1.00 40.08 ? 156  LYS B NZ  1 
ATOM   3256 N N   . ALA B 1 156 ? 38.901 27.113 104.065 1.00 39.05 ? 157  ALA B N   1 
ATOM   3257 C CA  . ALA B 1 156 ? 37.626 26.564 104.509 1.00 37.29 ? 157  ALA B CA  1 
ATOM   3258 C C   . ALA B 1 156 ? 36.929 27.493 105.488 1.00 37.32 ? 157  ALA B C   1 
ATOM   3259 O O   . ALA B 1 156 ? 35.711 27.631 105.457 1.00 35.29 ? 157  ALA B O   1 
ATOM   3260 C CB  . ALA B 1 156 ? 37.833 25.201 105.148 1.00 36.59 ? 157  ALA B CB  1 
ATOM   3261 N N   . GLN B 1 157 ? 37.696 28.136 106.358 1.00 36.53 ? 158  GLN B N   1 
ATOM   3262 C CA  . GLN B 1 157 ? 37.095 29.034 107.330 1.00 36.93 ? 158  GLN B CA  1 
ATOM   3263 C C   . GLN B 1 157 ? 36.629 30.317 106.661 1.00 36.69 ? 158  GLN B C   1 
ATOM   3264 O O   . GLN B 1 157 ? 35.684 30.956 107.126 1.00 38.10 ? 158  GLN B O   1 
ATOM   3265 C CB  . GLN B 1 157 ? 38.089 29.356 108.449 1.00 38.60 ? 158  GLN B CB  1 
ATOM   3266 C CG  . GLN B 1 157 ? 37.551 30.314 109.510 1.00 39.60 ? 158  GLN B CG  1 
ATOM   3267 C CD  . GLN B 1 157 ? 36.354 29.762 110.250 1.00 41.38 ? 158  GLN B CD  1 
ATOM   3268 O OE1 . GLN B 1 157 ? 36.411 28.670 110.826 1.00 40.79 ? 158  GLN B OE1 1 
ATOM   3269 N NE2 . GLN B 1 157 ? 35.258 30.513 110.246 1.00 40.29 ? 158  GLN B NE2 1 
ATOM   3270 N N   . ALA B 1 158 ? 37.303 30.699 105.581 1.00 35.96 ? 159  ALA B N   1 
ATOM   3271 C CA  . ALA B 1 158 ? 36.936 31.900 104.837 1.00 36.00 ? 159  ALA B CA  1 
ATOM   3272 C C   . ALA B 1 158 ? 35.629 31.632 104.063 1.00 35.45 ? 159  ALA B C   1 
ATOM   3273 O O   . ALA B 1 158 ? 34.755 32.503 103.972 1.00 35.40 ? 159  ALA B O   1 
ATOM   3274 C CB  . ALA B 1 158 ? 38.055 32.284 103.863 1.00 34.79 ? 159  ALA B CB  1 
ATOM   3275 N N   . ALA B 1 159 ? 35.512 30.427 103.508 1.00 33.19 ? 160  ALA B N   1 
ATOM   3276 C CA  . ALA B 1 159 ? 34.320 30.040 102.764 1.00 32.15 ? 160  ALA B CA  1 
ATOM   3277 C C   . ALA B 1 159 ? 33.138 30.057 103.730 1.00 32.76 ? 160  ALA B C   1 
ATOM   3278 O O   . ALA B 1 159 ? 32.059 30.556 103.410 1.00 32.63 ? 160  ALA B O   1 
ATOM   3279 C CB  . ALA B 1 159 ? 34.507 28.651 102.159 1.00 32.03 ? 160  ALA B CB  1 
ATOM   3280 N N   . ALA B 1 160 ? 33.362 29.536 104.931 1.00 32.45 ? 161  ALA B N   1 
ATOM   3281 C CA  . ALA B 1 160 ? 32.329 29.502 105.948 1.00 34.09 ? 161  ALA B CA  1 
ATOM   3282 C C   . ALA B 1 160 ? 31.933 30.911 106.377 1.00 36.07 ? 161  ALA B C   1 
ATOM   3283 O O   . ALA B 1 160 ? 30.746 31.213 106.489 1.00 36.68 ? 161  ALA B O   1 
ATOM   3284 C CB  . ALA B 1 160 ? 32.809 28.687 107.166 1.00 35.99 ? 161  ALA B CB  1 
ATOM   3285 N N   . ASP B 1 161 ? 32.917 31.784 106.609 1.00 36.54 ? 162  ASP B N   1 
ATOM   3286 C CA  . ASP B 1 161 ? 32.615 33.160 107.035 1.00 36.13 ? 162  ASP B CA  1 
ATOM   3287 C C   . ASP B 1 161 ? 31.778 33.878 105.973 1.00 35.22 ? 162  ASP B C   1 
ATOM   3288 O O   . ASP B 1 161 ? 30.822 34.598 106.293 1.00 35.87 ? 162  ASP B O   1 
ATOM   3289 C CB  . ASP B 1 161 ? 33.906 33.968 107.295 1.00 35.65 ? 162  ASP B CB  1 
ATOM   3290 C CG  . ASP B 1 161 ? 34.695 33.479 108.528 1.00 38.79 ? 162  ASP B CG  1 
ATOM   3291 O OD1 . ASP B 1 161 ? 34.098 32.872 109.456 1.00 38.19 ? 162  ASP B OD1 1 
ATOM   3292 O OD2 . ASP B 1 161 ? 35.924 33.733 108.572 1.00 38.34 ? 162  ASP B OD2 1 
ATOM   3293 N N   . SER B 1 162 ? 32.159 33.693 104.715 1.00 35.26 ? 163  SER B N   1 
ATOM   3294 C CA  . SER B 1 162 ? 31.438 34.300 103.594 1.00 36.21 ? 163  SER B CA  1 
ATOM   3295 C C   . SER B 1 162 ? 29.965 33.876 103.660 1.00 35.40 ? 163  SER B C   1 
ATOM   3296 O O   . SER B 1 162 ? 29.062 34.715 103.692 1.00 35.35 ? 163  SER B O   1 
ATOM   3297 C CB  . SER B 1 162 ? 32.059 33.841 102.272 1.00 36.45 ? 163  SER B CB  1 
ATOM   3298 O OG  . SER B 1 162 ? 31.415 34.428 101.151 1.00 39.23 ? 163  SER B OG  1 
ATOM   3299 N N   . VAL B 1 163 ? 29.729 32.569 103.684 1.00 34.12 ? 164  VAL B N   1 
ATOM   3300 C CA  . VAL B 1 163 ? 28.371 32.044 103.765 1.00 33.62 ? 164  VAL B CA  1 
ATOM   3301 C C   . VAL B 1 163 ? 27.623 32.587 104.993 1.00 34.78 ? 164  VAL B C   1 
ATOM   3302 O O   . VAL B 1 163 ? 26.458 33.023 104.905 1.00 32.91 ? 164  VAL B O   1 
ATOM   3303 C CB  . VAL B 1 163 ? 28.390 30.501 103.842 1.00 32.88 ? 164  VAL B CB  1 
ATOM   3304 C CG1 . VAL B 1 163 ? 27.015 29.978 104.181 1.00 33.00 ? 164  VAL B CG1 1 
ATOM   3305 C CG2 . VAL B 1 163 ? 28.859 29.930 102.526 1.00 32.55 ? 164  VAL B CG2 1 
ATOM   3306 N N   . ASN B 1 164 ? 28.293 32.575 106.141 1.00 33.78 ? 165  ASN B N   1 
ATOM   3307 C CA  . ASN B 1 164 ? 27.662 33.043 107.369 1.00 33.71 ? 165  ASN B CA  1 
ATOM   3308 C C   . ASN B 1 164 ? 27.189 34.482 107.301 1.00 34.11 ? 165  ASN B C   1 
ATOM   3309 O O   . ASN B 1 164 ? 26.106 34.811 107.785 1.00 33.96 ? 165  ASN B O   1 
ATOM   3310 C CB  . ASN B 1 164 ? 28.614 32.856 108.553 1.00 35.40 ? 165  ASN B CB  1 
ATOM   3311 C CG  . ASN B 1 164 ? 28.776 31.395 108.943 1.00 37.82 ? 165  ASN B CG  1 
ATOM   3312 O OD1 . ASN B 1 164 ? 28.046 30.522 108.461 1.00 35.63 ? 165  ASN B OD1 1 
ATOM   3313 N ND2 . ASN B 1 164 ? 29.746 31.119 109.812 1.00 34.18 ? 165  ASN B ND2 1 
ATOM   3314 N N   . LYS B 1 165 ? 27.983 35.345 106.690 1.00 33.77 ? 166  LYS B N   1 
ATOM   3315 C CA  . LYS B 1 165 ? 27.592 36.740 106.614 1.00 35.89 ? 166  LYS B CA  1 
ATOM   3316 C C   . LYS B 1 165 ? 26.494 36.978 105.571 1.00 34.50 ? 166  LYS B C   1 
ATOM   3317 O O   . LYS B 1 165 ? 25.532 37.688 105.839 1.00 35.25 ? 166  LYS B O   1 
ATOM   3318 C CB  . LYS B 1 165 ? 28.817 37.603 106.309 1.00 39.26 ? 166  LYS B CB  1 
ATOM   3319 C CG  . LYS B 1 165 ? 28.561 39.103 106.386 1.00 45.14 ? 166  LYS B CG  1 
ATOM   3320 C CD  . LYS B 1 165 ? 29.840 39.891 106.156 1.00 46.09 ? 166  LYS B CD  1 
ATOM   3321 C CE  . LYS B 1 165 ? 30.472 39.507 104.827 1.00 48.82 ? 166  LYS B CE  1 
ATOM   3322 N NZ  . LYS B 1 165 ? 31.615 40.379 104.438 1.00 51.21 ? 166  LYS B NZ  1 
ATOM   3323 N N   . ARG B 1 166 ? 26.632 36.369 104.396 1.00 32.62 ? 167  ARG B N   1 
ATOM   3324 C CA  . ARG B 1 166 ? 25.648 36.529 103.324 1.00 32.84 ? 167  ARG B CA  1 
ATOM   3325 C C   . ARG B 1 166 ? 24.275 35.968 103.669 1.00 33.43 ? 167  ARG B C   1 
ATOM   3326 O O   . ARG B 1 166 ? 23.261 36.590 103.362 1.00 32.31 ? 167  ARG B O   1 
ATOM   3327 C CB  . ARG B 1 166 ? 26.143 35.852 102.035 1.00 31.88 ? 167  ARG B CB  1 
ATOM   3328 C CG  . ARG B 1 166 ? 25.054 35.633 100.953 1.00 31.06 ? 167  ARG B CG  1 
ATOM   3329 C CD  . ARG B 1 166 ? 24.443 36.937 100.403 1.00 30.37 ? 167  ARG B CD  1 
ATOM   3330 N NE  . ARG B 1 166 ? 23.476 36.667 99.327  1.00 30.20 ? 167  ARG B NE  1 
ATOM   3331 C CZ  . ARG B 1 166 ? 22.222 36.252 99.511  1.00 30.07 ? 167  ARG B CZ  1 
ATOM   3332 N NH1 . ARG B 1 166 ? 21.748 36.066 100.739 1.00 29.24 ? 167  ARG B NH1 1 
ATOM   3333 N NH2 . ARG B 1 166 ? 21.448 35.975 98.464  1.00 25.87 ? 167  ARG B NH2 1 
ATOM   3334 N N   . PHE B 1 167 ? 24.242 34.803 104.316 1.00 34.39 ? 168  PHE B N   1 
ATOM   3335 C CA  . PHE B 1 167 ? 22.979 34.152 104.652 1.00 33.12 ? 168  PHE B CA  1 
ATOM   3336 C C   . PHE B 1 167 ? 22.550 34.140 106.119 1.00 35.29 ? 168  PHE B C   1 
ATOM   3337 O O   . PHE B 1 167 ? 21.551 33.497 106.477 1.00 35.56 ? 168  PHE B O   1 
ATOM   3338 C CB  . PHE B 1 167 ? 22.995 32.720 104.114 1.00 32.77 ? 168  PHE B CB  1 
ATOM   3339 C CG  . PHE B 1 167 ? 23.145 32.640 102.624 1.00 30.15 ? 168  PHE B CG  1 
ATOM   3340 C CD1 . PHE B 1 167 ? 24.389 32.441 102.048 1.00 29.65 ? 168  PHE B CD1 1 
ATOM   3341 C CD2 . PHE B 1 167 ? 22.031 32.768 101.796 1.00 28.83 ? 168  PHE B CD2 1 
ATOM   3342 C CE1 . PHE B 1 167 ? 24.533 32.363 100.663 1.00 28.23 ? 168  PHE B CE1 1 
ATOM   3343 C CE2 . PHE B 1 167 ? 22.160 32.696 100.411 1.00 26.90 ? 168  PHE B CE2 1 
ATOM   3344 C CZ  . PHE B 1 167 ? 23.418 32.490 99.844  1.00 28.65 ? 168  PHE B CZ  1 
ATOM   3345 N N   . LYS B 1 168 ? 23.301 34.836 106.967 1.00 36.64 ? 169  LYS B N   1 
ATOM   3346 C CA  . LYS B 1 168 ? 22.977 34.927 108.387 1.00 36.33 ? 169  LYS B CA  1 
ATOM   3347 C C   . LYS B 1 168 ? 22.754 33.575 109.065 1.00 36.26 ? 169  LYS B C   1 
ATOM   3348 O O   . LYS B 1 168 ? 21.702 33.326 109.668 1.00 35.29 ? 169  LYS B O   1 
ATOM   3349 C CB  . LYS B 1 168 ? 21.747 35.820 108.564 1.00 38.58 ? 169  LYS B CB  1 
ATOM   3350 C CG  . LYS B 1 168 ? 21.984 37.259 108.123 1.00 41.99 ? 169  LYS B CG  1 
ATOM   3351 C CD  . LYS B 1 168 ? 20.780 38.156 108.424 1.00 46.56 ? 169  LYS B CD  1 
ATOM   3352 C CE  . LYS B 1 168 ? 21.217 39.610 108.666 1.00 49.85 ? 169  LYS B CE  1 
ATOM   3353 N NZ  . LYS B 1 168 ? 21.761 40.292 107.448 1.00 50.05 ? 169  LYS B NZ  1 
ATOM   3354 N N   . VAL B 1 169 ? 23.756 32.709 108.959 1.00 36.05 ? 170  VAL B N   1 
ATOM   3355 C CA  . VAL B 1 169 ? 23.713 31.379 109.552 1.00 37.13 ? 170  VAL B CA  1 
ATOM   3356 C C   . VAL B 1 169 ? 25.051 31.112 110.236 1.00 37.48 ? 170  VAL B C   1 
ATOM   3357 O O   . VAL B 1 169 ? 25.909 31.993 110.272 1.00 37.93 ? 170  VAL B O   1 
ATOM   3358 C CB  . VAL B 1 169 ? 23.449 30.296 108.480 1.00 36.48 ? 170  VAL B CB  1 
ATOM   3359 C CG1 . VAL B 1 169 ? 22.072 30.505 107.866 1.00 35.99 ? 170  VAL B CG1 1 
ATOM   3360 C CG2 . VAL B 1 169 ? 24.523 30.347 107.411 1.00 35.37 ? 170  VAL B CG2 1 
ATOM   3361 N N   . ASN B 1 170 ? 25.241 29.906 110.767 1.00 38.87 ? 171  ASN B N   1 
ATOM   3362 C CA  . ASN B 1 170 ? 26.485 29.600 111.462 1.00 39.19 ? 171  ASN B CA  1 
ATOM   3363 C C   . ASN B 1 170 ? 27.137 28.279 111.079 1.00 38.51 ? 171  ASN B C   1 
ATOM   3364 O O   . ASN B 1 170 ? 27.156 27.325 111.861 1.00 39.41 ? 171  ASN B O   1 
ATOM   3365 C CB  . ASN B 1 170 ? 26.258 29.640 112.980 1.00 43.26 ? 171  ASN B CB  1 
ATOM   3366 C CG  . ASN B 1 170 ? 27.463 30.178 113.731 1.00 47.40 ? 171  ASN B CG  1 
ATOM   3367 O OD1 . ASN B 1 170 ? 28.559 29.612 113.666 1.00 48.54 ? 171  ASN B OD1 1 
ATOM   3368 N ND2 . ASN B 1 170 ? 27.270 31.285 114.442 1.00 50.96 ? 171  ASN B ND2 1 
ATOM   3369 N N   . VAL B 1 171 ? 27.677 28.239 109.869 1.00 36.76 ? 172  VAL B N   1 
ATOM   3370 C CA  . VAL B 1 171 ? 28.372 27.070 109.350 1.00 36.05 ? 172  VAL B CA  1 
ATOM   3371 C C   . VAL B 1 171 ? 29.766 27.030 109.995 1.00 37.82 ? 172  VAL B C   1 
ATOM   3372 O O   . VAL B 1 171 ? 30.376 28.079 110.175 1.00 37.50 ? 172  VAL B O   1 
ATOM   3373 C CB  . VAL B 1 171 ? 28.530 27.202 107.816 1.00 35.44 ? 172  VAL B CB  1 
ATOM   3374 C CG1 . VAL B 1 171 ? 29.383 26.080 107.264 1.00 34.81 ? 172  VAL B CG1 1 
ATOM   3375 C CG2 . VAL B 1 171 ? 27.159 27.209 107.158 1.00 33.92 ? 172  VAL B CG2 1 
ATOM   3376 N N   . THR B 1 172 ? 30.262 25.847 110.368 1.00 39.21 ? 173  THR B N   1 
ATOM   3377 C CA  . THR B 1 172 ? 31.616 25.758 110.936 1.00 40.22 ? 173  THR B CA  1 
ATOM   3378 C C   . THR B 1 172 ? 32.542 25.126 109.898 1.00 40.37 ? 173  THR B C   1 
ATOM   3379 O O   . THR B 1 172 ? 32.069 24.511 108.941 1.00 39.78 ? 173  THR B O   1 
ATOM   3380 C CB  . THR B 1 172 ? 31.663 24.933 112.251 1.00 40.09 ? 173  THR B CB  1 
ATOM   3381 O OG1 . THR B 1 172 ? 31.226 23.587 112.014 1.00 40.84 ? 173  THR B OG1 1 
ATOM   3382 C CG2 . THR B 1 172 ? 30.790 25.582 113.298 1.00 40.75 ? 173  THR B CG2 1 
ATOM   3383 N N   . ALA B 1 173 ? 33.855 25.285 110.076 1.00 39.79 ? 174  ALA B N   1 
ATOM   3384 C CA  . ALA B 1 173 ? 34.816 24.749 109.119 1.00 39.72 ? 174  ALA B CA  1 
ATOM   3385 C C   . ALA B 1 173 ? 35.730 23.668 109.680 1.00 40.72 ? 174  ALA B C   1 
ATOM   3386 O O   . ALA B 1 173 ? 35.872 23.531 110.887 1.00 42.38 ? 174  ALA B O   1 
ATOM   3387 C CB  . ALA B 1 173 ? 35.656 25.884 108.546 1.00 39.36 ? 174  ALA B CB  1 
ATOM   3388 N N   . ALA B 1 174 ? 36.349 22.905 108.789 1.00 40.73 ? 175  ALA B N   1 
ATOM   3389 C CA  . ALA B 1 174 ? 37.257 21.843 109.182 1.00 41.50 ? 175  ALA B CA  1 
ATOM   3390 C C   . ALA B 1 174 ? 38.220 21.534 108.044 1.00 42.11 ? 175  ALA B C   1 
ATOM   3391 O O   . ALA B 1 174 ? 37.879 21.650 106.869 1.00 40.05 ? 175  ALA B O   1 
ATOM   3392 C CB  . ALA B 1 174 ? 36.473 20.589 109.566 1.00 40.47 ? 175  ALA B CB  1 
ATOM   3393 N N   . GLU B 1 175 ? 39.426 21.120 108.414 1.00 43.17 ? 176  GLU B N   1 
ATOM   3394 C CA  . GLU B 1 175 ? 40.484 20.796 107.464 1.00 44.00 ? 176  GLU B CA  1 
ATOM   3395 C C   . GLU B 1 175 ? 40.571 19.289 107.218 1.00 43.80 ? 176  GLU B C   1 
ATOM   3396 O O   . GLU B 1 175 ? 40.673 18.503 108.167 1.00 43.92 ? 176  GLU B O   1 
ATOM   3397 C CB  . GLU B 1 175 ? 41.816 21.324 108.027 1.00 47.63 ? 176  GLU B CB  1 
ATOM   3398 C CG  . GLU B 1 175 ? 43.037 21.222 107.125 1.00 50.40 ? 176  GLU B CG  1 
ATOM   3399 C CD  . GLU B 1 175 ? 44.240 21.977 107.705 1.00 53.44 ? 176  GLU B CD  1 
ATOM   3400 O OE1 . GLU B 1 175 ? 44.729 21.598 108.792 1.00 54.81 ? 176  GLU B OE1 1 
ATOM   3401 O OE2 . GLU B 1 175 ? 44.695 22.958 107.076 1.00 54.07 ? 176  GLU B OE2 1 
ATOM   3402 N N   . THR B 1 176 ? 40.524 18.894 105.949 1.00 41.40 ? 177  THR B N   1 
ATOM   3403 C CA  . THR B 1 176 ? 40.620 17.490 105.569 1.00 41.79 ? 177  THR B CA  1 
ATOM   3404 C C   . THR B 1 176 ? 41.509 17.428 104.324 1.00 42.32 ? 177  THR B C   1 
ATOM   3405 O O   . THR B 1 176 ? 41.022 17.429 103.195 1.00 41.52 ? 177  THR B O   1 
ATOM   3406 C CB  . THR B 1 176 ? 39.212 16.863 105.259 1.00 40.97 ? 177  THR B CB  1 
ATOM   3407 O OG1 . THR B 1 176 ? 38.611 17.515 104.130 1.00 39.31 ? 177  THR B OG1 1 
ATOM   3408 C CG2 . THR B 1 176 ? 38.289 17.009 106.456 1.00 41.06 ? 177  THR B CG2 1 
ATOM   3409 N N   . ALA B 1 177 ? 42.822 17.367 104.542 1.00 44.30 ? 178  ALA B N   1 
ATOM   3410 C CA  . ALA B 1 177 ? 43.775 17.348 103.439 1.00 44.74 ? 178  ALA B CA  1 
ATOM   3411 C C   . ALA B 1 177 ? 44.025 16.000 102.783 1.00 47.49 ? 178  ALA B C   1 
ATOM   3412 O O   . ALA B 1 177 ? 44.656 15.949 101.727 1.00 49.62 ? 178  ALA B O   1 
ATOM   3413 C CB  . ALA B 1 177 ? 45.080 17.955 103.880 1.00 46.42 ? 178  ALA B CB  1 
ATOM   3414 N N   . ASP B 1 178 ? 43.559 14.909 103.388 1.00 47.91 ? 179  ASP B N   1 
ATOM   3415 C CA  . ASP B 1 178 ? 43.739 13.591 102.769 1.00 49.80 ? 179  ASP B CA  1 
ATOM   3416 C C   . ASP B 1 178 ? 42.548 12.661 102.979 1.00 49.53 ? 179  ASP B C   1 
ATOM   3417 O O   . ASP B 1 178 ? 41.644 12.966 103.759 1.00 51.16 ? 179  ASP B O   1 
ATOM   3418 C CB  . ASP B 1 178 ? 45.040 12.912 103.252 1.00 49.82 ? 179  ASP B CB  1 
ATOM   3419 C CG  . ASP B 1 178 ? 45.061 12.632 104.757 1.00 50.95 ? 179  ASP B CG  1 
ATOM   3420 O OD1 . ASP B 1 178 ? 46.106 12.138 105.236 1.00 49.40 ? 179  ASP B OD1 1 
ATOM   3421 O OD2 . ASP B 1 178 ? 44.057 12.892 105.463 1.00 50.02 ? 179  ASP B OD2 1 
ATOM   3422 N N   . ASP B 1 179 ? 42.546 11.536 102.267 1.00 48.76 ? 180  ASP B N   1 
ATOM   3423 C CA  . ASP B 1 179 ? 41.474 10.548 102.358 1.00 47.80 ? 180  ASP B CA  1 
ATOM   3424 C C   . ASP B 1 179 ? 41.089 10.253 103.788 1.00 45.54 ? 180  ASP B C   1 
ATOM   3425 O O   . ASP B 1 179 ? 39.934 10.407 104.177 1.00 44.89 ? 180  ASP B O   1 
ATOM   3426 C CB  . ASP B 1 179 ? 41.903 9.234  101.717 1.00 50.63 ? 180  ASP B CB  1 
ATOM   3427 C CG  . ASP B 1 179 ? 42.354 9.413  100.304 1.00 53.26 ? 180  ASP B CG  1 
ATOM   3428 O OD1 . ASP B 1 179 ? 42.661 8.394  99.642  1.00 54.72 ? 180  ASP B OD1 1 
ATOM   3429 O OD2 . ASP B 1 179 ? 42.403 10.580 99.862  1.00 53.03 ? 180  ASP B OD2 1 
ATOM   3430 N N   . ALA B 1 180 ? 42.070 9.800  104.557 1.00 41.40 ? 181  ALA B N   1 
ATOM   3431 C CA  . ALA B 1 180 ? 41.857 9.464  105.954 1.00 40.60 ? 181  ALA B CA  1 
ATOM   3432 C C   . ALA B 1 180 ? 41.102 10.550 106.729 1.00 39.39 ? 181  ALA B C   1 
ATOM   3433 O O   . ALA B 1 180 ? 40.143 10.252 107.444 1.00 40.05 ? 181  ALA B O   1 
ATOM   3434 C CB  . ALA B 1 180 ? 43.212 9.170  106.637 1.00 39.67 ? 181  ALA B CB  1 
ATOM   3435 N N   A SER B 1 181 ? 41.533 11.799 106.592 0.60 38.03 ? 182  SER B N   1 
ATOM   3436 N N   B SER B 1 181 ? 41.536 11.798 106.591 0.40 38.21 ? 182  SER B N   1 
ATOM   3437 C CA  A SER B 1 181 ? 40.890 12.901 107.302 0.60 37.78 ? 182  SER B CA  1 
ATOM   3438 C CA  B SER B 1 181 ? 40.893 12.905 107.292 0.40 37.58 ? 182  SER B CA  1 
ATOM   3439 C C   A SER B 1 181 ? 39.450 13.078 106.820 0.60 37.64 ? 182  SER B C   1 
ATOM   3440 C C   B SER B 1 181 ? 39.452 13.073 106.819 0.40 37.69 ? 182  SER B C   1 
ATOM   3441 O O   A SER B 1 181 ? 38.557 13.398 107.604 0.60 36.36 ? 182  SER B O   1 
ATOM   3442 O O   B SER B 1 181 ? 38.559 13.384 107.608 0.40 36.93 ? 182  SER B O   1 
ATOM   3443 C CB  A SER B 1 181 ? 41.675 14.200 107.095 0.60 37.99 ? 182  SER B CB  1 
ATOM   3444 C CB  B SER B 1 181 ? 41.667 14.203 107.055 0.40 37.23 ? 182  SER B CB  1 
ATOM   3445 O OG  A SER B 1 181 ? 41.194 15.230 107.942 0.60 37.66 ? 182  SER B OG  1 
ATOM   3446 O OG  B SER B 1 181 ? 41.682 14.542 105.679 0.40 34.76 ? 182  SER B OG  1 
ATOM   3447 N N   . ARG B 1 182 ? 39.236 12.866 105.524 1.00 38.17 ? 183  ARG B N   1 
ATOM   3448 C CA  . ARG B 1 182 ? 37.904 12.989 104.933 1.00 38.20 ? 183  ARG B CA  1 
ATOM   3449 C C   . ARG B 1 182 ? 36.987 11.921 105.537 1.00 37.77 ? 183  ARG B C   1 
ATOM   3450 O O   . ARG B 1 182 ? 35.901 12.219 106.017 1.00 36.23 ? 183  ARG B O   1 
ATOM   3451 C CB  . ARG B 1 182 ? 37.988 12.790 103.417 1.00 38.61 ? 183  ARG B CB  1 
ATOM   3452 C CG  . ARG B 1 182 ? 37.286 13.852 102.596 1.00 40.62 ? 183  ARG B CG  1 
ATOM   3453 C CD  . ARG B 1 182 ? 38.242 14.527 101.614 1.00 41.09 ? 183  ARG B CD  1 
ATOM   3454 N NE  . ARG B 1 182 ? 38.751 13.616 100.590 1.00 39.75 ? 183  ARG B NE  1 
ATOM   3455 C CZ  . ARG B 1 182 ? 39.899 13.799 99.935  1.00 41.51 ? 183  ARG B CZ  1 
ATOM   3456 N NH1 . ARG B 1 182 ? 40.668 14.857 100.196 1.00 39.19 ? 183  ARG B NH1 1 
ATOM   3457 N NH2 . ARG B 1 182 ? 40.279 12.927 99.012  1.00 42.20 ? 183  ARG B NH2 1 
ATOM   3458 N N   . ALA B 1 183 ? 37.447 10.673 105.500 1.00 38.28 ? 184  ALA B N   1 
ATOM   3459 C CA  . ALA B 1 183 ? 36.692 9.541  106.024 1.00 37.71 ? 184  ALA B CA  1 
ATOM   3460 C C   . ALA B 1 183 ? 36.363 9.774  107.496 1.00 37.49 ? 184  ALA B C   1 
ATOM   3461 O O   . ALA B 1 183 ? 35.294 9.390  107.982 1.00 36.48 ? 184  ALA B O   1 
ATOM   3462 C CB  . ALA B 1 183 ? 37.513 8.254  105.856 1.00 37.52 ? 184  ALA B CB  1 
ATOM   3463 N N   A GLU B 1 184 ? 37.296 10.414 108.193 0.60 38.08 ? 185  GLU B N   1 
ATOM   3464 N N   B GLU B 1 184 ? 37.287 10.402 108.213 0.40 37.52 ? 185  GLU B N   1 
ATOM   3465 C CA  A GLU B 1 184 ? 37.152 10.719 109.611 0.60 38.09 ? 185  GLU B CA  1 
ATOM   3466 C CA  B GLU B 1 184 ? 37.078 10.675 109.628 0.40 37.21 ? 185  GLU B CA  1 
ATOM   3467 C C   A GLU B 1 184 ? 36.053 11.764 109.845 0.60 37.83 ? 185  GLU B C   1 
ATOM   3468 C C   B GLU B 1 184 ? 36.030 11.769 109.852 0.40 37.25 ? 185  GLU B C   1 
ATOM   3469 O O   A GLU B 1 184 ? 35.215 11.622 110.741 0.60 36.84 ? 185  GLU B O   1 
ATOM   3470 O O   B GLU B 1 184 ? 35.203 11.670 110.762 0.40 36.59 ? 185  GLU B O   1 
ATOM   3471 C CB  A GLU B 1 184 ? 38.488 11.244 110.147 0.60 39.32 ? 185  GLU B CB  1 
ATOM   3472 C CB  B GLU B 1 184 ? 38.408 11.051 110.285 0.40 37.57 ? 185  GLU B CB  1 
ATOM   3473 C CG  A GLU B 1 184 ? 38.645 11.181 111.662 0.60 42.25 ? 185  GLU B CG  1 
ATOM   3474 C CG  B GLU B 1 184 ? 39.394 9.885  110.360 0.40 37.55 ? 185  GLU B CG  1 
ATOM   3475 C CD  A GLU B 1 184 ? 38.639 9.755  112.191 0.60 42.90 ? 185  GLU B CD  1 
ATOM   3476 C CD  B GLU B 1 184 ? 38.805 8.665  111.058 0.40 37.50 ? 185  GLU B CD  1 
ATOM   3477 O OE1 A GLU B 1 184 ? 39.325 8.890  111.599 0.60 44.92 ? 185  GLU B OE1 1 
ATOM   3478 O OE1 B GLU B 1 184 ? 38.412 8.781  112.239 0.40 36.85 ? 185  GLU B OE1 1 
ATOM   3479 O OE2 A GLU B 1 184 ? 37.958 9.502  113.203 0.60 43.59 ? 185  GLU B OE2 1 
ATOM   3480 O OE2 B GLU B 1 184 ? 38.730 7.591  110.425 0.40 36.11 ? 185  GLU B OE2 1 
ATOM   3481 N N   . ALA B 1 185 ? 36.055 12.803 109.017 1.00 36.90 ? 186  ALA B N   1 
ATOM   3482 C CA  . ALA B 1 185 ? 35.092 13.896 109.130 1.00 36.42 ? 186  ALA B CA  1 
ATOM   3483 C C   . ALA B 1 185 ? 33.618 13.497 108.973 1.00 34.93 ? 186  ALA B C   1 
ATOM   3484 O O   . ALA B 1 185 ? 32.730 14.174 109.511 1.00 34.02 ? 186  ALA B O   1 
ATOM   3485 C CB  . ALA B 1 185 ? 35.441 14.994 108.121 1.00 36.33 ? 186  ALA B CB  1 
ATOM   3486 N N   . VAL B 1 186 ? 33.345 12.407 108.258 1.00 34.33 ? 187  VAL B N   1 
ATOM   3487 C CA  . VAL B 1 186 ? 31.956 11.988 108.064 1.00 33.77 ? 187  VAL B CA  1 
ATOM   3488 C C   . VAL B 1 186 ? 31.369 11.104 109.156 1.00 34.16 ? 187  VAL B C   1 
ATOM   3489 O O   . VAL B 1 186 ? 30.192 10.767 109.102 1.00 32.69 ? 187  VAL B O   1 
ATOM   3490 C CB  . VAL B 1 186 ? 31.741 11.262 106.710 1.00 32.63 ? 187  VAL B CB  1 
ATOM   3491 C CG1 . VAL B 1 186 ? 32.173 12.173 105.557 1.00 34.73 ? 187  VAL B CG1 1 
ATOM   3492 C CG2 . VAL B 1 186 ? 32.503 9.949  106.681 1.00 34.36 ? 187  VAL B CG2 1 
ATOM   3493 N N   . LYS B 1 187 ? 32.164 10.730 110.153 1.00 35.07 ? 188  LYS B N   1 
ATOM   3494 C CA  . LYS B 1 187 ? 31.633 9.879  111.218 1.00 35.40 ? 188  LYS B CA  1 
ATOM   3495 C C   . LYS B 1 187 ? 30.660 10.660 112.093 1.00 34.78 ? 188  LYS B C   1 
ATOM   3496 O O   . LYS B 1 187 ? 30.930 11.799 112.503 1.00 35.82 ? 188  LYS B O   1 
ATOM   3497 C CB  . LYS B 1 187 ? 32.779 9.290  112.059 1.00 37.56 ? 188  LYS B CB  1 
ATOM   3498 C CG  . LYS B 1 187 ? 33.661 8.345  111.263 1.00 38.67 ? 188  LYS B CG  1 
ATOM   3499 C CD  . LYS B 1 187 ? 34.802 7.771  112.096 1.00 43.02 ? 188  LYS B CD  1 
ATOM   3500 C CE  . LYS B 1 187 ? 35.717 6.920  111.228 1.00 44.46 ? 188  LYS B CE  1 
ATOM   3501 N NZ  . LYS B 1 187 ? 36.786 6.231  112.006 1.00 46.60 ? 188  LYS B NZ  1 
ATOM   3502 N N   . GLY B 1 188 ? 29.505 10.064 112.350 1.00 33.93 ? 189  GLY B N   1 
ATOM   3503 C CA  . GLY B 1 188 ? 28.522 10.745 113.166 1.00 35.86 ? 189  GLY B CA  1 
ATOM   3504 C C   . GLY B 1 188 ? 27.607 11.652 112.356 1.00 36.55 ? 189  GLY B C   1 
ATOM   3505 O O   . GLY B 1 188 ? 26.650 12.207 112.902 1.00 38.58 ? 189  GLY B O   1 
ATOM   3506 N N   . ALA B 1 189 ? 27.881 11.807 111.060 1.00 34.75 ? 190  ALA B N   1 
ATOM   3507 C CA  . ALA B 1 189 ? 27.045 12.667 110.205 1.00 33.02 ? 190  ALA B CA  1 
ATOM   3508 C C   . ALA B 1 189 ? 25.813 11.934 109.663 1.00 31.50 ? 190  ALA B C   1 
ATOM   3509 O O   . ALA B 1 189 ? 25.849 10.722 109.438 1.00 30.47 ? 190  ALA B O   1 
ATOM   3510 C CB  . ALA B 1 189 ? 27.879 13.209 109.041 1.00 34.57 ? 190  ALA B CB  1 
ATOM   3511 N N   . HIS B 1 190 ? 24.728 12.672 109.442 1.00 29.58 ? 191  HIS B N   1 
ATOM   3512 C CA  . HIS B 1 190 ? 23.498 12.087 108.924 1.00 30.55 ? 191  HIS B CA  1 
ATOM   3513 C C   . HIS B 1 190 ? 23.427 12.246 107.401 1.00 30.23 ? 191  HIS B C   1 
ATOM   3514 O O   . HIS B 1 190 ? 22.920 11.372 106.680 1.00 27.95 ? 191  HIS B O   1 
ATOM   3515 C CB  . HIS B 1 190 ? 22.288 12.785 109.565 1.00 34.73 ? 191  HIS B CB  1 
ATOM   3516 C CG  . HIS B 1 190 ? 22.315 12.785 111.063 1.00 39.41 ? 191  HIS B CG  1 
ATOM   3517 N ND1 . HIS B 1 190 ? 21.964 11.684 111.816 1.00 42.18 ? 191  HIS B ND1 1 
ATOM   3518 C CD2 . HIS B 1 190 ? 22.716 13.732 111.945 1.00 39.51 ? 191  HIS B CD2 1 
ATOM   3519 C CE1 . HIS B 1 190 ? 22.154 11.952 113.097 1.00 41.45 ? 191  HIS B CE1 1 
ATOM   3520 N NE2 . HIS B 1 190 ? 22.610 13.187 113.202 1.00 43.47 ? 191  HIS B NE2 1 
ATOM   3521 N N   . PHE B 1 191 ? 23.953 13.370 106.919 1.00 29.22 ? 192  PHE B N   1 
ATOM   3522 C CA  . PHE B 1 191 ? 23.931 13.685 105.492 1.00 27.75 ? 192  PHE B CA  1 
ATOM   3523 C C   . PHE B 1 191 ? 25.327 14.142 105.032 1.00 27.51 ? 192  PHE B C   1 
ATOM   3524 O O   . PHE B 1 191 ? 25.976 14.955 105.695 1.00 27.10 ? 192  PHE B O   1 
ATOM   3525 C CB  . PHE B 1 191 ? 22.906 14.803 105.231 1.00 27.54 ? 192  PHE B CB  1 
ATOM   3526 C CG  . PHE B 1 191 ? 21.588 14.612 105.949 1.00 28.83 ? 192  PHE B CG  1 
ATOM   3527 C CD1 . PHE B 1 191 ? 21.177 15.522 106.921 1.00 28.04 ? 192  PHE B CD1 1 
ATOM   3528 C CD2 . PHE B 1 191 ? 20.772 13.514 105.672 1.00 28.47 ? 192  PHE B CD2 1 
ATOM   3529 C CE1 . PHE B 1 191 ? 19.974 15.346 107.614 1.00 28.15 ? 192  PHE B CE1 1 
ATOM   3530 C CE2 . PHE B 1 191 ? 19.563 13.329 106.363 1.00 27.82 ? 192  PHE B CE2 1 
ATOM   3531 C CZ  . PHE B 1 191 ? 19.169 14.241 107.331 1.00 28.37 ? 192  PHE B CZ  1 
ATOM   3532 N N   . VAL B 1 192 ? 25.780 13.599 103.909 1.00 26.21 ? 193  VAL B N   1 
ATOM   3533 C CA  . VAL B 1 192 ? 27.090 13.928 103.359 1.00 25.89 ? 193  VAL B CA  1 
ATOM   3534 C C   . VAL B 1 192 ? 26.972 14.369 101.909 1.00 24.09 ? 193  VAL B C   1 
ATOM   3535 O O   . VAL B 1 192 ? 26.334 13.688 101.108 1.00 26.85 ? 193  VAL B O   1 
ATOM   3536 C CB  . VAL B 1 192 ? 28.048 12.710 103.407 1.00 23.38 ? 193  VAL B CB  1 
ATOM   3537 C CG1 . VAL B 1 192 ? 29.398 13.083 102.788 1.00 25.86 ? 193  VAL B CG1 1 
ATOM   3538 C CG2 . VAL B 1 192 ? 28.238 12.255 104.855 1.00 28.38 ? 193  VAL B CG2 1 
ATOM   3539 N N   . PHE B 1 193 ? 27.569 15.519 101.584 1.00 24.42 ? 194  PHE B N   1 
ATOM   3540 C CA  . PHE B 1 193 ? 27.571 16.047 100.208 1.00 24.80 ? 194  PHE B CA  1 
ATOM   3541 C C   . PHE B 1 193 ? 29.036 16.168 99.731  1.00 24.00 ? 194  PHE B C   1 
ATOM   3542 O O   . PHE B 1 193 ? 29.893 16.592 100.503 1.00 24.33 ? 194  PHE B O   1 
ATOM   3543 C CB  . PHE B 1 193 ? 26.975 17.475 100.139 1.00 24.39 ? 194  PHE B CB  1 
ATOM   3544 C CG  . PHE B 1 193 ? 25.494 17.549 100.352 1.00 27.57 ? 194  PHE B CG  1 
ATOM   3545 C CD1 . PHE B 1 193 ? 24.943 17.393 101.621 1.00 25.17 ? 194  PHE B CD1 1 
ATOM   3546 C CD2 . PHE B 1 193 ? 24.643 17.793 99.279  1.00 25.73 ? 194  PHE B CD2 1 
ATOM   3547 C CE1 . PHE B 1 193 ? 23.553 17.479 101.817 1.00 23.11 ? 194  PHE B CE1 1 
ATOM   3548 C CE2 . PHE B 1 193 ? 23.261 17.878 99.471  1.00 27.25 ? 194  PHE B CE2 1 
ATOM   3549 C CZ  . PHE B 1 193 ? 22.717 17.719 100.743 1.00 25.09 ? 194  PHE B CZ  1 
ATOM   3550 N N   . THR B 1 194 ? 29.314 15.786 98.485  1.00 24.94 ? 195  THR B N   1 
ATOM   3551 C CA  . THR B 1 194 ? 30.649 15.961 97.911  1.00 24.75 ? 195  THR B CA  1 
ATOM   3552 C C   . THR B 1 194 ? 30.480 17.016 96.804  1.00 23.19 ? 195  THR B C   1 
ATOM   3553 O O   . THR B 1 194 ? 29.789 16.790 95.814  1.00 22.22 ? 195  THR B O   1 
ATOM   3554 C CB  . THR B 1 194 ? 31.239 14.638 97.318  1.00 24.41 ? 195  THR B CB  1 
ATOM   3555 O OG1 . THR B 1 194 ? 30.287 13.988 96.470  1.00 25.26 ? 195  THR B OG1 1 
ATOM   3556 C CG2 . THR B 1 194 ? 31.629 13.670 98.454  1.00 24.63 ? 195  THR B CG2 1 
ATOM   3557 N N   . ALA B 1 195 ? 31.092 18.177 97.002  1.00 24.39 ? 196  ALA B N   1 
ATOM   3558 C CA  . ALA B 1 195 ? 30.997 19.277 96.046  1.00 26.09 ? 196  ALA B CA  1 
ATOM   3559 C C   . ALA B 1 195 ? 32.380 19.592 95.453  1.00 26.91 ? 196  ALA B C   1 
ATOM   3560 O O   . ALA B 1 195 ? 32.731 20.761 95.261  1.00 26.58 ? 196  ALA B O   1 
ATOM   3561 C CB  . ALA B 1 195 ? 30.435 20.503 96.758  1.00 26.01 ? 196  ALA B CB  1 
ATOM   3562 N N   . GLY B 1 196 ? 33.150 18.539 95.182  1.00 26.27 ? 197  GLY B N   1 
ATOM   3563 C CA  . GLY B 1 196 ? 34.493 18.699 94.653  1.00 26.77 ? 197  GLY B CA  1 
ATOM   3564 C C   . GLY B 1 196 ? 34.589 19.020 93.176  1.00 26.67 ? 197  GLY B C   1 
ATOM   3565 O O   . GLY B 1 196 ? 33.656 18.779 92.405  1.00 22.70 ? 197  GLY B O   1 
ATOM   3566 N N   . ALA B 1 197 ? 35.736 19.577 92.787  1.00 29.42 ? 198  ALA B N   1 
ATOM   3567 C CA  . ALA B 1 197 ? 35.987 19.921 91.391  1.00 30.09 ? 198  ALA B CA  1 
ATOM   3568 C C   . ALA B 1 197 ? 35.759 18.658 90.577  1.00 30.47 ? 198  ALA B C   1 
ATOM   3569 O O   . ALA B 1 197 ? 35.841 17.538 91.108  1.00 31.28 ? 198  ALA B O   1 
ATOM   3570 C CB  . ALA B 1 197 ? 37.435 20.451 91.216  1.00 27.54 ? 198  ALA B CB  1 
ATOM   3571 N N   . ILE B 1 198 ? 35.459 18.844 89.297  1.00 29.77 ? 199  ILE B N   1 
ATOM   3572 C CA  . ILE B 1 198 ? 35.160 17.764 88.373  1.00 31.49 ? 199  ILE B CA  1 
ATOM   3573 C C   . ILE B 1 198 ? 36.252 16.695 88.224  1.00 34.12 ? 199  ILE B C   1 
ATOM   3574 O O   . ILE B 1 198 ? 37.449 17.007 88.248  1.00 32.12 ? 199  ILE B O   1 
ATOM   3575 C CB  . ILE B 1 198 ? 34.842 18.354 86.990  1.00 34.81 ? 199  ILE B CB  1 
ATOM   3576 C CG1 . ILE B 1 198 ? 34.295 17.275 86.066  1.00 36.24 ? 199  ILE B CG1 1 
ATOM   3577 C CG2 . ILE B 1 198 ? 36.106 18.985 86.404  1.00 36.05 ? 199  ILE B CG2 1 
ATOM   3578 C CD1 . ILE B 1 198 ? 33.819 17.806 84.726  1.00 37.92 ? 199  ILE B CD1 1 
ATOM   3579 N N   . GLY B 1 199 ? 35.816 15.439 88.091  1.00 33.09 ? 200  GLY B N   1 
ATOM   3580 C CA  . GLY B 1 199 ? 36.724 14.315 87.927  1.00 33.69 ? 200  GLY B CA  1 
ATOM   3581 C C   . GLY B 1 199 ? 37.505 13.811 89.140  1.00 35.26 ? 200  GLY B C   1 
ATOM   3582 O O   . GLY B 1 199 ? 38.491 13.085 88.967  1.00 36.69 ? 200  GLY B O   1 
ATOM   3583 N N   . LEU B 1 200 ? 37.082 14.158 90.351  1.00 32.87 ? 201  LEU B N   1 
ATOM   3584 C CA  . LEU B 1 200 ? 37.784 13.720 91.568  1.00 34.03 ? 201  LEU B CA  1 
ATOM   3585 C C   . LEU B 1 200 ? 36.913 12.893 92.513  1.00 33.64 ? 201  LEU B C   1 
ATOM   3586 O O   . LEU B 1 200 ? 35.743 13.213 92.695  1.00 31.74 ? 201  LEU B O   1 
ATOM   3587 C CB  . LEU B 1 200 ? 38.252 14.925 92.365  1.00 31.38 ? 201  LEU B CB  1 
ATOM   3588 C CG  . LEU B 1 200 ? 39.141 15.951 91.686  1.00 35.09 ? 201  LEU B CG  1 
ATOM   3589 C CD1 . LEU B 1 200 ? 39.254 17.161 92.604  1.00 34.82 ? 201  LEU B CD1 1 
ATOM   3590 C CD2 . LEU B 1 200 ? 40.518 15.331 91.403  1.00 35.48 ? 201  LEU B CD2 1 
ATOM   3591 N N   . GLU B 1 201 ? 37.487 11.855 93.125  1.00 34.29 ? 202  GLU B N   1 
ATOM   3592 C CA  . GLU B 1 201 ? 36.753 11.042 94.098  1.00 36.10 ? 202  GLU B CA  1 
ATOM   3593 C C   . GLU B 1 201 ? 37.123 11.600 95.469  1.00 36.98 ? 202  GLU B C   1 
ATOM   3594 O O   . GLU B 1 201 ? 38.304 11.869 95.725  1.00 36.70 ? 202  GLU B O   1 
ATOM   3595 C CB  . GLU B 1 201 ? 37.161 9.562  94.037  1.00 38.88 ? 202  GLU B CB  1 
ATOM   3596 C CG  . GLU B 1 201 ? 36.358 8.693  95.025  1.00 41.10 ? 202  GLU B CG  1 
ATOM   3597 C CD  . GLU B 1 201 ? 36.834 7.250  95.089  1.00 44.57 ? 202  GLU B CD  1 
ATOM   3598 O OE1 . GLU B 1 201 ? 37.957 7.013  95.597  1.00 45.51 ? 202  GLU B OE1 1 
ATOM   3599 O OE2 . GLU B 1 201 ? 36.086 6.356  94.634  1.00 43.74 ? 202  GLU B OE2 1 
ATOM   3600 N N   . LEU B 1 202 ? 36.133 11.771 96.349  1.00 35.02 ? 203  LEU B N   1 
ATOM   3601 C CA  . LEU B 1 202 ? 36.382 12.316 97.684  1.00 34.19 ? 203  LEU B CA  1 
ATOM   3602 C C   . LEU B 1 202 ? 35.889 11.402 98.812  1.00 34.39 ? 203  LEU B C   1 
ATOM   3603 O O   . LEU B 1 202 ? 36.298 11.554 99.962  1.00 31.95 ? 203  LEU B O   1 
ATOM   3604 C CB  . LEU B 1 202 ? 35.696 13.675 97.839  1.00 35.56 ? 203  LEU B CB  1 
ATOM   3605 C CG  . LEU B 1 202 ? 36.029 14.796 96.853  1.00 36.75 ? 203  LEU B CG  1 
ATOM   3606 C CD1 . LEU B 1 202 ? 35.238 16.058 97.205  1.00 34.47 ? 203  LEU B CD1 1 
ATOM   3607 C CD2 . LEU B 1 202 ? 37.515 15.084 96.919  1.00 39.59 ? 203  LEU B CD2 1 
ATOM   3608 N N   . LEU B 1 203 ? 35.002 10.468 98.481  1.00 33.87 ? 204  LEU B N   1 
ATOM   3609 C CA  . LEU B 1 203 ? 34.444 9.559  99.475  1.00 34.37 ? 204  LEU B CA  1 
ATOM   3610 C C   . LEU B 1 203 ? 34.234 8.141  98.920  1.00 33.98 ? 204  LEU B C   1 
ATOM   3611 O O   . LEU B 1 203 ? 33.172 7.811  98.393  1.00 32.93 ? 204  LEU B O   1 
ATOM   3612 C CB  . LEU B 1 203 ? 33.106 10.110 99.981  1.00 36.77 ? 204  LEU B CB  1 
ATOM   3613 C CG  . LEU B 1 203 ? 32.458 9.441  101.202 1.00 38.17 ? 204  LEU B CG  1 
ATOM   3614 C CD1 . LEU B 1 203 ? 33.216 9.834  102.456 1.00 39.24 ? 204  LEU B CD1 1 
ATOM   3615 C CD2 . LEU B 1 203 ? 31.004 9.873  101.319 1.00 38.75 ? 204  LEU B CD2 1 
ATOM   3616 N N   . PRO B 1 204 ? 35.255 7.285  99.033  1.00 35.24 ? 205  PRO B N   1 
ATOM   3617 C CA  . PRO B 1 204 ? 35.169 5.904  98.545  1.00 36.91 ? 205  PRO B CA  1 
ATOM   3618 C C   . PRO B 1 204 ? 34.042 5.127  99.240  1.00 37.12 ? 205  PRO B C   1 
ATOM   3619 O O   . PRO B 1 204 ? 33.643 5.446  100.367 1.00 34.42 ? 205  PRO B O   1 
ATOM   3620 C CB  . PRO B 1 204 ? 36.544 5.321  98.887  1.00 37.49 ? 205  PRO B CB  1 
ATOM   3621 C CG  . PRO B 1 204 ? 37.452 6.546  98.912  1.00 38.49 ? 205  PRO B CG  1 
ATOM   3622 C CD  . PRO B 1 204 ? 36.584 7.566  99.609  1.00 38.04 ? 205  PRO B CD  1 
ATOM   3623 N N   . GLN B 1 205 ? 33.546 4.107  98.553  1.00 39.14 ? 206  GLN B N   1 
ATOM   3624 C CA  . GLN B 1 205 ? 32.481 3.245  99.060  1.00 41.44 ? 206  GLN B CA  1 
ATOM   3625 C C   . GLN B 1 205 ? 32.689 2.867  100.539 1.00 42.02 ? 206  GLN B C   1 
ATOM   3626 O O   . GLN B 1 205 ? 31.752 2.906  101.342 1.00 41.74 ? 206  GLN B O   1 
ATOM   3627 C CB  . GLN B 1 205 ? 32.436 1.992  98.184  1.00 44.77 ? 206  GLN B CB  1 
ATOM   3628 C CG  . GLN B 1 205 ? 31.271 1.062  98.402  1.00 48.50 ? 206  GLN B CG  1 
ATOM   3629 C CD  . GLN B 1 205 ? 31.124 0.085  97.248  1.00 50.75 ? 206  GLN B CD  1 
ATOM   3630 O OE1 . GLN B 1 205 ? 30.239 -0.771 97.246  1.00 53.52 ? 206  GLN B OE1 1 
ATOM   3631 N NE2 . GLN B 1 205 ? 31.995 0.217  96.248  1.00 52.76 ? 206  GLN B NE2 1 
ATOM   3632 N N   . ALA B 1 206 ? 33.929 2.541  100.896 1.00 41.57 ? 207  ALA B N   1 
ATOM   3633 C CA  . ALA B 1 206 ? 34.276 2.136  102.260 1.00 42.13 ? 207  ALA B CA  1 
ATOM   3634 C C   . ALA B 1 206 ? 34.281 3.260  103.294 1.00 42.81 ? 207  ALA B C   1 
ATOM   3635 O O   . ALA B 1 206 ? 34.462 3.008  104.484 1.00 43.69 ? 207  ALA B O   1 
ATOM   3636 C CB  . ALA B 1 206 ? 35.646 1.436  102.263 1.00 41.36 ? 207  ALA B CB  1 
ATOM   3637 N N   . ALA B 1 207 ? 34.079 4.498  102.861 1.00 40.43 ? 208  ALA B N   1 
ATOM   3638 C CA  . ALA B 1 207 ? 34.091 5.599  103.807 1.00 37.94 ? 208  ALA B CA  1 
ATOM   3639 C C   . ALA B 1 207 ? 32.695 6.019  104.259 1.00 36.59 ? 208  ALA B C   1 
ATOM   3640 O O   . ALA B 1 207 ? 32.577 6.826  105.182 1.00 35.19 ? 208  ALA B O   1 
ATOM   3641 C CB  . ALA B 1 207 ? 34.835 6.789  103.216 1.00 39.88 ? 208  ALA B CB  1 
ATOM   3642 N N   . TRP B 1 208 ? 31.650 5.485  103.619 1.00 35.26 ? 209  TRP B N   1 
ATOM   3643 C CA  . TRP B 1 208 ? 30.276 5.826  104.008 1.00 35.93 ? 209  TRP B CA  1 
ATOM   3644 C C   . TRP B 1 208 ? 29.298 4.673  104.249 1.00 35.85 ? 209  TRP B C   1 
ATOM   3645 O O   . TRP B 1 208 ? 28.461 4.754  105.144 1.00 36.39 ? 209  TRP B O   1 
ATOM   3646 C CB  . TRP B 1 208 ? 29.621 6.800  103.004 1.00 32.49 ? 209  TRP B CB  1 
ATOM   3647 C CG  . TRP B 1 208 ? 29.414 6.278  101.606 1.00 30.29 ? 209  TRP B CG  1 
ATOM   3648 C CD1 . TRP B 1 208 ? 30.334 6.258  100.600 1.00 29.22 ? 209  TRP B CD1 1 
ATOM   3649 C CD2 . TRP B 1 208 ? 28.200 5.757  101.046 1.00 28.87 ? 209  TRP B CD2 1 
ATOM   3650 N NE1 . TRP B 1 208 ? 29.771 5.765  99.450  1.00 31.48 ? 209  TRP B NE1 1 
ATOM   3651 C CE2 . TRP B 1 208 ? 28.463 5.446  99.695  1.00 29.47 ? 209  TRP B CE2 1 
ATOM   3652 C CE3 . TRP B 1 208 ? 26.915 5.519  101.554 1.00 30.40 ? 209  TRP B CE3 1 
ATOM   3653 C CZ2 . TRP B 1 208 ? 27.492 4.917  98.841  1.00 30.13 ? 209  TRP B CZ2 1 
ATOM   3654 C CZ3 . TRP B 1 208 ? 25.951 4.994  100.705 1.00 28.10 ? 209  TRP B CZ3 1 
ATOM   3655 C CH2 . TRP B 1 208 ? 26.246 4.697  99.362  1.00 29.00 ? 209  TRP B CH2 1 
ATOM   3656 N N   . GLN B 1 209 ? 29.383 3.607  103.466 1.00 39.20 ? 210  GLN B N   1 
ATOM   3657 C CA  . GLN B 1 209 ? 28.449 2.500  103.638 1.00 41.67 ? 210  GLN B CA  1 
ATOM   3658 C C   . GLN B 1 209 ? 28.505 1.780  104.985 1.00 42.65 ? 210  GLN B C   1 
ATOM   3659 O O   . GLN B 1 209 ? 27.565 1.068  105.330 1.00 42.71 ? 210  GLN B O   1 
ATOM   3660 C CB  . GLN B 1 209 ? 28.608 1.481  102.514 1.00 43.86 ? 210  GLN B CB  1 
ATOM   3661 C CG  . GLN B 1 209 ? 28.030 1.926  101.180 1.00 48.42 ? 210  GLN B CG  1 
ATOM   3662 C CD  . GLN B 1 209 ? 27.792 0.755  100.237 1.00 51.95 ? 210  GLN B CD  1 
ATOM   3663 O OE1 . GLN B 1 209 ? 27.058 -0.182 100.566 1.00 53.51 ? 210  GLN B OE1 1 
ATOM   3664 N NE2 . GLN B 1 209 ? 28.408 0.803  99.060  1.00 51.85 ? 210  GLN B NE2 1 
ATOM   3665 N N   . ASN B 1 210 ? 29.584 1.968  105.745 1.00 43.23 ? 211  ASN B N   1 
ATOM   3666 C CA  . ASN B 1 210 ? 29.715 1.314  107.051 1.00 44.81 ? 211  ASN B CA  1 
ATOM   3667 C C   . ASN B 1 210 ? 29.533 2.254  108.242 1.00 44.50 ? 211  ASN B C   1 
ATOM   3668 O O   . ASN B 1 210 ? 29.807 1.879  109.384 1.00 45.46 ? 211  ASN B O   1 
ATOM   3669 C CB  . ASN B 1 210 ? 31.069 0.605  107.162 1.00 46.05 ? 211  ASN B CB  1 
ATOM   3670 C CG  . ASN B 1 210 ? 31.279 -0.409 106.057 1.00 48.59 ? 211  ASN B CG  1 
ATOM   3671 O OD1 . ASN B 1 210 ? 30.365 -1.167 105.716 1.00 48.46 ? 211  ASN B OD1 1 
ATOM   3672 N ND2 . ASN B 1 210 ? 32.486 -0.434 105.490 1.00 47.54 ? 211  ASN B ND2 1 
ATOM   3673 N N   . GLU B 1 211 ? 29.076 3.477  107.981 1.00 42.78 ? 212  GLU B N   1 
ATOM   3674 C CA  . GLU B 1 211 ? 28.835 4.439  109.054 1.00 40.61 ? 212  GLU B CA  1 
ATOM   3675 C C   . GLU B 1 211 ? 27.325 4.406  109.252 1.00 40.37 ? 212  GLU B C   1 
ATOM   3676 O O   . GLU B 1 211 ? 26.565 4.823  108.373 1.00 39.32 ? 212  GLU B O   1 
ATOM   3677 C CB  . GLU B 1 211 ? 29.292 5.842  108.638 1.00 40.29 ? 212  GLU B CB  1 
ATOM   3678 C CG  . GLU B 1 211 ? 29.215 6.892  109.742 1.00 36.87 ? 212  GLU B CG  1 
ATOM   3679 C CD  . GLU B 1 211 ? 30.138 6.593  110.920 1.00 38.43 ? 212  GLU B CD  1 
ATOM   3680 O OE1 . GLU B 1 211 ? 31.139 5.860  110.739 1.00 35.99 ? 212  GLU B OE1 1 
ATOM   3681 O OE2 . GLU B 1 211 ? 29.872 7.118  112.023 1.00 36.46 ? 212  GLU B OE2 1 
ATOM   3682 N N   A SER B 1 212 ? 26.897 3.905  110.407 0.60 39.99 ? 213  SER B N   1 
ATOM   3683 N N   B SER B 1 212 ? 26.892 3.907  110.406 0.40 39.43 ? 213  SER B N   1 
ATOM   3684 C CA  A SER B 1 212 ? 25.475 3.790  110.721 0.60 40.02 ? 213  SER B CA  1 
ATOM   3685 C CA  B SER B 1 212 ? 25.467 3.790  110.709 0.40 38.85 ? 213  SER B CA  1 
ATOM   3686 C C   A SER B 1 212 ? 24.702 5.107  110.742 0.60 39.18 ? 213  SER B C   1 
ATOM   3687 C C   B SER B 1 212 ? 24.698 5.110  110.741 0.40 38.53 ? 213  SER B C   1 
ATOM   3688 O O   A SER B 1 212 ? 23.549 5.156  110.313 0.60 39.09 ? 213  SER B O   1 
ATOM   3689 O O   B SER B 1 212 ? 23.544 5.165  110.318 0.40 38.53 ? 213  SER B O   1 
ATOM   3690 C CB  A SER B 1 212 ? 25.291 3.078  112.071 0.60 40.65 ? 213  SER B CB  1 
ATOM   3691 C CB  B SER B 1 212 ? 25.272 3.058  112.045 0.40 38.68 ? 213  SER B CB  1 
ATOM   3692 O OG  A SER B 1 212 ? 25.654 1.710  111.982 0.60 41.34 ? 213  SER B OG  1 
ATOM   3693 O OG  B SER B 1 212 ? 25.859 3.773  113.117 0.40 36.12 ? 213  SER B OG  1 
ATOM   3694 N N   . SER B 1 213 ? 25.329 6.167  111.245 1.00 37.92 ? 214  SER B N   1 
ATOM   3695 C CA  . SER B 1 213 ? 24.672 7.473  111.339 1.00 37.52 ? 214  SER B CA  1 
ATOM   3696 C C   . SER B 1 213 ? 24.250 8.085  110.007 1.00 36.99 ? 214  SER B C   1 
ATOM   3697 O O   . SER B 1 213 ? 23.287 8.852  109.941 1.00 38.58 ? 214  SER B O   1 
ATOM   3698 C CB  . SER B 1 213 ? 25.574 8.473  112.067 1.00 37.48 ? 214  SER B CB  1 
ATOM   3699 O OG  . SER B 1 213 ? 26.743 8.742  111.318 1.00 35.15 ? 214  SER B OG  1 
ATOM   3700 N N   . ILE B 1 214 ? 24.961 7.744  108.945 1.00 34.58 ? 215  ILE B N   1 
ATOM   3701 C CA  . ILE B 1 214 ? 24.654 8.309  107.639 1.00 32.36 ? 215  ILE B CA  1 
ATOM   3702 C C   . ILE B 1 214 ? 23.371 7.778  107.019 1.00 31.74 ? 215  ILE B C   1 
ATOM   3703 O O   . ILE B 1 214 ? 23.205 6.568  106.847 1.00 32.72 ? 215  ILE B O   1 
ATOM   3704 C CB  . ILE B 1 214 ? 25.823 8.066  106.678 1.00 29.59 ? 215  ILE B CB  1 
ATOM   3705 C CG1 . ILE B 1 214 ? 27.045 8.851  107.163 1.00 30.97 ? 215  ILE B CG1 1 
ATOM   3706 C CG2 . ILE B 1 214 ? 25.432 8.446  105.261 1.00 30.65 ? 215  ILE B CG2 1 
ATOM   3707 C CD1 . ILE B 1 214 ? 28.332 8.547  106.392 1.00 27.99 ? 215  ILE B CD1 1 
ATOM   3708 N N   . GLU B 1 215 ? 22.472 8.698  106.666 1.00 29.63 ? 216  GLU B N   1 
ATOM   3709 C CA  . GLU B 1 215 ? 21.200 8.336  106.040 1.00 28.83 ? 216  GLU B CA  1 
ATOM   3710 C C   . GLU B 1 215 ? 21.187 8.583  104.526 1.00 26.94 ? 216  GLU B C   1 
ATOM   3711 O O   . GLU B 1 215 ? 20.670 7.772  103.759 1.00 25.96 ? 216  GLU B O   1 
ATOM   3712 C CB  . GLU B 1 215 ? 20.060 9.156  106.647 1.00 29.99 ? 216  GLU B CB  1 
ATOM   3713 C CG  . GLU B 1 215 ? 19.866 9.048  108.154 1.00 33.41 ? 216  GLU B CG  1 
ATOM   3714 C CD  . GLU B 1 215 ? 18.899 10.101 108.670 1.00 35.93 ? 216  GLU B CD  1 
ATOM   3715 O OE1 . GLU B 1 215 ? 17.958 10.457 107.921 1.00 38.42 ? 216  GLU B OE1 1 
ATOM   3716 O OE2 . GLU B 1 215 ? 19.066 10.573 109.820 1.00 38.91 ? 216  GLU B OE2 1 
ATOM   3717 N N   . ILE B 1 216 ? 21.766 9.705  104.095 1.00 26.09 ? 217  ILE B N   1 
ATOM   3718 C CA  . ILE B 1 216 ? 21.741 10.084 102.674 1.00 26.50 ? 217  ILE B CA  1 
ATOM   3719 C C   . ILE B 1 216 ? 23.050 10.723 102.198 1.00 23.85 ? 217  ILE B C   1 
ATOM   3720 O O   . ILE B 1 216 ? 23.619 11.537 102.907 1.00 26.11 ? 217  ILE B O   1 
ATOM   3721 C CB  . ILE B 1 216 ? 20.590 11.124 102.445 1.00 25.78 ? 217  ILE B CB  1 
ATOM   3722 C CG1 . ILE B 1 216 ? 19.258 10.535 102.924 1.00 29.16 ? 217  ILE B CG1 1 
ATOM   3723 C CG2 . ILE B 1 216 ? 20.520 11.542 100.972 1.00 21.58 ? 217  ILE B CG2 1 
ATOM   3724 C CD1 . ILE B 1 216 ? 18.119 11.532 102.985 1.00 29.25 ? 217  ILE B CD1 1 
ATOM   3725 N N   . VAL B 1 217 ? 23.536 10.329 101.023 1.00 24.80 ? 218  VAL B N   1 
ATOM   3726 C CA  . VAL B 1 217 ? 24.741 10.939 100.459 1.00 23.71 ? 218  VAL B CA  1 
ATOM   3727 C C   . VAL B 1 217 ? 24.370 11.562 99.094  1.00 23.28 ? 218  VAL B C   1 
ATOM   3728 O O   . VAL B 1 217 ? 23.489 11.061 98.384  1.00 22.60 ? 218  VAL B O   1 
ATOM   3729 C CB  . VAL B 1 217 ? 25.891 9.913  100.285 1.00 26.46 ? 218  VAL B CB  1 
ATOM   3730 C CG1 . VAL B 1 217 ? 26.287 9.334  101.664 1.00 25.59 ? 218  VAL B CG1 1 
ATOM   3731 C CG2 . VAL B 1 217 ? 25.479 8.805  99.337  1.00 25.67 ? 218  VAL B CG2 1 
ATOM   3732 N N   . ALA B 1 218 ? 25.026 12.661 98.727  1.00 23.35 ? 219  ALA B N   1 
ATOM   3733 C CA  . ALA B 1 218 ? 24.719 13.337 97.455  1.00 22.41 ? 219  ALA B CA  1 
ATOM   3734 C C   . ALA B 1 218 ? 26.029 13.841 96.843  1.00 21.78 ? 219  ALA B C   1 
ATOM   3735 O O   . ALA B 1 218 ? 26.844 14.427 97.550  1.00 23.50 ? 219  ALA B O   1 
ATOM   3736 C CB  . ALA B 1 218 ? 23.761 14.513 97.712  1.00 22.52 ? 219  ALA B CB  1 
ATOM   3737 N N   . ASP B 1 219 ? 26.198 13.629 95.537  1.00 22.05 ? 220  ASP B N   1 
ATOM   3738 C CA  . ASP B 1 219 ? 27.425 13.984 94.797  1.00 24.79 ? 220  ASP B CA  1 
ATOM   3739 C C   . ASP B 1 219 ? 27.113 14.913 93.599  1.00 23.92 ? 220  ASP B C   1 
ATOM   3740 O O   . ASP B 1 219 ? 26.210 14.628 92.817  1.00 23.40 ? 220  ASP B O   1 
ATOM   3741 C CB  . ASP B 1 219 ? 28.044 12.662 94.307  1.00 25.33 ? 220  ASP B CB  1 
ATOM   3742 C CG  . ASP B 1 219 ? 29.379 12.832 93.578  1.00 28.96 ? 220  ASP B CG  1 
ATOM   3743 O OD1 . ASP B 1 219 ? 29.811 11.827 92.956  1.00 29.94 ? 220  ASP B OD1 1 
ATOM   3744 O OD2 . ASP B 1 219 ? 29.996 13.923 93.620  1.00 24.96 ? 220  ASP B OD2 1 
ATOM   3745 N N   . TYR B 1 220 ? 27.854 16.014 93.463  1.00 23.96 ? 221  TYR B N   1 
ATOM   3746 C CA  . TYR B 1 220 ? 27.628 16.963 92.356  1.00 24.73 ? 221  TYR B CA  1 
ATOM   3747 C C   . TYR B 1 220 ? 28.582 16.748 91.172  1.00 26.01 ? 221  TYR B C   1 
ATOM   3748 O O   . TYR B 1 220 ? 28.406 17.348 90.108  1.00 23.95 ? 221  TYR B O   1 
ATOM   3749 C CB  . TYR B 1 220 ? 27.771 18.409 92.856  1.00 23.79 ? 221  TYR B CB  1 
ATOM   3750 C CG  . TYR B 1 220 ? 26.706 18.856 93.854  1.00 19.10 ? 221  TYR B CG  1 
ATOM   3751 C CD1 . TYR B 1 220 ? 27.015 19.030 95.193  1.00 20.35 ? 221  TYR B CD1 1 
ATOM   3752 C CD2 . TYR B 1 220 ? 25.404 19.151 93.433  1.00 19.84 ? 221  TYR B CD2 1 
ATOM   3753 C CE1 . TYR B 1 220 ? 26.052 19.501 96.103  1.00 21.99 ? 221  TYR B CE1 1 
ATOM   3754 C CE2 . TYR B 1 220 ? 24.429 19.618 94.323  1.00 18.36 ? 221  TYR B CE2 1 
ATOM   3755 C CZ  . TYR B 1 220 ? 24.762 19.798 95.657  1.00 22.14 ? 221  TYR B CZ  1 
ATOM   3756 O OH  . TYR B 1 220 ? 23.834 20.311 96.541  1.00 21.02 ? 221  TYR B OH  1 
ATOM   3757 N N   . ASN B 1 221 ? 29.595 15.905 91.363  1.00 26.26 ? 222  ASN B N   1 
ATOM   3758 C CA  . ASN B 1 221 ? 30.555 15.606 90.288  1.00 28.20 ? 222  ASN B CA  1 
ATOM   3759 C C   . ASN B 1 221 ? 30.020 14.514 89.379  1.00 27.69 ? 222  ASN B C   1 
ATOM   3760 O O   . ASN B 1 221 ? 29.826 13.384 89.816  1.00 28.34 ? 222  ASN B O   1 
ATOM   3761 C CB  . ASN B 1 221 ? 31.909 15.145 90.855  1.00 27.72 ? 222  ASN B CB  1 
ATOM   3762 C CG  . ASN B 1 221 ? 32.850 14.649 89.764  1.00 29.56 ? 222  ASN B CG  1 
ATOM   3763 O OD1 . ASN B 1 221 ? 32.929 15.247 88.692  1.00 27.18 ? 222  ASN B OD1 1 
ATOM   3764 N ND2 . ASN B 1 221 ? 33.568 13.558 90.033  1.00 27.90 ? 222  ASN B ND2 1 
ATOM   3765 N N   . ALA B 1 222 ? 29.798 14.846 88.110  1.00 27.75 ? 223  ALA B N   1 
ATOM   3766 C CA  . ALA B 1 222 ? 29.276 13.885 87.159  1.00 29.17 ? 223  ALA B CA  1 
ATOM   3767 C C   . ALA B 1 222 ? 30.340 13.192 86.297  1.00 30.71 ? 223  ALA B C   1 
ATOM   3768 O O   . ALA B 1 222 ? 30.002 12.320 85.491  1.00 28.93 ? 223  ALA B O   1 
ATOM   3769 C CB  . ALA B 1 222 ? 28.248 14.561 86.257  1.00 30.78 ? 223  ALA B CB  1 
ATOM   3770 N N   . GLN B 1 223 ? 31.611 13.559 86.464  1.00 31.47 ? 224  GLN B N   1 
ATOM   3771 C CA  . GLN B 1 223 ? 32.673 12.951 85.645  1.00 33.30 ? 224  GLN B CA  1 
ATOM   3772 C C   . GLN B 1 223 ? 33.484 11.902 86.407  1.00 32.34 ? 224  GLN B C   1 
ATOM   3773 O O   . GLN B 1 223 ? 34.104 12.204 87.422  1.00 32.51 ? 224  GLN B O   1 
ATOM   3774 C CB  . GLN B 1 223 ? 33.625 14.034 85.106  1.00 34.02 ? 224  GLN B CB  1 
ATOM   3775 C CG  . GLN B 1 223 ? 34.783 13.485 84.237  1.00 37.14 ? 224  GLN B CG  1 
ATOM   3776 C CD  . GLN B 1 223 ? 35.733 14.575 83.773  1.00 40.28 ? 224  GLN B CD  1 
ATOM   3777 O OE1 . GLN B 1 223 ? 36.930 14.552 84.079  1.00 43.32 ? 224  GLN B OE1 1 
ATOM   3778 N NE2 . GLN B 1 223 ? 35.203 15.545 83.038  1.00 40.64 ? 224  GLN B NE2 1 
ATOM   3779 N N   . PRO B 1 224 ? 33.487 10.652 85.919  1.00 34.82 ? 225  PRO B N   1 
ATOM   3780 C CA  . PRO B 1 224 ? 34.225 9.549  86.551  1.00 36.60 ? 225  PRO B CA  1 
ATOM   3781 C C   . PRO B 1 224 ? 35.711 9.863  86.652  1.00 38.15 ? 225  PRO B C   1 
ATOM   3782 O O   . PRO B 1 224 ? 36.316 10.350 85.698  1.00 38.63 ? 225  PRO B O   1 
ATOM   3783 C CB  . PRO B 1 224 ? 33.962 8.372  85.614  1.00 37.84 ? 225  PRO B CB  1 
ATOM   3784 C CG  . PRO B 1 224 ? 32.616 8.678  85.054  1.00 37.23 ? 225  PRO B CG  1 
ATOM   3785 C CD  . PRO B 1 224 ? 32.710 10.168 84.765  1.00 34.24 ? 225  PRO B CD  1 
ATOM   3786 N N   . PRO B 1 225 ? 36.325 9.591  87.810  1.00 38.74 ? 226  PRO B N   1 
ATOM   3787 C CA  . PRO B 1 225 ? 35.777 9.013  89.044  1.00 37.84 ? 226  PRO B CA  1 
ATOM   3788 C C   . PRO B 1 225 ? 34.855 9.964  89.810  1.00 35.68 ? 226  PRO B C   1 
ATOM   3789 O O   . PRO B 1 225 ? 35.254 11.074 90.176  1.00 34.47 ? 226  PRO B O   1 
ATOM   3790 C CB  . PRO B 1 225 ? 37.033 8.680  89.842  1.00 39.52 ? 226  PRO B CB  1 
ATOM   3791 C CG  . PRO B 1 225 ? 37.942 9.826  89.474  1.00 39.87 ? 226  PRO B CG  1 
ATOM   3792 C CD  . PRO B 1 225 ? 37.753 9.916  87.973  1.00 39.68 ? 226  PRO B CD  1 
ATOM   3793 N N   . LEU B 1 226 ? 33.635 9.506  90.073  1.00 33.68 ? 227  LEU B N   1 
ATOM   3794 C CA  . LEU B 1 226 ? 32.639 10.307 90.790  1.00 32.59 ? 227  LEU B CA  1 
ATOM   3795 C C   . LEU B 1 226 ? 33.118 10.692 92.188  1.00 32.13 ? 227  LEU B C   1 
ATOM   3796 O O   . LEU B 1 226 ? 34.029 10.069 92.726  1.00 34.31 ? 227  LEU B O   1 
ATOM   3797 C CB  . LEU B 1 226 ? 31.327 9.522  90.879  1.00 31.41 ? 227  LEU B CB  1 
ATOM   3798 C CG  . LEU B 1 226 ? 30.802 9.018  89.530  1.00 32.00 ? 227  LEU B CG  1 
ATOM   3799 C CD1 . LEU B 1 226 ? 29.508 8.241  89.725  1.00 30.55 ? 227  LEU B CD1 1 
ATOM   3800 C CD2 . LEU B 1 226 ? 30.575 10.203 88.588  1.00 34.61 ? 227  LEU B CD2 1 
ATOM   3801 N N   . GLY B 1 227 ? 32.512 11.729 92.769  1.00 30.93 ? 228  GLY B N   1 
ATOM   3802 C CA  . GLY B 1 227 ? 32.893 12.172 94.099  1.00 27.34 ? 228  GLY B CA  1 
ATOM   3803 C C   . GLY B 1 227 ? 32.639 11.112 95.152  1.00 27.85 ? 228  GLY B C   1 
ATOM   3804 O O   . GLY B 1 227 ? 33.358 11.020 96.154  1.00 27.03 ? 228  GLY B O   1 
ATOM   3805 N N   . ILE B 1 228 ? 31.608 10.304 94.915  1.00 28.30 ? 229  ILE B N   1 
ATOM   3806 C CA  . ILE B 1 228 ? 31.236 9.220  95.826  1.00 29.91 ? 229  ILE B CA  1 
ATOM   3807 C C   . ILE B 1 228 ? 31.381 7.883  95.122  1.00 28.38 ? 229  ILE B C   1 
ATOM   3808 O O   . ILE B 1 228 ? 30.857 7.681  94.019  1.00 30.99 ? 229  ILE B O   1 
ATOM   3809 C CB  . ILE B 1 228 ? 29.766 9.375  96.312  1.00 29.90 ? 229  ILE B CB  1 
ATOM   3810 C CG1 . ILE B 1 228 ? 29.621 10.715 97.035  1.00 31.79 ? 229  ILE B CG1 1 
ATOM   3811 C CG2 . ILE B 1 228 ? 29.377 8.202  97.232  1.00 30.36 ? 229  ILE B CG2 1 
ATOM   3812 C CD1 . ILE B 1 228 ? 28.257 10.965 97.664  1.00 34.76 ? 229  ILE B CD1 1 
ATOM   3813 N N   . GLY B 1 229 ? 32.088 6.959  95.760  1.00 29.69 ? 230  GLY B N   1 
ATOM   3814 C CA  . GLY B 1 229 ? 32.271 5.660  95.155  1.00 28.91 ? 230  GLY B CA  1 
ATOM   3815 C C   . GLY B 1 229 ? 31.131 4.736  95.497  1.00 30.45 ? 230  GLY B C   1 
ATOM   3816 O O   . GLY B 1 229 ? 30.517 4.867  96.554  1.00 32.51 ? 230  GLY B O   1 
ATOM   3817 N N   . GLY B 1 230 ? 30.837 3.815  94.587  1.00 31.92 ? 231  GLY B N   1 
ATOM   3818 C CA  . GLY B 1 230 ? 29.775 2.858  94.810  1.00 32.56 ? 231  GLY B CA  1 
ATOM   3819 C C   . GLY B 1 230 ? 28.401 3.240  94.290  1.00 33.93 ? 231  GLY B C   1 
ATOM   3820 O O   . GLY B 1 230 ? 27.446 2.507  94.522  1.00 34.28 ? 231  GLY B O   1 
ATOM   3821 N N   . ILE B 1 231 ? 28.279 4.371  93.594  1.00 32.79 ? 232  ILE B N   1 
ATOM   3822 C CA  . ILE B 1 231 ? 26.974 4.793  93.071  1.00 31.73 ? 232  ILE B CA  1 
ATOM   3823 C C   . ILE B 1 231 ? 27.066 5.120  91.591  1.00 32.51 ? 232  ILE B C   1 
ATOM   3824 O O   . ILE B 1 231 ? 28.153 5.123  91.022  1.00 33.86 ? 232  ILE B O   1 
ATOM   3825 C CB  . ILE B 1 231 ? 26.474 6.072  93.765  1.00 30.99 ? 232  ILE B CB  1 
ATOM   3826 C CG1 . ILE B 1 231 ? 27.327 7.267  93.318  1.00 29.78 ? 232  ILE B CG1 1 
ATOM   3827 C CG2 . ILE B 1 231 ? 26.551 5.921  95.281  1.00 27.30 ? 232  ILE B CG2 1 
ATOM   3828 C CD1 . ILE B 1 231 ? 26.824 8.605  93.859  1.00 29.52 ? 232  ILE B CD1 1 
ATOM   3829 N N   . ASP B 1 232 ? 25.933 5.381  90.952  1.00 31.83 ? 233  ASP B N   1 
ATOM   3830 C CA  . ASP B 1 232 ? 25.994 5.776  89.553  1.00 31.03 ? 233  ASP B CA  1 
ATOM   3831 C C   . ASP B 1 232 ? 25.572 7.239  89.541  1.00 30.34 ? 233  ASP B C   1 
ATOM   3832 O O   . ASP B 1 232 ? 24.853 7.684  90.439  1.00 27.54 ? 233  ASP B O   1 
ATOM   3833 C CB  . ASP B 1 232 ? 25.067 4.953  88.668  1.00 31.73 ? 233  ASP B CB  1 
ATOM   3834 C CG  . ASP B 1 232 ? 25.310 5.214  87.180  1.00 37.43 ? 233  ASP B CG  1 
ATOM   3835 O OD1 . ASP B 1 232 ? 24.604 6.062  86.560  1.00 31.79 ? 233  ASP B OD1 1 
ATOM   3836 O OD2 . ASP B 1 232 ? 26.243 4.571  86.638  1.00 36.98 ? 233  ASP B OD2 1 
ATOM   3837 N N   . ALA B 1 233 ? 26.038 7.986  88.546  1.00 29.21 ? 234  ALA B N   1 
ATOM   3838 C CA  . ALA B 1 233 ? 25.716 9.398  88.459  1.00 27.90 ? 234  ALA B CA  1 
ATOM   3839 C C   . ALA B 1 233 ? 24.215 9.628  88.335  1.00 28.25 ? 234  ALA B C   1 
ATOM   3840 O O   . ALA B 1 233 ? 23.715 10.664 88.776  1.00 30.48 ? 234  ALA B O   1 
ATOM   3841 C CB  . ALA B 1 233 ? 26.464 10.038 87.274  1.00 25.99 ? 234  ALA B CB  1 
ATOM   3842 N N   . THR B 1 234 ? 23.496 8.666  87.760  1.00 26.97 ? 235  THR B N   1 
ATOM   3843 C CA  . THR B 1 234 ? 22.046 8.792  87.574  1.00 27.01 ? 235  THR B CA  1 
ATOM   3844 C C   . THR B 1 234 ? 21.218 8.421  88.810  1.00 27.61 ? 235  THR B C   1 
ATOM   3845 O O   . THR B 1 234 ? 19.994 8.571  88.809  1.00 26.19 ? 235  THR B O   1 
ATOM   3846 C CB  . THR B 1 234 ? 21.542 7.903  86.431  1.00 28.19 ? 235  THR B CB  1 
ATOM   3847 O OG1 . THR B 1 234 ? 21.848 6.534  86.736  1.00 28.67 ? 235  THR B OG1 1 
ATOM   3848 C CG2 . THR B 1 234 ? 22.189 8.301  85.094  1.00 27.17 ? 235  THR B CG2 1 
ATOM   3849 N N   . ASP B 1 235 ? 21.864 7.929  89.856  1.00 27.05 ? 236  ASP B N   1 
ATOM   3850 C CA  . ASP B 1 235 ? 21.114 7.559  91.053  1.00 28.58 ? 236  ASP B CA  1 
ATOM   3851 C C   . ASP B 1 235 ? 20.329 8.736  91.585  1.00 28.06 ? 236  ASP B C   1 
ATOM   3852 O O   . ASP B 1 235 ? 20.849 9.846  91.675  1.00 28.51 ? 236  ASP B O   1 
ATOM   3853 C CB  . ASP B 1 235 ? 22.038 7.040  92.157  1.00 27.30 ? 236  ASP B CB  1 
ATOM   3854 C CG  . ASP B 1 235 ? 22.559 5.656  91.864  1.00 29.05 ? 236  ASP B CG  1 
ATOM   3855 O OD1 . ASP B 1 235 ? 21.971 4.998  90.985  1.00 28.78 ? 236  ASP B OD1 1 
ATOM   3856 O OD2 . ASP B 1 235 ? 23.540 5.234  92.514  1.00 28.64 ? 236  ASP B OD2 1 
ATOM   3857 N N   . LYS B 1 236 ? 19.068 8.492  91.935  1.00 28.08 ? 237  LYS B N   1 
ATOM   3858 C CA  . LYS B 1 236 ? 18.219 9.556  92.484  1.00 28.41 ? 237  LYS B CA  1 
ATOM   3859 C C   . LYS B 1 236 ? 17.419 8.963  93.646  1.00 28.54 ? 237  LYS B C   1 
ATOM   3860 O O   . LYS B 1 236 ? 16.246 8.662  93.506  1.00 29.08 ? 237  LYS B O   1 
ATOM   3861 C CB  . LYS B 1 236 ? 17.268 10.089 91.402  1.00 26.46 ? 237  LYS B CB  1 
ATOM   3862 C CG  . LYS B 1 236 ? 16.512 11.367 91.761  1.00 27.75 ? 237  LYS B CG  1 
ATOM   3863 C CD  . LYS B 1 236 ? 15.699 11.869 90.545  1.00 26.51 ? 237  LYS B CD  1 
ATOM   3864 C CE  . LYS B 1 236 ? 15.012 13.218 90.830  1.00 24.97 ? 237  LYS B CE  1 
ATOM   3865 N NZ  . LYS B 1 236 ? 13.724 13.044 91.533  1.00 27.88 ? 237  LYS B NZ  1 
ATOM   3866 N N   . GLY B 1 237 ? 18.061 8.800  94.791  1.00 29.50 ? 238  GLY B N   1 
ATOM   3867 C CA  . GLY B 1 237 ? 17.357 8.226  95.923  1.00 31.33 ? 238  GLY B CA  1 
ATOM   3868 C C   . GLY B 1 237 ? 17.459 6.712  95.993  1.00 32.59 ? 238  GLY B C   1 
ATOM   3869 O O   . GLY B 1 237 ? 16.818 6.097  96.835  1.00 32.63 ? 238  GLY B O   1 
ATOM   3870 N N   . LYS B 1 238 ? 18.255 6.113  95.108  1.00 32.62 ? 239  LYS B N   1 
ATOM   3871 C CA  . LYS B 1 238 ? 18.447 4.664  95.092  1.00 33.55 ? 239  LYS B CA  1 
ATOM   3872 C C   . LYS B 1 238 ? 18.949 4.189  96.448  1.00 33.01 ? 239  LYS B C   1 
ATOM   3873 O O   . LYS B 1 238 ? 19.806 4.827  97.069  1.00 32.33 ? 239  LYS B O   1 
ATOM   3874 C CB  . LYS B 1 238 ? 19.455 4.278  94.004  1.00 36.27 ? 239  LYS B CB  1 
ATOM   3875 C CG  . LYS B 1 238 ? 19.731 2.773  93.884  1.00 35.75 ? 239  LYS B CG  1 
ATOM   3876 C CD  . LYS B 1 238 ? 20.547 2.442  92.627  1.00 37.13 ? 239  LYS B CD  1 
ATOM   3877 C CE  . LYS B 1 238 ? 20.954 0.963  92.606  1.00 38.34 ? 239  LYS B CE  1 
ATOM   3878 N NZ  . LYS B 1 238 ? 21.535 0.522  91.289  1.00 36.13 ? 239  LYS B NZ  1 
ATOM   3879 N N   . GLU B 1 239 ? 18.406 3.069  96.915  1.00 33.57 ? 240  GLU B N   1 
ATOM   3880 C CA  . GLU B 1 239 ? 18.795 2.524  98.209  1.00 33.42 ? 240  GLU B CA  1 
ATOM   3881 C C   . GLU B 1 239 ? 20.044 1.649  98.160  1.00 32.78 ? 240  GLU B C   1 
ATOM   3882 O O   . GLU B 1 239 ? 20.204 0.819  97.270  1.00 31.85 ? 240  GLU B O   1 
ATOM   3883 C CB  . GLU B 1 239 ? 17.641 1.707  98.818  1.00 36.77 ? 240  GLU B CB  1 
ATOM   3884 C CG  . GLU B 1 239 ? 16.375 2.509  99.083  1.00 40.78 ? 240  GLU B CG  1 
ATOM   3885 C CD  . GLU B 1 239 ? 15.340 1.738  99.879  1.00 44.79 ? 240  GLU B CD  1 
ATOM   3886 O OE1 . GLU B 1 239 ? 15.527 1.588  101.111 1.00 47.13 ? 240  GLU B OE1 1 
ATOM   3887 O OE2 . GLU B 1 239 ? 14.343 1.283  99.272  1.00 43.78 ? 240  GLU B OE2 1 
ATOM   3888 N N   . TYR B 1 240 ? 20.927 1.868  99.125  1.00 33.17 ? 241  TYR B N   1 
ATOM   3889 C CA  . TYR B 1 240 ? 22.152 1.088  99.287  1.00 36.24 ? 241  TYR B CA  1 
ATOM   3890 C C   . TYR B 1 240 ? 22.131 0.688  100.755 1.00 37.34 ? 241  TYR B C   1 
ATOM   3891 O O   . TYR B 1 240 ? 22.507 1.472  101.629 1.00 36.62 ? 241  TYR B O   1 
ATOM   3892 C CB  . TYR B 1 240 ? 23.398 1.930  98.986  1.00 35.93 ? 241  TYR B CB  1 
ATOM   3893 C CG  . TYR B 1 240 ? 23.597 2.202  97.510  1.00 34.45 ? 241  TYR B CG  1 
ATOM   3894 C CD1 . TYR B 1 240 ? 23.002 3.310  96.893  1.00 32.77 ? 241  TYR B CD1 1 
ATOM   3895 C CD2 . TYR B 1 240 ? 24.348 1.330  96.719  1.00 33.31 ? 241  TYR B CD2 1 
ATOM   3896 C CE1 . TYR B 1 240 ? 23.148 3.542  95.519  1.00 32.53 ? 241  TYR B CE1 1 
ATOM   3897 C CE2 . TYR B 1 240 ? 24.499 1.554  95.344  1.00 33.82 ? 241  TYR B CE2 1 
ATOM   3898 C CZ  . TYR B 1 240 ? 23.891 2.659  94.755  1.00 31.54 ? 241  TYR B CZ  1 
ATOM   3899 O OH  . TYR B 1 240 ? 23.986 2.839  93.398  1.00 32.29 ? 241  TYR B OH  1 
ATOM   3900 N N   . GLY B 1 241 ? 21.683 -0.533 101.031 1.00 40.20 ? 242  GLY B N   1 
ATOM   3901 C CA  . GLY B 1 241 ? 21.587 -0.950 102.417 1.00 41.97 ? 242  GLY B CA  1 
ATOM   3902 C C   . GLY B 1 241 ? 20.479 -0.116 103.040 1.00 41.45 ? 242  GLY B C   1 
ATOM   3903 O O   . GLY B 1 241 ? 19.367 -0.066 102.517 1.00 44.08 ? 242  GLY B O   1 
ATOM   3904 N N   . GLY B 1 242 ? 20.757 0.554  104.147 1.00 41.18 ? 243  GLY B N   1 
ATOM   3905 C CA  . GLY B 1 242 ? 19.711 1.372  104.736 1.00 40.08 ? 243  GLY B CA  1 
ATOM   3906 C C   . GLY B 1 242 ? 19.900 2.832  104.365 1.00 38.99 ? 243  GLY B C   1 
ATOM   3907 O O   . GLY B 1 242 ? 19.357 3.716  105.015 1.00 37.35 ? 243  GLY B O   1 
ATOM   3908 N N   . LYS B 1 243 ? 20.662 3.093  103.309 1.00 36.98 ? 244  LYS B N   1 
ATOM   3909 C CA  . LYS B 1 243 ? 20.926 4.473  102.919 1.00 36.06 ? 244  LYS B CA  1 
ATOM   3910 C C   . LYS B 1 243 ? 20.439 4.805  101.518 1.00 35.63 ? 244  LYS B C   1 
ATOM   3911 O O   . LYS B 1 243 ? 20.160 3.905  100.722 1.00 37.93 ? 244  LYS B O   1 
ATOM   3912 C CB  . LYS B 1 243 ? 22.422 4.741  103.013 1.00 35.75 ? 244  LYS B CB  1 
ATOM   3913 C CG  . LYS B 1 243 ? 23.062 4.184  104.268 1.00 36.77 ? 244  LYS B CG  1 
ATOM   3914 C CD  . LYS B 1 243 ? 24.538 4.562  104.369 1.00 36.33 ? 244  LYS B CD  1 
ATOM   3915 C CE  . LYS B 1 243 ? 25.179 3.877  105.568 1.00 36.34 ? 244  LYS B CE  1 
ATOM   3916 N NZ  . LYS B 1 243 ? 24.516 4.272  106.834 1.00 35.86 ? 244  LYS B NZ  1 
ATOM   3917 N N   . ARG B 1 244 ? 20.334 6.101  101.221 1.00 31.82 ? 245  ARG B N   1 
ATOM   3918 C CA  . ARG B 1 244 ? 19.899 6.542  99.904  1.00 30.09 ? 245  ARG B CA  1 
ATOM   3919 C C   . ARG B 1 244 ? 20.986 7.439  99.306  1.00 26.60 ? 245  ARG B C   1 
ATOM   3920 O O   . ARG B 1 244 ? 21.651 8.176  100.030 1.00 25.43 ? 245  ARG B O   1 
ATOM   3921 C CB  . ARG B 1 244 ? 18.571 7.300  99.998  1.00 33.13 ? 245  ARG B CB  1 
ATOM   3922 C CG  . ARG B 1 244 ? 17.579 6.634  100.950 1.00 41.52 ? 245  ARG B CG  1 
ATOM   3923 C CD  . ARG B 1 244 ? 16.139 7.022  100.691 1.00 43.37 ? 245  ARG B CD  1 
ATOM   3924 N NE  . ARG B 1 244 ? 15.666 6.434  99.443  1.00 49.53 ? 245  ARG B NE  1 
ATOM   3925 C CZ  . ARG B 1 244 ? 14.391 6.181  99.168  1.00 49.10 ? 245  ARG B CZ  1 
ATOM   3926 N NH1 . ARG B 1 244 ? 13.449 6.460  100.059 1.00 51.74 ? 245  ARG B NH1 1 
ATOM   3927 N NH2 . ARG B 1 244 ? 14.062 5.652  97.999  1.00 49.75 ? 245  ARG B NH2 1 
ATOM   3928 N N   . ALA B 1 245 ? 21.162 7.353  97.992  1.00 24.13 ? 246  ALA B N   1 
ATOM   3929 C CA  . ALA B 1 245 ? 22.178 8.142  97.290  1.00 24.06 ? 246  ALA B CA  1 
ATOM   3930 C C   . ALA B 1 245 ? 21.641 8.950  96.115  1.00 24.64 ? 246  ALA B C   1 
ATOM   3931 O O   . ALA B 1 245 ? 20.749 8.507  95.403  1.00 25.82 ? 246  ALA B O   1 
ATOM   3932 C CB  . ALA B 1 245 ? 23.276 7.226  96.781  1.00 22.23 ? 246  ALA B CB  1 
ATOM   3933 N N   . PHE B 1 246 ? 22.222 10.128 95.901  1.00 25.18 ? 247  PHE B N   1 
ATOM   3934 C CA  . PHE B 1 246 ? 21.829 10.974 94.773  1.00 24.92 ? 247  PHE B CA  1 
ATOM   3935 C C   . PHE B 1 246 ? 23.071 11.282 93.943  1.00 24.22 ? 247  PHE B C   1 
ATOM   3936 O O   . PHE B 1 246 ? 24.010 11.856 94.460  1.00 25.97 ? 247  PHE B O   1 
ATOM   3937 C CB  . PHE B 1 246 ? 21.192 12.273 95.275  1.00 23.75 ? 247  PHE B CB  1 
ATOM   3938 C CG  . PHE B 1 246 ? 19.811 12.077 95.860  1.00 26.39 ? 247  PHE B CG  1 
ATOM   3939 C CD1 . PHE B 1 246 ? 19.649 11.684 97.197  1.00 24.67 ? 247  PHE B CD1 1 
ATOM   3940 C CD2 . PHE B 1 246 ? 18.675 12.246 95.061  1.00 25.96 ? 247  PHE B CD2 1 
ATOM   3941 C CE1 . PHE B 1 246 ? 18.374 11.461 97.727  1.00 25.85 ? 247  PHE B CE1 1 
ATOM   3942 C CE2 . PHE B 1 246 ? 17.394 12.029 95.578  1.00 27.51 ? 247  PHE B CE2 1 
ATOM   3943 C CZ  . PHE B 1 246 ? 17.245 11.634 96.918  1.00 25.91 ? 247  PHE B CZ  1 
ATOM   3944 N N   . GLY B 1 247 ? 23.066 10.881 92.672  1.00 25.97 ? 248  GLY B N   1 
ATOM   3945 C CA  . GLY B 1 247 ? 24.194 11.139 91.788  1.00 26.38 ? 248  GLY B CA  1 
ATOM   3946 C C   . GLY B 1 247 ? 24.051 12.489 91.089  1.00 27.80 ? 248  GLY B C   1 
ATOM   3947 O O   . GLY B 1 247 ? 22.942 13.059 91.016  1.00 25.42 ? 248  GLY B O   1 
ATOM   3948 N N   . ALA B 1 248 ? 25.161 13.011 90.561  1.00 26.80 ? 249  ALA B N   1 
ATOM   3949 C CA  . ALA B 1 248 ? 25.129 14.325 89.913  1.00 25.17 ? 249  ALA B CA  1 
ATOM   3950 C C   . ALA B 1 248 ? 24.047 14.486 88.846  1.00 24.41 ? 249  ALA B C   1 
ATOM   3951 O O   . ALA B 1 248 ? 23.403 15.546 88.756  1.00 23.83 ? 249  ALA B O   1 
ATOM   3952 C CB  . ALA B 1 248 ? 26.525 14.670 89.331  1.00 23.95 ? 249  ALA B CB  1 
ATOM   3953 N N   . LEU B 1 249 ? 23.832 13.453 88.040  1.00 23.66 ? 250  LEU B N   1 
ATOM   3954 C CA  . LEU B 1 249 ? 22.805 13.519 86.996  1.00 24.14 ? 250  LEU B CA  1 
ATOM   3955 C C   . LEU B 1 249 ? 21.385 13.400 87.567  1.00 25.19 ? 250  LEU B C   1 
ATOM   3956 O O   . LEU B 1 249 ? 20.435 13.977 87.022  1.00 22.98 ? 250  LEU B O   1 
ATOM   3957 C CB  . LEU B 1 249 ? 23.045 12.431 85.952  1.00 25.91 ? 250  LEU B CB  1 
ATOM   3958 C CG  . LEU B 1 249 ? 24.372 12.517 85.191  1.00 26.92 ? 250  LEU B CG  1 
ATOM   3959 C CD1 . LEU B 1 249 ? 24.432 11.395 84.161  1.00 26.83 ? 250  LEU B CD1 1 
ATOM   3960 C CD2 . LEU B 1 249 ? 24.503 13.872 84.524  1.00 25.20 ? 250  LEU B CD2 1 
ATOM   3961 N N   . GLY B 1 250 ? 21.229 12.656 88.661  1.00 23.84 ? 251  GLY B N   1 
ATOM   3962 C CA  . GLY B 1 250 ? 19.912 12.557 89.261  1.00 24.60 ? 251  GLY B CA  1 
ATOM   3963 C C   . GLY B 1 250 ? 19.550 13.934 89.782  1.00 25.60 ? 251  GLY B C   1 
ATOM   3964 O O   . GLY B 1 250 ? 18.406 14.382 89.669  1.00 25.82 ? 251  GLY B O   1 
ATOM   3965 N N   . ILE B 1 251 ? 20.538 14.620 90.354  1.00 24.58 ? 252  ILE B N   1 
ATOM   3966 C CA  . ILE B 1 251 ? 20.310 15.963 90.871  1.00 22.10 ? 252  ILE B CA  1 
ATOM   3967 C C   . ILE B 1 251 ? 20.036 16.901 89.684  1.00 22.02 ? 252  ILE B C   1 
ATOM   3968 O O   . ILE B 1 251 ? 19.108 17.714 89.717  1.00 21.41 ? 252  ILE B O   1 
ATOM   3969 C CB  . ILE B 1 251 ? 21.556 16.476 91.667  1.00 20.72 ? 252  ILE B CB  1 
ATOM   3970 C CG1 . ILE B 1 251 ? 21.700 15.660 92.965  1.00 21.67 ? 252  ILE B CG1 1 
ATOM   3971 C CG2 . ILE B 1 251 ? 21.403 17.993 91.972  1.00 19.41 ? 252  ILE B CG2 1 
ATOM   3972 C CD1 . ILE B 1 251 ? 22.953 15.999 93.805  1.00 19.51 ? 252  ILE B CD1 1 
ATOM   3973 N N   . GLY B 1 252 ? 20.850 16.766 88.639  1.00 22.86 ? 253  GLY B N   1 
ATOM   3974 C CA  . GLY B 1 252 ? 20.734 17.594 87.442  1.00 21.88 ? 253  GLY B CA  1 
ATOM   3975 C C   . GLY B 1 252 ? 19.395 17.599 86.716  1.00 22.87 ? 253  GLY B C   1 
ATOM   3976 O O   . GLY B 1 252 ? 19.044 18.586 86.060  1.00 22.63 ? 253  GLY B O   1 
ATOM   3977 N N   . GLY B 1 253 ? 18.662 16.491 86.809  1.00 23.38 ? 254  GLY B N   1 
ATOM   3978 C CA  . GLY B 1 253 ? 17.358 16.395 86.178  1.00 22.15 ? 254  GLY B CA  1 
ATOM   3979 C C   . GLY B 1 253 ? 16.391 17.390 86.793  1.00 21.20 ? 254  GLY B C   1 
ATOM   3980 O O   . GLY B 1 253 ? 15.575 17.987 86.090  1.00 21.74 ? 254  GLY B O   1 
ATOM   3981 N N   . LEU B 1 254 ? 16.458 17.555 88.109  1.00 20.19 ? 255  LEU B N   1 
ATOM   3982 C CA  . LEU B 1 254 ? 15.589 18.524 88.781  1.00 19.12 ? 255  LEU B CA  1 
ATOM   3983 C C   . LEU B 1 254 ? 16.137 19.930 88.487  1.00 20.40 ? 255  LEU B C   1 
ATOM   3984 O O   . LEU B 1 254 ? 15.372 20.863 88.248  1.00 18.72 ? 255  LEU B O   1 
ATOM   3985 C CB  . LEU B 1 254 ? 15.599 18.307 90.293  1.00 16.75 ? 255  LEU B CB  1 
ATOM   3986 C CG  . LEU B 1 254 ? 14.937 19.372 91.176  1.00 18.23 ? 255  LEU B CG  1 
ATOM   3987 C CD1 . LEU B 1 254 ? 13.494 19.595 90.745  1.00 20.44 ? 255  LEU B CD1 1 
ATOM   3988 C CD2 . LEU B 1 254 ? 14.983 18.896 92.619  1.00 19.32 ? 255  LEU B CD2 1 
ATOM   3989 N N   A LYS B 1 255 ? 17.461 20.078 88.545  0.60 19.40 ? 256  LYS B N   1 
ATOM   3990 N N   B LYS B 1 255 ? 17.459 20.068 88.535  0.40 19.93 ? 256  LYS B N   1 
ATOM   3991 C CA  A LYS B 1 255 ? 18.078 21.381 88.280  0.60 20.79 ? 256  LYS B CA  1 
ATOM   3992 C CA  B LYS B 1 255 ? 18.089 21.358 88.269  0.40 21.25 ? 256  LYS B CA  1 
ATOM   3993 C C   A LYS B 1 255 ? 17.583 21.975 86.967  0.60 19.68 ? 256  LYS B C   1 
ATOM   3994 C C   B LYS B 1 255 ? 17.564 21.965 86.975  0.40 20.44 ? 256  LYS B C   1 
ATOM   3995 O O   A LYS B 1 255 ? 17.351 23.179 86.883  0.60 18.99 ? 256  LYS B O   1 
ATOM   3996 O O   B LYS B 1 255 ? 17.298 23.164 86.914  0.40 20.08 ? 256  LYS B O   1 
ATOM   3997 C CB  A LYS B 1 255 ? 19.612 21.265 88.261  0.60 20.68 ? 256  LYS B CB  1 
ATOM   3998 C CB  B LYS B 1 255 ? 19.615 21.200 88.185  0.40 21.54 ? 256  LYS B CB  1 
ATOM   3999 C CG  A LYS B 1 255 ? 20.364 22.525 87.757  0.60 23.59 ? 256  LYS B CG  1 
ATOM   4000 C CG  B LYS B 1 255 ? 20.388 22.468 87.770  0.40 23.93 ? 256  LYS B CG  1 
ATOM   4001 C CD  A LYS B 1 255 ? 20.502 22.524 86.230  0.60 27.47 ? 256  LYS B CD  1 
ATOM   4002 C CD  B LYS B 1 255 ? 20.185 22.815 86.294  0.40 26.48 ? 256  LYS B CD  1 
ATOM   4003 C CE  A LYS B 1 255 ? 21.410 23.661 85.699  0.60 29.37 ? 256  LYS B CE  1 
ATOM   4004 C CE  B LYS B 1 255 ? 21.071 23.978 85.856  0.40 28.73 ? 256  LYS B CE  1 
ATOM   4005 N NZ  A LYS B 1 255 ? 20.748 25.006 85.630  0.60 24.80 ? 256  LYS B NZ  1 
ATOM   4006 N NZ  B LYS B 1 255 ? 22.514 23.633 86.028  0.40 27.71 ? 256  LYS B NZ  1 
ATOM   4007 N N   . LEU B 1 256 ? 17.413 21.141 85.941  1.00 21.82 ? 257  LEU B N   1 
ATOM   4008 C CA  . LEU B 1 256 ? 16.945 21.651 84.629  1.00 21.29 ? 257  LEU B CA  1 
ATOM   4009 C C   . LEU B 1 256 ? 15.492 22.134 84.703  1.00 22.00 ? 257  LEU B C   1 
ATOM   4010 O O   . LEU B 1 256 ? 15.162 23.241 84.256  1.00 19.02 ? 257  LEU B O   1 
ATOM   4011 C CB  . LEU B 1 256 ? 17.103 20.571 83.547  1.00 19.91 ? 257  LEU B CB  1 
ATOM   4012 C CG  . LEU B 1 256 ? 16.778 20.905 82.085  1.00 22.94 ? 257  LEU B CG  1 
ATOM   4013 C CD1 . LEU B 1 256 ? 17.656 22.094 81.584  1.00 19.11 ? 257  LEU B CD1 1 
ATOM   4014 C CD2 . LEU B 1 256 ? 17.062 19.676 81.222  1.00 20.03 ? 257  LEU B CD2 1 
ATOM   4015 N N   . LYS B 1 257 ? 14.611 21.310 85.274  1.00 20.68 ? 258  LYS B N   1 
ATOM   4016 C CA  . LYS B 1 257 ? 13.208 21.712 85.391  1.00 20.62 ? 258  LYS B CA  1 
ATOM   4017 C C   . LYS B 1 257 ? 13.072 22.956 86.276  1.00 18.98 ? 258  LYS B C   1 
ATOM   4018 O O   . LYS B 1 257 ? 12.245 23.834 86.018  1.00 20.01 ? 258  LYS B O   1 
ATOM   4019 C CB  . LYS B 1 257 ? 12.371 20.548 85.954  1.00 21.04 ? 258  LYS B CB  1 
ATOM   4020 C CG  . LYS B 1 257 ? 12.175 19.417 84.936  1.00 27.79 ? 258  LYS B CG  1 
ATOM   4021 C CD  . LYS B 1 257 ? 11.456 18.211 85.564  1.00 34.47 ? 258  LYS B CD  1 
ATOM   4022 C CE  . LYS B 1 257 ? 11.241 17.109 84.533  1.00 36.60 ? 258  LYS B CE  1 
ATOM   4023 N NZ  . LYS B 1 257 ? 10.599 15.907 85.157  1.00 38.26 ? 258  LYS B NZ  1 
ATOM   4024 N N   . LEU B 1 258 ? 13.881 23.024 87.325  1.00 17.43 ? 259  LEU B N   1 
ATOM   4025 C CA  . LEU B 1 258 ? 13.860 24.162 88.244  1.00 17.67 ? 259  LEU B CA  1 
ATOM   4026 C C   . LEU B 1 258 ? 14.263 25.459 87.515  1.00 19.38 ? 259  LEU B C   1 
ATOM   4027 O O   . LEU B 1 258 ? 13.594 26.496 87.621  1.00 18.19 ? 259  LEU B O   1 
ATOM   4028 C CB  . LEU B 1 258 ? 14.844 23.923 89.405  1.00 16.01 ? 259  LEU B CB  1 
ATOM   4029 C CG  . LEU B 1 258 ? 15.097 25.080 90.386  1.00 15.95 ? 259  LEU B CG  1 
ATOM   4030 C CD1 . LEU B 1 258 ? 13.780 25.483 91.050  1.00 17.39 ? 259  LEU B CD1 1 
ATOM   4031 C CD2 . LEU B 1 258 ? 16.134 24.683 91.447  1.00 18.76 ? 259  LEU B CD2 1 
ATOM   4032 N N   . HIS B 1 259 ? 15.379 25.391 86.794  1.00 18.13 ? 260  HIS B N   1 
ATOM   4033 C CA  . HIS B 1 259 ? 15.884 26.546 86.053  1.00 19.96 ? 260  HIS B CA  1 
ATOM   4034 C C   . HIS B 1 259 ? 14.791 27.018 85.073  1.00 18.74 ? 260  HIS B C   1 
ATOM   4035 O O   . HIS B 1 259 ? 14.487 28.220 85.004  1.00 17.75 ? 260  HIS B O   1 
ATOM   4036 C CB  . HIS B 1 259 ? 17.199 26.129 85.363  1.00 18.48 ? 260  HIS B CB  1 
ATOM   4037 C CG  . HIS B 1 259 ? 17.910 27.231 84.647  1.00 19.05 ? 260  HIS B CG  1 
ATOM   4038 N ND1 . HIS B 1 259 ? 19.179 27.060 84.129  1.00 17.89 ? 260  HIS B ND1 1 
ATOM   4039 C CD2 . HIS B 1 259 ? 17.514 28.477 84.277  1.00 17.38 ? 260  HIS B CD2 1 
ATOM   4040 C CE1 . HIS B 1 259 ? 19.529 28.147 83.462  1.00 18.69 ? 260  HIS B CE1 1 
ATOM   4041 N NE2 . HIS B 1 259 ? 18.539 29.020 83.535  1.00 17.58 ? 260  HIS B NE2 1 
ATOM   4042 N N   . ARG B 1 260 ? 14.144 26.093 84.364  1.00 17.24 ? 261  ARG B N   1 
ATOM   4043 C CA  . ARG B 1 260 ? 13.061 26.502 83.453  1.00 17.44 ? 261  ARG B CA  1 
ATOM   4044 C C   . ARG B 1 260 ? 11.924 27.194 84.225  1.00 19.19 ? 261  ARG B C   1 
ATOM   4045 O O   . ARG B 1 260 ? 11.408 28.219 83.797  1.00 16.20 ? 261  ARG B O   1 
ATOM   4046 C CB  . ARG B 1 260 ? 12.438 25.311 82.717  1.00 20.58 ? 261  ARG B CB  1 
ATOM   4047 C CG  . ARG B 1 260 ? 13.305 24.631 81.683  1.00 17.64 ? 261  ARG B CG  1 
ATOM   4048 C CD  . ARG B 1 260 ? 12.620 23.340 81.194  1.00 20.48 ? 261  ARG B CD  1 
ATOM   4049 N NE  . ARG B 1 260 ? 13.506 22.586 80.297  1.00 22.51 ? 261  ARG B NE  1 
ATOM   4050 C CZ  . ARG B 1 260 ? 13.477 21.265 80.177  1.00 29.08 ? 261  ARG B CZ  1 
ATOM   4051 N NH1 . ARG B 1 260 ? 12.601 20.563 80.899  1.00 29.57 ? 261  ARG B NH1 1 
ATOM   4052 N NH2 . ARG B 1 260 ? 14.334 20.643 79.366  1.00 27.34 ? 261  ARG B NH2 1 
ATOM   4053 N N   . ALA B 1 261 ? 11.533 26.625 85.360  1.00 20.50 ? 262  ALA B N   1 
ATOM   4054 C CA  . ALA B 1 261 ? 10.450 27.193 86.174  1.00 19.84 ? 262  ALA B CA  1 
ATOM   4055 C C   . ALA B 1 261 ? 10.773 28.580 86.754  1.00 19.76 ? 262  ALA B C   1 
ATOM   4056 O O   . ALA B 1 261 ? 9.880  29.444 86.868  1.00 20.06 ? 262  ALA B O   1 
ATOM   4057 C CB  . ALA B 1 261 ? 10.078 26.220 87.295  1.00 18.78 ? 262  ALA B CB  1 
ATOM   4058 N N   . CYS B 1 262 ? 12.019 28.795 87.152  1.00 17.91 ? 263  CYS B N   1 
ATOM   4059 C CA  . CYS B 1 262 ? 12.415 30.105 87.662  1.00 18.54 ? 263  CYS B CA  1 
ATOM   4060 C C   . CYS B 1 262 ? 12.225 31.172 86.587  1.00 20.01 ? 263  CYS B C   1 
ATOM   4061 O O   . CYS B 1 262 ? 11.716 32.250 86.864  1.00 19.95 ? 263  CYS B O   1 
ATOM   4062 C CB  . CYS B 1 262 ? 13.884 30.102 88.100  1.00 19.28 ? 263  CYS B CB  1 
ATOM   4063 S SG  . CYS B 1 262 ? 14.182 29.189 89.638  1.00 19.05 ? 263  CYS B SG  1 
ATOM   4064 N N   . ILE B 1 263 ? 12.656 30.884 85.363  1.00 20.58 ? 264  ILE B N   1 
ATOM   4065 C CA  . ILE B 1 263 ? 12.496 31.858 84.286  1.00 19.33 ? 264  ILE B CA  1 
ATOM   4066 C C   . ILE B 1 263 ? 11.022 32.229 84.150  1.00 20.70 ? 264  ILE B C   1 
ATOM   4067 O O   . ILE B 1 263 ? 10.673 33.409 84.043  1.00 22.20 ? 264  ILE B O   1 
ATOM   4068 C CB  . ILE B 1 263 ? 13.025 31.278 82.924  1.00 21.69 ? 264  ILE B CB  1 
ATOM   4069 C CG1 . ILE B 1 263 ? 14.548 31.034 83.015  1.00 18.77 ? 264  ILE B CG1 1 
ATOM   4070 C CG2 . ILE B 1 263 ? 12.653 32.224 81.753  1.00 21.09 ? 264  ILE B CG2 1 
ATOM   4071 C CD1 . ILE B 1 263 ? 15.408 32.303 83.226  1.00 20.24 ? 264  ILE B CD1 1 
ATOM   4072 N N   . ALA B 1 264 ? 10.135 31.237 84.165  1.00 21.49 ? 265  ALA B N   1 
ATOM   4073 C CA  . ALA B 1 264 ? 8.710  31.555 84.000  1.00 18.96 ? 265  ALA B CA  1 
ATOM   4074 C C   . ALA B 1 264 ? 8.207  32.501 85.096  1.00 19.84 ? 265  ALA B C   1 
ATOM   4075 O O   . ALA B 1 264 ? 7.408  33.413 84.818  1.00 19.80 ? 265  ALA B O   1 
ATOM   4076 C CB  . ALA B 1 264 ? 7.854  30.263 83.962  1.00 18.64 ? 265  ALA B CB  1 
ATOM   4077 N N   . LYS B 1 265 ? 8.687  32.310 86.328  1.00 19.47 ? 266  LYS B N   1 
ATOM   4078 C CA  . LYS B 1 265 ? 8.280  33.163 87.465  1.00 19.46 ? 266  LYS B CA  1 
ATOM   4079 C C   . LYS B 1 265 ? 8.715  34.607 87.266  1.00 18.67 ? 266  LYS B C   1 
ATOM   4080 O O   . LYS B 1 265 ? 8.079  35.534 87.775  1.00 17.66 ? 266  LYS B O   1 
ATOM   4081 C CB  . LYS B 1 265 ? 8.927  32.697 88.774  1.00 21.58 ? 266  LYS B CB  1 
ATOM   4082 C CG  . LYS B 1 265 ? 8.496  31.336 89.310  1.00 25.58 ? 266  LYS B CG  1 
ATOM   4083 C CD  . LYS B 1 265 ? 7.093  31.352 89.905  1.00 31.34 ? 266  LYS B CD  1 
ATOM   4084 C CE  . LYS B 1 265 ? 6.863  30.083 90.746  1.00 31.14 ? 266  LYS B CE  1 
ATOM   4085 N NZ  . LYS B 1 265 ? 5.413  29.850 91.049  1.00 38.30 ? 266  LYS B NZ  1 
ATOM   4086 N N   . LEU B 1 266 ? 9.823  34.801 86.562  1.00 18.47 ? 267  LEU B N   1 
ATOM   4087 C CA  . LEU B 1 266 ? 10.331 36.160 86.344  1.00 18.72 ? 267  LEU B CA  1 
ATOM   4088 C C   . LEU B 1 266 ? 9.301  37.045 85.646  1.00 18.38 ? 267  LEU B C   1 
ATOM   4089 O O   . LEU B 1 266 ? 9.295  38.250 85.822  1.00 18.48 ? 267  LEU B O   1 
ATOM   4090 C CB  . LEU B 1 266 ? 11.621 36.114 85.515  1.00 20.05 ? 267  LEU B CB  1 
ATOM   4091 C CG  . LEU B 1 266 ? 12.823 35.385 86.129  1.00 17.00 ? 267  LEU B CG  1 
ATOM   4092 C CD1 . LEU B 1 266 ? 14.044 35.465 85.140  1.00 19.37 ? 267  LEU B CD1 1 
ATOM   4093 C CD2 . LEU B 1 266 ? 13.180 36.054 87.453  1.00 17.93 ? 267  LEU B CD2 1 
ATOM   4094 N N   . PHE B 1 267 ? 8.440  36.442 84.835  1.00 20.69 ? 268  PHE B N   1 
ATOM   4095 C CA  . PHE B 1 267 ? 7.424  37.210 84.118  1.00 21.34 ? 268  PHE B CA  1 
ATOM   4096 C C   . PHE B 1 267 ? 6.052  37.294 84.807  1.00 22.88 ? 268  PHE B C   1 
ATOM   4097 O O   . PHE B 1 267 ? 5.083  37.778 84.197  1.00 24.24 ? 268  PHE B O   1 
ATOM   4098 C CB  . PHE B 1 267 ? 7.258  36.658 82.706  1.00 21.33 ? 268  PHE B CB  1 
ATOM   4099 C CG  . PHE B 1 267 ? 8.532  36.721 81.887  1.00 21.51 ? 268  PHE B CG  1 
ATOM   4100 C CD1 . PHE B 1 267 ? 9.201  35.554 81.514  1.00 19.80 ? 268  PHE B CD1 1 
ATOM   4101 C CD2 . PHE B 1 267 ? 9.061  37.961 81.497  1.00 18.11 ? 268  PHE B CD2 1 
ATOM   4102 C CE1 . PHE B 1 267 ? 10.374 35.609 80.758  1.00 21.07 ? 268  PHE B CE1 1 
ATOM   4103 C CE2 . PHE B 1 267 ? 10.232 38.029 80.733  1.00 17.34 ? 268  PHE B CE2 1 
ATOM   4104 C CZ  . PHE B 1 267 ? 10.890 36.856 80.360  1.00 19.30 ? 268  PHE B CZ  1 
ATOM   4105 N N   . GLU B 1 268 ? 5.965  36.837 86.057  1.00 22.65 ? 269  GLU B N   1 
ATOM   4106 C CA  . GLU B 1 268 ? 4.687  36.888 86.793  1.00 25.06 ? 269  GLU B CA  1 
ATOM   4107 C C   . GLU B 1 268 ? 4.559  38.115 87.699  1.00 26.01 ? 269  GLU B C   1 
ATOM   4108 O O   . GLU B 1 268 ? 3.503  38.349 88.299  1.00 25.27 ? 269  GLU B O   1 
ATOM   4109 C CB  . GLU B 1 268 ? 4.492  35.599 87.610  1.00 26.23 ? 269  GLU B CB  1 
ATOM   4110 C CG  . GLU B 1 268 ? 4.221  34.387 86.729  1.00 28.66 ? 269  GLU B CG  1 
ATOM   4111 C CD  . GLU B 1 268 ? 4.178  33.067 87.502  1.00 34.38 ? 269  GLU B CD  1 
ATOM   4112 O OE1 . GLU B 1 268 ? 4.190  33.080 88.751  1.00 34.28 ? 269  GLU B OE1 1 
ATOM   4113 O OE2 . GLU B 1 268 ? 4.132  32.003 86.844  1.00 38.89 ? 269  GLU B OE2 1 
ATOM   4114 N N   . SER B 1 269 ? 5.644  38.883 87.802  1.00 23.65 ? 270  SER B N   1 
ATOM   4115 C CA  . SER B 1 269 ? 5.683  40.106 88.585  1.00 26.14 ? 270  SER B CA  1 
ATOM   4116 C C   . SER B 1 269 ? 6.919  40.885 88.138  1.00 26.41 ? 270  SER B C   1 
ATOM   4117 O O   . SER B 1 269 ? 7.750  40.361 87.385  1.00 23.17 ? 270  SER B O   1 
ATOM   4118 C CB  . SER B 1 269 ? 5.786  39.813 90.079  1.00 30.22 ? 270  SER B CB  1 
ATOM   4119 O OG  . SER B 1 269 ? 7.079  39.361 90.405  1.00 32.95 ? 270  SER B OG  1 
ATOM   4120 N N   . SER B 1 270 ? 7.045  42.130 88.587  1.00 23.82 ? 271  SER B N   1 
ATOM   4121 C CA  . SER B 1 270 ? 8.195  42.935 88.208  1.00 26.26 ? 271  SER B CA  1 
ATOM   4122 C C   . SER B 1 270 ? 9.086  43.213 89.407  1.00 25.47 ? 271  SER B C   1 
ATOM   4123 O O   . SER B 1 270 ? 9.923  44.108 89.363  1.00 26.08 ? 271  SER B O   1 
ATOM   4124 C CB  . SER B 1 270 ? 7.732  44.251 87.552  1.00 29.17 ? 271  SER B CB  1 
ATOM   4125 O OG  . SER B 1 270 ? 6.863  44.968 88.404  1.00 31.13 ? 271  SER B OG  1 
ATOM   4126 N N   . GLU B 1 271 ? 8.924  42.420 90.471  1.00 26.72 ? 272  GLU B N   1 
ATOM   4127 C CA  . GLU B 1 271 ? 9.721  42.598 91.684  1.00 26.02 ? 272  GLU B CA  1 
ATOM   4128 C C   . GLU B 1 271 ? 10.439 41.338 92.164  1.00 24.33 ? 272  GLU B C   1 
ATOM   4129 O O   . GLU B 1 271 ? 11.004 41.328 93.249  1.00 24.05 ? 272  GLU B O   1 
ATOM   4130 C CB  . GLU B 1 271 ? 8.834  43.103 92.838  1.00 33.02 ? 272  GLU B CB  1 
ATOM   4131 C CG  . GLU B 1 271 ? 7.732  44.072 92.431  1.00 37.12 ? 272  GLU B CG  1 
ATOM   4132 C CD  . GLU B 1 271 ? 6.887  44.486 93.620  1.00 41.85 ? 272  GLU B CD  1 
ATOM   4133 O OE1 . GLU B 1 271 ? 7.378  45.272 94.455  1.00 47.00 ? 272  GLU B OE1 1 
ATOM   4134 O OE2 . GLU B 1 271 ? 5.739  44.015 93.731  1.00 41.58 ? 272  GLU B OE2 1 
ATOM   4135 N N   . GLY B 1 272 ? 10.428 40.274 91.376  1.00 22.52 ? 273  GLY B N   1 
ATOM   4136 C CA  . GLY B 1 272 ? 11.095 39.060 91.814  1.00 21.91 ? 273  GLY B CA  1 
ATOM   4137 C C   . GLY B 1 272 ? 12.607 39.137 91.871  1.00 21.18 ? 273  GLY B C   1 
ATOM   4138 O O   . GLY B 1 272 ? 13.219 39.807 91.038  1.00 21.49 ? 273  GLY B O   1 
ATOM   4139 N N   . VAL B 1 273 ? 13.217 38.488 92.870  1.00 21.23 ? 274  VAL B N   1 
ATOM   4140 C CA  . VAL B 1 273 ? 14.682 38.453 92.991  1.00 20.22 ? 274  VAL B CA  1 
ATOM   4141 C C   . VAL B 1 273 ? 15.069 36.994 93.231  1.00 21.77 ? 274  VAL B C   1 
ATOM   4142 O O   . VAL B 1 273 ? 14.963 36.482 94.344  1.00 22.60 ? 274  VAL B O   1 
ATOM   4143 C CB  . VAL B 1 273 ? 15.192 39.335 94.143  1.00 19.36 ? 274  VAL B CB  1 
ATOM   4144 C CG1 . VAL B 1 273 ? 16.719 39.253 94.236  1.00 20.13 ? 274  VAL B CG1 1 
ATOM   4145 C CG2 . VAL B 1 273 ? 14.753 40.772 93.911  1.00 21.07 ? 274  VAL B CG2 1 
ATOM   4146 N N   . PHE B 1 274 ? 15.533 36.316 92.181  1.00 21.37 ? 275  PHE B N   1 
ATOM   4147 C CA  . PHE B 1 274 ? 15.860 34.911 92.314  1.00 18.60 ? 275  PHE B CA  1 
ATOM   4148 C C   . PHE B 1 274 ? 17.333 34.562 92.519  1.00 19.48 ? 275  PHE B C   1 
ATOM   4149 O O   . PHE B 1 274 ? 18.098 34.397 91.563  1.00 17.60 ? 275  PHE B O   1 
ATOM   4150 C CB  . PHE B 1 274 ? 15.275 34.138 91.118  1.00 22.00 ? 275  PHE B CB  1 
ATOM   4151 C CG  . PHE B 1 274 ? 13.776 33.905 91.219  1.00 21.19 ? 275  PHE B CG  1 
ATOM   4152 C CD1 . PHE B 1 274 ? 12.879 34.951 91.049  1.00 21.99 ? 275  PHE B CD1 1 
ATOM   4153 C CD2 . PHE B 1 274 ? 13.269 32.638 91.538  1.00 24.77 ? 275  PHE B CD2 1 
ATOM   4154 C CE1 . PHE B 1 274 ? 11.484 34.752 91.197  1.00 21.50 ? 275  PHE B CE1 1 
ATOM   4155 C CE2 . PHE B 1 274 ? 11.880 32.420 91.698  1.00 25.15 ? 275  PHE B CE2 1 
ATOM   4156 C CZ  . PHE B 1 274 ? 10.988 33.482 91.529  1.00 25.58 ? 275  PHE B CZ  1 
ATOM   4157 N N   . ASP B 1 275 ? 17.727 34.480 93.785  1.00 19.43 ? 276  ASP B N   1 
ATOM   4158 C CA  . ASP B 1 275 ? 19.097 34.117 94.173  1.00 21.03 ? 276  ASP B CA  1 
ATOM   4159 C C   . ASP B 1 275 ? 18.885 32.782 94.931  1.00 19.70 ? 276  ASP B C   1 
ATOM   4160 O O   . ASP B 1 275 ? 17.795 32.199 94.879  1.00 18.93 ? 276  ASP B O   1 
ATOM   4161 C CB  . ASP B 1 275 ? 19.710 35.212 95.092  1.00 19.62 ? 276  ASP B CB  1 
ATOM   4162 C CG  . ASP B 1 275 ? 21.243 35.153 95.181  1.00 22.08 ? 276  ASP B CG  1 
ATOM   4163 O OD1 . ASP B 1 275 ? 21.871 34.121 94.837  1.00 20.44 ? 276  ASP B OD1 1 
ATOM   4164 O OD2 . ASP B 1 275 ? 21.842 36.158 95.634  1.00 22.42 ? 276  ASP B OD2 1 
ATOM   4165 N N   . ALA B 1 276 ? 19.901 32.309 95.639  1.00 19.48 ? 277  ALA B N   1 
ATOM   4166 C CA  . ALA B 1 276 ? 19.798 31.025 96.328  1.00 19.76 ? 277  ALA B CA  1 
ATOM   4167 C C   . ALA B 1 276 ? 18.535 30.784 97.158  1.00 22.12 ? 277  ALA B C   1 
ATOM   4168 O O   . ALA B 1 276 ? 17.896 29.732 97.016  1.00 22.35 ? 277  ALA B O   1 
ATOM   4169 C CB  . ALA B 1 276 ? 21.049 30.796 97.182  1.00 19.92 ? 277  ALA B CB  1 
ATOM   4170 N N   . GLU B 1 277 ? 18.145 31.734 98.008  1.00 20.42 ? 278  GLU B N   1 
ATOM   4171 C CA  . GLU B 1 277 ? 16.954 31.513 98.842  1.00 19.99 ? 278  GLU B CA  1 
ATOM   4172 C C   . GLU B 1 277 ? 15.643 31.275 98.078  1.00 21.56 ? 278  GLU B C   1 
ATOM   4173 O O   . GLU B 1 277 ? 14.916 30.308 98.359  1.00 20.85 ? 278  GLU B O   1 
ATOM   4174 C CB  . GLU B 1 277 ? 16.733 32.679 99.811  1.00 22.54 ? 278  GLU B CB  1 
ATOM   4175 C CG  . GLU B 1 277 ? 17.916 33.033 100.700 1.00 24.20 ? 278  GLU B CG  1 
ATOM   4176 C CD  . GLU B 1 277 ? 18.828 34.115 100.106 1.00 27.55 ? 278  GLU B CD  1 
ATOM   4177 O OE1 . GLU B 1 277 ? 19.423 34.885 100.900 1.00 25.97 ? 278  GLU B OE1 1 
ATOM   4178 O OE2 . GLU B 1 277 ? 18.972 34.182 98.859  1.00 24.81 ? 278  GLU B OE2 1 
ATOM   4179 N N   . GLU B 1 278 ? 15.316 32.158 97.137  1.00 19.68 ? 279  GLU B N   1 
ATOM   4180 C CA  . GLU B 1 278 ? 14.066 32.006 96.380  1.00 21.77 ? 279  GLU B CA  1 
ATOM   4181 C C   . GLU B 1 278 ? 14.083 30.837 95.418  1.00 19.77 ? 279  GLU B C   1 
ATOM   4182 O O   . GLU B 1 278 ? 13.061 30.185 95.214  1.00 21.47 ? 279  GLU B O   1 
ATOM   4183 C CB  . GLU B 1 278 ? 13.736 33.291 95.603  1.00 25.10 ? 279  GLU B CB  1 
ATOM   4184 C CG  . GLU B 1 278 ? 13.331 34.459 96.480  1.00 30.71 ? 279  GLU B CG  1 
ATOM   4185 C CD  . GLU B 1 278 ? 12.013 34.208 97.198  1.00 33.02 ? 279  GLU B CD  1 
ATOM   4186 O OE1 . GLU B 1 278 ? 11.970 34.441 98.425  1.00 38.98 ? 279  GLU B OE1 1 
ATOM   4187 O OE2 . GLU B 1 278 ? 11.033 33.779 96.545  1.00 33.95 ? 279  GLU B OE2 1 
ATOM   4188 N N   . ILE B 1 279 ? 15.234 30.587 94.797  1.00 18.95 ? 280  ILE B N   1 
ATOM   4189 C CA  . ILE B 1 279 ? 15.350 29.466 93.878  1.00 18.00 ? 280  ILE B CA  1 
ATOM   4190 C C   . ILE B 1 279 ? 15.148 28.187 94.703  1.00 18.82 ? 280  ILE B C   1 
ATOM   4191 O O   . ILE B 1 279 ? 14.507 27.249 94.240  1.00 18.30 ? 280  ILE B O   1 
ATOM   4192 C CB  . ILE B 1 279 ? 16.754 29.466 93.181  1.00 19.22 ? 280  ILE B CB  1 
ATOM   4193 C CG1 . ILE B 1 279 ? 16.797 30.587 92.147  1.00 17.68 ? 280  ILE B CG1 1 
ATOM   4194 C CG2 . ILE B 1 279 ? 17.038 28.104 92.528  1.00 16.27 ? 280  ILE B CG2 1 
ATOM   4195 C CD1 . ILE B 1 279 ? 18.214 30.842 91.535  1.00 19.86 ? 280  ILE B CD1 1 
ATOM   4196 N N   . TYR B 1 280 ? 15.667 28.157 95.932  1.00 19.53 ? 281  TYR B N   1 
ATOM   4197 C CA  . TYR B 1 280 ? 15.504 26.970 96.784  1.00 18.55 ? 281  TYR B CA  1 
ATOM   4198 C C   . TYR B 1 280 ? 14.035 26.767 97.212  1.00 20.18 ? 281  TYR B C   1 
ATOM   4199 O O   . TYR B 1 280 ? 13.540 25.630 97.263  1.00 19.97 ? 281  TYR B O   1 
ATOM   4200 C CB  . TYR B 1 280 ? 16.436 27.049 98.021  1.00 18.46 ? 281  TYR B CB  1 
ATOM   4201 C CG  . TYR B 1 280 ? 16.300 25.870 98.975  1.00 18.60 ? 281  TYR B CG  1 
ATOM   4202 C CD1 . TYR B 1 280 ? 16.593 24.559 98.558  1.00 19.49 ? 281  TYR B CD1 1 
ATOM   4203 C CD2 . TYR B 1 280 ? 15.833 26.051 100.288 1.00 21.48 ? 281  TYR B CD2 1 
ATOM   4204 C CE1 . TYR B 1 280 ? 16.421 23.457 99.417  1.00 17.84 ? 281  TYR B CE1 1 
ATOM   4205 C CE2 . TYR B 1 280 ? 15.652 24.943 101.158 1.00 21.06 ? 281  TYR B CE2 1 
ATOM   4206 C CZ  . TYR B 1 280 ? 15.945 23.661 100.720 1.00 22.10 ? 281  TYR B CZ  1 
ATOM   4207 O OH  . TYR B 1 280 ? 15.767 22.581 101.575 1.00 21.74 ? 281  TYR B OH  1 
ATOM   4208 N N   A LYS B 1 281 ? 13.337 27.860 97.502  0.60 20.83 ? 282  LYS B N   1 
ATOM   4209 N N   B LYS B 1 281 ? 13.330 27.857 97.507  0.40 20.35 ? 282  LYS B N   1 
ATOM   4210 C CA  A LYS B 1 281 ? 11.935 27.754 97.894  0.60 22.70 ? 282  LYS B CA  1 
ATOM   4211 C CA  B LYS B 1 281 ? 11.927 27.735 97.902  0.40 21.60 ? 282  LYS B CA  1 
ATOM   4212 C C   A LYS B 1 281 ? 11.143 27.062 96.793  0.60 21.84 ? 282  LYS B C   1 
ATOM   4213 C C   B LYS B 1 281 ? 11.127 27.067 96.790  0.40 21.14 ? 282  LYS B C   1 
ATOM   4214 O O   A LYS B 1 281 ? 10.305 26.196 97.069  0.60 20.97 ? 282  LYS B O   1 
ATOM   4215 O O   B LYS B 1 281 ? 10.264 26.225 97.056  0.40 20.50 ? 282  LYS B O   1 
ATOM   4216 C CB  A LYS B 1 281 ? 11.347 29.141 98.173  0.60 24.03 ? 282  LYS B CB  1 
ATOM   4217 C CB  B LYS B 1 281 ? 11.326 29.107 98.244  0.40 22.06 ? 282  LYS B CB  1 
ATOM   4218 C CG  A LYS B 1 281 ? 9.883  29.126 98.553  0.60 26.41 ? 282  LYS B CG  1 
ATOM   4219 C CG  B LYS B 1 281 ? 11.945 29.756 99.472  0.40 23.35 ? 282  LYS B CG  1 
ATOM   4220 C CD  A LYS B 1 281 ? 9.343  30.543 98.756  0.60 29.15 ? 282  LYS B CD  1 
ATOM   4221 C CD  B LYS B 1 281 ? 11.225 31.034 99.885  0.40 25.64 ? 282  LYS B CD  1 
ATOM   4222 C CE  A LYS B 1 281 ? 10.114 31.295 99.822  0.60 30.31 ? 282  LYS B CE  1 
ATOM   4223 C CE  B LYS B 1 281 ? 11.796 31.593 101.191 0.40 25.73 ? 282  LYS B CE  1 
ATOM   4224 N NZ  A LYS B 1 281 ? 9.546  32.652 100.061 0.60 35.30 ? 282  LYS B NZ  1 
ATOM   4225 N NZ  B LYS B 1 281 ? 10.957 32.709 101.722 0.40 29.09 ? 282  LYS B NZ  1 
ATOM   4226 N N   . LEU B 1 282 ? 11.413 27.431 95.540  1.00 20.52 ? 283  LEU B N   1 
ATOM   4227 C CA  . LEU B 1 282 ? 10.709 26.817 94.408  1.00 20.21 ? 283  LEU B CA  1 
ATOM   4228 C C   . LEU B 1 282 ? 11.149 25.362 94.230  1.00 20.45 ? 283  LEU B C   1 
ATOM   4229 O O   . LEU B 1 282 ? 10.323 24.504 93.885  1.00 22.49 ? 283  LEU B O   1 
ATOM   4230 C CB  . LEU B 1 282 ? 10.940 27.590 93.104  1.00 17.43 ? 283  LEU B CB  1 
ATOM   4231 C CG  . LEU B 1 282 ? 10.245 27.100 91.823  1.00 20.60 ? 283  LEU B CG  1 
ATOM   4232 C CD1 . LEU B 1 282 ? 8.709  26.999 92.019  1.00 19.64 ? 283  LEU B CD1 1 
ATOM   4233 C CD2 . LEU B 1 282 ? 10.551 28.082 90.673  1.00 19.18 ? 283  LEU B CD2 1 
ATOM   4234 N N   . ALA B 1 283 ? 12.441 25.089 94.445  1.00 20.46 ? 284  ALA B N   1 
ATOM   4235 C CA  . ALA B 1 283 ? 12.975 23.728 94.339  1.00 20.41 ? 284  ALA B CA  1 
ATOM   4236 C C   . ALA B 1 283 ? 12.222 22.785 95.274  1.00 21.81 ? 284  ALA B C   1 
ATOM   4237 O O   . ALA B 1 283 ? 11.946 21.622 94.931  1.00 21.52 ? 284  ALA B O   1 
ATOM   4238 C CB  . ALA B 1 283 ? 14.464 23.703 94.712  1.00 17.11 ? 284  ALA B CB  1 
ATOM   4239 N N   . LYS B 1 284 ? 11.926 23.262 96.481  1.00 21.47 ? 285  LYS B N   1 
ATOM   4240 C CA  . LYS B 1 284 ? 11.195 22.402 97.416  1.00 21.54 ? 285  LYS B CA  1 
ATOM   4241 C C   . LYS B 1 284 ? 9.801  22.079 96.908  1.00 23.94 ? 285  LYS B C   1 
ATOM   4242 O O   . LYS B 1 284 ? 9.310  20.958 97.125  1.00 23.71 ? 285  LYS B O   1 
ATOM   4243 C CB  . LYS B 1 284 ? 11.116 23.037 98.799  1.00 21.29 ? 285  LYS B CB  1 
ATOM   4244 C CG  . LYS B 1 284 ? 12.478 23.229 99.494  1.00 23.11 ? 285  LYS B CG  1 
ATOM   4245 C CD  . LYS B 1 284 ? 12.268 23.668 100.962 1.00 24.44 ? 285  LYS B CD  1 
ATOM   4246 C CE  . LYS B 1 284 ? 11.756 22.512 101.820 1.00 27.71 ? 285  LYS B CE  1 
ATOM   4247 N NZ  . LYS B 1 284 ? 11.653 22.902 103.253 1.00 28.39 ? 285  LYS B NZ  1 
ATOM   4248 N N   . GLU B 1 285 ? 9.157  23.035 96.232  1.00 23.92 ? 286  GLU B N   1 
ATOM   4249 C CA  . GLU B 1 285 ? 7.814  22.815 95.693  1.00 25.19 ? 286  GLU B CA  1 
ATOM   4250 C C   . GLU B 1 285 ? 7.801  21.729 94.623  1.00 26.81 ? 286  GLU B C   1 
ATOM   4251 O O   . GLU B 1 285 ? 6.862  20.936 94.532  1.00 27.56 ? 286  GLU B O   1 
ATOM   4252 C CB  . GLU B 1 285 ? 7.244  24.076 95.018  1.00 27.60 ? 286  GLU B CB  1 
ATOM   4253 C CG  . GLU B 1 285 ? 6.927  25.281 95.885  1.00 32.00 ? 286  GLU B CG  1 
ATOM   4254 C CD  . GLU B 1 285 ? 6.353  26.425 95.045  1.00 36.25 ? 286  GLU B CD  1 
ATOM   4255 O OE1 . GLU B 1 285 ? 5.455  26.181 94.196  1.00 36.53 ? 286  GLU B OE1 1 
ATOM   4256 O OE2 . GLU B 1 285 ? 6.792  27.571 95.231  1.00 40.56 ? 286  GLU B OE2 1 
ATOM   4257 N N   . MET B 1 286 ? 8.854  21.705 93.816  1.00 23.40 ? 287  MET B N   1 
ATOM   4258 C CA  . MET B 1 286 ? 8.966  20.791 92.684  1.00 23.49 ? 287  MET B CA  1 
ATOM   4259 C C   . MET B 1 286 ? 9.669  19.456 92.888  1.00 20.51 ? 287  MET B C   1 
ATOM   4260 O O   . MET B 1 286 ? 9.490  18.556 92.090  1.00 21.84 ? 287  MET B O   1 
ATOM   4261 C CB  . MET B 1 286 ? 9.693  21.510 91.539  1.00 23.31 ? 287  MET B CB  1 
ATOM   4262 C CG  . MET B 1 286 ? 9.072  22.828 91.097  1.00 22.82 ? 287  MET B CG  1 
ATOM   4263 S SD  . MET B 1 286 ? 10.195 23.663 89.944  1.00 24.48 ? 287  MET B SD  1 
ATOM   4264 C CE  . MET B 1 286 ? 9.957  22.649 88.496  1.00 23.77 ? 287  MET B CE  1 
ATOM   4265 N N   . ALA B 1 287 ? 10.488 19.341 93.926  1.00 21.70 ? 288  ALA B N   1 
ATOM   4266 C CA  . ALA B 1 287 ? 11.256 18.123 94.170  1.00 20.43 ? 288  ALA B CA  1 
ATOM   4267 C C   . ALA B 1 287 ? 10.461 16.815 94.240  1.00 24.70 ? 288  ALA B C   1 
ATOM   4268 O O   . ALA B 1 287 ? 10.949 15.814 93.671  1.00 25.74 ? 288  ALA B O   1 
ATOM   4269 C CB  . ALA B 1 287 ? 12.116 18.297 95.443  1.00 21.82 ? 288  ALA B CB  1 
ATOM   4270 O OXT . ALA B 1 287 ? 9.380  16.790 94.870  1.00 26.31 ? 288  ALA B OXT 1 
ATOM   4271 N N   . SER C 1 1   ? 5.490  36.389 55.952  1.00 35.01 ? 2    SER C N   1 
ATOM   4272 C CA  . SER C 1 1   ? 6.884  36.298 56.457  1.00 34.12 ? 2    SER C CA  1 
ATOM   4273 C C   . SER C 1 1   ? 6.990  37.033 57.789  1.00 32.89 ? 2    SER C C   1 
ATOM   4274 O O   . SER C 1 1   ? 6.184  37.918 58.083  1.00 32.30 ? 2    SER C O   1 
ATOM   4275 C CB  . SER C 1 1   ? 7.850  36.926 55.445  1.00 37.95 ? 2    SER C CB  1 
ATOM   4276 O OG  . SER C 1 1   ? 7.746  36.317 54.163  1.00 41.82 ? 2    SER C OG  1 
ATOM   4277 N N   . LYS C 1 2   ? 7.985  36.669 58.594  1.00 28.86 ? 3    LYS C N   1 
ATOM   4278 C CA  . LYS C 1 2   ? 8.193  37.316 59.886  1.00 25.20 ? 3    LYS C CA  1 
ATOM   4279 C C   . LYS C 1 2   ? 8.855  38.678 59.688  1.00 21.59 ? 3    LYS C C   1 
ATOM   4280 O O   . LYS C 1 2   ? 9.731  38.841 58.833  1.00 20.46 ? 3    LYS C O   1 
ATOM   4281 C CB  . LYS C 1 2   ? 9.086  36.458 60.784  1.00 25.83 ? 3    LYS C CB  1 
ATOM   4282 C CG  . LYS C 1 2   ? 8.413  35.218 61.343  1.00 30.62 ? 3    LYS C CG  1 
ATOM   4283 C CD  . LYS C 1 2   ? 9.432  34.466 62.170  1.00 37.81 ? 3    LYS C CD  1 
ATOM   4284 C CE  . LYS C 1 2   ? 8.804  33.474 63.137  1.00 38.26 ? 3    LYS C CE  1 
ATOM   4285 N NZ  . LYS C 1 2   ? 9.881  32.903 63.967  1.00 38.26 ? 3    LYS C NZ  1 
ATOM   4286 N N   A LYS C 1 3   ? 8.425  39.647 60.489  0.60 20.39 ? 4    LYS C N   1 
ATOM   4287 N N   B LYS C 1 3   ? 8.425  39.652 60.481  0.40 20.42 ? 4    LYS C N   1 
ATOM   4288 C CA  A LYS C 1 3   ? 8.953  41.006 60.437  0.60 19.74 ? 4    LYS C CA  1 
ATOM   4289 C CA  B LYS C 1 3   ? 8.959  41.005 60.406  0.40 19.41 ? 4    LYS C CA  1 
ATOM   4290 C C   A LYS C 1 3   ? 10.303 41.013 61.153  0.60 20.33 ? 4    LYS C C   1 
ATOM   4291 C C   B LYS C 1 3   ? 10.296 41.033 61.146  0.40 19.98 ? 4    LYS C C   1 
ATOM   4292 O O   A LYS C 1 3   ? 10.361 40.916 62.381  0.60 17.97 ? 4    LYS C O   1 
ATOM   4293 O O   B LYS C 1 3   ? 10.339 40.975 62.377  0.40 18.36 ? 4    LYS C O   1 
ATOM   4294 C CB  A LYS C 1 3   ? 7.981  41.974 61.138  0.60 21.24 ? 4    LYS C CB  1 
ATOM   4295 C CB  B LYS C 1 3   ? 7.961  41.982 61.042  0.40 20.06 ? 4    LYS C CB  1 
ATOM   4296 C CG  A LYS C 1 3   ? 6.670  42.220 60.374  0.60 22.12 ? 4    LYS C CG  1 
ATOM   4297 C CG  B LYS C 1 3   ? 6.598  41.986 60.340  0.40 19.14 ? 4    LYS C CG  1 
ATOM   4298 C CD  A LYS C 1 3   ? 5.695  43.134 61.143  0.60 20.66 ? 4    LYS C CD  1 
ATOM   4299 C CD  B LYS C 1 3   ? 5.580  42.900 61.024  0.40 17.96 ? 4    LYS C CD  1 
ATOM   4300 C CE  A LYS C 1 3   ? 4.906  42.360 62.181  0.60 24.28 ? 4    LYS C CE  1 
ATOM   4301 C CE  B LYS C 1 3   ? 4.312  43.029 60.182  0.40 18.36 ? 4    LYS C CE  1 
ATOM   4302 N NZ  A LYS C 1 3   ? 3.897  43.206 62.923  0.60 22.93 ? 4    LYS C NZ  1 
ATOM   4303 N NZ  B LYS C 1 3   ? 3.613  41.727 59.977  0.40 19.17 ? 4    LYS C NZ  1 
ATOM   4304 N N   . LEU C 1 4   ? 11.380 41.114 60.381  1.00 19.69 ? 5    LEU C N   1 
ATOM   4305 C CA  . LEU C 1 4   ? 12.739 41.118 60.939  1.00 19.68 ? 5    LEU C CA  1 
ATOM   4306 C C   . LEU C 1 4   ? 13.381 42.497 60.966  1.00 19.48 ? 5    LEU C C   1 
ATOM   4307 O O   . LEU C 1 4   ? 13.549 43.127 59.929  1.00 19.65 ? 5    LEU C O   1 
ATOM   4308 C CB  . LEU C 1 4   ? 13.651 40.203 60.105  1.00 19.16 ? 5    LEU C CB  1 
ATOM   4309 C CG  . LEU C 1 4   ? 13.119 38.818 59.757  1.00 19.84 ? 5    LEU C CG  1 
ATOM   4310 C CD1 . LEU C 1 4   ? 14.086 38.141 58.756  1.00 19.38 ? 5    LEU C CD1 1 
ATOM   4311 C CD2 . LEU C 1 4   ? 12.967 37.992 61.036  1.00 18.32 ? 5    LEU C CD2 1 
ATOM   4312 N N   . LEU C 1 5   ? 13.766 42.963 62.147  1.00 18.21 ? 6    LEU C N   1 
ATOM   4313 C CA  . LEU C 1 5   ? 14.424 44.266 62.233  1.00 17.69 ? 6    LEU C CA  1 
ATOM   4314 C C   . LEU C 1 5   ? 15.914 44.047 62.454  1.00 19.78 ? 6    LEU C C   1 
ATOM   4315 O O   . LEU C 1 5   ? 16.292 43.262 63.339  1.00 18.54 ? 6    LEU C O   1 
ATOM   4316 C CB  . LEU C 1 5   ? 13.847 45.097 63.408  1.00 17.78 ? 6    LEU C CB  1 
ATOM   4317 C CG  . LEU C 1 5   ? 14.470 46.489 63.627  1.00 17.04 ? 6    LEU C CG  1 
ATOM   4318 C CD1 . LEU C 1 5   ? 13.963 47.451 62.578  1.00 17.07 ? 6    LEU C CD1 1 
ATOM   4319 C CD2 . LEU C 1 5   ? 14.107 47.025 65.023  1.00 18.39 ? 6    LEU C CD2 1 
ATOM   4320 N N   . PHE C 1 6   ? 16.758 44.712 61.657  1.00 16.55 ? 7    PHE C N   1 
ATOM   4321 C CA  . PHE C 1 6   ? 18.204 44.606 61.856  1.00 18.05 ? 7    PHE C CA  1 
ATOM   4322 C C   . PHE C 1 6   ? 18.693 45.920 62.496  1.00 19.09 ? 7    PHE C C   1 
ATOM   4323 O O   . PHE C 1 6   ? 18.551 47.000 61.912  1.00 17.58 ? 7    PHE C O   1 
ATOM   4324 C CB  . PHE C 1 6   ? 18.928 44.280 60.528  1.00 16.64 ? 7    PHE C CB  1 
ATOM   4325 C CG  . PHE C 1 6   ? 18.725 42.846 60.077  1.00 18.61 ? 7    PHE C CG  1 
ATOM   4326 C CD1 . PHE C 1 6   ? 17.610 42.480 59.321  1.00 18.45 ? 7    PHE C CD1 1 
ATOM   4327 C CD2 . PHE C 1 6   ? 19.587 41.843 60.515  1.00 21.96 ? 7    PHE C CD2 1 
ATOM   4328 C CE1 . PHE C 1 6   ? 17.349 41.140 59.018  1.00 18.69 ? 7    PHE C CE1 1 
ATOM   4329 C CE2 . PHE C 1 6   ? 19.342 40.507 60.226  1.00 19.58 ? 7    PHE C CE2 1 
ATOM   4330 C CZ  . PHE C 1 6   ? 18.218 40.147 59.477  1.00 21.44 ? 7    PHE C CZ  1 
ATOM   4331 N N   . GLN C 1 7   ? 19.235 45.808 63.717  1.00 17.51 ? 8    GLN C N   1 
ATOM   4332 C CA  . GLN C 1 7   ? 19.718 46.937 64.501  1.00 16.90 ? 8    GLN C CA  1 
ATOM   4333 C C   . GLN C 1 7   ? 21.233 47.129 64.371  1.00 17.57 ? 8    GLN C C   1 
ATOM   4334 O O   . GLN C 1 7   ? 22.011 46.250 64.744  1.00 20.07 ? 8    GLN C O   1 
ATOM   4335 C CB  . GLN C 1 7   ? 19.303 46.714 65.987  1.00 17.45 ? 8    GLN C CB  1 
ATOM   4336 C CG  . GLN C 1 7   ? 19.882 47.690 67.033  1.00 15.21 ? 8    GLN C CG  1 
ATOM   4337 C CD  . GLN C 1 7   ? 19.589 47.252 68.467  1.00 18.76 ? 8    GLN C CD  1 
ATOM   4338 O OE1 . GLN C 1 7   ? 19.286 46.083 68.725  1.00 20.54 ? 8    GLN C OE1 1 
ATOM   4339 N NE2 . GLN C 1 7   ? 19.694 48.190 69.414  1.00 15.67 ? 8    GLN C NE2 1 
ATOM   4340 N N   . PHE C 1 8   ? 21.636 48.277 63.823  1.00 16.49 ? 9    PHE C N   1 
ATOM   4341 C CA  . PHE C 1 8   ? 23.042 48.620 63.617  1.00 16.10 ? 9    PHE C CA  1 
ATOM   4342 C C   . PHE C 1 8   ? 23.381 49.742 64.587  1.00 17.39 ? 9    PHE C C   1 
ATOM   4343 O O   . PHE C 1 8   ? 22.975 50.899 64.388  1.00 17.28 ? 9    PHE C O   1 
ATOM   4344 C CB  . PHE C 1 8   ? 23.270 49.091 62.173  1.00 16.81 ? 9    PHE C CB  1 
ATOM   4345 C CG  . PHE C 1 8   ? 22.916 48.059 61.117  1.00 18.86 ? 9    PHE C CG  1 
ATOM   4346 C CD1 . PHE C 1 8   ? 22.496 48.468 59.843  1.00 18.33 ? 9    PHE C CD1 1 
ATOM   4347 C CD2 . PHE C 1 8   ? 22.994 46.685 61.389  1.00 17.03 ? 9    PHE C CD2 1 
ATOM   4348 C CE1 . PHE C 1 8   ? 22.160 47.541 58.866  1.00 18.45 ? 9    PHE C CE1 1 
ATOM   4349 C CE2 . PHE C 1 8   ? 22.658 45.742 60.412  1.00 19.66 ? 9    PHE C CE2 1 
ATOM   4350 C CZ  . PHE C 1 8   ? 22.241 46.170 59.153  1.00 20.27 ? 9    PHE C CZ  1 
ATOM   4351 N N   . ASP C 1 9   ? 24.147 49.400 65.627  1.00 17.89 ? 10   ASP C N   1 
ATOM   4352 C CA  . ASP C 1 9   ? 24.527 50.345 66.669  1.00 17.95 ? 10   ASP C CA  1 
ATOM   4353 C C   . ASP C 1 9   ? 26.016 50.675 66.525  1.00 18.60 ? 10   ASP C C   1 
ATOM   4354 O O   . ASP C 1 9   ? 26.839 49.774 66.301  1.00 17.87 ? 10   ASP C O   1 
ATOM   4355 C CB  . ASP C 1 9   ? 24.223 49.701 68.039  1.00 17.66 ? 10   ASP C CB  1 
ATOM   4356 C CG  . ASP C 1 9   ? 24.215 50.702 69.186  1.00 18.89 ? 10   ASP C CG  1 
ATOM   4357 O OD1 . ASP C 1 9   ? 25.187 51.482 69.301  1.00 18.32 ? 10   ASP C OD1 1 
ATOM   4358 O OD2 . ASP C 1 9   ? 23.233 50.695 69.980  1.00 16.11 ? 10   ASP C OD2 1 
ATOM   4359 N N   . THR C 1 10  ? 26.365 51.957 66.635  1.00 17.77 ? 11   THR C N   1 
ATOM   4360 C CA  . THR C 1 10  ? 27.764 52.377 66.511  1.00 20.10 ? 11   THR C CA  1 
ATOM   4361 C C   . THR C 1 10  ? 28.607 52.113 67.763  1.00 21.23 ? 11   THR C C   1 
ATOM   4362 O O   . THR C 1 10  ? 29.849 52.221 67.731  1.00 21.44 ? 11   THR C O   1 
ATOM   4363 C CB  . THR C 1 10  ? 27.873 53.882 66.157  1.00 18.47 ? 11   THR C CB  1 
ATOM   4364 O OG1 . THR C 1 10  ? 27.036 54.653 67.024  1.00 18.54 ? 11   THR C OG1 1 
ATOM   4365 C CG2 . THR C 1 10  ? 27.424 54.125 64.724  1.00 20.51 ? 11   THR C CG2 1 
ATOM   4366 N N   . ASP C 1 11  ? 27.948 51.779 68.868  1.00 17.30 ? 12   ASP C N   1 
ATOM   4367 C CA  . ASP C 1 11  ? 28.672 51.504 70.101  1.00 16.57 ? 12   ASP C CA  1 
ATOM   4368 C C   . ASP C 1 11  ? 29.121 50.045 70.133  1.00 16.84 ? 12   ASP C C   1 
ATOM   4369 O O   . ASP C 1 11  ? 28.800 49.260 69.219  1.00 18.06 ? 12   ASP C O   1 
ATOM   4370 C CB  . ASP C 1 11  ? 27.806 51.808 71.341  1.00 16.61 ? 12   ASP C CB  1 
ATOM   4371 C CG  . ASP C 1 11  ? 27.458 53.291 71.473  1.00 20.22 ? 12   ASP C CG  1 
ATOM   4372 O OD1 . ASP C 1 11  ? 28.326 54.161 71.230  1.00 19.26 ? 12   ASP C OD1 1 
ATOM   4373 O OD2 . ASP C 1 11  ? 26.313 53.587 71.852  1.00 19.99 ? 12   ASP C OD2 1 
ATOM   4374 N N   . ALA C 1 12  ? 29.853 49.685 71.187  1.00 18.85 ? 13   ALA C N   1 
ATOM   4375 C CA  . ALA C 1 12  ? 30.390 48.326 71.357  1.00 21.46 ? 13   ALA C CA  1 
ATOM   4376 C C   . ALA C 1 12  ? 29.340 47.219 71.299  1.00 20.70 ? 13   ALA C C   1 
ATOM   4377 O O   . ALA C 1 12  ? 29.601 46.151 70.725  1.00 19.12 ? 13   ALA C O   1 
ATOM   4378 C CB  . ALA C 1 12  ? 31.168 48.229 72.689  1.00 22.28 ? 13   ALA C CB  1 
ATOM   4379 N N   . THR C 1 13  ? 28.187 47.454 71.937  1.00 18.61 ? 14   THR C N   1 
ATOM   4380 C CA  . THR C 1 13  ? 27.076 46.492 71.947  1.00 18.53 ? 14   THR C CA  1 
ATOM   4381 C C   . THR C 1 13  ? 25.784 47.281 71.673  1.00 18.48 ? 14   THR C C   1 
ATOM   4382 O O   . THR C 1 13  ? 25.735 48.494 71.932  1.00 16.74 ? 14   THR C O   1 
ATOM   4383 C CB  . THR C 1 13  ? 26.941 45.784 73.308  1.00 19.71 ? 14   THR C CB  1 
ATOM   4384 O OG1 . THR C 1 13  ? 26.680 46.765 74.331  1.00 19.37 ? 14   THR C OG1 1 
ATOM   4385 C CG2 . THR C 1 13  ? 28.257 45.018 73.649  1.00 20.22 ? 14   THR C CG2 1 
ATOM   4386 N N   . PRO C 1 14  ? 24.719 46.611 71.180  1.00 16.96 ? 15   PRO C N   1 
ATOM   4387 C CA  . PRO C 1 14  ? 23.451 47.307 70.879  1.00 15.60 ? 15   PRO C CA  1 
ATOM   4388 C C   . PRO C 1 14  ? 22.663 47.799 72.085  1.00 14.91 ? 15   PRO C C   1 
ATOM   4389 O O   . PRO C 1 14  ? 22.589 47.118 73.098  1.00 16.37 ? 15   PRO C O   1 
ATOM   4390 C CB  . PRO C 1 14  ? 22.627 46.269 70.090  1.00 14.13 ? 15   PRO C CB  1 
ATOM   4391 C CG  . PRO C 1 14  ? 23.650 45.276 69.605  1.00 15.57 ? 15   PRO C CG  1 
ATOM   4392 C CD  . PRO C 1 14  ? 24.652 45.202 70.762  1.00 16.57 ? 15   PRO C CD  1 
ATOM   4393 N N   . SER C 1 15  ? 22.050 48.973 71.939  1.00 13.61 ? 16   SER C N   1 
ATOM   4394 C CA  . SER C 1 15  ? 21.233 49.581 72.996  1.00 13.72 ? 16   SER C CA  1 
ATOM   4395 C C   . SER C 1 15  ? 20.079 48.681 73.444  1.00 15.76 ? 16   SER C C   1 
ATOM   4396 O O   . SER C 1 15  ? 19.296 48.230 72.607  1.00 16.47 ? 16   SER C O   1 
ATOM   4397 C CB  . SER C 1 15  ? 20.623 50.896 72.486  1.00 15.41 ? 16   SER C CB  1 
ATOM   4398 O OG  . SER C 1 15  ? 19.584 51.357 73.362  1.00 12.53 ? 16   SER C OG  1 
ATOM   4399 N N   . VAL C 1 16  ? 19.954 48.440 74.750  1.00 15.05 ? 17   VAL C N   1 
ATOM   4400 C CA  . VAL C 1 16  ? 18.837 47.623 75.275  1.00 13.86 ? 17   VAL C CA  1 
ATOM   4401 C C   . VAL C 1 16  ? 17.526 48.397 75.078  1.00 16.42 ? 17   VAL C C   1 
ATOM   4402 O O   . VAL C 1 16  ? 16.478 47.836 74.774  1.00 14.80 ? 17   VAL C O   1 
ATOM   4403 C CB  . VAL C 1 16  ? 19.009 47.364 76.800  1.00 15.38 ? 17   VAL C CB  1 
ATOM   4404 C CG1 . VAL C 1 16  ? 17.690 46.799 77.420  1.00 17.44 ? 17   VAL C CG1 1 
ATOM   4405 C CG2 . VAL C 1 16  ? 20.167 46.379 77.030  1.00 14.02 ? 17   VAL C CG2 1 
ATOM   4406 N N   . PHE C 1 17  ? 17.581 49.705 75.283  1.00 16.01 ? 18   PHE C N   1 
ATOM   4407 C CA  . PHE C 1 17  ? 16.388 50.542 75.132  1.00 17.47 ? 18   PHE C CA  1 
ATOM   4408 C C   . PHE C 1 17  ? 15.771 50.379 73.733  1.00 16.84 ? 18   PHE C C   1 
ATOM   4409 O O   . PHE C 1 17  ? 14.569 50.214 73.596  1.00 16.04 ? 18   PHE C O   1 
ATOM   4410 C CB  . PHE C 1 17  ? 16.765 52.018 75.352  1.00 18.62 ? 18   PHE C CB  1 
ATOM   4411 C CG  . PHE C 1 17  ? 15.591 52.957 75.352  1.00 22.89 ? 18   PHE C CG  1 
ATOM   4412 C CD1 . PHE C 1 17  ? 15.172 53.555 76.528  1.00 22.62 ? 18   PHE C CD1 1 
ATOM   4413 C CD2 . PHE C 1 17  ? 14.919 53.261 74.163  1.00 22.56 ? 18   PHE C CD2 1 
ATOM   4414 C CE1 . PHE C 1 17  ? 14.099 54.446 76.526  1.00 24.06 ? 18   PHE C CE1 1 
ATOM   4415 C CE2 . PHE C 1 17  ? 13.862 54.139 74.156  1.00 24.13 ? 18   PHE C CE2 1 
ATOM   4416 C CZ  . PHE C 1 17  ? 13.446 54.739 75.352  1.00 22.22 ? 18   PHE C CZ  1 
ATOM   4417 N N   . ASP C 1 18  ? 16.612 50.407 72.700  1.00 16.37 ? 19   ASP C N   1 
ATOM   4418 C CA  . ASP C 1 18  ? 16.132 50.315 71.319  1.00 14.99 ? 19   ASP C CA  1 
ATOM   4419 C C   . ASP C 1 18  ? 15.552 48.929 70.979  1.00 16.49 ? 19   ASP C C   1 
ATOM   4420 O O   . ASP C 1 18  ? 14.711 48.802 70.086  1.00 16.59 ? 19   ASP C O   1 
ATOM   4421 C CB  . ASP C 1 18  ? 17.266 50.669 70.334  1.00 16.05 ? 19   ASP C CB  1 
ATOM   4422 C CG  . ASP C 1 18  ? 17.677 52.151 70.389  1.00 17.66 ? 19   ASP C CG  1 
ATOM   4423 O OD1 . ASP C 1 18  ? 16.858 53.009 70.836  1.00 18.83 ? 19   ASP C OD1 1 
ATOM   4424 O OD2 . ASP C 1 18  ? 18.805 52.469 69.960  1.00 14.37 ? 19   ASP C OD2 1 
ATOM   4425 N N   . VAL C 1 19  ? 16.052 47.897 71.653  1.00 15.24 ? 20   VAL C N   1 
ATOM   4426 C CA  . VAL C 1 19  ? 15.555 46.542 71.456  1.00 15.57 ? 20   VAL C CA  1 
ATOM   4427 C C   . VAL C 1 19  ? 14.123 46.425 72.010  1.00 14.03 ? 20   VAL C C   1 
ATOM   4428 O O   . VAL C 1 19  ? 13.216 45.920 71.329  1.00 16.29 ? 20   VAL C O   1 
ATOM   4429 C CB  . VAL C 1 19  ? 16.456 45.478 72.190  1.00 15.55 ? 20   VAL C CB  1 
ATOM   4430 C CG1 . VAL C 1 19  ? 15.802 44.079 72.097  1.00 16.77 ? 20   VAL C CG1 1 
ATOM   4431 C CG2 . VAL C 1 19  ? 17.884 45.444 71.588  1.00 13.88 ? 20   VAL C CG2 1 
ATOM   4432 N N   . VAL C 1 20  ? 13.908 46.881 73.244  1.00 13.70 ? 21   VAL C N   1 
ATOM   4433 C CA  . VAL C 1 20  ? 12.560 46.766 73.834  1.00 14.70 ? 21   VAL C CA  1 
ATOM   4434 C C   . VAL C 1 20  ? 11.533 47.534 73.002  1.00 16.93 ? 21   VAL C C   1 
ATOM   4435 O O   . VAL C 1 20  ? 10.462 47.017 72.664  1.00 15.62 ? 21   VAL C O   1 
ATOM   4436 C CB  . VAL C 1 20  ? 12.491 47.299 75.275  1.00 17.01 ? 21   VAL C CB  1 
ATOM   4437 C CG1 . VAL C 1 20  ? 11.024 47.212 75.804  1.00 17.60 ? 21   VAL C CG1 1 
ATOM   4438 C CG2 . VAL C 1 20  ? 13.397 46.469 76.207  1.00 18.76 ? 21   VAL C CG2 1 
ATOM   4439 N N   . VAL C 1 21  ? 11.853 48.779 72.671  1.00 15.65 ? 22   VAL C N   1 
ATOM   4440 C CA  . VAL C 1 21  ? 10.914 49.579 71.894  1.00 15.79 ? 22   VAL C CA  1 
ATOM   4441 C C   . VAL C 1 21  ? 10.640 48.961 70.514  1.00 15.31 ? 22   VAL C C   1 
ATOM   4442 O O   . VAL C 1 21  ? 9.509  49.026 70.011  1.00 15.67 ? 22   VAL C O   1 
ATOM   4443 C CB  . VAL C 1 21  ? 11.426 51.029 71.778  1.00 18.43 ? 22   VAL C CB  1 
ATOM   4444 C CG1 . VAL C 1 21  ? 10.469 51.861 70.919  1.00 21.45 ? 22   VAL C CG1 1 
ATOM   4445 C CG2 . VAL C 1 21  ? 11.500 51.656 73.201  1.00 18.83 ? 22   VAL C CG2 1 
ATOM   4446 N N   . GLY C 1 22  ? 11.666 48.347 69.917  1.00 18.56 ? 23   GLY C N   1 
ATOM   4447 C CA  . GLY C 1 22  ? 11.525 47.694 68.619  1.00 15.51 ? 23   GLY C CA  1 
ATOM   4448 C C   . GLY C 1 22  ? 10.539 46.531 68.676  1.00 20.31 ? 23   GLY C C   1 
ATOM   4449 O O   . GLY C 1 22  ? 9.742  46.326 67.740  1.00 17.66 ? 23   GLY C O   1 
ATOM   4450 N N   . TYR C 1 23  ? 10.571 45.749 69.760  1.00 17.51 ? 24   TYR C N   1 
ATOM   4451 C CA  . TYR C 1 23  ? 9.604  44.650 69.884  1.00 17.03 ? 24   TYR C CA  1 
ATOM   4452 C C   . TYR C 1 23  ? 8.196  45.204 70.167  1.00 17.48 ? 24   TYR C C   1 
ATOM   4453 O O   . TYR C 1 23  ? 7.206  44.690 69.640  1.00 16.72 ? 24   TYR C O   1 
ATOM   4454 C CB  . TYR C 1 23  ? 10.012 43.678 70.999  1.00 16.05 ? 24   TYR C CB  1 
ATOM   4455 C CG  . TYR C 1 23  ? 11.111 42.701 70.576  1.00 19.61 ? 24   TYR C CG  1 
ATOM   4456 C CD1 . TYR C 1 23  ? 12.323 42.619 71.273  1.00 18.52 ? 24   TYR C CD1 1 
ATOM   4457 C CD2 . TYR C 1 23  ? 10.925 41.852 69.483  1.00 19.08 ? 24   TYR C CD2 1 
ATOM   4458 C CE1 . TYR C 1 23  ? 13.334 41.700 70.869  1.00 18.48 ? 24   TYR C CE1 1 
ATOM   4459 C CE2 . TYR C 1 23  ? 11.916 40.939 69.083  1.00 16.81 ? 24   TYR C CE2 1 
ATOM   4460 C CZ  . TYR C 1 23  ? 13.101 40.872 69.765  1.00 21.14 ? 24   TYR C CZ  1 
ATOM   4461 O OH  . TYR C 1 23  ? 14.056 39.988 69.321  1.00 18.20 ? 24   TYR C OH  1 
ATOM   4462 N N   . ASP C 1 24  ? 8.099  46.245 70.995  1.00 18.43 ? 25   ASP C N   1 
ATOM   4463 C CA  . ASP C 1 24  ? 6.794  46.829 71.300  1.00 18.95 ? 25   ASP C CA  1 
ATOM   4464 C C   . ASP C 1 24  ? 6.216  47.572 70.079  1.00 21.64 ? 25   ASP C C   1 
ATOM   4465 O O   . ASP C 1 24  ? 5.031  47.878 70.015  1.00 23.36 ? 25   ASP C O   1 
ATOM   4466 C CB  . ASP C 1 24  ? 6.885  47.756 72.529  1.00 18.32 ? 25   ASP C CB  1 
ATOM   4467 C CG  . ASP C 1 24  ? 6.860  46.980 73.851  1.00 19.40 ? 25   ASP C CG  1 
ATOM   4468 O OD1 . ASP C 1 24  ? 6.333  45.839 73.862  1.00 18.71 ? 25   ASP C OD1 1 
ATOM   4469 O OD2 . ASP C 1 24  ? 7.353  47.494 74.879  1.00 18.13 ? 25   ASP C OD2 1 
ATOM   4470 N N   . GLY C 1 25  ? 7.066  47.840 69.102  1.00 19.94 ? 26   GLY C N   1 
ATOM   4471 C CA  . GLY C 1 25  ? 6.622  48.501 67.886  1.00 22.21 ? 26   GLY C CA  1 
ATOM   4472 C C   . GLY C 1 25  ? 6.151  47.470 66.868  1.00 22.82 ? 26   GLY C C   1 
ATOM   4473 O O   . GLY C 1 25  ? 5.719  47.826 65.775  1.00 26.15 ? 26   GLY C O   1 
ATOM   4474 N N   . GLY C 1 26  ? 6.240  46.188 67.211  1.00 21.05 ? 27   GLY C N   1 
ATOM   4475 C CA  . GLY C 1 26  ? 5.775  45.165 66.286  1.00 21.89 ? 27   GLY C CA  1 
ATOM   4476 C C   . GLY C 1 26  ? 6.787  44.269 65.561  1.00 22.67 ? 27   GLY C C   1 
ATOM   4477 O O   . GLY C 1 26  ? 6.384  43.447 64.726  1.00 24.31 ? 27   GLY C O   1 
ATOM   4478 N N   . ALA C 1 27  ? 8.084  44.417 65.822  1.00 19.31 ? 28   ALA C N   1 
ATOM   4479 C CA  . ALA C 1 27  ? 9.059  43.528 65.157  1.00 20.05 ? 28   ALA C CA  1 
ATOM   4480 C C   . ALA C 1 27  ? 8.828  42.112 65.687  1.00 19.45 ? 28   ALA C C   1 
ATOM   4481 O O   . ALA C 1 27  ? 8.509  41.955 66.871  1.00 17.81 ? 28   ALA C O   1 
ATOM   4482 C CB  . ALA C 1 27  ? 10.530 43.978 65.479  1.00 18.17 ? 28   ALA C CB  1 
ATOM   4483 N N   . ASP C 1 28  ? 8.974  41.092 64.833  1.00 19.47 ? 29   ASP C N   1 
ATOM   4484 C CA  . ASP C 1 28  ? 8.819  39.697 65.265  1.00 21.93 ? 29   ASP C CA  1 
ATOM   4485 C C   . ASP C 1 28  ? 10.173 39.192 65.772  1.00 21.36 ? 29   ASP C C   1 
ATOM   4486 O O   . ASP C 1 28  ? 10.233 38.312 66.631  1.00 21.78 ? 29   ASP C O   1 
ATOM   4487 C CB  . ASP C 1 28  ? 8.345  38.778 64.111  1.00 21.13 ? 29   ASP C CB  1 
ATOM   4488 C CG  . ASP C 1 28  ? 6.895  39.010 63.730  1.00 23.25 ? 29   ASP C CG  1 
ATOM   4489 O OD1 . ASP C 1 28  ? 6.049  39.098 64.648  1.00 23.73 ? 29   ASP C OD1 1 
ATOM   4490 O OD2 . ASP C 1 28  ? 6.595  39.091 62.519  1.00 20.96 ? 29   ASP C OD2 1 
ATOM   4491 N N   . HIS C 1 29  ? 11.250 39.747 65.214  1.00 21.80 ? 30   HIS C N   1 
ATOM   4492 C CA  . HIS C 1 29  ? 12.629 39.409 65.612  1.00 21.08 ? 30   HIS C CA  1 
ATOM   4493 C C   . HIS C 1 29  ? 13.564 40.591 65.403  1.00 20.64 ? 30   HIS C C   1 
ATOM   4494 O O   . HIS C 1 29  ? 13.455 41.302 64.399  1.00 20.83 ? 30   HIS C O   1 
ATOM   4495 C CB  . HIS C 1 29  ? 13.180 38.245 64.780  1.00 22.74 ? 30   HIS C CB  1 
ATOM   4496 C CG  . HIS C 1 29  ? 12.542 36.937 65.100  1.00 26.43 ? 30   HIS C CG  1 
ATOM   4497 N ND1 . HIS C 1 29  ? 11.606 36.342 64.279  1.00 31.48 ? 30   HIS C ND1 1 
ATOM   4498 C CD2 . HIS C 1 29  ? 12.621 36.164 66.210  1.00 28.09 ? 30   HIS C CD2 1 
ATOM   4499 C CE1 . HIS C 1 29  ? 11.129 35.261 64.876  1.00 29.69 ? 30   HIS C CE1 1 
ATOM   4500 N NE2 . HIS C 1 29  ? 11.727 35.133 66.048  1.00 29.91 ? 30   HIS C NE2 1 
ATOM   4501 N N   . ILE C 1 30  ? 14.478 40.794 66.347  1.00 19.32 ? 31   ILE C N   1 
ATOM   4502 C CA  . ILE C 1 30  ? 15.478 41.853 66.228  1.00 17.94 ? 31   ILE C CA  1 
ATOM   4503 C C   . ILE C 1 30  ? 16.880 41.223 66.327  1.00 18.21 ? 31   ILE C C   1 
ATOM   4504 O O   . ILE C 1 30  ? 17.169 40.534 67.307  1.00 18.67 ? 31   ILE C O   1 
ATOM   4505 C CB  . ILE C 1 30  ? 15.357 42.893 67.363  1.00 17.73 ? 31   ILE C CB  1 
ATOM   4506 C CG1 . ILE C 1 30  ? 14.019 43.633 67.259  1.00 18.37 ? 31   ILE C CG1 1 
ATOM   4507 C CG2 . ILE C 1 30  ? 16.549 43.884 67.279  1.00 18.11 ? 31   ILE C CG2 1 
ATOM   4508 C CD1 . ILE C 1 30  ? 13.805 44.697 68.359  1.00 17.91 ? 31   ILE C CD1 1 
ATOM   4509 N N   . THR C 1 31  ? 17.726 41.457 65.319  1.00 17.33 ? 32   THR C N   1 
ATOM   4510 C CA  . THR C 1 31  ? 19.108 40.973 65.301  1.00 16.52 ? 32   THR C CA  1 
ATOM   4511 C C   . THR C 1 31  ? 20.006 42.234 65.382  1.00 17.51 ? 32   THR C C   1 
ATOM   4512 O O   . THR C 1 31  ? 19.974 43.088 64.488  1.00 18.58 ? 32   THR C O   1 
ATOM   4513 C CB  . THR C 1 31  ? 19.402 40.204 64.009  1.00 18.36 ? 32   THR C CB  1 
ATOM   4514 O OG1 . THR C 1 31  ? 18.424 39.172 63.845  1.00 18.19 ? 32   THR C OG1 1 
ATOM   4515 C CG2 . THR C 1 31  ? 20.784 39.559 64.064  1.00 20.56 ? 32   THR C CG2 1 
ATOM   4516 N N   . GLY C 1 32  ? 20.782 42.345 66.463  1.00 16.56 ? 33   GLY C N   1 
ATOM   4517 C CA  . GLY C 1 32  ? 21.632 43.510 66.650  1.00 18.16 ? 33   GLY C CA  1 
ATOM   4518 C C   . GLY C 1 32  ? 23.119 43.358 66.458  1.00 18.10 ? 33   GLY C C   1 
ATOM   4519 O O   . GLY C 1 32  ? 23.688 42.314 66.788  1.00 17.49 ? 33   GLY C O   1 
ATOM   4520 N N   . TYR C 1 33  ? 23.748 44.408 65.918  1.00 16.66 ? 34   TYR C N   1 
ATOM   4521 C CA  . TYR C 1 33  ? 25.199 44.427 65.690  1.00 18.67 ? 34   TYR C CA  1 
ATOM   4522 C C   . TYR C 1 33  ? 25.810 45.659 66.342  1.00 18.57 ? 34   TYR C C   1 
ATOM   4523 O O   . TYR C 1 33  ? 25.212 46.729 66.297  1.00 17.98 ? 34   TYR C O   1 
ATOM   4524 C CB  . TYR C 1 33  ? 25.538 44.486 64.188  1.00 17.20 ? 34   TYR C CB  1 
ATOM   4525 C CG  . TYR C 1 33  ? 25.138 43.251 63.429  1.00 17.54 ? 34   TYR C CG  1 
ATOM   4526 C CD1 . TYR C 1 33  ? 23.801 43.006 63.134  1.00 16.84 ? 34   TYR C CD1 1 
ATOM   4527 C CD2 . TYR C 1 33  ? 26.093 42.281 63.067  1.00 19.32 ? 34   TYR C CD2 1 
ATOM   4528 C CE1 . TYR C 1 33  ? 23.400 41.822 62.504  1.00 17.21 ? 34   TYR C CE1 1 
ATOM   4529 C CE2 . TYR C 1 33  ? 25.707 41.097 62.430  1.00 17.88 ? 34   TYR C CE2 1 
ATOM   4530 C CZ  . TYR C 1 33  ? 24.355 40.876 62.157  1.00 19.21 ? 34   TYR C CZ  1 
ATOM   4531 O OH  . TYR C 1 33  ? 23.944 39.715 61.552  1.00 17.24 ? 34   TYR C OH  1 
ATOM   4532 N N   . GLY C 1 34  ? 26.981 45.501 66.955  1.00 19.40 ? 35   GLY C N   1 
ATOM   4533 C CA  . GLY C 1 34  ? 27.674 46.650 67.532  1.00 16.89 ? 35   GLY C CA  1 
ATOM   4534 C C   . GLY C 1 34  ? 28.876 46.977 66.644  1.00 18.61 ? 35   GLY C C   1 
ATOM   4535 O O   . GLY C 1 34  ? 29.141 46.277 65.666  1.00 16.68 ? 35   GLY C O   1 
ATOM   4536 N N   . ASN C 1 35  ? 29.609 48.043 66.959  1.00 19.37 ? 36   ASN C N   1 
ATOM   4537 C CA  . ASN C 1 35  ? 30.796 48.402 66.177  1.00 19.83 ? 36   ASN C CA  1 
ATOM   4538 C C   . ASN C 1 35  ? 30.532 48.566 64.676  1.00 21.57 ? 36   ASN C C   1 
ATOM   4539 O O   . ASN C 1 35  ? 31.426 48.322 63.869  1.00 20.12 ? 36   ASN C O   1 
ATOM   4540 C CB  . ASN C 1 35  ? 31.893 47.342 66.389  1.00 22.24 ? 36   ASN C CB  1 
ATOM   4541 C CG  . ASN C 1 35  ? 32.236 47.147 67.862  1.00 23.84 ? 36   ASN C CG  1 
ATOM   4542 O OD1 . ASN C 1 35  ? 32.573 48.113 68.553  1.00 21.92 ? 36   ASN C OD1 1 
ATOM   4543 N ND2 . ASN C 1 35  ? 32.153 45.893 68.349  1.00 25.08 ? 36   ASN C ND2 1 
ATOM   4544 N N   . VAL C 1 36  ? 29.319 48.992 64.301  1.00 19.36 ? 37   VAL C N   1 
ATOM   4545 C CA  . VAL C 1 36  ? 28.989 49.171 62.894  1.00 20.06 ? 37   VAL C CA  1 
ATOM   4546 C C   . VAL C 1 36  ? 29.589 50.481 62.382  1.00 20.24 ? 37   VAL C C   1 
ATOM   4547 O O   . VAL C 1 36  ? 29.521 51.508 63.057  1.00 20.57 ? 37   VAL C O   1 
ATOM   4548 C CB  . VAL C 1 36  ? 27.450 49.193 62.674  1.00 18.72 ? 37   VAL C CB  1 
ATOM   4549 C CG1 . VAL C 1 36  ? 27.134 49.302 61.181  1.00 17.47 ? 37   VAL C CG1 1 
ATOM   4550 C CG2 . VAL C 1 36  ? 26.810 47.933 63.250  1.00 17.22 ? 37   VAL C CG2 1 
ATOM   4551 N N   . THR C 1 37  ? 30.172 50.438 61.190  1.00 20.60 ? 38   THR C N   1 
ATOM   4552 C CA  . THR C 1 37  ? 30.808 51.614 60.584  1.00 22.14 ? 38   THR C CA  1 
ATOM   4553 C C   . THR C 1 37  ? 30.341 51.787 59.146  1.00 20.11 ? 38   THR C C   1 
ATOM   4554 O O   . THR C 1 37  ? 29.697 50.911 58.591  1.00 21.91 ? 38   THR C O   1 
ATOM   4555 C CB  . THR C 1 37  ? 32.337 51.455 60.517  1.00 24.41 ? 38   THR C CB  1 
ATOM   4556 O OG1 . THR C 1 37  ? 32.636 50.378 59.625  1.00 23.79 ? 38   THR C OG1 1 
ATOM   4557 C CG2 . THR C 1 37  ? 32.932 51.154 61.896  1.00 24.89 ? 38   THR C CG2 1 
ATOM   4558 N N   . PRO C 1 38  ? 30.665 52.929 58.518  1.00 25.31 ? 39   PRO C N   1 
ATOM   4559 C CA  . PRO C 1 38  ? 30.233 53.117 57.127  1.00 26.34 ? 39   PRO C CA  1 
ATOM   4560 C C   . PRO C 1 38  ? 30.881 52.036 56.249  1.00 28.57 ? 39   PRO C C   1 
ATOM   4561 O O   . PRO C 1 38  ? 30.371 51.681 55.188  1.00 31.77 ? 39   PRO C O   1 
ATOM   4562 C CB  . PRO C 1 38  ? 30.755 54.515 56.791  1.00 25.67 ? 39   PRO C CB  1 
ATOM   4563 C CG  . PRO C 1 38  ? 30.723 55.218 58.101  1.00 26.11 ? 39   PRO C CG  1 
ATOM   4564 C CD  . PRO C 1 38  ? 31.262 54.166 59.054  1.00 22.19 ? 39   PRO C CD  1 
ATOM   4565 N N   . ASP C 1 39  ? 31.994 51.488 56.722  1.00 29.52 ? 40   ASP C N   1 
ATOM   4566 C CA  . ASP C 1 39  ? 32.718 50.475 55.964  1.00 32.74 ? 40   ASP C CA  1 
ATOM   4567 C C   . ASP C 1 39  ? 32.164 49.062 56.038  1.00 31.71 ? 40   ASP C C   1 
ATOM   4568 O O   . ASP C 1 39  ? 32.057 48.385 55.005  1.00 34.53 ? 40   ASP C O   1 
ATOM   4569 C CB  . ASP C 1 39  ? 34.185 50.459 56.396  1.00 37.67 ? 40   ASP C CB  1 
ATOM   4570 C CG  . ASP C 1 39  ? 34.770 51.858 56.497  1.00 42.42 ? 40   ASP C CG  1 
ATOM   4571 O OD1 . ASP C 1 39  ? 34.488 52.577 57.504  1.00 44.77 ? 40   ASP C OD1 1 
ATOM   4572 O OD2 . ASP C 1 39  ? 35.488 52.240 55.550  1.00 42.30 ? 40   ASP C OD2 1 
ATOM   4573 N N   . ASN C 1 40  ? 31.807 48.593 57.232  1.00 25.57 ? 41   ASN C N   1 
ATOM   4574 C CA  . ASN C 1 40  ? 31.298 47.233 57.303  1.00 25.41 ? 41   ASN C CA  1 
ATOM   4575 C C   . ASN C 1 40  ? 29.789 47.072 57.143  1.00 21.88 ? 41   ASN C C   1 
ATOM   4576 O O   . ASN C 1 40  ? 29.307 45.945 57.019  1.00 22.01 ? 41   ASN C O   1 
ATOM   4577 C CB  . ASN C 1 40  ? 31.764 46.538 58.596  1.00 24.76 ? 41   ASN C CB  1 
ATOM   4578 C CG  . ASN C 1 40  ? 31.280 47.246 59.864  1.00 27.24 ? 41   ASN C CG  1 
ATOM   4579 O OD1 . ASN C 1 40  ? 30.315 48.026 59.833  1.00 22.03 ? 41   ASN C OD1 1 
ATOM   4580 N ND2 . ASN C 1 40  ? 31.947 46.966 60.983  1.00 23.96 ? 41   ASN C ND2 1 
ATOM   4581 N N   . VAL C 1 41  ? 29.040 48.176 57.104  1.00 23.40 ? 42   VAL C N   1 
ATOM   4582 C CA  . VAL C 1 41  ? 27.580 48.068 56.990  1.00 21.56 ? 42   VAL C CA  1 
ATOM   4583 C C   . VAL C 1 41  ? 27.081 47.596 55.622  1.00 21.78 ? 42   VAL C C   1 
ATOM   4584 O O   . VAL C 1 41  ? 26.019 46.989 55.514  1.00 22.07 ? 42   VAL C O   1 
ATOM   4585 C CB  . VAL C 1 41  ? 26.872 49.413 57.390  1.00 22.51 ? 42   VAL C CB  1 
ATOM   4586 C CG1 . VAL C 1 41  ? 26.992 50.463 56.279  1.00 21.38 ? 42   VAL C CG1 1 
ATOM   4587 C CG2 . VAL C 1 41  ? 25.401 49.128 57.751  1.00 18.62 ? 42   VAL C CG2 1 
ATOM   4588 N N   . GLY C 1 42  ? 27.858 47.857 54.566  1.00 22.35 ? 43   GLY C N   1 
ATOM   4589 C CA  . GLY C 1 42  ? 27.438 47.431 53.240  1.00 21.45 ? 43   GLY C CA  1 
ATOM   4590 C C   . GLY C 1 42  ? 27.116 45.947 53.146  1.00 21.39 ? 43   GLY C C   1 
ATOM   4591 O O   . GLY C 1 42  ? 26.095 45.566 52.582  1.00 19.88 ? 43   GLY C O   1 
ATOM   4592 N N   . ALA C 1 43  ? 27.971 45.093 53.702  1.00 23.00 ? 44   ALA C N   1 
ATOM   4593 C CA  . ALA C 1 43  ? 27.720 43.653 53.630  1.00 22.50 ? 44   ALA C CA  1 
ATOM   4594 C C   . ALA C 1 43  ? 26.481 43.319 54.427  1.00 22.03 ? 44   ALA C C   1 
ATOM   4595 O O   . ALA C 1 43  ? 25.737 42.411 54.070  1.00 21.64 ? 44   ALA C O   1 
ATOM   4596 C CB  . ALA C 1 43  ? 28.920 42.854 54.165  1.00 22.35 ? 44   ALA C CB  1 
ATOM   4597 N N   . TYR C 1 44  ? 26.253 44.047 55.517  1.00 21.43 ? 45   TYR C N   1 
ATOM   4598 C CA  . TYR C 1 44  ? 25.053 43.787 56.313  1.00 19.64 ? 45   TYR C CA  1 
ATOM   4599 C C   . TYR C 1 44  ? 23.802 44.113 55.492  1.00 19.92 ? 45   TYR C C   1 
ATOM   4600 O O   . TYR C 1 44  ? 22.836 43.327 55.442  1.00 19.02 ? 45   TYR C O   1 
ATOM   4601 C CB  . TYR C 1 44  ? 25.068 44.647 57.598  1.00 19.85 ? 45   TYR C CB  1 
ATOM   4602 C CG  . TYR C 1 44  ? 26.171 44.312 58.597  1.00 15.86 ? 45   TYR C CG  1 
ATOM   4603 C CD1 . TYR C 1 44  ? 26.622 45.266 59.498  1.00 17.18 ? 45   TYR C CD1 1 
ATOM   4604 C CD2 . TYR C 1 44  ? 26.704 43.024 58.685  1.00 19.64 ? 45   TYR C CD2 1 
ATOM   4605 C CE1 . TYR C 1 44  ? 27.573 44.965 60.472  1.00 18.44 ? 45   TYR C CE1 1 
ATOM   4606 C CE2 . TYR C 1 44  ? 27.669 42.701 59.666  1.00 18.52 ? 45   TYR C CE2 1 
ATOM   4607 C CZ  . TYR C 1 44  ? 28.098 43.677 60.556  1.00 18.77 ? 45   TYR C CZ  1 
ATOM   4608 O OH  . TYR C 1 44  ? 29.023 43.392 61.551  1.00 17.72 ? 45   TYR C OH  1 
ATOM   4609 N N   . VAL C 1 45  ? 23.816 45.270 54.841  1.00 19.98 ? 46   VAL C N   1 
ATOM   4610 C CA  . VAL C 1 45  ? 22.662 45.690 54.045  1.00 20.04 ? 46   VAL C CA  1 
ATOM   4611 C C   . VAL C 1 45  ? 22.383 44.692 52.926  1.00 20.91 ? 46   VAL C C   1 
ATOM   4612 O O   . VAL C 1 45  ? 21.224 44.381 52.638  1.00 22.39 ? 46   VAL C O   1 
ATOM   4613 C CB  . VAL C 1 45  ? 22.886 47.108 53.455  1.00 20.38 ? 46   VAL C CB  1 
ATOM   4614 C CG1 . VAL C 1 45  ? 21.773 47.459 52.448  1.00 22.05 ? 46   VAL C CG1 1 
ATOM   4615 C CG2 . VAL C 1 45  ? 22.935 48.119 54.583  1.00 23.59 ? 46   VAL C CG2 1 
ATOM   4616 N N   . ASP C 1 46  ? 23.441 44.173 52.298  1.00 22.18 ? 47   ASP C N   1 
ATOM   4617 C CA  . ASP C 1 46  ? 23.254 43.205 51.220  1.00 22.99 ? 47   ASP C CA  1 
ATOM   4618 C C   . ASP C 1 46  ? 22.379 42.065 51.727  1.00 22.95 ? 47   ASP C C   1 
ATOM   4619 O O   . ASP C 1 46  ? 21.506 41.562 51.013  1.00 24.15 ? 47   ASP C O   1 
ATOM   4620 C CB  . ASP C 1 46  ? 24.605 42.630 50.739  1.00 23.98 ? 47   ASP C CB  1 
ATOM   4621 C CG  . ASP C 1 46  ? 25.464 43.656 50.003  1.00 27.57 ? 47   ASP C CG  1 
ATOM   4622 O OD1 . ASP C 1 46  ? 24.963 44.746 49.667  1.00 26.64 ? 47   ASP C OD1 1 
ATOM   4623 O OD2 . ASP C 1 46  ? 26.655 43.368 49.749  1.00 25.88 ? 47   ASP C OD2 1 
ATOM   4624 N N   . GLY C 1 47  ? 22.615 41.646 52.968  1.00 21.86 ? 48   GLY C N   1 
ATOM   4625 C CA  . GLY C 1 47  ? 21.827 40.563 53.514  1.00 20.77 ? 48   GLY C CA  1 
ATOM   4626 C C   . GLY C 1 47  ? 20.337 40.871 53.619  1.00 22.72 ? 48   GLY C C   1 
ATOM   4627 O O   . GLY C 1 47  ? 19.516 39.939 53.645  1.00 23.48 ? 48   GLY C O   1 
ATOM   4628 N N   . THR C 1 48  ? 19.971 42.152 53.702  1.00 22.63 ? 49   THR C N   1 
ATOM   4629 C CA  . THR C 1 48  ? 18.559 42.495 53.817  1.00 22.99 ? 49   THR C CA  1 
ATOM   4630 C C   . THR C 1 48  ? 17.863 42.741 52.473  1.00 25.18 ? 49   THR C C   1 
ATOM   4631 O O   . THR C 1 48  ? 16.637 42.682 52.405  1.00 24.31 ? 49   THR C O   1 
ATOM   4632 C CB  . THR C 1 48  ? 18.325 43.744 54.708  1.00 22.71 ? 49   THR C CB  1 
ATOM   4633 O OG1 . THR C 1 48  ? 18.840 44.928 54.068  1.00 21.17 ? 49   THR C OG1 1 
ATOM   4634 C CG2 . THR C 1 48  ? 18.983 43.544 56.070  1.00 23.38 ? 49   THR C CG2 1 
ATOM   4635 N N   . ILE C 1 49  ? 18.634 42.981 51.414  1.00 24.43 ? 50   ILE C N   1 
ATOM   4636 C CA  . ILE C 1 49  ? 18.046 43.253 50.103  1.00 28.33 ? 50   ILE C CA  1 
ATOM   4637 C C   . ILE C 1 49  ? 18.111 42.144 49.045  1.00 29.62 ? 50   ILE C C   1 
ATOM   4638 O O   . ILE C 1 49  ? 17.476 42.266 47.991  1.00 29.58 ? 50   ILE C O   1 
ATOM   4639 C CB  . ILE C 1 49  ? 18.634 44.560 49.492  1.00 26.57 ? 50   ILE C CB  1 
ATOM   4640 C CG1 . ILE C 1 49  ? 20.158 44.451 49.333  1.00 29.25 ? 50   ILE C CG1 1 
ATOM   4641 C CG2 . ILE C 1 49  ? 18.268 45.753 50.390  1.00 28.54 ? 50   ILE C CG2 1 
ATOM   4642 C CD1 . ILE C 1 49  ? 20.810 45.672 48.655  1.00 28.44 ? 50   ILE C CD1 1 
ATOM   4643 N N   . TYR C 1 50  ? 18.817 41.049 49.333  1.00 28.94 ? 51   TYR C N   1 
ATOM   4644 C CA  . TYR C 1 50  ? 18.935 39.954 48.367  1.00 27.88 ? 51   TYR C CA  1 
ATOM   4645 C C   . TYR C 1 50  ? 18.365 38.634 48.851  1.00 28.53 ? 51   TYR C C   1 
ATOM   4646 O O   . TYR C 1 50  ? 18.563 37.597 48.205  1.00 28.22 ? 51   TYR C O   1 
ATOM   4647 C CB  . TYR C 1 50  ? 20.400 39.720 48.010  1.00 28.84 ? 51   TYR C CB  1 
ATOM   4648 C CG  . TYR C 1 50  ? 21.084 40.902 47.362  1.00 30.64 ? 51   TYR C CG  1 
ATOM   4649 C CD1 . TYR C 1 50  ? 22.364 41.286 47.765  1.00 33.48 ? 51   TYR C CD1 1 
ATOM   4650 C CD2 . TYR C 1 50  ? 20.476 41.616 46.329  1.00 33.14 ? 51   TYR C CD2 1 
ATOM   4651 C CE1 . TYR C 1 50  ? 23.022 42.345 47.159  1.00 34.23 ? 51   TYR C CE1 1 
ATOM   4652 C CE2 . TYR C 1 50  ? 21.123 42.680 45.713  1.00 35.20 ? 51   TYR C CE2 1 
ATOM   4653 C CZ  . TYR C 1 50  ? 22.405 43.037 46.139  1.00 36.95 ? 51   TYR C CZ  1 
ATOM   4654 O OH  . TYR C 1 50  ? 23.080 44.086 45.555  1.00 39.93 ? 51   TYR C OH  1 
ATOM   4655 N N   . THR C 1 51  ? 17.663 38.664 49.979  1.00 23.95 ? 52   THR C N   1 
ATOM   4656 C CA  . THR C 1 51  ? 17.106 37.456 50.564  1.00 24.03 ? 52   THR C CA  1 
ATOM   4657 C C   . THR C 1 51  ? 15.596 37.275 50.441  1.00 23.98 ? 52   THR C C   1 
ATOM   4658 O O   . THR C 1 51  ? 15.079 36.175 50.671  1.00 23.89 ? 52   THR C O   1 
ATOM   4659 C CB  . THR C 1 51  ? 17.461 37.384 52.063  1.00 23.76 ? 52   THR C CB  1 
ATOM   4660 O OG1 . THR C 1 51  ? 17.186 38.654 52.662  1.00 23.13 ? 52   THR C OG1 1 
ATOM   4661 C CG2 . THR C 1 51  ? 18.938 37.048 52.262  1.00 23.30 ? 52   THR C CG2 1 
ATOM   4662 N N   . ARG C 1 52  ? 14.886 38.354 50.123  1.00 24.57 ? 53   ARG C N   1 
ATOM   4663 C CA  . ARG C 1 52  ? 13.429 38.298 49.977  1.00 26.20 ? 53   ARG C CA  1 
ATOM   4664 C C   . ARG C 1 52  ? 12.989 39.066 48.728  1.00 27.52 ? 53   ARG C C   1 
ATOM   4665 O O   . ARG C 1 52  ? 13.686 39.966 48.271  1.00 29.39 ? 53   ARG C O   1 
ATOM   4666 C CB  . ARG C 1 52  ? 12.752 38.888 51.232  1.00 23.65 ? 53   ARG C CB  1 
ATOM   4667 C CG  . ARG C 1 52  ? 12.805 37.961 52.464  1.00 22.71 ? 53   ARG C CG  1 
ATOM   4668 C CD  . ARG C 1 52  ? 12.363 38.694 53.740  1.00 24.04 ? 53   ARG C CD  1 
ATOM   4669 N NE  . ARG C 1 52  ? 11.972 37.783 54.809  1.00 23.24 ? 53   ARG C NE  1 
ATOM   4670 C CZ  . ARG C 1 52  ? 11.499 38.169 55.994  1.00 23.15 ? 53   ARG C CZ  1 
ATOM   4671 N NH1 . ARG C 1 52  ? 11.368 39.463 56.273  1.00 18.14 ? 53   ARG C NH1 1 
ATOM   4672 N NH2 . ARG C 1 52  ? 11.134 37.256 56.890  1.00 20.34 ? 53   ARG C NH2 1 
ATOM   4673 N N   . GLY C 1 53  ? 11.830 38.716 48.181  1.00 32.25 ? 54   GLY C N   1 
ATOM   4674 C CA  . GLY C 1 53  ? 11.357 39.402 46.989  1.00 34.83 ? 54   GLY C CA  1 
ATOM   4675 C C   . GLY C 1 53  ? 9.897  39.773 47.048  1.00 35.75 ? 54   GLY C C   1 
ATOM   4676 O O   . GLY C 1 53  ? 9.178  39.390 47.978  1.00 37.35 ? 54   GLY C O   1 
ATOM   4677 N N   . GLY C 1 54  ? 9.455  40.540 46.057  1.00 37.59 ? 55   GLY C N   1 
ATOM   4678 C CA  . GLY C 1 54  ? 8.057  40.935 45.990  1.00 38.38 ? 55   GLY C CA  1 
ATOM   4679 C C   . GLY C 1 54  ? 7.458  41.529 47.251  1.00 39.31 ? 55   GLY C C   1 
ATOM   4680 O O   . GLY C 1 54  ? 8.005  42.468 47.828  1.00 39.70 ? 55   GLY C O   1 
ATOM   4681 N N   . LYS C 1 55  ? 6.329  40.979 47.685  1.00 39.85 ? 56   LYS C N   1 
ATOM   4682 C CA  . LYS C 1 55  ? 5.653  41.489 48.868  1.00 39.76 ? 56   LYS C CA  1 
ATOM   4683 C C   . LYS C 1 55  ? 6.350  41.150 50.185  1.00 37.25 ? 56   LYS C C   1 
ATOM   4684 O O   . LYS C 1 55  ? 5.983  41.691 51.221  1.00 34.68 ? 56   LYS C O   1 
ATOM   4685 C CB  . LYS C 1 55  ? 4.212  40.992 48.915  1.00 42.06 ? 56   LYS C CB  1 
ATOM   4686 C CG  . LYS C 1 55  ? 3.276  41.924 49.682  1.00 47.60 ? 56   LYS C CG  1 
ATOM   4687 C CD  . LYS C 1 55  ? 1.817  41.547 49.437  1.00 52.93 ? 56   LYS C CD  1 
ATOM   4688 C CE  . LYS C 1 55  ? 0.848  42.550 50.062  1.00 55.79 ? 56   LYS C CE  1 
ATOM   4689 N NZ  . LYS C 1 55  ? -0.578 42.086 49.958  1.00 56.67 ? 56   LYS C NZ  1 
ATOM   4690 N N   . GLU C 1 56  ? 7.336  40.254 50.146  1.00 36.01 ? 57   GLU C N   1 
ATOM   4691 C CA  . GLU C 1 56  ? 8.079  39.882 51.353  1.00 34.63 ? 57   GLU C CA  1 
ATOM   4692 C C   . GLU C 1 56  ? 9.171  40.894 51.674  1.00 31.27 ? 57   GLU C C   1 
ATOM   4693 O O   . GLU C 1 56  ? 9.674  40.935 52.795  1.00 32.48 ? 57   GLU C O   1 
ATOM   4694 C CB  . GLU C 1 56  ? 8.740  38.511 51.199  1.00 38.01 ? 57   GLU C CB  1 
ATOM   4695 C CG  . GLU C 1 56  ? 7.784  37.346 51.274  1.00 45.46 ? 57   GLU C CG  1 
ATOM   4696 C CD  . GLU C 1 56  ? 6.913  37.241 50.048  1.00 48.79 ? 57   GLU C CD  1 
ATOM   4697 O OE1 . GLU C 1 56  ? 7.461  36.982 48.949  1.00 53.34 ? 57   GLU C OE1 1 
ATOM   4698 O OE2 . GLU C 1 56  ? 5.681  37.418 50.186  1.00 50.70 ? 57   GLU C OE2 1 
ATOM   4699 N N   A LYS C 1 57  ? 9.569  41.694 50.691  0.60 29.60 ? 58   LYS C N   1 
ATOM   4700 N N   B LYS C 1 57  ? 9.517  41.696 50.674  0.40 29.97 ? 58   LYS C N   1 
ATOM   4701 C CA  A LYS C 1 57  ? 10.631 42.672 50.919  0.60 28.12 ? 58   LYS C CA  1 
ATOM   4702 C CA  B LYS C 1 57  ? 10.537 42.731 50.794  0.40 28.49 ? 58   LYS C CA  1 
ATOM   4703 C C   A LYS C 1 57  ? 10.354 43.605 52.082  0.60 26.82 ? 58   LYS C C   1 
ATOM   4704 C C   B LYS C 1 57  ? 10.346 43.608 52.017  0.40 27.02 ? 58   LYS C C   1 
ATOM   4705 O O   A LYS C 1 57  ? 11.246 43.875 52.889  0.60 26.13 ? 58   LYS C O   1 
ATOM   4706 O O   B LYS C 1 57  ? 11.276 43.832 52.794  0.40 26.54 ? 58   LYS C O   1 
ATOM   4707 C CB  A LYS C 1 57  ? 10.889 43.505 49.662  0.60 28.75 ? 58   LYS C CB  1 
ATOM   4708 C CB  B LYS C 1 57  ? 10.504 43.630 49.557  0.40 29.28 ? 58   LYS C CB  1 
ATOM   4709 C CG  A LYS C 1 57  ? 11.520 42.718 48.524  0.60 31.74 ? 58   LYS C CG  1 
ATOM   4710 C CG  B LYS C 1 57  ? 11.210 43.068 48.341  0.40 30.88 ? 58   LYS C CG  1 
ATOM   4711 C CD  A LYS C 1 57  ? 12.067 43.641 47.436  0.60 29.58 ? 58   LYS C CD  1 
ATOM   4712 C CD  B LYS C 1 57  ? 12.707 43.034 48.593  0.40 31.01 ? 58   LYS C CD  1 
ATOM   4713 C CE  A LYS C 1 57  ? 10.963 44.395 46.745  0.60 30.87 ? 58   LYS C CE  1 
ATOM   4714 C CE  B LYS C 1 57  ? 13.205 44.416 48.987  0.40 29.05 ? 58   LYS C CE  1 
ATOM   4715 N NZ  A LYS C 1 57  ? 11.500 45.311 45.699  0.60 29.02 ? 58   LYS C NZ  1 
ATOM   4716 N NZ  B LYS C 1 57  ? 14.596 44.390 49.474  0.40 26.62 ? 58   LYS C NZ  1 
ATOM   4717 N N   . GLN C 1 58  ? 9.126  44.103 52.172  1.00 24.02 ? 59   GLN C N   1 
ATOM   4718 C CA  . GLN C 1 58  ? 8.775  45.005 53.255  1.00 25.66 ? 59   GLN C CA  1 
ATOM   4719 C C   . GLN C 1 58  ? 8.779  44.404 54.654  1.00 24.49 ? 59   GLN C C   1 
ATOM   4720 O O   . GLN C 1 58  ? 8.637  45.132 55.622  1.00 24.79 ? 59   GLN C O   1 
ATOM   4721 C CB  . GLN C 1 58  ? 7.406  45.650 52.976  1.00 26.84 ? 59   GLN C CB  1 
ATOM   4722 C CG  . GLN C 1 58  ? 6.245  44.693 53.019  1.00 27.35 ? 59   GLN C CG  1 
ATOM   4723 C CD  . GLN C 1 58  ? 4.943  45.376 52.602  1.00 33.68 ? 59   GLN C CD  1 
ATOM   4724 O OE1 . GLN C 1 58  ? 4.091  45.703 53.431  1.00 33.34 ? 59   GLN C OE1 1 
ATOM   4725 N NE2 . GLN C 1 58  ? 4.805  45.609 51.311  1.00 32.68 ? 59   GLN C NE2 1 
ATOM   4726 N N   . SER C 1 59  ? 8.949  43.087 54.768  1.00 25.94 ? 60   SER C N   1 
ATOM   4727 C CA  . SER C 1 59  ? 8.973  42.453 56.081  1.00 22.19 ? 60   SER C CA  1 
ATOM   4728 C C   . SER C 1 59  ? 10.362 42.463 56.741  1.00 22.09 ? 60   SER C C   1 
ATOM   4729 O O   . SER C 1 59  ? 10.554 41.865 57.800  1.00 20.92 ? 60   SER C O   1 
ATOM   4730 C CB  . SER C 1 59  ? 8.431  41.022 55.995  1.00 25.90 ? 60   SER C CB  1 
ATOM   4731 O OG  . SER C 1 59  ? 7.021  41.035 55.790  1.00 27.38 ? 60   SER C OG  1 
ATOM   4732 N N   . THR C 1 60  ? 11.320 43.113 56.092  1.00 19.37 ? 61   THR C N   1 
ATOM   4733 C CA  . THR C 1 60  ? 12.669 43.268 56.645  1.00 21.11 ? 61   THR C CA  1 
ATOM   4734 C C   . THR C 1 60  ? 12.916 44.764 56.685  1.00 20.47 ? 61   THR C C   1 
ATOM   4735 O O   . THR C 1 60  ? 12.547 45.468 55.740  1.00 21.78 ? 61   THR C O   1 
ATOM   4736 C CB  . THR C 1 60  ? 13.774 42.618 55.771  1.00 22.55 ? 61   THR C CB  1 
ATOM   4737 O OG1 . THR C 1 60  ? 13.590 41.200 55.751  1.00 21.62 ? 61   THR C OG1 1 
ATOM   4738 C CG2 . THR C 1 60  ? 15.178 42.945 56.358  1.00 21.01 ? 61   THR C CG2 1 
ATOM   4739 N N   . ALA C 1 61  ? 13.504 45.252 57.785  1.00 17.55 ? 62   ALA C N   1 
ATOM   4740 C CA  . ALA C 1 61  ? 13.781 46.675 57.946  1.00 17.66 ? 62   ALA C CA  1 
ATOM   4741 C C   . ALA C 1 61  ? 15.070 46.950 58.744  1.00 17.09 ? 62   ALA C C   1 
ATOM   4742 O O   . ALA C 1 61  ? 15.594 46.064 59.423  1.00 16.70 ? 62   ALA C O   1 
ATOM   4743 C CB  . ALA C 1 61  ? 12.565 47.377 58.612  1.00 18.03 ? 62   ALA C CB  1 
ATOM   4744 N N   . ILE C 1 62  ? 15.576 48.178 58.644  1.00 17.61 ? 63   ILE C N   1 
ATOM   4745 C CA  . ILE C 1 62  ? 16.825 48.576 59.295  1.00 18.25 ? 63   ILE C CA  1 
ATOM   4746 C C   . ILE C 1 62  ? 16.662 49.739 60.268  1.00 20.40 ? 63   ILE C C   1 
ATOM   4747 O O   . ILE C 1 62  ? 15.943 50.694 59.979  1.00 19.26 ? 63   ILE C O   1 
ATOM   4748 C CB  . ILE C 1 62  ? 17.869 48.981 58.219  1.00 16.18 ? 63   ILE C CB  1 
ATOM   4749 C CG1 . ILE C 1 62  ? 18.348 47.724 57.464  1.00 16.12 ? 63   ILE C CG1 1 
ATOM   4750 C CG2 . ILE C 1 62  ? 19.004 49.745 58.844  1.00 18.27 ? 63   ILE C CG2 1 
ATOM   4751 C CD1 . ILE C 1 62  ? 19.028 48.004 56.114  1.00 17.80 ? 63   ILE C CD1 1 
ATOM   4752 N N   . PHE C 1 63  ? 17.346 49.659 61.412  1.00 21.27 ? 64   PHE C N   1 
ATOM   4753 C CA  . PHE C 1 63  ? 17.313 50.720 62.439  1.00 18.53 ? 64   PHE C CA  1 
ATOM   4754 C C   . PHE C 1 63  ? 18.764 51.045 62.801  1.00 20.16 ? 64   PHE C C   1 
ATOM   4755 O O   . PHE C 1 63  ? 19.522 50.148 63.173  1.00 19.66 ? 64   PHE C O   1 
ATOM   4756 C CB  . PHE C 1 63  ? 16.580 50.248 63.707  1.00 17.15 ? 64   PHE C CB  1 
ATOM   4757 C CG  . PHE C 1 63  ? 16.614 51.258 64.845  1.00 19.69 ? 64   PHE C CG  1 
ATOM   4758 C CD1 . PHE C 1 63  ? 15.633 52.233 64.959  1.00 15.45 ? 64   PHE C CD1 1 
ATOM   4759 C CD2 . PHE C 1 63  ? 17.649 51.238 65.788  1.00 16.64 ? 64   PHE C CD2 1 
ATOM   4760 C CE1 . PHE C 1 63  ? 15.676 53.185 65.996  1.00 15.31 ? 64   PHE C CE1 1 
ATOM   4761 C CE2 . PHE C 1 63  ? 17.703 52.180 66.831  1.00 19.28 ? 64   PHE C CE2 1 
ATOM   4762 C CZ  . PHE C 1 63  ? 16.713 53.160 66.934  1.00 17.94 ? 64   PHE C CZ  1 
ATOM   4763 N N   . VAL C 1 64  ? 19.157 52.309 62.680  1.00 17.92 ? 65   VAL C N   1 
ATOM   4764 C CA  . VAL C 1 64  ? 20.519 52.715 63.033  1.00 18.07 ? 65   VAL C CA  1 
ATOM   4765 C C   . VAL C 1 64  ? 20.474 53.508 64.316  1.00 19.89 ? 65   VAL C C   1 
ATOM   4766 O O   . VAL C 1 64  ? 19.694 54.466 64.431  1.00 17.32 ? 65   VAL C O   1 
ATOM   4767 C CB  . VAL C 1 64  ? 21.149 53.592 61.937  1.00 18.82 ? 65   VAL C CB  1 
ATOM   4768 C CG1 . VAL C 1 64  ? 22.516 54.107 62.383  1.00 18.11 ? 65   VAL C CG1 1 
ATOM   4769 C CG2 . VAL C 1 64  ? 21.235 52.781 60.645  1.00 18.50 ? 65   VAL C CG2 1 
ATOM   4770 N N   . GLY C 1 65  ? 21.314 53.120 65.270  1.00 16.75 ? 66   GLY C N   1 
ATOM   4771 C CA  . GLY C 1 65  ? 21.349 53.819 66.537  1.00 17.44 ? 66   GLY C CA  1 
ATOM   4772 C C   . GLY C 1 65  ? 22.713 53.849 67.197  1.00 16.90 ? 66   GLY C C   1 
ATOM   4773 O O   . GLY C 1 65  ? 23.730 53.449 66.607  1.00 16.95 ? 66   GLY C O   1 
ATOM   4774 N N   . GLY C 1 66  ? 22.746 54.303 68.442  1.00 15.57 ? 67   GLY C N   1 
ATOM   4775 C CA  . GLY C 1 66  ? 24.014 54.402 69.149  1.00 18.05 ? 67   GLY C CA  1 
ATOM   4776 C C   . GLY C 1 66  ? 24.128 55.759 69.820  1.00 19.33 ? 67   GLY C C   1 
ATOM   4777 O O   . GLY C 1 66  ? 23.300 56.633 69.585  1.00 18.94 ? 67   GLY C O   1 
ATOM   4778 N N   . GLY C 1 67  ? 25.166 55.950 70.638  1.00 21.01 ? 68   GLY C N   1 
ATOM   4779 C CA  . GLY C 1 67  ? 25.318 57.193 71.378  1.00 21.39 ? 68   GLY C CA  1 
ATOM   4780 C C   . GLY C 1 67  ? 25.743 58.465 70.666  1.00 23.88 ? 68   GLY C C   1 
ATOM   4781 O O   . GLY C 1 67  ? 25.363 59.563 71.094  1.00 22.24 ? 68   GLY C O   1 
ATOM   4782 N N   . ASP C 1 68  ? 26.505 58.327 69.587  1.00 22.11 ? 69   ASP C N   1 
ATOM   4783 C CA  . ASP C 1 68  ? 27.009 59.471 68.840  1.00 25.23 ? 69   ASP C CA  1 
ATOM   4784 C C   . ASP C 1 68  ? 26.216 59.708 67.561  1.00 24.12 ? 69   ASP C C   1 
ATOM   4785 O O   . ASP C 1 68  ? 26.261 58.903 66.635  1.00 24.65 ? 69   ASP C O   1 
ATOM   4786 C CB  . ASP C 1 68  ? 28.489 59.246 68.486  1.00 27.67 ? 69   ASP C CB  1 
ATOM   4787 C CG  . ASP C 1 68  ? 29.132 60.477 67.857  1.00 30.77 ? 69   ASP C CG  1 
ATOM   4788 O OD1 . ASP C 1 68  ? 29.611 61.351 68.606  1.00 36.28 ? 69   ASP C OD1 1 
ATOM   4789 O OD2 . ASP C 1 68  ? 29.145 60.585 66.624  1.00 31.71 ? 69   ASP C OD2 1 
ATOM   4790 N N   . MET C 1 69  ? 25.498 60.826 67.515  1.00 24.49 ? 70   MET C N   1 
ATOM   4791 C CA  . MET C 1 69  ? 24.690 61.171 66.357  1.00 26.36 ? 70   MET C CA  1 
ATOM   4792 C C   . MET C 1 69  ? 25.477 61.228 65.054  1.00 27.03 ? 70   MET C C   1 
ATOM   4793 O O   . MET C 1 69  ? 25.031 60.700 64.038  1.00 26.05 ? 70   MET C O   1 
ATOM   4794 C CB  . MET C 1 69  ? 23.999 62.528 66.562  1.00 30.77 ? 70   MET C CB  1 
ATOM   4795 C CG  . MET C 1 69  ? 23.123 62.948 65.371  1.00 33.47 ? 70   MET C CG  1 
ATOM   4796 S SD  . MET C 1 69  ? 21.629 61.924 65.270  1.00 37.45 ? 70   MET C SD  1 
ATOM   4797 C CE  . MET C 1 69  ? 21.787 61.199 63.734  1.00 38.41 ? 70   MET C CE  1 
ATOM   4798 N N   . ALA C 1 70  ? 26.634 61.889 65.069  1.00 26.96 ? 71   ALA C N   1 
ATOM   4799 C CA  . ALA C 1 70  ? 27.443 62.008 63.854  1.00 25.49 ? 71   ALA C CA  1 
ATOM   4800 C C   . ALA C 1 70  ? 27.859 60.644 63.300  1.00 26.19 ? 71   ALA C C   1 
ATOM   4801 O O   . ALA C 1 70  ? 27.832 60.411 62.092  1.00 23.73 ? 71   ALA C O   1 
ATOM   4802 C CB  . ALA C 1 70  ? 28.699 62.866 64.134  1.00 28.60 ? 71   ALA C CB  1 
ATOM   4803 N N   . ALA C 1 71  ? 28.259 59.741 64.188  1.00 24.53 ? 72   ALA C N   1 
ATOM   4804 C CA  . ALA C 1 71  ? 28.664 58.417 63.740  1.00 22.55 ? 72   ALA C CA  1 
ATOM   4805 C C   . ALA C 1 71  ? 27.445 57.734 63.126  1.00 22.30 ? 72   ALA C C   1 
ATOM   4806 O O   . ALA C 1 71  ? 27.552 57.061 62.093  1.00 20.07 ? 72   ALA C O   1 
ATOM   4807 C CB  . ALA C 1 71  ? 29.203 57.608 64.924  1.00 23.52 ? 72   ALA C CB  1 
ATOM   4808 N N   . GLY C 1 72  ? 26.289 57.919 63.768  1.00 20.91 ? 73   GLY C N   1 
ATOM   4809 C CA  . GLY C 1 72  ? 25.054 57.330 63.270  1.00 23.13 ? 73   GLY C CA  1 
ATOM   4810 C C   . GLY C 1 72  ? 24.683 57.858 61.892  1.00 23.37 ? 73   GLY C C   1 
ATOM   4811 O O   . GLY C 1 72  ? 24.274 57.097 61.003  1.00 18.68 ? 73   GLY C O   1 
ATOM   4812 N N   . GLU C 1 73  ? 24.831 59.170 61.693  1.00 24.15 ? 74   GLU C N   1 
ATOM   4813 C CA  . GLU C 1 73  ? 24.494 59.729 60.391  1.00 25.06 ? 74   GLU C CA  1 
ATOM   4814 C C   . GLU C 1 73  ? 25.385 59.144 59.305  1.00 25.99 ? 74   GLU C C   1 
ATOM   4815 O O   . GLU C 1 73  ? 24.910 58.862 58.194  1.00 25.63 ? 74   GLU C O   1 
ATOM   4816 C CB  . GLU C 1 73  ? 24.600 61.253 60.414  1.00 27.13 ? 74   GLU C CB  1 
ATOM   4817 C CG  . GLU C 1 73  ? 23.425 61.907 61.116  1.00 30.12 ? 74   GLU C CG  1 
ATOM   4818 C CD  . GLU C 1 73  ? 23.563 63.410 61.224  1.00 36.14 ? 74   GLU C CD  1 
ATOM   4819 O OE1 . GLU C 1 73  ? 22.543 64.113 61.040  1.00 39.80 ? 74   GLU C OE1 1 
ATOM   4820 O OE2 . GLU C 1 73  ? 24.680 63.884 61.504  1.00 36.70 ? 74   GLU C OE2 1 
ATOM   4821 N N   . ARG C 1 74  ? 26.660 58.925 59.620  1.00 24.86 ? 75   ARG C N   1 
ATOM   4822 C CA  . ARG C 1 74  ? 27.567 58.363 58.621  1.00 25.80 ? 75   ARG C CA  1 
ATOM   4823 C C   . ARG C 1 74  ? 27.127 56.965 58.217  1.00 24.92 ? 75   ARG C C   1 
ATOM   4824 O O   . ARG C 1 74  ? 27.115 56.616 57.028  1.00 22.27 ? 75   ARG C O   1 
ATOM   4825 C CB  . ARG C 1 74  ? 29.009 58.326 59.139  1.00 28.41 ? 75   ARG C CB  1 
ATOM   4826 C CG  . ARG C 1 74  ? 29.665 59.723 59.256  1.00 33.07 ? 75   ARG C CG  1 
ATOM   4827 C CD  . ARG C 1 74  ? 31.182 59.620 59.430  1.00 34.97 ? 75   ARG C CD  1 
ATOM   4828 N NE  . ARG C 1 74  ? 31.580 59.166 60.762  1.00 37.60 ? 75   ARG C NE  1 
ATOM   4829 C CZ  . ARG C 1 74  ? 31.616 59.946 61.841  1.00 39.52 ? 75   ARG C CZ  1 
ATOM   4830 N NH1 . ARG C 1 74  ? 31.280 61.226 61.752  1.00 41.13 ? 75   ARG C NH1 1 
ATOM   4831 N NH2 . ARG C 1 74  ? 31.991 59.450 63.014  1.00 38.89 ? 75   ARG C NH2 1 
ATOM   4832 N N   . VAL C 1 75  ? 26.758 56.154 59.204  1.00 22.44 ? 76   VAL C N   1 
ATOM   4833 C CA  . VAL C 1 75  ? 26.306 54.805 58.891  1.00 20.20 ? 76   VAL C CA  1 
ATOM   4834 C C   . VAL C 1 75  ? 24.996 54.879 58.090  1.00 20.57 ? 76   VAL C C   1 
ATOM   4835 O O   . VAL C 1 75  ? 24.838 54.192 57.082  1.00 21.15 ? 76   VAL C O   1 
ATOM   4836 C CB  . VAL C 1 75  ? 26.114 53.986 60.192  1.00 18.52 ? 76   VAL C CB  1 
ATOM   4837 C CG1 . VAL C 1 75  ? 25.328 52.688 59.906  1.00 20.41 ? 76   VAL C CG1 1 
ATOM   4838 C CG2 . VAL C 1 75  ? 27.494 53.668 60.796  1.00 20.17 ? 76   VAL C CG2 1 
ATOM   4839 N N   . PHE C 1 76  ? 24.064 55.729 58.519  1.00 22.16 ? 77   PHE C N   1 
ATOM   4840 C CA  . PHE C 1 76  ? 22.771 55.867 57.828  1.00 21.46 ? 77   PHE C CA  1 
ATOM   4841 C C   . PHE C 1 76  ? 22.939 56.228 56.344  1.00 23.29 ? 77   PHE C C   1 
ATOM   4842 O O   . PHE C 1 76  ? 22.217 55.710 55.473  1.00 21.61 ? 77   PHE C O   1 
ATOM   4843 C CB  . PHE C 1 76  ? 21.904 56.933 58.536  1.00 19.64 ? 77   PHE C CB  1 
ATOM   4844 C CG  . PHE C 1 76  ? 20.418 56.864 58.192  1.00 21.73 ? 77   PHE C CG  1 
ATOM   4845 C CD1 . PHE C 1 76  ? 19.677 55.703 58.444  1.00 20.36 ? 77   PHE C CD1 1 
ATOM   4846 C CD2 . PHE C 1 76  ? 19.747 57.981 57.667  1.00 20.53 ? 77   PHE C CD2 1 
ATOM   4847 C CE1 . PHE C 1 76  ? 18.288 55.650 58.180  1.00 20.27 ? 77   PHE C CE1 1 
ATOM   4848 C CE2 . PHE C 1 76  ? 18.368 57.937 57.402  1.00 22.68 ? 77   PHE C CE2 1 
ATOM   4849 C CZ  . PHE C 1 76  ? 17.635 56.767 57.659  1.00 19.43 ? 77   PHE C CZ  1 
ATOM   4850 N N   . GLU C 1 77  ? 23.875 57.127 56.056  1.00 23.08 ? 78   GLU C N   1 
ATOM   4851 C CA  . GLU C 1 77  ? 24.145 57.529 54.670  1.00 26.33 ? 78   GLU C CA  1 
ATOM   4852 C C   . GLU C 1 77  ? 24.727 56.355 53.862  1.00 23.59 ? 78   GLU C C   1 
ATOM   4853 O O   . GLU C 1 77  ? 24.395 56.166 52.683  1.00 24.34 ? 78   GLU C O   1 
ATOM   4854 C CB  . GLU C 1 77  ? 25.108 58.726 54.652  1.00 29.31 ? 78   GLU C CB  1 
ATOM   4855 C CG  . GLU C 1 77  ? 24.451 60.024 55.123  1.00 33.32 ? 78   GLU C CG  1 
ATOM   4856 C CD  . GLU C 1 77  ? 23.212 60.362 54.289  1.00 35.80 ? 78   GLU C CD  1 
ATOM   4857 O OE1 . GLU C 1 77  ? 23.312 60.305 53.048  1.00 39.61 ? 78   GLU C OE1 1 
ATOM   4858 O OE2 . GLU C 1 77  ? 22.146 60.683 54.860  1.00 35.07 ? 78   GLU C OE2 1 
ATOM   4859 N N   . ALA C 1 78  ? 25.579 55.555 54.503  1.00 25.03 ? 79   ALA C N   1 
ATOM   4860 C CA  . ALA C 1 78  ? 26.182 54.383 53.856  1.00 22.22 ? 79   ALA C CA  1 
ATOM   4861 C C   . ALA C 1 78  ? 25.115 53.334 53.558  1.00 23.04 ? 79   ALA C C   1 
ATOM   4862 O O   . ALA C 1 78  ? 25.200 52.611 52.563  1.00 20.79 ? 79   ALA C O   1 
ATOM   4863 C CB  . ALA C 1 78  ? 27.270 53.779 54.758  1.00 22.50 ? 79   ALA C CB  1 
ATOM   4864 N N   . VAL C 1 79  ? 24.121 53.228 54.438  1.00 22.04 ? 80   VAL C N   1 
ATOM   4865 C CA  . VAL C 1 79  ? 23.017 52.287 54.237  1.00 22.28 ? 80   VAL C CA  1 
ATOM   4866 C C   . VAL C 1 79  ? 22.198 52.698 53.001  1.00 22.89 ? 80   VAL C C   1 
ATOM   4867 O O   . VAL C 1 79  ? 21.862 51.864 52.156  1.00 24.01 ? 80   VAL C O   1 
ATOM   4868 C CB  . VAL C 1 79  ? 22.024 52.275 55.450  1.00 21.18 ? 80   VAL C CB  1 
ATOM   4869 C CG1 . VAL C 1 79  ? 20.719 51.541 55.058  1.00 21.90 ? 80   VAL C CG1 1 
ATOM   4870 C CG2 . VAL C 1 79  ? 22.662 51.593 56.665  1.00 17.49 ? 80   VAL C CG2 1 
ATOM   4871 N N   . LYS C 1 80  ? 21.850 53.979 52.919  1.00 23.33 ? 81   LYS C N   1 
ATOM   4872 C CA  . LYS C 1 80  ? 21.047 54.462 51.794  1.00 23.91 ? 81   LYS C CA  1 
ATOM   4873 C C   . LYS C 1 80  ? 21.837 54.349 50.486  1.00 24.80 ? 81   LYS C C   1 
ATOM   4874 O O   . LYS C 1 80  ? 21.271 54.083 49.429  1.00 23.40 ? 81   LYS C O   1 
ATOM   4875 C CB  . LYS C 1 80  ? 20.594 55.912 52.036  1.00 21.59 ? 81   LYS C CB  1 
ATOM   4876 C CG  . LYS C 1 80  ? 19.644 56.086 53.223  1.00 21.61 ? 81   LYS C CG  1 
ATOM   4877 C CD  . LYS C 1 80  ? 19.133 57.543 53.393  1.00 24.30 ? 81   LYS C CD  1 
ATOM   4878 C CE  . LYS C 1 80  ? 20.165 58.497 53.929  1.00 27.48 ? 81   LYS C CE  1 
ATOM   4879 N NZ  . LYS C 1 80  ? 19.632 59.908 53.968  1.00 28.50 ? 81   LYS C NZ  1 
ATOM   4880 N N   . LYS C 1 81  ? 23.150 54.514 50.581  1.00 26.56 ? 82   LYS C N   1 
ATOM   4881 C CA  . LYS C 1 81  ? 24.031 54.441 49.419  1.00 28.50 ? 82   LYS C CA  1 
ATOM   4882 C C   . LYS C 1 81  ? 24.129 53.024 48.863  1.00 27.89 ? 82   LYS C C   1 
ATOM   4883 O O   . LYS C 1 81  ? 24.386 52.828 47.674  1.00 25.92 ? 82   LYS C O   1 
ATOM   4884 C CB  . LYS C 1 81  ? 25.424 54.936 49.813  1.00 30.17 ? 82   LYS C CB  1 
ATOM   4885 C CG  . LYS C 1 81  ? 26.378 55.160 48.660  1.00 38.07 ? 82   LYS C CG  1 
ATOM   4886 C CD  . LYS C 1 81  ? 27.721 55.648 49.190  1.00 40.94 ? 82   LYS C CD  1 
ATOM   4887 C CE  . LYS C 1 81  ? 28.554 56.365 48.112  1.00 47.29 ? 82   LYS C CE  1 
ATOM   4888 N NZ  . LYS C 1 81  ? 28.745 55.566 46.859  1.00 46.72 ? 82   LYS C NZ  1 
ATOM   4889 N N   . ARG C 1 82  ? 23.932 52.024 49.713  1.00 26.55 ? 83   ARG C N   1 
ATOM   4890 C CA  . ARG C 1 82  ? 24.028 50.640 49.246  1.00 25.91 ? 83   ARG C CA  1 
ATOM   4891 C C   . ARG C 1 82  ? 22.775 50.228 48.480  1.00 26.76 ? 83   ARG C C   1 
ATOM   4892 O O   . ARG C 1 82  ? 22.816 49.308 47.669  1.00 27.37 ? 83   ARG C O   1 
ATOM   4893 C CB  . ARG C 1 82  ? 24.236 49.693 50.433  1.00 25.95 ? 83   ARG C CB  1 
ATOM   4894 C CG  . ARG C 1 82  ? 24.664 48.278 50.051  1.00 27.02 ? 83   ARG C CG  1 
ATOM   4895 C CD  . ARG C 1 82  ? 26.131 48.282 49.651  1.00 26.09 ? 83   ARG C CD  1 
ATOM   4896 N NE  . ARG C 1 82  ? 26.690 46.935 49.592  1.00 28.55 ? 83   ARG C NE  1 
ATOM   4897 C CZ  . ARG C 1 82  ? 27.991 46.691 49.564  1.00 28.11 ? 83   ARG C CZ  1 
ATOM   4898 N NH1 . ARG C 1 82  ? 28.848 47.707 49.595  1.00 28.48 ? 83   ARG C NH1 1 
ATOM   4899 N NH2 . ARG C 1 82  ? 28.437 45.439 49.487  1.00 30.47 ? 83   ARG C NH2 1 
ATOM   4900 N N   . PHE C 1 83  ? 21.649 50.882 48.759  1.00 26.24 ? 84   PHE C N   1 
ATOM   4901 C CA  . PHE C 1 83  ? 20.421 50.562 48.064  1.00 27.04 ? 84   PHE C CA  1 
ATOM   4902 C C   . PHE C 1 83  ? 20.581 50.953 46.595  1.00 29.06 ? 84   PHE C C   1 
ATOM   4903 O O   . PHE C 1 83  ? 21.417 51.787 46.263  1.00 29.44 ? 84   PHE C O   1 
ATOM   4904 C CB  . PHE C 1 83  ? 19.234 51.361 48.608  1.00 27.31 ? 84   PHE C CB  1 
ATOM   4905 C CG  . PHE C 1 83  ? 18.891 51.086 50.052  1.00 25.88 ? 84   PHE C CG  1 
ATOM   4906 C CD1 . PHE C 1 83  ? 19.036 49.816 50.601  1.00 24.40 ? 84   PHE C CD1 1 
ATOM   4907 C CD2 . PHE C 1 83  ? 18.305 52.086 50.825  1.00 26.41 ? 84   PHE C CD2 1 
ATOM   4908 C CE1 . PHE C 1 83  ? 18.593 49.548 51.896  1.00 24.46 ? 84   PHE C CE1 1 
ATOM   4909 C CE2 . PHE C 1 83  ? 17.859 51.831 52.114  1.00 24.61 ? 84   PHE C CE2 1 
ATOM   4910 C CZ  . PHE C 1 83  ? 18.000 50.559 52.653  1.00 26.10 ? 84   PHE C CZ  1 
ATOM   4911 N N   . PHE C 1 84  ? 19.775 50.347 45.731  1.00 30.77 ? 85   PHE C N   1 
ATOM   4912 C CA  . PHE C 1 84  ? 19.772 50.680 44.305  1.00 34.88 ? 85   PHE C CA  1 
ATOM   4913 C C   . PHE C 1 84  ? 18.535 50.079 43.638  1.00 33.42 ? 85   PHE C C   1 
ATOM   4914 O O   . PHE C 1 84  ? 18.231 48.891 43.809  1.00 33.30 ? 85   PHE C O   1 
ATOM   4915 C CB  . PHE C 1 84  ? 21.065 50.201 43.620  1.00 37.77 ? 85   PHE C CB  1 
ATOM   4916 C CG  . PHE C 1 84  ? 21.128 48.725 43.378  1.00 41.48 ? 85   PHE C CG  1 
ATOM   4917 C CD1 . PHE C 1 84  ? 20.741 48.192 42.152  1.00 43.33 ? 85   PHE C CD1 1 
ATOM   4918 C CD2 . PHE C 1 84  ? 21.602 47.864 44.365  1.00 44.30 ? 85   PHE C CD2 1 
ATOM   4919 C CE1 . PHE C 1 84  ? 20.828 46.817 41.908  1.00 44.62 ? 85   PHE C CE1 1 
ATOM   4920 C CE2 . PHE C 1 84  ? 21.694 46.484 44.133  1.00 46.50 ? 85   PHE C CE2 1 
ATOM   4921 C CZ  . PHE C 1 84  ? 21.306 45.962 42.899  1.00 46.07 ? 85   PHE C CZ  1 
ATOM   4922 N N   . GLY C 1 85  ? 17.808 50.913 42.901  1.00 30.76 ? 86   GLY C N   1 
ATOM   4923 C CA  . GLY C 1 85  ? 16.607 50.449 42.232  1.00 30.88 ? 86   GLY C CA  1 
ATOM   4924 C C   . GLY C 1 85  ? 15.591 49.936 43.227  1.00 31.54 ? 86   GLY C C   1 
ATOM   4925 O O   . GLY C 1 85  ? 15.322 50.604 44.228  1.00 33.25 ? 86   GLY C O   1 
ATOM   4926 N N   . PRO C 1 86  ? 15.003 48.757 42.980  1.00 31.55 ? 87   PRO C N   1 
ATOM   4927 C CA  . PRO C 1 86  ? 14.010 48.145 43.859  1.00 31.38 ? 87   PRO C CA  1 
ATOM   4928 C C   . PRO C 1 86  ? 14.635 47.345 45.018  1.00 31.07 ? 87   PRO C C   1 
ATOM   4929 O O   . PRO C 1 86  ? 13.917 46.833 45.888  1.00 30.00 ? 87   PRO C O   1 
ATOM   4930 C CB  . PRO C 1 86  ? 13.228 47.270 42.905  1.00 33.19 ? 87   PRO C CB  1 
ATOM   4931 C CG  . PRO C 1 86  ? 14.303 46.757 42.011  1.00 32.10 ? 87   PRO C CG  1 
ATOM   4932 C CD  . PRO C 1 86  ? 15.121 47.996 41.725  1.00 32.29 ? 87   PRO C CD  1 
ATOM   4933 N N   . PHE C 1 87  ? 15.962 47.228 45.017  1.00 29.00 ? 88   PHE C N   1 
ATOM   4934 C CA  . PHE C 1 87  ? 16.670 46.508 46.081  1.00 27.34 ? 88   PHE C CA  1 
ATOM   4935 C C   . PHE C 1 87  ? 16.869 47.453 47.263  1.00 25.61 ? 88   PHE C C   1 
ATOM   4936 O O   . PHE C 1 87  ? 17.890 48.133 47.357  1.00 23.99 ? 88   PHE C O   1 
ATOM   4937 C CB  . PHE C 1 87  ? 18.029 45.993 45.572  1.00 28.74 ? 88   PHE C CB  1 
ATOM   4938 C CG  . PHE C 1 87  ? 17.904 44.950 44.483  1.00 30.17 ? 88   PHE C CG  1 
ATOM   4939 C CD1 . PHE C 1 87  ? 17.948 45.314 43.144  1.00 32.05 ? 88   PHE C CD1 1 
ATOM   4940 C CD2 . PHE C 1 87  ? 17.674 43.618 44.802  1.00 31.37 ? 88   PHE C CD2 1 
ATOM   4941 C CE1 . PHE C 1 87  ? 17.760 44.361 42.135  1.00 34.32 ? 88   PHE C CE1 1 
ATOM   4942 C CE2 . PHE C 1 87  ? 17.482 42.650 43.798  1.00 31.81 ? 88   PHE C CE2 1 
ATOM   4943 C CZ  . PHE C 1 87  ? 17.525 43.026 42.466  1.00 31.90 ? 88   PHE C CZ  1 
ATOM   4944 N N   . ARG C 1 88  ? 15.878 47.500 48.150  1.00 23.41 ? 89   ARG C N   1 
ATOM   4945 C CA  . ARG C 1 88  ? 15.944 48.383 49.315  1.00 22.82 ? 89   ARG C CA  1 
ATOM   4946 C C   . ARG C 1 88  ? 14.866 47.973 50.313  1.00 21.57 ? 89   ARG C C   1 
ATOM   4947 O O   . ARG C 1 88  ? 13.945 47.225 49.973  1.00 22.53 ? 89   ARG C O   1 
ATOM   4948 C CB  . ARG C 1 88  ? 15.721 49.857 48.902  1.00 25.01 ? 89   ARG C CB  1 
ATOM   4949 C CG  . ARG C 1 88  ? 14.305 50.178 48.423  1.00 26.28 ? 89   ARG C CG  1 
ATOM   4950 C CD  . ARG C 1 88  ? 14.172 51.641 47.915  1.00 28.54 ? 89   ARG C CD  1 
ATOM   4951 N NE  . ARG C 1 88  ? 15.071 51.905 46.778  1.00 28.20 ? 89   ARG C NE  1 
ATOM   4952 C CZ  . ARG C 1 88  ? 16.080 52.774 46.778  1.00 27.72 ? 89   ARG C CZ  1 
ATOM   4953 N NH1 . ARG C 1 88  ? 16.356 53.505 47.852  1.00 29.45 ? 89   ARG C NH1 1 
ATOM   4954 N NH2 . ARG C 1 88  ? 16.837 52.896 45.697  1.00 28.46 ? 89   ARG C NH2 1 
ATOM   4955 N N   . VAL C 1 89  ? 15.011 48.439 51.550  1.00 22.74 ? 90   VAL C N   1 
ATOM   4956 C CA  . VAL C 1 89  ? 14.039 48.174 52.620  1.00 20.90 ? 90   VAL C CA  1 
ATOM   4957 C C   . VAL C 1 89  ? 13.860 49.489 53.377  1.00 20.59 ? 90   VAL C C   1 
ATOM   4958 O O   . VAL C 1 89  ? 14.637 50.420 53.182  1.00 21.40 ? 90   VAL C O   1 
ATOM   4959 C CB  . VAL C 1 89  ? 14.544 47.078 53.632  1.00 22.18 ? 90   VAL C CB  1 
ATOM   4960 C CG1 . VAL C 1 89  ? 14.592 45.712 52.950  1.00 19.33 ? 90   VAL C CG1 1 
ATOM   4961 C CG2 . VAL C 1 89  ? 15.948 47.439 54.188  1.00 21.07 ? 90   VAL C CG2 1 
ATOM   4962 N N   . SER C 1 90  ? 12.846 49.574 54.236  1.00 20.76 ? 91   SER C N   1 
ATOM   4963 C CA  . SER C 1 90  ? 12.655 50.785 55.022  1.00 22.03 ? 91   SER C CA  1 
ATOM   4964 C C   . SER C 1 90  ? 13.765 50.872 56.076  1.00 23.07 ? 91   SER C C   1 
ATOM   4965 O O   . SER C 1 90  ? 14.265 49.840 56.548  1.00 22.04 ? 91   SER C O   1 
ATOM   4966 C CB  . SER C 1 90  ? 11.293 50.762 55.724  1.00 23.15 ? 91   SER C CB  1 
ATOM   4967 O OG  . SER C 1 90  ? 10.225 50.890 54.803  1.00 24.31 ? 91   SER C OG  1 
ATOM   4968 N N   . CYS C 1 91  ? 14.153 52.098 56.430  1.00 20.04 ? 92   CYS C N   1 
ATOM   4969 C CA  . CYS C 1 91  ? 15.197 52.312 57.429  1.00 20.80 ? 92   CYS C CA  1 
ATOM   4970 C C   . CYS C 1 91  ? 14.876 53.503 58.325  1.00 19.35 ? 92   CYS C C   1 
ATOM   4971 O O   . CYS C 1 91  ? 14.123 54.400 57.932  1.00 20.68 ? 92   CYS C O   1 
ATOM   4972 C CB  . CYS C 1 91  ? 16.555 52.523 56.742  1.00 22.73 ? 92   CYS C CB  1 
ATOM   4973 S SG  . CYS C 1 91  ? 16.605 53.882 55.520  1.00 23.76 ? 92   CYS C SG  1 
ATOM   4974 N N   . MET C 1 92  ? 15.460 53.518 59.520  1.00 16.81 ? 93   MET C N   1 
ATOM   4975 C CA  . MET C 1 92  ? 15.232 54.564 60.496  1.00 15.79 ? 93   MET C CA  1 
ATOM   4976 C C   . MET C 1 92  ? 16.542 54.926 61.208  1.00 18.64 ? 93   MET C C   1 
ATOM   4977 O O   . MET C 1 92  ? 17.398 54.048 61.416  1.00 16.68 ? 93   MET C O   1 
ATOM   4978 C CB  . MET C 1 92  ? 14.191 54.067 61.527  1.00 16.27 ? 93   MET C CB  1 
ATOM   4979 C CG  . MET C 1 92  ? 13.987 54.991 62.738  1.00 19.44 ? 93   MET C CG  1 
ATOM   4980 S SD  . MET C 1 92  ? 12.629 54.424 63.811  1.00 18.62 ? 93   MET C SD  1 
ATOM   4981 C CE  . MET C 1 92  ? 12.635 55.690 65.045  1.00 18.35 ? 93   MET C CE  1 
ATOM   4982 N N   . LEU C 1 93  ? 16.692 56.212 61.552  1.00 16.78 ? 94   LEU C N   1 
ATOM   4983 C CA  . LEU C 1 93  ? 17.836 56.726 62.294  1.00 17.60 ? 94   LEU C CA  1 
ATOM   4984 C C   . LEU C 1 93  ? 17.338 57.357 63.602  1.00 19.03 ? 94   LEU C C   1 
ATOM   4985 O O   . LEU C 1 93  ? 16.421 58.190 63.575  1.00 19.95 ? 94   LEU C O   1 
ATOM   4986 C CB  . LEU C 1 93  ? 18.577 57.824 61.486  1.00 14.78 ? 94   LEU C CB  1 
ATOM   4987 C CG  . LEU C 1 93  ? 19.708 58.566 62.210  1.00 16.26 ? 94   LEU C CG  1 
ATOM   4988 C CD1 . LEU C 1 93  ? 20.821 57.560 62.580  1.00 17.29 ? 94   LEU C CD1 1 
ATOM   4989 C CD2 . LEU C 1 93  ? 20.278 59.689 61.301  1.00 15.68 ? 94   LEU C CD2 1 
ATOM   4990 N N   . ASP C 1 94  ? 17.911 56.954 64.738  1.00 19.77 ? 95   ASP C N   1 
ATOM   4991 C CA  . ASP C 1 94  ? 17.555 57.570 66.022  1.00 20.11 ? 95   ASP C CA  1 
ATOM   4992 C C   . ASP C 1 94  ? 18.648 57.432 67.091  1.00 20.20 ? 95   ASP C C   1 
ATOM   4993 O O   . ASP C 1 94  ? 18.376 57.134 68.261  1.00 19.49 ? 95   ASP C O   1 
ATOM   4994 C CB  . ASP C 1 94  ? 16.208 57.051 66.554  1.00 19.66 ? 95   ASP C CB  1 
ATOM   4995 C CG  . ASP C 1 94  ? 15.575 58.002 67.591  1.00 20.75 ? 95   ASP C CG  1 
ATOM   4996 O OD1 . ASP C 1 94  ? 15.656 59.242 67.410  1.00 20.22 ? 95   ASP C OD1 1 
ATOM   4997 O OD2 . ASP C 1 94  ? 14.981 57.516 68.585  1.00 20.24 ? 95   ASP C OD2 1 
ATOM   4998 N N   . SER C 1 95  ? 19.885 57.683 66.679  1.00 20.46 ? 96   SER C N   1 
ATOM   4999 C CA  . SER C 1 95  ? 21.029 57.662 67.586  1.00 20.29 ? 96   SER C CA  1 
ATOM   5000 C C   . SER C 1 95  ? 20.717 58.517 68.838  1.00 22.31 ? 96   SER C C   1 
ATOM   5001 O O   . SER C 1 95  ? 20.358 59.699 68.723  1.00 20.60 ? 96   SER C O   1 
ATOM   5002 C CB  . SER C 1 95  ? 22.271 58.231 66.874  1.00 20.10 ? 96   SER C CB  1 
ATOM   5003 O OG  . SER C 1 95  ? 22.672 57.411 65.783  1.00 24.69 ? 96   SER C OG  1 
ATOM   5004 N N   . ASN C 1 96  ? 20.844 57.889 70.008  1.00 23.52 ? 97   ASN C N   1 
ATOM   5005 C CA  . ASN C 1 96  ? 20.606 58.506 71.310  1.00 26.13 ? 97   ASN C CA  1 
ATOM   5006 C C   . ASN C 1 96  ? 19.201 59.099 71.461  1.00 25.43 ? 97   ASN C C   1 
ATOM   5007 O O   . ASN C 1 96  ? 18.977 59.952 72.319  1.00 28.07 ? 97   ASN C O   1 
ATOM   5008 C CB  . ASN C 1 96  ? 21.642 59.592 71.590  1.00 27.63 ? 97   ASN C CB  1 
ATOM   5009 C CG  . ASN C 1 96  ? 21.807 59.874 73.080  1.00 32.10 ? 97   ASN C CG  1 
ATOM   5010 O OD1 . ASN C 1 96  ? 22.022 61.018 73.493  1.00 31.26 ? 97   ASN C OD1 1 
ATOM   5011 N ND2 . ASN C 1 96  ? 21.719 58.822 73.893  1.00 34.03 ? 97   ASN C ND2 1 
ATOM   5012 N N   . GLY C 1 97  ? 18.261 58.639 70.645  1.00 23.10 ? 98   GLY C N   1 
ATOM   5013 C CA  . GLY C 1 97  ? 16.897 59.144 70.718  1.00 21.65 ? 98   GLY C CA  1 
ATOM   5014 C C   . GLY C 1 97  ? 16.813 60.610 70.318  1.00 22.16 ? 98   GLY C C   1 
ATOM   5015 O O   . GLY C 1 97  ? 15.834 61.290 70.659  1.00 19.37 ? 98   GLY C O   1 
ATOM   5016 N N   . SER C 1 98  ? 17.812 61.099 69.578  1.00 20.64 ? 99   SER C N   1 
ATOM   5017 C CA  . SER C 1 98  ? 17.823 62.508 69.188  1.00 23.46 ? 99   SER C CA  1 
ATOM   5018 C C   . SER C 1 98  ? 16.667 62.915 68.259  1.00 21.94 ? 99   SER C C   1 
ATOM   5019 O O   . SER C 1 98  ? 16.073 63.981 68.448  1.00 21.67 ? 99   SER C O   1 
ATOM   5020 C CB  . SER C 1 98  ? 19.165 62.869 68.546  1.00 27.13 ? 99   SER C CB  1 
ATOM   5021 O OG  . SER C 1 98  ? 20.192 62.876 69.527  1.00 28.94 ? 99   SER C OG  1 
ATOM   5022 N N   . ASN C 1 99  ? 16.336 62.076 67.279  1.00 21.59 ? 100  ASN C N   1 
ATOM   5023 C CA  . ASN C 1 99  ? 15.233 62.395 66.367  1.00 21.10 ? 100  ASN C CA  1 
ATOM   5024 C C   . ASN C 1 99  ? 13.860 62.296 67.026  1.00 20.31 ? 100  ASN C C   1 
ATOM   5025 O O   . ASN C 1 99  ? 13.028 63.192 66.863  1.00 17.84 ? 100  ASN C O   1 
ATOM   5026 C CB  . ASN C 1 99  ? 15.226 61.479 65.130  1.00 18.45 ? 100  ASN C CB  1 
ATOM   5027 C CG  . ASN C 1 99  ? 16.130 61.978 64.018  1.00 21.17 ? 100  ASN C CG  1 
ATOM   5028 O OD1 . ASN C 1 99  ? 16.331 63.184 63.853  1.00 18.23 ? 100  ASN C OD1 1 
ATOM   5029 N ND2 . ASN C 1 99  ? 16.668 61.049 63.233  1.00 19.31 ? 100  ASN C ND2 1 
ATOM   5030 N N   . THR C 1 100 ? 13.604 61.208 67.757  1.00 19.31 ? 101  THR C N   1 
ATOM   5031 C CA  . THR C 1 100 ? 12.282 61.050 68.383  1.00 18.09 ? 101  THR C CA  1 
ATOM   5032 C C   . THR C 1 100 ? 12.055 62.054 69.519  1.00 19.79 ? 101  THR C C   1 
ATOM   5033 O O   . THR C 1 100 ? 10.902 62.492 69.779  1.00 18.12 ? 101  THR C O   1 
ATOM   5034 C CB  . THR C 1 100 ? 12.037 59.562 68.856  1.00 18.22 ? 101  THR C CB  1 
ATOM   5035 O OG1 . THR C 1 100 ? 13.088 59.135 69.740  1.00 19.46 ? 101  THR C OG1 1 
ATOM   5036 C CG2 . THR C 1 100 ? 12.009 58.628 67.636  1.00 16.93 ? 101  THR C CG2 1 
ATOM   5037 N N   . THR C 1 101 ? 13.135 62.452 70.183  1.00 16.73 ? 102  THR C N   1 
ATOM   5038 C CA  . THR C 1 101 ? 13.017 63.428 71.266  1.00 18.44 ? 102  THR C CA  1 
ATOM   5039 C C   . THR C 1 101 ? 12.701 64.829 70.722  1.00 19.86 ? 102  THR C C   1 
ATOM   5040 O O   . THR C 1 101 ? 11.811 65.535 71.249  1.00 16.81 ? 102  THR C O   1 
ATOM   5041 C CB  . THR C 1 101 ? 14.327 63.523 72.092  1.00 19.16 ? 102  THR C CB  1 
ATOM   5042 O OG1 . THR C 1 101 ? 14.526 62.297 72.803  1.00 21.26 ? 102  THR C OG1 1 
ATOM   5043 C CG2 . THR C 1 101 ? 14.255 64.672 73.108  1.00 17.18 ? 102  THR C CG2 1 
ATOM   5044 N N   . ALA C 1 102 ? 13.457 65.255 69.701  1.00 16.67 ? 103  ALA C N   1 
ATOM   5045 C CA  . ALA C 1 102 ? 13.228 66.582 69.127  1.00 19.52 ? 103  ALA C CA  1 
ATOM   5046 C C   . ALA C 1 102 ? 11.863 66.639 68.442  1.00 18.00 ? 103  ALA C C   1 
ATOM   5047 O O   . ALA C 1 102 ? 11.156 67.644 68.558  1.00 17.60 ? 103  ALA C O   1 
ATOM   5048 C CB  . ALA C 1 102 ? 14.368 66.955 68.112  1.00 17.28 ? 103  ALA C CB  1 
ATOM   5049 N N   . ALA C 1 103 ? 11.488 65.576 67.724  1.00 19.75 ? 104  ALA C N   1 
ATOM   5050 C CA  . ALA C 1 103 ? 10.186 65.559 67.063  1.00 18.04 ? 104  ALA C CA  1 
ATOM   5051 C C   . ALA C 1 103 ? 9.022  65.623 68.085  1.00 18.97 ? 104  ALA C C   1 
ATOM   5052 O O   . ALA C 1 103 ? 8.039  66.341 67.853  1.00 19.54 ? 104  ALA C O   1 
ATOM   5053 C CB  . ALA C 1 103 ? 10.038 64.309 66.160  1.00 16.76 ? 104  ALA C CB  1 
ATOM   5054 N N   . ALA C 1 104 ? 9.117  64.885 69.193  1.00 18.47 ? 105  ALA C N   1 
ATOM   5055 C CA  . ALA C 1 104 ? 8.050  64.934 70.199  1.00 19.29 ? 105  ALA C CA  1 
ATOM   5056 C C   . ALA C 1 104 ? 7.940  66.329 70.806  1.00 18.20 ? 105  ALA C C   1 
ATOM   5057 O O   . ALA C 1 104 ? 6.842  66.845 70.974  1.00 16.94 ? 105  ALA C O   1 
ATOM   5058 C CB  . ALA C 1 104 ? 8.300  63.932 71.307  1.00 19.20 ? 105  ALA C CB  1 
ATOM   5059 N N   . GLY C 1 105 ? 9.086  66.928 71.138  1.00 18.39 ? 106  GLY C N   1 
ATOM   5060 C CA  . GLY C 1 105 ? 9.087  68.248 71.737  1.00 19.83 ? 106  GLY C CA  1 
ATOM   5061 C C   . GLY C 1 105 ? 8.470  69.315 70.847  1.00 21.25 ? 106  GLY C C   1 
ATOM   5062 O O   . GLY C 1 105 ? 7.595  70.079 71.286  1.00 19.10 ? 106  GLY C O   1 
ATOM   5063 N N   . VAL C 1 106 ? 8.910  69.377 69.594  1.00 19.07 ? 107  VAL C N   1 
ATOM   5064 C CA  . VAL C 1 106 ? 8.376  70.381 68.694  1.00 20.20 ? 107  VAL C CA  1 
ATOM   5065 C C   . VAL C 1 106 ? 6.892  70.143 68.400  1.00 20.52 ? 107  VAL C C   1 
ATOM   5066 O O   . VAL C 1 106 ? 6.098  71.110 68.352  1.00 22.21 ? 107  VAL C O   1 
ATOM   5067 C CB  . VAL C 1 106 ? 9.206  70.440 67.382  1.00 20.35 ? 107  VAL C CB  1 
ATOM   5068 C CG1 . VAL C 1 106 ? 8.622  71.512 66.436  1.00 22.23 ? 107  VAL C CG1 1 
ATOM   5069 C CG2 . VAL C 1 106 ? 10.679 70.813 67.721  1.00 18.17 ? 107  VAL C CG2 1 
ATOM   5070 N N   . ALA C 1 107 ? 6.493  68.876 68.228  1.00 20.17 ? 108  ALA C N   1 
ATOM   5071 C CA  . ALA C 1 107 ? 5.095  68.581 67.950  1.00 19.18 ? 108  ALA C CA  1 
ATOM   5072 C C   . ALA C 1 107 ? 4.184  69.030 69.095  1.00 19.82 ? 108  ALA C C   1 
ATOM   5073 O O   . ALA C 1 107 ? 3.117  69.602 68.851  1.00 20.70 ? 108  ALA C O   1 
ATOM   5074 C CB  . ALA C 1 107 ? 4.894  67.083 67.671  1.00 20.54 ? 108  ALA C CB  1 
ATOM   5075 N N   . LEU C 1 108 ? 4.596  68.793 70.336  1.00 17.49 ? 109  LEU C N   1 
ATOM   5076 C CA  . LEU C 1 108 ? 3.768  69.190 71.482  1.00 19.19 ? 109  LEU C CA  1 
ATOM   5077 C C   . LEU C 1 108 ? 3.582  70.709 71.554  1.00 19.97 ? 109  LEU C C   1 
ATOM   5078 O O   . LEU C 1 108 ? 2.474  71.212 71.795  1.00 19.64 ? 109  LEU C O   1 
ATOM   5079 C CB  . LEU C 1 108 ? 4.391  68.684 72.783  1.00 18.16 ? 109  LEU C CB  1 
ATOM   5080 C CG  . LEU C 1 108 ? 4.192  67.174 72.952  1.00 18.80 ? 109  LEU C CG  1 
ATOM   5081 C CD1 . LEU C 1 108 ? 5.186  66.669 73.993  1.00 19.46 ? 109  LEU C CD1 1 
ATOM   5082 C CD2 . LEU C 1 108 ? 2.725  66.854 73.349  1.00 17.10 ? 109  LEU C CD2 1 
ATOM   5083 N N   . VAL C 1 109 ? 4.671  71.438 71.362  1.00 18.38 ? 110  VAL C N   1 
ATOM   5084 C CA  . VAL C 1 109 ? 4.607  72.896 71.402  1.00 19.56 ? 110  VAL C CA  1 
ATOM   5085 C C   . VAL C 1 109 ? 3.765  73.472 70.258  1.00 20.64 ? 110  VAL C C   1 
ATOM   5086 O O   . VAL C 1 109 ? 2.956  74.392 70.465  1.00 20.77 ? 110  VAL C O   1 
ATOM   5087 C CB  . VAL C 1 109 ? 6.026  73.485 71.339  1.00 18.64 ? 110  VAL C CB  1 
ATOM   5088 C CG1 . VAL C 1 109 ? 5.976  74.999 71.115  1.00 18.97 ? 110  VAL C CG1 1 
ATOM   5089 C CG2 . VAL C 1 109 ? 6.757  73.150 72.616  1.00 15.88 ? 110  VAL C CG2 1 
ATOM   5090 N N   . VAL C 1 110 ? 3.933  72.939 69.050  1.00 20.53 ? 111  VAL C N   1 
ATOM   5091 C CA  . VAL C 1 110 ? 3.162  73.455 67.929  1.00 20.20 ? 111  VAL C CA  1 
ATOM   5092 C C   . VAL C 1 110 ? 1.653  73.222 68.141  1.00 22.69 ? 111  VAL C C   1 
ATOM   5093 O O   . VAL C 1 110 ? 0.836  74.096 67.831  1.00 21.42 ? 111  VAL C O   1 
ATOM   5094 C CB  . VAL C 1 110 ? 3.646  72.816 66.613  1.00 22.54 ? 111  VAL C CB  1 
ATOM   5095 C CG1 . VAL C 1 110 ? 2.736  73.204 65.450  1.00 20.37 ? 111  VAL C CG1 1 
ATOM   5096 C CG2 . VAL C 1 110 ? 5.089  73.263 66.337  1.00 18.37 ? 111  VAL C CG2 1 
ATOM   5097 N N   . LYS C 1 111 ? 1.280  72.059 68.674  1.00 19.19 ? 112  LYS C N   1 
ATOM   5098 C CA  . LYS C 1 111 ? -0.138 71.759 68.901  1.00 19.26 ? 112  LYS C CA  1 
ATOM   5099 C C   . LYS C 1 111 ? -0.671 72.695 69.986  1.00 19.18 ? 112  LYS C C   1 
ATOM   5100 O O   . LYS C 1 111 ? -1.771 73.261 69.857  1.00 18.85 ? 112  LYS C O   1 
ATOM   5101 C CB  . LYS C 1 111 ? -0.317 70.280 69.319  1.00 21.07 ? 112  LYS C CB  1 
ATOM   5102 C CG  . LYS C 1 111 ? -1.784 69.812 69.483  1.00 21.68 ? 112  LYS C CG  1 
ATOM   5103 C CD  . LYS C 1 111 ? -1.880 68.510 70.306  1.00 22.20 ? 112  LYS C CD  1 
ATOM   5104 C CE  . LYS C 1 111 ? -3.289 67.878 70.221  1.00 27.22 ? 112  LYS C CE  1 
ATOM   5105 N NZ  . LYS C 1 111 ? -3.458 66.728 71.179  1.00 25.90 ? 112  LYS C NZ  1 
ATOM   5106 N N   . ALA C 1 112 ? 0.113  72.891 71.042  1.00 18.77 ? 113  ALA C N   1 
ATOM   5107 C CA  . ALA C 1 112 ? -0.306 73.776 72.127  1.00 21.46 ? 113  ALA C CA  1 
ATOM   5108 C C   . ALA C 1 112 ? -0.424 75.220 71.630  1.00 22.63 ? 113  ALA C C   1 
ATOM   5109 O O   . ALA C 1 112 ? -1.199 76.008 72.185  1.00 23.35 ? 113  ALA C O   1 
ATOM   5110 C CB  . ALA C 1 112 ? 0.686  73.701 73.289  1.00 20.14 ? 113  ALA C CB  1 
ATOM   5111 N N   . ALA C 1 113 ? 0.329  75.563 70.586  1.00 22.06 ? 114  ALA C N   1 
ATOM   5112 C CA  . ALA C 1 113 ? 0.289  76.912 70.020  1.00 23.14 ? 114  ALA C CA  1 
ATOM   5113 C C   . ALA C 1 113 ? -0.854 77.082 69.017  1.00 23.88 ? 114  ALA C C   1 
ATOM   5114 O O   . ALA C 1 113 ? -0.894 78.059 68.279  1.00 25.97 ? 114  ALA C O   1 
ATOM   5115 C CB  . ALA C 1 113 ? 1.612  77.238 69.325  1.00 24.30 ? 114  ALA C CB  1 
ATOM   5116 N N   . GLY C 1 114 ? -1.765 76.124 68.964  1.00 22.65 ? 115  GLY C N   1 
ATOM   5117 C CA  . GLY C 1 114 ? -2.873 76.260 68.041  1.00 22.19 ? 115  GLY C CA  1 
ATOM   5118 C C   . GLY C 1 114 ? -2.646 75.622 66.682  1.00 21.68 ? 115  GLY C C   1 
ATOM   5119 O O   . GLY C 1 114 ? -3.457 75.777 65.792  1.00 21.63 ? 115  GLY C O   1 
ATOM   5120 N N   . GLY C 1 115 ? -1.540 74.914 66.516  1.00 22.69 ? 116  GLY C N   1 
ATOM   5121 C CA  . GLY C 1 115 ? -1.286 74.262 65.242  1.00 22.89 ? 116  GLY C CA  1 
ATOM   5122 C C   . GLY C 1 115 ? -0.401 75.039 64.282  1.00 23.25 ? 116  GLY C C   1 
ATOM   5123 O O   . GLY C 1 115 ? -0.067 74.527 63.216  1.00 22.98 ? 116  GLY C O   1 
ATOM   5124 N N   . SER C 1 116 ? -0.017 76.259 64.644  1.00 24.04 ? 117  SER C N   1 
ATOM   5125 C CA  . SER C 1 116 ? 0.837  77.071 63.775  1.00 26.05 ? 117  SER C CA  1 
ATOM   5126 C C   . SER C 1 116 ? 1.787  77.959 64.551  1.00 26.29 ? 117  SER C C   1 
ATOM   5127 O O   . SER C 1 116 ? 1.407  78.531 65.571  1.00 29.13 ? 117  SER C O   1 
ATOM   5128 C CB  . SER C 1 116 ? -0.024 77.951 62.844  1.00 30.58 ? 117  SER C CB  1 
ATOM   5129 O OG  . SER C 1 116 ? 0.777  78.806 62.018  1.00 30.41 ? 117  SER C OG  1 
ATOM   5130 N N   . VAL C 1 117 ? 3.027  78.069 64.071  1.00 24.46 ? 118  VAL C N   1 
ATOM   5131 C CA  . VAL C 1 117 ? 4.036  78.931 64.691  1.00 24.40 ? 118  VAL C CA  1 
ATOM   5132 C C   . VAL C 1 117 ? 4.681  79.804 63.598  1.00 24.29 ? 118  VAL C C   1 
ATOM   5133 O O   . VAL C 1 117 ? 5.686  80.458 63.817  1.00 23.33 ? 118  VAL C O   1 
ATOM   5134 C CB  . VAL C 1 117 ? 5.148  78.123 65.379  1.00 24.10 ? 118  VAL C CB  1 
ATOM   5135 C CG1 . VAL C 1 117 ? 4.593  77.415 66.600  1.00 24.34 ? 118  VAL C CG1 1 
ATOM   5136 C CG2 . VAL C 1 117 ? 5.736  77.124 64.394  1.00 24.14 ? 118  VAL C CG2 1 
ATOM   5137 N N   . LYS C 1 118 ? 4.084  79.788 62.419  1.00 26.54 ? 119  LYS C N   1 
ATOM   5138 C CA  . LYS C 1 118 ? 4.585  80.565 61.296  1.00 30.38 ? 119  LYS C CA  1 
ATOM   5139 C C   . LYS C 1 118 ? 4.714  82.032 61.688  1.00 31.89 ? 119  LYS C C   1 
ATOM   5140 O O   . LYS C 1 118 ? 3.803  82.617 62.276  1.00 31.76 ? 119  LYS C O   1 
ATOM   5141 C CB  . LYS C 1 118 ? 3.613  80.418 60.124  1.00 32.59 ? 119  LYS C CB  1 
ATOM   5142 C CG  . LYS C 1 118 ? 3.991  81.134 58.850  1.00 36.98 ? 119  LYS C CG  1 
ATOM   5143 C CD  . LYS C 1 118 ? 2.893  80.850 57.832  1.00 41.30 ? 119  LYS C CD  1 
ATOM   5144 C CE  . LYS C 1 118 ? 3.201  81.391 56.441  1.00 42.80 ? 119  LYS C CE  1 
ATOM   5145 N NZ  . LYS C 1 118 ? 2.028  81.153 55.542  1.00 43.73 ? 119  LYS C NZ  1 
ATOM   5146 N N   . GLY C 1 119 ? 5.865  82.620 61.388  1.00 32.56 ? 120  GLY C N   1 
ATOM   5147 C CA  . GLY C 1 119 ? 6.071  84.022 61.689  1.00 32.93 ? 120  GLY C CA  1 
ATOM   5148 C C   . GLY C 1 119 ? 6.423  84.386 63.112  1.00 32.25 ? 120  GLY C C   1 
ATOM   5149 O O   . GLY C 1 119 ? 6.704  85.548 63.383  1.00 33.11 ? 120  GLY C O   1 
ATOM   5150 N N   . LYS C 1 120 ? 6.399  83.430 64.038  1.00 31.41 ? 121  LYS C N   1 
ATOM   5151 C CA  . LYS C 1 120 ? 6.744  83.766 65.419  1.00 30.05 ? 121  LYS C CA  1 
ATOM   5152 C C   . LYS C 1 120 ? 8.189  83.412 65.715  1.00 27.86 ? 121  LYS C C   1 
ATOM   5153 O O   . LYS C 1 120 ? 8.787  82.621 65.002  1.00 27.89 ? 121  LYS C O   1 
ATOM   5154 C CB  . LYS C 1 120 ? 5.797  83.083 66.404  1.00 32.13 ? 121  LYS C CB  1 
ATOM   5155 C CG  . LYS C 1 120 ? 4.427  83.780 66.479  1.00 35.14 ? 121  LYS C CG  1 
ATOM   5156 C CD  . LYS C 1 120 ? 3.533  83.169 67.553  1.00 34.85 ? 121  LYS C CD  1 
ATOM   5157 C CE  . LYS C 1 120 ? 2.145  83.805 67.553  1.00 34.37 ? 121  LYS C CE  1 
ATOM   5158 N NZ  . LYS C 1 120 ? 1.302  83.181 68.607  1.00 31.90 ? 121  LYS C NZ  1 
ATOM   5159 N N   . LYS C 1 121 ? 8.744  84.025 66.756  1.00 27.25 ? 122  LYS C N   1 
ATOM   5160 C CA  . LYS C 1 121 ? 10.137 83.805 67.120  1.00 28.64 ? 122  LYS C CA  1 
ATOM   5161 C C   . LYS C 1 121 ? 10.354 82.690 68.148  1.00 26.80 ? 122  LYS C C   1 
ATOM   5162 O O   . LYS C 1 121 ? 9.775  82.714 69.235  1.00 24.30 ? 122  LYS C O   1 
ATOM   5163 C CB  . LYS C 1 121 ? 10.745 85.113 67.652  1.00 31.94 ? 122  LYS C CB  1 
ATOM   5164 C CG  . LYS C 1 121 ? 12.274 85.077 67.778  1.00 35.02 ? 122  LYS C CG  1 
ATOM   5165 C CD  . LYS C 1 121 ? 12.851 86.383 68.310  1.00 39.79 ? 122  LYS C CD  1 
ATOM   5166 C CE  . LYS C 1 121 ? 14.378 86.328 68.341  1.00 39.26 ? 122  LYS C CE  1 
ATOM   5167 N NZ  . LYS C 1 121 ? 14.982 87.600 68.814  1.00 42.24 ? 122  LYS C NZ  1 
ATOM   5168 N N   . ALA C 1 122 ? 11.210 81.733 67.794  1.00 24.08 ? 123  ALA C N   1 
ATOM   5169 C CA  . ALA C 1 122 ? 11.543 80.610 68.669  1.00 22.77 ? 123  ALA C CA  1 
ATOM   5170 C C   . ALA C 1 122 ? 13.041 80.634 68.940  1.00 24.11 ? 123  ALA C C   1 
ATOM   5171 O O   . ALA C 1 122 ? 13.842 80.747 68.018  1.00 25.03 ? 123  ALA C O   1 
ATOM   5172 C CB  . ALA C 1 122 ? 11.151 79.289 68.008  1.00 22.31 ? 123  ALA C CB  1 
ATOM   5173 N N   . VAL C 1 123 ? 13.418 80.534 70.207  1.00 21.53 ? 124  VAL C N   1 
ATOM   5174 C CA  . VAL C 1 123 ? 14.817 80.552 70.580  1.00 21.14 ? 124  VAL C CA  1 
ATOM   5175 C C   . VAL C 1 123 ? 15.198 79.198 71.180  1.00 21.69 ? 124  VAL C C   1 
ATOM   5176 O O   . VAL C 1 123 ? 14.511 78.689 72.068  1.00 21.82 ? 124  VAL C O   1 
ATOM   5177 C CB  . VAL C 1 123 ? 15.091 81.677 71.629  1.00 21.64 ? 124  VAL C CB  1 
ATOM   5178 C CG1 . VAL C 1 123 ? 16.532 81.625 72.111  1.00 24.52 ? 124  VAL C CG1 1 
ATOM   5179 C CG2 . VAL C 1 123 ? 14.806 83.073 71.001  1.00 22.75 ? 124  VAL C CG2 1 
ATOM   5180 N N   . VAL C 1 124 ? 16.280 78.602 70.686  1.00 21.19 ? 125  VAL C N   1 
ATOM   5181 C CA  . VAL C 1 124 ? 16.746 77.326 71.237  1.00 19.67 ? 125  VAL C CA  1 
ATOM   5182 C C   . VAL C 1 124 ? 18.061 77.547 72.019  1.00 21.09 ? 125  VAL C C   1 
ATOM   5183 O O   . VAL C 1 124 ? 19.120 77.726 71.411  1.00 22.53 ? 125  VAL C O   1 
ATOM   5184 C CB  . VAL C 1 124 ? 17.012 76.280 70.130  1.00 15.83 ? 125  VAL C CB  1 
ATOM   5185 C CG1 . VAL C 1 124 ? 17.398 74.939 70.782  1.00 16.27 ? 125  VAL C CG1 1 
ATOM   5186 C CG2 . VAL C 1 124 ? 15.773 76.109 69.225  1.00 16.17 ? 125  VAL C CG2 1 
ATOM   5187 N N   . LEU C 1 125 ? 17.997 77.542 73.354  1.00 19.10 ? 126  LEU C N   1 
ATOM   5188 C CA  . LEU C 1 125 ? 19.183 77.746 74.192  1.00 19.19 ? 126  LEU C CA  1 
ATOM   5189 C C   . LEU C 1 125 ? 20.037 76.448 74.196  1.00 20.44 ? 126  LEU C C   1 
ATOM   5190 O O   . LEU C 1 125 ? 19.484 75.348 74.219  1.00 21.50 ? 126  LEU C O   1 
ATOM   5191 C CB  . LEU C 1 125 ? 18.769 78.151 75.628  1.00 18.57 ? 126  LEU C CB  1 
ATOM   5192 C CG  . LEU C 1 125 ? 18.096 79.546 75.758  1.00 20.68 ? 126  LEU C CG  1 
ATOM   5193 C CD1 . LEU C 1 125 ? 17.706 79.863 77.213  1.00 18.62 ? 126  LEU C CD1 1 
ATOM   5194 C CD2 . LEU C 1 125 ? 19.067 80.627 75.230  1.00 18.06 ? 126  LEU C CD2 1 
ATOM   5195 N N   . ALA C 1 126 ? 21.365 76.602 74.156  1.00 22.53 ? 127  ALA C N   1 
ATOM   5196 C CA  . ALA C 1 126 ? 22.325 75.472 74.090  1.00 21.80 ? 127  ALA C CA  1 
ATOM   5197 C C   . ALA C 1 126 ? 21.900 74.551 72.946  1.00 23.48 ? 127  ALA C C   1 
ATOM   5198 O O   . ALA C 1 126 ? 21.926 73.320 73.069  1.00 25.74 ? 127  ALA C O   1 
ATOM   5199 C CB  . ALA C 1 126 ? 22.341 74.696 75.417  1.00 21.78 ? 127  ALA C CB  1 
ATOM   5200 N N   . GLY C 1 127 ? 21.507 75.146 71.824  1.00 22.90 ? 128  GLY C N   1 
ATOM   5201 C CA  . GLY C 1 127 ? 21.035 74.355 70.694  1.00 21.88 ? 128  GLY C CA  1 
ATOM   5202 C C   . GLY C 1 127 ? 22.073 73.756 69.756  1.00 22.65 ? 128  GLY C C   1 
ATOM   5203 O O   . GLY C 1 127 ? 21.730 73.351 68.641  1.00 22.81 ? 128  GLY C O   1 
ATOM   5204 N N   . THR C 1 128 ? 23.316 73.655 70.213  1.00 22.02 ? 129  THR C N   1 
ATOM   5205 C CA  . THR C 1 128 ? 24.395 73.131 69.382  1.00 22.68 ? 129  THR C CA  1 
ATOM   5206 C C   . THR C 1 128 ? 24.552 71.608 69.410  1.00 23.29 ? 129  THR C C   1 
ATOM   5207 O O   . THR C 1 128 ? 25.364 71.043 68.649  1.00 24.43 ? 129  THR C O   1 
ATOM   5208 C CB  . THR C 1 128 ? 25.731 73.795 69.766  1.00 22.57 ? 129  THR C CB  1 
ATOM   5209 O OG1 . THR C 1 128 ? 25.948 73.663 71.170  1.00 23.81 ? 129  THR C OG1 1 
ATOM   5210 C CG2 . THR C 1 128 ? 25.718 75.273 69.379  1.00 24.24 ? 129  THR C CG2 1 
ATOM   5211 N N   . GLY C 1 129 ? 23.789 70.956 70.287  1.00 21.28 ? 130  GLY C N   1 
ATOM   5212 C CA  . GLY C 1 129 ? 23.821 69.502 70.385  1.00 21.95 ? 130  GLY C CA  1 
ATOM   5213 C C   . GLY C 1 129 ? 22.860 68.899 69.379  1.00 22.19 ? 130  GLY C C   1 
ATOM   5214 O O   . GLY C 1 129 ? 22.087 69.630 68.757  1.00 21.90 ? 130  GLY C O   1 
ATOM   5215 N N   . PRO C 1 130 ? 22.856 67.567 69.201  1.00 21.38 ? 131  PRO C N   1 
ATOM   5216 C CA  . PRO C 1 130 ? 21.925 67.003 68.219  1.00 21.53 ? 131  PRO C CA  1 
ATOM   5217 C C   . PRO C 1 130 ? 20.440 67.264 68.481  1.00 18.54 ? 131  PRO C C   1 
ATOM   5218 O O   . PRO C 1 130 ? 19.669 67.464 67.544  1.00 19.01 ? 131  PRO C O   1 
ATOM   5219 C CB  . PRO C 1 130 ? 22.301 65.506 68.189  1.00 23.04 ? 131  PRO C CB  1 
ATOM   5220 C CG  . PRO C 1 130 ? 22.863 65.246 69.555  1.00 25.16 ? 131  PRO C CG  1 
ATOM   5221 C CD  . PRO C 1 130 ? 23.660 66.520 69.866  1.00 23.33 ? 131  PRO C CD  1 
ATOM   5222 N N   . VAL C 1 131 ? 20.032 67.297 69.744  1.00 19.00 ? 132  VAL C N   1 
ATOM   5223 C CA  . VAL C 1 131 ? 18.617 67.523 70.021  1.00 19.98 ? 132  VAL C CA  1 
ATOM   5224 C C   . VAL C 1 131 ? 18.254 68.976 69.694  1.00 20.36 ? 132  VAL C C   1 
ATOM   5225 O O   . VAL C 1 131 ? 17.199 69.251 69.103  1.00 18.92 ? 132  VAL C O   1 
ATOM   5226 C CB  . VAL C 1 131 ? 18.287 67.183 71.490  1.00 18.59 ? 132  VAL C CB  1 
ATOM   5227 C CG1 . VAL C 1 131 ? 16.882 67.633 71.824  1.00 23.08 ? 132  VAL C CG1 1 
ATOM   5228 C CG2 . VAL C 1 131 ? 18.404 65.637 71.694  1.00 19.14 ? 132  VAL C CG2 1 
ATOM   5229 N N   . GLY C 1 132 ? 19.136 69.889 70.092  1.00 20.21 ? 133  GLY C N   1 
ATOM   5230 C CA  . GLY C 1 132 ? 18.942 71.302 69.818  1.00 19.37 ? 133  GLY C CA  1 
ATOM   5231 C C   . GLY C 1 132 ? 18.923 71.565 68.329  1.00 19.79 ? 133  GLY C C   1 
ATOM   5232 O O   . GLY C 1 132 ? 18.087 72.318 67.836  1.00 20.77 ? 133  GLY C O   1 
ATOM   5233 N N   . MET C 1 133 ? 19.844 70.962 67.584  1.00 19.52 ? 134  MET C N   1 
ATOM   5234 C CA  . MET C 1 133 ? 19.877 71.179 66.138  1.00 18.81 ? 134  MET C CA  1 
ATOM   5235 C C   . MET C 1 133 ? 18.653 70.617 65.402  1.00 21.67 ? 134  MET C C   1 
ATOM   5236 O O   . MET C 1 133 ? 18.127 71.250 64.470  1.00 20.41 ? 134  MET C O   1 
ATOM   5237 C CB  . MET C 1 133 ? 21.181 70.601 65.540  1.00 19.90 ? 134  MET C CB  1 
ATOM   5238 C CG  . MET C 1 133 ? 22.451 71.317 66.063  1.00 18.77 ? 134  MET C CG  1 
ATOM   5239 S SD  . MET C 1 133 ? 24.016 70.545 65.492  1.00 22.74 ? 134  MET C SD  1 
ATOM   5240 C CE  . MET C 1 133 ? 23.736 70.619 63.828  1.00 18.96 ? 134  MET C CE  1 
ATOM   5241 N N   . ARG C 1 134 ? 18.192 69.434 65.798  1.00 18.91 ? 135  ARG C N   1 
ATOM   5242 C CA  . ARG C 1 134 ? 17.016 68.852 65.153  1.00 21.27 ? 135  ARG C CA  1 
ATOM   5243 C C   . ARG C 1 134 ? 15.777 69.671 65.536  1.00 19.27 ? 135  ARG C C   1 
ATOM   5244 O O   . ARG C 1 134 ? 14.875 69.871 64.720  1.00 19.95 ? 135  ARG C O   1 
ATOM   5245 C CB  . ARG C 1 134 ? 16.816 67.398 65.582  1.00 22.32 ? 135  ARG C CB  1 
ATOM   5246 C CG  . ARG C 1 134 ? 17.863 66.408 65.022  1.00 25.99 ? 135  ARG C CG  1 
ATOM   5247 C CD  . ARG C 1 134 ? 18.008 66.477 63.496  1.00 28.04 ? 135  ARG C CD  1 
ATOM   5248 N NE  . ARG C 1 134 ? 18.221 65.153 62.883  1.00 31.90 ? 135  ARG C NE  1 
ATOM   5249 C CZ  . ARG C 1 134 ? 19.311 64.783 62.209  1.00 33.93 ? 135  ARG C CZ  1 
ATOM   5250 N NH1 . ARG C 1 134 ? 20.332 65.621 62.051  1.00 32.65 ? 135  ARG C NH1 1 
ATOM   5251 N NH2 . ARG C 1 134 ? 19.362 63.584 61.641  1.00 32.91 ? 135  ARG C NH2 1 
ATOM   5252 N N   . SER C 1 135 ? 15.741 70.154 66.774  1.00 21.19 ? 136  SER C N   1 
ATOM   5253 C CA  . SER C 1 135 ? 14.596 70.964 67.196  1.00 20.62 ? 136  SER C CA  1 
ATOM   5254 C C   . SER C 1 135 ? 14.525 72.241 66.328  1.00 21.13 ? 136  SER C C   1 
ATOM   5255 O O   . SER C 1 135 ? 13.451 72.608 65.840  1.00 20.44 ? 136  SER C O   1 
ATOM   5256 C CB  . SER C 1 135 ? 14.727 71.320 68.674  1.00 18.47 ? 136  SER C CB  1 
ATOM   5257 O OG  . SER C 1 135 ? 14.424 70.190 69.485  1.00 18.51 ? 136  SER C OG  1 
ATOM   5258 N N   . ALA C 1 136 ? 15.676 72.880 66.105  1.00 20.81 ? 137  ALA C N   1 
ATOM   5259 C CA  . ALA C 1 136 ? 15.732 74.109 65.307  1.00 19.97 ? 137  ALA C CA  1 
ATOM   5260 C C   . ALA C 1 136 ? 15.269 73.842 63.892  1.00 21.94 ? 137  ALA C C   1 
ATOM   5261 O O   . ALA C 1 136 ? 14.547 74.651 63.302  1.00 23.09 ? 137  ALA C O   1 
ATOM   5262 C CB  . ALA C 1 136 ? 17.170 74.680 65.298  1.00 19.58 ? 137  ALA C CB  1 
ATOM   5263 N N   . ALA C 1 137 ? 15.683 72.701 63.339  1.00 21.30 ? 138  ALA C N   1 
ATOM   5264 C CA  . ALA C 1 137 ? 15.298 72.338 61.973  1.00 21.29 ? 138  ALA C CA  1 
ATOM   5265 C C   . ALA C 1 137 ? 13.788 72.151 61.764  1.00 23.12 ? 138  ALA C C   1 
ATOM   5266 O O   . ALA C 1 137 ? 13.229 72.593 60.744  1.00 24.58 ? 138  ALA C O   1 
ATOM   5267 C CB  . ALA C 1 137 ? 16.029 71.059 61.553  1.00 19.94 ? 138  ALA C CB  1 
ATOM   5268 N N   . LEU C 1 138 ? 13.125 71.487 62.712  1.00 19.85 ? 139  LEU C N   1 
ATOM   5269 C CA  . LEU C 1 138 ? 11.694 71.241 62.581  1.00 20.36 ? 139  LEU C CA  1 
ATOM   5270 C C   . LEU C 1 138 ? 10.895 72.524 62.776  1.00 19.57 ? 139  LEU C C   1 
ATOM   5271 O O   . LEU C 1 138 ? 9.881  72.749 62.100  1.00 21.78 ? 139  LEU C O   1 
ATOM   5272 C CB  . LEU C 1 138 ? 11.243 70.165 63.580  1.00 17.11 ? 139  LEU C CB  1 
ATOM   5273 C CG  . LEU C 1 138 ? 11.957 68.814 63.386  1.00 19.50 ? 139  LEU C CG  1 
ATOM   5274 C CD1 . LEU C 1 138 ? 11.555 67.854 64.537  1.00 18.80 ? 139  LEU C CD1 1 
ATOM   5275 C CD2 . LEU C 1 138 ? 11.599 68.227 62.023  1.00 18.15 ? 139  LEU C CD2 1 
ATOM   5276 N N   . LEU C 1 139 ? 11.353 73.348 63.712  1.00 21.09 ? 140  LEU C N   1 
ATOM   5277 C CA  . LEU C 1 139 ? 10.729 74.649 63.994  1.00 23.64 ? 140  LEU C CA  1 
ATOM   5278 C C   . LEU C 1 139 ? 10.849 75.556 62.749  1.00 24.06 ? 140  LEU C C   1 
ATOM   5279 O O   . LEU C 1 139 ? 9.883  76.214 62.342  1.00 24.67 ? 140  LEU C O   1 
ATOM   5280 C CB  . LEU C 1 139 ? 11.430 75.299 65.187  1.00 21.95 ? 140  LEU C CB  1 
ATOM   5281 C CG  . LEU C 1 139 ? 11.076 74.783 66.587  1.00 21.53 ? 140  LEU C CG  1 
ATOM   5282 C CD1 . LEU C 1 139 ? 12.118 75.245 67.624  1.00 19.02 ? 140  LEU C CD1 1 
ATOM   5283 C CD2 . LEU C 1 139 ? 9.672  75.309 66.955  1.00 21.00 ? 140  LEU C CD2 1 
ATOM   5284 N N   . ALA C 1 140 ? 12.029 75.587 62.139  1.00 25.03 ? 141  ALA C N   1 
ATOM   5285 C CA  . ALA C 1 140 ? 12.210 76.404 60.940  1.00 25.61 ? 141  ALA C CA  1 
ATOM   5286 C C   . ALA C 1 140 ? 11.313 75.854 59.815  1.00 25.87 ? 141  ALA C C   1 
ATOM   5287 O O   . ALA C 1 140 ? 10.733 76.614 59.036  1.00 26.86 ? 141  ALA C O   1 
ATOM   5288 C CB  . ALA C 1 140 ? 13.712 76.426 60.518  1.00 22.26 ? 141  ALA C CB  1 
ATOM   5289 N N   . GLY C 1 141 ? 11.172 74.536 59.746  1.00 25.61 ? 142  GLY C N   1 
ATOM   5290 C CA  . GLY C 1 141 ? 10.311 73.948 58.733  1.00 25.52 ? 142  GLY C CA  1 
ATOM   5291 C C   . GLY C 1 141 ? 8.844  74.359 58.910  1.00 27.33 ? 142  GLY C C   1 
ATOM   5292 O O   . GLY C 1 141 ? 8.061  74.342 57.953  1.00 27.30 ? 142  GLY C O   1 
ATOM   5293 N N   . GLU C 1 142 ? 8.473  74.736 60.131  1.00 28.15 ? 143  GLU C N   1 
ATOM   5294 C CA  . GLU C 1 142 ? 7.114  75.164 60.433  1.00 28.01 ? 143  GLU C CA  1 
ATOM   5295 C C   . GLU C 1 142 ? 6.942  76.661 60.145  1.00 27.98 ? 143  GLU C C   1 
ATOM   5296 O O   . GLU C 1 142 ? 5.861  77.224 60.356  1.00 27.35 ? 143  GLU C O   1 
ATOM   5297 C CB  . GLU C 1 142 ? 6.790  74.890 61.907  1.00 28.59 ? 143  GLU C CB  1 
ATOM   5298 C CG  . GLU C 1 142 ? 6.485  73.425 62.224  1.00 28.02 ? 143  GLU C CG  1 
ATOM   5299 C CD  . GLU C 1 142 ? 5.053  73.050 61.882  1.00 31.00 ? 143  GLU C CD  1 
ATOM   5300 O OE1 . GLU C 1 142 ? 4.667  71.885 62.119  1.00 27.02 ? 143  GLU C OE1 1 
ATOM   5301 O OE2 . GLU C 1 142 ? 4.313  73.932 61.378  1.00 28.68 ? 143  GLU C OE2 1 
ATOM   5302 N N   . GLY C 1 143 ? 8.014  77.299 59.689  1.00 27.78 ? 144  GLY C N   1 
ATOM   5303 C CA  . GLY C 1 143 ? 7.950  78.714 59.363  1.00 28.32 ? 144  GLY C CA  1 
ATOM   5304 C C   . GLY C 1 143 ? 8.265  79.655 60.503  1.00 29.40 ? 144  GLY C C   1 
ATOM   5305 O O   . GLY C 1 143 ? 8.007  80.854 60.402  1.00 27.20 ? 144  GLY C O   1 
ATOM   5306 N N   . ALA C 1 144 ? 8.815  79.143 61.603  1.00 28.67 ? 145  ALA C N   1 
ATOM   5307 C CA  . ALA C 1 144 ? 9.149  80.040 62.708  1.00 28.23 ? 145  ALA C CA  1 
ATOM   5308 C C   . ALA C 1 144 ? 10.483 80.725 62.414  1.00 27.84 ? 145  ALA C C   1 
ATOM   5309 O O   . ALA C 1 144 ? 11.240 80.271 61.561  1.00 28.70 ? 145  ALA C O   1 
ATOM   5310 C CB  . ALA C 1 144 ? 9.247  79.264 64.019  1.00 27.27 ? 145  ALA C CB  1 
ATOM   5311 N N   . GLU C 1 145 ? 10.764 81.820 63.113  1.00 27.77 ? 146  GLU C N   1 
ATOM   5312 C CA  . GLU C 1 145 ? 12.037 82.515 62.963  1.00 30.43 ? 146  GLU C CA  1 
ATOM   5313 C C   . GLU C 1 145 ? 12.832 81.940 64.119  1.00 28.99 ? 146  GLU C C   1 
ATOM   5314 O O   . GLU C 1 145 ? 12.500 82.181 65.284  1.00 28.95 ? 146  GLU C O   1 
ATOM   5315 C CB  . GLU C 1 145 ? 11.846 84.026 63.112  1.00 33.75 ? 146  GLU C CB  1 
ATOM   5316 C CG  . GLU C 1 145 ? 10.923 84.587 62.047  1.00 39.97 ? 146  GLU C CG  1 
ATOM   5317 C CD  . GLU C 1 145 ? 10.561 86.055 62.256  1.00 46.16 ? 146  GLU C CD  1 
ATOM   5318 O OE1 . GLU C 1 145 ? 9.613  86.530 61.567  1.00 46.23 ? 146  GLU C OE1 1 
ATOM   5319 O OE2 . GLU C 1 145 ? 11.221 86.725 63.097  1.00 47.33 ? 146  GLU C OE2 1 
ATOM   5320 N N   . VAL C 1 146 ? 13.866 81.159 63.791  1.00 27.76 ? 147  VAL C N   1 
ATOM   5321 C CA  . VAL C 1 146 ? 14.682 80.455 64.791  1.00 25.20 ? 147  VAL C CA  1 
ATOM   5322 C C   . VAL C 1 146 ? 16.089 80.993 65.067  1.00 26.19 ? 147  VAL C C   1 
ATOM   5323 O O   . VAL C 1 146 ? 16.845 81.275 64.141  1.00 27.76 ? 147  VAL C O   1 
ATOM   5324 C CB  . VAL C 1 146 ? 14.833 78.954 64.387  1.00 24.33 ? 147  VAL C CB  1 
ATOM   5325 C CG1 . VAL C 1 146 ? 15.476 78.178 65.518  1.00 24.26 ? 147  VAL C CG1 1 
ATOM   5326 C CG2 . VAL C 1 146 ? 13.479 78.353 64.006  1.00 21.63 ? 147  VAL C CG2 1 
ATOM   5327 N N   . VAL C 1 147 ? 16.434 81.120 66.346  1.00 26.54 ? 148  VAL C N   1 
ATOM   5328 C CA  . VAL C 1 147 ? 17.765 81.560 66.761  1.00 25.78 ? 148  VAL C CA  1 
ATOM   5329 C C   . VAL C 1 147 ? 18.397 80.455 67.636  1.00 26.73 ? 148  VAL C C   1 
ATOM   5330 O O   . VAL C 1 147 ? 17.919 80.157 68.742  1.00 23.13 ? 148  VAL C O   1 
ATOM   5331 C CB  . VAL C 1 147 ? 17.721 82.870 67.595  1.00 27.42 ? 148  VAL C CB  1 
ATOM   5332 C CG1 . VAL C 1 147 ? 19.123 83.258 68.009  1.00 25.90 ? 148  VAL C CG1 1 
ATOM   5333 C CG2 . VAL C 1 147 ? 17.086 84.016 66.771  1.00 27.40 ? 148  VAL C CG2 1 
ATOM   5334 N N   . LEU C 1 148 ? 19.478 79.871 67.130  1.00 25.59 ? 149  LEU C N   1 
ATOM   5335 C CA  . LEU C 1 148 ? 20.205 78.796 67.797  1.00 23.26 ? 149  LEU C CA  1 
ATOM   5336 C C   . LEU C 1 148 ? 21.360 79.389 68.615  1.00 24.75 ? 149  LEU C C   1 
ATOM   5337 O O   . LEU C 1 148 ? 22.289 79.987 68.060  1.00 25.70 ? 149  LEU C O   1 
ATOM   5338 C CB  . LEU C 1 148 ? 20.695 77.834 66.706  1.00 24.16 ? 149  LEU C CB  1 
ATOM   5339 C CG  . LEU C 1 148 ? 21.181 76.422 67.075  1.00 22.30 ? 149  LEU C CG  1 
ATOM   5340 C CD1 . LEU C 1 148 ? 21.110 75.528 65.852  1.00 22.11 ? 149  LEU C CD1 1 
ATOM   5341 C CD2 . LEU C 1 148 ? 22.580 76.488 67.623  1.00 23.02 ? 149  LEU C CD2 1 
ATOM   5342 N N   . CYS C 1 149 ? 21.292 79.256 69.939  1.00 22.72 ? 150  CYS C N   1 
ATOM   5343 C CA  . CYS C 1 149 ? 22.311 79.820 70.823  1.00 24.32 ? 150  CYS C CA  1 
ATOM   5344 C C   . CYS C 1 149 ? 23.300 78.830 71.434  1.00 27.00 ? 150  CYS C C   1 
ATOM   5345 O O   . CYS C 1 149 ? 22.975 77.658 71.661  1.00 26.11 ? 150  CYS C O   1 
ATOM   5346 C CB  . CYS C 1 149 ? 21.634 80.566 71.967  1.00 24.18 ? 150  CYS C CB  1 
ATOM   5347 S SG  . CYS C 1 149 ? 20.431 81.782 71.400  1.00 25.78 ? 150  CYS C SG  1 
ATOM   5348 N N   . GLY C 1 150 ? 24.484 79.345 71.760  1.00 26.53 ? 151  GLY C N   1 
ATOM   5349 C CA  . GLY C 1 150 ? 25.529 78.548 72.374  1.00 25.92 ? 151  GLY C CA  1 
ATOM   5350 C C   . GLY C 1 150 ? 26.533 79.496 73.006  1.00 25.70 ? 151  GLY C C   1 
ATOM   5351 O O   . GLY C 1 150 ? 26.514 80.693 72.718  1.00 26.99 ? 151  GLY C O   1 
ATOM   5352 N N   . ARG C 1 151 ? 27.408 78.973 73.852  1.00 25.96 ? 152  ARG C N   1 
ATOM   5353 C CA  . ARG C 1 151 ? 28.399 79.798 74.544  1.00 27.44 ? 152  ARG C CA  1 
ATOM   5354 C C   . ARG C 1 151 ? 29.465 80.441 73.652  1.00 29.27 ? 152  ARG C C   1 
ATOM   5355 O O   . ARG C 1 151 ? 30.127 81.385 74.078  1.00 29.38 ? 152  ARG C O   1 
ATOM   5356 C CB  . ARG C 1 151 ? 29.096 78.984 75.633  1.00 26.06 ? 152  ARG C CB  1 
ATOM   5357 C CG  . ARG C 1 151 ? 28.284 78.737 76.901  1.00 24.72 ? 152  ARG C CG  1 
ATOM   5358 C CD  . ARG C 1 151 ? 28.945 77.652 77.730  1.00 28.22 ? 152  ARG C CD  1 
ATOM   5359 N NE  . ARG C 1 151 ? 29.094 76.409 76.957  1.00 28.11 ? 152  ARG C NE  1 
ATOM   5360 C CZ  . ARG C 1 151 ? 29.740 75.329 77.384  1.00 28.66 ? 152  ARG C CZ  1 
ATOM   5361 N NH1 . ARG C 1 151 ? 30.303 75.321 78.590  1.00 28.99 ? 152  ARG C NH1 1 
ATOM   5362 N NH2 . ARG C 1 151 ? 29.830 74.252 76.602  1.00 30.21 ? 152  ARG C NH2 1 
ATOM   5363 N N   . LYS C 1 152 ? 29.635 79.926 72.438  1.00 29.20 ? 153  LYS C N   1 
ATOM   5364 C CA  . LYS C 1 152 ? 30.627 80.446 71.481  1.00 29.48 ? 153  LYS C CA  1 
ATOM   5365 C C   . LYS C 1 152 ? 29.990 80.599 70.112  1.00 30.09 ? 153  LYS C C   1 
ATOM   5366 O O   . LYS C 1 152 ? 29.369 79.659 69.595  1.00 30.92 ? 153  LYS C O   1 
ATOM   5367 C CB  . LYS C 1 152 ? 31.825 79.491 71.349  1.00 30.73 ? 153  LYS C CB  1 
ATOM   5368 C CG  . LYS C 1 152 ? 32.711 79.387 72.569  1.00 33.51 ? 153  LYS C CG  1 
ATOM   5369 C CD  . LYS C 1 152 ? 33.451 80.694 72.857  1.00 37.49 ? 153  LYS C CD  1 
ATOM   5370 C CE  . LYS C 1 152 ? 34.821 80.427 73.488  1.00 41.66 ? 153  LYS C CE  1 
ATOM   5371 N NZ  . LYS C 1 152 ? 34.782 79.517 74.687  1.00 41.94 ? 153  LYS C NZ  1 
ATOM   5372 N N   . LEU C 1 153 ? 30.181 81.759 69.491  1.00 30.33 ? 154  LEU C N   1 
ATOM   5373 C CA  . LEU C 1 153 ? 29.591 82.006 68.188  1.00 30.61 ? 154  LEU C CA  1 
ATOM   5374 C C   . LEU C 1 153 ? 30.033 81.066 67.074  1.00 30.62 ? 154  LEU C C   1 
ATOM   5375 O O   . LEU C 1 153 ? 29.209 80.646 66.274  1.00 30.62 ? 154  LEU C O   1 
ATOM   5376 C CB  . LEU C 1 153 ? 29.837 83.455 67.750  1.00 33.71 ? 154  LEU C CB  1 
ATOM   5377 C CG  . LEU C 1 153 ? 29.201 83.813 66.399  1.00 34.02 ? 154  LEU C CG  1 
ATOM   5378 C CD1 . LEU C 1 153 ? 27.677 83.798 66.510  1.00 32.91 ? 154  LEU C CD1 1 
ATOM   5379 C CD2 . LEU C 1 153 ? 29.684 85.201 65.954  1.00 34.94 ? 154  LEU C CD2 1 
ATOM   5380 N N   . ASP C 1 154 ? 31.320 80.724 67.010  1.00 32.23 ? 155  ASP C N   1 
ATOM   5381 C CA  . ASP C 1 154 ? 31.760 79.851 65.922  1.00 32.55 ? 155  ASP C CA  1 
ATOM   5382 C C   . ASP C 1 154 ? 31.054 78.497 65.928  1.00 28.95 ? 155  ASP C C   1 
ATOM   5383 O O   . ASP C 1 154 ? 30.582 78.043 64.888  1.00 29.66 ? 155  ASP C O   1 
ATOM   5384 C CB  . ASP C 1 154 ? 33.287 79.677 65.921  1.00 36.44 ? 155  ASP C CB  1 
ATOM   5385 C CG  . ASP C 1 154 ? 33.847 79.262 67.270  1.00 41.01 ? 155  ASP C CG  1 
ATOM   5386 O OD1 . ASP C 1 154 ? 35.069 78.999 67.341  1.00 43.51 ? 155  ASP C OD1 1 
ATOM   5387 O OD2 . ASP C 1 154 ? 33.091 79.206 68.257  1.00 46.23 ? 155  ASP C OD2 1 
ATOM   5388 N N   . LYS C 1 155 ? 30.967 77.869 67.097  1.00 29.51 ? 156  LYS C N   1 
ATOM   5389 C CA  . LYS C 1 155 ? 30.294 76.569 67.229  1.00 27.87 ? 156  LYS C CA  1 
ATOM   5390 C C   . LYS C 1 155 ? 28.794 76.690 66.932  1.00 28.98 ? 156  LYS C C   1 
ATOM   5391 O O   . LYS C 1 155 ? 28.196 75.817 66.276  1.00 29.24 ? 156  LYS C O   1 
ATOM   5392 C CB  . LYS C 1 155 ? 30.513 76.030 68.640  1.00 28.71 ? 156  LYS C CB  1 
ATOM   5393 C CG  . LYS C 1 155 ? 29.916 74.640 68.922  1.00 25.24 ? 156  LYS C CG  1 
ATOM   5394 C CD  . LYS C 1 155 ? 30.284 74.225 70.339  1.00 26.87 ? 156  LYS C CD  1 
ATOM   5395 C CE  . LYS C 1 155 ? 29.679 72.851 70.721  1.00 25.08 ? 156  LYS C CE  1 
ATOM   5396 N NZ  . LYS C 1 155 ? 30.041 72.484 72.114  1.00 25.70 ? 156  LYS C NZ  1 
ATOM   5397 N N   . ALA C 1 156 ? 28.174 77.764 67.420  1.00 27.69 ? 157  ALA C N   1 
ATOM   5398 C CA  . ALA C 1 156 ? 26.745 77.980 67.182  1.00 25.87 ? 157  ALA C CA  1 
ATOM   5399 C C   . ALA C 1 156 ? 26.454 78.220 65.701  1.00 27.20 ? 157  ALA C C   1 
ATOM   5400 O O   . ALA C 1 156 ? 25.447 77.737 65.161  1.00 24.46 ? 157  ALA C O   1 
ATOM   5401 C CB  . ALA C 1 156 ? 26.246 79.170 68.034  1.00 29.75 ? 157  ALA C CB  1 
ATOM   5402 N N   . GLN C 1 157 ? 27.344 78.946 65.023  1.00 26.63 ? 158  GLN C N   1 
ATOM   5403 C CA  . GLN C 1 157 ? 27.141 79.224 63.601  1.00 28.49 ? 158  GLN C CA  1 
ATOM   5404 C C   . GLN C 1 157 ? 27.379 77.978 62.775  1.00 26.39 ? 158  GLN C C   1 
ATOM   5405 O O   . GLN C 1 157 ? 26.732 77.762 61.756  1.00 28.60 ? 158  GLN C O   1 
ATOM   5406 C CB  . GLN C 1 157 ? 28.079 80.330 63.102  1.00 32.20 ? 158  GLN C CB  1 
ATOM   5407 C CG  . GLN C 1 157 ? 27.786 80.767 61.664  1.00 32.20 ? 158  GLN C CG  1 
ATOM   5408 C CD  . GLN C 1 157 ? 26.428 81.469 61.525  1.00 32.16 ? 158  GLN C CD  1 
ATOM   5409 O OE1 . GLN C 1 157 ? 26.135 82.412 62.252  1.00 32.19 ? 158  GLN C OE1 1 
ATOM   5410 N NE2 . GLN C 1 157 ? 25.609 81.012 60.584  1.00 30.87 ? 158  GLN C NE2 1 
ATOM   5411 N N   . ALA C 1 158 ? 28.323 77.155 63.214  1.00 28.17 ? 159  ALA C N   1 
ATOM   5412 C CA  . ALA C 1 158 ? 28.607 75.920 62.497  1.00 25.42 ? 159  ALA C CA  1 
ATOM   5413 C C   . ALA C 1 158 ? 27.355 75.044 62.574  1.00 23.59 ? 159  ALA C C   1 
ATOM   5414 O O   . ALA C 1 158 ? 26.978 74.382 61.605  1.00 24.12 ? 159  ALA C O   1 
ATOM   5415 C CB  . ALA C 1 158 ? 29.788 75.204 63.139  1.00 23.47 ? 159  ALA C CB  1 
ATOM   5416 N N   . ALA C 1 159 ? 26.700 75.069 63.729  1.00 24.83 ? 160  ALA C N   1 
ATOM   5417 C CA  . ALA C 1 159 ? 25.495 74.264 63.933  1.00 25.20 ? 160  ALA C CA  1 
ATOM   5418 C C   . ALA C 1 159 ? 24.366 74.721 63.005  1.00 25.98 ? 160  ALA C C   1 
ATOM   5419 O O   . ALA C 1 159 ? 23.701 73.912 62.361  1.00 22.94 ? 160  ALA C O   1 
ATOM   5420 C CB  . ALA C 1 159 ? 25.064 74.356 65.405  1.00 26.78 ? 160  ALA C CB  1 
ATOM   5421 N N   . ALA C 1 160 ? 24.153 76.031 62.937  1.00 27.63 ? 161  ALA C N   1 
ATOM   5422 C CA  . ALA C 1 160 ? 23.116 76.575 62.070  1.00 28.36 ? 161  ALA C CA  1 
ATOM   5423 C C   . ALA C 1 160 ? 23.454 76.280 60.602  1.00 28.70 ? 161  ALA C C   1 
ATOM   5424 O O   . ALA C 1 160 ? 22.567 75.959 59.811  1.00 28.38 ? 161  ALA C O   1 
ATOM   5425 C CB  . ALA C 1 160 ? 22.982 78.089 62.295  1.00 26.90 ? 161  ALA C CB  1 
ATOM   5426 N N   . ASP C 1 161 ? 24.732 76.393 60.235  1.00 29.50 ? 162  ASP C N   1 
ATOM   5427 C CA  . ASP C 1 161 ? 25.139 76.109 58.856  1.00 28.93 ? 162  ASP C CA  1 
ATOM   5428 C C   . ASP C 1 161 ? 24.802 74.650 58.532  1.00 28.44 ? 162  ASP C C   1 
ATOM   5429 O O   . ASP C 1 161 ? 24.266 74.343 57.472  1.00 29.34 ? 162  ASP C O   1 
ATOM   5430 C CB  . ASP C 1 161 ? 26.648 76.329 58.676  1.00 30.21 ? 162  ASP C CB  1 
ATOM   5431 C CG  . ASP C 1 161 ? 27.054 77.800 58.746  1.00 33.71 ? 162  ASP C CG  1 
ATOM   5432 O OD1 . ASP C 1 161 ? 28.280 78.067 58.813  1.00 33.99 ? 162  ASP C OD1 1 
ATOM   5433 O OD2 . ASP C 1 161 ? 26.171 78.681 58.728  1.00 31.36 ? 162  ASP C OD2 1 
ATOM   5434 N N   . SER C 1 162 ? 25.130 73.750 59.453  1.00 27.90 ? 163  SER C N   1 
ATOM   5435 C CA  . SER C 1 162 ? 24.838 72.326 59.251  1.00 27.63 ? 163  SER C CA  1 
ATOM   5436 C C   . SER C 1 162 ? 23.332 72.112 59.029  1.00 27.53 ? 163  SER C C   1 
ATOM   5437 O O   . SER C 1 162 ? 22.905 71.513 58.038  1.00 26.82 ? 163  SER C O   1 
ATOM   5438 C CB  . SER C 1 162 ? 25.316 71.522 60.467  1.00 28.32 ? 163  SER C CB  1 
ATOM   5439 O OG  . SER C 1 162 ? 24.959 70.151 60.340  1.00 33.18 ? 163  SER C OG  1 
ATOM   5440 N N   . VAL C 1 163 ? 22.532 72.619 59.961  1.00 28.03 ? 164  VAL C N   1 
ATOM   5441 C CA  . VAL C 1 163 ? 21.075 72.520 59.879  1.00 25.39 ? 164  VAL C CA  1 
ATOM   5442 C C   . VAL C 1 163 ? 20.517 73.134 58.587  1.00 27.04 ? 164  VAL C C   1 
ATOM   5443 O O   . VAL C 1 163 ? 19.676 72.528 57.915  1.00 25.21 ? 164  VAL C O   1 
ATOM   5444 C CB  . VAL C 1 163 ? 20.421 73.226 61.110  1.00 25.84 ? 164  VAL C CB  1 
ATOM   5445 C CG1 . VAL C 1 163 ? 18.898 73.246 60.974  1.00 24.95 ? 164  VAL C CG1 1 
ATOM   5446 C CG2 . VAL C 1 163 ? 20.835 72.514 62.403  1.00 26.43 ? 164  VAL C CG2 1 
ATOM   5447 N N   . ASN C 1 164 ? 20.999 74.322 58.222  1.00 27.49 ? 165  ASN C N   1 
ATOM   5448 C CA  . ASN C 1 164 ? 20.500 74.994 57.028  1.00 28.68 ? 165  ASN C CA  1 
ATOM   5449 C C   . ASN C 1 164 ? 20.806 74.231 55.756  1.00 29.88 ? 165  ASN C C   1 
ATOM   5450 O O   . ASN C 1 164 ? 19.992 74.193 54.846  1.00 30.83 ? 165  ASN C O   1 
ATOM   5451 C CB  . ASN C 1 164 ? 21.068 76.417 56.920  1.00 29.72 ? 165  ASN C CB  1 
ATOM   5452 C CG  . ASN C 1 164 ? 20.608 77.312 58.045  1.00 32.65 ? 165  ASN C CG  1 
ATOM   5453 O OD1 . ASN C 1 164 ? 19.539 77.097 58.631  1.00 31.65 ? 165  ASN C OD1 1 
ATOM   5454 N ND2 . ASN C 1 164 ? 21.396 78.344 58.343  1.00 32.98 ? 165  ASN C ND2 1 
ATOM   5455 N N   . LYS C 1 165 ? 21.985 73.621 55.695  1.00 32.32 ? 166  LYS C N   1 
ATOM   5456 C CA  . LYS C 1 165 ? 22.360 72.856 54.515  1.00 33.17 ? 166  LYS C CA  1 
ATOM   5457 C C   . LYS C 1 165 ? 21.565 71.553 54.443  1.00 31.84 ? 166  LYS C C   1 
ATOM   5458 O O   . LYS C 1 165 ? 21.058 71.176 53.385  1.00 28.52 ? 166  LYS C O   1 
ATOM   5459 C CB  . LYS C 1 165 ? 23.862 72.545 54.531  1.00 35.84 ? 166  LYS C CB  1 
ATOM   5460 C CG  . LYS C 1 165 ? 24.267 71.522 53.473  1.00 41.54 ? 166  LYS C CG  1 
ATOM   5461 C CD  . LYS C 1 165 ? 25.710 71.056 53.645  1.00 44.45 ? 166  LYS C CD  1 
ATOM   5462 C CE  . LYS C 1 165 ? 26.695 72.128 53.201  1.00 48.67 ? 166  LYS C CE  1 
ATOM   5463 N NZ  . LYS C 1 165 ? 28.089 71.594 53.127  1.00 50.35 ? 166  LYS C NZ  1 
ATOM   5464 N N   . ARG C 1 166 ? 21.432 70.880 55.580  1.00 29.49 ? 167  ARG C N   1 
ATOM   5465 C CA  . ARG C 1 166 ? 20.715 69.612 55.606  1.00 28.47 ? 167  ARG C CA  1 
ATOM   5466 C C   . ARG C 1 166 ? 19.205 69.690 55.384  1.00 29.11 ? 167  ARG C C   1 
ATOM   5467 O O   . ARG C 1 166 ? 18.636 68.837 54.702  1.00 26.59 ? 167  ARG C O   1 
ATOM   5468 C CB  . ARG C 1 166 ? 20.972 68.901 56.940  1.00 29.80 ? 167  ARG C CB  1 
ATOM   5469 C CG  . ARG C 1 166 ? 20.071 67.688 57.195  1.00 26.48 ? 167  ARG C CG  1 
ATOM   5470 C CD  . ARG C 1 166 ? 20.336 66.497 56.275  1.00 26.92 ? 167  ARG C CD  1 
ATOM   5471 N NE  . ARG C 1 166 ? 19.457 65.391 56.657  1.00 24.55 ? 167  ARG C NE  1 
ATOM   5472 C CZ  . ARG C 1 166 ? 18.154 65.350 56.387  1.00 25.73 ? 167  ARG C CZ  1 
ATOM   5473 N NH1 . ARG C 1 166 ? 17.584 66.343 55.706  1.00 23.02 ? 167  ARG C NH1 1 
ATOM   5474 N NH2 . ARG C 1 166 ? 17.405 64.347 56.839  1.00 22.60 ? 167  ARG C NH2 1 
ATOM   5475 N N   . PHE C 1 167 ? 18.547 70.687 55.971  1.00 28.49 ? 168  PHE C N   1 
ATOM   5476 C CA  . PHE C 1 167 ? 17.092 70.770 55.846  1.00 29.74 ? 168  PHE C CA  1 
ATOM   5477 C C   . PHE C 1 167 ? 16.592 71.901 54.958  1.00 31.42 ? 168  PHE C C   1 
ATOM   5478 O O   . PHE C 1 167 ? 15.382 72.084 54.785  1.00 33.47 ? 168  PHE C O   1 
ATOM   5479 C CB  . PHE C 1 167 ? 16.468 70.878 57.239  1.00 28.52 ? 168  PHE C CB  1 
ATOM   5480 C CG  . PHE C 1 167 ? 16.790 69.709 58.125  1.00 26.80 ? 168  PHE C CG  1 
ATOM   5481 C CD1 . PHE C 1 167 ? 17.853 69.766 59.016  1.00 28.61 ? 168  PHE C CD1 1 
ATOM   5482 C CD2 . PHE C 1 167 ? 16.037 68.537 58.049  1.00 28.37 ? 168  PHE C CD2 1 
ATOM   5483 C CE1 . PHE C 1 167 ? 18.170 68.675 59.830  1.00 26.91 ? 168  PHE C CE1 1 
ATOM   5484 C CE2 . PHE C 1 167 ? 16.342 67.434 58.853  1.00 25.96 ? 168  PHE C CE2 1 
ATOM   5485 C CZ  . PHE C 1 167 ? 17.413 67.506 59.748  1.00 26.70 ? 168  PHE C CZ  1 
ATOM   5486 N N   . LYS C 1 168 ? 17.536 72.644 54.390  1.00 31.75 ? 169  LYS C N   1 
ATOM   5487 C CA  . LYS C 1 168 ? 17.220 73.746 53.500  1.00 31.73 ? 169  LYS C CA  1 
ATOM   5488 C C   . LYS C 1 168 ? 16.316 74.763 54.159  1.00 30.54 ? 169  LYS C C   1 
ATOM   5489 O O   . LYS C 1 168 ? 15.213 75.009 53.702  1.00 32.13 ? 169  LYS C O   1 
ATOM   5490 C CB  . LYS C 1 168 ? 16.581 73.198 52.224  1.00 33.86 ? 169  LYS C CB  1 
ATOM   5491 C CG  . LYS C 1 168 ? 17.525 72.251 51.486  1.00 34.55 ? 169  LYS C CG  1 
ATOM   5492 C CD  . LYS C 1 168 ? 16.968 71.741 50.173  1.00 40.02 ? 169  LYS C CD  1 
ATOM   5493 C CE  . LYS C 1 168 ? 18.062 70.991 49.415  1.00 41.20 ? 169  LYS C CE  1 
ATOM   5494 N NZ  . LYS C 1 168 ? 17.679 70.692 48.006  1.00 47.49 ? 169  LYS C NZ  1 
ATOM   5495 N N   . VAL C 1 169 ? 16.804 75.361 55.236  1.00 30.05 ? 170  VAL C N   1 
ATOM   5496 C CA  . VAL C 1 169 ? 16.045 76.362 55.973  1.00 30.10 ? 170  VAL C CA  1 
ATOM   5497 C C   . VAL C 1 169 ? 17.000 77.487 56.299  1.00 30.29 ? 170  VAL C C   1 
ATOM   5498 O O   . VAL C 1 169 ? 18.147 77.465 55.871  1.00 29.49 ? 170  VAL C O   1 
ATOM   5499 C CB  . VAL C 1 169 ? 15.470 75.785 57.294  1.00 29.36 ? 170  VAL C CB  1 
ATOM   5500 C CG1 . VAL C 1 169 ? 14.319 74.845 56.992  1.00 28.37 ? 170  VAL C CG1 1 
ATOM   5501 C CG2 . VAL C 1 169 ? 16.562 75.034 58.040  1.00 29.18 ? 170  VAL C CG2 1 
ATOM   5502 N N   . ASN C 1 170 ? 16.548 78.464 57.071  1.00 31.29 ? 171  ASN C N   1 
ATOM   5503 C CA  . ASN C 1 170 ? 17.426 79.573 57.384  1.00 32.76 ? 171  ASN C CA  1 
ATOM   5504 C C   . ASN C 1 170 ? 17.455 79.997 58.853  1.00 31.71 ? 171  ASN C C   1 
ATOM   5505 O O   . ASN C 1 170 ? 17.006 81.087 59.226  1.00 29.77 ? 171  ASN C O   1 
ATOM   5506 C CB  . ASN C 1 170 ? 17.069 80.758 56.481  1.00 36.81 ? 171  ASN C CB  1 
ATOM   5507 C CG  . ASN C 1 170 ? 18.032 81.913 56.631  1.00 41.26 ? 171  ASN C CG  1 
ATOM   5508 O OD1 . ASN C 1 170 ? 19.243 81.769 56.410  1.00 44.51 ? 171  ASN C OD1 1 
ATOM   5509 N ND2 . ASN C 1 170 ? 17.503 83.073 57.017  1.00 42.87 ? 171  ASN C ND2 1 
ATOM   5510 N N   . VAL C 1 171 ? 17.999 79.116 59.682  1.00 27.83 ? 172  VAL C N   1 
ATOM   5511 C CA  . VAL C 1 171 ? 18.153 79.355 61.109  1.00 26.30 ? 172  VAL C CA  1 
ATOM   5512 C C   . VAL C 1 171 ? 19.327 80.318 61.329  1.00 28.46 ? 172  VAL C C   1 
ATOM   5513 O O   . VAL C 1 171 ? 20.326 80.250 60.615  1.00 28.00 ? 172  VAL C O   1 
ATOM   5514 C CB  . VAL C 1 171 ? 18.460 78.000 61.817  1.00 26.12 ? 172  VAL C CB  1 
ATOM   5515 C CG1 . VAL C 1 171 ? 18.887 78.210 63.271  1.00 26.69 ? 172  VAL C CG1 1 
ATOM   5516 C CG2 . VAL C 1 171 ? 17.240 77.082 61.694  1.00 22.92 ? 172  VAL C CG2 1 
ATOM   5517 N N   A THR C 1 172 ? 19.195 81.189 62.324  0.60 28.52 ? 173  THR C N   1 
ATOM   5518 N N   B THR C 1 172 ? 19.205 81.216 62.304  0.40 27.83 ? 173  THR C N   1 
ATOM   5519 C CA  A THR C 1 172 ? 20.217 82.169 62.666  0.60 30.52 ? 173  THR C CA  1 
ATOM   5520 C CA  B THR C 1 172 ? 20.288 82.148 62.604  0.40 28.76 ? 173  THR C CA  1 
ATOM   5521 C C   A THR C 1 172 ? 20.962 81.749 63.941  0.60 31.47 ? 173  THR C C   1 
ATOM   5522 C C   B THR C 1 172 ? 20.988 81.708 63.889  0.40 30.34 ? 173  THR C C   1 
ATOM   5523 O O   A THR C 1 172 ? 20.401 81.049 64.784  0.60 29.42 ? 173  THR C O   1 
ATOM   5524 O O   B THR C 1 172 ? 20.418 80.967 64.690  0.40 29.06 ? 173  THR C O   1 
ATOM   5525 C CB  A THR C 1 172 ? 19.554 83.537 62.876  0.60 31.53 ? 173  THR C CB  1 
ATOM   5526 C CB  B THR C 1 172 ? 19.776 83.592 62.790  0.40 28.43 ? 173  THR C CB  1 
ATOM   5527 O OG1 A THR C 1 172 ? 18.892 83.920 61.662  0.60 33.88 ? 173  THR C OG1 1 
ATOM   5528 O OG1 B THR C 1 172 ? 20.894 84.481 62.909  0.40 29.92 ? 173  THR C OG1 1 
ATOM   5529 C CG2 A THR C 1 172 ? 20.579 84.591 63.265  0.60 33.61 ? 173  THR C CG2 1 
ATOM   5530 C CG2 B THR C 1 172 ? 18.926 83.709 64.038  0.40 25.45 ? 173  THR C CG2 1 
ATOM   5531 N N   . ALA C 1 173 ? 22.221 82.164 64.084  1.00 30.97 ? 174  ALA C N   1 
ATOM   5532 C CA  . ALA C 1 173 ? 22.988 81.802 65.278  1.00 31.99 ? 174  ALA C CA  1 
ATOM   5533 C C   . ALA C 1 173 ? 23.325 82.994 66.147  1.00 33.05 ? 174  ALA C C   1 
ATOM   5534 O O   . ALA C 1 173 ? 23.424 84.111 65.666  1.00 35.36 ? 174  ALA C O   1 
ATOM   5535 C CB  . ALA C 1 173 ? 24.278 81.078 64.883  1.00 33.58 ? 174  ALA C CB  1 
ATOM   5536 N N   . ALA C 1 174 ? 23.507 82.753 67.434  1.00 32.95 ? 175  ALA C N   1 
ATOM   5537 C CA  . ALA C 1 174 ? 23.862 83.821 68.345  1.00 32.98 ? 175  ALA C CA  1 
ATOM   5538 C C   . ALA C 1 174 ? 24.684 83.253 69.490  1.00 34.03 ? 175  ALA C C   1 
ATOM   5539 O O   . ALA C 1 174 ? 24.496 82.106 69.889  1.00 33.72 ? 175  ALA C O   1 
ATOM   5540 C CB  . ALA C 1 174 ? 22.607 84.489 68.885  1.00 35.29 ? 175  ALA C CB  1 
ATOM   5541 N N   . GLU C 1 175 ? 25.601 84.065 70.005  1.00 30.05 ? 176  GLU C N   1 
ATOM   5542 C CA  . GLU C 1 175 ? 26.449 83.682 71.122  1.00 32.06 ? 176  GLU C CA  1 
ATOM   5543 C C   . GLU C 1 175 ? 25.814 84.183 72.417  1.00 30.66 ? 176  GLU C C   1 
ATOM   5544 O O   . GLU C 1 175 ? 25.431 85.345 72.504  1.00 31.57 ? 176  GLU C O   1 
ATOM   5545 C CB  . GLU C 1 175 ? 27.839 84.316 70.959  1.00 32.00 ? 176  GLU C CB  1 
ATOM   5546 C CG  . GLU C 1 175 ? 28.777 84.105 72.128  1.00 35.45 ? 176  GLU C CG  1 
ATOM   5547 C CD  . GLU C 1 175 ? 30.196 84.555 71.812  1.00 38.61 ? 176  GLU C CD  1 
ATOM   5548 O OE1 . GLU C 1 175 ? 30.643 85.570 72.384  1.00 40.16 ? 176  GLU C OE1 1 
ATOM   5549 O OE2 . GLU C 1 175 ? 30.857 83.900 70.979  1.00 34.86 ? 176  GLU C OE2 1 
ATOM   5550 N N   . THR C 1 176 ? 25.666 83.297 73.398  1.00 29.37 ? 177  THR C N   1 
ATOM   5551 C CA  . THR C 1 176 ? 25.111 83.658 74.703  1.00 28.00 ? 177  THR C CA  1 
ATOM   5552 C C   . THR C 1 176 ? 26.041 82.983 75.697  1.00 29.17 ? 177  THR C C   1 
ATOM   5553 O O   . THR C 1 176 ? 25.828 81.837 76.124  1.00 29.52 ? 177  THR C O   1 
ATOM   5554 C CB  . THR C 1 176 ? 23.665 83.151 74.885  1.00 26.47 ? 177  THR C CB  1 
ATOM   5555 O OG1 . THR C 1 176 ? 23.636 81.728 74.754  1.00 25.79 ? 177  THR C OG1 1 
ATOM   5556 C CG2 . THR C 1 176 ? 22.753 83.756 73.838  1.00 25.31 ? 177  THR C CG2 1 
ATOM   5557 N N   . ALA C 1 177 ? 27.072 83.722 76.088  1.00 29.71 ? 178  ALA C N   1 
ATOM   5558 C CA  . ALA C 1 177 ? 28.107 83.190 76.955  1.00 30.14 ? 178  ALA C CA  1 
ATOM   5559 C C   . ALA C 1 177 ? 27.842 83.072 78.440  1.00 30.86 ? 178  ALA C C   1 
ATOM   5560 O O   . ALA C 1 177 ? 28.533 82.316 79.118  1.00 31.15 ? 178  ALA C O   1 
ATOM   5561 C CB  . ALA C 1 177 ? 29.397 83.990 76.724  1.00 30.48 ? 178  ALA C CB  1 
ATOM   5562 N N   . ASP C 1 178 ? 26.851 83.792 78.958  1.00 30.75 ? 179  ASP C N   1 
ATOM   5563 C CA  . ASP C 1 178 ? 26.570 83.748 80.391  1.00 30.03 ? 179  ASP C CA  1 
ATOM   5564 C C   . ASP C 1 178 ? 25.066 83.905 80.687  1.00 30.09 ? 179  ASP C C   1 
ATOM   5565 O O   . ASP C 1 178 ? 24.254 83.969 79.761  1.00 27.83 ? 179  ASP C O   1 
ATOM   5566 C CB  . ASP C 1 178 ? 27.360 84.862 81.068  1.00 32.26 ? 179  ASP C CB  1 
ATOM   5567 C CG  . ASP C 1 178 ? 27.082 86.200 80.444  1.00 33.68 ? 179  ASP C CG  1 
ATOM   5568 O OD1 . ASP C 1 178 ? 27.875 87.144 80.631  1.00 36.62 ? 179  ASP C OD1 1 
ATOM   5569 O OD2 . ASP C 1 178 ? 26.050 86.298 79.761  1.00 31.25 ? 179  ASP C OD2 1 
ATOM   5570 N N   . ASP C 1 179 ? 24.702 83.960 81.969  1.00 30.33 ? 180  ASP C N   1 
ATOM   5571 C CA  . ASP C 1 179 ? 23.281 84.085 82.359  1.00 31.54 ? 180  ASP C CA  1 
ATOM   5572 C C   . ASP C 1 179 ? 22.660 85.329 81.758  1.00 28.28 ? 180  ASP C C   1 
ATOM   5573 O O   . ASP C 1 179 ? 21.560 85.299 81.206  1.00 27.88 ? 180  ASP C O   1 
ATOM   5574 C CB  . ASP C 1 179 ? 23.117 84.178 83.879  1.00 30.58 ? 180  ASP C CB  1 
ATOM   5575 C CG  . ASP C 1 179 ? 23.442 82.885 84.585  1.00 36.04 ? 180  ASP C CG  1 
ATOM   5576 O OD1 . ASP C 1 179 ? 23.498 82.895 85.829  1.00 39.04 ? 180  ASP C OD1 1 
ATOM   5577 O OD2 . ASP C 1 179 ? 23.640 81.858 83.908  1.00 38.24 ? 180  ASP C OD2 1 
ATOM   5578 N N   . ALA C 1 180 ? 23.374 86.436 81.898  1.00 27.85 ? 181  ALA C N   1 
ATOM   5579 C CA  . ALA C 1 180 ? 22.897 87.702 81.379  1.00 25.92 ? 181  ALA C CA  1 
ATOM   5580 C C   . ALA C 1 180 ? 22.558 87.648 79.881  1.00 24.69 ? 181  ALA C C   1 
ATOM   5581 O O   . ALA C 1 180 ? 21.518 88.157 79.477  1.00 23.08 ? 181  ALA C O   1 
ATOM   5582 C CB  . ALA C 1 180 ? 23.941 88.804 81.659  1.00 25.57 ? 181  ALA C CB  1 
ATOM   5583 N N   . SER C 1 181 ? 23.404 87.022 79.056  1.00 23.31 ? 182  SER C N   1 
ATOM   5584 C CA  . SER C 1 181 ? 23.121 86.983 77.614  1.00 24.36 ? 182  SER C CA  1 
ATOM   5585 C C   . SER C 1 181 ? 21.978 86.033 77.256  1.00 24.29 ? 182  SER C C   1 
ATOM   5586 O O   . SER C 1 181 ? 21.194 86.300 76.343  1.00 22.77 ? 182  SER C O   1 
ATOM   5587 C CB  . SER C 1 181 ? 24.384 86.616 76.818  1.00 26.15 ? 182  SER C CB  1 
ATOM   5588 O OG  . SER C 1 181 ? 25.390 87.600 77.018  1.00 28.43 ? 182  SER C OG  1 
ATOM   5589 N N   . ARG C 1 182 ? 21.878 84.916 77.965  1.00 24.45 ? 183  ARG C N   1 
ATOM   5590 C CA  . ARG C 1 182 ? 20.775 84.000 77.703  1.00 25.25 ? 183  ARG C CA  1 
ATOM   5591 C C   . ARG C 1 182 ? 19.461 84.702 78.053  1.00 23.39 ? 183  ARG C C   1 
ATOM   5592 O O   . ARG C 1 182 ? 18.494 84.618 77.303  1.00 23.78 ? 183  ARG C O   1 
ATOM   5593 C CB  . ARG C 1 182 ? 20.941 82.711 78.514  1.00 25.88 ? 183  ARG C CB  1 
ATOM   5594 C CG  . ARG C 1 182 ? 22.029 81.770 77.955  1.00 27.36 ? 183  ARG C CG  1 
ATOM   5595 C CD  . ARG C 1 182 ? 22.036 80.436 78.733  1.00 26.67 ? 183  ARG C CD  1 
ATOM   5596 N NE  . ARG C 1 182 ? 22.738 80.571 80.008  1.00 30.42 ? 183  ARG C NE  1 
ATOM   5597 C CZ  . ARG C 1 182 ? 24.031 80.305 80.182  1.00 34.18 ? 183  ARG C CZ  1 
ATOM   5598 N NH1 . ARG C 1 182 ? 24.757 79.871 79.165  1.00 36.28 ? 183  ARG C NH1 1 
ATOM   5599 N NH2 . ARG C 1 182 ? 24.614 80.522 81.355  1.00 35.05 ? 183  ARG C NH2 1 
ATOM   5600 N N   . ALA C 1 183 ? 19.423 85.414 79.173  1.00 24.03 ? 184  ALA C N   1 
ATOM   5601 C CA  . ALA C 1 183 ? 18.190 86.127 79.532  1.00 25.87 ? 184  ALA C CA  1 
ATOM   5602 C C   . ALA C 1 183 ? 17.861 87.213 78.488  1.00 25.66 ? 184  ALA C C   1 
ATOM   5603 O O   . ALA C 1 183 ? 16.691 87.444 78.174  1.00 26.68 ? 184  ALA C O   1 
ATOM   5604 C CB  . ALA C 1 183 ? 18.313 86.758 80.932  1.00 22.09 ? 184  ALA C CB  1 
ATOM   5605 N N   . GLU C 1 184 ? 18.883 87.871 77.936  1.00 26.29 ? 185  GLU C N   1 
ATOM   5606 C CA  . GLU C 1 184 ? 18.620 88.912 76.936  1.00 24.63 ? 185  GLU C CA  1 
ATOM   5607 C C   . GLU C 1 184 ? 18.107 88.279 75.640  1.00 24.26 ? 185  GLU C C   1 
ATOM   5608 O O   . GLU C 1 184 ? 17.179 88.789 74.997  1.00 19.07 ? 185  GLU C O   1 
ATOM   5609 C CB  . GLU C 1 184 ? 19.895 89.725 76.662  1.00 29.23 ? 185  GLU C CB  1 
ATOM   5610 C CG  . GLU C 1 184 ? 19.725 90.877 75.665  1.00 33.30 ? 185  GLU C CG  1 
ATOM   5611 C CD  . GLU C 1 184 ? 18.543 91.801 75.985  1.00 38.97 ? 185  GLU C CD  1 
ATOM   5612 O OE1 . GLU C 1 184 ? 18.418 92.216 77.165  1.00 39.27 ? 185  GLU C OE1 1 
ATOM   5613 O OE2 . GLU C 1 184 ? 17.748 92.105 75.046  1.00 38.72 ? 185  GLU C OE2 1 
ATOM   5614 N N   . ALA C 1 185 ? 18.660 87.115 75.295  1.00 21.16 ? 186  ALA C N   1 
ATOM   5615 C CA  . ALA C 1 185 ? 18.264 86.454 74.055  1.00 22.36 ? 186  ALA C CA  1 
ATOM   5616 C C   . ALA C 1 185 ? 16.794 86.011 73.948  1.00 22.85 ? 186  ALA C C   1 
ATOM   5617 O O   . ALA C 1 185 ? 16.271 85.861 72.834  1.00 22.92 ? 186  ALA C O   1 
ATOM   5618 C CB  . ALA C 1 185 ? 19.207 85.262 73.782  1.00 20.78 ? 186  ALA C CB  1 
ATOM   5619 N N   . VAL C 1 186 ? 16.108 85.806 75.069  1.00 18.61 ? 187  VAL C N   1 
ATOM   5620 C CA  . VAL C 1 186 ? 14.717 85.357 74.944  1.00 22.65 ? 187  VAL C CA  1 
ATOM   5621 C C   . VAL C 1 186 ? 13.681 86.476 75.035  1.00 24.04 ? 187  VAL C C   1 
ATOM   5622 O O   . VAL C 1 186 ? 12.473 86.234 74.898  1.00 23.90 ? 187  VAL C O   1 
ATOM   5623 C CB  . VAL C 1 186 ? 14.375 84.249 75.976  1.00 19.72 ? 187  VAL C CB  1 
ATOM   5624 C CG1 . VAL C 1 186 ? 15.344 83.063 75.791  1.00 20.86 ? 187  VAL C CG1 1 
ATOM   5625 C CG2 . VAL C 1 186 ? 14.434 84.793 77.411  1.00 18.88 ? 187  VAL C CG2 1 
ATOM   5626 N N   . LYS C 1 187 ? 14.144 87.704 75.256  1.00 24.19 ? 188  LYS C N   1 
ATOM   5627 C CA  . LYS C 1 187 ? 13.201 88.812 75.335  1.00 24.96 ? 188  LYS C CA  1 
ATOM   5628 C C   . LYS C 1 187 ? 12.550 88.989 73.965  1.00 25.69 ? 188  LYS C C   1 
ATOM   5629 O O   . LYS C 1 187 ? 13.235 88.992 72.933  1.00 25.00 ? 188  LYS C O   1 
ATOM   5630 C CB  . LYS C 1 187 ? 13.917 90.098 75.791  1.00 24.29 ? 188  LYS C CB  1 
ATOM   5631 C CG  . LYS C 1 187 ? 14.362 90.053 77.254  1.00 25.67 ? 188  LYS C CG  1 
ATOM   5632 C CD  . LYS C 1 187 ? 15.134 91.324 77.665  1.00 27.39 ? 188  LYS C CD  1 
ATOM   5633 C CE  . LYS C 1 187 ? 15.519 91.282 79.149  1.00 27.96 ? 188  LYS C CE  1 
ATOM   5634 N NZ  . LYS C 1 187 ? 16.394 92.422 79.580  1.00 27.58 ? 188  LYS C NZ  1 
ATOM   5635 N N   . GLY C 1 188 ? 11.224 89.102 73.952  1.00 24.91 ? 189  GLY C N   1 
ATOM   5636 C CA  . GLY C 1 188 ? 10.506 89.254 72.695  1.00 24.93 ? 189  GLY C CA  1 
ATOM   5637 C C   . GLY C 1 188 ? 10.195 87.945 71.978  1.00 26.98 ? 189  GLY C C   1 
ATOM   5638 O O   . GLY C 1 188 ? 9.477  87.922 70.963  1.00 24.81 ? 189  GLY C O   1 
ATOM   5639 N N   . ALA C 1 189 ? 10.736 86.838 72.482  1.00 24.51 ? 190  ALA C N   1 
ATOM   5640 C CA  . ALA C 1 189 ? 10.468 85.554 71.838  1.00 24.65 ? 190  ALA C CA  1 
ATOM   5641 C C   . ALA C 1 189 ? 9.088  85.013 72.247  1.00 23.68 ? 190  ALA C C   1 
ATOM   5642 O O   . ALA C 1 189 ? 8.557  85.363 73.313  1.00 23.76 ? 190  ALA C O   1 
ATOM   5643 C CB  . ALA C 1 189 ? 11.572 84.536 72.217  1.00 25.75 ? 190  ALA C CB  1 
ATOM   5644 N N   . HIS C 1 190 ? 8.511  84.169 71.399  1.00 21.62 ? 191  HIS C N   1 
ATOM   5645 C CA  . HIS C 1 190 ? 7.215  83.549 71.678  1.00 23.63 ? 191  HIS C CA  1 
ATOM   5646 C C   . HIS C 1 190 ? 7.394  82.133 72.228  1.00 23.43 ? 191  HIS C C   1 
ATOM   5647 O O   . HIS C 1 190 ? 6.602  81.666 73.051  1.00 21.73 ? 191  HIS C O   1 
ATOM   5648 C CB  . HIS C 1 190 ? 6.374  83.507 70.396  1.00 26.29 ? 191  HIS C CB  1 
ATOM   5649 C CG  . HIS C 1 190 ? 5.933  84.859 69.944  1.00 35.17 ? 191  HIS C CG  1 
ATOM   5650 N ND1 . HIS C 1 190 ? 4.734  85.418 70.337  1.00 37.72 ? 191  HIS C ND1 1 
ATOM   5651 C CD2 . HIS C 1 190 ? 6.589  85.820 69.252  1.00 36.05 ? 191  HIS C CD2 1 
ATOM   5652 C CE1 . HIS C 1 190 ? 4.674  86.668 69.911  1.00 38.59 ? 191  HIS C CE1 1 
ATOM   5653 N NE2 . HIS C 1 190 ? 5.788  86.937 69.252  1.00 38.09 ? 191  HIS C NE2 1 
ATOM   5654 N N   . PHE C 1 191 ? 8.455  81.460 71.786  1.00 21.74 ? 192  PHE C N   1 
ATOM   5655 C CA  . PHE C 1 191 ? 8.719  80.083 72.226  1.00 21.73 ? 192  PHE C CA  1 
ATOM   5656 C C   . PHE C 1 191 ? 10.197 79.899 72.602  1.00 21.39 ? 192  PHE C C   1 
ATOM   5657 O O   . PHE C 1 191 ? 11.079 80.378 71.878  1.00 23.04 ? 192  PHE C O   1 
ATOM   5658 C CB  . PHE C 1 191 ? 8.333  79.100 71.102  1.00 21.20 ? 192  PHE C CB  1 
ATOM   5659 C CG  . PHE C 1 191 ? 6.955  79.332 70.538  1.00 24.64 ? 192  PHE C CG  1 
ATOM   5660 C CD1 . PHE C 1 191 ? 6.789  79.865 69.263  1.00 23.99 ? 192  PHE C CD1 1 
ATOM   5661 C CD2 . PHE C 1 191 ? 5.817  79.021 71.286  1.00 25.63 ? 192  PHE C CD2 1 
ATOM   5662 C CE1 . PHE C 1 191 ? 5.517  80.079 68.746  1.00 24.72 ? 192  PHE C CE1 1 
ATOM   5663 C CE2 . PHE C 1 191 ? 4.543  79.232 70.777  1.00 23.12 ? 192  PHE C CE2 1 
ATOM   5664 C CZ  . PHE C 1 191 ? 4.387  79.756 69.517  1.00 25.08 ? 192  PHE C CZ  1 
ATOM   5665 N N   . VAL C 1 192 ? 10.464 79.229 73.731  1.00 19.01 ? 193  VAL C N   1 
ATOM   5666 C CA  . VAL C 1 192 ? 11.838 78.985 74.172  1.00 19.06 ? 193  VAL C CA  1 
ATOM   5667 C C   . VAL C 1 192 ? 12.047 77.511 74.499  1.00 19.97 ? 193  VAL C C   1 
ATOM   5668 O O   . VAL C 1 192 ? 11.267 76.923 75.262  1.00 18.58 ? 193  VAL C O   1 
ATOM   5669 C CB  . VAL C 1 192 ? 12.205 79.782 75.454  1.00 20.08 ? 193  VAL C CB  1 
ATOM   5670 C CG1 . VAL C 1 192 ? 13.664 79.490 75.861  1.00 16.91 ? 193  VAL C CG1 1 
ATOM   5671 C CG2 . VAL C 1 192 ? 11.988 81.293 75.225  1.00 17.16 ? 193  VAL C CG2 1 
ATOM   5672 N N   . PHE C 1 193 ? 13.097 76.932 73.915  1.00 19.65 ? 194  PHE C N   1 
ATOM   5673 C CA  . PHE C 1 193 ? 13.469 75.531 74.142  1.00 21.54 ? 194  PHE C CA  1 
ATOM   5674 C C   . PHE C 1 193 ? 14.860 75.504 74.784  1.00 22.37 ? 194  PHE C C   1 
ATOM   5675 O O   . PHE C 1 193 ? 15.752 76.226 74.334  1.00 22.05 ? 194  PHE C O   1 
ATOM   5676 C CB  . PHE C 1 193 ? 13.593 74.755 72.813  1.00 19.36 ? 194  PHE C CB  1 
ATOM   5677 C CG  . PHE C 1 193 ? 12.278 74.457 72.119  1.00 20.16 ? 194  PHE C CG  1 
ATOM   5678 C CD1 . PHE C 1 193 ? 11.556 75.461 71.483  1.00 18.13 ? 194  PHE C CD1 1 
ATOM   5679 C CD2 . PHE C 1 193 ? 11.779 73.154 72.077  1.00 18.41 ? 194  PHE C CD2 1 
ATOM   5680 C CE1 . PHE C 1 193 ? 10.345 75.177 70.809  1.00 18.60 ? 194  PHE C CE1 1 
ATOM   5681 C CE2 . PHE C 1 193 ? 10.567 72.858 71.405  1.00 20.22 ? 194  PHE C CE2 1 
ATOM   5682 C CZ  . PHE C 1 193 ? 9.849  73.886 70.769  1.00 17.68 ? 194  PHE C CZ  1 
ATOM   5683 N N   . THR C 1 194 ? 15.048 74.690 75.828  1.00 20.63 ? 195  THR C N   1 
ATOM   5684 C CA  . THR C 1 194 ? 16.359 74.542 76.464  1.00 20.21 ? 195  THR C CA  1 
ATOM   5685 C C   . THR C 1 194 ? 16.795 73.126 76.128  1.00 21.62 ? 195  THR C C   1 
ATOM   5686 O O   . THR C 1 194 ? 16.146 72.150 76.545  1.00 18.79 ? 195  THR C O   1 
ATOM   5687 C CB  . THR C 1 194 ? 16.333 74.719 78.006  1.00 23.88 ? 195  THR C CB  1 
ATOM   5688 O OG1 . THR C 1 194 ? 15.302 73.895 78.603  1.00 20.23 ? 195  THR C OG1 1 
ATOM   5689 C CG2 . THR C 1 194 ? 16.101 76.217 78.351  1.00 21.73 ? 195  THR C CG2 1 
ATOM   5690 N N   . ALA C 1 195 ? 17.861 73.016 75.337  1.00 17.83 ? 196  ALA C N   1 
ATOM   5691 C CA  . ALA C 1 195 ? 18.372 71.712 74.928  1.00 18.78 ? 196  ALA C CA  1 
ATOM   5692 C C   . ALA C 1 195 ? 19.799 71.515 75.426  1.00 21.88 ? 196  ALA C C   1 
ATOM   5693 O O   . ALA C 1 195 ? 20.651 71.000 74.700  1.00 20.63 ? 196  ALA C O   1 
ATOM   5694 C CB  . ALA C 1 195 ? 18.319 71.592 73.414  1.00 18.98 ? 196  ALA C CB  1 
ATOM   5695 N N   . GLY C 1 196 ? 20.046 71.907 76.672  1.00 19.70 ? 197  GLY C N   1 
ATOM   5696 C CA  . GLY C 1 196 ? 21.384 71.784 77.214  1.00 22.67 ? 197  GLY C CA  1 
ATOM   5697 C C   . GLY C 1 196 ? 21.798 70.399 77.684  1.00 23.01 ? 197  GLY C C   1 
ATOM   5698 O O   . GLY C 1 196 ? 20.966 69.500 77.800  1.00 20.03 ? 197  GLY C O   1 
ATOM   5699 N N   . ALA C 1 197 ? 23.093 70.234 77.958  1.00 23.37 ? 198  ALA C N   1 
ATOM   5700 C CA  . ALA C 1 197 ? 23.610 68.952 78.454  1.00 24.51 ? 198  ALA C CA  1 
ATOM   5701 C C   . ALA C 1 197 ? 22.881 68.610 79.754  1.00 27.14 ? 198  ALA C C   1 
ATOM   5702 O O   . ALA C 1 197 ? 22.319 69.481 80.433  1.00 25.85 ? 198  ALA C O   1 
ATOM   5703 C CB  . ALA C 1 197 ? 25.131 69.031 78.698  1.00 25.29 ? 198  ALA C CB  1 
ATOM   5704 N N   . ILE C 1 198 ? 22.919 67.339 80.121  1.00 24.98 ? 199  ILE C N   1 
ATOM   5705 C CA  . ILE C 1 198 ? 22.202 66.890 81.288  1.00 27.95 ? 199  ILE C CA  1 
ATOM   5706 C C   . ILE C 1 198 ? 22.641 67.533 82.605  1.00 27.97 ? 199  ILE C C   1 
ATOM   5707 O O   . ILE C 1 198 ? 23.825 67.796 82.826  1.00 27.67 ? 199  ILE C O   1 
ATOM   5708 C CB  . ILE C 1 198 ? 22.264 65.335 81.378  1.00 28.68 ? 199  ILE C CB  1 
ATOM   5709 C CG1 . ILE C 1 198 ? 21.421 64.841 82.554  1.00 30.14 ? 199  ILE C CG1 1 
ATOM   5710 C CG2 . ILE C 1 198 ? 23.702 64.884 81.484  1.00 31.74 ? 199  ILE C CG2 1 
ATOM   5711 C CD1 . ILE C 1 198 ? 21.051 63.358 82.479  1.00 32.44 ? 199  ILE C CD1 1 
ATOM   5712 N N   . GLY C 1 199 ? 21.657 67.829 83.453  1.00 27.98 ? 200  GLY C N   1 
ATOM   5713 C CA  . GLY C 1 199 ? 21.918 68.407 84.763  1.00 27.76 ? 200  GLY C CA  1 
ATOM   5714 C C   . GLY C 1 199 ? 22.349 69.863 84.855  1.00 28.63 ? 200  GLY C C   1 
ATOM   5715 O O   . GLY C 1 199 ? 23.046 70.225 85.803  1.00 28.48 ? 200  GLY C O   1 
ATOM   5716 N N   . LEU C 1 200 ? 21.930 70.704 83.910  1.00 24.38 ? 201  LEU C N   1 
ATOM   5717 C CA  . LEU C 1 200 ? 22.308 72.121 83.927  1.00 25.77 ? 201  LEU C CA  1 
ATOM   5718 C C   . LEU C 1 200 ? 21.116 73.044 83.759  1.00 25.39 ? 201  LEU C C   1 
ATOM   5719 O O   . LEU C 1 200 ? 20.221 72.759 82.957  1.00 22.37 ? 201  LEU C O   1 
ATOM   5720 C CB  . LEU C 1 200 ? 23.262 72.421 82.779  1.00 28.85 ? 201  LEU C CB  1 
ATOM   5721 C CG  . LEU C 1 200 ? 24.549 71.609 82.724  1.00 32.30 ? 201  LEU C CG  1 
ATOM   5722 C CD1 . LEU C 1 200 ? 25.202 71.837 81.381  1.00 31.84 ? 201  LEU C CD1 1 
ATOM   5723 C CD2 . LEU C 1 200 ? 25.473 72.012 83.872  1.00 34.18 ? 201  LEU C CD2 1 
ATOM   5724 N N   . GLU C 1 201 ? 21.108 74.157 84.488  1.00 25.12 ? 202  GLU C N   1 
ATOM   5725 C CA  . GLU C 1 201 ? 20.013 75.118 84.335  1.00 26.44 ? 202  GLU C CA  1 
ATOM   5726 C C   . GLU C 1 201 ? 20.457 76.185 83.336  1.00 26.97 ? 202  GLU C C   1 
ATOM   5727 O O   . GLU C 1 201 ? 21.541 76.761 83.480  1.00 24.43 ? 202  GLU C O   1 
ATOM   5728 C CB  . GLU C 1 201 ? 19.654 75.804 85.665  1.00 29.12 ? 202  GLU C CB  1 
ATOM   5729 C CG  . GLU C 1 201 ? 18.560 76.912 85.517  1.00 29.42 ? 202  GLU C CG  1 
ATOM   5730 C CD  . GLU C 1 201 ? 18.206 77.605 86.831  1.00 33.96 ? 202  GLU C CD  1 
ATOM   5731 O OE1 . GLU C 1 201 ? 19.028 78.394 87.355  1.00 33.87 ? 202  GLU C OE1 1 
ATOM   5732 O OE2 . GLU C 1 201 ? 17.103 77.358 87.356  1.00 34.05 ? 202  GLU C OE2 1 
ATOM   5733 N N   . LEU C 1 202 ? 19.612 76.450 82.340  1.00 26.21 ? 203  LEU C N   1 
ATOM   5734 C CA  . LEU C 1 202 ? 19.898 77.450 81.313  1.00 25.26 ? 203  LEU C CA  1 
ATOM   5735 C C   . LEU C 1 202 ? 18.960 78.652 81.347  1.00 27.42 ? 203  LEU C C   1 
ATOM   5736 O O   . LEU C 1 202 ? 19.322 79.728 80.863  1.00 26.86 ? 203  LEU C O   1 
ATOM   5737 C CB  . LEU C 1 202 ? 19.788 76.849 79.919  1.00 24.74 ? 203  LEU C CB  1 
ATOM   5738 C CG  . LEU C 1 202 ? 20.826 75.840 79.422  1.00 25.82 ? 203  LEU C CG  1 
ATOM   5739 C CD1 . LEU C 1 202 ? 20.396 75.400 78.037  1.00 26.58 ? 203  LEU C CD1 1 
ATOM   5740 C CD2 . LEU C 1 202 ? 22.204 76.470 79.362  1.00 29.14 ? 203  LEU C CD2 1 
ATOM   5741 N N   . LEU C 1 203 ? 17.758 78.470 81.888  1.00 26.25 ? 204  LEU C N   1 
ATOM   5742 C CA  . LEU C 1 203 ? 16.775 79.556 81.921  1.00 27.11 ? 204  LEU C CA  1 
ATOM   5743 C C   . LEU C 1 203 ? 16.109 79.702 83.294  1.00 26.69 ? 204  LEU C C   1 
ATOM   5744 O O   . LEU C 1 203 ? 15.108 79.044 83.584  1.00 27.48 ? 204  LEU C O   1 
ATOM   5745 C CB  . LEU C 1 203 ? 15.705 79.289 80.851  1.00 27.66 ? 204  LEU C CB  1 
ATOM   5746 C CG  . LEU C 1 203 ? 14.687 80.396 80.558  1.00 29.21 ? 204  LEU C CG  1 
ATOM   5747 C CD1 . LEU C 1 203 ? 15.389 81.569 79.925  1.00 28.16 ? 204  LEU C CD1 1 
ATOM   5748 C CD2 . LEU C 1 203 ? 13.590 79.877 79.641  1.00 26.63 ? 204  LEU C CD2 1 
ATOM   5749 N N   . PRO C 1 204 ? 16.656 80.564 84.164  1.00 26.24 ? 205  PRO C N   1 
ATOM   5750 C CA  . PRO C 1 204 ? 16.040 80.725 85.487  1.00 26.46 ? 205  PRO C CA  1 
ATOM   5751 C C   . PRO C 1 204 ? 14.579 81.167 85.433  1.00 26.45 ? 205  PRO C C   1 
ATOM   5752 O O   . PRO C 1 204 ? 14.126 81.812 84.487  1.00 24.66 ? 205  PRO C O   1 
ATOM   5753 C CB  . PRO C 1 204 ? 16.924 81.775 86.160  1.00 27.64 ? 205  PRO C CB  1 
ATOM   5754 C CG  . PRO C 1 204 ? 18.267 81.565 85.479  1.00 28.09 ? 205  PRO C CG  1 
ATOM   5755 C CD  . PRO C 1 204 ? 17.885 81.372 84.045  1.00 24.68 ? 205  PRO C CD  1 
ATOM   5756 N N   . GLN C 1 205 ? 13.842 80.821 86.475  1.00 26.63 ? 206  GLN C N   1 
ATOM   5757 C CA  . GLN C 1 205 ? 12.439 81.176 86.561  1.00 28.08 ? 206  GLN C CA  1 
ATOM   5758 C C   . GLN C 1 205 ? 12.185 82.657 86.222  1.00 27.57 ? 206  GLN C C   1 
ATOM   5759 O O   . GLN C 1 205 ? 11.351 82.974 85.375  1.00 24.07 ? 206  GLN C O   1 
ATOM   5760 C CB  . GLN C 1 205 ? 11.954 80.882 87.975  1.00 31.16 ? 206  GLN C CB  1 
ATOM   5761 C CG  . GLN C 1 205 ? 10.455 80.832 88.137  1.00 33.75 ? 206  GLN C CG  1 
ATOM   5762 C CD  . GLN C 1 205 ? 10.077 80.442 89.547  1.00 35.45 ? 206  GLN C CD  1 
ATOM   5763 O OE1 . GLN C 1 205 ? 10.939 80.081 90.356  1.00 40.01 ? 206  GLN C OE1 1 
ATOM   5764 N NE2 . GLN C 1 205 ? 8.797  80.498 89.850  1.00 36.24 ? 206  GLN C NE2 1 
ATOM   5765 N N   . ALA C 1 206 ? 12.914 83.554 86.884  1.00 27.80 ? 207  ALA C N   1 
ATOM   5766 C CA  . ALA C 1 206 ? 12.734 84.997 86.671  1.00 29.03 ? 207  ALA C CA  1 
ATOM   5767 C C   . ALA C 1 206 ? 13.115 85.453 85.265  1.00 29.36 ? 207  ALA C C   1 
ATOM   5768 O O   . ALA C 1 206 ? 12.791 86.576 84.851  1.00 32.32 ? 207  ALA C O   1 
ATOM   5769 C CB  . ALA C 1 206 ? 13.553 85.793 87.720  1.00 27.39 ? 207  ALA C CB  1 
ATOM   5770 N N   . ALA C 1 207 ? 13.812 84.599 84.531  1.00 27.05 ? 208  ALA C N   1 
ATOM   5771 C CA  . ALA C 1 207 ? 14.226 84.957 83.174  1.00 27.88 ? 208  ALA C CA  1 
ATOM   5772 C C   . ALA C 1 207 ? 13.151 84.689 82.120  1.00 25.42 ? 208  ALA C C   1 
ATOM   5773 O O   . ALA C 1 207 ? 13.322 85.070 80.958  1.00 28.31 ? 208  ALA C O   1 
ATOM   5774 C CB  . ALA C 1 207 ? 15.542 84.227 82.801  1.00 25.07 ? 208  ALA C CB  1 
ATOM   5775 N N   . TRP C 1 208 ? 12.061 84.014 82.485  1.00 24.69 ? 209  TRP C N   1 
ATOM   5776 C CA  . TRP C 1 208 ? 10.999 83.781 81.497  1.00 24.22 ? 209  TRP C CA  1 
ATOM   5777 C C   . TRP C 1 208 ? 9.580  84.149 81.963  1.00 25.87 ? 209  TRP C C   1 
ATOM   5778 O O   . TRP C 1 208 ? 8.759  84.627 81.160  1.00 26.59 ? 209  TRP C O   1 
ATOM   5779 C CB  . TRP C 1 208 ? 11.001 82.321 80.971  1.00 24.68 ? 209  TRP C CB  1 
ATOM   5780 C CG  . TRP C 1 208 ? 10.671 81.214 81.990  1.00 22.18 ? 209  TRP C CG  1 
ATOM   5781 C CD1 . TRP C 1 208 ? 11.531 80.656 82.907  1.00 24.04 ? 209  TRP C CD1 1 
ATOM   5782 C CD2 . TRP C 1 208 ? 9.399  80.575 82.199  1.00 22.58 ? 209  TRP C CD2 1 
ATOM   5783 N NE1 . TRP C 1 208 ? 10.876 79.710 83.666  1.00 22.87 ? 209  TRP C NE1 1 
ATOM   5784 C CE2 . TRP C 1 208 ? 9.568  79.640 83.252  1.00 23.27 ? 209  TRP C CE2 1 
ATOM   5785 C CE3 . TRP C 1 208 ? 8.132  80.695 81.594  1.00 23.58 ? 209  TRP C CE3 1 
ATOM   5786 C CZ2 . TRP C 1 208 ? 8.517  78.840 83.725  1.00 23.35 ? 209  TRP C CZ2 1 
ATOM   5787 C CZ3 . TRP C 1 208 ? 7.084  79.896 82.062  1.00 25.81 ? 209  TRP C CZ3 1 
ATOM   5788 C CH2 . TRP C 1 208 ? 7.289  78.975 83.119  1.00 25.32 ? 209  TRP C CH2 1 
ATOM   5789 N N   . GLN C 1 209 ? 9.280  83.951 83.243  1.00 26.00 ? 210  GLN C N   1 
ATOM   5790 C CA  . GLN C 1 209 ? 7.924  84.248 83.720  1.00 28.44 ? 210  GLN C CA  1 
ATOM   5791 C C   . GLN C 1 209 ? 7.524  85.729 83.720  1.00 29.54 ? 210  GLN C C   1 
ATOM   5792 O O   . GLN C 1 209 ? 6.346  86.051 83.868  1.00 32.90 ? 210  GLN C O   1 
ATOM   5793 C CB  . GLN C 1 209 ? 7.709  83.649 85.114  1.00 28.00 ? 210  GLN C CB  1 
ATOM   5794 C CG  . GLN C 1 209 ? 7.918  82.132 85.180  1.00 32.96 ? 210  GLN C CG  1 
ATOM   5795 C CD  . GLN C 1 209 ? 7.430  81.529 86.487  1.00 34.95 ? 210  GLN C CD  1 
ATOM   5796 O OE1 . GLN C 1 209 ? 7.381  82.210 87.517  1.00 35.56 ? 210  GLN C OE1 1 
ATOM   5797 N NE2 . GLN C 1 209 ? 7.083  80.244 86.459  1.00 36.06 ? 210  GLN C NE2 1 
ATOM   5798 N N   . ASN C 1 210 ? 8.490  86.625 83.555  1.00 32.25 ? 211  ASN C N   1 
ATOM   5799 C CA  . ASN C 1 210 ? 8.222  88.073 83.539  1.00 34.11 ? 211  ASN C CA  1 
ATOM   5800 C C   . ASN C 1 210 ? 8.249  88.648 82.119  1.00 34.44 ? 211  ASN C C   1 
ATOM   5801 O O   . ASN C 1 210 ? 8.146  89.858 81.943  1.00 36.28 ? 211  ASN C O   1 
ATOM   5802 C CB  . ASN C 1 210 ? 9.263  88.825 84.384  1.00 33.97 ? 211  ASN C CB  1 
ATOM   5803 C CG  . ASN C 1 210 ? 9.217  88.453 85.866  1.00 38.50 ? 211  ASN C CG  1 
ATOM   5804 O OD1 . ASN C 1 210 ? 10.252 88.445 86.547  1.00 42.41 ? 211  ASN C OD1 1 
ATOM   5805 N ND2 . ASN C 1 210 ? 8.022  88.170 86.376  1.00 35.33 ? 211  ASN C ND2 1 
ATOM   5806 N N   . GLU C 1 211 ? 8.381  87.789 81.108  1.00 34.02 ? 212  GLU C N   1 
ATOM   5807 C CA  . GLU C 1 211 ? 8.430  88.238 79.713  1.00 31.42 ? 212  GLU C CA  1 
ATOM   5808 C C   . GLU C 1 211 ? 7.079  87.986 79.049  1.00 31.88 ? 212  GLU C C   1 
ATOM   5809 O O   . GLU C 1 211 ? 6.769  86.848 78.699  1.00 26.40 ? 212  GLU C O   1 
ATOM   5810 C CB  . GLU C 1 211 ? 9.527  87.475 78.958  1.00 31.56 ? 212  GLU C CB  1 
ATOM   5811 C CG  . GLU C 1 211 ? 9.788  87.974 77.549  1.00 28.32 ? 212  GLU C CG  1 
ATOM   5812 C CD  . GLU C 1 211 ? 10.392 89.381 77.513  1.00 29.48 ? 212  GLU C CD  1 
ATOM   5813 O OE1 . GLU C 1 211 ? 11.018 89.807 78.510  1.00 27.47 ? 212  GLU C OE1 1 
ATOM   5814 O OE2 . GLU C 1 211 ? 10.258 90.047 76.466  1.00 28.39 ? 212  GLU C OE2 1 
ATOM   5815 N N   . SER C 1 212 ? 6.279  89.043 78.855  1.00 29.97 ? 213  SER C N   1 
ATOM   5816 C CA  . SER C 1 212 ? 4.945  88.869 78.285  1.00 30.92 ? 213  SER C CA  1 
ATOM   5817 C C   . SER C 1 212 ? 4.823  88.196 76.920  1.00 29.53 ? 213  SER C C   1 
ATOM   5818 O O   . SER C 1 212 ? 3.818  87.537 76.646  1.00 30.39 ? 213  SER C O   1 
ATOM   5819 C CB  . SER C 1 212 ? 4.196  90.203 78.242  1.00 32.50 ? 213  SER C CB  1 
ATOM   5820 O OG  . SER C 1 212 ? 4.860  91.117 77.397  1.00 37.08 ? 213  SER C OG  1 
ATOM   5821 N N   . SER C 1 213 ? 5.817  88.349 76.057  1.00 28.41 ? 214  SER C N   1 
ATOM   5822 C CA  . SER C 1 213 ? 5.722  87.733 74.739  1.00 26.90 ? 214  SER C CA  1 
ATOM   5823 C C   . SER C 1 213 ? 5.803  86.204 74.775  1.00 25.54 ? 214  SER C C   1 
ATOM   5824 O O   . SER C 1 213 ? 5.257  85.536 73.898  1.00 24.34 ? 214  SER C O   1 
ATOM   5825 C CB  . SER C 1 213 ? 6.837  88.256 73.827  1.00 27.65 ? 214  SER C CB  1 
ATOM   5826 O OG  . SER C 1 213 ? 8.098  88.016 74.426  1.00 26.74 ? 214  SER C OG  1 
ATOM   5827 N N   . ILE C 1 214 ? 6.476  85.644 75.773  1.00 24.94 ? 215  ILE C N   1 
ATOM   5828 C CA  . ILE C 1 214 ? 6.623  84.188 75.805  1.00 22.91 ? 215  ILE C CA  1 
ATOM   5829 C C   . ILE C 1 214 ? 5.305  83.455 76.046  1.00 24.16 ? 215  ILE C C   1 
ATOM   5830 O O   . ILE C 1 214 ? 4.585  83.720 77.017  1.00 20.63 ? 215  ILE C O   1 
ATOM   5831 C CB  . ILE C 1 214 ? 7.695  83.748 76.849  1.00 24.78 ? 215  ILE C CB  1 
ATOM   5832 C CG1 . ILE C 1 214 ? 9.084  84.201 76.378  1.00 23.07 ? 215  ILE C CG1 1 
ATOM   5833 C CG2 . ILE C 1 214 ? 7.687  82.213 77.017  1.00 23.55 ? 215  ILE C CG2 1 
ATOM   5834 C CD1 . ILE C 1 214 ? 10.176 84.027 77.437  1.00 22.09 ? 215  ILE C CD1 1 
ATOM   5835 N N   . GLU C 1 215 ? 4.991  82.539 75.134  1.00 19.65 ? 216  GLU C N   1 
ATOM   5836 C CA  . GLU C 1 215 ? 3.764  81.760 75.228  1.00 22.11 ? 216  GLU C CA  1 
ATOM   5837 C C   . GLU C 1 215 ? 3.954  80.360 75.814  1.00 22.83 ? 216  GLU C C   1 
ATOM   5838 O O   . GLU C 1 215 ? 3.206  79.943 76.714  1.00 19.39 ? 216  GLU C O   1 
ATOM   5839 C CB  . GLU C 1 215 ? 3.124  81.621 73.848  1.00 21.27 ? 216  GLU C CB  1 
ATOM   5840 C CG  . GLU C 1 215 ? 2.632  82.931 73.269  1.00 27.81 ? 216  GLU C CG  1 
ATOM   5841 C CD  . GLU C 1 215 ? 2.134  82.773 71.862  1.00 28.47 ? 216  GLU C CD  1 
ATOM   5842 O OE1 . GLU C 1 215 ? 1.272  81.905 71.634  1.00 32.47 ? 216  GLU C OE1 1 
ATOM   5843 O OE2 . GLU C 1 215 ? 2.600  83.516 70.982  1.00 32.38 ? 216  GLU C OE2 1 
ATOM   5844 N N   . ILE C 1 216 ? 4.932  79.630 75.274  1.00 20.95 ? 217  ILE C N   1 
ATOM   5845 C CA  . ILE C 1 216 ? 5.211  78.258 75.699  1.00 21.28 ? 217  ILE C CA  1 
ATOM   5846 C C   . ILE C 1 216 ? 6.712  78.005 75.833  1.00 21.04 ? 217  ILE C C   1 
ATOM   5847 O O   . ILE C 1 216 ? 7.481  78.526 75.040  1.00 22.01 ? 217  ILE C O   1 
ATOM   5848 C CB  . ILE C 1 216 ? 4.677  77.255 74.655  1.00 19.67 ? 217  ILE C CB  1 
ATOM   5849 C CG1 . ILE C 1 216 ? 3.182  77.486 74.415  1.00 21.41 ? 217  ILE C CG1 1 
ATOM   5850 C CG2 . ILE C 1 216 ? 4.919  75.832 75.131  1.00 19.53 ? 217  ILE C CG2 1 
ATOM   5851 C CD1 . ILE C 1 216 ? 2.643  76.836 73.125  1.00 18.28 ? 217  ILE C CD1 1 
ATOM   5852 N N   . VAL C 1 217 ? 7.133  77.250 76.852  1.00 19.63 ? 218  VAL C N   1 
ATOM   5853 C CA  . VAL C 1 217 ? 8.556  76.907 77.012  1.00 19.89 ? 218  VAL C CA  1 
ATOM   5854 C C   . VAL C 1 217 ? 8.676  75.371 77.059  1.00 20.46 ? 218  VAL C C   1 
ATOM   5855 O O   . VAL C 1 217 ? 7.722  74.697 77.404  1.00 20.40 ? 218  VAL C O   1 
ATOM   5856 C CB  . VAL C 1 217 ? 9.174  77.542 78.293  1.00 22.57 ? 218  VAL C CB  1 
ATOM   5857 C CG1 . VAL C 1 217 ? 9.173  79.087 78.174  1.00 18.75 ? 218  VAL C CG1 1 
ATOM   5858 C CG2 . VAL C 1 217 ? 8.405  77.090 79.536  1.00 22.24 ? 218  VAL C CG2 1 
ATOM   5859 N N   . ALA C 1 218 ? 9.824  74.817 76.661  1.00 19.57 ? 219  ALA C N   1 
ATOM   5860 C CA  . ALA C 1 218 ? 10.026 73.357 76.658  1.00 19.14 ? 219  ALA C CA  1 
ATOM   5861 C C   . ALA C 1 218 ? 11.463 73.076 77.048  1.00 18.73 ? 219  ALA C C   1 
ATOM   5862 O O   . ALA C 1 218 ? 12.373 73.790 76.613  1.00 20.24 ? 219  ALA C O   1 
ATOM   5863 C CB  . ALA C 1 218 ? 9.743  72.774 75.272  1.00 17.31 ? 219  ALA C CB  1 
ATOM   5864 N N   . ASP C 1 219 ? 11.663 72.023 77.839  1.00 16.85 ? 220  ASP C N   1 
ATOM   5865 C CA  . ASP C 1 219 ? 12.968 71.648 78.366  1.00 18.23 ? 220  ASP C CA  1 
ATOM   5866 C C   . ASP C 1 219 ? 13.222 70.154 78.140  1.00 21.88 ? 220  ASP C C   1 
ATOM   5867 O O   . ASP C 1 219 ? 12.354 69.312 78.437  1.00 19.25 ? 220  ASP C O   1 
ATOM   5868 C CB  . ASP C 1 219 ? 12.967 71.998 79.861  1.00 18.40 ? 220  ASP C CB  1 
ATOM   5869 C CG  . ASP C 1 219 ? 14.260 71.663 80.567  1.00 21.10 ? 220  ASP C CG  1 
ATOM   5870 O OD1 . ASP C 1 219 ? 15.318 71.585 79.910  1.00 26.04 ? 220  ASP C OD1 1 
ATOM   5871 O OD2 . ASP C 1 219 ? 14.214 71.501 81.806  1.00 22.60 ? 220  ASP C OD2 1 
ATOM   5872 N N   . TYR C 1 220 ? 14.401 69.832 77.611  1.00 20.51 ? 221  TYR C N   1 
ATOM   5873 C CA  . TYR C 1 220 ? 14.772 68.435 77.326  1.00 21.33 ? 221  TYR C CA  1 
ATOM   5874 C C   . TYR C 1 220 ? 15.622 67.781 78.418  1.00 21.76 ? 221  TYR C C   1 
ATOM   5875 O O   . TYR C 1 220 ? 15.863 66.570 78.393  1.00 22.03 ? 221  TYR C O   1 
ATOM   5876 C CB  . TYR C 1 220 ? 15.524 68.357 75.986  1.00 18.78 ? 221  TYR C CB  1 
ATOM   5877 C CG  . TYR C 1 220 ? 14.692 68.711 74.775  1.00 16.89 ? 221  TYR C CG  1 
ATOM   5878 C CD1 . TYR C 1 220 ? 14.955 69.871 74.032  1.00 17.87 ? 221  TYR C CD1 1 
ATOM   5879 C CD2 . TYR C 1 220 ? 13.689 67.856 74.331  1.00 18.06 ? 221  TYR C CD2 1 
ATOM   5880 C CE1 . TYR C 1 220 ? 14.237 70.159 72.873  1.00 19.37 ? 221  TYR C CE1 1 
ATOM   5881 C CE2 . TYR C 1 220 ? 12.959 68.123 73.164  1.00 18.17 ? 221  TYR C CE2 1 
ATOM   5882 C CZ  . TYR C 1 220 ? 13.240 69.271 72.442  1.00 20.43 ? 221  TYR C CZ  1 
ATOM   5883 O OH  . TYR C 1 220 ? 12.543 69.517 71.281  1.00 16.69 ? 221  TYR C OH  1 
ATOM   5884 N N   . ASN C 1 221 ? 16.066 68.572 79.383  1.00 20.25 ? 222  ASN C N   1 
ATOM   5885 C CA  . ASN C 1 221 ? 16.895 68.057 80.468  1.00 21.07 ? 222  ASN C CA  1 
ATOM   5886 C C   . ASN C 1 221 ? 16.031 67.548 81.608  1.00 21.71 ? 222  ASN C C   1 
ATOM   5887 O O   . ASN C 1 221 ? 15.273 68.325 82.195  1.00 21.61 ? 222  ASN C O   1 
ATOM   5888 C CB  . ASN C 1 221 ? 17.836 69.152 80.988  1.00 20.73 ? 222  ASN C CB  1 
ATOM   5889 C CG  . ASN C 1 221 ? 18.539 68.748 82.275  1.00 22.55 ? 222  ASN C CG  1 
ATOM   5890 O OD1 . ASN C 1 221 ? 18.917 67.593 82.446  1.00 23.82 ? 222  ASN C OD1 1 
ATOM   5891 N ND2 . ASN C 1 221 ? 18.720 69.695 83.180  1.00 20.16 ? 222  ASN C ND2 1 
ATOM   5892 N N   . ALA C 1 222 ? 16.143 66.249 81.912  1.00 20.85 ? 223  ALA C N   1 
ATOM   5893 C CA  . ALA C 1 222 ? 15.368 65.610 82.979  1.00 23.21 ? 223  ALA C CA  1 
ATOM   5894 C C   . ALA C 1 222 ? 16.082 65.513 84.344  1.00 24.98 ? 223  ALA C C   1 
ATOM   5895 O O   . ALA C 1 222 ? 15.474 65.105 85.340  1.00 22.69 ? 223  ALA C O   1 
ATOM   5896 C CB  . ALA C 1 222 ? 14.936 64.202 82.535  1.00 26.78 ? 223  ALA C CB  1 
ATOM   5897 N N   . GLN C 1 223 ? 17.352 65.900 84.392  1.00 25.97 ? 224  GLN C N   1 
ATOM   5898 C CA  . GLN C 1 223 ? 18.124 65.828 85.631  1.00 28.62 ? 224  GLN C CA  1 
ATOM   5899 C C   . GLN C 1 223 ? 18.310 67.167 86.336  1.00 27.33 ? 224  GLN C C   1 
ATOM   5900 O O   . GLN C 1 223 ? 18.908 68.085 85.801  1.00 25.96 ? 224  GLN C O   1 
ATOM   5901 C CB  . GLN C 1 223 ? 19.496 65.210 85.358  1.00 28.62 ? 224  GLN C CB  1 
ATOM   5902 C CG  . GLN C 1 223 ? 20.342 64.987 86.603  1.00 34.43 ? 224  GLN C CG  1 
ATOM   5903 C CD  . GLN C 1 223 ? 21.667 64.307 86.298  1.00 36.97 ? 224  GLN C CD  1 
ATOM   5904 O OE1 . GLN C 1 223 ? 21.699 63.165 85.827  1.00 38.95 ? 224  GLN C OE1 1 
ATOM   5905 N NE2 . GLN C 1 223 ? 22.776 65.010 86.559  1.00 38.38 ? 224  GLN C NE2 1 
ATOM   5906 N N   . PRO C 1 224 ? 17.797 67.284 87.568  1.00 30.62 ? 225  PRO C N   1 
ATOM   5907 C CA  . PRO C 1 224 ? 17.920 68.524 88.348  1.00 29.42 ? 225  PRO C CA  1 
ATOM   5908 C C   . PRO C 1 224 ? 19.385 68.918 88.509  1.00 30.13 ? 225  PRO C C   1 
ATOM   5909 O O   . PRO C 1 224 ? 20.249 68.059 88.708  1.00 31.56 ? 225  PRO C O   1 
ATOM   5910 C CB  . PRO C 1 224 ? 17.278 68.151 89.683  1.00 31.54 ? 225  PRO C CB  1 
ATOM   5911 C CG  . PRO C 1 224 ? 16.231 67.150 89.279  1.00 30.13 ? 225  PRO C CG  1 
ATOM   5912 C CD  . PRO C 1 224 ? 16.984 66.287 88.286  1.00 30.11 ? 225  PRO C CD  1 
ATOM   5913 N N   . PRO C 1 225 ? 19.697 70.219 88.402  1.00 29.10 ? 226  PRO C N   1 
ATOM   5914 C CA  . PRO C 1 225 ? 18.772 71.328 88.133  1.00 28.91 ? 226  PRO C CA  1 
ATOM   5915 C C   . PRO C 1 225 ? 18.263 71.266 86.693  1.00 25.81 ? 226  PRO C C   1 
ATOM   5916 O O   . PRO C 1 225 ? 19.053 71.124 85.747  1.00 25.35 ? 226  PRO C O   1 
ATOM   5917 C CB  . PRO C 1 225 ? 19.628 72.557 88.401  1.00 27.76 ? 226  PRO C CB  1 
ATOM   5918 C CG  . PRO C 1 225 ? 20.986 72.103 87.950  1.00 32.39 ? 226  PRO C CG  1 
ATOM   5919 C CD  . PRO C 1 225 ? 21.073 70.718 88.578  1.00 30.90 ? 226  PRO C CD  1 
ATOM   5920 N N   . LEU C 1 226 ? 16.946 71.362 86.536  1.00 24.43 ? 227  LEU C N   1 
ATOM   5921 C CA  . LEU C 1 226 ? 16.333 71.288 85.207  1.00 23.12 ? 227  LEU C CA  1 
ATOM   5922 C C   . LEU C 1 226 ? 16.780 72.477 84.367  1.00 23.69 ? 227  LEU C C   1 
ATOM   5923 O O   . LEU C 1 226 ? 17.202 73.503 84.910  1.00 22.80 ? 227  LEU C O   1 
ATOM   5924 C CB  . LEU C 1 226 ? 14.797 71.261 85.321  1.00 21.20 ? 227  LEU C CB  1 
ATOM   5925 C CG  . LEU C 1 226 ? 14.156 70.174 86.218  1.00 21.25 ? 227  LEU C CG  1 
ATOM   5926 C CD1 . LEU C 1 226 ? 12.642 70.236 86.062  1.00 22.79 ? 227  LEU C CD1 1 
ATOM   5927 C CD2 . LEU C 1 226 ? 14.646 68.773 85.838  1.00 21.24 ? 227  LEU C CD2 1 
ATOM   5928 N N   . GLY C 1 227 ? 16.685 72.322 83.052  1.00 20.40 ? 228  GLY C N   1 
ATOM   5929 C CA  . GLY C 1 227 ? 17.082 73.363 82.133  1.00 21.90 ? 228  GLY C CA  1 
ATOM   5930 C C   . GLY C 1 227 ? 16.295 74.635 82.362  1.00 23.25 ? 228  GLY C C   1 
ATOM   5931 O O   . GLY C 1 227 ? 16.848 75.729 82.237  1.00 22.77 ? 228  GLY C O   1 
ATOM   5932 N N   . ILE C 1 228 ? 15.019 74.494 82.716  1.00 22.07 ? 229  ILE C N   1 
ATOM   5933 C CA  . ILE C 1 228 ? 14.152 75.662 82.962  1.00 21.23 ? 229  ILE C CA  1 
ATOM   5934 C C   . ILE C 1 228 ? 13.735 75.686 84.419  1.00 22.86 ? 229  ILE C C   1 
ATOM   5935 O O   . ILE C 1 228 ? 13.195 74.705 84.922  1.00 23.52 ? 229  ILE C O   1 
ATOM   5936 C CB  . ILE C 1 228 ? 12.870 75.605 82.092  1.00 20.08 ? 229  ILE C CB  1 
ATOM   5937 C CG1 . ILE C 1 228 ? 13.270 75.656 80.615  1.00 18.21 ? 229  ILE C CG1 1 
ATOM   5938 C CG2 . ILE C 1 228 ? 11.906 76.762 82.484  1.00 19.64 ? 229  ILE C CG2 1 
ATOM   5939 C CD1 . ILE C 1 228 ? 12.092 75.680 79.611  1.00 19.25 ? 229  ILE C CD1 1 
ATOM   5940 N N   . GLY C 1 229 ? 13.976 76.798 85.107  1.00 21.17 ? 230  GLY C N   1 
ATOM   5941 C CA  . GLY C 1 229 ? 13.596 76.853 86.512  1.00 23.50 ? 230  GLY C CA  1 
ATOM   5942 C C   . GLY C 1 229 ? 12.119 77.142 86.708  1.00 22.67 ? 230  GLY C C   1 
ATOM   5943 O O   . GLY C 1 229 ? 11.485 77.770 85.856  1.00 25.13 ? 230  GLY C O   1 
ATOM   5944 N N   . GLY C 1 230 ? 11.569 76.675 87.830  1.00 24.09 ? 231  GLY C N   1 
ATOM   5945 C CA  . GLY C 1 230 ? 10.171 76.911 88.123  1.00 23.39 ? 231  GLY C CA  1 
ATOM   5946 C C   . GLY C 1 230 ? 9.164  75.937 87.542  1.00 26.05 ? 231  GLY C C   1 
ATOM   5947 O O   . GLY C 1 230 ? 7.950  76.127 87.704  1.00 26.52 ? 231  GLY C O   1 
ATOM   5948 N N   . ILE C 1 231 ? 9.630  74.894 86.861  1.00 24.80 ? 232  ILE C N   1 
ATOM   5949 C CA  . ILE C 1 231 ? 8.698  73.914 86.305  1.00 23.05 ? 232  ILE C CA  1 
ATOM   5950 C C   . ILE C 1 231 ? 9.044  72.541 86.846  1.00 23.72 ? 232  ILE C C   1 
ATOM   5951 O O   . ILE C 1 231 ? 10.065 72.372 87.505  1.00 23.71 ? 232  ILE C O   1 
ATOM   5952 C CB  . ILE C 1 231 ? 8.771  73.829 84.756  1.00 23.03 ? 232  ILE C CB  1 
ATOM   5953 C CG1 . ILE C 1 231 ? 10.143 73.261 84.320  1.00 18.73 ? 232  ILE C CG1 1 
ATOM   5954 C CG2 . ILE C 1 231 ? 8.503  75.213 84.146  1.00 19.59 ? 232  ILE C CG2 1 
ATOM   5955 C CD1 . ILE C 1 231 ? 10.216 72.843 82.814  1.00 19.77 ? 232  ILE C CD1 1 
ATOM   5956 N N   . ASP C 1 232 ? 8.192  71.562 86.576  1.00 24.21 ? 233  ASP C N   1 
ATOM   5957 C CA  . ASP C 1 232 ? 8.478  70.196 86.998  1.00 25.94 ? 233  ASP C CA  1 
ATOM   5958 C C   . ASP C 1 232 ? 8.720  69.383 85.736  1.00 24.06 ? 233  ASP C C   1 
ATOM   5959 O O   . ASP C 1 232 ? 8.060  69.602 84.728  1.00 24.07 ? 233  ASP C O   1 
ATOM   5960 C CB  . ASP C 1 232 ? 7.311  69.597 87.785  1.00 29.19 ? 233  ASP C CB  1 
ATOM   5961 C CG  . ASP C 1 232 ? 7.696  68.313 88.472  1.00 39.63 ? 233  ASP C CG  1 
ATOM   5962 O OD1 . ASP C 1 232 ? 7.433  67.215 87.921  1.00 44.30 ? 233  ASP C OD1 1 
ATOM   5963 O OD2 . ASP C 1 232 ? 8.303  68.401 89.562  1.00 43.87 ? 233  ASP C OD2 1 
ATOM   5964 N N   . ALA C 1 233 ? 9.662  68.450 85.773  1.00 24.65 ? 234  ALA C N   1 
ATOM   5965 C CA  . ALA C 1 233 ? 9.956  67.654 84.582  1.00 24.14 ? 234  ALA C CA  1 
ATOM   5966 C C   . ALA C 1 233 ? 8.719  66.976 83.983  1.00 24.89 ? 234  ALA C C   1 
ATOM   5967 O O   . ALA C 1 233 ? 8.682  66.726 82.781  1.00 21.78 ? 234  ALA C O   1 
ATOM   5968 C CB  . ALA C 1 233 ? 11.024 66.591 84.902  1.00 26.21 ? 234  ALA C CB  1 
ATOM   5969 N N   . THR C 1 234 ? 7.711  66.672 84.809  1.00 24.17 ? 235  THR C N   1 
ATOM   5970 C CA  . THR C 1 234 ? 6.507  65.986 84.308  1.00 24.15 ? 235  THR C CA  1 
ATOM   5971 C C   . THR C 1 234 ? 5.489  66.907 83.652  1.00 22.64 ? 235  THR C C   1 
ATOM   5972 O O   . THR C 1 234 ? 4.508  66.435 83.084  1.00 21.85 ? 235  THR C O   1 
ATOM   5973 C CB  . THR C 1 234 ? 5.749  65.202 85.432  1.00 24.14 ? 235  THR C CB  1 
ATOM   5974 O OG1 . THR C 1 234 ? 5.383  66.108 86.481  1.00 26.15 ? 235  THR C OG1 1 
ATOM   5975 C CG2 . THR C 1 234 ? 6.624  64.072 86.003  1.00 24.39 ? 235  THR C CG2 1 
ATOM   5976 N N   . ASP C 1 235 ? 5.710  68.214 83.725  1.00 22.53 ? 236  ASP C N   1 
ATOM   5977 C CA  . ASP C 1 235 ? 4.757  69.136 83.117  1.00 22.10 ? 236  ASP C CA  1 
ATOM   5978 C C   . ASP C 1 235 ? 4.548  68.819 81.643  1.00 23.54 ? 236  ASP C C   1 
ATOM   5979 O O   . ASP C 1 235 ? 5.505  68.519 80.914  1.00 22.59 ? 236  ASP C O   1 
ATOM   5980 C CB  . ASP C 1 235 ? 5.232  70.596 83.257  1.00 24.22 ? 236  ASP C CB  1 
ATOM   5981 C CG  . ASP C 1 235 ? 5.134  71.110 84.685  1.00 28.43 ? 236  ASP C CG  1 
ATOM   5982 O OD1 . ASP C 1 235 ? 4.494  70.411 85.505  1.00 26.04 ? 236  ASP C OD1 1 
ATOM   5983 O OD2 . ASP C 1 235 ? 5.684  72.199 84.982  1.00 23.83 ? 236  ASP C OD2 1 
ATOM   5984 N N   . LYS C 1 236 ? 3.293  68.896 81.212  1.00 21.43 ? 237  LYS C N   1 
ATOM   5985 C CA  . LYS C 1 236 ? 2.941  68.658 79.826  1.00 22.43 ? 237  LYS C CA  1 
ATOM   5986 C C   . LYS C 1 236 ? 1.797  69.606 79.489  1.00 24.11 ? 237  LYS C C   1 
ATOM   5987 O O   . LYS C 1 236 ? 0.630  69.193 79.377  1.00 23.09 ? 237  LYS C O   1 
ATOM   5988 C CB  . LYS C 1 236 ? 2.502  67.219 79.622  1.00 26.45 ? 237  LYS C CB  1 
ATOM   5989 C CG  . LYS C 1 236 ? 2.186  66.885 78.174  1.00 26.37 ? 237  LYS C CG  1 
ATOM   5990 C CD  . LYS C 1 236 ? 1.923  65.401 78.013  1.00 30.01 ? 237  LYS C CD  1 
ATOM   5991 C CE  . LYS C 1 236 ? 1.408  65.088 76.596  1.00 30.71 ? 237  LYS C CE  1 
ATOM   5992 N NZ  . LYS C 1 236 ? 1.179  63.632 76.394  1.00 37.27 ? 237  LYS C NZ  1 
ATOM   5993 N N   . GLY C 1 237 ? 2.136  70.881 79.328  1.00 23.49 ? 238  GLY C N   1 
ATOM   5994 C CA  . GLY C 1 237 ? 1.115  71.879 79.042  1.00 23.46 ? 238  GLY C CA  1 
ATOM   5995 C C   . GLY C 1 237 ? 0.628  72.540 80.330  1.00 25.15 ? 238  GLY C C   1 
ATOM   5996 O O   . GLY C 1 237 ? -0.367 73.262 80.330  1.00 23.92 ? 238  GLY C O   1 
ATOM   5997 N N   . LYS C 1 238 ? 1.320  72.306 81.438  1.00 24.26 ? 239  LYS C N   1 
ATOM   5998 C CA  . LYS C 1 238 ? 0.906  72.925 82.694  1.00 26.89 ? 239  LYS C CA  1 
ATOM   5999 C C   . LYS C 1 238 ? 0.972  74.445 82.532  1.00 26.98 ? 239  LYS C C   1 
ATOM   6000 O O   . LYS C 1 238 ? 1.917  74.971 81.927  1.00 23.76 ? 239  LYS C O   1 
ATOM   6001 C CB  . LYS C 1 238 ? 1.811  72.504 83.843  1.00 27.55 ? 239  LYS C CB  1 
ATOM   6002 C CG  . LYS C 1 238 ? 1.235  72.897 85.206  1.00 33.47 ? 239  LYS C CG  1 
ATOM   6003 C CD  . LYS C 1 238 ? 2.139  72.489 86.361  1.00 35.09 ? 239  LYS C CD  1 
ATOM   6004 C CE  . LYS C 1 238 ? 1.497  72.855 87.704  1.00 39.53 ? 239  LYS C CE  1 
ATOM   6005 N NZ  . LYS C 1 238 ? 2.481  72.891 88.827  1.00 39.99 ? 239  LYS C NZ  1 
ATOM   6006 N N   . GLU C 1 239 ? -0.023 75.146 83.075  1.00 27.05 ? 240  GLU C N   1 
ATOM   6007 C CA  . GLU C 1 239 ? -0.071 76.598 82.943  1.00 26.95 ? 240  GLU C CA  1 
ATOM   6008 C C   . GLU C 1 239 ? 0.562  77.345 84.101  1.00 28.01 ? 240  GLU C C   1 
ATOM   6009 O O   . GLU C 1 239 ? 0.318  77.017 85.264  1.00 27.28 ? 240  GLU C O   1 
ATOM   6010 C CB  . GLU C 1 239 ? -1.529 77.063 82.761  1.00 31.95 ? 240  GLU C CB  1 
ATOM   6011 C CG  . GLU C 1 239 ? -2.106 76.670 81.411  1.00 34.35 ? 240  GLU C CG  1 
ATOM   6012 C CD  . GLU C 1 239 ? -3.394 77.398 81.060  1.00 40.69 ? 240  GLU C CD  1 
ATOM   6013 O OE1 . GLU C 1 239 ? -3.655 78.477 81.650  1.00 41.08 ? 240  GLU C OE1 1 
ATOM   6014 O OE2 . GLU C 1 239 ? -4.137 76.901 80.179  1.00 39.83 ? 240  GLU C OE2 1 
ATOM   6015 N N   . TYR C 1 240 ? 1.392  78.338 83.775  1.00 24.24 ? 241  TYR C N   1 
ATOM   6016 C CA  . TYR C 1 240 ? 2.043  79.180 84.772  1.00 25.02 ? 241  TYR C CA  1 
ATOM   6017 C C   . TYR C 1 240 ? 1.655  80.581 84.338  1.00 26.54 ? 241  TYR C C   1 
ATOM   6018 O O   . TYR C 1 240 ? 2.183  81.095 83.344  1.00 24.64 ? 241  TYR C O   1 
ATOM   6019 C CB  . TYR C 1 240 ? 3.575  79.013 84.728  1.00 25.15 ? 241  TYR C CB  1 
ATOM   6020 C CG  . TYR C 1 240 ? 4.040  77.679 85.275  1.00 21.48 ? 241  TYR C CG  1 
ATOM   6021 C CD1 . TYR C 1 240 ? 4.101  76.556 84.461  1.00 24.21 ? 241  TYR C CD1 1 
ATOM   6022 C CD2 . TYR C 1 240 ? 4.347  77.529 86.644  1.00 24.78 ? 241  TYR C CD2 1 
ATOM   6023 C CE1 . TYR C 1 240 ? 4.458  75.292 84.983  1.00 23.69 ? 241  TYR C CE1 1 
ATOM   6024 C CE2 . TYR C 1 240 ? 4.704  76.275 87.184  1.00 24.94 ? 241  TYR C CE2 1 
ATOM   6025 C CZ  . TYR C 1 240 ? 4.756  75.161 86.338  1.00 22.02 ? 241  TYR C CZ  1 
ATOM   6026 O OH  . TYR C 1 240 ? 5.105  73.935 86.851  1.00 20.40 ? 241  TYR C OH  1 
ATOM   6027 N N   . GLY C 1 241 ? 0.691  81.179 85.041  1.00 26.76 ? 242  GLY C N   1 
ATOM   6028 C CA  . GLY C 1 241 ? 0.240  82.505 84.662  1.00 27.95 ? 242  GLY C CA  1 
ATOM   6029 C C   . GLY C 1 241 ? -0.304 82.464 83.246  1.00 29.84 ? 242  GLY C C   1 
ATOM   6030 O O   . GLY C 1 241 ? -1.142 81.628 82.915  1.00 32.85 ? 242  GLY C O   1 
ATOM   6031 N N   . GLY C 1 242 ? 0.158  83.348 82.382  1.00 29.16 ? 243  GLY C N   1 
ATOM   6032 C CA  . GLY C 1 242 ? -0.364 83.289 81.032  1.00 34.65 ? 243  GLY C CA  1 
ATOM   6033 C C   . GLY C 1 242 ? 0.416  82.342 80.133  1.00 32.99 ? 243  GLY C C   1 
ATOM   6034 O O   . GLY C 1 242 ? 0.283  82.433 78.911  1.00 38.36 ? 243  GLY C O   1 
ATOM   6035 N N   . LYS C 1 243 ? 1.177  81.410 80.710  1.00 30.07 ? 244  LYS C N   1 
ATOM   6036 C CA  . LYS C 1 243 ? 2.033  80.511 79.912  1.00 26.73 ? 244  LYS C CA  1 
ATOM   6037 C C   . LYS C 1 243 ? 1.895  78.986 80.133  1.00 27.53 ? 244  LYS C C   1 
ATOM   6038 O O   . LYS C 1 243 ? 1.387  78.547 81.162  1.00 27.96 ? 244  LYS C O   1 
ATOM   6039 C CB  . LYS C 1 243 ? 3.491  80.932 80.144  1.00 27.43 ? 244  LYS C CB  1 
ATOM   6040 C CG  . LYS C 1 243 ? 3.710  82.454 80.059  1.00 28.62 ? 244  LYS C CG  1 
ATOM   6041 C CD  . LYS C 1 243 ? 5.128  82.872 80.506  1.00 26.54 ? 244  LYS C CD  1 
ATOM   6042 C CE  . LYS C 1 243 ? 5.221  84.405 80.658  1.00 30.26 ? 244  LYS C CE  1 
ATOM   6043 N NZ  . LYS C 1 243 ? 4.735  85.101 79.426  1.00 28.76 ? 244  LYS C NZ  1 
ATOM   6044 N N   . ARG C 1 244 ? 2.339  78.196 79.146  1.00 24.48 ? 245  ARG C N   1 
ATOM   6045 C CA  . ARG C 1 244 ? 2.293  76.718 79.182  1.00 25.23 ? 245  ARG C CA  1 
ATOM   6046 C C   . ARG C 1 244 ? 3.747  76.190 79.206  1.00 24.88 ? 245  ARG C C   1 
ATOM   6047 O O   . ARG C 1 244 ? 4.612  76.738 78.509  1.00 24.94 ? 245  ARG C O   1 
ATOM   6048 C CB  . ARG C 1 244 ? 1.628  76.148 77.913  1.00 24.88 ? 245  ARG C CB  1 
ATOM   6049 C CG  . ARG C 1 244 ? 0.162  75.697 77.987  1.00 30.32 ? 245  ARG C CG  1 
ATOM   6050 C CD  . ARG C 1 244 ? -0.822 76.827 77.821  1.00 27.33 ? 245  ARG C CD  1 
ATOM   6051 N NE  . ARG C 1 244 ? -0.534 77.682 76.675  1.00 28.09 ? 245  ARG C NE  1 
ATOM   6052 C CZ  . ARG C 1 244 ? -1.039 77.520 75.457  1.00 29.26 ? 245  ARG C CZ  1 
ATOM   6053 N NH1 . ARG C 1 244 ? -1.872 76.510 75.193  1.00 32.50 ? 245  ARG C NH1 1 
ATOM   6054 N NH2 . ARG C 1 244 ? -0.753 78.408 74.514  1.00 27.24 ? 245  ARG C NH2 1 
ATOM   6055 N N   . ALA C 1 245 ? 4.007  75.143 79.991  1.00 22.09 ? 246  ALA C N   1 
ATOM   6056 C CA  . ALA C 1 245 ? 5.334  74.537 80.066  1.00 20.39 ? 246  ALA C CA  1 
ATOM   6057 C C   . ALA C 1 245 ? 5.319  73.032 79.769  1.00 23.45 ? 246  ALA C C   1 
ATOM   6058 O O   . ALA C 1 245 ? 4.368  72.330 80.119  1.00 22.54 ? 246  ALA C O   1 
ATOM   6059 C CB  . ALA C 1 245 ? 5.957  74.765 81.454  1.00 18.17 ? 246  ALA C CB  1 
ATOM   6060 N N   . PHE C 1 246 ? 6.375  72.556 79.106  1.00 20.60 ? 247  PHE C N   1 
ATOM   6061 C CA  . PHE C 1 246 ? 6.545  71.131 78.822  1.00 21.62 ? 247  PHE C CA  1 
ATOM   6062 C C   . PHE C 1 246 ? 7.925  70.725 79.370  1.00 21.97 ? 247  PHE C C   1 
ATOM   6063 O O   . PHE C 1 246 ? 8.957  71.255 78.950  1.00 23.38 ? 247  PHE C O   1 
ATOM   6064 C CB  . PHE C 1 246 ? 6.481  70.829 77.316  1.00 23.14 ? 247  PHE C CB  1 
ATOM   6065 C CG  . PHE C 1 246 ? 5.105  70.967 76.730  1.00 20.24 ? 247  PHE C CG  1 
ATOM   6066 C CD1 . PHE C 1 246 ? 4.630  72.204 76.330  1.00 20.85 ? 247  PHE C CD1 1 
ATOM   6067 C CD2 . PHE C 1 246 ? 4.285  69.852 76.576  1.00 18.66 ? 247  PHE C CD2 1 
ATOM   6068 C CE1 . PHE C 1 246 ? 3.352  72.338 75.771  1.00 21.06 ? 247  PHE C CE1 1 
ATOM   6069 C CE2 . PHE C 1 246 ? 3.012  69.968 76.028  1.00 19.53 ? 247  PHE C CE2 1 
ATOM   6070 C CZ  . PHE C 1 246 ? 2.542  71.219 75.619  1.00 18.57 ? 247  PHE C CZ  1 
ATOM   6071 N N   . GLY C 1 247 ? 7.927  69.817 80.340  1.00 20.87 ? 248  GLY C N   1 
ATOM   6072 C CA  . GLY C 1 247 ? 9.167  69.342 80.931  1.00 19.78 ? 248  GLY C CA  1 
ATOM   6073 C C   . GLY C 1 247 ? 9.694  68.109 80.204  1.00 19.85 ? 248  GLY C C   1 
ATOM   6074 O O   . GLY C 1 247 ? 8.968  67.478 79.428  1.00 18.25 ? 248  GLY C O   1 
ATOM   6075 N N   . ALA C 1 248 ? 10.939 67.732 80.504  1.00 18.51 ? 249  ALA C N   1 
ATOM   6076 C CA  . ALA C 1 248 ? 11.576 66.608 79.830  1.00 20.99 ? 249  ALA C CA  1 
ATOM   6077 C C   . ALA C 1 248 ? 10.816 65.277 79.912  1.00 21.25 ? 249  ALA C C   1 
ATOM   6078 O O   . ALA C 1 248 ? 10.780 64.542 78.930  1.00 19.97 ? 249  ALA C O   1 
ATOM   6079 C CB  . ALA C 1 248 ? 13.003 66.453 80.346  1.00 19.94 ? 249  ALA C CB  1 
ATOM   6080 N N   . LEU C 1 249 ? 10.211 64.958 81.060  1.00 19.42 ? 250  LEU C N   1 
ATOM   6081 C CA  . LEU C 1 249 ? 9.456  63.694 81.170  1.00 19.21 ? 250  LEU C CA  1 
ATOM   6082 C C   . LEU C 1 249 ? 8.104  63.749 80.446  1.00 22.32 ? 250  LEU C C   1 
ATOM   6083 O O   . LEU C 1 249 ? 7.647  62.744 79.874  1.00 22.65 ? 250  LEU C O   1 
ATOM   6084 C CB  . LEU C 1 249 ? 9.278  63.304 82.643  1.00 21.04 ? 250  LEU C CB  1 
ATOM   6085 C CG  . LEU C 1 249 ? 10.608 62.926 83.329  1.00 23.26 ? 250  LEU C CG  1 
ATOM   6086 C CD1 . LEU C 1 249 ? 10.383 62.562 84.811  1.00 25.47 ? 250  LEU C CD1 1 
ATOM   6087 C CD2 . LEU C 1 249 ? 11.236 61.756 82.594  1.00 27.59 ? 250  LEU C CD2 1 
ATOM   6088 N N   . GLY C 1 250 ? 7.460  64.913 80.455  1.00 19.15 ? 251  GLY C N   1 
ATOM   6089 C CA  . GLY C 1 250 ? 6.201  65.048 79.741  1.00 22.84 ? 251  GLY C CA  1 
ATOM   6090 C C   . GLY C 1 250 ? 6.423  64.803 78.243  1.00 21.79 ? 251  GLY C C   1 
ATOM   6091 O O   . GLY C 1 250 ? 5.582  64.207 77.551  1.00 22.17 ? 251  GLY C O   1 
ATOM   6092 N N   . ILE C 1 251 ? 7.570  65.261 77.747  1.00 17.85 ? 252  ILE C N   1 
ATOM   6093 C CA  . ILE C 1 251 ? 7.937  65.115 76.337  1.00 16.65 ? 252  ILE C CA  1 
ATOM   6094 C C   . ILE C 1 251 ? 8.356  63.665 76.061  1.00 18.84 ? 252  ILE C C   1 
ATOM   6095 O O   . ILE C 1 251 ? 7.984  63.072 75.036  1.00 16.77 ? 252  ILE C O   1 
ATOM   6096 C CB  . ILE C 1 251 ? 9.106  66.072 76.003  1.00 13.72 ? 252  ILE C CB  1 
ATOM   6097 C CG1 . ILE C 1 251 ? 8.588  67.516 76.006  1.00 17.07 ? 252  ILE C CG1 1 
ATOM   6098 C CG2 . ILE C 1 251 ? 9.737  65.723 74.623  1.00 16.88 ? 252  ILE C CG2 1 
ATOM   6099 C CD1 . ILE C 1 251 ? 9.729  68.556 75.997  1.00 14.39 ? 252  ILE C CD1 1 
ATOM   6100 N N   . GLY C 1 252 ? 9.093  63.101 77.006  1.00 18.12 ? 253  GLY C N   1 
ATOM   6101 C CA  . GLY C 1 252 ? 9.545  61.722 76.872  1.00 20.91 ? 253  GLY C CA  1 
ATOM   6102 C C   . GLY C 1 252 ? 8.417  60.716 76.723  1.00 21.65 ? 253  GLY C C   1 
ATOM   6103 O O   . GLY C 1 252 ? 8.590  59.672 76.094  1.00 21.98 ? 253  GLY C O   1 
ATOM   6104 N N   . GLY C 1 253 ? 7.256  61.014 77.295  1.00 19.68 ? 254  GLY C N   1 
ATOM   6105 C CA  . GLY C 1 253 ? 6.136  60.082 77.177  1.00 23.33 ? 254  GLY C CA  1 
ATOM   6106 C C   . GLY C 1 253 ? 5.658  59.930 75.746  1.00 22.32 ? 254  GLY C C   1 
ATOM   6107 O O   . GLY C 1 253 ? 5.274  58.838 75.304  1.00 20.59 ? 254  GLY C O   1 
ATOM   6108 N N   . LEU C 1 254 ? 5.634  61.039 75.013  1.00 18.46 ? 255  LEU C N   1 
ATOM   6109 C CA  . LEU C 1 254 ? 5.242  60.983 73.610  1.00 18.37 ? 255  LEU C CA  1 
ATOM   6110 C C   . LEU C 1 254 ? 6.388  60.368 72.804  1.00 19.32 ? 255  LEU C C   1 
ATOM   6111 O O   . LEU C 1 254 ? 6.141  59.577 71.892  1.00 19.45 ? 255  LEU C O   1 
ATOM   6112 C CB  . LEU C 1 254 ? 4.957  62.385 73.057  1.00 17.60 ? 255  LEU C CB  1 
ATOM   6113 C CG  . LEU C 1 254 ? 4.764  62.511 71.548  1.00 19.68 ? 255  LEU C CG  1 
ATOM   6114 C CD1 . LEU C 1 254 ? 3.629  61.601 71.058  1.00 19.17 ? 255  LEU C CD1 1 
ATOM   6115 C CD2 . LEU C 1 254 ? 4.436  63.973 71.235  1.00 21.01 ? 255  LEU C CD2 1 
ATOM   6116 N N   A LYS C 1 255 ? 7.629  60.741 73.128  0.60 19.41 ? 256  LYS C N   1 
ATOM   6117 N N   B LYS C 1 255 ? 7.626  60.743 73.124  0.40 19.27 ? 256  LYS C N   1 
ATOM   6118 C CA  A LYS C 1 255 ? 8.798  60.189 72.412  0.60 18.95 ? 256  LYS C CA  1 
ATOM   6119 C CA  B LYS C 1 255 ? 8.796  60.200 72.414  0.40 18.97 ? 256  LYS C CA  1 
ATOM   6120 C C   A LYS C 1 255 ? 8.753  58.664 72.386  0.60 17.80 ? 256  LYS C C   1 
ATOM   6121 C C   B LYS C 1 255 ? 8.760  58.670 72.390  0.40 18.01 ? 256  LYS C C   1 
ATOM   6122 O O   A LYS C 1 255 ? 9.040  58.043 71.366  0.60 17.32 ? 256  LYS C O   1 
ATOM   6123 O O   B LYS C 1 255 ? 9.036  58.050 71.365  0.40 17.74 ? 256  LYS C O   1 
ATOM   6124 C CB  A LYS C 1 255 ? 10.116 60.612 73.073  0.60 18.63 ? 256  LYS C CB  1 
ATOM   6125 C CB  B LYS C 1 255 ? 10.098 60.684 73.077  0.40 18.86 ? 256  LYS C CB  1 
ATOM   6126 C CG  A LYS C 1 255 ? 11.364 59.887 72.491  0.60 20.93 ? 256  LYS C CG  1 
ATOM   6127 C CG  B LYS C 1 255 ? 11.394 59.996 72.587  0.40 21.04 ? 256  LYS C CG  1 
ATOM   6128 C CD  A LYS C 1 255 ? 12.103 59.056 73.550  0.60 23.36 ? 256  LYS C CD  1 
ATOM   6129 C CD  B LYS C 1 255 ? 11.723 58.735 73.404  0.40 21.44 ? 256  LYS C CD  1 
ATOM   6130 C CE  A LYS C 1 255 ? 13.376 58.370 72.986  0.60 26.81 ? 256  LYS C CE  1 
ATOM   6131 C CE  B LYS C 1 255 ? 12.964 57.992 72.874  0.40 25.62 ? 256  LYS C CE  1 
ATOM   6132 N NZ  A LYS C 1 255 ? 13.081 57.293 71.968  0.60 22.07 ? 256  LYS C NZ  1 
ATOM   6133 N NZ  B LYS C 1 255 ? 14.233 58.312 73.599  0.40 19.65 ? 256  LYS C NZ  1 
ATOM   6134 N N   . LEU C 1 256 ? 8.437  58.071 73.530  1.00 17.73 ? 257  LEU C N   1 
ATOM   6135 C CA  . LEU C 1 256 ? 8.364  56.610 73.646  1.00 16.74 ? 257  LEU C CA  1 
ATOM   6136 C C   . LEU C 1 256 ? 7.291  56.037 72.730  1.00 18.39 ? 257  LEU C C   1 
ATOM   6137 O O   . LEU C 1 256 ? 7.539  55.094 71.975  1.00 17.15 ? 257  LEU C O   1 
ATOM   6138 C CB  . LEU C 1 256 ? 8.086  56.227 75.105  1.00 17.60 ? 257  LEU C CB  1 
ATOM   6139 C CG  . LEU C 1 256 ? 8.030  54.760 75.512  1.00 20.05 ? 257  LEU C CG  1 
ATOM   6140 C CD1 . LEU C 1 256 ? 9.333  54.058 75.049  1.00 20.89 ? 257  LEU C CD1 1 
ATOM   6141 C CD2 . LEU C 1 256 ? 7.858  54.661 77.035  1.00 19.60 ? 257  LEU C CD2 1 
ATOM   6142 N N   . LYS C 1 257 ? 6.081  56.582 72.796  1.00 17.39 ? 258  LYS C N   1 
ATOM   6143 C CA  . LYS C 1 257 ? 4.994  56.091 71.923  1.00 18.26 ? 258  LYS C CA  1 
ATOM   6144 C C   . LYS C 1 257 ? 5.283  56.289 70.433  1.00 17.10 ? 258  LYS C C   1 
ATOM   6145 O O   . LYS C 1 257 ? 4.898  55.462 69.584  1.00 15.06 ? 258  LYS C O   1 
ATOM   6146 C CB  . LYS C 1 257 ? 3.677  56.805 72.257  1.00 20.60 ? 258  LYS C CB  1 
ATOM   6147 C CG  . LYS C 1 257 ? 3.127  56.454 73.636  1.00 25.82 ? 258  LYS C CG  1 
ATOM   6148 C CD  . LYS C 1 257 ? 1.834  57.231 73.911  1.00 31.73 ? 258  LYS C CD  1 
ATOM   6149 C CE  . LYS C 1 257 ? 1.263  56.910 75.280  1.00 34.72 ? 258  LYS C CE  1 
ATOM   6150 N NZ  . LYS C 1 257 ? -0.059 57.612 75.503  1.00 43.00 ? 258  LYS C NZ  1 
ATOM   6151 N N   . LEU C 1 258 ? 5.921  57.417 70.124  1.00 17.88 ? 259  LEU C N   1 
ATOM   6152 C CA  . LEU C 1 258 ? 6.294  57.777 68.752  1.00 17.72 ? 259  LEU C CA  1 
ATOM   6153 C C   . LEU C 1 258 ? 7.332  56.777 68.202  1.00 17.84 ? 259  LEU C C   1 
ATOM   6154 O O   . LEU C 1 258 ? 7.214  56.305 67.078  1.00 16.80 ? 259  LEU C O   1 
ATOM   6155 C CB  . LEU C 1 258 ? 6.901  59.188 68.747  1.00 17.78 ? 259  LEU C CB  1 
ATOM   6156 C CG  . LEU C 1 258 ? 7.578  59.654 67.451  1.00 16.65 ? 259  LEU C CG  1 
ATOM   6157 C CD1 . LEU C 1 258 ? 6.537  59.764 66.327  1.00 17.55 ? 259  LEU C CD1 1 
ATOM   6158 C CD2 . LEU C 1 258 ? 8.268  61.035 67.694  1.00 19.40 ? 259  LEU C CD2 1 
ATOM   6159 N N   . HIS C 1 259 ? 8.357  56.488 69.008  1.00 17.12 ? 260  HIS C N   1 
ATOM   6160 C CA  . HIS C 1 259 ? 9.417  55.554 68.608  1.00 18.59 ? 260  HIS C CA  1 
ATOM   6161 C C   . HIS C 1 259 ? 8.780  54.198 68.257  1.00 19.45 ? 260  HIS C C   1 
ATOM   6162 O O   . HIS C 1 259 ? 9.088  53.620 67.206  1.00 17.27 ? 260  HIS C O   1 
ATOM   6163 C CB  . HIS C 1 259 ? 10.445 55.456 69.755  1.00 18.28 ? 260  HIS C CB  1 
ATOM   6164 C CG  . HIS C 1 259 ? 11.672 54.647 69.440  1.00 20.49 ? 260  HIS C CG  1 
ATOM   6165 N ND1 . HIS C 1 259 ? 12.777 54.640 70.269  1.00 18.61 ? 260  HIS C ND1 1 
ATOM   6166 C CD2 . HIS C 1 259 ? 11.949 53.783 68.436  1.00 20.04 ? 260  HIS C CD2 1 
ATOM   6167 C CE1 . HIS C 1 259 ? 13.681 53.800 69.792  1.00 19.96 ? 260  HIS C CE1 1 
ATOM   6168 N NE2 . HIS C 1 259 ? 13.206 53.265 68.681  1.00 22.27 ? 260  HIS C NE2 1 
ATOM   6169 N N   . ARG C 1 260 ? 7.861  53.718 69.107  1.00 18.69 ? 261  ARG C N   1 
ATOM   6170 C CA  . ARG C 1 260 ? 7.162  52.458 68.853  1.00 17.55 ? 261  ARG C CA  1 
ATOM   6171 C C   . ARG C 1 260 ? 6.395  52.512 67.555  1.00 19.63 ? 261  ARG C C   1 
ATOM   6172 O O   . ARG C 1 260 ? 6.450  51.585 66.771  1.00 17.67 ? 261  ARG C O   1 
ATOM   6173 C CB  . ARG C 1 260 ? 6.146  52.128 69.961  1.00 16.40 ? 261  ARG C CB  1 
ATOM   6174 C CG  . ARG C 1 260 ? 6.749  51.752 71.299  1.00 17.45 ? 261  ARG C CG  1 
ATOM   6175 C CD  . ARG C 1 260 ? 5.654  51.568 72.332  1.00 18.78 ? 261  ARG C CD  1 
ATOM   6176 N NE  . ARG C 1 260 ? 6.195  51.478 73.685  1.00 24.13 ? 261  ARG C NE  1 
ATOM   6177 C CZ  . ARG C 1 260 ? 5.548  51.938 74.749  1.00 29.38 ? 261  ARG C CZ  1 
ATOM   6178 N NH1 . ARG C 1 260 ? 4.357  52.517 74.586  1.00 27.29 ? 261  ARG C NH1 1 
ATOM   6179 N NH2 . ARG C 1 260 ? 6.067  51.799 75.969  1.00 28.33 ? 261  ARG C NH2 1 
ATOM   6180 N N   . ALA C 1 261 ? 5.668  53.608 67.326  1.00 20.08 ? 262  ALA C N   1 
ATOM   6181 C CA  . ALA C 1 261 ? 4.857  53.717 66.115  1.00 19.89 ? 262  ALA C CA  1 
ATOM   6182 C C   . ALA C 1 261 ? 5.684  53.793 64.823  1.00 19.93 ? 262  ALA C C   1 
ATOM   6183 O O   . ALA C 1 261 ? 5.232  53.311 63.781  1.00 20.69 ? 262  ALA C O   1 
ATOM   6184 C CB  . ALA C 1 261 ? 3.888  54.931 66.216  1.00 18.86 ? 262  ALA C CB  1 
ATOM   6185 N N   . CYS C 1 262 ? 6.874  54.382 64.899  1.00 19.02 ? 263  CYS C N   1 
ATOM   6186 C CA  . CYS C 1 262 ? 7.774  54.491 63.750  1.00 19.22 ? 263  CYS C CA  1 
ATOM   6187 C C   . CYS C 1 262 ? 8.255  53.104 63.309  1.00 19.30 ? 263  CYS C C   1 
ATOM   6188 O O   . CYS C 1 262 ? 8.354  52.807 62.105  1.00 17.08 ? 263  CYS C O   1 
ATOM   6189 C CB  . CYS C 1 262 ? 9.004  55.339 64.094  1.00 20.60 ? 263  CYS C CB  1 
ATOM   6190 S SG  . CYS C 1 262 ? 8.738  57.154 64.192  1.00 19.87 ? 263  CYS C SG  1 
ATOM   6191 N N   . ILE C 1 263 ? 8.578  52.256 64.284  1.00 19.15 ? 264  ILE C N   1 
ATOM   6192 C CA  . ILE C 1 263 ? 9.052  50.897 63.974  1.00 18.25 ? 264  ILE C CA  1 
ATOM   6193 C C   . ILE C 1 263 ? 7.957  50.175 63.194  1.00 18.44 ? 264  ILE C C   1 
ATOM   6194 O O   . ILE C 1 263 ? 8.235  49.484 62.216  1.00 17.75 ? 264  ILE C O   1 
ATOM   6195 C CB  . ILE C 1 263 ? 9.362  50.098 65.269  1.00 18.39 ? 264  ILE C CB  1 
ATOM   6196 C CG1 . ILE C 1 263 ? 10.585 50.699 65.972  1.00 17.51 ? 264  ILE C CG1 1 
ATOM   6197 C CG2 . ILE C 1 263 ? 9.558  48.592 64.951  1.00 18.22 ? 264  ILE C CG2 1 
ATOM   6198 C CD1 . ILE C 1 263 ? 11.881 50.668 65.134  1.00 17.20 ? 264  ILE C CD1 1 
ATOM   6199 N N   . ALA C 1 264 ? 6.703  50.350 63.627  1.00 20.11 ? 265  ALA C N   1 
ATOM   6200 C CA  . ALA C 1 264 ? 5.567  49.703 62.967  1.00 20.23 ? 265  ALA C CA  1 
ATOM   6201 C C   . ALA C 1 264 ? 5.469  50.106 61.493  1.00 22.82 ? 265  ALA C C   1 
ATOM   6202 O O   . ALA C 1 264 ? 5.180  49.272 60.615  1.00 21.86 ? 265  ALA C O   1 
ATOM   6203 C CB  . ALA C 1 264 ? 4.271  50.043 63.696  1.00 21.67 ? 265  ALA C CB  1 
ATOM   6204 N N   . LYS C 1 265 ? 5.713  51.383 61.221  1.00 22.71 ? 266  LYS C N   1 
ATOM   6205 C CA  . LYS C 1 265 ? 5.667  51.894 59.854  1.00 23.35 ? 266  LYS C CA  1 
ATOM   6206 C C   . LYS C 1 265 ? 6.698  51.256 58.934  1.00 23.49 ? 266  LYS C C   1 
ATOM   6207 O O   . LYS C 1 265 ? 6.446  51.112 57.735  1.00 22.53 ? 266  LYS C O   1 
ATOM   6208 C CB  . LYS C 1 265 ? 5.910  53.407 59.825  1.00 24.90 ? 266  LYS C CB  1 
ATOM   6209 C CG  . LYS C 1 265 ? 4.847  54.270 60.505  1.00 30.10 ? 266  LYS C CG  1 
ATOM   6210 C CD  . LYS C 1 265 ? 3.541  54.290 59.741  1.00 31.36 ? 266  LYS C CD  1 
ATOM   6211 C CE  . LYS C 1 265 ? 2.577  55.312 60.345  1.00 35.91 ? 266  LYS C CE  1 
ATOM   6212 N NZ  . LYS C 1 265 ? 1.167  55.153 59.842  1.00 37.72 ? 266  LYS C NZ  1 
ATOM   6213 N N   . LEU C 1 266 ? 7.865  50.890 59.479  1.00 23.10 ? 267  LEU C N   1 
ATOM   6214 C CA  . LEU C 1 266 ? 8.926  50.325 58.648  1.00 22.45 ? 267  LEU C CA  1 
ATOM   6215 C C   . LEU C 1 266 ? 8.528  49.068 57.905  1.00 21.06 ? 267  LEU C C   1 
ATOM   6216 O O   . LEU C 1 266 ? 9.088  48.763 56.851  1.00 20.60 ? 267  LEU C O   1 
ATOM   6217 C CB  . LEU C 1 266 ? 10.187 50.031 59.481  1.00 21.92 ? 267  LEU C CB  1 
ATOM   6218 C CG  . LEU C 1 266 ? 10.798 51.176 60.298  1.00 23.85 ? 267  LEU C CG  1 
ATOM   6219 C CD1 . LEU C 1 266 ? 12.009 50.635 61.076  1.00 21.35 ? 267  LEU C CD1 1 
ATOM   6220 C CD2 . LEU C 1 266 ? 11.229 52.339 59.385  1.00 25.65 ? 267  LEU C CD2 1 
ATOM   6221 N N   . PHE C 1 267 ? 7.589  48.320 58.466  1.00 20.46 ? 268  PHE C N   1 
ATOM   6222 C CA  . PHE C 1 267 ? 7.148  47.083 57.828  1.00 22.08 ? 268  PHE C CA  1 
ATOM   6223 C C   . PHE C 1 267 ? 5.911  47.249 56.913  1.00 25.61 ? 268  PHE C C   1 
ATOM   6224 O O   . PHE C 1 267 ? 5.409  46.262 56.344  1.00 24.90 ? 268  PHE C O   1 
ATOM   6225 C CB  . PHE C 1 267 ? 6.879  46.023 58.899  1.00 20.12 ? 268  PHE C CB  1 
ATOM   6226 C CG  . PHE C 1 267 ? 8.086  45.709 59.747  1.00 20.44 ? 268  PHE C CG  1 
ATOM   6227 C CD1 . PHE C 1 267 ? 8.184  46.194 61.047  1.00 19.88 ? 268  PHE C CD1 1 
ATOM   6228 C CD2 . PHE C 1 267 ? 9.126  44.942 59.233  1.00 18.88 ? 268  PHE C CD2 1 
ATOM   6229 C CE1 . PHE C 1 267 ? 9.301  45.914 61.824  1.00 21.22 ? 268  PHE C CE1 1 
ATOM   6230 C CE2 . PHE C 1 267 ? 10.256 44.655 60.007  1.00 18.54 ? 268  PHE C CE2 1 
ATOM   6231 C CZ  . PHE C 1 267 ? 10.341 45.138 61.294  1.00 20.77 ? 268  PHE C CZ  1 
ATOM   6232 N N   . GLU C 1 268 ? 5.439  48.489 56.764  1.00 26.07 ? 269  GLU C N   1 
ATOM   6233 C CA  . GLU C 1 268 ? 4.274  48.768 55.909  1.00 29.03 ? 269  GLU C CA  1 
ATOM   6234 C C   . GLU C 1 268 ? 4.640  49.032 54.445  1.00 30.02 ? 269  GLU C C   1 
ATOM   6235 O O   . GLU C 1 268 ? 3.771  49.095 53.573  1.00 28.21 ? 269  GLU C O   1 
ATOM   6236 C CB  . GLU C 1 268 ? 3.456  49.934 56.491  1.00 29.54 ? 269  GLU C CB  1 
ATOM   6237 C CG  . GLU C 1 268 ? 2.666  49.502 57.728  1.00 31.06 ? 269  GLU C CG  1 
ATOM   6238 C CD  . GLU C 1 268 ? 1.967  50.651 58.436  1.00 35.17 ? 269  GLU C CD  1 
ATOM   6239 O OE1 . GLU C 1 268 ? 2.062  51.803 57.954  1.00 35.70 ? 269  GLU C OE1 1 
ATOM   6240 O OE2 . GLU C 1 268 ? 1.330  50.394 59.481  1.00 33.64 ? 269  GLU C OE2 1 
ATOM   6241 N N   . SER C 1 269 ? 5.934  49.179 54.185  1.00 29.57 ? 270  SER C N   1 
ATOM   6242 C CA  . SER C 1 269 ? 6.444  49.402 52.838  1.00 30.23 ? 270  SER C CA  1 
ATOM   6243 C C   . SER C 1 269 ? 7.936  49.096 52.880  1.00 29.85 ? 270  SER C C   1 
ATOM   6244 O O   . SER C 1 269 ? 8.508  48.926 53.970  1.00 28.23 ? 270  SER C O   1 
ATOM   6245 C CB  . SER C 1 269 ? 6.247  50.857 52.393  1.00 31.56 ? 270  SER C CB  1 
ATOM   6246 O OG  . SER C 1 269 ? 7.298  51.687 52.860  1.00 34.57 ? 270  SER C OG  1 
ATOM   6247 N N   . SER C 1 270 ? 8.566  49.036 51.709  1.00 28.27 ? 271  SER C N   1 
ATOM   6248 C CA  . SER C 1 270 ? 9.998  48.758 51.645  1.00 28.52 ? 271  SER C CA  1 
ATOM   6249 C C   . SER C 1 270 ? 10.777 49.993 51.201  1.00 27.31 ? 271  SER C C   1 
ATOM   6250 O O   . SER C 1 270 ? 11.927 49.889 50.788  1.00 29.29 ? 271  SER C O   1 
ATOM   6251 C CB  . SER C 1 270 ? 10.271 47.589 50.681  1.00 29.82 ? 271  SER C CB  1 
ATOM   6252 O OG  . SER C 1 270 ? 9.925  47.908 49.341  1.00 31.67 ? 271  SER C OG  1 
ATOM   6253 N N   . GLU C 1 271 ? 10.163 51.168 51.322  1.00 28.12 ? 272  GLU C N   1 
ATOM   6254 C CA  . GLU C 1 271 ? 10.804 52.404 50.885  1.00 29.64 ? 272  GLU C CA  1 
ATOM   6255 C C   . GLU C 1 271 ? 10.802 53.526 51.912  1.00 29.19 ? 272  GLU C C   1 
ATOM   6256 O O   . GLU C 1 271 ? 11.134 54.671 51.586  1.00 28.29 ? 272  GLU C O   1 
ATOM   6257 C CB  . GLU C 1 271 ? 10.100 52.935 49.631  1.00 34.74 ? 272  GLU C CB  1 
ATOM   6258 C CG  . GLU C 1 271 ? 9.643  51.886 48.665  1.00 39.92 ? 272  GLU C CG  1 
ATOM   6259 C CD  . GLU C 1 271 ? 8.936  52.504 47.465  1.00 43.80 ? 272  GLU C CD  1 
ATOM   6260 O OE1 . GLU C 1 271 ? 7.848  53.098 47.647  1.00 45.04 ? 272  GLU C OE1 1 
ATOM   6261 O OE2 . GLU C 1 271 ? 9.483  52.408 46.349  1.00 43.89 ? 272  GLU C OE2 1 
ATOM   6262 N N   . GLY C 1 272 ? 10.420 53.222 53.142  1.00 27.47 ? 273  GLY C N   1 
ATOM   6263 C CA  . GLY C 1 272 ? 10.385 54.270 54.139  1.00 25.25 ? 273  GLY C CA  1 
ATOM   6264 C C   . GLY C 1 272 ? 11.757 54.741 54.578  1.00 24.21 ? 273  GLY C C   1 
ATOM   6265 O O   . GLY C 1 272 ? 12.689 53.944 54.713  1.00 22.21 ? 273  GLY C O   1 
ATOM   6266 N N   . VAL C 1 273 ? 11.894 56.048 54.769  1.00 22.36 ? 274  VAL C N   1 
ATOM   6267 C CA  . VAL C 1 273 ? 13.140 56.615 55.253  1.00 23.46 ? 274  VAL C CA  1 
ATOM   6268 C C   . VAL C 1 273 ? 12.777 57.490 56.452  1.00 25.47 ? 274  VAL C C   1 
ATOM   6269 O O   . VAL C 1 273 ? 12.329 58.648 56.309  1.00 23.87 ? 274  VAL C O   1 
ATOM   6270 C CB  . VAL C 1 273 ? 13.832 57.469 54.197  1.00 23.92 ? 274  VAL C CB  1 
ATOM   6271 C CG1 . VAL C 1 273 ? 15.109 58.044 54.759  1.00 21.84 ? 274  VAL C CG1 1 
ATOM   6272 C CG2 . VAL C 1 273 ? 14.120 56.626 52.956  1.00 22.11 ? 274  VAL C CG2 1 
ATOM   6273 N N   . PHE C 1 274 ? 12.966 56.935 57.644  1.00 22.58 ? 275  PHE C N   1 
ATOM   6274 C CA  . PHE C 1 274 ? 12.622 57.666 58.850  1.00 22.01 ? 275  PHE C CA  1 
ATOM   6275 C C   . PHE C 1 274 ? 13.732 58.434 59.537  1.00 22.02 ? 275  PHE C C   1 
ATOM   6276 O O   . PHE C 1 274 ? 14.418 57.923 60.437  1.00 19.69 ? 275  PHE C O   1 
ATOM   6277 C CB  . PHE C 1 274 ? 11.894 56.730 59.843  1.00 23.35 ? 275  PHE C CB  1 
ATOM   6278 C CG  . PHE C 1 274 ? 10.437 56.519 59.495  1.00 23.97 ? 275  PHE C CG  1 
ATOM   6279 C CD1 . PHE C 1 274 ? 10.070 55.750 58.378  1.00 22.51 ? 275  PHE C CD1 1 
ATOM   6280 C CD2 . PHE C 1 274 ? 9.436  57.165 60.223  1.00 23.06 ? 275  PHE C CD2 1 
ATOM   6281 C CE1 . PHE C 1 274 ? 8.735  55.632 57.988  1.00 24.26 ? 275  PHE C CE1 1 
ATOM   6282 C CE2 . PHE C 1 274 ? 8.093  57.059 59.850  1.00 26.57 ? 275  PHE C CE2 1 
ATOM   6283 C CZ  . PHE C 1 274 ? 7.735  56.291 58.726  1.00 24.91 ? 275  PHE C CZ  1 
ATOM   6284 N N   . ASP C 1 275 ? 13.929 59.665 59.061  1.00 20.33 ? 276  ASP C N   1 
ATOM   6285 C CA  . ASP C 1 275 ? 14.888 60.567 59.648  1.00 21.11 ? 276  ASP C CA  1 
ATOM   6286 C C   . ASP C 1 275 ? 14.023 61.660 60.295  1.00 21.22 ? 276  ASP C C   1 
ATOM   6287 O O   . ASP C 1 275 ? 12.793 61.517 60.393  1.00 21.16 ? 276  ASP C O   1 
ATOM   6288 C CB  . ASP C 1 275 ? 15.832 61.142 58.586  1.00 19.58 ? 276  ASP C CB  1 
ATOM   6289 C CG  . ASP C 1 275 ? 17.139 61.673 59.177  1.00 22.13 ? 276  ASP C CG  1 
ATOM   6290 O OD1 . ASP C 1 275 ? 17.211 61.970 60.401  1.00 19.00 ? 276  ASP C OD1 1 
ATOM   6291 O OD2 . ASP C 1 275 ? 18.111 61.815 58.398  1.00 20.78 ? 276  ASP C OD2 1 
ATOM   6292 N N   . ALA C 1 276 ? 14.623 62.762 60.712  1.00 21.31 ? 277  ALA C N   1 
ATOM   6293 C CA  . ALA C 1 276 ? 13.824 63.789 61.391  1.00 22.41 ? 277  ALA C CA  1 
ATOM   6294 C C   . ALA C 1 276 ? 12.494 64.221 60.755  1.00 22.05 ? 277  ALA C C   1 
ATOM   6295 O O   . ALA C 1 276 ? 11.471 64.306 61.440  1.00 21.59 ? 277  ALA C O   1 
ATOM   6296 C CB  . ALA C 1 276 ? 14.695 65.026 61.661  1.00 21.09 ? 277  ALA C CB  1 
ATOM   6297 N N   . GLU C 1 277 ? 12.477 64.483 59.458  1.00 21.81 ? 278  GLU C N   1 
ATOM   6298 C CA  . GLU C 1 277 ? 11.237 64.968 58.837  1.00 22.08 ? 278  GLU C CA  1 
ATOM   6299 C C   . GLU C 1 277 ? 10.030 64.025 58.896  1.00 23.43 ? 278  GLU C C   1 
ATOM   6300 O O   . GLU C 1 277 ? 8.911  64.428 59.255  1.00 20.99 ? 278  GLU C O   1 
ATOM   6301 C CB  . GLU C 1 277 ? 11.502 65.353 57.380  1.00 23.14 ? 278  GLU C CB  1 
ATOM   6302 C CG  . GLU C 1 277 ? 12.628 66.373 57.174  1.00 22.48 ? 278  GLU C CG  1 
ATOM   6303 C CD  . GLU C 1 277 ? 13.937 65.719 56.729  1.00 28.14 ? 278  GLU C CD  1 
ATOM   6304 O OE1 . GLU C 1 277 ? 14.550 66.200 55.749  1.00 24.97 ? 278  GLU C OE1 1 
ATOM   6305 O OE2 . GLU C 1 277 ? 14.362 64.728 57.363  1.00 25.84 ? 278  GLU C OE2 1 
ATOM   6306 N N   . GLU C 1 278 ? 10.257 62.766 58.555  1.00 22.57 ? 279  GLU C N   1 
ATOM   6307 C CA  . GLU C 1 278 ? 9.187  61.771 58.526  1.00 23.73 ? 279  GLU C CA  1 
ATOM   6308 C C   . GLU C 1 278 ? 8.759  61.398 59.948  1.00 22.76 ? 279  GLU C C   1 
ATOM   6309 O O   . GLU C 1 278 ? 7.598  61.070 60.204  1.00 20.57 ? 279  GLU C O   1 
ATOM   6310 C CB  . GLU C 1 278 ? 9.691  60.541 57.759  1.00 27.16 ? 279  GLU C CB  1 
ATOM   6311 C CG  . GLU C 1 278 ? 8.634  59.730 56.983  1.00 37.08 ? 279  GLU C CG  1 
ATOM   6312 C CD  . GLU C 1 278 ? 7.787  60.556 55.984  1.00 37.37 ? 279  GLU C CD  1 
ATOM   6313 O OE1 . GLU C 1 278 ? 8.299  61.480 55.318  1.00 41.53 ? 279  GLU C OE1 1 
ATOM   6314 O OE2 . GLU C 1 278 ? 6.591  60.247 55.854  1.00 41.94 ? 279  GLU C OE2 1 
ATOM   6315 N N   . ILE C 1 279 ? 9.702  61.441 60.881  1.00 21.72 ? 280  ILE C N   1 
ATOM   6316 C CA  . ILE C 1 279 ? 9.384  61.109 62.263  1.00 19.98 ? 280  ILE C CA  1 
ATOM   6317 C C   . ILE C 1 279 ? 8.512  62.225 62.855  1.00 21.83 ? 280  ILE C C   1 
ATOM   6318 O O   . ILE C 1 279 ? 7.568  61.967 63.614  1.00 21.84 ? 280  ILE C O   1 
ATOM   6319 C CB  . ILE C 1 279 ? 10.689 60.930 63.076  1.00 20.88 ? 280  ILE C CB  1 
ATOM   6320 C CG1 . ILE C 1 279 ? 11.444 59.696 62.553  1.00 17.86 ? 280  ILE C CG1 1 
ATOM   6321 C CG2 . ILE C 1 279 ? 10.375 60.865 64.585  1.00 16.89 ? 280  ILE C CG2 1 
ATOM   6322 C CD1 . ILE C 1 279 ? 12.793 59.440 63.242  1.00 18.40 ? 280  ILE C CD1 1 
ATOM   6323 N N   . TYR C 1 280 ? 8.822  63.463 62.484  1.00 22.17 ? 281  TYR C N   1 
ATOM   6324 C CA  . TYR C 1 280 ? 8.052  64.617 62.952  1.00 21.43 ? 281  TYR C CA  1 
ATOM   6325 C C   . TYR C 1 280 ? 6.647  64.586 62.341  1.00 21.92 ? 281  TYR C C   1 
ATOM   6326 O O   . TYR C 1 280 ? 5.656  64.930 62.987  1.00 20.58 ? 281  TYR C O   1 
ATOM   6327 C CB  . TYR C 1 280 ? 8.770  65.904 62.556  1.00 18.89 ? 281  TYR C CB  1 
ATOM   6328 C CG  . TYR C 1 280 ? 8.042  67.147 63.008  1.00 20.24 ? 281  TYR C CG  1 
ATOM   6329 C CD1 . TYR C 1 280 ? 7.731  67.349 64.354  1.00 17.60 ? 281  TYR C CD1 1 
ATOM   6330 C CD2 . TYR C 1 280 ? 7.643  68.113 62.082  1.00 22.87 ? 281  TYR C CD2 1 
ATOM   6331 C CE1 . TYR C 1 280 ? 7.028  68.495 64.775  1.00 19.89 ? 281  TYR C CE1 1 
ATOM   6332 C CE2 . TYR C 1 280 ? 6.941  69.260 62.485  1.00 24.50 ? 281  TYR C CE2 1 
ATOM   6333 C CZ  . TYR C 1 280 ? 6.633  69.443 63.826  1.00 24.89 ? 281  TYR C CZ  1 
ATOM   6334 O OH  . TYR C 1 280 ? 5.899  70.560 64.187  1.00 21.72 ? 281  TYR C OH  1 
ATOM   6335 N N   . LYS C 1 281 ? 6.544  64.185 61.085  1.00 23.07 ? 282  LYS C N   1 
ATOM   6336 C CA  . LYS C 1 281 ? 5.218  64.098 60.483  1.00 24.71 ? 282  LYS C CA  1 
ATOM   6337 C C   . LYS C 1 281 ? 4.322  63.169 61.332  1.00 24.64 ? 282  LYS C C   1 
ATOM   6338 O O   . LYS C 1 281 ? 3.148  63.474 61.594  1.00 22.67 ? 282  LYS C O   1 
ATOM   6339 C CB  . LYS C 1 281 ? 5.316  63.551 59.056  1.00 27.58 ? 282  LYS C CB  1 
ATOM   6340 C CG  . LYS C 1 281 ? 3.967  63.198 58.477  1.00 34.34 ? 282  LYS C CG  1 
ATOM   6341 C CD  . LYS C 1 281 ? 4.030  62.850 56.996  1.00 39.74 ? 282  LYS C CD  1 
ATOM   6342 C CE  . LYS C 1 281 ? 2.643  62.485 56.473  1.00 40.82 ? 282  LYS C CE  1 
ATOM   6343 N NZ  . LYS C 1 281 ? 2.698  62.055 55.048  1.00 44.24 ? 282  LYS C NZ  1 
ATOM   6344 N N   . LEU C 1 282 ? 4.883  62.045 61.785  1.00 21.52 ? 283  LEU C N   1 
ATOM   6345 C CA  . LEU C 1 282 ? 4.110  61.099 62.590  1.00 19.53 ? 283  LEU C CA  1 
ATOM   6346 C C   . LEU C 1 282 ? 3.865  61.666 63.989  1.00 19.67 ? 283  LEU C C   1 
ATOM   6347 O O   . LEU C 1 282 ? 2.788  61.482 64.564  1.00 24.20 ? 283  LEU C O   1 
ATOM   6348 C CB  . LEU C 1 282 ? 4.847  59.751 62.671  1.00 20.48 ? 283  LEU C CB  1 
ATOM   6349 C CG  . LEU C 1 282 ? 4.147  58.622 63.441  1.00 19.37 ? 283  LEU C CG  1 
ATOM   6350 C CD1 . LEU C 1 282 ? 2.679  58.473 62.928  1.00 21.03 ? 283  LEU C CD1 1 
ATOM   6351 C CD2 . LEU C 1 282 ? 4.936  57.293 63.248  1.00 22.52 ? 283  LEU C CD2 1 
ATOM   6352 N N   . ALA C 1 283 ? 4.850  62.362 64.540  1.00 18.05 ? 284  ALA C N   1 
ATOM   6353 C CA  . ALA C 1 283 ? 4.694  62.962 65.863  1.00 18.93 ? 284  ALA C CA  1 
ATOM   6354 C C   . ALA C 1 283 ? 3.468  63.909 65.884  1.00 20.55 ? 284  ALA C C   1 
ATOM   6355 O O   . ALA C 1 283 ? 2.725  63.949 66.866  1.00 21.05 ? 284  ALA C O   1 
ATOM   6356 C CB  . ALA C 1 283 ? 5.968  63.749 66.247  1.00 15.66 ? 284  ALA C CB  1 
ATOM   6357 N N   . LYS C 1 284 ? 3.278  64.680 64.815  1.00 20.81 ? 285  LYS C N   1 
ATOM   6358 C CA  . LYS C 1 284 ? 2.143  65.608 64.751  1.00 23.98 ? 285  LYS C CA  1 
ATOM   6359 C C   . LYS C 1 284 ? 0.805  64.899 64.777  1.00 23.60 ? 285  LYS C C   1 
ATOM   6360 O O   . LYS C 1 284 ? -0.157 65.404 65.353  1.00 24.72 ? 285  LYS C O   1 
ATOM   6361 C CB  . LYS C 1 284 ? 2.229  66.504 63.503  1.00 24.36 ? 285  LYS C CB  1 
ATOM   6362 C CG  . LYS C 1 284 ? 3.441  67.428 63.507  1.00 22.49 ? 285  LYS C CG  1 
ATOM   6363 C CD  . LYS C 1 284 ? 3.355  68.496 62.382  1.00 25.57 ? 285  LYS C CD  1 
ATOM   6364 C CE  . LYS C 1 284 ? 2.257  69.556 62.706  1.00 26.54 ? 285  LYS C CE  1 
ATOM   6365 N NZ  . LYS C 1 284 ? 2.183  70.669 61.694  1.00 25.43 ? 285  LYS C NZ  1 
ATOM   6366 N N   . GLU C 1 285 ? 0.748  63.735 64.153  1.00 22.89 ? 286  GLU C N   1 
ATOM   6367 C CA  . GLU C 1 285 ? -0.463 62.932 64.115  1.00 25.69 ? 286  GLU C CA  1 
ATOM   6368 C C   . GLU C 1 285 ? -0.805 62.345 65.482  1.00 25.37 ? 286  GLU C C   1 
ATOM   6369 O O   . GLU C 1 285 ? -1.974 62.091 65.790  1.00 26.20 ? 286  GLU C O   1 
ATOM   6370 C CB  . GLU C 1 285 ? -0.291 61.760 63.152  1.00 26.56 ? 286  GLU C CB  1 
ATOM   6371 C CG  . GLU C 1 285 ? -0.333 62.089 61.688  1.00 34.01 ? 286  GLU C CG  1 
ATOM   6372 C CD  . GLU C 1 285 ? -0.018 60.867 60.839  1.00 37.64 ? 286  GLU C CD  1 
ATOM   6373 O OE1 . GLU C 1 285 ? -0.488 59.752 61.197  1.00 38.69 ? 286  GLU C OE1 1 
ATOM   6374 O OE2 . GLU C 1 285 ? 0.692  61.028 59.817  1.00 39.62 ? 286  GLU C OE2 1 
ATOM   6375 N N   . MET C 1 286 ? 0.225  62.131 66.291  1.00 24.11 ? 287  MET C N   1 
ATOM   6376 C CA  . MET C 1 286 ? 0.096  61.508 67.613  1.00 22.67 ? 287  MET C CA  1 
ATOM   6377 C C   . MET C 1 286 ? 0.099  62.414 68.846  1.00 23.90 ? 287  MET C C   1 
ATOM   6378 O O   . MET C 1 286 ? -0.313 61.979 69.921  1.00 22.69 ? 287  MET C O   1 
ATOM   6379 C CB  . MET C 1 286 ? 1.246  60.512 67.802  1.00 23.63 ? 287  MET C CB  1 
ATOM   6380 C CG  . MET C 1 286 ? 1.311  59.395 66.779  1.00 22.79 ? 287  MET C CG  1 
ATOM   6381 S SD  . MET C 1 286 ? 2.702  58.283 67.103  1.00 22.46 ? 287  MET C SD  1 
ATOM   6382 C CE  . MET C 1 286 ? 2.131  57.484 68.657  1.00 19.09 ? 287  MET C CE  1 
ATOM   6383 N N   . ALA C 1 287 ? 0.565  63.657 68.712  1.00 22.45 ? 288  ALA C N   1 
ATOM   6384 C CA  . ALA C 1 287 ? 0.697  64.529 69.883  1.00 22.38 ? 288  ALA C CA  1 
ATOM   6385 C C   . ALA C 1 287 ? -0.569 64.799 70.679  1.00 25.58 ? 288  ALA C C   1 
ATOM   6386 O O   . ALA C 1 287 ? -1.651 64.914 70.072  1.00 26.21 ? 288  ALA C O   1 
ATOM   6387 C CB  . ALA C 1 287 ? 1.351  65.866 69.484  1.00 21.76 ? 288  ALA C CB  1 
ATOM   6388 O OXT . ALA C 1 287 ? -0.427 64.926 71.911  1.00 24.92 ? 288  ALA C OXT 1 
HETATM 6389 P PA  . NAP D 2 .   ? 36.038 33.301 44.241  1.00 28.60 ? 456  NAP A PA  1 
HETATM 6390 O O1A . NAP D 2 .   ? 35.831 34.702 44.593  1.00 25.15 ? 456  NAP A O1A 1 
HETATM 6391 O O2A . NAP D 2 .   ? 36.764 32.433 45.167  1.00 28.43 ? 456  NAP A O2A 1 
HETATM 6392 O O5B . NAP D 2 .   ? 36.742 33.302 42.768  1.00 27.83 ? 456  NAP A O5B 1 
HETATM 6393 C C5B . NAP D 2 .   ? 36.776 32.115 41.953  1.00 28.67 ? 456  NAP A C5B 1 
HETATM 6394 C C4B . NAP D 2 .   ? 38.058 32.065 41.141  1.00 30.76 ? 456  NAP A C4B 1 
HETATM 6395 O O4B . NAP D 2 .   ? 38.024 33.075 40.156  1.00 31.59 ? 456  NAP A O4B 1 
HETATM 6396 C C3B . NAP D 2 .   ? 39.340 32.314 41.891  1.00 30.99 ? 456  NAP A C3B 1 
HETATM 6397 O O3B . NAP D 2 .   ? 39.758 31.137 42.589  1.00 26.48 ? 456  NAP A O3B 1 
HETATM 6398 C C2B . NAP D 2 .   ? 40.318 32.624 40.757  1.00 29.38 ? 456  NAP A C2B 1 
HETATM 6399 O O2B . NAP D 2 .   ? 40.928 31.438 40.164  1.00 32.16 ? 456  NAP A O2B 1 
HETATM 6400 C C1B . NAP D 2 .   ? 39.393 33.218 39.681  1.00 33.26 ? 456  NAP A C1B 1 
HETATM 6401 N N9A . NAP D 2 .   ? 39.643 34.647 39.376  1.00 36.62 ? 456  NAP A N9A 1 
HETATM 6402 C C8A . NAP D 2 .   ? 39.596 35.766 40.203  1.00 38.19 ? 456  NAP A C8A 1 
HETATM 6403 N N7A . NAP D 2 .   ? 39.886 36.875 39.564  1.00 40.80 ? 456  NAP A N7A 1 
HETATM 6404 C C5A . NAP D 2 .   ? 40.137 36.478 38.265  1.00 39.48 ? 456  NAP A C5A 1 
HETATM 6405 C C6A . NAP D 2 .   ? 40.496 37.195 37.094  1.00 40.99 ? 456  NAP A C6A 1 
HETATM 6406 N N6A . NAP D 2 .   ? 40.658 38.512 37.104  1.00 40.76 ? 456  NAP A N6A 1 
HETATM 6407 N N1A . NAP D 2 .   ? 40.677 36.490 35.939  1.00 40.36 ? 456  NAP A N1A 1 
HETATM 6408 C C2A . NAP D 2 .   ? 40.509 35.144 35.918  1.00 40.62 ? 456  NAP A C2A 1 
HETATM 6409 N N3A . NAP D 2 .   ? 40.166 34.392 36.978  1.00 40.10 ? 456  NAP A N3A 1 
HETATM 6410 C C4A . NAP D 2 .   ? 39.992 35.131 38.130  1.00 38.28 ? 456  NAP A C4A 1 
HETATM 6411 O O3  . NAP D 2 .   ? 34.638 32.636 43.869  1.00 25.07 ? 456  NAP A O3  1 
HETATM 6412 P PN  . NAP D 2 .   ? 33.513 31.795 44.657  1.00 24.04 ? 456  NAP A PN  1 
HETATM 6413 O O1N . NAP D 2 .   ? 33.857 30.369 44.542  1.00 21.39 ? 456  NAP A O1N 1 
HETATM 6414 O O2N . NAP D 2 .   ? 33.440 32.396 46.033  1.00 23.77 ? 456  NAP A O2N 1 
HETATM 6415 O O5D . NAP D 2 .   ? 32.125 32.195 44.049  1.00 27.50 ? 456  NAP A O5D 1 
HETATM 6416 C C5D . NAP D 2 .   ? 31.772 31.757 42.734  1.00 28.13 ? 456  NAP A C5D 1 
HETATM 6417 C C4D . NAP D 2 .   ? 30.769 32.714 42.079  1.00 26.98 ? 456  NAP A C4D 1 
HETATM 6418 O O4D . NAP D 2 .   ? 29.439 32.420 42.511  1.00 27.73 ? 456  NAP A O4D 1 
HETATM 6419 C C3D . NAP D 2 .   ? 30.976 34.220 42.371  1.00 28.43 ? 456  NAP A C3D 1 
HETATM 6420 O O3D . NAP D 2 .   ? 30.780 35.069 41.228  1.00 30.06 ? 456  NAP A O3D 1 
HETATM 6421 C C2D . NAP D 2 .   ? 29.985 34.565 43.479  1.00 30.26 ? 456  NAP A C2D 1 
HETATM 6422 O O2D . NAP D 2 .   ? 29.480 35.878 43.385  1.00 33.84 ? 456  NAP A O2D 1 
HETATM 6423 C C1D . NAP D 2 .   ? 28.870 33.503 43.258  1.00 28.96 ? 456  NAP A C1D 1 
HETATM 6424 N N1N . NAP D 2 .   ? 28.237 33.072 44.532  1.00 29.22 ? 456  NAP A N1N 1 
HETATM 6425 C C2N . NAP D 2 .   ? 26.915 33.539 44.695  1.00 30.46 ? 456  NAP A C2N 1 
HETATM 6426 C C3N . NAP D 2 .   ? 26.218 33.182 45.909  1.00 33.96 ? 456  NAP A C3N 1 
HETATM 6427 C C7N . NAP D 2 .   ? 24.842 33.659 46.165  1.00 36.72 ? 456  NAP A C7N 1 
HETATM 6428 O O7N . NAP D 2 .   ? 24.085 33.129 46.985  1.00 39.42 ? 456  NAP A O7N 1 
HETATM 6429 N N7N . NAP D 2 .   ? 24.337 34.695 45.481  1.00 40.97 ? 456  NAP A N7N 1 
HETATM 6430 C C4N . NAP D 2 .   ? 26.887 32.362 46.849  1.00 32.84 ? 456  NAP A C4N 1 
HETATM 6431 C C5N . NAP D 2 .   ? 28.169 31.926 46.674  1.00 30.20 ? 456  NAP A C5N 1 
HETATM 6432 C C6N . NAP D 2 .   ? 28.852 32.281 45.515  1.00 29.32 ? 456  NAP A C6N 1 
HETATM 6433 P P2B . NAP D 2 .   ? 42.508 31.262 39.836  1.00 30.92 ? 456  NAP A P2B 1 
HETATM 6434 O O1X . NAP D 2 .   ? 42.871 29.855 40.067  1.00 31.49 ? 456  NAP A O1X 1 
HETATM 6435 O O2X . NAP D 2 .   ? 42.563 31.661 38.416  1.00 33.27 ? 456  NAP A O2X 1 
HETATM 6436 O O3X . NAP D 2 .   ? 43.189 32.233 40.705  1.00 32.73 ? 456  NAP A O3X 1 
HETATM 6437 P PA  . NAP E 2 .   ? 35.137 23.913 92.133  1.00 30.41 ? 1456 NAP B PA  1 
HETATM 6438 O O1A . NAP E 2 .   ? 35.677 23.633 90.784  1.00 27.27 ? 1456 NAP B O1A 1 
HETATM 6439 O O2A . NAP E 2 .   ? 35.202 25.241 92.675  1.00 29.90 ? 1456 NAP B O2A 1 
HETATM 6440 O O5B . NAP E 2 .   ? 35.838 22.833 93.153  1.00 31.74 ? 1456 NAP B O5B 1 
HETATM 6441 C C5B . NAP E 2 .   ? 35.361 22.664 94.507  1.00 31.42 ? 1456 NAP B C5B 1 
HETATM 6442 C C4B . NAP E 2 .   ? 36.522 22.444 95.473  1.00 34.06 ? 1456 NAP B C4B 1 
HETATM 6443 O O4B . NAP E 2 .   ? 37.220 21.234 95.172  1.00 32.78 ? 1456 NAP B O4B 1 
HETATM 6444 C C3B . NAP E 2 .   ? 37.595 23.480 95.492  1.00 34.28 ? 1456 NAP B C3B 1 
HETATM 6445 O O3B . NAP E 2 .   ? 37.172 24.657 96.207  1.00 32.11 ? 1456 NAP B O3B 1 
HETATM 6446 C C2B . NAP E 2 .   ? 38.708 22.753 96.274  1.00 33.43 ? 1456 NAP B C2B 1 
HETATM 6447 O O2B . NAP E 2 .   ? 38.636 22.944 97.708  1.00 32.87 ? 1456 NAP B O2B 1 
HETATM 6448 C C1B . NAP E 2 .   ? 38.428 21.267 95.992  1.00 35.48 ? 1456 NAP B C1B 1 
HETATM 6449 N N9A . NAP E 2 .   ? 39.518 20.546 95.260  1.00 39.69 ? 1456 NAP B N9A 1 
HETATM 6450 C C8A . NAP E 2 .   ? 40.126 20.850 94.041  1.00 41.18 ? 1456 NAP B C8A 1 
HETATM 6451 N N7A . NAP E 2 .   ? 41.050 19.994 93.706  1.00 40.97 ? 1456 NAP B N7A 1 
HETATM 6452 C C5A . NAP E 2 .   ? 41.072 19.076 94.733  1.00 42.90 ? 1456 NAP B C5A 1 
HETATM 6453 C C6A . NAP E 2 .   ? 41.847 17.915 94.958  1.00 42.67 ? 1456 NAP B C6A 1 
HETATM 6454 N N6A . NAP E 2 .   ? 42.768 17.515 94.099  1.00 44.35 ? 1456 NAP B N6A 1 
HETATM 6455 N N1A . NAP E 2 .   ? 41.623 17.201 96.095  1.00 42.96 ? 1456 NAP B N1A 1 
HETATM 6456 C C2A . NAP E 2 .   ? 40.686 17.595 96.979  1.00 42.85 ? 1456 NAP B C2A 1 
HETATM 6457 N N3A . NAP E 2 .   ? 39.911 18.677 96.849  1.00 42.54 ? 1456 NAP B N3A 1 
HETATM 6458 C C4A . NAP E 2 .   ? 40.154 19.384 95.688  1.00 41.59 ? 1456 NAP B C4A 1 
HETATM 6459 O O3  . NAP E 2 .   ? 33.625 23.359 92.168  1.00 28.58 ? 1456 NAP B O3  1 
HETATM 6460 P PN  . NAP E 2 .   ? 32.165 23.947 91.974  1.00 27.53 ? 1456 NAP B PN  1 
HETATM 6461 O O1N . NAP E 2 .   ? 31.768 24.406 93.296  1.00 24.24 ? 1456 NAP B O1N 1 
HETATM 6462 O O2N . NAP E 2 .   ? 32.290 24.978 90.870  1.00 25.54 ? 1456 NAP B O2N 1 
HETATM 6463 O O5D . NAP E 2 .   ? 31.317 22.807 91.317  1.00 25.86 ? 1456 NAP B O5D 1 
HETATM 6464 C C5D . NAP E 2 .   ? 31.032 21.634 92.115  1.00 28.25 ? 1456 NAP B C5D 1 
HETATM 6465 C C4D . NAP E 2 .   ? 30.865 20.355 91.298  1.00 26.00 ? 1456 NAP B C4D 1 
HETATM 6466 O O4D . NAP E 2 .   ? 29.584 20.327 90.711  1.00 27.91 ? 1456 NAP B O4D 1 
HETATM 6467 C C3D . NAP E 2 .   ? 31.828 20.126 90.120  1.00 28.84 ? 1456 NAP B C3D 1 
HETATM 6468 O O3D . NAP E 2 .   ? 32.162 18.755 89.913  1.00 27.76 ? 1456 NAP B O3D 1 
HETATM 6469 C C2D . NAP E 2 .   ? 31.118 20.682 88.911  1.00 27.99 ? 1456 NAP B C2D 1 
HETATM 6470 O O2D . NAP E 2 .   ? 31.435 20.017 87.713  1.00 28.38 ? 1456 NAP B O2D 1 
HETATM 6471 C C1D . NAP E 2 .   ? 29.640 20.428 89.298  1.00 28.91 ? 1456 NAP B C1D 1 
HETATM 6472 N N1N . NAP E 2 .   ? 28.726 21.473 88.773  1.00 30.88 ? 1456 NAP B N1N 1 
HETATM 6473 C C2N . NAP E 2 .   ? 27.812 20.995 87.803  1.00 32.34 ? 1456 NAP B C2N 1 
HETATM 6474 C C3N . NAP E 2 .   ? 26.877 21.948 87.242  1.00 35.55 ? 1456 NAP B C3N 1 
HETATM 6475 C C7N . NAP E 2 .   ? 25.880 21.531 86.230  1.00 37.79 ? 1456 NAP B C7N 1 
HETATM 6476 O O7N . NAP E 2 .   ? 24.856 22.199 85.963  1.00 41.61 ? 1456 NAP B O7N 1 
HETATM 6477 N N7N . NAP E 2 .   ? 26.022 20.365 85.577  1.00 40.40 ? 1456 NAP B N7N 1 
HETATM 6478 C C4N . NAP E 2 .   ? 26.923 23.281 87.703  1.00 31.84 ? 1456 NAP B C4N 1 
HETATM 6479 C C5N . NAP E 2 .   ? 27.823 23.723 88.630  1.00 30.61 ? 1456 NAP B C5N 1 
HETATM 6480 C C6N . NAP E 2 .   ? 28.728 22.819 89.173  1.00 30.47 ? 1456 NAP B C6N 1 
HETATM 6481 P P2B . NAP E 2 .   ? 39.911 23.044 98.696  1.00 34.22 ? 1456 NAP B P2B 1 
HETATM 6482 O O1X . NAP E 2 .   ? 40.392 21.674 99.060  1.00 33.42 ? 1456 NAP B O1X 1 
HETATM 6483 O O2X . NAP E 2 .   ? 40.849 23.828 97.859  1.00 34.93 ? 1456 NAP B O2X 1 
HETATM 6484 O O3X . NAP E 2 .   ? 39.381 23.820 99.809  1.00 31.74 ? 1456 NAP B O3X 1 
HETATM 6485 P PA  . NAP F 2 .   ? 24.636 67.676 74.490  1.00 25.23 ? 2456 NAP C PA  1 
HETATM 6486 O O1A . NAP F 2 .   ? 25.114 66.838 75.608  1.00 22.48 ? 2456 NAP C O1A 1 
HETATM 6487 O O2A . NAP F 2 .   ? 25.174 67.473 73.151  1.00 20.91 ? 2456 NAP C O2A 1 
HETATM 6488 O O5B . NAP F 2 .   ? 24.805 69.221 75.010  1.00 23.98 ? 2456 NAP C O5B 1 
HETATM 6489 C C5B . NAP F 2 .   ? 24.045 70.284 74.365  1.00 24.50 ? 2456 NAP C C5B 1 
HETATM 6490 C C4B . NAP F 2 .   ? 24.797 71.590 74.489  1.00 23.77 ? 2456 NAP C C4B 1 
HETATM 6491 O O4B . NAP F 2 .   ? 24.780 72.021 75.856  1.00 21.73 ? 2456 NAP C O4B 1 
HETATM 6492 C C3B . NAP F 2 .   ? 26.247 71.529 74.135  1.00 23.96 ? 2456 NAP C C3B 1 
HETATM 6493 O O3B . NAP F 2 .   ? 26.431 71.535 72.701  1.00 24.04 ? 2456 NAP C O3B 1 
HETATM 6494 C C2B . NAP F 2 .   ? 26.727 72.846 74.738  1.00 24.38 ? 2456 NAP C C2B 1 
HETATM 6495 O O2B . NAP F 2 .   ? 26.558 73.978 73.860  1.00 23.71 ? 2456 NAP C O2B 1 
HETATM 6496 C C1B . NAP F 2 .   ? 25.813 73.041 75.964  1.00 24.02 ? 2456 NAP C C1B 1 
HETATM 6497 N N9A . NAP F 2 .   ? 26.548 72.917 77.261  1.00 25.40 ? 2456 NAP C N9A 1 
HETATM 6498 C C8A . NAP F 2 .   ? 27.341 71.869 77.745  1.00 25.99 ? 2456 NAP C C8A 1 
HETATM 6499 N N7A . NAP F 2 .   ? 27.856 72.125 78.932  1.00 28.09 ? 2456 NAP C N7A 1 
HETATM 6500 C C5A . NAP F 2 .   ? 27.399 73.378 79.258  1.00 26.47 ? 2456 NAP C C5A 1 
HETATM 6501 C C6A . NAP F 2 .   ? 27.606 74.217 80.402  1.00 30.82 ? 2456 NAP C C6A 1 
HETATM 6502 N N6A . NAP F 2 .   ? 28.371 73.838 81.429  1.00 30.34 ? 2456 NAP C N6A 1 
HETATM 6503 N N1A . NAP F 2 .   ? 26.992 75.437 80.426  1.00 25.10 ? 2456 NAP C N1A 1 
HETATM 6504 C C2A . NAP F 2 .   ? 26.216 75.832 79.390  1.00 28.39 ? 2456 NAP C C2A 1 
HETATM 6505 N N3A . NAP F 2 .   ? 25.968 75.118 78.276  1.00 27.09 ? 2456 NAP C N3A 1 
HETATM 6506 C C4A . NAP F 2 .   ? 26.597 73.883 78.268  1.00 26.93 ? 2456 NAP C C4A 1 
HETATM 6507 O O3  . NAP F 2 .   ? 23.048 67.555 74.422  1.00 20.92 ? 2456 NAP C O3  1 
HETATM 6508 P PN  . NAP F 2 .   ? 21.988 66.683 73.540  1.00 21.35 ? 2456 NAP C PN  1 
HETATM 6509 O O1N . NAP F 2 .   ? 21.669 67.468 72.351  1.00 18.35 ? 2456 NAP C O1N 1 
HETATM 6510 O O2N . NAP F 2 .   ? 22.622 65.340 73.309  1.00 22.29 ? 2456 NAP C O2N 1 
HETATM 6511 O O5D . NAP F 2 .   ? 20.786 66.340 74.500  1.00 21.16 ? 2456 NAP C O5D 1 
HETATM 6512 C C5D . NAP F 2 .   ? 19.884 67.393 74.865  1.00 22.31 ? 2456 NAP C C5D 1 
HETATM 6513 C C4D . NAP F 2 .   ? 19.207 67.159 76.229  1.00 22.55 ? 2456 NAP C C4D 1 
HETATM 6514 O O4D . NAP F 2 .   ? 18.099 66.282 76.096  1.00 23.11 ? 2456 NAP C O4D 1 
HETATM 6515 C C3D . NAP F 2 .   ? 20.088 66.547 77.340  1.00 21.66 ? 2456 NAP C C3D 1 
HETATM 6516 O O3D . NAP F 2 .   ? 19.823 67.056 78.652  1.00 23.92 ? 2456 NAP C O3D 1 
HETATM 6517 C C2D . NAP F 2 .   ? 19.805 65.066 77.288  1.00 25.09 ? 2456 NAP C C2D 1 
HETATM 6518 O O2D . NAP F 2 .   ? 19.919 64.432 78.527  1.00 22.32 ? 2456 NAP C O2D 1 
HETATM 6519 C C1D . NAP F 2 .   ? 18.328 65.045 76.783  1.00 25.02 ? 2456 NAP C C1D 1 
HETATM 6520 N N1N . NAP F 2 .   ? 18.095 63.863 75.933  1.00 25.65 ? 2456 NAP C N1N 1 
HETATM 6521 C C2N . NAP F 2 .   ? 17.093 62.988 76.416  1.00 29.12 ? 2456 NAP C C2N 1 
HETATM 6522 C C3N . NAP F 2 .   ? 16.821 61.799 75.639  1.00 31.35 ? 2456 NAP C C3N 1 
HETATM 6523 C C7N . NAP F 2 .   ? 15.791 60.831 76.050  1.00 35.26 ? 2456 NAP C C7N 1 
HETATM 6524 O O7N . NAP F 2 .   ? 15.335 59.980 75.280  1.00 38.94 ? 2456 NAP C O7N 1 
HETATM 6525 N N7N . NAP F 2 .   ? 15.274 60.861 77.282  1.00 36.84 ? 2456 NAP C N7N 1 
HETATM 6526 C C4N . NAP F 2 .   ? 17.554 61.585 74.458  1.00 27.98 ? 2456 NAP C C4N 1 
HETATM 6527 C C5N . NAP F 2 .   ? 18.514 62.446 74.016  1.00 26.54 ? 2456 NAP C C5N 1 
HETATM 6528 C C6N . NAP F 2 .   ? 18.792 63.589 74.749  1.00 23.25 ? 2456 NAP C C6N 1 
HETATM 6529 P P2B . NAP F 2 .   ? 27.734 75.061 73.613  1.00 27.37 ? 2456 NAP C P2B 1 
HETATM 6530 O O1X . NAP F 2 .   ? 29.059 74.418 73.819  1.00 25.78 ? 2456 NAP C O1X 1 
HETATM 6531 O O2X . NAP F 2 .   ? 27.421 75.414 72.242  1.00 22.27 ? 2456 NAP C O2X 1 
HETATM 6532 O O3X . NAP F 2 .   ? 27.418 76.114 74.589  1.00 28.45 ? 2456 NAP C O3X 1 
HETATM 6533 O O   . HOH G 3 .   ? 29.835 35.955 57.795  1.00 16.56 ? 3187 HOH A O   1 
HETATM 6534 O O   . HOH G 3 .   ? 26.284 40.129 56.845  1.00 19.64 ? 3190 HOH A O   1 
HETATM 6535 O O   . HOH G 3 .   ? 35.560 33.044 57.959  1.00 18.49 ? 3191 HOH A O   1 
HETATM 6536 O O   . HOH G 3 .   ? 38.495 20.523 63.468  1.00 24.53 ? 3192 HOH A O   1 
HETATM 6537 O O   . HOH G 3 .   ? 25.451 13.312 63.997  1.00 20.82 ? 3197 HOH A O   1 
HETATM 6538 O O   . HOH G 3 .   ? 36.848 32.405 63.918  1.00 20.26 ? 3200 HOH A O   1 
HETATM 6539 O O   . HOH G 3 .   ? 20.758 29.945 57.558  1.00 23.35 ? 3208 HOH A O   1 
HETATM 6540 O O   . HOH G 3 .   ? 18.062 18.741 65.421  1.00 18.75 ? 3209 HOH A O   1 
HETATM 6541 O O   . HOH G 3 .   ? 32.904 28.787 74.158  1.00 17.54 ? 3211 HOH A O   1 
HETATM 6542 O O   . HOH G 3 .   ? 33.832 19.144 54.341  1.00 23.50 ? 3216 HOH A O   1 
HETATM 6543 O O   . HOH G 3 .   ? 26.611 32.525 59.294  1.00 16.23 ? 3218 HOH A O   1 
HETATM 6544 O O   . HOH G 3 .   ? 32.038 32.902 36.267  1.00 26.44 ? 3223 HOH A O   1 
HETATM 6545 O O   . HOH G 3 .   ? 24.084 34.319 72.750  1.00 21.78 ? 3227 HOH A O   1 
HETATM 6546 O O   . HOH G 3 .   ? 32.911 32.734 69.819  1.00 21.30 ? 3234 HOH A O   1 
HETATM 6547 O O   . HOH G 3 .   ? 24.111 15.635 63.541  1.00 19.35 ? 3237 HOH A O   1 
HETATM 6548 O O   . HOH G 3 .   ? 26.602 15.702 53.407  1.00 20.21 ? 3239 HOH A O   1 
HETATM 6549 O O   . HOH G 3 .   ? 29.110 7.998  69.460  1.00 27.20 ? 3255 HOH A O   1 
HETATM 6550 O O   . HOH G 3 .   ? 25.498 35.869 70.743  1.00 27.42 ? 3258 HOH A O   1 
HETATM 6551 O O   . HOH G 3 .   ? 30.355 17.359 76.376  1.00 25.32 ? 3259 HOH A O   1 
HETATM 6552 O O   . HOH G 3 .   ? 29.612 38.556 58.754  1.00 25.11 ? 3263 HOH A O   1 
HETATM 6553 O O   . HOH G 3 .   ? 18.781 21.789 73.061  1.00 21.50 ? 3265 HOH A O   1 
HETATM 6554 O O   . HOH G 3 .   ? 35.026 28.961 42.421  1.00 23.51 ? 3270 HOH A O   1 
HETATM 6555 O O   . HOH G 3 .   ? 35.208 19.211 69.469  1.00 29.67 ? 3271 HOH A O   1 
HETATM 6556 O O   . HOH G 3 .   ? 21.945 36.628 67.785  1.00 36.42 ? 3273 HOH A O   1 
HETATM 6557 O O   . HOH G 3 .   ? 22.564 35.932 64.368  1.00 21.41 ? 3274 HOH A O   1 
HETATM 6558 O O   . HOH G 3 .   ? 33.233 29.648 57.282  1.00 22.92 ? 3276 HOH A O   1 
HETATM 6559 O O   . HOH G 3 .   ? 15.763 12.080 65.573  1.00 29.41 ? 3277 HOH A O   1 
HETATM 6560 O O   . HOH G 3 .   ? 17.768 16.508 60.070  1.00 23.65 ? 3278 HOH A O   1 
HETATM 6561 O O   . HOH G 3 .   ? 38.251 27.352 61.917  1.00 24.29 ? 3283 HOH A O   1 
HETATM 6562 O O   . HOH G 3 .   ? 30.761 16.625 56.617  1.00 31.65 ? 3284 HOH A O   1 
HETATM 6563 O O   . HOH G 3 .   ? 44.103 25.677 45.530  1.00 26.28 ? 3291 HOH A O   1 
HETATM 6564 O O   . HOH G 3 .   ? 29.290 12.727 65.363  1.00 30.63 ? 3292 HOH A O   1 
HETATM 6565 O O   . HOH G 3 .   ? 26.749 35.562 54.114  1.00 28.29 ? 3293 HOH A O   1 
HETATM 6566 O O   . HOH G 3 .   ? 35.025 24.731 74.080  1.00 26.93 ? 3294 HOH A O   1 
HETATM 6567 O O   . HOH G 3 .   ? 39.608 29.852 70.160  1.00 25.63 ? 3297 HOH A O   1 
HETATM 6568 O O   . HOH G 3 .   ? 37.076 19.764 52.045  1.00 29.95 ? 3300 HOH A O   1 
HETATM 6569 O O   . HOH G 3 .   ? 32.659 29.231 50.873  1.00 22.12 ? 3302 HOH A O   1 
HETATM 6570 O O   . HOH G 3 .   ? 19.164 16.688 39.115  1.00 33.80 ? 3306 HOH A O   1 
HETATM 6571 O O   . HOH G 3 .   ? 38.916 27.871 51.991  1.00 27.28 ? 3307 HOH A O   1 
HETATM 6572 O O   . HOH G 3 .   ? 25.035 13.267 47.147  1.00 29.92 ? 3308 HOH A O   1 
HETATM 6573 O O   . HOH G 3 .   ? 45.564 20.818 48.234  1.00 28.38 ? 3310 HOH A O   1 
HETATM 6574 O O   . HOH G 3 .   ? 37.833 20.617 49.649  1.00 27.89 ? 3314 HOH A O   1 
HETATM 6575 O O   . HOH G 3 .   ? 37.141 36.858 58.971  1.00 31.24 ? 3318 HOH A O   1 
HETATM 6576 O O   . HOH G 3 .   ? 29.611 31.290 16.130  1.00 29.91 ? 3325 HOH A O   1 
HETATM 6577 O O   . HOH G 3 .   ? 23.958 11.484 62.323  1.00 31.86 ? 3326 HOH A O   1 
HETATM 6578 O O   . HOH G 3 .   ? 16.360 16.787 39.543  1.00 33.06 ? 3330 HOH A O   1 
HETATM 6579 O O   . HOH G 3 .   ? 10.834 21.897 60.363  1.00 30.47 ? 3334 HOH A O   1 
HETATM 6580 O O   . HOH G 3 .   ? 13.545 31.702 44.861  1.00 32.52 ? 3335 HOH A O   1 
HETATM 6581 O O   . HOH G 3 .   ? 25.008 34.449 35.025  1.00 33.19 ? 3336 HOH A O   1 
HETATM 6582 O O   . HOH G 3 .   ? 12.509 20.688 54.070  1.00 26.18 ? 3339 HOH A O   1 
HETATM 6583 O O   . HOH G 3 .   ? 35.575 39.023 60.059  1.00 28.78 ? 3343 HOH A O   1 
HETATM 6584 O O   . HOH G 3 .   ? 28.106 32.407 55.490  1.00 25.84 ? 3344 HOH A O   1 
HETATM 6585 O O   . HOH G 3 .   ? 33.948 31.681 50.509  1.00 30.51 ? 3345 HOH A O   1 
HETATM 6586 O O   . HOH G 3 .   ? 18.530 29.910 69.139  1.00 26.17 ? 3346 HOH A O   1 
HETATM 6587 O O   . HOH G 3 .   ? 39.302 27.812 47.435  1.00 27.51 ? 3347 HOH A O   1 
HETATM 6588 O O   . HOH G 3 .   ? 35.837 35.932 55.591  1.00 28.24 ? 3348 HOH A O   1 
HETATM 6589 O O   . HOH G 3 .   ? 24.310 37.936 68.055  1.00 34.45 ? 3355 HOH A O   1 
HETATM 6590 O O   . HOH G 3 .   ? 36.488 29.947 51.171  1.00 32.15 ? 3363 HOH A O   1 
HETATM 6591 O O   . HOH G 3 .   ? 25.603 24.267 18.695  1.00 30.32 ? 3364 HOH A O   1 
HETATM 6592 O O   . HOH G 3 .   ? 11.329 32.139 46.648  1.00 38.06 ? 3374 HOH A O   1 
HETATM 6593 O O   . HOH G 3 .   ? 29.813 36.638 69.053  1.00 25.30 ? 3377 HOH A O   1 
HETATM 6594 O O   . HOH G 3 .   ? 41.313 33.153 45.040  1.00 31.96 ? 3382 HOH A O   1 
HETATM 6595 O O   . HOH G 3 .   ? 42.465 21.312 51.363  1.00 32.48 ? 3389 HOH A O   1 
HETATM 6596 O O   . HOH G 3 .   ? 33.242 19.357 19.394  1.00 37.57 ? 3390 HOH A O   1 
HETATM 6597 O O   . HOH G 3 .   ? 33.105 35.301 36.809  1.00 31.34 ? 3391 HOH A O   1 
HETATM 6598 O O   . HOH G 3 .   ? 32.052 34.971 46.495  1.00 35.37 ? 3395 HOH A O   1 
HETATM 6599 O O   . HOH G 3 .   ? 10.426 26.333 73.592  1.00 31.03 ? 3397 HOH A O   1 
HETATM 6600 O O   . HOH G 3 .   ? 27.610 13.631 43.203  1.00 27.26 ? 3399 HOH A O   1 
HETATM 6601 O O   . HOH G 3 .   ? 25.932 33.195 52.933  1.00 36.16 ? 3406 HOH A O   1 
HETATM 6602 O O   . HOH G 3 .   ? 15.293 29.839 39.879  1.00 32.26 ? 3408 HOH A O   1 
HETATM 6603 O O   . HOH G 3 .   ? 27.698 37.617 22.530  1.00 37.36 ? 3410 HOH A O   1 
HETATM 6604 O O   . HOH G 3 .   ? 26.703 26.004 76.849  1.00 27.49 ? 3412 HOH A O   1 
HETATM 6605 O O   . HOH G 3 .   ? 37.841 32.211 72.023  1.00 40.03 ? 3414 HOH A O   1 
HETATM 6606 O O   . HOH G 3 .   ? 39.340 21.807 54.313  1.00 33.75 ? 3415 HOH A O   1 
HETATM 6607 O O   . HOH G 3 .   ? 23.264 31.379 51.275  1.00 47.88 ? 3418 HOH A O   1 
HETATM 6608 O O   . HOH G 3 .   ? 37.687 23.003 51.248  1.00 33.85 ? 3422 HOH A O   1 
HETATM 6609 O O   . HOH G 3 .   ? 42.049 24.099 57.177  1.00 48.60 ? 3426 HOH A O   1 
HETATM 6610 O O   . HOH G 3 .   ? 35.755 22.348 70.988  1.00 31.96 ? 3430 HOH A O   1 
HETATM 6611 O O   . HOH G 3 .   ? 39.819 28.850 33.990  1.00 35.08 ? 3432 HOH A O   1 
HETATM 6612 O O   . HOH G 3 .   ? 47.801 22.499 32.368  1.00 42.83 ? 3434 HOH A O   1 
HETATM 6613 O O   . HOH G 3 .   ? 15.033 13.867 68.880  1.00 34.85 ? 3437 HOH A O   1 
HETATM 6614 O O   . HOH G 3 .   ? 31.856 15.720 74.290  1.00 36.79 ? 3442 HOH A O   1 
HETATM 6615 O O   . HOH G 3 .   ? 44.960 14.519 43.419  1.00 36.10 ? 3443 HOH A O   1 
HETATM 6616 O O   . HOH G 3 .   ? 10.416 12.628 73.832  1.00 30.96 ? 3446 HOH A O   1 
HETATM 6617 O O   . HOH G 3 .   ? 11.887 25.909 50.350  1.00 34.15 ? 3449 HOH A O   1 
HETATM 6618 O O   . HOH G 3 .   ? 34.563 32.997 48.468  1.00 34.45 ? 3456 HOH A O   1 
HETATM 6619 O O   . HOH G 3 .   ? 31.574 11.799 46.998  1.00 36.32 ? 3459 HOH A O   1 
HETATM 6620 O O   . HOH G 3 .   ? 35.174 40.799 67.644  1.00 41.28 ? 3461 HOH A O   1 
HETATM 6621 O O   . HOH G 3 .   ? 19.796 12.282 38.142  1.00 37.90 ? 3465 HOH A O   1 
HETATM 6622 O O   . HOH G 3 .   ? 15.547 34.613 31.252  1.00 44.44 ? 3468 HOH A O   1 
HETATM 6623 O O   . HOH G 3 .   ? 31.293 31.544 47.937  1.00 30.95 ? 3474 HOH A O   1 
HETATM 6624 O O   . HOH G 3 .   ? 40.874 26.777 67.539  1.00 33.22 ? 3475 HOH A O   1 
HETATM 6625 O O   . HOH G 3 .   ? 41.486 29.187 56.620  1.00 32.31 ? 3477 HOH A O   1 
HETATM 6626 O O   . HOH G 3 .   ? 9.828  34.257 58.213  1.00 37.23 ? 3478 HOH A O   1 
HETATM 6627 O O   . HOH G 3 .   ? 33.296 36.511 69.982  1.00 31.98 ? 3482 HOH A O   1 
HETATM 6628 O O   . HOH G 3 .   ? 24.541 30.369 53.440  1.00 42.12 ? 3483 HOH A O   1 
HETATM 6629 O O   . HOH G 3 .   ? 7.188  25.883 66.591  1.00 36.11 ? 3488 HOH A O   1 
HETATM 6630 O O   . HOH G 3 .   ? 15.119 30.562 30.895  1.00 36.63 ? 3495 HOH A O   1 
HETATM 6631 O O   . HOH G 3 .   ? 14.200 17.790 79.043  1.00 31.43 ? 3500 HOH A O   1 
HETATM 6632 O O   . HOH G 3 .   ? 16.845 21.550 34.951  1.00 32.88 ? 3502 HOH A O   1 
HETATM 6633 O O   . HOH G 3 .   ? 22.131 13.617 57.417  1.00 28.61 ? 3503 HOH A O   1 
HETATM 6634 O O   . HOH G 3 .   ? 17.977 13.030 45.525  1.00 29.55 ? 3504 HOH A O   1 
HETATM 6635 O O   . HOH G 3 .   ? 10.476 18.787 69.269  1.00 37.36 ? 3506 HOH A O   1 
HETATM 6636 O O   . HOH G 3 .   ? 28.165 34.816 18.853  1.00 38.30 ? 3508 HOH A O   1 
HETATM 6637 O O   . HOH G 3 .   ? 35.609 21.405 48.040  1.00 32.95 ? 3513 HOH A O   1 
HETATM 6638 O O   . HOH G 3 .   ? 33.826 36.443 44.205  1.00 35.62 ? 3515 HOH A O   1 
HETATM 6639 O O   . HOH G 3 .   ? 45.945 17.074 37.127  1.00 36.26 ? 3516 HOH A O   1 
HETATM 6640 O O   . HOH G 3 .   ? 52.183 27.180 38.905  1.00 37.93 ? 3517 HOH A O   1 
HETATM 6641 O O   . HOH G 3 .   ? 9.217  33.064 67.727  1.00 36.84 ? 3520 HOH A O   1 
HETATM 6642 O O   . HOH G 3 .   ? 24.058 31.462 41.682  1.00 37.23 ? 3521 HOH A O   1 
HETATM 6643 O O   . HOH G 3 .   ? 14.202 24.301 39.860  1.00 33.43 ? 3524 HOH A O   1 
HETATM 6644 O O   . HOH G 3 .   ? 22.132 39.513 33.010  1.00 48.12 ? 3528 HOH A O   1 
HETATM 6645 O O   . HOH G 3 .   ? 37.783 29.841 63.175  1.00 38.00 ? 3534 HOH A O   1 
HETATM 6646 O O   . HOH G 3 .   ? 24.656 37.805 19.936  1.00 43.61 ? 3536 HOH A O   1 
HETATM 6647 O O   . HOH G 3 .   ? 18.154 28.735 19.339  1.00 37.95 ? 3538 HOH A O   1 
HETATM 6648 O O   . HOH G 3 .   ? 32.566 13.343 72.298  1.00 42.54 ? 3539 HOH A O   1 
HETATM 6649 O O   . HOH G 3 .   ? 16.082 15.126 33.700  1.00 37.73 ? 3541 HOH A O   1 
HETATM 6650 O O   . HOH G 3 .   ? 25.540 11.067 36.296  1.00 38.86 ? 3544 HOH A O   1 
HETATM 6651 O O   . HOH G 3 .   ? 38.529 33.027 52.213  1.00 42.36 ? 3545 HOH A O   1 
HETATM 6652 O O   . HOH G 3 .   ? 37.185 33.889 69.607  1.00 37.03 ? 3546 HOH A O   1 
HETATM 6653 O O   . HOH G 3 .   ? 34.777 19.278 56.934  1.00 41.09 ? 3548 HOH A O   1 
HETATM 6654 O O   . HOH G 3 .   ? 31.617 12.204 67.727  1.00 44.33 ? 3549 HOH A O   1 
HETATM 6655 O O   . HOH G 3 .   ? 31.481 35.533 21.191  1.00 36.30 ? 3550 HOH A O   1 
HETATM 6656 O O   . HOH G 3 .   ? 29.614 10.318 67.368  1.00 30.92 ? 3551 HOH A O   1 
HETATM 6657 O O   . HOH G 3 .   ? 19.035 15.173 52.125  1.00 40.19 ? 3552 HOH A O   1 
HETATM 6658 O O   . HOH G 3 .   ? 22.115 11.313 58.877  1.00 40.66 ? 3554 HOH A O   1 
HETATM 6659 O O   . HOH G 3 .   ? 29.865 38.701 67.056  1.00 33.96 ? 3557 HOH A O   1 
HETATM 6660 O O   . HOH G 3 .   ? 19.884 36.236 65.096  1.00 33.38 ? 3559 HOH A O   1 
HETATM 6661 O O   . HOH G 3 .   ? 26.557 14.008 55.326  1.00 41.48 ? 3561 HOH A O   1 
HETATM 6662 O O   . HOH G 3 .   ? 31.850 23.091 78.333  1.00 43.11 ? 3572 HOH A O   1 
HETATM 6663 O O   . HOH G 3 .   ? 11.485 34.501 47.947  1.00 44.66 ? 3577 HOH A O   1 
HETATM 6664 O O   . HOH G 3 .   ? 41.494 31.487 33.950  1.00 45.37 ? 3578 HOH A O   1 
HETATM 6665 O O   . HOH G 3 .   ? 17.598 35.736 27.917  1.00 48.78 ? 3588 HOH A O   1 
HETATM 6666 O O   . HOH G 3 .   ? 37.281 11.775 52.613  1.00 54.63 ? 3593 HOH A O   1 
HETATM 6667 O O   . HOH G 3 .   ? 30.532 12.689 54.105  1.00 43.52 ? 3594 HOH A O   1 
HETATM 6668 O O   . HOH G 3 .   ? 22.799 8.413  68.297  1.00 41.79 ? 3595 HOH A O   1 
HETATM 6669 O O   . HOH G 3 .   ? 10.771 28.926 49.786  1.00 47.21 ? 3600 HOH A O   1 
HETATM 6670 O O   . HOH G 3 .   ? 19.838 12.894 69.172  1.00 34.75 ? 3601 HOH A O   1 
HETATM 6671 O O   . HOH G 3 .   ? 35.115 25.764 19.908  1.00 35.87 ? 3607 HOH A O   1 
HETATM 6672 O O   . HOH G 3 .   ? 11.000 20.313 65.620  1.00 41.60 ? 3611 HOH A O   1 
HETATM 6673 O O   . HOH G 3 .   ? 18.296 12.405 60.176  1.00 37.46 ? 3615 HOH A O   1 
HETATM 6674 O O   . HOH G 3 .   ? 34.956 35.584 51.714  1.00 39.35 ? 3616 HOH A O   1 
HETATM 6675 O O   . HOH G 3 .   ? 39.422 22.576 57.040  1.00 42.82 ? 3622 HOH A O   1 
HETATM 6676 O O   . HOH G 3 .   ? 32.217 37.720 55.320  1.00 43.28 ? 3623 HOH A O   1 
HETATM 6677 O O   . HOH G 3 .   ? 23.140 31.012 44.399  1.00 34.23 ? 3624 HOH A O   1 
HETATM 6678 O O   . HOH G 3 .   ? 10.200 31.583 61.108  1.00 35.08 ? 3625 HOH A O   1 
HETATM 6679 O O   . HOH G 3 .   ? 21.255 18.973 81.716  1.00 38.11 ? 3630 HOH A O   1 
HETATM 6680 O O   . HOH G 3 .   ? 12.325 30.241 43.173  1.00 50.69 ? 3635 HOH A O   1 
HETATM 6681 O O   . HOH G 3 .   ? 34.274 10.879 38.121  1.00 48.73 ? 3636 HOH A O   1 
HETATM 6682 O O   . HOH G 3 .   ? 14.379 24.913 32.963  1.00 48.06 ? 3639 HOH A O   1 
HETATM 6683 O O   . HOH G 3 .   ? 35.840 40.226 32.469  1.00 47.78 ? 3640 HOH A O   1 
HETATM 6684 O O   . HOH G 3 .   ? 5.150  26.852 68.634  1.00 49.93 ? 3641 HOH A O   1 
HETATM 6685 O O   . HOH G 3 .   ? 39.291 31.784 45.272  1.00 25.07 ? 3644 HOH A O   1 
HETATM 6686 O O   . HOH G 3 .   ? 34.938 34.502 71.150  1.00 26.19 ? 3648 HOH A O   1 
HETATM 6687 O O   . HOH G 3 .   ? 28.894 40.537 57.150  1.00 30.73 ? 3651 HOH A O   1 
HETATM 6688 O O   . HOH G 3 .   ? 28.148 13.675 63.110  1.00 26.05 ? 3653 HOH A O   1 
HETATM 6689 O O   . HOH G 3 .   ? 38.116 18.689 65.441  1.00 29.56 ? 3655 HOH A O   1 
HETATM 6690 O O   . HOH G 3 .   ? 18.627 14.543 37.682  1.00 29.54 ? 3657 HOH A O   1 
HETATM 6691 O O   . HOH G 3 .   ? 28.278 36.965 71.108  1.00 27.13 ? 3658 HOH A O   1 
HETATM 6692 O O   . HOH G 3 .   ? 35.085 27.355 75.422  1.00 28.89 ? 3659 HOH A O   1 
HETATM 6693 O O   . HOH G 3 .   ? 35.596 33.388 73.596  1.00 30.77 ? 3660 HOH A O   1 
HETATM 6694 O O   . HOH G 3 .   ? 29.247 34.780 55.157  1.00 30.80 ? 3668 HOH A O   1 
HETATM 6695 O O   . HOH G 3 .   ? 36.529 24.594 49.083  1.00 34.12 ? 3669 HOH A O   1 
HETATM 6696 O O   . HOH G 3 .   ? 40.851 26.005 48.865  1.00 31.23 ? 3674 HOH A O   1 
HETATM 6697 O O   . HOH G 3 .   ? 15.322 23.807 35.175  1.00 32.42 ? 3679 HOH A O   1 
HETATM 6698 O O   . HOH G 3 .   ? 37.614 27.604 49.746  1.00 31.76 ? 3681 HOH A O   1 
HETATM 6699 O O   . HOH G 3 .   ? 7.417  12.282 73.121  1.00 40.60 ? 3683 HOH A O   1 
HETATM 6700 O O   . HOH G 3 .   ? 17.397 14.602 58.111  1.00 36.34 ? 3685 HOH A O   1 
HETATM 6701 O O   . HOH G 3 .   ? 42.378 27.737 45.692  1.00 32.75 ? 3686 HOH A O   1 
HETATM 6702 O O   . HOH G 3 .   ? 40.627 31.707 36.318  1.00 37.10 ? 3687 HOH A O   1 
HETATM 6703 O O   . HOH G 3 .   ? 30.804 32.321 13.881  1.00 33.68 ? 3690 HOH A O   1 
HETATM 6704 O O   . HOH G 3 .   ? 40.980 21.810 64.071  1.00 34.92 ? 3691 HOH A O   1 
HETATM 6705 O O   . HOH G 3 .   ? 39.897 24.649 51.310  1.00 40.36 ? 3694 HOH A O   1 
HETATM 6706 O O   . HOH G 3 .   ? 39.804 30.207 47.502  1.00 36.58 ? 3700 HOH A O   1 
HETATM 6707 O O   . HOH G 3 .   ? 35.769 22.746 76.027  1.00 36.22 ? 3701 HOH A O   1 
HETATM 6708 O O   . HOH G 3 .   ? 45.463 18.690 49.204  1.00 37.08 ? 3703 HOH A O   1 
HETATM 6709 O O   . HOH G 3 .   ? 25.489 33.881 50.740  1.00 36.27 ? 3705 HOH A O   1 
HETATM 6710 O O   . HOH G 3 .   ? 26.817 23.980 79.082  1.00 38.65 ? 3708 HOH A O   1 
HETATM 6711 O O   . HOH G 3 .   ? 20.324 11.320 44.962  1.00 39.02 ? 3713 HOH A O   1 
HETATM 6712 O O   . HOH G 3 .   ? 38.439 20.287 58.447  1.00 39.94 ? 3718 HOH A O   1 
HETATM 6713 O O   . HOH G 3 .   ? 28.595 38.749 19.862  1.00 41.44 ? 3720 HOH A O   1 
HETATM 6714 O O   . HOH G 3 .   ? 19.672 18.713 74.403  1.00 36.09 ? 3722 HOH A O   1 
HETATM 6715 O O   . HOH G 3 .   ? 42.809 24.394 47.483  1.00 34.72 ? 3726 HOH A O   1 
HETATM 6716 O O   . HOH G 3 .   ? 30.116 39.513 54.744  1.00 37.89 ? 3728 HOH A O   1 
HETATM 6717 O O   . HOH G 3 .   ? 39.359 19.436 61.212  1.00 37.73 ? 3729 HOH A O   1 
HETATM 6718 O O   . HOH G 3 .   ? 40.722 35.156 43.187  1.00 43.47 ? 3730 HOH A O   1 
HETATM 6719 O O   . HOH G 3 .   ? 26.435 37.478 29.028  1.00 43.35 ? 3748 HOH A O   1 
HETATM 6720 O O   . HOH G 3 .   ? 31.842 11.892 49.599  1.00 38.32 ? 3750 HOH A O   1 
HETATM 6721 O O   . HOH G 3 .   ? 27.749 13.550 46.057  1.00 36.16 ? 3752 HOH A O   1 
HETATM 6722 O O   . HOH G 3 .   ? 38.350 33.080 58.689  1.00 37.40 ? 3754 HOH A O   1 
HETATM 6723 O O   . HOH G 3 .   ? 35.476 25.554 17.074  1.00 42.31 ? 3762 HOH A O   1 
HETATM 6724 O O   . HOH G 3 .   ? 29.855 16.581 18.722  1.00 46.30 ? 3767 HOH A O   1 
HETATM 6725 O O   . HOH G 3 .   ? 37.727 19.195 67.853  1.00 40.19 ? 3778 HOH A O   1 
HETATM 6726 O O   . HOH G 3 .   ? 17.147 37.206 65.702  1.00 38.54 ? 3779 HOH A O   1 
HETATM 6727 O O   . HOH G 3 .   ? 15.484 36.868 29.315  1.00 45.94 ? 3781 HOH A O   1 
HETATM 6728 O O   . HOH G 3 .   ? 41.624 23.359 52.967  1.00 37.95 ? 3783 HOH A O   1 
HETATM 6729 O O   . HOH G 3 .   ? 22.851 16.776 81.977  1.00 40.10 ? 3784 HOH A O   1 
HETATM 6730 O O   . HOH G 3 .   ? 30.287 22.885 15.922  1.00 35.17 ? 3789 HOH A O   1 
HETATM 6731 O O   . HOH G 3 .   ? 37.296 18.546 56.755  1.00 41.39 ? 3791 HOH A O   1 
HETATM 6732 O O   . HOH G 3 .   ? 36.296 10.816 39.711  1.00 40.77 ? 3796 HOH A O   1 
HETATM 6733 O O   . HOH G 3 .   ? 44.373 15.075 39.678  1.00 42.36 ? 3797 HOH A O   1 
HETATM 6734 O O   . HOH G 3 .   ? 31.759 44.078 37.007  1.00 38.36 ? 3798 HOH A O   1 
HETATM 6735 O O   . HOH G 3 .   ? 25.518 11.518 42.689  1.00 40.12 ? 3799 HOH A O   1 
HETATM 6736 O O   . HOH G 3 .   ? 40.844 17.782 51.254  1.00 34.54 ? 3802 HOH A O   1 
HETATM 6737 O O   . HOH G 3 .   ? 10.359 24.547 60.149  1.00 37.65 ? 3804 HOH A O   1 
HETATM 6738 O O   . HOH G 3 .   ? 20.942 7.931  62.620  1.00 44.82 ? 3805 HOH A O   1 
HETATM 6739 O O   . HOH G 3 .   ? 26.188 10.629 60.079  1.00 46.77 ? 3808 HOH A O   1 
HETATM 6740 O O   . HOH G 3 .   ? 45.211 29.144 39.285  1.00 41.22 ? 3813 HOH A O   1 
HETATM 6741 O O   . HOH G 3 .   ? 15.384 20.751 32.783  1.00 43.09 ? 3816 HOH A O   1 
HETATM 6742 O O   . HOH G 3 .   ? 17.112 7.547  65.100  1.00 45.88 ? 3819 HOH A O   1 
HETATM 6743 O O   . HOH G 3 .   ? 8.812  15.968 57.480  1.00 50.68 ? 3820 HOH A O   1 
HETATM 6744 O O   . HOH G 3 .   ? 26.368 9.386  30.398  1.00 50.36 ? 3821 HOH A O   1 
HETATM 6745 O O   . HOH G 3 .   ? 37.567 21.830 73.001  1.00 42.23 ? 3824 HOH A O   1 
HETATM 6746 O O   . HOH G 3 .   ? 24.705 12.211 29.607  1.00 49.70 ? 3825 HOH A O   1 
HETATM 6747 O O   . HOH G 3 .   ? 21.070 35.400 46.754  1.00 54.34 ? 3838 HOH A O   1 
HETATM 6748 O O   . HOH G 3 .   ? 43.509 18.447 50.945  1.00 41.03 ? 3843 HOH A O   1 
HETATM 6749 O O   . HOH G 3 .   ? 25.797 20.688 18.637  1.00 45.93 ? 3846 HOH A O   1 
HETATM 6750 O O   . HOH G 3 .   ? 19.442 42.008 28.292  1.00 49.70 ? 3847 HOH A O   1 
HETATM 6751 O O   . HOH G 3 .   ? 29.198 14.591 55.987  1.00 42.67 ? 3857 HOH A O   1 
HETATM 6752 O O   . HOH G 3 .   ? 35.920 40.197 41.307  1.00 42.77 ? 3860 HOH A O   1 
HETATM 6753 O O   . HOH G 3 .   ? 12.609 11.761 63.088  1.00 51.22 ? 3864 HOH A O   1 
HETATM 6754 O O   . HOH G 3 .   ? 38.743 18.728 54.001  1.00 51.72 ? 3869 HOH A O   1 
HETATM 6755 O O   . HOH G 3 .   ? 30.803 13.817 45.697  1.00 46.61 ? 3870 HOH A O   1 
HETATM 6756 O O   . HOH G 3 .   ? 21.503 20.745 25.085  1.00 44.43 ? 3873 HOH A O   1 
HETATM 6757 O O   . HOH G 3 .   ? 27.871 36.788 41.547  1.00 40.63 ? 3875 HOH A O   1 
HETATM 6758 O O   . HOH G 3 .   ? 39.021 31.691 61.435  1.00 46.55 ? 3877 HOH A O   1 
HETATM 6759 O O   . HOH G 3 .   ? 17.175 38.834 26.335  1.00 48.04 ? 3878 HOH A O   1 
HETATM 6760 O O   . HOH G 3 .   ? 6.087  29.206 66.831  1.00 47.35 ? 3879 HOH A O   1 
HETATM 6761 O O   . HOH G 3 .   ? 5.960  25.432 64.181  1.00 49.41 ? 3883 HOH A O   1 
HETATM 6762 O O   . HOH G 3 .   ? 42.029 28.984 21.587  1.00 45.55 ? 3885 HOH A O   1 
HETATM 6763 O O   . HOH G 3 .   ? 40.813 28.972 64.001  1.00 50.29 ? 3886 HOH A O   1 
HETATM 6764 O O   . HOH G 3 .   ? 41.121 30.150 60.461  1.00 37.79 ? 3887 HOH A O   1 
HETATM 6765 O O   . HOH G 3 .   ? 37.178 32.913 47.882  1.00 34.17 ? 3893 HOH A O   1 
HETATM 6766 O O   . HOH H 3 .   ? 29.201 34.785 86.173  1.00 15.62 ? 3185 HOH B O   1 
HETATM 6767 O O   . HOH H 3 .   ? 21.559 43.486 71.662  1.00 17.62 ? 3188 HOH B O   1 
HETATM 6768 O O   . HOH H 3 .   ? 32.807 34.753 84.171  1.00 18.10 ? 3193 HOH B O   1 
HETATM 6769 O O   . HOH H 3 .   ? 11.190 46.930 79.649  1.00 18.86 ? 3194 HOH B O   1 
HETATM 6770 O O   . HOH H 3 .   ? 29.021 44.177 77.525  1.00 16.92 ? 3196 HOH B O   1 
HETATM 6771 O O   . HOH H 3 .   ? 9.682  41.433 85.421  1.00 18.65 ? 3202 HOH B O   1 
HETATM 6772 O O   . HOH H 3 .   ? 5.671  33.278 82.855  1.00 20.98 ? 3206 HOH B O   1 
HETATM 6773 O O   . HOH H 3 .   ? 25.418 30.883 83.754  1.00 21.89 ? 3207 HOH B O   1 
HETATM 6774 O O   . HOH H 3 .   ? 26.580 49.565 78.760  1.00 18.99 ? 3210 HOH B O   1 
HETATM 6775 O O   . HOH H 3 .   ? 28.880 45.269 92.508  1.00 20.43 ? 3212 HOH B O   1 
HETATM 6776 O O   . HOH H 3 .   ? 26.582 51.652 82.692  1.00 26.27 ? 3215 HOH B O   1 
HETATM 6777 O O   . HOH H 3 .   ? 12.454 19.420 99.709  1.00 22.94 ? 3217 HOH B O   1 
HETATM 6778 O O   . HOH H 3 .   ? 21.891 35.208 74.060  1.00 19.38 ? 3219 HOH B O   1 
HETATM 6779 O O   . HOH H 3 .   ? 17.785 34.138 70.448  1.00 29.86 ? 3220 HOH B O   1 
HETATM 6780 O O   . HOH H 3 .   ? 13.735 42.688 91.094  1.00 19.13 ? 3221 HOH B O   1 
HETATM 6781 O O   . HOH H 3 .   ? 24.431 33.322 80.755  1.00 16.54 ? 3222 HOH B O   1 
HETATM 6782 O O   . HOH H 3 .   ? 13.824 13.232 97.282  1.00 22.63 ? 3230 HOH B O   1 
HETATM 6783 O O   . HOH H 3 .   ? 31.891 29.477 89.347  1.00 22.40 ? 3231 HOH B O   1 
HETATM 6784 O O   . HOH H 3 .   ? 7.162  28.535 87.067  1.00 21.50 ? 3232 HOH B O   1 
HETATM 6785 O O   . HOH H 3 .   ? 15.583 23.418 78.350  1.00 21.39 ? 3235 HOH B O   1 
HETATM 6786 O O   . HOH H 3 .   ? 27.950 28.069 75.683  1.00 20.80 ? 3236 HOH B O   1 
HETATM 6787 O O   . HOH H 3 .   ? 18.545 31.129 81.574  1.00 22.96 ? 3241 HOH B O   1 
HETATM 6788 O O   . HOH H 3 .   ? 28.282 41.177 73.796  1.00 21.21 ? 3242 HOH B O   1 
HETATM 6789 O O   . HOH H 3 .   ? 8.843  37.214 89.796  1.00 27.53 ? 3245 HOH B O   1 
HETATM 6790 O O   . HOH H 3 .   ? 15.116 40.395 75.026  1.00 25.34 ? 3248 HOH B O   1 
HETATM 6791 O O   . HOH H 3 .   ? 29.003 31.662 79.971  1.00 23.85 ? 3249 HOH B O   1 
HETATM 6792 O O   . HOH H 3 .   ? 26.434 50.126 86.756  1.00 22.49 ? 3251 HOH B O   1 
HETATM 6793 O O   . HOH H 3 .   ? 29.959 31.347 77.178  1.00 27.70 ? 3254 HOH B O   1 
HETATM 6794 O O   . HOH H 3 .   ? 16.962 34.606 96.815  1.00 27.06 ? 3262 HOH B O   1 
HETATM 6795 O O   . HOH H 3 .   ? 9.931  23.203 84.515  1.00 22.34 ? 3268 HOH B O   1 
HETATM 6796 O O   . HOH H 3 .   ? 13.630 44.457 93.164  1.00 26.73 ? 3272 HOH B O   1 
HETATM 6797 O O   . HOH H 3 .   ? 32.358 15.810 94.450  1.00 24.73 ? 3279 HOH B O   1 
HETATM 6798 O O   . HOH H 3 .   ? 24.775 49.813 89.251  1.00 26.05 ? 3281 HOH B O   1 
HETATM 6799 O O   . HOH H 3 .   ? 10.077 21.474 82.423  1.00 25.67 ? 3285 HOH B O   1 
HETATM 6800 O O   . HOH H 3 .   ? 10.298 30.922 95.021  1.00 25.12 ? 3287 HOH B O   1 
HETATM 6801 O O   . HOH H 3 .   ? 24.495 36.664 96.072  1.00 29.18 ? 3289 HOH B O   1 
HETATM 6802 O O   . HOH H 3 .   ? 20.525 38.416 95.942  1.00 27.60 ? 3296 HOH B O   1 
HETATM 6803 O O   . HOH H 3 .   ? 32.287 41.262 85.503  1.00 27.47 ? 3299 HOH B O   1 
HETATM 6804 O O   . HOH H 3 .   ? 14.655 29.531 101.003 1.00 24.97 ? 3304 HOH B O   1 
HETATM 6805 O O   . HOH H 3 .   ? 18.790 54.857 86.062  1.00 26.99 ? 3309 HOH B O   1 
HETATM 6806 O O   . HOH H 3 .   ? 8.678  52.379 83.761  1.00 27.25 ? 3312 HOH B O   1 
HETATM 6807 O O   . HOH H 3 .   ? 12.505 14.722 108.698 1.00 31.36 ? 3313 HOH B O   1 
HETATM 6808 O O   . HOH H 3 .   ? 34.597 15.698 92.910  1.00 28.03 ? 3320 HOH B O   1 
HETATM 6809 O O   . HOH H 3 .   ? 32.453 41.230 87.990  1.00 32.96 ? 3328 HOH B O   1 
HETATM 6810 O O   . HOH H 3 .   ? 27.558 6.092  112.935 1.00 35.93 ? 3338 HOH B O   1 
HETATM 6811 O O   . HOH H 3 .   ? 17.550 6.083  91.214  1.00 32.07 ? 3341 HOH B O   1 
HETATM 6812 O O   . HOH H 3 .   ? 22.750 20.298 88.185  1.00 37.22 ? 3342 HOH B O   1 
HETATM 6813 O O   . HOH H 3 .   ? 8.346  13.185 107.510 1.00 31.61 ? 3349 HOH B O   1 
HETATM 6814 O O   . HOH H 3 .   ? 32.163 23.529 95.980  1.00 27.33 ? 3352 HOH B O   1 
HETATM 6815 O O   . HOH H 3 .   ? 39.552 17.391 101.114 1.00 33.48 ? 3358 HOH B O   1 
HETATM 6816 O O   . HOH H 3 .   ? 27.747 11.671 90.858  1.00 28.34 ? 3361 HOH B O   1 
HETATM 6817 O O   . HOH H 3 .   ? 11.470 37.624 95.137  1.00 30.97 ? 3362 HOH B O   1 
HETATM 6818 O O   . HOH H 3 .   ? 40.130 11.063 92.377  1.00 31.51 ? 3367 HOH B O   1 
HETATM 6819 O O   . HOH H 3 .   ? 28.113 6.962  86.720  1.00 29.31 ? 3368 HOH B O   1 
HETATM 6820 O O   . HOH H 3 .   ? 23.704 41.537 71.955  1.00 30.19 ? 3371 HOH B O   1 
HETATM 6821 O O   . HOH H 3 .   ? 16.470 13.735 87.761  1.00 31.60 ? 3373 HOH B O   1 
HETATM 6822 O O   . HOH H 3 .   ? 16.347 39.900 70.695  1.00 35.91 ? 3375 HOH B O   1 
HETATM 6823 O O   . HOH H 3 .   ? 25.029 39.302 94.592  1.00 35.14 ? 3376 HOH B O   1 
HETATM 6824 O O   . HOH H 3 .   ? 11.861 43.013 94.995  1.00 27.04 ? 3379 HOH B O   1 
HETATM 6825 O O   . HOH H 3 .   ? 9.471  30.281 74.581  1.00 33.58 ? 3380 HOH B O   1 
HETATM 6826 O O   . HOH H 3 .   ? 12.505 15.763 91.689  1.00 32.94 ? 3388 HOH B O   1 
HETATM 6827 O O   . HOH H 3 .   ? 33.443 48.077 82.270  1.00 34.54 ? 3392 HOH B O   1 
HETATM 6828 O O   . HOH H 3 .   ? 8.719  25.940 99.156  1.00 28.94 ? 3393 HOH B O   1 
HETATM 6829 O O   . HOH H 3 .   ? 15.857 12.282 108.448 1.00 42.25 ? 3394 HOH B O   1 
HETATM 6830 O O   . HOH H 3 .   ? 29.115 38.549 73.150  1.00 23.19 ? 3398 HOH B O   1 
HETATM 6831 O O   . HOH H 3 .   ? 15.738 37.117 96.941  1.00 28.02 ? 3400 HOH B O   1 
HETATM 6832 O O   . HOH H 3 .   ? 27.770 35.335 98.549  1.00 30.74 ? 3403 HOH B O   1 
HETATM 6833 O O   . HOH H 3 .   ? 35.441 34.333 78.275  1.00 33.94 ? 3407 HOH B O   1 
HETATM 6834 O O   . HOH H 3 .   ? 15.659 49.725 95.070  1.00 33.28 ? 3409 HOH B O   1 
HETATM 6835 O O   . HOH H 3 .   ? 22.838 2.543  90.073  1.00 32.46 ? 3411 HOH B O   1 
HETATM 6836 O O   . HOH H 3 .   ? 23.189 28.374 84.627  1.00 31.78 ? 3421 HOH B O   1 
HETATM 6837 O O   . HOH H 3 .   ? 34.338 6.824  107.109 1.00 36.68 ? 3424 HOH B O   1 
HETATM 6838 O O   . HOH H 3 .   ? 29.557 37.193 102.429 1.00 33.16 ? 3427 HOH B O   1 
HETATM 6839 O O   . HOH H 3 .   ? 37.303 30.888 101.178 1.00 38.95 ? 3435 HOH B O   1 
HETATM 6840 O O   . HOH H 3 .   ? 13.019 17.706 81.418  1.00 32.30 ? 3439 HOH B O   1 
HETATM 6841 O O   . HOH H 3 .   ? 23.023 19.441 85.482  1.00 33.61 ? 3440 HOH B O   1 
HETATM 6842 O O   . HOH H 3 .   ? 35.836 34.351 80.950  1.00 28.25 ? 3441 HOH B O   1 
HETATM 6843 O O   . HOH H 3 .   ? 10.369 49.471 81.891  1.00 32.77 ? 3444 HOH B O   1 
HETATM 6844 O O   . HOH H 3 .   ? 7.794  18.583 96.139  1.00 36.26 ? 3447 HOH B O   1 
HETATM 6845 O O   . HOH H 3 .   ? 34.886 38.353 79.930  1.00 37.10 ? 3448 HOH B O   1 
HETATM 6846 O O   . HOH H 3 .   ? 34.269 7.015  92.572  1.00 37.16 ? 3454 HOH B O   1 
HETATM 6847 O O   . HOH H 3 .   ? 14.555 21.366 108.392 1.00 36.25 ? 3462 HOH B O   1 
HETATM 6848 O O   . HOH H 3 .   ? 18.036 49.978 94.183  1.00 36.52 ? 3464 HOH B O   1 
HETATM 6849 O O   . HOH H 3 .   ? 19.808 51.252 77.139  1.00 28.93 ? 3469 HOH B O   1 
HETATM 6850 O O   . HOH H 3 .   ? 14.909 17.001 83.683  1.00 30.90 ? 3470 HOH B O   1 
HETATM 6851 O O   . HOH H 3 .   ? 4.273  38.812 81.713  1.00 26.91 ? 3471 HOH B O   1 
HETATM 6852 O O   . HOH H 3 .   ? 21.451 37.615 71.835  1.00 38.22 ? 3476 HOH B O   1 
HETATM 6853 O O   . HOH H 3 .   ? 20.635 19.940 83.957  1.00 36.54 ? 3484 HOH B O   1 
HETATM 6854 O O   . HOH H 3 .   ? 13.746 12.073 94.514  1.00 34.12 ? 3486 HOH B O   1 
HETATM 6855 O O   . HOH H 3 .   ? 28.488 23.458 112.640 1.00 48.33 ? 3497 HOH B O   1 
HETATM 6856 O O   . HOH H 3 .   ? 25.717 1.568  108.332 1.00 47.70 ? 3498 HOH B O   1 
HETATM 6857 O O   . HOH H 3 .   ? 33.053 40.484 82.173  1.00 26.91 ? 3499 HOH B O   1 
HETATM 6858 O O   . HOH H 3 .   ? 24.166 18.225 89.479  1.00 40.43 ? 3501 HOH B O   1 
HETATM 6859 O O   . HOH H 3 .   ? 36.991 29.134 98.136  1.00 42.13 ? 3505 HOH B O   1 
HETATM 6860 O O   . HOH H 3 .   ? 9.412  13.945 102.475 1.00 32.68 ? 3512 HOH B O   1 
HETATM 6861 O O   . HOH H 3 .   ? 27.927 -0.047 95.926  1.00 39.02 ? 3518 HOH B O   1 
HETATM 6862 O O   . HOH H 3 .   ? 25.234 38.984 108.115 1.00 49.86 ? 3519 HOH B O   1 
HETATM 6863 O O   . HOH H 3 .   ? 19.465 34.809 72.239  1.00 39.80 ? 3522 HOH B O   1 
HETATM 6864 O O   . HOH H 3 .   ? 4.518  43.270 90.051  1.00 40.49 ? 3523 HOH B O   1 
HETATM 6865 O O   . HOH H 3 .   ? 25.173 27.514 81.728  1.00 38.35 ? 3526 HOH B O   1 
HETATM 6866 O O   . HOH H 3 .   ? 10.422 20.437 104.032 1.00 31.90 ? 3527 HOH B O   1 
HETATM 6867 O O   . HOH H 3 .   ? 17.376 27.144 103.714 1.00 32.70 ? 3532 HOH B O   1 
HETATM 6868 O O   . HOH H 3 .   ? 28.899 33.342 100.058 1.00 41.86 ? 3533 HOH B O   1 
HETATM 6869 O O   . HOH H 3 .   ? 33.354 45.009 78.717  1.00 36.97 ? 3535 HOH B O   1 
HETATM 6870 O O   . HOH H 3 .   ? 30.729 17.486 87.338  1.00 38.92 ? 3537 HOH B O   1 
HETATM 6871 O O   . HOH H 3 .   ? 32.509 32.687 76.118  1.00 34.28 ? 3540 HOH B O   1 
HETATM 6872 O O   . HOH H 3 .   ? 10.044 18.766 98.526  1.00 37.89 ? 3547 HOH B O   1 
HETATM 6873 O O   . HOH H 3 .   ? 31.181 6.903  114.197 1.00 40.55 ? 3553 HOH B O   1 
HETATM 6874 O O   . HOH H 3 .   ? 19.392 32.474 104.861 1.00 32.59 ? 3558 HOH B O   1 
HETATM 6875 O O   . HOH H 3 .   ? 5.739  32.487 75.858  1.00 50.19 ? 3560 HOH B O   1 
HETATM 6876 O O   . HOH H 3 .   ? 38.927 16.466 84.107  1.00 47.90 ? 3565 HOH B O   1 
HETATM 6877 O O   . HOH H 3 .   ? 34.268 29.574 96.108  1.00 41.85 ? 3566 HOH B O   1 
HETATM 6878 O O   . HOH H 3 .   ? 26.813 3.702  84.086  1.00 38.73 ? 3567 HOH B O   1 
HETATM 6879 O O   . HOH H 3 .   ? 31.742 3.579  106.408 1.00 42.13 ? 3568 HOH B O   1 
HETATM 6880 O O   . HOH H 3 .   ? 27.638 24.376 84.296  1.00 41.83 ? 3569 HOH B O   1 
HETATM 6881 O O   . HOH H 3 .   ? 18.398 37.462 100.313 1.00 30.38 ? 3571 HOH B O   1 
HETATM 6882 O O   . HOH H 3 .   ? 7.162  32.931 71.655  1.00 34.35 ? 3574 HOH B O   1 
HETATM 6883 O O   . HOH H 3 .   ? 2.602  42.271 81.138  1.00 34.94 ? 3575 HOH B O   1 
HETATM 6884 O O   . HOH H 3 .   ? 3.058  48.831 73.753  1.00 48.03 ? 3576 HOH B O   1 
HETATM 6885 O O   . HOH H 3 .   ? 26.466 18.309 88.549  1.00 44.34 ? 3579 HOH B O   1 
HETATM 6886 O O   . HOH H 3 .   ? 30.901 5.847  92.248  1.00 40.75 ? 3580 HOH B O   1 
HETATM 6887 O O   . HOH H 3 .   ? 16.271 1.851  95.363  1.00 36.61 ? 3581 HOH B O   1 
HETATM 6888 O O   . HOH H 3 .   ? 13.625 9.557  94.930  1.00 43.06 ? 3582 HOH B O   1 
HETATM 6889 O O   . HOH H 3 .   ? 30.091 28.148 82.549  1.00 33.99 ? 3584 HOH B O   1 
HETATM 6890 O O   . HOH H 3 .   ? 18.334 -0.338 95.713  1.00 48.20 ? 3586 HOH B O   1 
HETATM 6891 O O   . HOH H 3 .   ? 39.660 26.486 94.377  1.00 38.01 ? 3589 HOH B O   1 
HETATM 6892 O O   . HOH H 3 .   ? 19.730 29.667 103.644 1.00 39.86 ? 3590 HOH B O   1 
HETATM 6893 O O   . HOH H 3 .   ? 7.390  38.980 93.436  1.00 37.07 ? 3591 HOH B O   1 
HETATM 6894 O O   . HOH H 3 .   ? 6.662  32.200 80.809  1.00 35.14 ? 3592 HOH B O   1 
HETATM 6895 O O   . HOH H 3 .   ? 39.032 15.153 109.954 1.00 42.96 ? 3598 HOH B O   1 
HETATM 6896 O O   . HOH H 3 .   ? 3.577  36.065 75.278  1.00 38.04 ? 3610 HOH B O   1 
HETATM 6897 O O   . HOH H 3 .   ? 45.766 17.416 96.795  1.00 56.06 ? 3613 HOH B O   1 
HETATM 6898 O O   . HOH H 3 .   ? 35.404 50.500 88.436  1.00 37.10 ? 3619 HOH B O   1 
HETATM 6899 O O   . HOH H 3 .   ? 31.769 33.251 110.558 1.00 41.85 ? 3620 HOH B O   1 
HETATM 6900 O O   . HOH H 3 .   ? 36.876 17.922 101.881 1.00 35.90 ? 3621 HOH B O   1 
HETATM 6901 O O   . HOH H 3 .   ? 34.303 28.422 85.065  1.00 47.24 ? 3628 HOH B O   1 
HETATM 6902 O O   . HOH H 3 .   ? 18.841 34.783 103.757 1.00 32.75 ? 3629 HOH B O   1 
HETATM 6903 O O   . HOH H 3 .   ? 40.260 7.518  108.508 1.00 50.66 ? 3638 HOH B O   1 
HETATM 6904 O O   . HOH H 3 .   ? 17.995 38.298 97.631  1.00 29.67 ? 3643 HOH B O   1 
HETATM 6905 O O   . HOH H 3 .   ? 30.585 28.913 76.213  1.00 21.65 ? 3650 HOH B O   1 
HETATM 6906 O O   . HOH H 3 .   ? 24.173 52.437 89.569  1.00 27.70 ? 3656 HOH B O   1 
HETATM 6907 O O   . HOH H 3 .   ? 17.338 29.703 102.706 1.00 33.81 ? 3661 HOH B O   1 
HETATM 6908 O O   . HOH H 3 .   ? 26.619 42.278 71.790  1.00 32.52 ? 3663 HOH B O   1 
HETATM 6909 O O   . HOH H 3 .   ? 28.577 29.622 81.457  1.00 25.04 ? 3664 HOH B O   1 
HETATM 6910 O O   . HOH H 3 .   ? 19.417 17.249 83.004  1.00 31.75 ? 3665 HOH B O   1 
HETATM 6911 O O   . HOH H 3 .   ? 16.594 42.601 96.728  1.00 27.51 ? 3666 HOH B O   1 
HETATM 6912 O O   . HOH H 3 .   ? 16.276 44.349 94.410  1.00 29.89 ? 3667 HOH B O   1 
HETATM 6913 O O   . HOH H 3 .   ? 12.092 11.452 98.270  1.00 34.47 ? 3675 HOH B O   1 
HETATM 6914 O O   . HOH H 3 .   ? 34.939 36.248 84.438  1.00 35.54 ? 3676 HOH B O   1 
HETATM 6915 O O   . HOH H 3 .   ? 31.171 45.565 76.394  1.00 29.46 ? 3678 HOH B O   1 
HETATM 6916 O O   . HOH H 3 .   ? 16.871 11.590 86.598  1.00 37.46 ? 3680 HOH B O   1 
HETATM 6917 O O   . HOH H 3 .   ? 40.679 24.367 102.104 1.00 36.10 ? 3684 HOH B O   1 
HETATM 6918 O O   . HOH H 3 .   ? 27.439 47.450 92.975  1.00 31.04 ? 3689 HOH B O   1 
HETATM 6919 O O   . HOH H 3 .   ? 24.428 25.240 84.110  1.00 47.10 ? 3695 HOH B O   1 
HETATM 6920 O O   . HOH H 3 .   ? 36.722 26.625 94.423  1.00 31.56 ? 3696 HOH B O   1 
HETATM 6921 O O   . HOH H 3 .   ? 8.697  25.545 83.611  1.00 31.58 ? 3698 HOH B O   1 
HETATM 6922 O O   . HOH H 3 .   ? 36.450 5.078  107.159 1.00 37.48 ? 3702 HOH B O   1 
HETATM 6923 O O   . HOH H 3 .   ? 5.617  29.581 80.906  1.00 40.58 ? 3704 HOH B O   1 
HETATM 6924 O O   . HOH H 3 .   ? 33.693 32.063 92.041  1.00 39.94 ? 3710 HOH B O   1 
HETATM 6925 O O   . HOH H 3 .   ? 40.410 24.087 93.417  1.00 46.22 ? 3711 HOH B O   1 
HETATM 6926 O O   . HOH H 3 .   ? 27.704 51.872 79.948  1.00 33.54 ? 3712 HOH B O   1 
HETATM 6927 O O   . HOH H 3 .   ? 14.707 26.957 104.581 1.00 30.34 ? 3715 HOH B O   1 
HETATM 6928 O O   . HOH H 3 .   ? 23.218 17.125 84.763  1.00 37.46 ? 3716 HOH B O   1 
HETATM 6929 O O   . HOH H 3 .   ? 27.964 31.296 98.651  1.00 34.34 ? 3717 HOH B O   1 
HETATM 6930 O O   . HOH H 3 .   ? 14.212 17.376 112.847 1.00 38.72 ? 3721 HOH B O   1 
HETATM 6931 O O   . HOH H 3 .   ? 18.304 -1.224 100.624 1.00 43.12 ? 3733 HOH B O   1 
HETATM 6932 O O   . HOH H 3 .   ? 10.951 12.538 109.695 1.00 42.70 ? 3734 HOH B O   1 
HETATM 6933 O O   . HOH H 3 .   ? 27.426 52.595 86.344  1.00 38.02 ? 3735 HOH B O   1 
HETATM 6934 O O   . HOH H 3 .   ? 10.864 18.687 101.944 1.00 32.53 ? 3737 HOH B O   1 
HETATM 6935 O O   . HOH H 3 .   ? 6.685  26.510 85.280  1.00 40.60 ? 3738 HOH B O   1 
HETATM 6936 O O   . HOH H 3 .   ? 8.156  25.552 80.884  1.00 40.76 ? 3741 HOH B O   1 
HETATM 6937 O O   . HOH H 3 .   ? 23.813 37.856 70.897  1.00 39.24 ? 3742 HOH B O   1 
HETATM 6938 O O   . HOH H 3 .   ? 7.864  21.800 85.474  1.00 38.93 ? 3749 HOH B O   1 
HETATM 6939 O O   . HOH H 3 .   ? 17.310 15.780 82.338  1.00 34.67 ? 3751 HOH B O   1 
HETATM 6940 O O   . HOH H 3 .   ? 39.976 21.354 111.169 1.00 32.13 ? 3753 HOH B O   1 
HETATM 6941 O O   . HOH H 3 .   ? 19.370 54.181 88.818  1.00 39.83 ? 3756 HOH B O   1 
HETATM 6942 O O   . HOH H 3 .   ? 34.537 39.455 85.109  1.00 33.66 ? 3758 HOH B O   1 
HETATM 6943 O O   . HOH H 3 .   ? 8.392  30.932 93.421  1.00 45.06 ? 3759 HOH B O   1 
HETATM 6944 O O   . HOH H 3 .   ? 6.757  12.883 96.061  1.00 41.16 ? 3760 HOH B O   1 
HETATM 6945 O O   . HOH H 3 .   ? 32.930 47.577 78.717  1.00 40.91 ? 3770 HOH B O   1 
HETATM 6946 O O   . HOH H 3 .   ? 40.591 32.253 107.098 1.00 42.73 ? 3772 HOH B O   1 
HETATM 6947 O O   . HOH H 3 .   ? 34.682 26.991 112.180 1.00 41.70 ? 3786 HOH B O   1 
HETATM 6948 O O   . HOH H 3 .   ? 22.789 0.823  106.487 1.00 48.54 ? 3787 HOH B O   1 
HETATM 6949 O O   . HOH H 3 .   ? 11.923 16.527 88.982  1.00 39.42 ? 3790 HOH B O   1 
HETATM 6950 O O   . HOH H 3 .   ? 16.016 1.821  92.596  1.00 37.67 ? 3792 HOH B O   1 
HETATM 6951 O O   . HOH H 3 .   ? 34.586 31.550 82.903  1.00 36.08 ? 3793 HOH B O   1 
HETATM 6952 O O   . HOH H 3 .   ? 32.119 50.582 81.971  1.00 44.53 ? 3794 HOH B O   1 
HETATM 6953 O O   . HOH H 3 .   ? 38.321 30.472 96.115  1.00 41.08 ? 3800 HOH B O   1 
HETATM 6954 O O   . HOH H 3 .   ? 11.343 23.268 106.351 1.00 37.76 ? 3801 HOH B O   1 
HETATM 6955 O O   . HOH H 3 .   ? 29.363 43.683 94.811  1.00 39.53 ? 3803 HOH B O   1 
HETATM 6956 O O   . HOH H 3 .   ? 21.073 7.541  111.100 1.00 35.78 ? 3806 HOH B O   1 
HETATM 6957 O O   . HOH H 3 .   ? 26.725 7.622  115.562 1.00 50.76 ? 3807 HOH B O   1 
HETATM 6958 O O   . HOH H 3 .   ? 25.377 16.855 85.988  1.00 41.61 ? 3809 HOH B O   1 
HETATM 6959 O O   . HOH H 3 .   ? 16.912 46.751 94.545  1.00 34.02 ? 3810 HOH B O   1 
HETATM 6960 O O   . HOH H 3 .   ? 31.474 46.286 92.121  1.00 43.39 ? 3811 HOH B O   1 
HETATM 6961 O O   . HOH H 3 .   ? 1.867  40.367 73.185  1.00 51.22 ? 3812 HOH B O   1 
HETATM 6962 O O   . HOH H 3 .   ? 34.725 32.517 98.194  1.00 38.35 ? 3814 HOH B O   1 
HETATM 6963 O O   . HOH H 3 .   ? 0.991  39.665 81.807  1.00 49.65 ? 3817 HOH B O   1 
HETATM 6964 O O   . HOH H 3 .   ? 32.470 29.281 111.520 1.00 41.69 ? 3827 HOH B O   1 
HETATM 6965 O O   . HOH H 3 .   ? 22.965 46.093 95.427  1.00 40.58 ? 3828 HOH B O   1 
HETATM 6966 O O   . HOH H 3 .   ? 20.227 4.617  87.643  1.00 40.38 ? 3834 HOH B O   1 
HETATM 6967 O O   . HOH H 3 .   ? 7.953  47.335 88.417  1.00 39.00 ? 3835 HOH B O   1 
HETATM 6968 O O   . HOH H 3 .   ? 8.431  34.690 69.950  1.00 44.92 ? 3836 HOH B O   1 
HETATM 6969 O O   . HOH H 3 .   ? 6.341  26.465 89.403  1.00 47.93 ? 3839 HOH B O   1 
HETATM 6970 O O   . HOH H 3 .   ? 7.838  17.274 99.299  1.00 42.87 ? 3852 HOH B O   1 
HETATM 6971 O O   . HOH H 3 .   ? 30.825 35.773 108.906 1.00 41.02 ? 3854 HOH B O   1 
HETATM 6972 O O   . HOH H 3 .   ? 28.382 48.747 76.810  1.00 46.30 ? 3856 HOH B O   1 
HETATM 6973 O O   . HOH H 3 .   ? 19.077 -0.012 89.558  1.00 35.97 ? 3858 HOH B O   1 
HETATM 6974 O O   . HOH H 3 .   ? 8.437  54.850 82.237  1.00 47.34 ? 3859 HOH B O   1 
HETATM 6975 O O   . HOH H 3 .   ? 2.818  41.514 91.122  1.00 49.35 ? 3861 HOH B O   1 
HETATM 6976 O O   . HOH H 3 .   ? 41.794 31.706 102.380 1.00 42.78 ? 3862 HOH B O   1 
HETATM 6977 O O   . HOH H 3 .   ? 19.094 24.259 114.612 1.00 46.99 ? 3863 HOH B O   1 
HETATM 6978 O O   . HOH H 3 .   ? 16.299 9.580  106.024 1.00 47.29 ? 3867 HOH B O   1 
HETATM 6979 O O   . HOH H 3 .   ? 17.693 7.262  104.164 1.00 49.47 ? 3868 HOH B O   1 
HETATM 6980 O O   . HOH H 3 .   ? 8.558  22.841 80.393  1.00 44.38 ? 3872 HOH B O   1 
HETATM 6981 O O   . HOH H 3 .   ? 39.740 32.296 100.607 1.00 48.87 ? 3874 HOH B O   1 
HETATM 6982 O O   . HOH H 3 .   ? 7.938  36.095 91.931  1.00 42.29 ? 3881 HOH B O   1 
HETATM 6983 O O   . HOH H 3 .   ? 16.314 30.209 107.607 1.00 51.56 ? 3882 HOH B O   1 
HETATM 6984 O O   . HOH H 3 .   ? 20.875 15.356 84.588  1.00 45.21 ? 3884 HOH B O   1 
HETATM 6985 O O   . HOH H 3 .   ? 21.562 55.055 80.576  1.00 40.74 ? 3891 HOH B O   1 
HETATM 6986 O O   . HOH H 3 .   ? 20.994 52.431 94.703  1.00 39.76 ? 3892 HOH B O   1 
HETATM 6987 O O   . HOH H 3 .   ? 7.584  52.443 86.582  1.00 36.44 ? 3895 HOH B O   1 
HETATM 6988 O O   . HOH H 3 .   ? 38.823 19.636 99.602  1.00 36.10 ? 3896 HOH B O   1 
HETATM 6989 O O   . HOH I 3 .   ? 25.008 56.429 66.575  1.00 17.78 ? 3186 HOH C O   1 
HETATM 6990 O O   . HOH I 3 .   ? 21.851 49.612 76.665  1.00 17.56 ? 3189 HOH C O   1 
HETATM 6991 O O   . HOH I 3 .   ? 28.365 55.696 68.956  1.00 18.91 ? 3195 HOH C O   1 
HETATM 6992 O O   . HOH I 3 .   ? 19.836 43.459 69.590  1.00 17.44 ? 3198 HOH C O   1 
HETATM 6993 O O   . HOH I 3 .   ? 12.684 69.253 82.436  1.00 20.80 ? 3199 HOH C O   1 
HETATM 6994 O O   . HOH I 3 .   ? 25.114 50.169 73.962  1.00 22.46 ? 3201 HOH C O   1 
HETATM 6995 O O   . HOH I 3 .   ? 15.416 40.750 53.538  1.00 20.82 ? 3203 HOH C O   1 
HETATM 6996 O O   . HOH I 3 .   ? 23.742 38.288 64.030  1.00 21.67 ? 3204 HOH C O   1 
HETATM 6997 O O   . HOH I 3 .   ? 24.111 52.148 72.092  1.00 19.73 ? 3205 HOH C O   1 
HETATM 6998 O O   . HOH I 3 .   ? 3.536  76.488 61.688  1.00 21.06 ? 3213 HOH C O   1 
HETATM 6999 O O   . HOH I 3 .   ? 14.331 50.569 67.975  1.00 20.36 ? 3214 HOH C O   1 
HETATM 7000 O O   . HOH I 3 .   ? 20.731 50.839 68.834  1.00 20.50 ? 3224 HOH C O   1 
HETATM 7001 O O   . HOH I 3 .   ? 28.383 43.037 67.071  1.00 20.54 ? 3225 HOH C O   1 
HETATM 7002 O O   . HOH I 3 .   ? -4.181 72.821 68.054  1.00 22.82 ? 3226 HOH C O   1 
HETATM 7003 O O   . HOH I 3 .   ? 20.056 54.760 69.732  1.00 23.09 ? 3228 HOH C O   1 
HETATM 7004 O O   . HOH I 3 .   ? 20.338 71.454 80.420  1.00 22.94 ? 3229 HOH C O   1 
HETATM 7005 O O   . HOH I 3 .   ? 4.399  56.965 77.127  1.00 26.53 ? 3233 HOH C O   1 
HETATM 7006 O O   . HOH I 3 .   ? 2.400  52.841 72.441  1.00 23.59 ? 3238 HOH C O   1 
HETATM 7007 O O   . HOH I 3 .   ? 29.995 45.299 63.181  1.00 25.10 ? 3240 HOH C O   1 
HETATM 7008 O O   . HOH I 3 .   ? 21.315 70.223 71.884  1.00 20.26 ? 3243 HOH C O   1 
HETATM 7009 O O   . HOH I 3 .   ? 2.766  53.764 69.922  1.00 17.83 ? 3244 HOH C O   1 
HETATM 7010 O O   . HOH I 3 .   ? 18.123 72.154 78.888  1.00 21.65 ? 3246 HOH C O   1 
HETATM 7011 O O   . HOH I 3 .   ? 14.752 34.079 52.555  1.00 28.76 ? 3247 HOH C O   1 
HETATM 7012 O O   . HOH I 3 .   ? 27.929 49.637 74.428  1.00 25.82 ? 3250 HOH C O   1 
HETATM 7013 O O   . HOH I 3 .   ? 2.488  53.081 63.413  1.00 20.88 ? 3252 HOH C O   1 
HETATM 7014 O O   . HOH I 3 .   ? 22.373 79.255 74.998  1.00 22.92 ? 3253 HOH C O   1 
HETATM 7015 O O   . HOH I 3 .   ? 15.160 54.173 50.237  1.00 28.57 ? 3256 HOH C O   1 
HETATM 7016 O O   . HOH I 3 .   ? 12.724 73.686 87.502  1.00 24.36 ? 3257 HOH C O   1 
HETATM 7017 O O   . HOH I 3 .   ? 24.856 39.848 65.909  1.00 23.50 ? 3260 HOH C O   1 
HETATM 7018 O O   . HOH I 3 .   ? 8.420  49.859 74.609  1.00 22.33 ? 3261 HOH C O   1 
HETATM 7019 O O   . HOH I 3 .   ? 4.088  70.990 88.321  1.00 30.29 ? 3264 HOH C O   1 
HETATM 7020 O O   . HOH I 3 .   ? 12.455 88.742 80.857  1.00 35.90 ? 3266 HOH C O   1 
HETATM 7021 O O   . HOH I 3 .   ? 0.340  69.935 73.081  1.00 19.92 ? 3267 HOH C O   1 
HETATM 7022 O O   . HOH I 3 .   ? 12.874 62.177 57.314  1.00 25.25 ? 3269 HOH C O   1 
HETATM 7023 O O   . HOH I 3 .   ? 12.712 60.778 54.739  1.00 25.67 ? 3275 HOH C O   1 
HETATM 7024 O O   . HOH I 3 .   ? 28.722 73.254 65.833  1.00 27.79 ? 3280 HOH C O   1 
HETATM 7025 O O   . HOH I 3 .   ? -2.376 78.541 71.971  1.00 31.45 ? 3282 HOH C O   1 
HETATM 7026 O O   . HOH I 3 .   ? 11.090 92.510 76.158  1.00 28.70 ? 3286 HOH C O   1 
HETATM 7027 O O   . HOH I 3 .   ? 3.677  46.895 61.152  1.00 27.80 ? 3288 HOH C O   1 
HETATM 7028 O O   . HOH I 3 .   ? 14.583 53.083 52.555  1.00 24.39 ? 3290 HOH C O   1 
HETATM 7029 O O   . HOH I 3 .   ? 30.179 56.110 61.864  1.00 25.84 ? 3295 HOH C O   1 
HETATM 7030 O O   . HOH I 3 .   ? 17.899 60.854 55.737  1.00 29.37 ? 3298 HOH C O   1 
HETATM 7031 O O   . HOH I 3 .   ? 27.508 51.911 51.342  1.00 32.62 ? 3301 HOH C O   1 
HETATM 7032 O O   . HOH I 3 .   ? 3.446  54.408 76.817  1.00 26.80 ? 3303 HOH C O   1 
HETATM 7033 O O   . HOH I 3 .   ? 14.631 87.339 80.196  1.00 23.12 ? 3305 HOH C O   1 
HETATM 7034 O O   . HOH I 3 .   ? 24.773 79.317 76.616  1.00 24.26 ? 3311 HOH C O   1 
HETATM 7035 O O   . HOH I 3 .   ? 3.867  62.537 78.170  1.00 26.89 ? 3315 HOH C O   1 
HETATM 7036 O O   . HOH I 3 .   ? 20.468 63.064 58.627  1.00 28.57 ? 3316 HOH C O   1 
HETATM 7037 O O   . HOH I 3 .   ? 30.260 43.350 57.493  1.00 28.30 ? 3317 HOH C O   1 
HETATM 7038 O O   . HOH I 3 .   ? 8.857  71.295 60.062  1.00 29.71 ? 3319 HOH C O   1 
HETATM 7039 O O   . HOH I 3 .   ? 18.758 55.124 48.644  1.00 28.17 ? 3321 HOH C O   1 
HETATM 7040 O O   . HOH I 3 .   ? 30.690 45.953 53.818  1.00 28.70 ? 3322 HOH C O   1 
HETATM 7041 O O   . HOH I 3 .   ? 10.941 47.475 54.773  1.00 20.59 ? 3323 HOH C O   1 
HETATM 7042 O O   . HOH I 3 .   ? 16.598 74.695 87.343  1.00 23.51 ? 3324 HOH C O   1 
HETATM 7043 O O   . HOH I 3 .   ? 23.292 74.374 86.431  1.00 33.52 ? 3327 HOH C O   1 
HETATM 7044 O O   . HOH I 3 .   ? 16.650 55.505 70.520  1.00 29.10 ? 3329 HOH C O   1 
HETATM 7045 O O   . HOH I 3 .   ? 30.882 51.541 73.150  1.00 27.15 ? 3331 HOH C O   1 
HETATM 7046 O O   . HOH I 3 .   ? 1.648  69.285 66.348  1.00 24.97 ? 3332 HOH C O   1 
HETATM 7047 O O   . HOH I 3 .   ? 15.021 79.402 88.741  1.00 38.41 ? 3333 HOH C O   1 
HETATM 7048 O O   . HOH I 3 .   ? 18.169 41.522 69.825  1.00 37.19 ? 3337 HOH C O   1 
HETATM 7049 O O   . HOH I 3 .   ? 19.630 83.593 82.504  1.00 29.08 ? 3340 HOH C O   1 
HETATM 7050 O O   . HOH I 3 .   ? 11.140 67.675 88.263  1.00 35.68 ? 3350 HOH C O   1 
HETATM 7051 O O   . HOH I 3 .   ? 5.622  59.961 58.616  1.00 27.44 ? 3351 HOH C O   1 
HETATM 7052 O O   . HOH I 3 .   ? 4.108  38.310 61.441  1.00 34.20 ? 3353 HOH C O   1 
HETATM 7053 O O   . HOH I 3 .   ? 18.605 54.128 72.922  1.00 37.03 ? 3354 HOH C O   1 
HETATM 7054 O O   . HOH I 3 .   ? 28.073 71.449 67.873  1.00 26.57 ? 3356 HOH C O   1 
HETATM 7055 O O   . HOH I 3 .   ? 27.831 72.786 57.479  1.00 35.42 ? 3357 HOH C O   1 
HETATM 7056 O O   . HOH I 3 .   ? 0.999  63.535 73.609  1.00 31.30 ? 3359 HOH C O   1 
HETATM 7057 O O   . HOH I 3 .   ? 24.994 39.702 54.585  1.00 32.73 ? 3360 HOH C O   1 
HETATM 7058 O O   . HOH I 3 .   ? 31.231 51.830 65.335  1.00 25.69 ? 3365 HOH C O   1 
HETATM 7059 O O   . HOH I 3 .   ? 6.805  48.885 49.388  1.00 34.39 ? 3366 HOH C O   1 
HETATM 7060 O O   . HOH I 3 .   ? 21.263 79.346 84.075  1.00 33.04 ? 3369 HOH C O   1 
HETATM 7061 O O   . HOH I 3 .   ? 7.634  90.506 75.907  1.00 30.69 ? 3370 HOH C O   1 
HETATM 7062 O O   . HOH I 3 .   ? -0.609 67.683 66.853  1.00 29.12 ? 3372 HOH C O   1 
HETATM 7063 O O   . HOH I 3 .   ? 31.084 43.587 66.409  1.00 29.83 ? 3378 HOH C O   1 
HETATM 7064 O O   . HOH I 3 .   ? -0.263 71.836 62.888  1.00 26.53 ? 3381 HOH C O   1 
HETATM 7065 O O   . HOH I 3 .   ? 34.171 76.957 69.891  1.00 33.03 ? 3383 HOH C O   1 
HETATM 7066 O O   . HOH I 3 .   ? 22.743 66.185 59.427  1.00 33.94 ? 3384 HOH C O   1 
HETATM 7067 O O   . HOH I 3 .   ? 8.195  66.894 58.503  1.00 28.45 ? 3385 HOH C O   1 
HETATM 7068 O O   . HOH I 3 .   ? 0.323  59.532 71.279  1.00 31.64 ? 3386 HOH C O   1 
HETATM 7069 O O   . HOH I 3 .   ? 14.512 80.336 61.151  1.00 32.09 ? 3387 HOH C O   1 
HETATM 7070 O O   . HOH I 3 .   ? 11.222 87.013 82.705  1.00 40.35 ? 3396 HOH C O   1 
HETATM 7071 O O   . HOH I 3 .   ? 25.976 68.501 67.545  1.00 30.71 ? 3401 HOH C O   1 
HETATM 7072 O O   . HOH I 3 .   ? 26.402 67.670 81.733  1.00 40.28 ? 3402 HOH C O   1 
HETATM 7073 O O   . HOH I 3 .   ? 24.878 48.009 46.240  1.00 40.29 ? 3404 HOH C O   1 
HETATM 7074 O O   . HOH I 3 .   ? 20.723 40.409 68.689  1.00 31.70 ? 3405 HOH C O   1 
HETATM 7075 O O   . HOH I 3 .   ? 4.915  52.576 78.347  1.00 26.89 ? 3413 HOH C O   1 
HETATM 7076 O O   . HOH I 3 .   ? 27.044 86.664 74.957  1.00 29.29 ? 3416 HOH C O   1 
HETATM 7077 O O   . HOH I 3 .   ? 31.031 54.315 63.495  1.00 31.21 ? 3417 HOH C O   1 
HETATM 7078 O O   . HOH I 3 .   ? 5.937  37.967 67.072  1.00 37.53 ? 3419 HOH C O   1 
HETATM 7079 O O   . HOH I 3 .   ? 15.495 40.843 50.176  1.00 26.48 ? 3420 HOH C O   1 
HETATM 7080 O O   . HOH I 3 .   ? 10.868 57.689 76.754  1.00 30.46 ? 3423 HOH C O   1 
HETATM 7081 O O   . HOH I 3 .   ? 7.114  78.448 88.983  1.00 31.20 ? 3425 HOH C O   1 
HETATM 7082 O O   . HOH I 3 .   ? 14.661 90.555 70.035  1.00 51.24 ? 3428 HOH C O   1 
HETATM 7083 O O   . HOH I 3 .   ? 3.609  68.106 86.267  1.00 32.72 ? 3429 HOH C O   1 
HETATM 7084 O O   . HOH I 3 .   ? 24.592 69.433 56.956  1.00 27.23 ? 3431 HOH C O   1 
HETATM 7085 O O   . HOH I 3 .   ? 21.629 63.249 71.797  1.00 36.97 ? 3433 HOH C O   1 
HETATM 7086 O O   . HOH I 3 .   ? 13.007 70.725 55.933  1.00 30.96 ? 3436 HOH C O   1 
HETATM 7087 O O   . HOH I 3 .   ? 28.864 73.253 60.006  1.00 34.88 ? 3438 HOH C O   1 
HETATM 7088 O O   . HOH I 3 .   ? 18.045 64.576 80.487  1.00 28.10 ? 3445 HOH C O   1 
HETATM 7089 O O   . HOH I 3 .   ? 10.603 36.431 49.536  1.00 37.69 ? 3450 HOH C O   1 
HETATM 7090 O O   . HOH I 3 .   ? 32.192 51.145 68.896  1.00 30.55 ? 3451 HOH C O   1 
HETATM 7091 O O   . HOH I 3 .   ? 25.705 86.766 83.751  1.00 32.39 ? 3452 HOH C O   1 
HETATM 7092 O O   . HOH I 3 .   ? 24.180 78.925 57.163  1.00 31.23 ? 3453 HOH C O   1 
HETATM 7093 O O   . HOH I 3 .   ? 2.264  60.567 76.308  1.00 31.31 ? 3455 HOH C O   1 
HETATM 7094 O O   . HOH I 3 .   ? 1.593  65.109 60.367  1.00 32.29 ? 3457 HOH C O   1 
HETATM 7095 O O   . HOH I 3 .   ? 34.309 48.043 63.617  1.00 38.54 ? 3458 HOH C O   1 
HETATM 7096 O O   . HOH I 3 .   ? 16.675 56.923 73.097  1.00 37.33 ? 3460 HOH C O   1 
HETATM 7097 O O   . HOH I 3 .   ? 12.632 64.587 76.634  1.00 33.30 ? 3463 HOH C O   1 
HETATM 7098 O O   . HOH I 3 .   ? 16.288 40.378 62.427  1.00 28.57 ? 3466 HOH C O   1 
HETATM 7099 O O   . HOH I 3 .   ? 28.790 57.601 55.116  1.00 28.59 ? 3467 HOH C O   1 
HETATM 7100 O O   . HOH I 3 .   ? 16.337 83.547 62.422  1.00 35.94 ? 3472 HOH C O   1 
HETATM 7101 O O   . HOH I 3 .   ? 2.957  86.479 72.891  1.00 33.76 ? 3473 HOH C O   1 
HETATM 7102 O O   . HOH I 3 .   ? 5.809  43.284 72.498  1.00 31.38 ? 3479 HOH C O   1 
HETATM 7103 O O   . HOH I 3 .   ? 9.897  35.363 52.571  1.00 46.34 ? 3480 HOH C O   1 
HETATM 7104 O O   . HOH I 3 .   ? 24.799 62.046 70.429  1.00 33.67 ? 3481 HOH C O   1 
HETATM 7105 O O   . HOH I 3 .   ? 5.246  43.357 56.768  1.00 29.67 ? 3485 HOH C O   1 
HETATM 7106 O O   . HOH I 3 .   ? 15.326 64.458 53.872  1.00 38.81 ? 3487 HOH C O   1 
HETATM 7107 O O   . HOH I 3 .   ? -0.523 80.137 87.500  1.00 31.37 ? 3489 HOH C O   1 
HETATM 7108 O O   . HOH I 3 .   ? 2.185  85.282 82.744  1.00 41.16 ? 3490 HOH C O   1 
HETATM 7109 O O   . HOH I 3 .   ? 23.682 83.491 61.922  1.00 34.55 ? 3491 HOH C O   1 
HETATM 7110 O O   . HOH I 3 .   ? 21.399 81.953 87.429  1.00 47.71 ? 3492 HOH C O   1 
HETATM 7111 O O   . HOH I 3 .   ? 18.791 54.972 45.409  1.00 36.72 ? 3493 HOH C O   1 
HETATM 7112 O O   . HOH I 3 .   ? 13.772 68.567 54.303  1.00 38.78 ? 3494 HOH C O   1 
HETATM 7113 O O   . HOH I 3 .   ? 32.588 77.020 75.577  1.00 48.77 ? 3496 HOH C O   1 
HETATM 7114 O O   . HOH I 3 .   ? 25.140 44.977 46.960  1.00 31.40 ? 3507 HOH C O   1 
HETATM 7115 O O   . HOH I 3 .   ? 12.764 55.634 49.471  1.00 34.08 ? 3509 HOH C O   1 
HETATM 7116 O O   . HOH I 3 .   ? 9.784  57.685 53.898  1.00 34.92 ? 3510 HOH C O   1 
HETATM 7117 O O   . HOH I 3 .   ? 26.188 86.466 68.662  1.00 32.10 ? 3511 HOH C O   1 
HETATM 7118 O O   . HOH I 3 .   ? 1.070  68.937 83.041  1.00 33.32 ? 3514 HOH C O   1 
HETATM 7119 O O   . HOH I 3 .   ? 7.890  52.560 55.737  1.00 30.45 ? 3525 HOH C O   1 
HETATM 7120 O O   . HOH I 3 .   ? 18.179 94.767 78.119  1.00 35.66 ? 3529 HOH C O   1 
HETATM 7121 O O   . HOH I 3 .   ? 6.608  41.969 68.478  1.00 33.55 ? 3530 HOH C O   1 
HETATM 7122 O O   . HOH I 3 .   ? 30.403 77.874 60.440  1.00 45.17 ? 3531 HOH C O   1 
HETATM 7123 O O   . HOH I 3 .   ? 4.452  83.051 84.177  1.00 29.26 ? 3542 HOH C O   1 
HETATM 7124 O O   . HOH I 3 .   ? 6.762  54.642 52.103  1.00 40.17 ? 3543 HOH C O   1 
HETATM 7125 O O   . HOH I 3 .   ? 1.710  69.552 59.189  1.00 41.53 ? 3555 HOH C O   1 
HETATM 7126 O O   . HOH I 3 .   ? -7.465 77.440 80.252  1.00 38.56 ? 3556 HOH C O   1 
HETATM 7127 O O   . HOH I 3 .   ? 21.391 79.261 86.471  1.00 42.59 ? 3562 HOH C O   1 
HETATM 7128 O O   . HOH I 3 .   ? 29.796 87.011 82.545  1.00 43.09 ? 3563 HOH C O   1 
HETATM 7129 O O   . HOH I 3 .   ? 12.542 75.774 90.063  1.00 37.76 ? 3564 HOH C O   1 
HETATM 7130 O O   . HOH I 3 .   ? 22.845 81.509 59.814  1.00 43.23 ? 3570 HOH C O   1 
HETATM 7131 O O   . HOH I 3 .   ? -5.685 79.726 80.294  1.00 37.77 ? 3573 HOH C O   1 
HETATM 7132 O O   . HOH I 3 .   ? 28.418 43.784 69.829  1.00 42.31 ? 3583 HOH C O   1 
HETATM 7133 O O   . HOH I 3 .   ? 4.498  39.869 58.469  1.00 33.97 ? 3585 HOH C O   1 
HETATM 7134 O O   . HOH I 3 .   ? 7.563  44.709 49.595  1.00 31.77 ? 3587 HOH C O   1 
HETATM 7135 O O   . HOH I 3 .   ? 17.074 90.707 81.793  1.00 54.28 ? 3596 HOH C O   1 
HETATM 7136 O O   . HOH I 3 .   ? 1.819  73.389 60.326  1.00 36.64 ? 3597 HOH C O   1 
HETATM 7137 O O   . HOH I 3 .   ? 12.447 62.032 75.183  1.00 33.17 ? 3599 HOH C O   1 
HETATM 7138 O O   . HOH I 3 .   ? 27.108 64.254 60.452  1.00 50.97 ? 3602 HOH C O   1 
HETATM 7139 O O   . HOH I 3 .   ? 22.650 63.606 75.460  1.00 34.38 ? 3603 HOH C O   1 
HETATM 7140 O O   . HOH I 3 .   ? 13.755 78.980 57.579  1.00 41.29 ? 3604 HOH C O   1 
HETATM 7141 O O   . HOH I 3 .   ? 15.054 41.227 46.227  1.00 34.68 ? 3605 HOH C O   1 
HETATM 7142 O O   . HOH I 3 .   ? 27.518 63.737 67.415  1.00 43.19 ? 3606 HOH C O   1 
HETATM 7143 O O   . HOH I 3 .   ? 23.683 58.191 51.046  1.00 41.27 ? 3608 HOH C O   1 
HETATM 7144 O O   . HOH I 3 .   ? 28.585 41.430 50.703  1.00 47.19 ? 3609 HOH C O   1 
HETATM 7145 O O   . HOH I 3 .   ? -4.180 74.494 62.916  1.00 48.46 ? 3612 HOH C O   1 
HETATM 7146 O O   . HOH I 3 .   ? 31.758 60.790 65.258  1.00 49.20 ? 3614 HOH C O   1 
HETATM 7147 O O   . HOH I 3 .   ? 7.459  92.075 78.676  1.00 41.41 ? 3617 HOH C O   1 
HETATM 7148 O O   . HOH I 3 .   ? 8.902  73.356 55.447  1.00 46.31 ? 3618 HOH C O   1 
HETATM 7149 O O   . HOH I 3 .   ? 34.915 48.971 59.769  1.00 35.61 ? 3626 HOH C O   1 
HETATM 7150 O O   . HOH I 3 .   ? 20.233 61.415 77.388  1.00 42.69 ? 3627 HOH C O   1 
HETATM 7151 O O   . HOH I 3 .   ? 21.058 81.251 82.263  1.00 33.09 ? 3631 HOH C O   1 
HETATM 7152 O O   . HOH I 3 .   ? 30.721 81.285 59.193  1.00 45.24 ? 3632 HOH C O   1 
HETATM 7153 O O   . HOH I 3 .   ? 12.045 80.060 58.917  1.00 43.06 ? 3633 HOH C O   1 
HETATM 7154 O O   . HOH I 3 .   ? 31.311 53.841 71.526  1.00 40.25 ? 3634 HOH C O   1 
HETATM 7155 O O   . HOH I 3 .   ? 29.451 87.224 74.048  1.00 38.55 ? 3637 HOH C O   1 
HETATM 7156 O O   . HOH I 3 .   ? 6.039  56.651 79.269  1.00 23.71 ? 3642 HOH C O   1 
HETATM 7157 O O   . HOH I 3 .   ? 2.863  51.869 68.108  1.00 26.05 ? 3645 HOH C O   1 
HETATM 7158 O O   . HOH I 3 .   ? 25.119 76.829 75.839  1.00 22.78 ? 3646 HOH C O   1 
HETATM 7159 O O   . HOH I 3 .   ? 27.690 40.553 66.667  1.00 28.43 ? 3647 HOH C O   1 
HETATM 7160 O O   . HOH I 3 .   ? 24.399 50.432 76.671  1.00 21.28 ? 3649 HOH C O   1 
HETATM 7161 O O   . HOH I 3 .   ? -0.250 70.906 65.439  1.00 25.02 ? 3652 HOH C O   1 
HETATM 7162 O O   . HOH I 3 .   ? 16.640 96.262 79.429  1.00 30.44 ? 3654 HOH C O   1 
HETATM 7163 O O   . HOH I 3 .   ? 17.095 55.992 50.602  1.00 29.64 ? 3662 HOH C O   1 
HETATM 7164 O O   . HOH I 3 .   ? 27.794 67.747 69.822  1.00 32.03 ? 3670 HOH C O   1 
HETATM 7165 O O   . HOH I 3 .   ? 22.529 54.460 72.667  1.00 28.56 ? 3671 HOH C O   1 
HETATM 7166 O O   . HOH I 3 .   ? 28.441 56.653 52.502  1.00 31.68 ? 3672 HOH C O   1 
HETATM 7167 O O   . HOH I 3 .   ? 23.213 40.505 69.595  1.00 34.93 ? 3673 HOH C O   1 
HETATM 7168 O O   . HOH I 3 .   ? 20.338 95.509 78.797  1.00 42.57 ? 3677 HOH C O   1 
HETATM 7169 O O   . HOH I 3 .   ? 6.125  54.149 80.349  1.00 37.66 ? 3682 HOH C O   1 
HETATM 7170 O O   . HOH I 3 .   ? 32.401 44.595 63.832  1.00 34.16 ? 3688 HOH C O   1 
HETATM 7171 O O   . HOH I 3 .   ? 33.491 75.779 71.973  1.00 38.73 ? 3692 HOH C O   1 
HETATM 7172 O O   . HOH I 3 .   ? 10.038 68.927 58.531  1.00 32.55 ? 3693 HOH C O   1 
HETATM 7173 O O   . HOH I 3 .   ? 12.572 70.795 58.604  1.00 39.01 ? 3697 HOH C O   1 
HETATM 7174 O O   . HOH I 3 .   ? 27.681 71.583 63.920  1.00 39.21 ? 3699 HOH C O   1 
HETATM 7175 O O   . HOH I 3 .   ? -0.027 68.055 75.145  1.00 36.73 ? 3706 HOH C O   1 
HETATM 7176 O O   . HOH I 3 .   ? 32.205 43.809 55.655  1.00 34.27 ? 3707 HOH C O   1 
HETATM 7177 O O   . HOH I 3 .   ? 31.058 76.262 73.546  1.00 39.67 ? 3709 HOH C O   1 
HETATM 7178 O O   . HOH I 3 .   ? 31.624 78.617 62.451  1.00 33.77 ? 3714 HOH C O   1 
HETATM 7179 O O   . HOH I 3 .   ? 28.304 88.634 84.278  1.00 46.08 ? 3719 HOH C O   1 
HETATM 7180 O O   . HOH I 3 .   ? 31.471 57.756 55.745  1.00 40.57 ? 3723 HOH C O   1 
HETATM 7181 O O   . HOH I 3 .   ? 30.890 56.481 68.219  1.00 34.92 ? 3724 HOH C O   1 
HETATM 7182 O O   . HOH I 3 .   ? 17.675 56.804 75.241  1.00 49.95 ? 3725 HOH C O   1 
HETATM 7183 O O   . HOH I 3 .   ? 15.271 43.345 47.293  1.00 36.31 ? 3727 HOH C O   1 
HETATM 7184 O O   . HOH I 3 .   ? 24.911 64.053 72.411  1.00 36.45 ? 3731 HOH C O   1 
HETATM 7185 O O   . HOH I 3 .   ? -2.082 70.974 73.414  1.00 27.51 ? 3732 HOH C O   1 
HETATM 7186 O O   . HOH I 3 .   ? 2.627  66.957 58.573  1.00 32.68 ? 3736 HOH C O   1 
HETATM 7187 O O   . HOH I 3 .   ? 6.130  71.002 59.032  1.00 42.98 ? 3739 HOH C O   1 
HETATM 7188 O O   . HOH I 3 .   ? 31.625 72.786 65.727  1.00 37.62 ? 3740 HOH C O   1 
HETATM 7189 O O   . HOH I 3 .   ? 22.426 69.056 60.522  1.00 39.25 ? 3743 HOH C O   1 
HETATM 7190 O O   . HOH I 3 .   ? 7.527  39.479 69.076  1.00 39.15 ? 3744 HOH C O   1 
HETATM 7191 O O   . HOH I 3 .   ? 1.202  87.586 78.084  1.00 39.89 ? 3745 HOH C O   1 
HETATM 7192 O O   . HOH I 3 .   ? 29.308 71.259 61.625  1.00 36.58 ? 3746 HOH C O   1 
HETATM 7193 O O   . HOH I 3 .   ? 26.693 50.808 46.157  1.00 52.34 ? 3747 HOH C O   1 
HETATM 7194 O O   . HOH I 3 .   ? 15.396 71.517 89.341  1.00 35.25 ? 3755 HOH C O   1 
HETATM 7195 O O   . HOH I 3 .   ? 20.452 61.316 51.587  1.00 43.62 ? 3757 HOH C O   1 
HETATM 7196 O O   . HOH I 3 .   ? 15.479 61.939 54.450  1.00 38.45 ? 3761 HOH C O   1 
HETATM 7197 O O   . HOH I 3 .   ? 5.570  68.303 58.772  1.00 41.72 ? 3763 HOH C O   1 
HETATM 7198 O O   . HOH I 3 .   ? 28.628 77.448 71.149  1.00 30.12 ? 3764 HOH C O   1 
HETATM 7199 O O   . HOH I 3 .   ? 3.969  36.811 64.705  1.00 42.08 ? 3765 HOH C O   1 
HETATM 7200 O O   . HOH I 3 .   ? 26.933 69.069 71.759  1.00 25.79 ? 3766 HOH C O   1 
HETATM 7201 O O   . HOH I 3 .   ? 29.384 69.654 72.983  1.00 37.49 ? 3768 HOH C O   1 
HETATM 7202 O O   . HOH I 3 .   ? 4.008  63.685 82.353  1.00 39.33 ? 3769 HOH C O   1 
HETATM 7203 O O   . HOH I 3 .   ? 4.783  38.949 46.728  1.00 45.38 ? 3771 HOH C O   1 
HETATM 7204 O O   . HOH I 3 .   ? 7.498  65.775 55.948  1.00 49.95 ? 3773 HOH C O   1 
HETATM 7205 O O   . HOH I 3 .   ? 14.711 73.906 88.974  1.00 42.91 ? 3774 HOH C O   1 
HETATM 7206 O O   . HOH I 3 .   ? -2.304 72.949 78.275  1.00 33.95 ? 3775 HOH C O   1 
HETATM 7207 O O   . HOH I 3 .   ? 0.695  60.846 73.848  1.00 45.09 ? 3776 HOH C O   1 
HETATM 7208 O O   . HOH I 3 .   ? 6.801  73.711 89.510  1.00 40.69 ? 3777 HOH C O   1 
HETATM 7209 O O   . HOH I 3 .   ? 28.662 56.456 72.672  1.00 37.37 ? 3780 HOH C O   1 
HETATM 7210 O O   . HOH I 3 .   ? 0.383  55.222 63.630  1.00 49.67 ? 3782 HOH C O   1 
HETATM 7211 O O   . HOH I 3 .   ? 28.335 50.804 49.075  1.00 42.10 ? 3785 HOH C O   1 
HETATM 7212 O O   . HOH I 3 .   ? 0.144  54.175 73.798  1.00 46.93 ? 3788 HOH C O   1 
HETATM 7213 O O   . HOH I 3 .   ? 11.047 92.414 79.328  1.00 49.06 ? 3795 HOH C O   1 
HETATM 7214 O O   . HOH I 3 .   ? 21.888 86.410 66.001  1.00 46.99 ? 3815 HOH C O   1 
HETATM 7215 O O   . HOH I 3 .   ? 33.162 72.832 72.320  1.00 43.20 ? 3818 HOH C O   1 
HETATM 7216 O O   . HOH I 3 .   ? 13.115 89.411 85.734  1.00 49.86 ? 3822 HOH C O   1 
HETATM 7217 O O   . HOH I 3 .   ? 20.802 68.426 62.746  1.00 33.76 ? 3823 HOH C O   1 
HETATM 7218 O O   . HOH I 3 .   ? 4.318  45.922 63.344  1.00 38.98 ? 3826 HOH C O   1 
HETATM 7219 O O   . HOH I 3 .   ? 17.739 65.253 52.405  1.00 49.58 ? 3829 HOH C O   1 
HETATM 7220 O O   . HOH I 3 .   ? 31.593 72.310 78.890  1.00 51.02 ? 3830 HOH C O   1 
HETATM 7221 O O   . HOH I 3 .   ? 31.740 42.412 59.655  1.00 52.76 ? 3831 HOH C O   1 
HETATM 7222 O O   . HOH I 3 .   ? 5.911  54.543 55.076  1.00 51.62 ? 3832 HOH C O   1 
HETATM 7223 O O   . HOH I 3 .   ? 27.702 84.510 62.727  1.00 34.45 ? 3833 HOH C O   1 
HETATM 7224 O O   . HOH I 3 .   ? 18.252 62.407 82.017  1.00 36.07 ? 3837 HOH C O   1 
HETATM 7225 O O   . HOH I 3 .   ? 22.268 60.648 57.384  1.00 38.84 ? 3840 HOH C O   1 
HETATM 7226 O O   . HOH I 3 .   ? 17.437 85.792 70.193  1.00 36.85 ? 3841 HOH C O   1 
HETATM 7227 O O   . HOH I 3 .   ? 24.147 65.740 77.902  1.00 29.29 ? 3842 HOH C O   1 
HETATM 7228 O O   . HOH I 3 .   ? 23.031 56.282 74.288  1.00 36.26 ? 3844 HOH C O   1 
HETATM 7229 O O   . HOH I 3 .   ? 2.801  49.356 68.865  1.00 43.10 ? 3845 HOH C O   1 
HETATM 7230 O O   . HOH I 3 .   ? -1.093 66.190 61.274  1.00 43.44 ? 3848 HOH C O   1 
HETATM 7231 O O   . HOH I 3 .   ? 19.063 85.355 84.417  1.00 47.16 ? 3849 HOH C O   1 
HETATM 7232 O O   . HOH I 3 .   ? 32.926 49.767 75.055  1.00 50.64 ? 3850 HOH C O   1 
HETATM 7233 O O   . HOH I 3 .   ? 2.800  45.572 58.838  1.00 41.34 ? 3851 HOH C O   1 
HETATM 7234 O O   . HOH I 3 .   ? 20.186 90.409 80.189  1.00 43.96 ? 3853 HOH C O   1 
HETATM 7235 O O   . HOH I 3 .   ? 12.555 59.964 76.702  1.00 41.74 ? 3855 HOH C O   1 
HETATM 7236 O O   . HOH I 3 .   ? 31.612 45.393 51.628  1.00 48.87 ? 3865 HOH C O   1 
HETATM 7237 O O   . HOH I 3 .   ? 29.721 49.954 53.405  1.00 44.71 ? 3866 HOH C O   1 
HETATM 7238 O O   . HOH I 3 .   ? 13.492 65.438 87.385  1.00 52.62 ? 3871 HOH C O   1 
HETATM 7239 O O   . HOH I 3 .   ? 2.926  62.471 80.604  1.00 39.93 ? 3876 HOH C O   1 
HETATM 7240 O O   . HOH I 3 .   ? 30.777 77.452 80.925  1.00 43.90 ? 3880 HOH C O   1 
HETATM 7241 O O   . HOH I 3 .   ? 13.045 63.907 52.133  1.00 48.27 ? 3888 HOH C O   1 
HETATM 7242 O O   . HOH I 3 .   ? 11.332 70.809 89.936  1.00 46.29 ? 3889 HOH C O   1 
HETATM 7243 O O   . HOH I 3 .   ? 27.472 68.733 65.042  1.00 35.26 ? 3890 HOH C O   1 
HETATM 7244 O O   . HOH I 3 .   ? -1.401 69.195 77.102  1.00 50.66 ? 3894 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   2   SER SER A . n 
A 1 2   LYS 2   3   3   LYS LYS A . n 
A 1 3   LYS 3   4   4   LYS LYS A . n 
A 1 4   LEU 4   5   5   LEU LEU A . n 
A 1 5   LEU 5   6   6   LEU LEU A . n 
A 1 6   PHE 6   7   7   PHE PHE A . n 
A 1 7   GLN 7   8   8   GLN GLN A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   ASP 9   10  10  ASP ASP A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  ASP 11  12  12  ASP ASP A . n 
A 1 12  ALA 12  13  13  ALA ALA A . n 
A 1 13  THR 13  14  14  THR THR A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  SER 15  16  16  SER SER A . n 
A 1 16  VAL 16  17  17  VAL VAL A . n 
A 1 17  PHE 17  18  18  PHE PHE A . n 
A 1 18  ASP 18  19  19  ASP ASP A . n 
A 1 19  VAL 19  20  20  VAL VAL A . n 
A 1 20  VAL 20  21  21  VAL VAL A . n 
A 1 21  VAL 21  22  22  VAL VAL A . n 
A 1 22  GLY 22  23  23  GLY GLY A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  ASP 24  25  25  ASP ASP A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  ALA 27  28  28  ALA ALA A . n 
A 1 28  ASP 28  29  29  ASP ASP A . n 
A 1 29  HIS 29  30  30  HIS HIS A . n 
A 1 30  ILE 30  31  31  ILE ILE A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  GLY 32  33  33  GLY GLY A . n 
A 1 33  TYR 33  34  34  TYR TYR A . n 
A 1 34  GLY 34  35  35  GLY GLY A . n 
A 1 35  ASN 35  36  36  ASN ASN A . n 
A 1 36  VAL 36  37  37  VAL VAL A . n 
A 1 37  THR 37  38  38  THR THR A . n 
A 1 38  PRO 38  39  39  PRO PRO A . n 
A 1 39  ASP 39  40  40  ASP ASP A . n 
A 1 40  ASN 40  41  41  ASN ASN A . n 
A 1 41  VAL 41  42  42  VAL VAL A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  ALA 43  44  44  ALA ALA A . n 
A 1 44  TYR 44  45  45  TYR TYR A . n 
A 1 45  VAL 45  46  46  VAL VAL A . n 
A 1 46  ASP 46  47  47  ASP ASP A . n 
A 1 47  GLY 47  48  48  GLY GLY A . n 
A 1 48  THR 48  49  49  THR THR A . n 
A 1 49  ILE 49  50  50  ILE ILE A . n 
A 1 50  TYR 50  51  51  TYR TYR A . n 
A 1 51  THR 51  52  52  THR THR A . n 
A 1 52  ARG 52  53  53  ARG ARG A . n 
A 1 53  GLY 53  54  54  GLY GLY A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  LYS 55  56  56  LYS LYS A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  LYS 57  58  58  LYS LYS A . n 
A 1 58  GLN 58  59  59  GLN GLN A . n 
A 1 59  SER 59  60  60  SER SER A . n 
A 1 60  THR 60  61  61  THR THR A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  PHE 63  64  64  PHE PHE A . n 
A 1 64  VAL 64  65  65  VAL VAL A . n 
A 1 65  GLY 65  66  66  GLY GLY A . n 
A 1 66  GLY 66  67  67  GLY GLY A . n 
A 1 67  GLY 67  68  68  GLY GLY A . n 
A 1 68  ASP 68  69  69  ASP ASP A . n 
A 1 69  MET 69  70  70  MET MET A . n 
A 1 70  ALA 70  71  71  ALA ALA A . n 
A 1 71  ALA 71  72  72  ALA ALA A . n 
A 1 72  GLY 72  73  73  GLY GLY A . n 
A 1 73  GLU 73  74  74  GLU GLU A . n 
A 1 74  ARG 74  75  75  ARG ARG A . n 
A 1 75  VAL 75  76  76  VAL VAL A . n 
A 1 76  PHE 76  77  77  PHE PHE A . n 
A 1 77  GLU 77  78  78  GLU GLU A . n 
A 1 78  ALA 78  79  79  ALA ALA A . n 
A 1 79  VAL 79  80  80  VAL VAL A . n 
A 1 80  LYS 80  81  81  LYS LYS A . n 
A 1 81  LYS 81  82  82  LYS LYS A . n 
A 1 82  ARG 82  83  83  ARG ARG A . n 
A 1 83  PHE 83  84  84  PHE PHE A . n 
A 1 84  PHE 84  85  85  PHE PHE A . n 
A 1 85  GLY 85  86  86  GLY GLY A . n 
A 1 86  PRO 86  87  87  PRO PRO A . n 
A 1 87  PHE 87  88  88  PHE PHE A . n 
A 1 88  ARG 88  89  89  ARG ARG A . n 
A 1 89  VAL 89  90  90  VAL VAL A . n 
A 1 90  SER 90  91  91  SER SER A . n 
A 1 91  CYS 91  92  92  CYS CYS A . n 
A 1 92  MET 92  93  93  MET MET A . n 
A 1 93  LEU 93  94  94  LEU LEU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  SER 95  96  96  SER SER A . n 
A 1 96  ASN 96  97  97  ASN ASN A . n 
A 1 97  GLY 97  98  98  GLY GLY A . n 
A 1 98  SER 98  99  99  SER SER A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 THR 100 101 101 THR THR A . n 
A 1 101 THR 101 102 102 THR THR A . n 
A 1 102 ALA 102 103 103 ALA ALA A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 ALA 104 105 105 ALA ALA A . n 
A 1 105 GLY 105 106 106 GLY GLY A . n 
A 1 106 VAL 106 107 107 VAL VAL A . n 
A 1 107 ALA 107 108 108 ALA ALA A . n 
A 1 108 LEU 108 109 109 LEU LEU A . n 
A 1 109 VAL 109 110 110 VAL VAL A . n 
A 1 110 VAL 110 111 111 VAL VAL A . n 
A 1 111 LYS 111 112 112 LYS LYS A . n 
A 1 112 ALA 112 113 113 ALA ALA A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 GLY 114 115 115 GLY GLY A . n 
A 1 115 GLY 115 116 116 GLY GLY A . n 
A 1 116 SER 116 117 117 SER SER A . n 
A 1 117 VAL 117 118 118 VAL VAL A . n 
A 1 118 LYS 118 119 119 LYS LYS A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 LYS 120 121 121 LYS LYS A . n 
A 1 121 LYS 121 122 122 LYS LYS A . n 
A 1 122 ALA 122 123 123 ALA ALA A . n 
A 1 123 VAL 123 124 124 VAL VAL A . n 
A 1 124 VAL 124 125 125 VAL VAL A . n 
A 1 125 LEU 125 126 126 LEU LEU A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 GLY 127 128 128 GLY GLY A . n 
A 1 128 THR 128 129 129 THR THR A . n 
A 1 129 GLY 129 130 130 GLY GLY A . n 
A 1 130 PRO 130 131 131 PRO PRO A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 GLY 132 133 133 GLY GLY A . n 
A 1 133 MET 133 134 134 MET MET A . n 
A 1 134 ARG 134 135 135 ARG ARG A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ALA 136 137 137 ALA ALA A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 LEU 138 139 139 LEU LEU A . n 
A 1 139 LEU 139 140 140 LEU LEU A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLY 141 142 142 GLY GLY A . n 
A 1 142 GLU 142 143 143 GLU GLU A . n 
A 1 143 GLY 143 144 144 GLY GLY A . n 
A 1 144 ALA 144 145 145 ALA ALA A . n 
A 1 145 GLU 145 146 146 GLU GLU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 VAL 147 148 148 VAL VAL A . n 
A 1 148 LEU 148 149 149 LEU LEU A . n 
A 1 149 CYS 149 150 150 CYS CYS A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 LYS 152 153 153 LYS LYS A . n 
A 1 153 LEU 153 154 154 LEU LEU A . n 
A 1 154 ASP 154 155 155 ASP ASP A . n 
A 1 155 LYS 155 156 156 LYS LYS A . n 
A 1 156 ALA 156 157 157 ALA ALA A . n 
A 1 157 GLN 157 158 158 GLN GLN A . n 
A 1 158 ALA 158 159 159 ALA ALA A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 ALA 160 161 161 ALA ALA A . n 
A 1 161 ASP 161 162 162 ASP ASP A . n 
A 1 162 SER 162 163 163 SER SER A . n 
A 1 163 VAL 163 164 164 VAL VAL A . n 
A 1 164 ASN 164 165 165 ASN ASN A . n 
A 1 165 LYS 165 166 166 LYS LYS A . n 
A 1 166 ARG 166 167 167 ARG ARG A . n 
A 1 167 PHE 167 168 168 PHE PHE A . n 
A 1 168 LYS 168 169 169 LYS LYS A . n 
A 1 169 VAL 169 170 170 VAL VAL A . n 
A 1 170 ASN 170 171 171 ASN ASN A . n 
A 1 171 VAL 171 172 172 VAL VAL A . n 
A 1 172 THR 172 173 173 THR THR A . n 
A 1 173 ALA 173 174 174 ALA ALA A . n 
A 1 174 ALA 174 175 175 ALA ALA A . n 
A 1 175 GLU 175 176 176 GLU GLU A . n 
A 1 176 THR 176 177 177 THR THR A . n 
A 1 177 ALA 177 178 178 ALA ALA A . n 
A 1 178 ASP 178 179 179 ASP ASP A . n 
A 1 179 ASP 179 180 180 ASP ASP A . n 
A 1 180 ALA 180 181 181 ALA ALA A . n 
A 1 181 SER 181 182 182 SER SER A . n 
A 1 182 ARG 182 183 183 ARG ARG A . n 
A 1 183 ALA 183 184 184 ALA ALA A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ALA 185 186 186 ALA ALA A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 LYS 187 188 188 LYS LYS A . n 
A 1 188 GLY 188 189 189 GLY GLY A . n 
A 1 189 ALA 189 190 190 ALA ALA A . n 
A 1 190 HIS 190 191 191 HIS HIS A . n 
A 1 191 PHE 191 192 192 PHE PHE A . n 
A 1 192 VAL 192 193 193 VAL VAL A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 ALA 195 196 196 ALA ALA A . n 
A 1 196 GLY 196 197 197 GLY GLY A . n 
A 1 197 ALA 197 198 198 ALA ALA A . n 
A 1 198 ILE 198 199 199 ILE ILE A . n 
A 1 199 GLY 199 200 200 GLY GLY A . n 
A 1 200 LEU 200 201 201 LEU LEU A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 LEU 202 203 203 LEU LEU A . n 
A 1 203 LEU 203 204 204 LEU LEU A . n 
A 1 204 PRO 204 205 205 PRO PRO A . n 
A 1 205 GLN 205 206 206 GLN GLN A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 ALA 207 208 208 ALA ALA A . n 
A 1 208 TRP 208 209 209 TRP TRP A . n 
A 1 209 GLN 209 210 210 GLN GLN A . n 
A 1 210 ASN 210 211 211 ASN ASN A . n 
A 1 211 GLU 211 212 212 GLU GLU A . n 
A 1 212 SER 212 213 213 SER SER A . n 
A 1 213 SER 213 214 214 SER SER A . n 
A 1 214 ILE 214 215 215 ILE ILE A . n 
A 1 215 GLU 215 216 216 GLU GLU A . n 
A 1 216 ILE 216 217 217 ILE ILE A . n 
A 1 217 VAL 217 218 218 VAL VAL A . n 
A 1 218 ALA 218 219 219 ALA ALA A . n 
A 1 219 ASP 219 220 220 ASP ASP A . n 
A 1 220 TYR 220 221 221 TYR TYR A . n 
A 1 221 ASN 221 222 222 ASN ASN A . n 
A 1 222 ALA 222 223 223 ALA ALA A . n 
A 1 223 GLN 223 224 224 GLN GLN A . n 
A 1 224 PRO 224 225 225 PRO PRO A . n 
A 1 225 PRO 225 226 226 PRO PRO A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLY 227 228 228 GLY GLY A . n 
A 1 228 ILE 228 229 229 ILE ILE A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 GLY 230 231 231 GLY GLY A . n 
A 1 231 ILE 231 232 232 ILE ILE A . n 
A 1 232 ASP 232 233 233 ASP ASP A . n 
A 1 233 ALA 233 234 234 ALA ALA A . n 
A 1 234 THR 234 235 235 THR THR A . n 
A 1 235 ASP 235 236 236 ASP ASP A . n 
A 1 236 LYS 236 237 237 LYS LYS A . n 
A 1 237 GLY 237 238 238 GLY GLY A . n 
A 1 238 LYS 238 239 239 LYS LYS A . n 
A 1 239 GLU 239 240 240 GLU GLU A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLY 242 243 243 GLY GLY A . n 
A 1 243 LYS 243 244 244 LYS LYS A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ALA 245 246 246 ALA ALA A . n 
A 1 246 PHE 246 247 247 PHE PHE A . n 
A 1 247 GLY 247 248 248 GLY GLY A . n 
A 1 248 ALA 248 249 249 ALA ALA A . n 
A 1 249 LEU 249 250 250 LEU LEU A . n 
A 1 250 GLY 250 251 251 GLY GLY A . n 
A 1 251 ILE 251 252 252 ILE ILE A . n 
A 1 252 GLY 252 253 253 GLY GLY A . n 
A 1 253 GLY 253 254 254 GLY GLY A . n 
A 1 254 LEU 254 255 255 LEU LEU A . n 
A 1 255 LYS 255 256 256 LYS LYS A . n 
A 1 256 LEU 256 257 257 LEU LEU A . n 
A 1 257 LYS 257 258 258 LYS LYS A . n 
A 1 258 LEU 258 259 259 LEU LEU A . n 
A 1 259 HIS 259 260 260 HIS HIS A . n 
A 1 260 ARG 260 261 261 ARG ARG A . n 
A 1 261 ALA 261 262 262 ALA ALA A . n 
A 1 262 CYS 262 263 263 CYS CYS A . n 
A 1 263 ILE 263 264 264 ILE ILE A . n 
A 1 264 ALA 264 265 265 ALA ALA A . n 
A 1 265 LYS 265 266 266 LYS LYS A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 PHE 267 268 268 PHE PHE A . n 
A 1 268 GLU 268 269 269 GLU GLU A . n 
A 1 269 SER 269 270 270 SER SER A . n 
A 1 270 SER 270 271 271 SER SER A . n 
A 1 271 GLU 271 272 272 GLU GLU A . n 
A 1 272 GLY 272 273 273 GLY GLY A . n 
A 1 273 VAL 273 274 274 VAL VAL A . n 
A 1 274 PHE 274 275 275 PHE PHE A . n 
A 1 275 ASP 275 276 276 ASP ASP A . n 
A 1 276 ALA 276 277 277 ALA ALA A . n 
A 1 277 GLU 277 278 278 GLU GLU A . n 
A 1 278 GLU 278 279 279 GLU GLU A . n 
A 1 279 ILE 279 280 280 ILE ILE A . n 
A 1 280 TYR 280 281 281 TYR TYR A . n 
A 1 281 LYS 281 282 282 LYS LYS A . n 
A 1 282 LEU 282 283 283 LEU LEU A . n 
A 1 283 ALA 283 284 284 ALA ALA A . n 
A 1 284 LYS 284 285 285 LYS LYS A . n 
A 1 285 GLU 285 286 286 GLU GLU A . n 
A 1 286 MET 286 287 287 MET MET A . n 
A 1 287 ALA 287 288 288 ALA ALA A . n 
B 1 1   SER 1   2   2   SER SER B . n 
B 1 2   LYS 2   3   3   LYS LYS B . n 
B 1 3   LYS 3   4   4   LYS LYS B . n 
B 1 4   LEU 4   5   5   LEU LEU B . n 
B 1 5   LEU 5   6   6   LEU LEU B . n 
B 1 6   PHE 6   7   7   PHE PHE B . n 
B 1 7   GLN 7   8   8   GLN GLN B . n 
B 1 8   PHE 8   9   9   PHE PHE B . n 
B 1 9   ASP 9   10  10  ASP ASP B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  ASP 11  12  12  ASP ASP B . n 
B 1 12  ALA 12  13  13  ALA ALA B . n 
B 1 13  THR 13  14  14  THR THR B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  SER 15  16  16  SER SER B . n 
B 1 16  VAL 16  17  17  VAL VAL B . n 
B 1 17  PHE 17  18  18  PHE PHE B . n 
B 1 18  ASP 18  19  19  ASP ASP B . n 
B 1 19  VAL 19  20  20  VAL VAL B . n 
B 1 20  VAL 20  21  21  VAL VAL B . n 
B 1 21  VAL 21  22  22  VAL VAL B . n 
B 1 22  GLY 22  23  23  GLY GLY B . n 
B 1 23  TYR 23  24  24  TYR TYR B . n 
B 1 24  ASP 24  25  25  ASP ASP B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  ALA 27  28  28  ALA ALA B . n 
B 1 28  ASP 28  29  29  ASP ASP B . n 
B 1 29  HIS 29  30  30  HIS HIS B . n 
B 1 30  ILE 30  31  31  ILE ILE B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  GLY 32  33  33  GLY GLY B . n 
B 1 33  TYR 33  34  34  TYR TYR B . n 
B 1 34  GLY 34  35  35  GLY GLY B . n 
B 1 35  ASN 35  36  36  ASN ASN B . n 
B 1 36  VAL 36  37  37  VAL VAL B . n 
B 1 37  THR 37  38  38  THR THR B . n 
B 1 38  PRO 38  39  39  PRO PRO B . n 
B 1 39  ASP 39  40  40  ASP ASP B . n 
B 1 40  ASN 40  41  41  ASN ASN B . n 
B 1 41  VAL 41  42  42  VAL VAL B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  ALA 43  44  44  ALA ALA B . n 
B 1 44  TYR 44  45  45  TYR TYR B . n 
B 1 45  VAL 45  46  46  VAL VAL B . n 
B 1 46  ASP 46  47  47  ASP ASP B . n 
B 1 47  GLY 47  48  48  GLY GLY B . n 
B 1 48  THR 48  49  49  THR THR B . n 
B 1 49  ILE 49  50  50  ILE ILE B . n 
B 1 50  TYR 50  51  51  TYR TYR B . n 
B 1 51  THR 51  52  52  THR THR B . n 
B 1 52  ARG 52  53  53  ARG ARG B . n 
B 1 53  GLY 53  54  54  GLY GLY B . n 
B 1 54  GLY 54  55  55  GLY GLY B . n 
B 1 55  LYS 55  56  56  LYS LYS B . n 
B 1 56  GLU 56  57  57  GLU GLU B . n 
B 1 57  LYS 57  58  58  LYS LYS B . n 
B 1 58  GLN 58  59  59  GLN GLN B . n 
B 1 59  SER 59  60  60  SER SER B . n 
B 1 60  THR 60  61  61  THR THR B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  PHE 63  64  64  PHE PHE B . n 
B 1 64  VAL 64  65  65  VAL VAL B . n 
B 1 65  GLY 65  66  66  GLY GLY B . n 
B 1 66  GLY 66  67  67  GLY GLY B . n 
B 1 67  GLY 67  68  68  GLY GLY B . n 
B 1 68  ASP 68  69  69  ASP ASP B . n 
B 1 69  MET 69  70  70  MET MET B . n 
B 1 70  ALA 70  71  71  ALA ALA B . n 
B 1 71  ALA 71  72  72  ALA ALA B . n 
B 1 72  GLY 72  73  73  GLY GLY B . n 
B 1 73  GLU 73  74  74  GLU GLU B . n 
B 1 74  ARG 74  75  75  ARG ARG B . n 
B 1 75  VAL 75  76  76  VAL VAL B . n 
B 1 76  PHE 76  77  77  PHE PHE B . n 
B 1 77  GLU 77  78  78  GLU GLU B . n 
B 1 78  ALA 78  79  79  ALA ALA B . n 
B 1 79  VAL 79  80  80  VAL VAL B . n 
B 1 80  LYS 80  81  81  LYS LYS B . n 
B 1 81  LYS 81  82  82  LYS LYS B . n 
B 1 82  ARG 82  83  83  ARG ARG B . n 
B 1 83  PHE 83  84  84  PHE PHE B . n 
B 1 84  PHE 84  85  85  PHE PHE B . n 
B 1 85  GLY 85  86  86  GLY GLY B . n 
B 1 86  PRO 86  87  87  PRO PRO B . n 
B 1 87  PHE 87  88  88  PHE PHE B . n 
B 1 88  ARG 88  89  89  ARG ARG B . n 
B 1 89  VAL 89  90  90  VAL VAL B . n 
B 1 90  SER 90  91  91  SER SER B . n 
B 1 91  CYS 91  92  92  CYS CYS B . n 
B 1 92  MET 92  93  93  MET MET B . n 
B 1 93  LEU 93  94  94  LEU LEU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  SER 95  96  96  SER SER B . n 
B 1 96  ASN 96  97  97  ASN ASN B . n 
B 1 97  GLY 97  98  98  GLY GLY B . n 
B 1 98  SER 98  99  99  SER SER B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 THR 100 101 101 THR THR B . n 
B 1 101 THR 101 102 102 THR THR B . n 
B 1 102 ALA 102 103 103 ALA ALA B . n 
B 1 103 ALA 103 104 104 ALA ALA B . n 
B 1 104 ALA 104 105 105 ALA ALA B . n 
B 1 105 GLY 105 106 106 GLY GLY B . n 
B 1 106 VAL 106 107 107 VAL VAL B . n 
B 1 107 ALA 107 108 108 ALA ALA B . n 
B 1 108 LEU 108 109 109 LEU LEU B . n 
B 1 109 VAL 109 110 110 VAL VAL B . n 
B 1 110 VAL 110 111 111 VAL VAL B . n 
B 1 111 LYS 111 112 112 LYS LYS B . n 
B 1 112 ALA 112 113 113 ALA ALA B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 GLY 114 115 115 GLY GLY B . n 
B 1 115 GLY 115 116 116 GLY GLY B . n 
B 1 116 SER 116 117 117 SER SER B . n 
B 1 117 VAL 117 118 118 VAL VAL B . n 
B 1 118 LYS 118 119 119 LYS LYS B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 LYS 120 121 121 LYS LYS B . n 
B 1 121 LYS 121 122 122 LYS LYS B . n 
B 1 122 ALA 122 123 123 ALA ALA B . n 
B 1 123 VAL 123 124 124 VAL VAL B . n 
B 1 124 VAL 124 125 125 VAL VAL B . n 
B 1 125 LEU 125 126 126 LEU LEU B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 GLY 127 128 128 GLY GLY B . n 
B 1 128 THR 128 129 129 THR THR B . n 
B 1 129 GLY 129 130 130 GLY GLY B . n 
B 1 130 PRO 130 131 131 PRO PRO B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 GLY 132 133 133 GLY GLY B . n 
B 1 133 MET 133 134 134 MET MET B . n 
B 1 134 ARG 134 135 135 ARG ARG B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ALA 136 137 137 ALA ALA B . n 
B 1 137 ALA 137 138 138 ALA ALA B . n 
B 1 138 LEU 138 139 139 LEU LEU B . n 
B 1 139 LEU 139 140 140 LEU LEU B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLY 141 142 142 GLY GLY B . n 
B 1 142 GLU 142 143 143 GLU GLU B . n 
B 1 143 GLY 143 144 144 GLY GLY B . n 
B 1 144 ALA 144 145 145 ALA ALA B . n 
B 1 145 GLU 145 146 146 GLU GLU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 VAL 147 148 148 VAL VAL B . n 
B 1 148 LEU 148 149 149 LEU LEU B . n 
B 1 149 CYS 149 150 150 CYS CYS B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 LYS 152 153 153 LYS LYS B . n 
B 1 153 LEU 153 154 154 LEU LEU B . n 
B 1 154 ASP 154 155 155 ASP ASP B . n 
B 1 155 LYS 155 156 156 LYS LYS B . n 
B 1 156 ALA 156 157 157 ALA ALA B . n 
B 1 157 GLN 157 158 158 GLN GLN B . n 
B 1 158 ALA 158 159 159 ALA ALA B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 ALA 160 161 161 ALA ALA B . n 
B 1 161 ASP 161 162 162 ASP ASP B . n 
B 1 162 SER 162 163 163 SER SER B . n 
B 1 163 VAL 163 164 164 VAL VAL B . n 
B 1 164 ASN 164 165 165 ASN ASN B . n 
B 1 165 LYS 165 166 166 LYS LYS B . n 
B 1 166 ARG 166 167 167 ARG ARG B . n 
B 1 167 PHE 167 168 168 PHE PHE B . n 
B 1 168 LYS 168 169 169 LYS LYS B . n 
B 1 169 VAL 169 170 170 VAL VAL B . n 
B 1 170 ASN 170 171 171 ASN ASN B . n 
B 1 171 VAL 171 172 172 VAL VAL B . n 
B 1 172 THR 172 173 173 THR THR B . n 
B 1 173 ALA 173 174 174 ALA ALA B . n 
B 1 174 ALA 174 175 175 ALA ALA B . n 
B 1 175 GLU 175 176 176 GLU GLU B . n 
B 1 176 THR 176 177 177 THR THR B . n 
B 1 177 ALA 177 178 178 ALA ALA B . n 
B 1 178 ASP 178 179 179 ASP ASP B . n 
B 1 179 ASP 179 180 180 ASP ASP B . n 
B 1 180 ALA 180 181 181 ALA ALA B . n 
B 1 181 SER 181 182 182 SER SER B . n 
B 1 182 ARG 182 183 183 ARG ARG B . n 
B 1 183 ALA 183 184 184 ALA ALA B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ALA 185 186 186 ALA ALA B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 LYS 187 188 188 LYS LYS B . n 
B 1 188 GLY 188 189 189 GLY GLY B . n 
B 1 189 ALA 189 190 190 ALA ALA B . n 
B 1 190 HIS 190 191 191 HIS HIS B . n 
B 1 191 PHE 191 192 192 PHE PHE B . n 
B 1 192 VAL 192 193 193 VAL VAL B . n 
B 1 193 PHE 193 194 194 PHE PHE B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 ALA 195 196 196 ALA ALA B . n 
B 1 196 GLY 196 197 197 GLY GLY B . n 
B 1 197 ALA 197 198 198 ALA ALA B . n 
B 1 198 ILE 198 199 199 ILE ILE B . n 
B 1 199 GLY 199 200 200 GLY GLY B . n 
B 1 200 LEU 200 201 201 LEU LEU B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 LEU 202 203 203 LEU LEU B . n 
B 1 203 LEU 203 204 204 LEU LEU B . n 
B 1 204 PRO 204 205 205 PRO PRO B . n 
B 1 205 GLN 205 206 206 GLN GLN B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 ALA 207 208 208 ALA ALA B . n 
B 1 208 TRP 208 209 209 TRP TRP B . n 
B 1 209 GLN 209 210 210 GLN GLN B . n 
B 1 210 ASN 210 211 211 ASN ASN B . n 
B 1 211 GLU 211 212 212 GLU GLU B . n 
B 1 212 SER 212 213 213 SER SER B . n 
B 1 213 SER 213 214 214 SER SER B . n 
B 1 214 ILE 214 215 215 ILE ILE B . n 
B 1 215 GLU 215 216 216 GLU GLU B . n 
B 1 216 ILE 216 217 217 ILE ILE B . n 
B 1 217 VAL 217 218 218 VAL VAL B . n 
B 1 218 ALA 218 219 219 ALA ALA B . n 
B 1 219 ASP 219 220 220 ASP ASP B . n 
B 1 220 TYR 220 221 221 TYR TYR B . n 
B 1 221 ASN 221 222 222 ASN ASN B . n 
B 1 222 ALA 222 223 223 ALA ALA B . n 
B 1 223 GLN 223 224 224 GLN GLN B . n 
B 1 224 PRO 224 225 225 PRO PRO B . n 
B 1 225 PRO 225 226 226 PRO PRO B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLY 227 228 228 GLY GLY B . n 
B 1 228 ILE 228 229 229 ILE ILE B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 GLY 230 231 231 GLY GLY B . n 
B 1 231 ILE 231 232 232 ILE ILE B . n 
B 1 232 ASP 232 233 233 ASP ASP B . n 
B 1 233 ALA 233 234 234 ALA ALA B . n 
B 1 234 THR 234 235 235 THR THR B . n 
B 1 235 ASP 235 236 236 ASP ASP B . n 
B 1 236 LYS 236 237 237 LYS LYS B . n 
B 1 237 GLY 237 238 238 GLY GLY B . n 
B 1 238 LYS 238 239 239 LYS LYS B . n 
B 1 239 GLU 239 240 240 GLU GLU B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLY 242 243 243 GLY GLY B . n 
B 1 243 LYS 243 244 244 LYS LYS B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ALA 245 246 246 ALA ALA B . n 
B 1 246 PHE 246 247 247 PHE PHE B . n 
B 1 247 GLY 247 248 248 GLY GLY B . n 
B 1 248 ALA 248 249 249 ALA ALA B . n 
B 1 249 LEU 249 250 250 LEU LEU B . n 
B 1 250 GLY 250 251 251 GLY GLY B . n 
B 1 251 ILE 251 252 252 ILE ILE B . n 
B 1 252 GLY 252 253 253 GLY GLY B . n 
B 1 253 GLY 253 254 254 GLY GLY B . n 
B 1 254 LEU 254 255 255 LEU LEU B . n 
B 1 255 LYS 255 256 256 LYS LYS B . n 
B 1 256 LEU 256 257 257 LEU LEU B . n 
B 1 257 LYS 257 258 258 LYS LYS B . n 
B 1 258 LEU 258 259 259 LEU LEU B . n 
B 1 259 HIS 259 260 260 HIS HIS B . n 
B 1 260 ARG 260 261 261 ARG ARG B . n 
B 1 261 ALA 261 262 262 ALA ALA B . n 
B 1 262 CYS 262 263 263 CYS CYS B . n 
B 1 263 ILE 263 264 264 ILE ILE B . n 
B 1 264 ALA 264 265 265 ALA ALA B . n 
B 1 265 LYS 265 266 266 LYS LYS B . n 
B 1 266 LEU 266 267 267 LEU LEU B . n 
B 1 267 PHE 267 268 268 PHE PHE B . n 
B 1 268 GLU 268 269 269 GLU GLU B . n 
B 1 269 SER 269 270 270 SER SER B . n 
B 1 270 SER 270 271 271 SER SER B . n 
B 1 271 GLU 271 272 272 GLU GLU B . n 
B 1 272 GLY 272 273 273 GLY GLY B . n 
B 1 273 VAL 273 274 274 VAL VAL B . n 
B 1 274 PHE 274 275 275 PHE PHE B . n 
B 1 275 ASP 275 276 276 ASP ASP B . n 
B 1 276 ALA 276 277 277 ALA ALA B . n 
B 1 277 GLU 277 278 278 GLU GLU B . n 
B 1 278 GLU 278 279 279 GLU GLU B . n 
B 1 279 ILE 279 280 280 ILE ILE B . n 
B 1 280 TYR 280 281 281 TYR TYR B . n 
B 1 281 LYS 281 282 282 LYS LYS B . n 
B 1 282 LEU 282 283 283 LEU LEU B . n 
B 1 283 ALA 283 284 284 ALA ALA B . n 
B 1 284 LYS 284 285 285 LYS LYS B . n 
B 1 285 GLU 285 286 286 GLU GLU B . n 
B 1 286 MET 286 287 287 MET MET B . n 
B 1 287 ALA 287 288 288 ALA ALA B . n 
C 1 1   SER 1   2   2   SER SER C . n 
C 1 2   LYS 2   3   3   LYS LYS C . n 
C 1 3   LYS 3   4   4   LYS LYS C . n 
C 1 4   LEU 4   5   5   LEU LEU C . n 
C 1 5   LEU 5   6   6   LEU LEU C . n 
C 1 6   PHE 6   7   7   PHE PHE C . n 
C 1 7   GLN 7   8   8   GLN GLN C . n 
C 1 8   PHE 8   9   9   PHE PHE C . n 
C 1 9   ASP 9   10  10  ASP ASP C . n 
C 1 10  THR 10  11  11  THR THR C . n 
C 1 11  ASP 11  12  12  ASP ASP C . n 
C 1 12  ALA 12  13  13  ALA ALA C . n 
C 1 13  THR 13  14  14  THR THR C . n 
C 1 14  PRO 14  15  15  PRO PRO C . n 
C 1 15  SER 15  16  16  SER SER C . n 
C 1 16  VAL 16  17  17  VAL VAL C . n 
C 1 17  PHE 17  18  18  PHE PHE C . n 
C 1 18  ASP 18  19  19  ASP ASP C . n 
C 1 19  VAL 19  20  20  VAL VAL C . n 
C 1 20  VAL 20  21  21  VAL VAL C . n 
C 1 21  VAL 21  22  22  VAL VAL C . n 
C 1 22  GLY 22  23  23  GLY GLY C . n 
C 1 23  TYR 23  24  24  TYR TYR C . n 
C 1 24  ASP 24  25  25  ASP ASP C . n 
C 1 25  GLY 25  26  26  GLY GLY C . n 
C 1 26  GLY 26  27  27  GLY GLY C . n 
C 1 27  ALA 27  28  28  ALA ALA C . n 
C 1 28  ASP 28  29  29  ASP ASP C . n 
C 1 29  HIS 29  30  30  HIS HIS C . n 
C 1 30  ILE 30  31  31  ILE ILE C . n 
C 1 31  THR 31  32  32  THR THR C . n 
C 1 32  GLY 32  33  33  GLY GLY C . n 
C 1 33  TYR 33  34  34  TYR TYR C . n 
C 1 34  GLY 34  35  35  GLY GLY C . n 
C 1 35  ASN 35  36  36  ASN ASN C . n 
C 1 36  VAL 36  37  37  VAL VAL C . n 
C 1 37  THR 37  38  38  THR THR C . n 
C 1 38  PRO 38  39  39  PRO PRO C . n 
C 1 39  ASP 39  40  40  ASP ASP C . n 
C 1 40  ASN 40  41  41  ASN ASN C . n 
C 1 41  VAL 41  42  42  VAL VAL C . n 
C 1 42  GLY 42  43  43  GLY GLY C . n 
C 1 43  ALA 43  44  44  ALA ALA C . n 
C 1 44  TYR 44  45  45  TYR TYR C . n 
C 1 45  VAL 45  46  46  VAL VAL C . n 
C 1 46  ASP 46  47  47  ASP ASP C . n 
C 1 47  GLY 47  48  48  GLY GLY C . n 
C 1 48  THR 48  49  49  THR THR C . n 
C 1 49  ILE 49  50  50  ILE ILE C . n 
C 1 50  TYR 50  51  51  TYR TYR C . n 
C 1 51  THR 51  52  52  THR THR C . n 
C 1 52  ARG 52  53  53  ARG ARG C . n 
C 1 53  GLY 53  54  54  GLY GLY C . n 
C 1 54  GLY 54  55  55  GLY GLY C . n 
C 1 55  LYS 55  56  56  LYS LYS C . n 
C 1 56  GLU 56  57  57  GLU GLU C . n 
C 1 57  LYS 57  58  58  LYS LYS C . n 
C 1 58  GLN 58  59  59  GLN GLN C . n 
C 1 59  SER 59  60  60  SER SER C . n 
C 1 60  THR 60  61  61  THR THR C . n 
C 1 61  ALA 61  62  62  ALA ALA C . n 
C 1 62  ILE 62  63  63  ILE ILE C . n 
C 1 63  PHE 63  64  64  PHE PHE C . n 
C 1 64  VAL 64  65  65  VAL VAL C . n 
C 1 65  GLY 65  66  66  GLY GLY C . n 
C 1 66  GLY 66  67  67  GLY GLY C . n 
C 1 67  GLY 67  68  68  GLY GLY C . n 
C 1 68  ASP 68  69  69  ASP ASP C . n 
C 1 69  MET 69  70  70  MET MET C . n 
C 1 70  ALA 70  71  71  ALA ALA C . n 
C 1 71  ALA 71  72  72  ALA ALA C . n 
C 1 72  GLY 72  73  73  GLY GLY C . n 
C 1 73  GLU 73  74  74  GLU GLU C . n 
C 1 74  ARG 74  75  75  ARG ARG C . n 
C 1 75  VAL 75  76  76  VAL VAL C . n 
C 1 76  PHE 76  77  77  PHE PHE C . n 
C 1 77  GLU 77  78  78  GLU GLU C . n 
C 1 78  ALA 78  79  79  ALA ALA C . n 
C 1 79  VAL 79  80  80  VAL VAL C . n 
C 1 80  LYS 80  81  81  LYS LYS C . n 
C 1 81  LYS 81  82  82  LYS LYS C . n 
C 1 82  ARG 82  83  83  ARG ARG C . n 
C 1 83  PHE 83  84  84  PHE PHE C . n 
C 1 84  PHE 84  85  85  PHE PHE C . n 
C 1 85  GLY 85  86  86  GLY GLY C . n 
C 1 86  PRO 86  87  87  PRO PRO C . n 
C 1 87  PHE 87  88  88  PHE PHE C . n 
C 1 88  ARG 88  89  89  ARG ARG C . n 
C 1 89  VAL 89  90  90  VAL VAL C . n 
C 1 90  SER 90  91  91  SER SER C . n 
C 1 91  CYS 91  92  92  CYS CYS C . n 
C 1 92  MET 92  93  93  MET MET C . n 
C 1 93  LEU 93  94  94  LEU LEU C . n 
C 1 94  ASP 94  95  95  ASP ASP C . n 
C 1 95  SER 95  96  96  SER SER C . n 
C 1 96  ASN 96  97  97  ASN ASN C . n 
C 1 97  GLY 97  98  98  GLY GLY C . n 
C 1 98  SER 98  99  99  SER SER C . n 
C 1 99  ASN 99  100 100 ASN ASN C . n 
C 1 100 THR 100 101 101 THR THR C . n 
C 1 101 THR 101 102 102 THR THR C . n 
C 1 102 ALA 102 103 103 ALA ALA C . n 
C 1 103 ALA 103 104 104 ALA ALA C . n 
C 1 104 ALA 104 105 105 ALA ALA C . n 
C 1 105 GLY 105 106 106 GLY GLY C . n 
C 1 106 VAL 106 107 107 VAL VAL C . n 
C 1 107 ALA 107 108 108 ALA ALA C . n 
C 1 108 LEU 108 109 109 LEU LEU C . n 
C 1 109 VAL 109 110 110 VAL VAL C . n 
C 1 110 VAL 110 111 111 VAL VAL C . n 
C 1 111 LYS 111 112 112 LYS LYS C . n 
C 1 112 ALA 112 113 113 ALA ALA C . n 
C 1 113 ALA 113 114 114 ALA ALA C . n 
C 1 114 GLY 114 115 115 GLY GLY C . n 
C 1 115 GLY 115 116 116 GLY GLY C . n 
C 1 116 SER 116 117 117 SER SER C . n 
C 1 117 VAL 117 118 118 VAL VAL C . n 
C 1 118 LYS 118 119 119 LYS LYS C . n 
C 1 119 GLY 119 120 120 GLY GLY C . n 
C 1 120 LYS 120 121 121 LYS LYS C . n 
C 1 121 LYS 121 122 122 LYS LYS C . n 
C 1 122 ALA 122 123 123 ALA ALA C . n 
C 1 123 VAL 123 124 124 VAL VAL C . n 
C 1 124 VAL 124 125 125 VAL VAL C . n 
C 1 125 LEU 125 126 126 LEU LEU C . n 
C 1 126 ALA 126 127 127 ALA ALA C . n 
C 1 127 GLY 127 128 128 GLY GLY C . n 
C 1 128 THR 128 129 129 THR THR C . n 
C 1 129 GLY 129 130 130 GLY GLY C . n 
C 1 130 PRO 130 131 131 PRO PRO C . n 
C 1 131 VAL 131 132 132 VAL VAL C . n 
C 1 132 GLY 132 133 133 GLY GLY C . n 
C 1 133 MET 133 134 134 MET MET C . n 
C 1 134 ARG 134 135 135 ARG ARG C . n 
C 1 135 SER 135 136 136 SER SER C . n 
C 1 136 ALA 136 137 137 ALA ALA C . n 
C 1 137 ALA 137 138 138 ALA ALA C . n 
C 1 138 LEU 138 139 139 LEU LEU C . n 
C 1 139 LEU 139 140 140 LEU LEU C . n 
C 1 140 ALA 140 141 141 ALA ALA C . n 
C 1 141 GLY 141 142 142 GLY GLY C . n 
C 1 142 GLU 142 143 143 GLU GLU C . n 
C 1 143 GLY 143 144 144 GLY GLY C . n 
C 1 144 ALA 144 145 145 ALA ALA C . n 
C 1 145 GLU 145 146 146 GLU GLU C . n 
C 1 146 VAL 146 147 147 VAL VAL C . n 
C 1 147 VAL 147 148 148 VAL VAL C . n 
C 1 148 LEU 148 149 149 LEU LEU C . n 
C 1 149 CYS 149 150 150 CYS CYS C . n 
C 1 150 GLY 150 151 151 GLY GLY C . n 
C 1 151 ARG 151 152 152 ARG ARG C . n 
C 1 152 LYS 152 153 153 LYS LYS C . n 
C 1 153 LEU 153 154 154 LEU LEU C . n 
C 1 154 ASP 154 155 155 ASP ASP C . n 
C 1 155 LYS 155 156 156 LYS LYS C . n 
C 1 156 ALA 156 157 157 ALA ALA C . n 
C 1 157 GLN 157 158 158 GLN GLN C . n 
C 1 158 ALA 158 159 159 ALA ALA C . n 
C 1 159 ALA 159 160 160 ALA ALA C . n 
C 1 160 ALA 160 161 161 ALA ALA C . n 
C 1 161 ASP 161 162 162 ASP ASP C . n 
C 1 162 SER 162 163 163 SER SER C . n 
C 1 163 VAL 163 164 164 VAL VAL C . n 
C 1 164 ASN 164 165 165 ASN ASN C . n 
C 1 165 LYS 165 166 166 LYS LYS C . n 
C 1 166 ARG 166 167 167 ARG ARG C . n 
C 1 167 PHE 167 168 168 PHE PHE C . n 
C 1 168 LYS 168 169 169 LYS LYS C . n 
C 1 169 VAL 169 170 170 VAL VAL C . n 
C 1 170 ASN 170 171 171 ASN ASN C . n 
C 1 171 VAL 171 172 172 VAL VAL C . n 
C 1 172 THR 172 173 173 THR THR C . n 
C 1 173 ALA 173 174 174 ALA ALA C . n 
C 1 174 ALA 174 175 175 ALA ALA C . n 
C 1 175 GLU 175 176 176 GLU GLU C . n 
C 1 176 THR 176 177 177 THR THR C . n 
C 1 177 ALA 177 178 178 ALA ALA C . n 
C 1 178 ASP 178 179 179 ASP ASP C . n 
C 1 179 ASP 179 180 180 ASP ASP C . n 
C 1 180 ALA 180 181 181 ALA ALA C . n 
C 1 181 SER 181 182 182 SER SER C . n 
C 1 182 ARG 182 183 183 ARG ARG C . n 
C 1 183 ALA 183 184 184 ALA ALA C . n 
C 1 184 GLU 184 185 185 GLU GLU C . n 
C 1 185 ALA 185 186 186 ALA ALA C . n 
C 1 186 VAL 186 187 187 VAL VAL C . n 
C 1 187 LYS 187 188 188 LYS LYS C . n 
C 1 188 GLY 188 189 189 GLY GLY C . n 
C 1 189 ALA 189 190 190 ALA ALA C . n 
C 1 190 HIS 190 191 191 HIS HIS C . n 
C 1 191 PHE 191 192 192 PHE PHE C . n 
C 1 192 VAL 192 193 193 VAL VAL C . n 
C 1 193 PHE 193 194 194 PHE PHE C . n 
C 1 194 THR 194 195 195 THR THR C . n 
C 1 195 ALA 195 196 196 ALA ALA C . n 
C 1 196 GLY 196 197 197 GLY GLY C . n 
C 1 197 ALA 197 198 198 ALA ALA C . n 
C 1 198 ILE 198 199 199 ILE ILE C . n 
C 1 199 GLY 199 200 200 GLY GLY C . n 
C 1 200 LEU 200 201 201 LEU LEU C . n 
C 1 201 GLU 201 202 202 GLU GLU C . n 
C 1 202 LEU 202 203 203 LEU LEU C . n 
C 1 203 LEU 203 204 204 LEU LEU C . n 
C 1 204 PRO 204 205 205 PRO PRO C . n 
C 1 205 GLN 205 206 206 GLN GLN C . n 
C 1 206 ALA 206 207 207 ALA ALA C . n 
C 1 207 ALA 207 208 208 ALA ALA C . n 
C 1 208 TRP 208 209 209 TRP TRP C . n 
C 1 209 GLN 209 210 210 GLN GLN C . n 
C 1 210 ASN 210 211 211 ASN ASN C . n 
C 1 211 GLU 211 212 212 GLU GLU C . n 
C 1 212 SER 212 213 213 SER SER C . n 
C 1 213 SER 213 214 214 SER SER C . n 
C 1 214 ILE 214 215 215 ILE ILE C . n 
C 1 215 GLU 215 216 216 GLU GLU C . n 
C 1 216 ILE 216 217 217 ILE ILE C . n 
C 1 217 VAL 217 218 218 VAL VAL C . n 
C 1 218 ALA 218 219 219 ALA ALA C . n 
C 1 219 ASP 219 220 220 ASP ASP C . n 
C 1 220 TYR 220 221 221 TYR TYR C . n 
C 1 221 ASN 221 222 222 ASN ASN C . n 
C 1 222 ALA 222 223 223 ALA ALA C . n 
C 1 223 GLN 223 224 224 GLN GLN C . n 
C 1 224 PRO 224 225 225 PRO PRO C . n 
C 1 225 PRO 225 226 226 PRO PRO C . n 
C 1 226 LEU 226 227 227 LEU LEU C . n 
C 1 227 GLY 227 228 228 GLY GLY C . n 
C 1 228 ILE 228 229 229 ILE ILE C . n 
C 1 229 GLY 229 230 230 GLY GLY C . n 
C 1 230 GLY 230 231 231 GLY GLY C . n 
C 1 231 ILE 231 232 232 ILE ILE C . n 
C 1 232 ASP 232 233 233 ASP ASP C . n 
C 1 233 ALA 233 234 234 ALA ALA C . n 
C 1 234 THR 234 235 235 THR THR C . n 
C 1 235 ASP 235 236 236 ASP ASP C . n 
C 1 236 LYS 236 237 237 LYS LYS C . n 
C 1 237 GLY 237 238 238 GLY GLY C . n 
C 1 238 LYS 238 239 239 LYS LYS C . n 
C 1 239 GLU 239 240 240 GLU GLU C . n 
C 1 240 TYR 240 241 241 TYR TYR C . n 
C 1 241 GLY 241 242 242 GLY GLY C . n 
C 1 242 GLY 242 243 243 GLY GLY C . n 
C 1 243 LYS 243 244 244 LYS LYS C . n 
C 1 244 ARG 244 245 245 ARG ARG C . n 
C 1 245 ALA 245 246 246 ALA ALA C . n 
C 1 246 PHE 246 247 247 PHE PHE C . n 
C 1 247 GLY 247 248 248 GLY GLY C . n 
C 1 248 ALA 248 249 249 ALA ALA C . n 
C 1 249 LEU 249 250 250 LEU LEU C . n 
C 1 250 GLY 250 251 251 GLY GLY C . n 
C 1 251 ILE 251 252 252 ILE ILE C . n 
C 1 252 GLY 252 253 253 GLY GLY C . n 
C 1 253 GLY 253 254 254 GLY GLY C . n 
C 1 254 LEU 254 255 255 LEU LEU C . n 
C 1 255 LYS 255 256 256 LYS LYS C . n 
C 1 256 LEU 256 257 257 LEU LEU C . n 
C 1 257 LYS 257 258 258 LYS LYS C . n 
C 1 258 LEU 258 259 259 LEU LEU C . n 
C 1 259 HIS 259 260 260 HIS HIS C . n 
C 1 260 ARG 260 261 261 ARG ARG C . n 
C 1 261 ALA 261 262 262 ALA ALA C . n 
C 1 262 CYS 262 263 263 CYS CYS C . n 
C 1 263 ILE 263 264 264 ILE ILE C . n 
C 1 264 ALA 264 265 265 ALA ALA C . n 
C 1 265 LYS 265 266 266 LYS LYS C . n 
C 1 266 LEU 266 267 267 LEU LEU C . n 
C 1 267 PHE 267 268 268 PHE PHE C . n 
C 1 268 GLU 268 269 269 GLU GLU C . n 
C 1 269 SER 269 270 270 SER SER C . n 
C 1 270 SER 270 271 271 SER SER C . n 
C 1 271 GLU 271 272 272 GLU GLU C . n 
C 1 272 GLY 272 273 273 GLY GLY C . n 
C 1 273 VAL 273 274 274 VAL VAL C . n 
C 1 274 PHE 274 275 275 PHE PHE C . n 
C 1 275 ASP 275 276 276 ASP ASP C . n 
C 1 276 ALA 276 277 277 ALA ALA C . n 
C 1 277 GLU 277 278 278 GLU GLU C . n 
C 1 278 GLU 278 279 279 GLU GLU C . n 
C 1 279 ILE 279 280 280 ILE ILE C . n 
C 1 280 TYR 280 281 281 TYR TYR C . n 
C 1 281 LYS 281 282 282 LYS LYS C . n 
C 1 282 LEU 282 283 283 LEU LEU C . n 
C 1 283 ALA 283 284 284 ALA ALA C . n 
C 1 284 LYS 284 285 285 LYS LYS C . n 
C 1 285 GLU 285 286 286 GLU GLU C . n 
C 1 286 MET 286 287 287 MET MET C . n 
C 1 287 ALA 287 288 288 ALA ALA C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6920  ? 
1 MORE         -26   ? 
1 'SSA (A^2)'  32860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-09-11 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 95  ? ? -156.18 46.45   
2 1 ASN A 97  ? ? 58.83   18.28   
3 1 ASP A 276 ? ? -120.30 -167.15 
4 1 ASP B 95  ? ? -153.97 47.25   
5 1 ASP B 276 ? ? -116.22 -167.34 
6 1 ASP C 95  ? ? -156.35 44.59   
7 1 TRP C 209 ? ? -130.08 -34.83  
8 1 ASP C 276 ? ? -110.98 -168.14 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 
3 water                                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 NAP 1   456  456  NAP NAP A . 
E 2 NAP 1   1456 456  NAP NAP B . 
F 2 NAP 1   2456 456  NAP NAP C . 
G 3 HOH 1   3187 3187 HOH WAT A . 
G 3 HOH 2   3190 3190 HOH WAT A . 
G 3 HOH 3   3191 3191 HOH WAT A . 
G 3 HOH 4   3192 3192 HOH WAT A . 
G 3 HOH 5   3197 3197 HOH WAT A . 
G 3 HOH 6   3200 3200 HOH WAT A . 
G 3 HOH 7   3208 3208 HOH WAT A . 
G 3 HOH 8   3209 3209 HOH WAT A . 
G 3 HOH 9   3211 3211 HOH WAT A . 
G 3 HOH 10  3216 3216 HOH WAT A . 
G 3 HOH 11  3218 3218 HOH WAT A . 
G 3 HOH 12  3223 3223 HOH WAT A . 
G 3 HOH 13  3227 3227 HOH WAT A . 
G 3 HOH 14  3234 3234 HOH WAT A . 
G 3 HOH 15  3237 3237 HOH WAT A . 
G 3 HOH 16  3239 3239 HOH WAT A . 
G 3 HOH 17  3255 3255 HOH WAT A . 
G 3 HOH 18  3258 3258 HOH WAT A . 
G 3 HOH 19  3259 3259 HOH WAT A . 
G 3 HOH 20  3263 3263 HOH WAT A . 
G 3 HOH 21  3265 3265 HOH WAT A . 
G 3 HOH 22  3270 3270 HOH WAT A . 
G 3 HOH 23  3271 3271 HOH WAT A . 
G 3 HOH 24  3273 3273 HOH WAT A . 
G 3 HOH 25  3274 3274 HOH WAT A . 
G 3 HOH 26  3276 3276 HOH WAT A . 
G 3 HOH 27  3277 3277 HOH WAT A . 
G 3 HOH 28  3278 3278 HOH WAT A . 
G 3 HOH 29  3283 3283 HOH WAT A . 
G 3 HOH 30  3284 3284 HOH WAT A . 
G 3 HOH 31  3291 3291 HOH WAT A . 
G 3 HOH 32  3292 3292 HOH WAT A . 
G 3 HOH 33  3293 3293 HOH WAT A . 
G 3 HOH 34  3294 3294 HOH WAT A . 
G 3 HOH 35  3297 3297 HOH WAT A . 
G 3 HOH 36  3300 3300 HOH WAT A . 
G 3 HOH 37  3302 3302 HOH WAT A . 
G 3 HOH 38  3306 3306 HOH WAT A . 
G 3 HOH 39  3307 3307 HOH WAT A . 
G 3 HOH 40  3308 3308 HOH WAT A . 
G 3 HOH 41  3310 3310 HOH WAT A . 
G 3 HOH 42  3314 3314 HOH WAT A . 
G 3 HOH 43  3318 3318 HOH WAT A . 
G 3 HOH 44  3325 3325 HOH WAT A . 
G 3 HOH 45  3326 3326 HOH WAT A . 
G 3 HOH 46  3330 3330 HOH WAT A . 
G 3 HOH 47  3334 3334 HOH WAT A . 
G 3 HOH 48  3335 3335 HOH WAT A . 
G 3 HOH 49  3336 3336 HOH WAT A . 
G 3 HOH 50  3339 3339 HOH WAT A . 
G 3 HOH 51  3343 3343 HOH WAT A . 
G 3 HOH 52  3344 3344 HOH WAT A . 
G 3 HOH 53  3345 3345 HOH WAT A . 
G 3 HOH 54  3346 3346 HOH WAT A . 
G 3 HOH 55  3347 3347 HOH WAT A . 
G 3 HOH 56  3348 3348 HOH WAT A . 
G 3 HOH 57  3355 3355 HOH WAT A . 
G 3 HOH 58  3363 3363 HOH WAT A . 
G 3 HOH 59  3364 3364 HOH WAT A . 
G 3 HOH 60  3374 3374 HOH WAT A . 
G 3 HOH 61  3377 3377 HOH WAT A . 
G 3 HOH 62  3382 3382 HOH WAT A . 
G 3 HOH 63  3389 3389 HOH WAT A . 
G 3 HOH 64  3390 3390 HOH WAT A . 
G 3 HOH 65  3391 3391 HOH WAT A . 
G 3 HOH 66  3395 3395 HOH WAT A . 
G 3 HOH 67  3397 3397 HOH WAT A . 
G 3 HOH 68  3399 3399 HOH WAT A . 
G 3 HOH 69  3406 3406 HOH WAT A . 
G 3 HOH 70  3408 3408 HOH WAT A . 
G 3 HOH 71  3410 3410 HOH WAT A . 
G 3 HOH 72  3412 3412 HOH WAT A . 
G 3 HOH 73  3414 3414 HOH WAT A . 
G 3 HOH 74  3415 3415 HOH WAT A . 
G 3 HOH 75  3418 3418 HOH WAT A . 
G 3 HOH 76  3422 3422 HOH WAT A . 
G 3 HOH 77  3426 3426 HOH WAT A . 
G 3 HOH 78  3430 3430 HOH WAT A . 
G 3 HOH 79  3432 3432 HOH WAT A . 
G 3 HOH 80  3434 3434 HOH WAT A . 
G 3 HOH 81  3437 3437 HOH WAT A . 
G 3 HOH 82  3442 3442 HOH WAT A . 
G 3 HOH 83  3443 3443 HOH WAT A . 
G 3 HOH 84  3446 3446 HOH WAT A . 
G 3 HOH 85  3449 3449 HOH WAT A . 
G 3 HOH 86  3456 3456 HOH WAT A . 
G 3 HOH 87  3459 3459 HOH WAT A . 
G 3 HOH 88  3461 3461 HOH WAT A . 
G 3 HOH 89  3465 3465 HOH WAT A . 
G 3 HOH 90  3468 3468 HOH WAT A . 
G 3 HOH 91  3474 3474 HOH WAT A . 
G 3 HOH 92  3475 3475 HOH WAT A . 
G 3 HOH 93  3477 3477 HOH WAT A . 
G 3 HOH 94  3478 3478 HOH WAT A . 
G 3 HOH 95  3482 3482 HOH WAT A . 
G 3 HOH 96  3483 3483 HOH WAT A . 
G 3 HOH 97  3488 3488 HOH WAT A . 
G 3 HOH 98  3495 3495 HOH WAT A . 
G 3 HOH 99  3500 3500 HOH WAT A . 
G 3 HOH 100 3502 3502 HOH WAT A . 
G 3 HOH 101 3503 3503 HOH WAT A . 
G 3 HOH 102 3504 3504 HOH WAT A . 
G 3 HOH 103 3506 3506 HOH WAT A . 
G 3 HOH 104 3508 3508 HOH WAT A . 
G 3 HOH 105 3513 3513 HOH WAT A . 
G 3 HOH 106 3515 3515 HOH WAT A . 
G 3 HOH 107 3516 3516 HOH WAT A . 
G 3 HOH 108 3517 3517 HOH WAT A . 
G 3 HOH 109 3520 3520 HOH WAT A . 
G 3 HOH 110 3521 3521 HOH WAT A . 
G 3 HOH 111 3524 3524 HOH WAT A . 
G 3 HOH 112 3528 3528 HOH WAT A . 
G 3 HOH 113 3534 3534 HOH WAT A . 
G 3 HOH 114 3536 3536 HOH WAT A . 
G 3 HOH 115 3538 3538 HOH WAT A . 
G 3 HOH 116 3539 3539 HOH WAT A . 
G 3 HOH 117 3541 3541 HOH WAT A . 
G 3 HOH 118 3544 3544 HOH WAT A . 
G 3 HOH 119 3545 3545 HOH WAT A . 
G 3 HOH 120 3546 3546 HOH WAT A . 
G 3 HOH 121 3548 3548 HOH WAT A . 
G 3 HOH 122 3549 3549 HOH WAT A . 
G 3 HOH 123 3550 3550 HOH WAT A . 
G 3 HOH 124 3551 3551 HOH WAT A . 
G 3 HOH 125 3552 3552 HOH WAT A . 
G 3 HOH 126 3554 3554 HOH WAT A . 
G 3 HOH 127 3557 3557 HOH WAT A . 
G 3 HOH 128 3559 3559 HOH WAT A . 
G 3 HOH 129 3561 3561 HOH WAT A . 
G 3 HOH 130 3572 3572 HOH WAT A . 
G 3 HOH 131 3577 3577 HOH WAT A . 
G 3 HOH 132 3578 3578 HOH WAT A . 
G 3 HOH 133 3588 3588 HOH WAT A . 
G 3 HOH 134 3593 3593 HOH WAT A . 
G 3 HOH 135 3594 3594 HOH WAT A . 
G 3 HOH 136 3595 3595 HOH WAT A . 
G 3 HOH 137 3600 3600 HOH WAT A . 
G 3 HOH 138 3601 3601 HOH WAT A . 
G 3 HOH 139 3607 3607 HOH WAT A . 
G 3 HOH 140 3611 3611 HOH WAT A . 
G 3 HOH 141 3615 3615 HOH WAT A . 
G 3 HOH 142 3616 3616 HOH WAT A . 
G 3 HOH 143 3622 3622 HOH WAT A . 
G 3 HOH 144 3623 3623 HOH WAT A . 
G 3 HOH 145 3624 3624 HOH WAT A . 
G 3 HOH 146 3625 3625 HOH WAT A . 
G 3 HOH 147 3630 3630 HOH WAT A . 
G 3 HOH 148 3635 3635 HOH WAT A . 
G 3 HOH 149 3636 3636 HOH WAT A . 
G 3 HOH 150 3639 3639 HOH WAT A . 
G 3 HOH 151 3640 3640 HOH WAT A . 
G 3 HOH 152 3641 3641 HOH WAT A . 
G 3 HOH 153 3644 3644 HOH WAT A . 
G 3 HOH 154 3648 3648 HOH WAT A . 
G 3 HOH 155 3651 3651 HOH WAT A . 
G 3 HOH 156 3653 3653 HOH WAT A . 
G 3 HOH 157 3655 3655 HOH WAT A . 
G 3 HOH 158 3657 3657 HOH WAT A . 
G 3 HOH 159 3658 3658 HOH WAT A . 
G 3 HOH 160 3659 3659 HOH WAT A . 
G 3 HOH 161 3660 3660 HOH WAT A . 
G 3 HOH 162 3668 3668 HOH WAT A . 
G 3 HOH 163 3669 3669 HOH WAT A . 
G 3 HOH 164 3674 3674 HOH WAT A . 
G 3 HOH 165 3679 3679 HOH WAT A . 
G 3 HOH 166 3681 3681 HOH WAT A . 
G 3 HOH 167 3683 3683 HOH WAT A . 
G 3 HOH 168 3685 3685 HOH WAT A . 
G 3 HOH 169 3686 3686 HOH WAT A . 
G 3 HOH 170 3687 3687 HOH WAT A . 
G 3 HOH 171 3690 3690 HOH WAT A . 
G 3 HOH 172 3691 3691 HOH WAT A . 
G 3 HOH 173 3694 3694 HOH WAT A . 
G 3 HOH 174 3700 3700 HOH WAT A . 
G 3 HOH 175 3701 3701 HOH WAT A . 
G 3 HOH 176 3703 3703 HOH WAT A . 
G 3 HOH 177 3705 3705 HOH WAT A . 
G 3 HOH 178 3708 3708 HOH WAT A . 
G 3 HOH 179 3713 3713 HOH WAT A . 
G 3 HOH 180 3718 3718 HOH WAT A . 
G 3 HOH 181 3720 3720 HOH WAT A . 
G 3 HOH 182 3722 3722 HOH WAT A . 
G 3 HOH 183 3726 3726 HOH WAT A . 
G 3 HOH 184 3728 3728 HOH WAT A . 
G 3 HOH 185 3729 3729 HOH WAT A . 
G 3 HOH 186 3730 3730 HOH WAT A . 
G 3 HOH 187 3748 3748 HOH WAT A . 
G 3 HOH 188 3750 3750 HOH WAT A . 
G 3 HOH 189 3752 3752 HOH WAT A . 
G 3 HOH 190 3754 3754 HOH WAT A . 
G 3 HOH 191 3762 3762 HOH WAT A . 
G 3 HOH 192 3767 3767 HOH WAT A . 
G 3 HOH 193 3778 3778 HOH WAT A . 
G 3 HOH 194 3779 3779 HOH WAT A . 
G 3 HOH 195 3781 3781 HOH WAT A . 
G 3 HOH 196 3783 3783 HOH WAT A . 
G 3 HOH 197 3784 3784 HOH WAT A . 
G 3 HOH 198 3789 3789 HOH WAT A . 
G 3 HOH 199 3791 3791 HOH WAT A . 
G 3 HOH 200 3796 3796 HOH WAT A . 
G 3 HOH 201 3797 3797 HOH WAT A . 
G 3 HOH 202 3798 3798 HOH WAT A . 
G 3 HOH 203 3799 3799 HOH WAT A . 
G 3 HOH 204 3802 3802 HOH WAT A . 
G 3 HOH 205 3804 3804 HOH WAT A . 
G 3 HOH 206 3805 3805 HOH WAT A . 
G 3 HOH 207 3808 3808 HOH WAT A . 
G 3 HOH 208 3813 3813 HOH WAT A . 
G 3 HOH 209 3816 3816 HOH WAT A . 
G 3 HOH 210 3819 3819 HOH WAT A . 
G 3 HOH 211 3820 3820 HOH WAT A . 
G 3 HOH 212 3821 3821 HOH WAT A . 
G 3 HOH 213 3824 3824 HOH WAT A . 
G 3 HOH 214 3825 3825 HOH WAT A . 
G 3 HOH 215 3838 3838 HOH WAT A . 
G 3 HOH 216 3843 3843 HOH WAT A . 
G 3 HOH 217 3846 3846 HOH WAT A . 
G 3 HOH 218 3847 3847 HOH WAT A . 
G 3 HOH 219 3857 3857 HOH WAT A . 
G 3 HOH 220 3860 3860 HOH WAT A . 
G 3 HOH 221 3864 3864 HOH WAT A . 
G 3 HOH 222 3869 3869 HOH WAT A . 
G 3 HOH 223 3870 3870 HOH WAT A . 
G 3 HOH 224 3873 3873 HOH WAT A . 
G 3 HOH 225 3875 3875 HOH WAT A . 
G 3 HOH 226 3877 3877 HOH WAT A . 
G 3 HOH 227 3878 3878 HOH WAT A . 
G 3 HOH 228 3879 3879 HOH WAT A . 
G 3 HOH 229 3883 3883 HOH WAT A . 
G 3 HOH 230 3885 3885 HOH WAT A . 
G 3 HOH 231 3886 3886 HOH WAT A . 
G 3 HOH 232 3887 3887 HOH WAT A . 
G 3 HOH 233 3893 3893 HOH WAT A . 
H 3 HOH 1   3185 3185 HOH WAT B . 
H 3 HOH 2   3188 3188 HOH WAT B . 
H 3 HOH 3   3193 3193 HOH WAT B . 
H 3 HOH 4   3194 3194 HOH WAT B . 
H 3 HOH 5   3196 3196 HOH WAT B . 
H 3 HOH 6   3202 3202 HOH WAT B . 
H 3 HOH 7   3206 3206 HOH WAT B . 
H 3 HOH 8   3207 3207 HOH WAT B . 
H 3 HOH 9   3210 3210 HOH WAT B . 
H 3 HOH 10  3212 3212 HOH WAT B . 
H 3 HOH 11  3215 3215 HOH WAT B . 
H 3 HOH 12  3217 3217 HOH WAT B . 
H 3 HOH 13  3219 3219 HOH WAT B . 
H 3 HOH 14  3220 3220 HOH WAT B . 
H 3 HOH 15  3221 3221 HOH WAT B . 
H 3 HOH 16  3222 3222 HOH WAT B . 
H 3 HOH 17  3230 3230 HOH WAT B . 
H 3 HOH 18  3231 3231 HOH WAT B . 
H 3 HOH 19  3232 3232 HOH WAT B . 
H 3 HOH 20  3235 3235 HOH WAT B . 
H 3 HOH 21  3236 3236 HOH WAT B . 
H 3 HOH 22  3241 3241 HOH WAT B . 
H 3 HOH 23  3242 3242 HOH WAT B . 
H 3 HOH 24  3245 3245 HOH WAT B . 
H 3 HOH 25  3248 3248 HOH WAT B . 
H 3 HOH 26  3249 3249 HOH WAT B . 
H 3 HOH 27  3251 3251 HOH WAT B . 
H 3 HOH 28  3254 3254 HOH WAT B . 
H 3 HOH 29  3262 3262 HOH WAT B . 
H 3 HOH 30  3268 3268 HOH WAT B . 
H 3 HOH 31  3272 3272 HOH WAT B . 
H 3 HOH 32  3279 3279 HOH WAT B . 
H 3 HOH 33  3281 3281 HOH WAT B . 
H 3 HOH 34  3285 3285 HOH WAT B . 
H 3 HOH 35  3287 3287 HOH WAT B . 
H 3 HOH 36  3289 3289 HOH WAT B . 
H 3 HOH 37  3296 3296 HOH WAT B . 
H 3 HOH 38  3299 3299 HOH WAT B . 
H 3 HOH 39  3304 3304 HOH WAT B . 
H 3 HOH 40  3309 3309 HOH WAT B . 
H 3 HOH 41  3312 3312 HOH WAT B . 
H 3 HOH 42  3313 3313 HOH WAT B . 
H 3 HOH 43  3320 3320 HOH WAT B . 
H 3 HOH 44  3328 3328 HOH WAT B . 
H 3 HOH 45  3338 3338 HOH WAT B . 
H 3 HOH 46  3341 3341 HOH WAT B . 
H 3 HOH 47  3342 3342 HOH WAT B . 
H 3 HOH 48  3349 3349 HOH WAT B . 
H 3 HOH 49  3352 3352 HOH WAT B . 
H 3 HOH 50  3358 3358 HOH WAT B . 
H 3 HOH 51  3361 3361 HOH WAT B . 
H 3 HOH 52  3362 3362 HOH WAT B . 
H 3 HOH 53  3367 3367 HOH WAT B . 
H 3 HOH 54  3368 3368 HOH WAT B . 
H 3 HOH 55  3371 3371 HOH WAT B . 
H 3 HOH 56  3373 3373 HOH WAT B . 
H 3 HOH 57  3375 3375 HOH WAT B . 
H 3 HOH 58  3376 3376 HOH WAT B . 
H 3 HOH 59  3379 3379 HOH WAT B . 
H 3 HOH 60  3380 3380 HOH WAT B . 
H 3 HOH 61  3388 3388 HOH WAT B . 
H 3 HOH 62  3392 3392 HOH WAT B . 
H 3 HOH 63  3393 3393 HOH WAT B . 
H 3 HOH 64  3394 3394 HOH WAT B . 
H 3 HOH 65  3398 3398 HOH WAT B . 
H 3 HOH 66  3400 3400 HOH WAT B . 
H 3 HOH 67  3403 3403 HOH WAT B . 
H 3 HOH 68  3407 3407 HOH WAT B . 
H 3 HOH 69  3409 3409 HOH WAT B . 
H 3 HOH 70  3411 3411 HOH WAT B . 
H 3 HOH 71  3421 3421 HOH WAT B . 
H 3 HOH 72  3424 3424 HOH WAT B . 
H 3 HOH 73  3427 3427 HOH WAT B . 
H 3 HOH 74  3435 3435 HOH WAT B . 
H 3 HOH 75  3439 3439 HOH WAT B . 
H 3 HOH 76  3440 3440 HOH WAT B . 
H 3 HOH 77  3441 3441 HOH WAT B . 
H 3 HOH 78  3444 3444 HOH WAT B . 
H 3 HOH 79  3447 3447 HOH WAT B . 
H 3 HOH 80  3448 3448 HOH WAT B . 
H 3 HOH 81  3454 3454 HOH WAT B . 
H 3 HOH 82  3462 3462 HOH WAT B . 
H 3 HOH 83  3464 3464 HOH WAT B . 
H 3 HOH 84  3469 3469 HOH WAT B . 
H 3 HOH 85  3470 3470 HOH WAT B . 
H 3 HOH 86  3471 3471 HOH WAT B . 
H 3 HOH 87  3476 3476 HOH WAT B . 
H 3 HOH 88  3484 3484 HOH WAT B . 
H 3 HOH 89  3486 3486 HOH WAT B . 
H 3 HOH 90  3497 3497 HOH WAT B . 
H 3 HOH 91  3498 3498 HOH WAT B . 
H 3 HOH 92  3499 3499 HOH WAT B . 
H 3 HOH 93  3501 3501 HOH WAT B . 
H 3 HOH 94  3505 3505 HOH WAT B . 
H 3 HOH 95  3512 3512 HOH WAT B . 
H 3 HOH 96  3518 3518 HOH WAT B . 
H 3 HOH 97  3519 3519 HOH WAT B . 
H 3 HOH 98  3522 3522 HOH WAT B . 
H 3 HOH 99  3523 3523 HOH WAT B . 
H 3 HOH 100 3526 3526 HOH WAT B . 
H 3 HOH 101 3527 3527 HOH WAT B . 
H 3 HOH 102 3532 3532 HOH WAT B . 
H 3 HOH 103 3533 3533 HOH WAT B . 
H 3 HOH 104 3535 3535 HOH WAT B . 
H 3 HOH 105 3537 3537 HOH WAT B . 
H 3 HOH 106 3540 3540 HOH WAT B . 
H 3 HOH 107 3547 3547 HOH WAT B . 
H 3 HOH 108 3553 3553 HOH WAT B . 
H 3 HOH 109 3558 3558 HOH WAT B . 
H 3 HOH 110 3560 3560 HOH WAT B . 
H 3 HOH 111 3565 3565 HOH WAT B . 
H 3 HOH 112 3566 3566 HOH WAT B . 
H 3 HOH 113 3567 3567 HOH WAT B . 
H 3 HOH 114 3568 3568 HOH WAT B . 
H 3 HOH 115 3569 3569 HOH WAT B . 
H 3 HOH 116 3571 3571 HOH WAT B . 
H 3 HOH 117 3574 3574 HOH WAT B . 
H 3 HOH 118 3575 3575 HOH WAT B . 
H 3 HOH 119 3576 3576 HOH WAT B . 
H 3 HOH 120 3579 3579 HOH WAT B . 
H 3 HOH 121 3580 3580 HOH WAT B . 
H 3 HOH 122 3581 3581 HOH WAT B . 
H 3 HOH 123 3582 3582 HOH WAT B . 
H 3 HOH 124 3584 3584 HOH WAT B . 
H 3 HOH 125 3586 3586 HOH WAT B . 
H 3 HOH 126 3589 3589 HOH WAT B . 
H 3 HOH 127 3590 3590 HOH WAT B . 
H 3 HOH 128 3591 3591 HOH WAT B . 
H 3 HOH 129 3592 3592 HOH WAT B . 
H 3 HOH 130 3598 3598 HOH WAT B . 
H 3 HOH 131 3610 3610 HOH WAT B . 
H 3 HOH 132 3613 3613 HOH WAT B . 
H 3 HOH 133 3619 3619 HOH WAT B . 
H 3 HOH 134 3620 3620 HOH WAT B . 
H 3 HOH 135 3621 3621 HOH WAT B . 
H 3 HOH 136 3628 3628 HOH WAT B . 
H 3 HOH 137 3629 3629 HOH WAT B . 
H 3 HOH 138 3638 3638 HOH WAT B . 
H 3 HOH 139 3643 3643 HOH WAT B . 
H 3 HOH 140 3650 3650 HOH WAT B . 
H 3 HOH 141 3656 3656 HOH WAT B . 
H 3 HOH 142 3661 3661 HOH WAT B . 
H 3 HOH 143 3663 3663 HOH WAT B . 
H 3 HOH 144 3664 3664 HOH WAT B . 
H 3 HOH 145 3665 3665 HOH WAT B . 
H 3 HOH 146 3666 3666 HOH WAT B . 
H 3 HOH 147 3667 3667 HOH WAT B . 
H 3 HOH 148 3675 3675 HOH WAT B . 
H 3 HOH 149 3676 3676 HOH WAT B . 
H 3 HOH 150 3678 3678 HOH WAT B . 
H 3 HOH 151 3680 3680 HOH WAT B . 
H 3 HOH 152 3684 3684 HOH WAT B . 
H 3 HOH 153 3689 3689 HOH WAT B . 
H 3 HOH 154 3695 3695 HOH WAT B . 
H 3 HOH 155 3696 3696 HOH WAT B . 
H 3 HOH 156 3698 3698 HOH WAT B . 
H 3 HOH 157 3702 3702 HOH WAT B . 
H 3 HOH 158 3704 3704 HOH WAT B . 
H 3 HOH 159 3710 3710 HOH WAT B . 
H 3 HOH 160 3711 3711 HOH WAT B . 
H 3 HOH 161 3712 3712 HOH WAT B . 
H 3 HOH 162 3715 3715 HOH WAT B . 
H 3 HOH 163 3716 3716 HOH WAT B . 
H 3 HOH 164 3717 3717 HOH WAT B . 
H 3 HOH 165 3721 3721 HOH WAT B . 
H 3 HOH 166 3733 3733 HOH WAT B . 
H 3 HOH 167 3734 3734 HOH WAT B . 
H 3 HOH 168 3735 3735 HOH WAT B . 
H 3 HOH 169 3737 3737 HOH WAT B . 
H 3 HOH 170 3738 3738 HOH WAT B . 
H 3 HOH 171 3741 3741 HOH WAT B . 
H 3 HOH 172 3742 3742 HOH WAT B . 
H 3 HOH 173 3749 3749 HOH WAT B . 
H 3 HOH 174 3751 3751 HOH WAT B . 
H 3 HOH 175 3753 3753 HOH WAT B . 
H 3 HOH 176 3756 3756 HOH WAT B . 
H 3 HOH 177 3758 3758 HOH WAT B . 
H 3 HOH 178 3759 3759 HOH WAT B . 
H 3 HOH 179 3760 3760 HOH WAT B . 
H 3 HOH 180 3770 3770 HOH WAT B . 
H 3 HOH 181 3772 3772 HOH WAT B . 
H 3 HOH 182 3786 3786 HOH WAT B . 
H 3 HOH 183 3787 3787 HOH WAT B . 
H 3 HOH 184 3790 3790 HOH WAT B . 
H 3 HOH 185 3792 3792 HOH WAT B . 
H 3 HOH 186 3793 3793 HOH WAT B . 
H 3 HOH 187 3794 3794 HOH WAT B . 
H 3 HOH 188 3800 3800 HOH WAT B . 
H 3 HOH 189 3801 3801 HOH WAT B . 
H 3 HOH 190 3803 3803 HOH WAT B . 
H 3 HOH 191 3806 3806 HOH WAT B . 
H 3 HOH 192 3807 3807 HOH WAT B . 
H 3 HOH 193 3809 3809 HOH WAT B . 
H 3 HOH 194 3810 3810 HOH WAT B . 
H 3 HOH 195 3811 3811 HOH WAT B . 
H 3 HOH 196 3812 3812 HOH WAT B . 
H 3 HOH 197 3814 3814 HOH WAT B . 
H 3 HOH 198 3817 3817 HOH WAT B . 
H 3 HOH 199 3827 3827 HOH WAT B . 
H 3 HOH 200 3828 3828 HOH WAT B . 
H 3 HOH 201 3834 3834 HOH WAT B . 
H 3 HOH 202 3835 3835 HOH WAT B . 
H 3 HOH 203 3836 3836 HOH WAT B . 
H 3 HOH 204 3839 3839 HOH WAT B . 
H 3 HOH 205 3852 3852 HOH WAT B . 
H 3 HOH 206 3854 3854 HOH WAT B . 
H 3 HOH 207 3856 3856 HOH WAT B . 
H 3 HOH 208 3858 3858 HOH WAT B . 
H 3 HOH 209 3859 3859 HOH WAT B . 
H 3 HOH 210 3861 3861 HOH WAT B . 
H 3 HOH 211 3862 3862 HOH WAT B . 
H 3 HOH 212 3863 3863 HOH WAT B . 
H 3 HOH 213 3867 3867 HOH WAT B . 
H 3 HOH 214 3868 3868 HOH WAT B . 
H 3 HOH 215 3872 3872 HOH WAT B . 
H 3 HOH 216 3874 3874 HOH WAT B . 
H 3 HOH 217 3881 3881 HOH WAT B . 
H 3 HOH 218 3882 3882 HOH WAT B . 
H 3 HOH 219 3884 3884 HOH WAT B . 
H 3 HOH 220 3891 3891 HOH WAT B . 
H 3 HOH 221 3892 3892 HOH WAT B . 
H 3 HOH 222 3895 3895 HOH WAT B . 
H 3 HOH 223 3896 3896 HOH WAT B . 
I 3 HOH 1   3186 3186 HOH WAT C . 
I 3 HOH 2   3189 3189 HOH WAT C . 
I 3 HOH 3   3195 3195 HOH WAT C . 
I 3 HOH 4   3198 3198 HOH WAT C . 
I 3 HOH 5   3199 3199 HOH WAT C . 
I 3 HOH 6   3201 3201 HOH WAT C . 
I 3 HOH 7   3203 3203 HOH WAT C . 
I 3 HOH 8   3204 3204 HOH WAT C . 
I 3 HOH 9   3205 3205 HOH WAT C . 
I 3 HOH 10  3213 3213 HOH WAT C . 
I 3 HOH 11  3214 3214 HOH WAT C . 
I 3 HOH 12  3224 3224 HOH WAT C . 
I 3 HOH 13  3225 3225 HOH WAT C . 
I 3 HOH 14  3226 3226 HOH WAT C . 
I 3 HOH 15  3228 3228 HOH WAT C . 
I 3 HOH 16  3229 3229 HOH WAT C . 
I 3 HOH 17  3233 3233 HOH WAT C . 
I 3 HOH 18  3238 3238 HOH WAT C . 
I 3 HOH 19  3240 3240 HOH WAT C . 
I 3 HOH 20  3243 3243 HOH WAT C . 
I 3 HOH 21  3244 3244 HOH WAT C . 
I 3 HOH 22  3246 3246 HOH WAT C . 
I 3 HOH 23  3247 3247 HOH WAT C . 
I 3 HOH 24  3250 3250 HOH WAT C . 
I 3 HOH 25  3252 3252 HOH WAT C . 
I 3 HOH 26  3253 3253 HOH WAT C . 
I 3 HOH 27  3256 3256 HOH WAT C . 
I 3 HOH 28  3257 3257 HOH WAT C . 
I 3 HOH 29  3260 3260 HOH WAT C . 
I 3 HOH 30  3261 3261 HOH WAT C . 
I 3 HOH 31  3264 3264 HOH WAT C . 
I 3 HOH 32  3266 3266 HOH WAT C . 
I 3 HOH 33  3267 3267 HOH WAT C . 
I 3 HOH 34  3269 3269 HOH WAT C . 
I 3 HOH 35  3275 3275 HOH WAT C . 
I 3 HOH 36  3280 3280 HOH WAT C . 
I 3 HOH 37  3282 3282 HOH WAT C . 
I 3 HOH 38  3286 3286 HOH WAT C . 
I 3 HOH 39  3288 3288 HOH WAT C . 
I 3 HOH 40  3290 3290 HOH WAT C . 
I 3 HOH 41  3295 3295 HOH WAT C . 
I 3 HOH 42  3298 3298 HOH WAT C . 
I 3 HOH 43  3301 3301 HOH WAT C . 
I 3 HOH 44  3303 3303 HOH WAT C . 
I 3 HOH 45  3305 3305 HOH WAT C . 
I 3 HOH 46  3311 3311 HOH WAT C . 
I 3 HOH 47  3315 3315 HOH WAT C . 
I 3 HOH 48  3316 3316 HOH WAT C . 
I 3 HOH 49  3317 3317 HOH WAT C . 
I 3 HOH 50  3319 3319 HOH WAT C . 
I 3 HOH 51  3321 3321 HOH WAT C . 
I 3 HOH 52  3322 3322 HOH WAT C . 
I 3 HOH 53  3323 3323 HOH WAT C . 
I 3 HOH 54  3324 3324 HOH WAT C . 
I 3 HOH 55  3327 3327 HOH WAT C . 
I 3 HOH 56  3329 3329 HOH WAT C . 
I 3 HOH 57  3331 3331 HOH WAT C . 
I 3 HOH 58  3332 3332 HOH WAT C . 
I 3 HOH 59  3333 3333 HOH WAT C . 
I 3 HOH 60  3337 3337 HOH WAT C . 
I 3 HOH 61  3340 3340 HOH WAT C . 
I 3 HOH 62  3350 3350 HOH WAT C . 
I 3 HOH 63  3351 3351 HOH WAT C . 
I 3 HOH 64  3353 3353 HOH WAT C . 
I 3 HOH 65  3354 3354 HOH WAT C . 
I 3 HOH 66  3356 3356 HOH WAT C . 
I 3 HOH 67  3357 3357 HOH WAT C . 
I 3 HOH 68  3359 3359 HOH WAT C . 
I 3 HOH 69  3360 3360 HOH WAT C . 
I 3 HOH 70  3365 3365 HOH WAT C . 
I 3 HOH 71  3366 3366 HOH WAT C . 
I 3 HOH 72  3369 3369 HOH WAT C . 
I 3 HOH 73  3370 3370 HOH WAT C . 
I 3 HOH 74  3372 3372 HOH WAT C . 
I 3 HOH 75  3378 3378 HOH WAT C . 
I 3 HOH 76  3381 3381 HOH WAT C . 
I 3 HOH 77  3383 3383 HOH WAT C . 
I 3 HOH 78  3384 3384 HOH WAT C . 
I 3 HOH 79  3385 3385 HOH WAT C . 
I 3 HOH 80  3386 3386 HOH WAT C . 
I 3 HOH 81  3387 3387 HOH WAT C . 
I 3 HOH 82  3396 3396 HOH WAT C . 
I 3 HOH 83  3401 3401 HOH WAT C . 
I 3 HOH 84  3402 3402 HOH WAT C . 
I 3 HOH 85  3404 3404 HOH WAT C . 
I 3 HOH 86  3405 3405 HOH WAT C . 
I 3 HOH 87  3413 3413 HOH WAT C . 
I 3 HOH 88  3416 3416 HOH WAT C . 
I 3 HOH 89  3417 3417 HOH WAT C . 
I 3 HOH 90  3419 3419 HOH WAT C . 
I 3 HOH 91  3420 3420 HOH WAT C . 
I 3 HOH 92  3423 3423 HOH WAT C . 
I 3 HOH 93  3425 3425 HOH WAT C . 
I 3 HOH 94  3428 3428 HOH WAT C . 
I 3 HOH 95  3429 3429 HOH WAT C . 
I 3 HOH 96  3431 3431 HOH WAT C . 
I 3 HOH 97  3433 3433 HOH WAT C . 
I 3 HOH 98  3436 3436 HOH WAT C . 
I 3 HOH 99  3438 3438 HOH WAT C . 
I 3 HOH 100 3445 3445 HOH WAT C . 
I 3 HOH 101 3450 3450 HOH WAT C . 
I 3 HOH 102 3451 3451 HOH WAT C . 
I 3 HOH 103 3452 3452 HOH WAT C . 
I 3 HOH 104 3453 3453 HOH WAT C . 
I 3 HOH 105 3455 3455 HOH WAT C . 
I 3 HOH 106 3457 3457 HOH WAT C . 
I 3 HOH 107 3458 3458 HOH WAT C . 
I 3 HOH 108 3460 3460 HOH WAT C . 
I 3 HOH 109 3463 3463 HOH WAT C . 
I 3 HOH 110 3466 3466 HOH WAT C . 
I 3 HOH 111 3467 3467 HOH WAT C . 
I 3 HOH 112 3472 3472 HOH WAT C . 
I 3 HOH 113 3473 3473 HOH WAT C . 
I 3 HOH 114 3479 3479 HOH WAT C . 
I 3 HOH 115 3480 3480 HOH WAT C . 
I 3 HOH 116 3481 3481 HOH WAT C . 
I 3 HOH 117 3485 3485 HOH WAT C . 
I 3 HOH 118 3487 3487 HOH WAT C . 
I 3 HOH 119 3489 3489 HOH WAT C . 
I 3 HOH 120 3490 3490 HOH WAT C . 
I 3 HOH 121 3491 3491 HOH WAT C . 
I 3 HOH 122 3492 3492 HOH WAT C . 
I 3 HOH 123 3493 3493 HOH WAT C . 
I 3 HOH 124 3494 3494 HOH WAT C . 
I 3 HOH 125 3496 3496 HOH WAT C . 
I 3 HOH 126 3507 3507 HOH WAT C . 
I 3 HOH 127 3509 3509 HOH WAT C . 
I 3 HOH 128 3510 3510 HOH WAT C . 
I 3 HOH 129 3511 3511 HOH WAT C . 
I 3 HOH 130 3514 3514 HOH WAT C . 
I 3 HOH 131 3525 3525 HOH WAT C . 
I 3 HOH 132 3529 3529 HOH WAT C . 
I 3 HOH 133 3530 3530 HOH WAT C . 
I 3 HOH 134 3531 3531 HOH WAT C . 
I 3 HOH 135 3542 3542 HOH WAT C . 
I 3 HOH 136 3543 3543 HOH WAT C . 
I 3 HOH 137 3555 3555 HOH WAT C . 
I 3 HOH 138 3556 3556 HOH WAT C . 
I 3 HOH 139 3562 3562 HOH WAT C . 
I 3 HOH 140 3563 3563 HOH WAT C . 
I 3 HOH 141 3564 3564 HOH WAT C . 
I 3 HOH 142 3570 3570 HOH WAT C . 
I 3 HOH 143 3573 3573 HOH WAT C . 
I 3 HOH 144 3583 3583 HOH WAT C . 
I 3 HOH 145 3585 3585 HOH WAT C . 
I 3 HOH 146 3587 3587 HOH WAT C . 
I 3 HOH 147 3596 3596 HOH WAT C . 
I 3 HOH 148 3597 3597 HOH WAT C . 
I 3 HOH 149 3599 3599 HOH WAT C . 
I 3 HOH 150 3602 3602 HOH WAT C . 
I 3 HOH 151 3603 3603 HOH WAT C . 
I 3 HOH 152 3604 3604 HOH WAT C . 
I 3 HOH 153 3605 3605 HOH WAT C . 
I 3 HOH 154 3606 3606 HOH WAT C . 
I 3 HOH 155 3608 3608 HOH WAT C . 
I 3 HOH 156 3609 3609 HOH WAT C . 
I 3 HOH 157 3612 3612 HOH WAT C . 
I 3 HOH 158 3614 3614 HOH WAT C . 
I 3 HOH 159 3617 3617 HOH WAT C . 
I 3 HOH 160 3618 3618 HOH WAT C . 
I 3 HOH 161 3626 3626 HOH WAT C . 
I 3 HOH 162 3627 3627 HOH WAT C . 
I 3 HOH 163 3631 3631 HOH WAT C . 
I 3 HOH 164 3632 3632 HOH WAT C . 
I 3 HOH 165 3633 3633 HOH WAT C . 
I 3 HOH 166 3634 3634 HOH WAT C . 
I 3 HOH 167 3637 3637 HOH WAT C . 
I 3 HOH 168 3642 3642 HOH WAT C . 
I 3 HOH 169 3645 3645 HOH WAT C . 
I 3 HOH 170 3646 3646 HOH WAT C . 
I 3 HOH 171 3647 3647 HOH WAT C . 
I 3 HOH 172 3649 3649 HOH WAT C . 
I 3 HOH 173 3652 3652 HOH WAT C . 
I 3 HOH 174 3654 3654 HOH WAT C . 
I 3 HOH 175 3662 3662 HOH WAT C . 
I 3 HOH 176 3670 3670 HOH WAT C . 
I 3 HOH 177 3671 3671 HOH WAT C . 
I 3 HOH 178 3672 3672 HOH WAT C . 
I 3 HOH 179 3673 3673 HOH WAT C . 
I 3 HOH 180 3677 3677 HOH WAT C . 
I 3 HOH 181 3682 3682 HOH WAT C . 
I 3 HOH 182 3688 3688 HOH WAT C . 
I 3 HOH 183 3692 3692 HOH WAT C . 
I 3 HOH 184 3693 3693 HOH WAT C . 
I 3 HOH 185 3697 3697 HOH WAT C . 
I 3 HOH 186 3699 3699 HOH WAT C . 
I 3 HOH 187 3706 3706 HOH WAT C . 
I 3 HOH 188 3707 3707 HOH WAT C . 
I 3 HOH 189 3709 3709 HOH WAT C . 
I 3 HOH 190 3714 3714 HOH WAT C . 
I 3 HOH 191 3719 3719 HOH WAT C . 
I 3 HOH 192 3723 3723 HOH WAT C . 
I 3 HOH 193 3724 3724 HOH WAT C . 
I 3 HOH 194 3725 3725 HOH WAT C . 
I 3 HOH 195 3727 3727 HOH WAT C . 
I 3 HOH 196 3731 3731 HOH WAT C . 
I 3 HOH 197 3732 3732 HOH WAT C . 
I 3 HOH 198 3736 3736 HOH WAT C . 
I 3 HOH 199 3739 3739 HOH WAT C . 
I 3 HOH 200 3740 3740 HOH WAT C . 
I 3 HOH 201 3743 3743 HOH WAT C . 
I 3 HOH 202 3744 3744 HOH WAT C . 
I 3 HOH 203 3745 3745 HOH WAT C . 
I 3 HOH 204 3746 3746 HOH WAT C . 
I 3 HOH 205 3747 3747 HOH WAT C . 
I 3 HOH 206 3755 3755 HOH WAT C . 
I 3 HOH 207 3757 3757 HOH WAT C . 
I 3 HOH 208 3761 3761 HOH WAT C . 
I 3 HOH 209 3763 3763 HOH WAT C . 
I 3 HOH 210 3764 3764 HOH WAT C . 
I 3 HOH 211 3765 3765 HOH WAT C . 
I 3 HOH 212 3766 3766 HOH WAT C . 
I 3 HOH 213 3768 3768 HOH WAT C . 
I 3 HOH 214 3769 3769 HOH WAT C . 
I 3 HOH 215 3771 3771 HOH WAT C . 
I 3 HOH 216 3773 3773 HOH WAT C . 
I 3 HOH 217 3774 3774 HOH WAT C . 
I 3 HOH 218 3775 3775 HOH WAT C . 
I 3 HOH 219 3776 3776 HOH WAT C . 
I 3 HOH 220 3777 3777 HOH WAT C . 
I 3 HOH 221 3780 3780 HOH WAT C . 
I 3 HOH 222 3782 3782 HOH WAT C . 
I 3 HOH 223 3785 3785 HOH WAT C . 
I 3 HOH 224 3788 3788 HOH WAT C . 
I 3 HOH 225 3795 3795 HOH WAT C . 
I 3 HOH 226 3815 3815 HOH WAT C . 
I 3 HOH 227 3818 3818 HOH WAT C . 
I 3 HOH 228 3822 3822 HOH WAT C . 
I 3 HOH 229 3823 3823 HOH WAT C . 
I 3 HOH 230 3826 3826 HOH WAT C . 
I 3 HOH 231 3829 3829 HOH WAT C . 
I 3 HOH 232 3830 3830 HOH WAT C . 
I 3 HOH 233 3831 3831 HOH WAT C . 
I 3 HOH 234 3832 3832 HOH WAT C . 
I 3 HOH 235 3833 3833 HOH WAT C . 
I 3 HOH 236 3837 3837 HOH WAT C . 
I 3 HOH 237 3840 3840 HOH WAT C . 
I 3 HOH 238 3841 3841 HOH WAT C . 
I 3 HOH 239 3842 3842 HOH WAT C . 
I 3 HOH 240 3844 3844 HOH WAT C . 
I 3 HOH 241 3845 3845 HOH WAT C . 
I 3 HOH 242 3848 3848 HOH WAT C . 
I 3 HOH 243 3849 3849 HOH WAT C . 
I 3 HOH 244 3850 3850 HOH WAT C . 
I 3 HOH 245 3851 3851 HOH WAT C . 
I 3 HOH 246 3853 3853 HOH WAT C . 
I 3 HOH 247 3855 3855 HOH WAT C . 
I 3 HOH 248 3865 3865 HOH WAT C . 
I 3 HOH 249 3866 3866 HOH WAT C . 
I 3 HOH 250 3871 3871 HOH WAT C . 
I 3 HOH 251 3876 3876 HOH WAT C . 
I 3 HOH 252 3880 3880 HOH WAT C . 
I 3 HOH 253 3888 3888 HOH WAT C . 
I 3 HOH 254 3889 3889 HOH WAT C . 
I 3 HOH 255 3890 3890 HOH WAT C . 
I 3 HOH 256 3894 3894 HOH WAT C . 
#