data_1LV5
# 
_entry.id   1LV5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LV5         
NDB   PD0317       
RCSB  RCSB016304   
WWPDB D_1000016304 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1L3S '1L3S IS THE WILD TYPE BACILLUS DNA POLYMERASE I BOUND TO A 9 BASE PAIR DNA DUPLEX IN THE OPEN CONFORMATION' unspecified 
PDB 1L3T 
;1L3T IS A 10 BASE PAIR PROTEIN-DNA PRODUCT COMPLEX, PRODUCED BY PLACING A CRYSTAL OF THE 9 BASE PAIR COMPLEX (1L3S) IN A STABILIZATION SOLUTION CONTAINING DTTP.
;
unspecified 
PDB 1L3U 
;1L3U IS AN 11 BASE PAIR PROTEIN-DNA PRODUCT COMPLEX, PRODUCED BY PLACING A CRYSTAL OF THE 9 BASE PAIR COMPLEX (1L3S) IN A STABILIZATION SOLUTION CONTAINING DTTP AND DATP.
;
unspecified 
PDB 1L5U 
;1L5U IS A 12 BASE PAIR PROTEIN-DNA PRODUCT COMPLEX, PRODUCED BY PLACING A CRYSTAL OF THE 9 BASE PAIR COMPLEX (1L3S) IN A STABILIZATION SOLUTION CONTAINING DTTP, DATP, AND DCTP.
;
unspecified 
PDB 1L3V 
;1L3V IS A 15 BASE PAIR PROTEIN-DNA PRODUCT COMPLEX, PRODUCED BY PLACING A CRYSTAL OF THE 9 BASE PAIR COMPLEX (1L3S) IN A STABILIZATION SOLUTION CONTAINING DTTP, DATP, DCTP, AND DGTP.
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LV5 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johnson, S.J.' 1 
'Taylor, J.S.'  2 
'Beese, L.S.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Processive DNA synthesis observed in a polymerase crystal suggests a 
mechanism for the prevention of frameshift mutations
;
Proc.Natl.Acad.Sci.USA 100 3895 3900 2003 PNASA6 US 0027-8424 0040 ? 12649320 10.1073/pnas.0630532100         
1       'Visualizing DNA Replication in a Catalytically Active Bacillus DNA Polymerase Crystal' Nature                 391 304  
307  1998 NATUAS UK 0028-0836 0006 ? ?        10.1038/34693                   
2       'Crystal Structure of a Thermostable Bacillus DNA Polymerase I Large Fragment at 2.1 A Resolution' Structure              
5   95   108  1997 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(97)00169-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Johnson, S.J.'  1  
primary 'Taylor, J.S.'   2  
primary 'Beese, L.S.'    3  
1       'Kiefer, J.R.'   4  
1       'Mao, C.'        5  
1       'Braman, J.C.'   6  
1       'Beese, L.S.'    7  
2       'Kiefer, J.R.'   8  
2       'Mao, C.'        9  
2       'Hansen, C.J.'   10 
2       'Basehore, S.L.' 11 
2       'Hogrefe, H.H.'  12 
2       'Braman, J.C.'   13 
2       'Beese, L.S.'    14 
# 
_cell.entry_id           1LV5 
_cell.length_a           91.681 
_cell.length_b           91.681 
_cell.length_c           190.116 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LV5 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*AP*TP*CP*AP*GP*CP*GP*A)-3'"             3094.043  2   ?       ?     ? 'PRIMER STRAND'   
2 polymer     syn "5'-D(*AP*CP*GP*TP*CP*GP*CP*TP*GP*AP*TP*CP*CP*G)-3'" 4256.767  2   ?       ?     ? 'Template Strand' 
3 polymer     man 'DNA POLYMERASE I'                                   66128.836 2   2.7.7.7 D329A 
'BACILLUS FRAGMENT (ANALOGOUS TO THE E. COLI KLENOW FRAGMENT)' ?                 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    2   ?       ?     ? ?                 
5 non-polymer syn 'MAGNESIUM ION'                                      24.305    1   ?       ?     ? ?                 
6 non-polymer syn 'SULFATE ION'                                        96.063    2   ?       ?     ? ?                 
7 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                   467.157   2   ?       ?     ? ?                 
8 water       nat water                                                18.015    186 ?       ?     ? ?                 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DG)(DA)(DT)(DC)(DA)(DG)(DC)(DG)(DA)' GGATCAGCGA C,E ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(DT)(DC)(DC)(DG)' ACGTCGCTGATCCG D,F ? 
3 'polypeptide(L)'        no no 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DA  n 
1 4   DT  n 
1 5   DC  n 
1 6   DA  n 
1 7   DG  n 
1 8   DC  n 
1 9   DG  n 
1 10  DA  n 
2 1   DA  n 
2 2   DC  n 
2 3   DG  n 
2 4   DT  n 
2 5   DC  n 
2 6   DG  n 
2 7   DC  n 
2 8   DT  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DC  n 
2 13  DC  n 
2 14  DG  n 
3 1   ALA n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ALA n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-30A(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'THIS PROTEIN WAS ISOLATED FROM AN AS YET UNNAMED NOVEL STRAIN OF BACILLUS STEAROTHERMOPHILUS (SEE REF 2).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP DPO1_BACST P52026 3 304 ? ? 
2 PDB 1LV5       1LV5   1 ?   ? ? 
3 PDB 1LV5       1LV5   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LV5 A 8 ? 580 ? P52026 304 ? 876 ? 304 876 
2 1 1LV5 B 8 ? 580 ? P52026 304 ? 876 ? 304 876 
3 2 1LV5 C 1 ? 10  ? 1LV5   20  ? 29  ? 20  29  
4 3 1LV5 D 1 ? 14  ? 1LV5   1   ? 14  ? 1   14  
5 2 1LV5 E 1 ? 10  ? 1LV5   20  ? 29  ? 20  29  
6 3 1LV5 F 1 ? 14  ? 1LV5   1   ? 14  ? 1   14  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'             24.305  
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1LV5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.12 
_exptl_crystal.density_percent_sol   60.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_details    
'AMMONIUM SULFATE, MAGNESIUM SULFATE, MPD, MES, MANGANESE SULFATE, pH 5.80, VAPOR DIFFUSION, HANGING DROP, temperature 290.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'AMMONIUM SULFATE' ? ? ? 
1 2 1 MgSO4              ? ? ? 
1 3 1 MPD                ? ? ? 
1 4 1 MES                ? ? ? 
1 5 1 MnSo4              ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2001-03-29 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1LV5 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.7 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   129531 
_reflns.number_all                   129531 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.6 
_reflns.B_iso_Wilson_estimate        23.2 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      12800 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LV5 
_refine.ls_number_reflns_obs                     96536 
_refine.ls_number_reflns_all                     98839 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             39.70 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    74.2 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          0.264 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  4574 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               43.9 
_refine.aniso_B[1][1]                            0.30 
_refine.aniso_B[2][2]                            0.30 
_refine.aniso_B[3][3]                            -0.60 
_refine.aniso_B[1][2]                            0.74 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.364792 
_refine.solvent_model_param_bsol                 47.4519 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;The crystal was twinned, with a partial twinning fraction of 0.485.  
Detwinning of the data was performed by treating the data as perfectly twinned, using the detwin_perfect.inp routine in CNS.
The Bacillus polymerase was co-crystallized with ddATP, dCTP, and a DNA
containing a 9 base pair duplex, a 4 base 5' template overhang, and a
single base 3' template overhang.  The 3' overhang on the template strand
assured that the DNA duplex was not bound backwards by the polymerase
during crystallization.  ddATP was incorporated onto the 3' terminus of
the primer strand.  dCTP was not incorporated onto the primer strand, but
was paired opposite the next template base.  Thus, the resulting structure
contained a 10 base pair DNA duplex with a 3' primer terminus and a 3 base
5' template overhang.
Electron density was observed for all protein side chains except Lysine
298, which was modelled to the beta carbon.  The manganese and magnesium
atoms were assigned on the basis of low B-factor, proximity to
coordinating residues, and by comparison to a related Klentaq polymerase
structure (3KTQ).  The data prevent a definitive assignment between MG 205
and water.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2BDP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LV5 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.33 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9294 
_refine_hist.pdbx_number_atoms_nucleic_acid   974 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             186 
_refine_hist.number_atoms_total               10523 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        39.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.42  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.66  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.12  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        0.83  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       1.26  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             4895 
_refine_ls_shell.R_factor_R_work                  0.307 
_refine_ls_shell.percent_reflns_obs               39.8 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             259 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM        PROTEIN.TOP            'X-RAY DIFFRACTION' 
2 DNA-RNA-MULTI-ENDO.PARAM DNA-RNA-MULTI-ENDO.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM          ATER.TOP               'X-RAY DIFFRACTION' 
4 ION.PARAM                ION.TOP                'X-RAY DIFFRACTION' 
5 DCTP.PARAM               DCTP.TOP               'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LV5 
_struct.title                     
'Crystal Structure of the Closed Conformation of Bacillus DNA Polymerase I Fragment Bound to DNA and dCTP' 
_struct.pdbx_descriptor           'DNA POLYMERASE I (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LV5 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'DNA POLYMERASE I, DNA REPLICATION, KLENOW FRAGMENT, PROTEIN-DNA-DNTP COMPLEX, CLOSED CONFORMATION, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 4 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR E 12  ? LEU E 16  ? THR A 308 LEU A 312 5 ? 5  
HELX_P HELX_P2  2  ARG E 51  ? LEU E 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP E 58  ? ASP E 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP E 76  ? TRP E 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU E 98  ? ASP E 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO E 107 ? GLY E 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP E 113 ? MET E 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO E 128 ? GLY E 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS E 135 ? ARG E 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP E 143 ? ASN E 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN E 174 ? GLU E 180 ? GLN A 470 GLU A 476 1 ? 7  
HELX_P HELX_P12 12 LEU E 181 ? GLY E 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP E 200 ? THR E 217 ? ASP A 496 THR A 513 1 ? 18 
HELX_P HELX_P14 14 GLU E 219 ? GLY E 227 ? GLU A 515 GLY A 523 1 ? 9  
HELX_P HELX_P15 15 SER E 234 ? ILE E 241 ? SER A 530 ILE A 537 1 ? 8  
HELX_P HELX_P16 16 SER E 261 ? GLU E 266 ? SER A 557 GLU A 562 1 ? 6  
HELX_P HELX_P17 17 ILE E 274 ? THR E 290 ? ILE A 570 THR A 586 1 ? 17 
HELX_P HELX_P18 18 TYR E 291 ? LYS E 297 ? TYR A 587 LYS A 593 1 ? 7  
HELX_P HELX_P19 19 LEU E 334 ? LYS E 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE E 340 ? GLN E 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN E 360 ? GLU E 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP E 372 ? ARG E 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P23 23 ASP E 384 ? PHE E 394 ? ASP A 680 PHE A 690 1 ? 11 
HELX_P HELX_P24 24 SER E 397 ? VAL E 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P25 25 THR E 402 ? TYR E 418 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P26 26 SER E 421 ? LEU E 429 ? SER A 717 LEU A 725 1 ? 9  
HELX_P HELX_P27 27 SER E 432 ? PHE E 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE E 447 ? GLY E 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO E 478 ? SER E 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN E 484 ? GLU E 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P31 31 GLU E 544 ? ALA E 559 ? GLU A 840 ALA A 855 1 ? 16 
HELX_P HELX_P32 32 THR F 12  ? ALA F 17  ? THR B 308 ALA B 313 5 ? 6  
HELX_P HELX_P33 33 ARG F 51  ? LEU F 56  ? ARG B 347 LEU B 352 1 ? 6  
HELX_P HELX_P34 34 ASP F 58  ? GLY F 66  ? ASP B 354 GLY B 362 1 ? 9  
HELX_P HELX_P35 35 ASP F 76  ? TRP F 86  ? ASP B 372 TRP B 382 1 ? 11 
HELX_P HELX_P36 36 LEU F 98  ? ASP F 106 ? LEU B 394 ASP B 402 1 ? 9  
HELX_P HELX_P37 37 PRO F 107 ? GLY F 110 ? PRO B 403 GLY B 406 5 ? 4  
HELX_P HELX_P38 38 ASP F 113 ? MET F 120 ? ASP B 409 MET B 416 1 ? 8  
HELX_P HELX_P39 39 ASP F 129 ? GLY F 134 ? ASP B 425 GLY B 430 1 ? 6  
HELX_P HELX_P40 40 ASP F 143 ? ASN F 172 ? ASP B 439 ASN B 468 1 ? 30 
HELX_P HELX_P41 41 GLN F 174 ? GLU F 180 ? GLN B 470 GLU B 476 1 ? 7  
HELX_P HELX_P42 42 LEU F 181 ? GLY F 196 ? LEU B 477 GLY B 492 1 ? 16 
HELX_P HELX_P43 43 ASP F 200 ? GLU F 224 ? ASP B 496 GLU B 520 1 ? 25 
HELX_P HELX_P44 44 GLN F 237 ? PHE F 243 ? GLN B 533 PHE B 539 1 ? 7  
HELX_P HELX_P45 45 SER F 261 ? GLU F 266 ? SER B 557 GLU B 562 1 ? 6  
HELX_P HELX_P46 46 LEU F 268 ? HIS F 272 ? LEU B 564 HIS B 568 5 ? 5  
HELX_P HELX_P47 47 GLU F 273 ? GLN F 288 ? GLU B 569 GLN B 584 1 ? 16 
HELX_P HELX_P48 48 THR F 290 ? VAL F 299 ? THR B 586 VAL B 595 1 ? 10 
HELX_P HELX_P49 49 GLY F 337 ? ALA F 343 ? GLY B 633 ALA B 639 5 ? 7  
HELX_P HELX_P50 50 GLN F 360 ? GLU F 371 ? GLN B 656 GLU B 667 1 ? 12 
HELX_P HELX_P51 51 ASP F 372 ? ARG F 381 ? ASP B 668 ARG B 677 1 ? 10 
HELX_P HELX_P52 52 ASP F 384 ? GLN F 395 ? ASP B 680 GLN B 691 1 ? 12 
HELX_P HELX_P53 53 THR F 402 ? TYR F 418 ? THR B 698 TYR B 714 1 ? 17 
HELX_P HELX_P54 54 SER F 421 ? LEU F 429 ? SER B 717 LEU B 725 1 ? 9  
HELX_P HELX_P55 55 SER F 432 ? PHE F 447 ? SER B 728 PHE B 743 1 ? 16 
HELX_P HELX_P56 56 PHE F 447 ? GLY F 465 ? PHE B 743 GLY B 761 1 ? 19 
HELX_P HELX_P57 57 PRO F 478 ? SER F 482 ? PRO B 774 SER B 778 5 ? 5  
HELX_P HELX_P58 58 ASN F 484 ? GLU F 522 ? ASN B 780 GLU B 818 1 ? 39 
HELX_P HELX_P59 59 GLU F 544 ? GLN F 558 ? GLU B 840 GLN B 854 1 ? 15 
HELX_P HELX_P60 60 THR F 575 ? ALA F 579 ? THR B 871 ALA B 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G MN .  MN ? ? ? 1_555 E ASP 534 OD2 ? ? A MN 1   A ASP 830 1_555 ? ? ? ? ? ? ?            2.499 ? 
metalc2  metalc ? ? G MN .  MN ? ? ? 1_555 J DCP .   O2A ? ? A MN 1   A DCP 201 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc3  metalc ? ? G MN .  MN ? ? ? 1_555 J DCP .   O2B ? ? A MN 1   A DCP 201 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc4  metalc ? ? G MN .  MN ? ? ? 1_555 E ASP 357 OD1 ? ? A MN 1   A ASP 653 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc5  metalc ? ? G MN .  MN ? ? ? 1_555 E ASP 357 OD2 ? ? A MN 1   A ASP 653 1_555 ? ? ? ? ? ? ?            2.764 ? 
metalc6  metalc ? ? G MN .  MN ? ? ? 1_555 E TYR 358 O   ? ? A MN 1   A TYR 654 1_555 ? ? ? ? ? ? ?            2.720 ? 
metalc7  metalc ? ? G MN .  MN ? ? ? 1_555 J DCP .   O2G ? ? A MN 1   A DCP 201 1_555 ? ? ? ? ? ? ?            2.004 ? 
metalc8  metalc ? ? H MG .  MG ? ? ? 1_555 J DCP .   O2A ? ? A MG 205 A DCP 201 1_555 ? ? ? ? ? ? ?            2.660 ? 
metalc9  metalc ? ? H MG .  MG ? ? ? 1_555 E ASP 534 OD1 ? ? A MG 205 A ASP 830 1_555 ? ? ? ? ? ? ?            2.659 ? 
metalc10 metalc ? ? H MG .  MG ? ? ? 1_555 E ASP 357 OD2 ? ? A MG 205 A ASP 653 1_555 ? ? ? ? ? ? ?            2.934 ? 
metalc11 metalc ? ? K MN .  MN ? ? ? 1_555 M DCP .   O2G ? ? B MN 2   B DCP 202 1_555 ? ? ? ? ? ? ?            2.093 ? 
metalc12 metalc ? ? K MN .  MN ? ? ? 1_555 M DCP .   O2B ? ? B MN 2   B DCP 202 1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc13 metalc ? ? K MN .  MN ? ? ? 1_555 M DCP .   O2A ? ? B MN 2   B DCP 202 1_555 ? ? ? ? ? ? ?            2.091 ? 
metalc14 metalc ? ? K MN .  MN ? ? ? 1_555 F ASP 534 OD1 ? ? B MN 2   B ASP 830 1_555 ? ? ? ? ? ? ?            2.164 ? 
metalc15 metalc ? ? K MN .  MN ? ? ? 1_555 F TYR 358 O   ? ? B MN 2   B TYR 654 1_555 ? ? ? ? ? ? ?            1.856 ? 
metalc16 metalc ? ? K MN .  MN ? ? ? 1_555 F ASP 357 OD2 ? ? B MN 2   B ASP 653 1_555 ? ? ? ? ? ? ?            2.464 ? 
hydrog1  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  12  N4  ? ? C DG 20  D DC  12  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  13  N3  ? ? C DG 20  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  13  O2  ? ? C DG 20  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  13  N4  ? ? C DG 20  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC  12  N3  ? ? C DG 21  D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC  12  O2  ? ? C DG 21  D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC  12  N4  ? ? C DG 21  D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA  10  N1  ? ? C DT 23  D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA  10  N6  ? ? C DT 23  D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG  9   N2  ? ? C DC 24  D DG  9   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog11 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT  8   N3  ? ? C DA 25  D DT  8   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog12 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC  7   N3  ? ? C DG 26  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC  7   O2  ? ? C DG 26  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC  7   N4  ? ? C DG 26  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG  6   N1  ? ? C DC 27  D DG  6   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog16 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC  5   N3  ? ? C DG 28  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  5   O2  ? ? C DG 28  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC  5   N4  ? ? C DG 28  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  4   N3  ? ? C DA 29  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  4   O4  ? ? C DA 29  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC  13  N3  ? ? E DG 20  F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC  13  O2  ? ? E DG 20  F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC  13  N4  ? ? E DG 20  F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC  12  O2  ? ? E DG 21  F DC  12  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog25 hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT  11  N3  ? ? E DA 22  F DT  11  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog26 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA  10  N1  ? ? E DT 23  F DA  10  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog27 hydrog ? ? C DC 5  O2 ? ? ? 1_555 D DG  9   N2  ? ? E DC 24  F DG  9   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog28 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT  8   N3  ? ? E DA 25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT  8   O4  ? ? E DA 25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG 7  N1 ? ? ? 1_555 D DC  7   N3  ? ? E DG 26  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG 7  N2 ? ? ? 1_555 D DC  7   O2  ? ? E DG 26  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG 7  O6 ? ? ? 1_555 D DC  7   N4  ? ? E DG 26  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DC 8  N3 ? ? ? 1_555 D DG  6   N1  ? ? E DC 27  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DC 8  N4 ? ? ? 1_555 D DG  6   O6  ? ? E DC 27  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC 8  O2 ? ? ? 1_555 D DG  6   N2  ? ? E DC 27  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC  5   N3  ? ? E DG 28  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC  5   O2  ? ? E DG 28  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC  5   N4  ? ? E DG 28  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT  4   N3  ? ? E DA 29  F DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT  4   O4  ? ? E DA 29  F DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 324 E . ? GLU 620 A PRO 325 E ? PRO 621 A 1 0.26  
2 GLU 324 F . ? GLU 620 B PRO 325 F ? PRO 621 B 1 -0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 6 ? 
G ? 2 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR E 6   ? ALA E 8   ? THR A 302 ALA A 304 
A 2 GLY E 46  ? LEU E 50  ? GLY A 342 LEU A 346 
A 3 GLY E 38  ? ASN E 43  ? GLY A 334 ASN A 339 
A 4 LYS E 19  ? GLU E 25  ? LYS A 315 GLU A 321 
A 5 LYS E 71  ? MET E 74  ? LYS A 367 MET A 370 
A 6 VAL E 94  ? ASP E 97  ? VAL A 390 ASP A 393 
B 1 LYS E 305 ? VAL E 306 ? LYS A 601 VAL A 602 
B 2 VAL E 197 ? VAL E 199 ? VAL A 493 VAL A 495 
B 3 PHE E 344 ? VAL E 345 ? PHE A 640 VAL A 641 
C 1 ILE E 309 ? ASN E 311 ? ILE A 605 ASN A 607 
C 2 SER E 321 ? THR E 323 ? SER A 617 THR A 619 
D 1 HIS E 527 ? GLN E 531 ? HIS A 823 GLN A 827 
D 2 LEU E 536 ? PRO E 541 ? LEU A 832 PRO A 837 
D 3 TRP E 351 ? ALA E 356 ? TRP A 647 ALA A 652 
D 4 TYR E 570 ? GLY E 573 ? TYR A 866 GLY A 869 
E 1 TYR E 466 ? THR E 468 ? TYR A 762 THR A 764 
E 2 ARG E 474 ? TYR E 476 ? ARG A 770 TYR A 772 
F 1 THR F 6   ? LEU F 7   ? THR B 302 LEU B 303 
F 2 GLY F 46  ? LEU F 50  ? GLY B 342 LEU B 346 
F 3 ILE F 39  ? ASN F 43  ? ILE B 335 ASN B 339 
F 4 LYS F 19  ? VAL F 24  ? LYS B 315 VAL B 320 
F 5 LYS F 71  ? MET F 74  ? LYS B 367 MET B 370 
F 6 VAL F 94  ? ASP F 97  ? VAL B 390 ASP B 393 
G 1 VAL F 197 ? LYS F 198 ? VAL B 493 LYS B 494 
G 2 LYS F 305 ? VAL F 306 ? LYS B 601 VAL B 602 
H 1 ILE F 309 ? PHE F 310 ? ILE B 605 PHE B 606 
H 2 SER F 322 ? THR F 323 ? SER B 618 THR B 619 
I 1 HIS F 527 ? GLN F 531 ? HIS B 823 GLN B 827 
I 2 GLU F 535 ? PRO F 541 ? GLU B 831 PRO B 837 
I 3 TRP F 351 ? TYR F 358 ? TRP B 647 TYR B 654 
I 4 VAL F 568 ? GLY F 573 ? VAL B 864 GLY B 869 
J 1 TYR F 466 ? THR F 468 ? TYR B 762 THR B 764 
J 2 ARG F 474 ? TYR F 476 ? ARG B 770 TYR B 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 6   ? N THR A 302 O ARG E 47  ? O ARG A 343 
A 2 3 O GLY E 46  ? O GLY A 342 N ASN E 43  ? N ASN A 339 
A 3 4 O VAL E 42  ? O VAL A 338 N ALA E 21  ? N ALA A 317 
A 4 5 N ALA E 20  ? N ALA A 316 O SER E 73  ? O SER A 369 
A 5 6 N MET E 74  ? N MET A 370 O PHE E 96  ? O PHE A 392 
B 1 2 O VAL E 306 ? O VAL A 602 N VAL E 197 ? N VAL A 493 
B 2 3 N LYS E 198 ? N LYS A 494 O VAL E 345 ? O VAL A 641 
C 1 2 N ASN E 311 ? N ASN A 607 O SER E 321 ? O SER A 617 
D 1 2 N LEU E 530 ? N LEU A 826 O ILE E 537 ? O ILE A 833 
D 2 3 O LEU E 538 ? O LEU A 834 N PHE E 354 ? N PHE A 650 
D 3 4 N ILE E 353 ? N ILE A 649 O GLY E 573 ? O GLY A 869 
E 1 2 N VAL E 467 ? N VAL A 763 O ARG E 475 ? O ARG A 771 
F 1 2 N THR F 6   ? N THR B 302 O ARG F 47  ? O ARG B 343 
F 2 3 O PHE F 48  ? O PHE B 344 N VAL F 41  ? N VAL B 337 
F 3 4 O ALA F 40  ? O ALA B 336 N VAL F 23  ? N VAL B 319 
F 4 5 N ALA F 20  ? N ALA B 316 O LYS F 71  ? O LYS B 367 
F 5 6 N MET F 74  ? N MET B 370 O PHE F 96  ? O PHE B 392 
G 1 2 N VAL F 197 ? N VAL B 493 O VAL F 306 ? O VAL B 602 
H 1 2 N ILE F 309 ? N ILE B 605 O THR F 323 ? O THR B 619 
I 1 2 N LEU F 530 ? N LEU B 826 O ILE F 537 ? O ILE B 833 
I 2 3 O LEU F 538 ? O LEU B 834 N PHE F 354 ? N PHE B 650 
I 3 4 N ASP F 357 ? N ASP B 653 O ASP F 569 ? O ASP B 865 
J 1 2 N VAL F 467 ? N VAL B 763 O ARG F 475 ? O ARG B 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 1'    
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN B 2'    
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 205'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 203' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 B 204' 
AC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE DCP A 201' 
AC7 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DCP B 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  DCP J .   ? DCP A 201 . ? 1_555 ? 
2  AC1 5  MG  H .   ? MG  A 205 . ? 1_555 ? 
3  AC1 5  ASP E 357 ? ASP A 653 . ? 1_555 ? 
4  AC1 5  TYR E 358 ? TYR A 654 . ? 1_555 ? 
5  AC1 5  ASP E 534 ? ASP A 830 . ? 1_555 ? 
6  AC2 4  DCP M .   ? DCP B 202 . ? 1_555 ? 
7  AC2 4  ASP F 357 ? ASP B 653 . ? 1_555 ? 
8  AC2 4  TYR F 358 ? TYR B 654 . ? 1_555 ? 
9  AC2 4  ASP F 534 ? ASP B 830 . ? 1_555 ? 
10 AC3 5  MN  G .   ? MN  A 1   . ? 1_555 ? 
11 AC3 5  DCP J .   ? DCP A 201 . ? 1_555 ? 
12 AC3 5  ASP E 357 ? ASP A 653 . ? 1_555 ? 
13 AC3 5  ASP E 534 ? ASP A 830 . ? 1_555 ? 
14 AC3 5  DA  A 10  ? DA  C 29  . ? 1_555 ? 
15 AC4 3  HOH R .   ? HOH A 154 . ? 1_555 ? 
16 AC4 3  ARG E 176 ? ARG A 472 . ? 1_555 ? 
17 AC4 3  GLU E 180 ? GLU A 476 . ? 1_555 ? 
18 AC5 1  GLU F 180 ? GLU B 476 . ? 1_555 ? 
19 AC6 19 MN  G .   ? MN  A 1   . ? 1_555 ? 
20 AC6 19 HOH R .   ? HOH A 98  . ? 1_555 ? 
21 AC6 19 HOH R .   ? HOH A 123 . ? 1_555 ? 
22 AC6 19 MG  H .   ? MG  A 205 . ? 1_555 ? 
23 AC6 19 ARG E 319 ? ARG A 615 . ? 1_555 ? 
24 AC6 19 ASP E 357 ? ASP A 653 . ? 1_555 ? 
25 AC6 19 TYR E 358 ? TYR A 654 . ? 1_555 ? 
26 AC6 19 GLN E 360 ? GLN A 656 . ? 1_555 ? 
27 AC6 19 ILE E 361 ? ILE A 657 . ? 1_555 ? 
28 AC6 19 GLU E 362 ? GLU A 658 . ? 1_555 ? 
29 AC6 19 HIS E 386 ? HIS A 682 . ? 1_555 ? 
30 AC6 19 ARG E 406 ? ARG A 702 . ? 1_555 ? 
31 AC6 19 LYS E 410 ? LYS A 706 . ? 1_555 ? 
32 AC6 19 PHE E 414 ? PHE A 710 . ? 1_555 ? 
33 AC6 19 TYR E 418 ? TYR A 714 . ? 1_555 ? 
34 AC6 19 ASP E 534 ? ASP A 830 . ? 1_555 ? 
35 AC6 19 HOH N .   ? HOH C 18  . ? 1_555 ? 
36 AC6 19 DA  A 10  ? DA  C 29  . ? 1_555 ? 
37 AC6 19 DG  B 3   ? DG  D 3   . ? 1_555 ? 
38 AC7 17 MN  K .   ? MN  B 2   . ? 1_555 ? 
39 AC7 17 HOH S .   ? HOH B 96  . ? 1_555 ? 
40 AC7 17 ARG F 319 ? ARG B 615 . ? 1_555 ? 
41 AC7 17 ASP F 357 ? ASP B 653 . ? 1_555 ? 
42 AC7 17 TYR F 358 ? TYR B 654 . ? 1_555 ? 
43 AC7 17 SER F 359 ? SER B 655 . ? 1_555 ? 
44 AC7 17 GLN F 360 ? GLN B 656 . ? 1_555 ? 
45 AC7 17 ILE F 361 ? ILE B 657 . ? 1_555 ? 
46 AC7 17 GLU F 362 ? GLU B 658 . ? 1_555 ? 
47 AC7 17 HIS F 386 ? HIS B 682 . ? 1_555 ? 
48 AC7 17 ARG F 406 ? ARG B 702 . ? 1_555 ? 
49 AC7 17 LYS F 410 ? LYS B 706 . ? 1_555 ? 
50 AC7 17 PHE F 414 ? PHE B 710 . ? 1_555 ? 
51 AC7 17 ASP F 534 ? ASP B 830 . ? 1_555 ? 
52 AC7 17 DA  C 10  ? DA  E 29  . ? 1_555 ? 
53 AC7 17 DG  D 3   ? DG  F 3   . ? 1_555 ? 
54 AC7 17 DT  D 4   ? DT  F 4   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LV5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LV5 
_atom_sites.fract_transf_matrix[1][1]   0.010907 
_atom_sites.fract_transf_matrix[1][2]   0.006297 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012595 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005260 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DG  A 1 1   ? 17.535  8.350  -116.954 1.00 99.33  ? 20  DG  C "O5'" 1 
ATOM   2     C  "C5'" . DG  A 1 1   ? 17.964  9.525  -116.258 1.00 99.47  ? 20  DG  C "C5'" 1 
ATOM   3     C  "C4'" . DG  A 1 1   ? 16.894  10.065 -115.336 1.00 99.52  ? 20  DG  C "C4'" 1 
ATOM   4     O  "O4'" . DG  A 1 1   ? 16.595  9.095  -114.309 1.00 99.69  ? 20  DG  C "O4'" 1 
ATOM   5     C  "C3'" . DG  A 1 1   ? 17.279  11.336 -114.587 1.00 99.44  ? 20  DG  C "C3'" 1 
ATOM   6     O  "O3'" . DG  A 1 1   ? 16.958  12.490 -115.377 1.00 99.06  ? 20  DG  C "O3'" 1 
ATOM   7     C  "C2'" . DG  A 1 1   ? 16.430  11.256 -113.331 1.00 99.49  ? 20  DG  C "C2'" 1 
ATOM   8     C  "C1'" . DG  A 1 1   ? 16.326  9.753  -113.072 1.00 99.71  ? 20  DG  C "C1'" 1 
ATOM   9     N  N9    . DG  A 1 1   ? 17.262  9.234  -112.075 1.00 99.90  ? 20  DG  C N9    1 
ATOM   10    C  C8    . DG  A 1 1   ? 18.416  8.522  -112.310 1.00 99.90  ? 20  DG  C C8    1 
ATOM   11    N  N7    . DG  A 1 1   ? 19.039  8.177  -111.216 1.00 99.96  ? 20  DG  C N7    1 
ATOM   12    C  C5    . DG  A 1 1   ? 18.254  8.693  -110.195 1.00 99.95  ? 20  DG  C C5    1 
ATOM   13    C  C6    . DG  A 1 1   ? 18.424  8.633  -108.787 1.00 99.97  ? 20  DG  C C6    1 
ATOM   14    O  O6    . DG  A 1 1   ? 19.329  8.090  -108.142 1.00 99.96  ? 20  DG  C O6    1 
ATOM   15    N  N1    . DG  A 1 1   ? 17.397  9.295  -108.120 1.00 100.01 ? 20  DG  C N1    1 
ATOM   16    C  C2    . DG  A 1 1   ? 16.342  9.933  -108.727 1.00 100.02 ? 20  DG  C C2    1 
ATOM   17    N  N2    . DG  A 1 1   ? 15.456  10.522 -107.908 1.00 100.00 ? 20  DG  C N2    1 
ATOM   18    N  N3    . DG  A 1 1   ? 16.168  9.991  -110.038 1.00 99.98  ? 20  DG  C N3    1 
ATOM   19    C  C4    . DG  A 1 1   ? 17.155  9.354  -110.706 1.00 99.95  ? 20  DG  C C4    1 
ATOM   20    P  P     . DG  A 1 2   ? 17.737  13.877 -115.127 1.00 98.91  ? 21  DG  C P     1 
ATOM   21    O  OP1   . DG  A 1 2   ? 17.272  14.853 -116.148 1.00 98.83  ? 21  DG  C OP1   1 
ATOM   22    O  OP2   . DG  A 1 2   ? 19.188  13.571 -115.014 1.00 98.88  ? 21  DG  C OP2   1 
ATOM   23    O  "O5'" . DG  A 1 2   ? 17.217  14.360 -113.698 1.00 98.37  ? 21  DG  C "O5'" 1 
ATOM   24    C  "C5'" . DG  A 1 2   ? 15.809  14.554 -113.451 1.00 97.51  ? 21  DG  C "C5'" 1 
ATOM   25    C  "C4'" . DG  A 1 2   ? 15.571  14.973 -112.018 1.00 96.98  ? 21  DG  C "C4'" 1 
ATOM   26    O  "O4'" . DG  A 1 2   ? 15.977  13.912 -111.119 1.00 96.95  ? 21  DG  C "O4'" 1 
ATOM   27    C  "C3'" . DG  A 1 2   ? 16.318  16.229 -111.560 1.00 96.62  ? 21  DG  C "C3'" 1 
ATOM   28    O  "O3'" . DG  A 1 2   ? 15.478  17.008 -110.696 1.00 95.88  ? 21  DG  C "O3'" 1 
ATOM   29    C  "C2'" . DG  A 1 2   ? 17.479  15.678 -110.754 1.00 96.74  ? 21  DG  C "C2'" 1 
ATOM   30    C  "C1'" . DG  A 1 2   ? 16.872  14.430 -110.147 1.00 96.88  ? 21  DG  C "C1'" 1 
ATOM   31    N  N9    . DG  A 1 2   ? 17.836  13.390 -109.800 1.00 96.91  ? 21  DG  C N9    1 
ATOM   32    C  C8    . DG  A 1 2   ? 18.582  12.606 -110.650 1.00 96.84  ? 21  DG  C C8    1 
ATOM   33    N  N7    . DG  A 1 2   ? 19.369  11.775 -110.019 1.00 96.81  ? 21  DG  C N7    1 
ATOM   34    C  C5    . DG  A 1 2   ? 19.124  12.024 -108.674 1.00 96.88  ? 21  DG  C C5    1 
ATOM   35    C  C6    . DG  A 1 2   ? 19.680  11.431 -107.508 1.00 96.96  ? 21  DG  C C6    1 
ATOM   36    O  O6    . DG  A 1 2   ? 20.530  10.533 -107.428 1.00 96.94  ? 21  DG  C O6    1 
ATOM   37    N  N1    . DG  A 1 2   ? 19.146  11.986 -106.348 1.00 96.95  ? 21  DG  C N1    1 
ATOM   38    C  C2    . DG  A 1 2   ? 18.199  12.981 -106.311 1.00 96.88  ? 21  DG  C C2    1 
ATOM   39    N  N2    . DG  A 1 2   ? 17.808  13.386 -105.094 1.00 96.80  ? 21  DG  C N2    1 
ATOM   40    N  N3    . DG  A 1 2   ? 17.674  13.538 -107.386 1.00 96.86  ? 21  DG  C N3    1 
ATOM   41    C  C4    . DG  A 1 2   ? 18.178  13.016 -108.525 1.00 96.88  ? 21  DG  C C4    1 
ATOM   42    P  P     . DA  A 1 3   ? 16.006  18.414 -110.117 1.00 95.54  ? 22  DA  C P     1 
ATOM   43    O  OP1   . DA  A 1 3   ? 14.840  19.329 -109.993 1.00 95.48  ? 22  DA  C OP1   1 
ATOM   44    O  OP2   . DA  A 1 3   ? 17.182  18.831 -110.928 1.00 95.47  ? 22  DA  C OP2   1 
ATOM   45    O  "O5'" . DA  A 1 3   ? 16.531  18.063 -108.652 1.00 94.64  ? 22  DA  C "O5'" 1 
ATOM   46    C  "C5'" . DA  A 1 3   ? 15.613  17.907 -107.549 1.00 93.37  ? 22  DA  C "C5'" 1 
ATOM   47    C  "C4'" . DA  A 1 3   ? 16.332  18.095 -106.231 1.00 92.40  ? 22  DA  C "C4'" 1 
ATOM   48    O  "O4'" . DA  A 1 3   ? 17.331  17.058 -106.087 1.00 92.13  ? 22  DA  C "O4'" 1 
ATOM   49    C  "C3'" . DA  A 1 3   ? 17.069  19.426 -106.065 1.00 91.90  ? 22  DA  C "C3'" 1 
ATOM   50    O  "O3'" . DA  A 1 3   ? 16.931  19.890 -104.710 1.00 91.32  ? 22  DA  C "O3'" 1 
ATOM   51    C  "C2'" . DA  A 1 3   ? 18.515  19.071 -106.372 1.00 91.66  ? 22  DA  C "C2'" 1 
ATOM   52    C  "C1'" . DA  A 1 3   ? 18.625  17.621 -105.919 1.00 91.57  ? 22  DA  C "C1'" 1 
ATOM   53    N  N9    . DA  A 1 3   ? 19.567  16.795 -106.684 1.00 91.07  ? 22  DA  C N9    1 
ATOM   54    C  C8    . DA  A 1 3   ? 19.863  16.864 -108.025 1.00 90.74  ? 22  DA  C C8    1 
ATOM   55    N  N7    . DA  A 1 3   ? 20.721  15.959 -108.425 1.00 90.45  ? 22  DA  C N7    1 
ATOM   56    C  C5    . DA  A 1 3   ? 21.019  15.248 -107.272 1.00 90.40  ? 22  DA  C C5    1 
ATOM   57    C  C6    . DA  A 1 3   ? 21.865  14.149 -107.030 1.00 90.24  ? 22  DA  C C6    1 
ATOM   58    N  N6    . DA  A 1 3   ? 22.590  13.549 -107.976 1.00 89.95  ? 22  DA  C N6    1 
ATOM   59    N  N1    . DA  A 1 3   ? 21.938  13.679 -105.766 1.00 90.25  ? 22  DA  C N1    1 
ATOM   60    C  C2    . DA  A 1 3   ? 21.209  14.279 -104.817 1.00 90.45  ? 22  DA  C C2    1 
ATOM   61    N  N3    . DA  A 1 3   ? 20.378  15.315 -104.920 1.00 90.65  ? 22  DA  C N3    1 
ATOM   62    C  C4    . DA  A 1 3   ? 20.326  15.758 -106.188 1.00 90.67  ? 22  DA  C C4    1 
ATOM   63    P  P     . DT  A 1 4   ? 17.136  21.455 -104.358 1.00 91.03  ? 23  DT  C P     1 
ATOM   64    O  OP1   . DT  A 1 4   ? 16.001  21.892 -103.505 1.00 90.78  ? 23  DT  C OP1   1 
ATOM   65    O  OP2   . DT  A 1 4   ? 17.437  22.199 -105.613 1.00 90.79  ? 23  DT  C OP2   1 
ATOM   66    O  "O5'" . DT  A 1 4   ? 18.453  21.461 -103.460 1.00 90.22  ? 23  DT  C "O5'" 1 
ATOM   67    C  "C5'" . DT  A 1 4   ? 19.539  20.582 -103.779 1.00 89.05  ? 23  DT  C "C5'" 1 
ATOM   68    C  "C4'" . DT  A 1 4   ? 20.163  20.020 -102.524 1.00 88.17  ? 23  DT  C "C4'" 1 
ATOM   69    O  "O4'" . DT  A 1 4   ? 20.722  18.730 -102.854 1.00 88.34  ? 23  DT  C "O4'" 1 
ATOM   70    C  "C3'" . DT  A 1 4   ? 21.309  20.855 -101.952 1.00 87.50  ? 23  DT  C "C3'" 1 
ATOM   71    O  "O3'" . DT  A 1 4   ? 21.328  20.788 -100.517 1.00 86.06  ? 23  DT  C "O3'" 1 
ATOM   72    C  "C2'" . DT  A 1 4   ? 22.546  20.202 -102.544 1.00 87.85  ? 23  DT  C "C2'" 1 
ATOM   73    C  "C1'" . DT  A 1 4   ? 22.138  18.750 -102.779 1.00 88.11  ? 23  DT  C "C1'" 1 
ATOM   74    N  N1    . DT  A 1 4   ? 22.655  18.196 -104.053 1.00 88.12  ? 23  DT  C N1    1 
ATOM   75    C  C2    . DT  A 1 4   ? 23.342  17.002 -104.023 1.00 88.12  ? 23  DT  C C2    1 
ATOM   76    O  O2    . DT  A 1 4   ? 23.534  16.362 -102.999 1.00 88.29  ? 23  DT  C O2    1 
ATOM   77    N  N3    . DT  A 1 4   ? 23.799  16.576 -105.247 1.00 88.05  ? 23  DT  C N3    1 
ATOM   78    C  C4    . DT  A 1 4   ? 23.641  17.205 -106.467 1.00 87.86  ? 23  DT  C C4    1 
ATOM   79    O  O4    . DT  A 1 4   ? 24.116  16.699 -107.481 1.00 87.66  ? 23  DT  C O4    1 
ATOM   80    C  C5    . DT  A 1 4   ? 22.902  18.449 -106.427 1.00 87.78  ? 23  DT  C C5    1 
ATOM   81    C  C7    . DT  A 1 4   ? 22.675  19.205 -107.698 1.00 87.82  ? 23  DT  C C7    1 
ATOM   82    C  C6    . DT  A 1 4   ? 22.452  18.873 -105.241 1.00 87.91  ? 23  DT  C C6    1 
ATOM   83    P  P     . DC  A 1 5   ? 22.426  21.629 -99.687  1.00 85.07  ? 24  DC  C P     1 
ATOM   84    O  OP1   . DC  A 1 5   ? 21.975  21.698 -98.274  1.00 85.10  ? 24  DC  C OP1   1 
ATOM   85    O  OP2   . DC  A 1 5   ? 22.696  22.892 -100.426 1.00 85.05  ? 24  DC  C OP2   1 
ATOM   86    O  "O5'" . DC  A 1 5   ? 23.735  20.715 -99.756  1.00 83.48  ? 24  DC  C "O5'" 1 
ATOM   87    C  "C5'" . DC  A 1 5   ? 23.788  19.454 -99.053  1.00 81.21  ? 24  DC  C "C5'" 1 
ATOM   88    C  "C4'" . DC  A 1 5   ? 24.994  18.639 -99.473  1.00 79.56  ? 24  DC  C "C4'" 1 
ATOM   89    O  "O4'" . DC  A 1 5   ? 24.905  18.251 -100.860 1.00 79.24  ? 24  DC  C "O4'" 1 
ATOM   90    C  "C3'" . DC  A 1 5   ? 26.366  19.294 -99.343  1.00 78.45  ? 24  DC  C "C3'" 1 
ATOM   91    O  "O3'" . DC  A 1 5   ? 26.860  19.137 -98.008  1.00 76.46  ? 24  DC  C "O3'" 1 
ATOM   92    C  "C2'" . DC  A 1 5   ? 27.212  18.477 -100.304 1.00 78.40  ? 24  DC  C "C2'" 1 
ATOM   93    C  "C1'" . DC  A 1 5   ? 26.217  17.962 -101.339 1.00 78.60  ? 24  DC  C "C1'" 1 
ATOM   94    N  N1    . DC  A 1 5   ? 26.358  18.506 -102.704 1.00 78.31  ? 24  DC  C N1    1 
ATOM   95    C  C2    . DC  A 1 5   ? 26.900  17.677 -103.699 1.00 78.23  ? 24  DC  C C2    1 
ATOM   96    O  O2    . DC  A 1 5   ? 27.256  16.525 -103.399 1.00 77.98  ? 24  DC  C O2    1 
ATOM   97    N  N3    . DC  A 1 5   ? 27.025  18.153 -104.961 1.00 78.14  ? 24  DC  C N3    1 
ATOM   98    C  C4    . DC  A 1 5   ? 26.643  19.400 -105.245 1.00 78.01  ? 24  DC  C C4    1 
ATOM   99    N  N4    . DC  A 1 5   ? 26.785  19.823 -106.505 1.00 77.73  ? 24  DC  C N4    1 
ATOM   100   C  C5    . DC  A 1 5   ? 26.098  20.268 -104.252 1.00 77.96  ? 24  DC  C C5    1 
ATOM   101   C  C6    . DC  A 1 5   ? 25.974  19.784 -103.006 1.00 78.22  ? 24  DC  C C6    1 
ATOM   102   P  P     . DA  A 1 6   ? 28.154  19.963 -97.528  1.00 74.98  ? 25  DA  C P     1 
ATOM   103   O  OP1   . DA  A 1 6   ? 28.334  19.657 -96.094  1.00 75.16  ? 25  DA  C OP1   1 
ATOM   104   O  OP2   . DA  A 1 6   ? 27.975  21.375 -97.953  1.00 74.98  ? 25  DA  C OP2   1 
ATOM   105   O  "O5'" . DA  A 1 6   ? 29.368  19.337 -98.363  1.00 73.70  ? 25  DA  C "O5'" 1 
ATOM   106   C  "C5'" . DA  A 1 6   ? 29.863  18.006 -98.087  1.00 71.28  ? 25  DA  C "C5'" 1 
ATOM   107   C  "C4'" . DA  A 1 6   ? 30.767  17.515 -99.200  1.00 69.74  ? 25  DA  C "C4'" 1 
ATOM   108   O  "O4'" . DA  A 1 6   ? 30.044  17.439 -100.452 1.00 69.69  ? 25  DA  C "O4'" 1 
ATOM   109   C  "C3'" . DA  A 1 6   ? 32.015  18.334 -99.530  1.00 68.45  ? 25  DA  C "C3'" 1 
ATOM   110   O  "O3'" . DA  A 1 6   ? 33.115  17.994 -98.670  1.00 65.99  ? 25  DA  C "O3'" 1 
ATOM   111   C  "C2'" . DA  A 1 6   ? 32.329  17.881 -100.945 1.00 69.04  ? 25  DA  C "C2'" 1 
ATOM   112   C  "C1'" . DA  A 1 6   ? 30.974  17.515 -101.535 1.00 69.49  ? 25  DA  C "C1'" 1 
ATOM   113   N  N9    . DA  A 1 6   ? 30.484  18.477 -102.526 1.00 69.78  ? 25  DA  C N9    1 
ATOM   114   C  C8    . DA  A 1 6   ? 29.689  19.585 -102.354 1.00 69.96  ? 25  DA  C C8    1 
ATOM   115   N  N7    . DA  A 1 6   ? 29.453  20.244 -103.466 1.00 69.83  ? 25  DA  C N7    1 
ATOM   116   C  C5    . DA  A 1 6   ? 30.134  19.520 -104.435 1.00 69.75  ? 25  DA  C C5    1 
ATOM   117   C  C6    . DA  A 1 6   ? 30.276  19.695 -105.824 1.00 69.83  ? 25  DA  C C6    1 
ATOM   118   N  N6    . DA  A 1 6   ? 29.712  20.694 -106.506 1.00 69.88  ? 25  DA  C N6    1 
ATOM   119   N  N1    . DA  A 1 6   ? 31.027  18.795 -106.497 1.00 69.80  ? 25  DA  C N1    1 
ATOM   120   C  C2    . DA  A 1 6   ? 31.589  17.790 -105.814 1.00 69.70  ? 25  DA  C C2    1 
ATOM   121   N  N3    . DA  A 1 6   ? 31.526  17.517 -104.514 1.00 69.67  ? 25  DA  C N3    1 
ATOM   122   C  C4    . DA  A 1 6   ? 30.774  18.430 -103.872 1.00 69.82  ? 25  DA  C C4    1 
ATOM   123   P  P     . DG  A 1 7   ? 34.468  18.877 -98.704  1.00 64.18  ? 26  DG  C P     1 
ATOM   124   O  OP1   . DG  A 1 7   ? 35.485  18.217 -97.847  1.00 64.27  ? 26  DG  C OP1   1 
ATOM   125   O  OP2   . DG  A 1 7   ? 34.095  20.290 -98.436  1.00 63.54  ? 26  DG  C OP2   1 
ATOM   126   O  "O5'" . DG  A 1 7   ? 34.968  18.780 -100.216 1.00 62.86  ? 26  DG  C "O5'" 1 
ATOM   127   C  "C5'" . DG  A 1 7   ? 35.415  17.526 -100.778 1.00 60.98  ? 26  DG  C "C5'" 1 
ATOM   128   C  "C4'" . DG  A 1 7   ? 36.152  17.761 -102.078 1.00 59.68  ? 26  DG  C "C4'" 1 
ATOM   129   O  "O4'" . DG  A 1 7   ? 35.242  18.264 -103.091 1.00 59.71  ? 26  DG  C "O4'" 1 
ATOM   130   C  "C3'" . DG  A 1 7   ? 37.300  18.770 -101.994 1.00 58.57  ? 26  DG  C "C3'" 1 
ATOM   131   O  "O3'" . DG  A 1 7   ? 38.409  18.337 -102.791 1.00 56.18  ? 26  DG  C "O3'" 1 
ATOM   132   C  "C2'" . DG  A 1 7   ? 36.713  20.031 -102.601 1.00 59.00  ? 26  DG  C "C2'" 1 
ATOM   133   C  "C1'" . DG  A 1 7   ? 35.758  19.470 -103.638 1.00 59.95  ? 26  DG  C "C1'" 1 
ATOM   134   N  N9    . DG  A 1 7   ? 34.642  20.351 -103.983 1.00 60.29  ? 26  DG  C N9    1 
ATOM   135   C  C8    . DG  A 1 7   ? 33.879  21.120 -103.134 1.00 60.81  ? 26  DG  C C8    1 
ATOM   136   N  N7    . DG  A 1 7   ? 33.002  21.859 -103.761 1.00 61.00  ? 26  DG  C N7    1 
ATOM   137   C  C5    . DG  A 1 7   ? 33.186  21.549 -105.101 1.00 61.04  ? 26  DG  C C5    1 
ATOM   138   C  C6    . DG  A 1 7   ? 32.535  22.051 -106.262 1.00 61.50  ? 26  DG  C C6    1 
ATOM   139   O  O6    . DG  A 1 7   ? 31.641  22.910 -106.340 1.00 62.04  ? 26  DG  C O6    1 
ATOM   140   N  N1    . DG  A 1 7   ? 33.027  21.455 -107.421 1.00 61.25  ? 26  DG  C N1    1 
ATOM   141   C  C2    . DG  A 1 7   ? 34.021  20.507 -107.462 1.00 61.24  ? 26  DG  C C2    1 
ATOM   142   N  N2    . DG  A 1 7   ? 34.353  20.045 -108.679 1.00 61.25  ? 26  DG  C N2    1 
ATOM   143   N  N3    . DG  A 1 7   ? 34.644  20.043 -106.390 1.00 60.84  ? 26  DG  C N3    1 
ATOM   144   C  C4    . DG  A 1 7   ? 34.179  20.603 -105.254 1.00 60.75  ? 26  DG  C C4    1 
ATOM   145   P  P     . DC  A 1 8   ? 39.810  19.131 -102.716 1.00 54.95  ? 27  DC  C P     1 
ATOM   146   O  OP1   . DC  A 1 8   ? 40.892  18.109 -102.616 1.00 54.59  ? 27  DC  C OP1   1 
ATOM   147   O  OP2   . DC  A 1 8   ? 39.721  20.206 -101.685 1.00 54.23  ? 27  DC  C OP2   1 
ATOM   148   O  "O5'" . DC  A 1 8   ? 39.912  19.840 -104.140 1.00 52.88  ? 27  DC  C "O5'" 1 
ATOM   149   C  "C5'" . DC  A 1 8   ? 40.420  19.121 -105.273 1.00 50.29  ? 27  DC  C "C5'" 1 
ATOM   150   C  "C4'" . DC  A 1 8   ? 40.241  19.915 -106.546 1.00 48.27  ? 27  DC  C "C4'" 1 
ATOM   151   O  "O4'" . DC  A 1 8   ? 38.852  19.984 -106.945 1.00 48.05  ? 27  DC  C "O4'" 1 
ATOM   152   C  "C3'" . DC  A 1 8   ? 40.697  21.368 -106.541 1.00 46.96  ? 27  DC  C "C3'" 1 
ATOM   153   O  "O3'" . DC  A 1 8   ? 42.109  21.493 -106.699 1.00 44.38  ? 27  DC  C "O3'" 1 
ATOM   154   C  "C2'" . DC  A 1 8   ? 39.968  21.927 -107.747 1.00 47.02  ? 27  DC  C "C2'" 1 
ATOM   155   C  "C1'" . DC  A 1 8   ? 38.656  21.155 -107.744 1.00 47.59  ? 27  DC  C "C1'" 1 
ATOM   156   N  N1    . DC  A 1 8   ? 37.583  21.972 -107.152 1.00 47.26  ? 27  DC  C N1    1 
ATOM   157   C  C2    . DC  A 1 8   ? 36.822  22.786 -108.008 1.00 47.08  ? 27  DC  C C2    1 
ATOM   158   O  O2    . DC  A 1 8   ? 37.035  22.743 -109.230 1.00 46.84  ? 27  DC  C O2    1 
ATOM   159   N  N3    . DC  A 1 8   ? 35.881  23.596 -107.485 1.00 47.34  ? 27  DC  C N3    1 
ATOM   160   C  C4    . DC  A 1 8   ? 35.677  23.616 -106.169 1.00 47.24  ? 27  DC  C C4    1 
ATOM   161   N  N4    . DC  A 1 8   ? 34.755  24.446 -105.701 1.00 47.67  ? 27  DC  C N4    1 
ATOM   162   C  C5    . DC  A 1 8   ? 36.416  22.784 -105.276 1.00 47.34  ? 27  DC  C C5    1 
ATOM   163   C  C6    . DC  A 1 8   ? 37.346  21.980 -105.806 1.00 46.97  ? 27  DC  C C6    1 
ATOM   164   P  P     . DG  A 1 9   ? 42.779  22.945 -106.609 1.00 41.25  ? 28  DG  C P     1 
ATOM   165   O  OP1   . DG  A 1 9   ? 44.256  22.781 -106.676 1.00 42.14  ? 28  DG  C OP1   1 
ATOM   166   O  OP2   . DG  A 1 9   ? 42.178  23.655 -105.459 1.00 42.33  ? 28  DG  C OP2   1 
ATOM   167   O  "O5'" . DG  A 1 9   ? 42.296  23.647 -107.956 1.00 40.83  ? 28  DG  C "O5'" 1 
ATOM   168   C  "C5'" . DG  A 1 9   ? 42.608  23.045 -109.228 1.00 38.27  ? 28  DG  C "C5'" 1 
ATOM   169   C  "C4'" . DG  A 1 9   ? 42.003  23.830 -110.366 1.00 36.60  ? 28  DG  C "C4'" 1 
ATOM   170   O  "O4'" . DG  A 1 9   ? 40.568  23.669 -110.416 1.00 36.80  ? 28  DG  C "O4'" 1 
ATOM   171   C  "C3'" . DG  A 1 9   ? 42.216  25.334 -110.345 1.00 35.35  ? 28  DG  C "C3'" 1 
ATOM   172   O  "O3'" . DG  A 1 9   ? 43.509  25.694 -110.834 1.00 34.08  ? 28  DG  C "O3'" 1 
ATOM   173   C  "C2'" . DG  A 1 9   ? 41.115  25.822 -111.266 1.00 34.99  ? 28  DG  C "C2'" 1 
ATOM   174   C  "C1'" . DG  A 1 9   ? 39.985  24.827 -111.010 1.00 35.15  ? 28  DG  C "C1'" 1 
ATOM   175   N  N9    . DG  A 1 9   ? 38.982  25.369 -110.099 1.00 33.95  ? 28  DG  C N9    1 
ATOM   176   C  C8    . DG  A 1 9   ? 38.881  25.202 -108.739 1.00 34.12  ? 28  DG  C C8    1 
ATOM   177   N  N7    . DG  A 1 9   ? 37.908  25.893 -108.210 1.00 32.88  ? 28  DG  C N7    1 
ATOM   178   C  C5    . DG  A 1 9   ? 37.328  26.545 -109.286 1.00 33.22  ? 28  DG  C C5    1 
ATOM   179   C  C6    . DG  A 1 9   ? 36.239  27.462 -109.336 1.00 33.50  ? 28  DG  C C6    1 
ATOM   180   O  O6    . DG  A 1 9   ? 35.575  27.925 -108.396 1.00 34.36  ? 28  DG  C O6    1 
ATOM   181   N  N1    . DG  A 1 9   ? 35.964  27.857 -110.644 1.00 32.01  ? 28  DG  C N1    1 
ATOM   182   C  C2    . DG  A 1 9   ? 36.658  27.443 -111.755 1.00 32.13  ? 28  DG  C C2    1 
ATOM   183   N  N2    . DG  A 1 9   ? 36.247  27.924 -112.936 1.00 30.43  ? 28  DG  C N2    1 
ATOM   184   N  N3    . DG  A 1 9   ? 37.686  26.611 -111.715 1.00 32.17  ? 28  DG  C N3    1 
ATOM   185   C  C4    . DG  A 1 9   ? 37.961  26.207 -110.461 1.00 32.97  ? 28  DG  C C4    1 
ATOM   186   P  P     . DA  A 1 10  ? 44.031  27.199 -110.632 1.00 31.14  ? 29  DA  C P     1 
ATOM   187   O  OP1   . DA  A 1 10  ? 45.395  27.290 -111.207 1.00 32.39  ? 29  DA  C OP1   1 
ATOM   188   O  OP2   . DA  A 1 10  ? 43.799  27.589 -109.233 1.00 31.75  ? 29  DA  C OP2   1 
ATOM   189   O  "O5'" . DA  A 1 10  ? 43.051  28.065 -111.537 1.00 31.52  ? 29  DA  C "O5'" 1 
ATOM   190   C  "C5'" . DA  A 1 10  ? 43.104  28.000 -112.978 1.00 30.88  ? 29  DA  C "C5'" 1 
ATOM   191   C  "C4'" . DA  A 1 10  ? 42.286  29.124 -113.572 1.00 32.94  ? 29  DA  C "C4'" 1 
ATOM   192   O  "O4'" . DA  A 1 10  ? 40.897  28.935 -113.221 1.00 33.75  ? 29  DA  C "O4'" 1 
ATOM   193   C  "C3'" . DA  A 1 10  ? 42.642  30.507 -113.039 1.00 32.46  ? 29  DA  C "C3'" 1 
ATOM   194   C  "C2'" . DA  A 1 10  ? 41.330  31.265 -113.160 1.00 34.30  ? 29  DA  C "C2'" 1 
ATOM   195   C  "C1'" . DA  A 1 10  ? 40.274  30.188 -112.959 1.00 35.07  ? 29  DA  C "C1'" 1 
ATOM   196   N  N9    . DA  A 1 10  ? 39.692  30.132 -111.614 1.00 37.30  ? 29  DA  C N9    1 
ATOM   197   C  C8    . DA  A 1 10  ? 40.016  29.280 -110.584 1.00 37.34  ? 29  DA  C C8    1 
ATOM   198   N  N7    . DA  A 1 10  ? 39.286  29.451 -109.508 1.00 38.14  ? 29  DA  C N7    1 
ATOM   199   C  C5    . DA  A 1 10  ? 38.429  30.490 -109.845 1.00 37.74  ? 29  DA  C C5    1 
ATOM   200   C  C6    . DA  A 1 10  ? 37.390  31.137 -109.133 1.00 38.15  ? 29  DA  C C6    1 
ATOM   201   N  N6    . DA  A 1 10  ? 37.020  30.806 -107.887 1.00 38.51  ? 29  DA  C N6    1 
ATOM   202   N  N1    . DA  A 1 10  ? 36.733  32.141 -109.757 1.00 37.53  ? 29  DA  C N1    1 
ATOM   203   C  C2    . DA  A 1 10  ? 37.089  32.457 -111.012 1.00 37.95  ? 29  DA  C C2    1 
ATOM   204   N  N3    . DA  A 1 10  ? 38.037  31.918 -111.785 1.00 37.50  ? 29  DA  C N3    1 
ATOM   205   C  C4    . DA  A 1 10  ? 38.676  30.929 -111.134 1.00 37.17  ? 29  DA  C C4    1 
ATOM   206   O  "O5'" . DA  B 2 1   ? 19.340  40.327 -95.859  1.00 43.29  ? 1   DA  D "O5'" 1 
ATOM   207   C  "C5'" . DA  B 2 1   ? 19.843  40.173 -97.185  1.00 41.29  ? 1   DA  D "C5'" 1 
ATOM   208   C  "C4'" . DA  B 2 1   ? 21.348  40.082 -97.130  1.00 41.17  ? 1   DA  D "C4'" 1 
ATOM   209   O  "O4'" . DA  B 2 1   ? 21.728  38.969 -96.285  1.00 41.65  ? 1   DA  D "O4'" 1 
ATOM   210   C  "C3'" . DA  B 2 1   ? 22.042  39.859 -98.475  1.00 40.33  ? 1   DA  D "C3'" 1 
ATOM   211   O  "O3'" . DA  B 2 1   ? 23.251  40.623 -98.516  1.00 38.68  ? 1   DA  D "O3'" 1 
ATOM   212   C  "C2'" . DA  B 2 1   ? 22.376  38.381 -98.461  1.00 40.85  ? 1   DA  D "C2'" 1 
ATOM   213   C  "C1'" . DA  B 2 1   ? 22.620  38.115 -96.986  1.00 42.07  ? 1   DA  D "C1'" 1 
ATOM   214   N  N9    . DA  B 2 1   ? 22.361  36.732 -96.574  1.00 42.61  ? 1   DA  D N9    1 
ATOM   215   C  C8    . DA  B 2 1   ? 23.255  35.847 -96.015  1.00 42.31  ? 1   DA  D C8    1 
ATOM   216   N  N7    . DA  B 2 1   ? 22.749  34.656 -95.791  1.00 43.48  ? 1   DA  D N7    1 
ATOM   217   C  C5    . DA  B 2 1   ? 21.434  34.764 -96.221  1.00 43.30  ? 1   DA  D C5    1 
ATOM   218   C  C6    . DA  B 2 1   ? 20.366  33.843 -96.260  1.00 44.18  ? 1   DA  D C6    1 
ATOM   219   N  N6    . DA  B 2 1   ? 20.454  32.576 -95.839  1.00 44.36  ? 1   DA  D N6    1 
ATOM   220   N  N1    . DA  B 2 1   ? 19.185  34.275 -96.753  1.00 44.95  ? 1   DA  D N1    1 
ATOM   221   C  C2    . DA  B 2 1   ? 19.089  35.546 -97.169  1.00 44.54  ? 1   DA  D C2    1 
ATOM   222   N  N3    . DA  B 2 1   ? 20.016  36.504 -97.182  1.00 44.07  ? 1   DA  D N3    1 
ATOM   223   C  C4    . DA  B 2 1   ? 21.178  36.043 -96.693  1.00 43.37  ? 1   DA  D C4    1 
ATOM   224   P  P     . DC  B 2 2   ? 24.132  40.671 -99.863  1.00 37.71  ? 2   DC  D P     1 
ATOM   225   O  OP1   . DC  B 2 2   ? 25.167  41.719 -99.637  1.00 38.39  ? 2   DC  D OP1   1 
ATOM   226   O  OP2   . DC  B 2 2   ? 23.253  40.748 -101.057 1.00 38.10  ? 2   DC  D OP2   1 
ATOM   227   O  "O5'" . DC  B 2 2   ? 24.855  39.255 -99.892  1.00 36.37  ? 2   DC  D "O5'" 1 
ATOM   228   C  "C5'" . DC  B 2 2   ? 25.791  38.901 -98.871  1.00 34.85  ? 2   DC  D "C5'" 1 
ATOM   229   C  "C4'" . DC  B 2 2   ? 26.267  37.481 -99.061  1.00 34.31  ? 2   DC  D "C4'" 1 
ATOM   230   O  "O4'" . DC  B 2 2   ? 25.191  36.549 -98.828  1.00 34.41  ? 2   DC  D "O4'" 1 
ATOM   231   C  "C3'" . DC  B 2 2   ? 26.827  37.151 -100.447 1.00 33.75  ? 2   DC  D "C3'" 1 
ATOM   232   O  "O3'" . DC  B 2 2   ? 27.938  36.267 -100.271 1.00 32.29  ? 2   DC  D "O3'" 1 
ATOM   233   C  "C2'" . DC  B 2 2   ? 25.698  36.374 -101.104 1.00 33.94  ? 2   DC  D "C2'" 1 
ATOM   234   C  "C1'" . DC  B 2 2   ? 25.135  35.635 -99.904  1.00 35.45  ? 2   DC  D "C1'" 1 
ATOM   235   N  N1    . DC  B 2 2   ? 23.774  35.073 -99.970  1.00 36.73  ? 2   DC  D N1    1 
ATOM   236   C  C2    . DC  B 2 2   ? 23.549  33.824 -99.371  1.00 37.43  ? 2   DC  D C2    1 
ATOM   237   O  O2    . DC  B 2 2   ? 24.501  33.237 -98.811  1.00 37.89  ? 2   DC  D O2    1 
ATOM   238   N  N3    . DC  B 2 2   ? 22.310  33.285 -99.414  1.00 37.52  ? 2   DC  D N3    1 
ATOM   239   C  C4    . DC  B 2 2   ? 21.320  33.934 -100.029 1.00 38.71  ? 2   DC  D C4    1 
ATOM   240   N  N4    . DC  B 2 2   ? 20.116  33.349 -100.056 1.00 40.01  ? 2   DC  D N4    1 
ATOM   241   C  C5    . DC  B 2 2   ? 21.518  35.207 -100.645 1.00 38.05  ? 2   DC  D C5    1 
ATOM   242   C  C6    . DC  B 2 2   ? 22.749  35.735 -100.591 1.00 36.90  ? 2   DC  D C6    1 
ATOM   243   P  P     . DG  B 2 3   ? 29.404  36.868 -99.968  1.00 31.41  ? 3   DG  D P     1 
ATOM   244   O  OP1   . DG  B 2 3   ? 30.241  35.702 -99.583  1.00 30.62  ? 3   DG  D OP1   1 
ATOM   245   O  OP2   . DG  B 2 3   ? 29.314  38.036 -99.065  1.00 31.17  ? 3   DG  D OP2   1 
ATOM   246   O  "O5'" . DG  B 2 3   ? 29.911  37.419 -101.373 1.00 30.73  ? 3   DG  D "O5'" 1 
ATOM   247   C  "C5'" . DG  B 2 3   ? 29.865  36.605 -102.539 1.00 29.16  ? 3   DG  D "C5'" 1 
ATOM   248   C  "C4'" . DG  B 2 3   ? 30.446  37.355 -103.712 1.00 29.47  ? 3   DG  D "C4'" 1 
ATOM   249   O  "O4'" . DG  B 2 3   ? 31.858  37.586 -103.527 1.00 29.55  ? 3   DG  D "O4'" 1 
ATOM   250   C  "C3'" . DG  B 2 3   ? 30.333  36.584 -105.014 1.00 29.02  ? 3   DG  D "C3'" 1 
ATOM   251   O  "O3'" . DG  B 2 3   ? 29.066  36.906 -105.585 1.00 28.27  ? 3   DG  D "O3'" 1 
ATOM   252   C  "C2'" . DG  B 2 3   ? 31.498  37.118 -105.829 1.00 29.02  ? 3   DG  D "C2'" 1 
ATOM   253   C  "C1'" . DG  B 2 3   ? 32.546  37.445 -104.762 1.00 29.06  ? 3   DG  D "C1'" 1 
ATOM   254   N  N9    . DG  B 2 3   ? 33.613  36.453 -104.576 1.00 29.22  ? 3   DG  D N9    1 
ATOM   255   C  C8    . DG  B 2 3   ? 33.964  35.815 -103.410 1.00 28.92  ? 3   DG  D C8    1 
ATOM   256   N  N7    . DG  B 2 3   ? 34.989  35.014 -103.550 1.00 29.43  ? 3   DG  D N7    1 
ATOM   257   C  C5    . DG  B 2 3   ? 35.329  35.124 -104.890 1.00 29.40  ? 3   DG  D C5    1 
ATOM   258   C  C6    . DG  B 2 3   ? 36.383  34.498 -105.639 1.00 29.31  ? 3   DG  D C6    1 
ATOM   259   O  O6    . DG  B 2 3   ? 37.246  33.694 -105.247 1.00 28.44  ? 3   DG  D O6    1 
ATOM   260   N  N1    . DG  B 2 3   ? 36.361  34.893 -106.971 1.00 29.00  ? 3   DG  D N1    1 
ATOM   261   C  C2    . DG  B 2 3   ? 35.451  35.770 -107.520 1.00 29.52  ? 3   DG  D C2    1 
ATOM   262   N  N2    . DG  B 2 3   ? 35.583  36.020 -108.824 1.00 29.35  ? 3   DG  D N2    1 
ATOM   263   N  N3    . DG  B 2 3   ? 34.477  36.357 -106.839 1.00 29.14  ? 3   DG  D N3    1 
ATOM   264   C  C4    . DG  B 2 3   ? 34.478  35.996 -105.541 1.00 28.88  ? 3   DG  D C4    1 
ATOM   265   P  P     . DT  B 2 4   ? 28.289  35.816 -106.463 1.00 28.25  ? 4   DT  D P     1 
ATOM   266   O  OP1   . DT  B 2 4   ? 26.945  36.348 -106.751 1.00 28.18  ? 4   DT  D OP1   1 
ATOM   267   O  OP2   . DT  B 2 4   ? 28.432  34.490 -105.837 1.00 27.24  ? 4   DT  D OP2   1 
ATOM   268   O  "O5'" . DT  B 2 4   ? 29.129  35.790 -107.818 1.00 28.17  ? 4   DT  D "O5'" 1 
ATOM   269   C  "C5'" . DT  B 2 4   ? 29.238  36.958 -108.648 1.00 27.25  ? 4   DT  D "C5'" 1 
ATOM   270   C  "C4'" . DT  B 2 4   ? 30.132  36.665 -109.829 1.00 28.49  ? 4   DT  D "C4'" 1 
ATOM   271   O  "O4'" . DT  B 2 4   ? 31.473  36.407 -109.362 1.00 28.63  ? 4   DT  D "O4'" 1 
ATOM   272   C  "C3'" . DT  B 2 4   ? 29.748  35.425 -110.629 1.00 28.84  ? 4   DT  D "C3'" 1 
ATOM   273   O  "O3'" . DT  B 2 4   ? 28.812  35.770 -111.657 1.00 27.48  ? 4   DT  D "O3'" 1 
ATOM   274   C  "C2'" . DT  B 2 4   ? 31.074  34.983 -111.223 1.00 28.92  ? 4   DT  D "C2'" 1 
ATOM   275   C  "C1'" . DT  B 2 4   ? 32.090  35.424 -110.181 1.00 28.45  ? 4   DT  D "C1'" 1 
ATOM   276   N  N1    . DT  B 2 4   ? 32.643  34.364 -109.310 1.00 28.67  ? 4   DT  D N1    1 
ATOM   277   C  C2    . DT  B 2 4   ? 33.719  33.650 -109.805 1.00 29.52  ? 4   DT  D C2    1 
ATOM   278   O  O2    . DT  B 2 4   ? 34.171  33.821 -110.931 1.00 29.38  ? 4   DT  D O2    1 
ATOM   279   N  N3    . DT  B 2 4   ? 34.243  32.720 -108.937 1.00 28.70  ? 4   DT  D N3    1 
ATOM   280   C  C4    . DT  B 2 4   ? 33.805  32.427 -107.661 1.00 28.67  ? 4   DT  D C4    1 
ATOM   281   O  O4    . DT  B 2 4   ? 34.378  31.554 -107.001 1.00 28.80  ? 4   DT  D O4    1 
ATOM   282   C  C5    . DT  B 2 4   ? 32.658  33.201 -107.211 1.00 28.46  ? 4   DT  D C5    1 
ATOM   283   C  C7    . DT  B 2 4   ? 32.118  32.962 -105.840 1.00 27.39  ? 4   DT  D C7    1 
ATOM   284   C  C6    . DT  B 2 4   ? 32.136  34.110 -108.052 1.00 28.33  ? 4   DT  D C6    1 
ATOM   285   P  P     . DC  B 2 5   ? 28.042  34.607 -112.447 1.00 28.41  ? 5   DC  D P     1 
ATOM   286   O  OP1   . DC  B 2 5   ? 27.320  35.273 -113.555 1.00 27.88  ? 5   DC  D OP1   1 
ATOM   287   O  OP2   . DC  B 2 5   ? 27.291  33.800 -111.456 1.00 28.08  ? 5   DC  D OP2   1 
ATOM   288   O  "O5'" . DC  B 2 5   ? 29.209  33.680 -113.020 1.00 28.05  ? 5   DC  D "O5'" 1 
ATOM   289   C  "C5'" . DC  B 2 5   ? 29.895  34.016 -114.237 1.00 25.79  ? 5   DC  D "C5'" 1 
ATOM   290   C  "C4'" . DC  B 2 5   ? 30.819  32.895 -114.654 1.00 25.20  ? 5   DC  D "C4'" 1 
ATOM   291   O  "O4'" . DC  B 2 5   ? 31.947  32.766 -113.752 1.00 25.00  ? 5   DC  D "O4'" 1 
ATOM   292   C  "C3'" . DC  B 2 5   ? 30.203  31.501 -114.688 1.00 24.59  ? 5   DC  D "C3'" 1 
ATOM   293   O  "O3'" . DC  B 2 5   ? 29.451  31.294 -115.894 1.00 24.82  ? 5   DC  D "O3'" 1 
ATOM   294   C  "C2'" . DC  B 2 5   ? 31.432  30.609 -114.618 1.00 24.28  ? 5   DC  D "C2'" 1 
ATOM   295   C  "C1'" . DC  B 2 5   ? 32.430  31.419 -113.793 1.00 24.53  ? 5   DC  D "C1'" 1 
ATOM   296   N  N1    . DC  B 2 5   ? 32.620  30.930 -112.408 1.00 24.84  ? 5   DC  D N1    1 
ATOM   297   C  C2    . DC  B 2 5   ? 33.593  29.930 -112.164 1.00 25.06  ? 5   DC  D C2    1 
ATOM   298   O  O2    . DC  B 2 5   ? 34.288  29.507 -113.104 1.00 21.74  ? 5   DC  D O2    1 
ATOM   299   N  N3    . DC  B 2 5   ? 33.748  29.457 -110.909 1.00 26.31  ? 5   DC  D N3    1 
ATOM   300   C  C4    . DC  B 2 5   ? 33.002  29.937 -109.918 1.00 25.77  ? 5   DC  D C4    1 
ATOM   301   N  N4    . DC  B 2 5   ? 33.197  29.441 -108.702 1.00 26.35  ? 5   DC  D N4    1 
ATOM   302   C  C5    . DC  B 2 5   ? 32.022  30.952 -110.131 1.00 26.08  ? 5   DC  D C5    1 
ATOM   303   C  C6    . DC  B 2 5   ? 31.868  31.415 -111.377 1.00 25.72  ? 5   DC  D C6    1 
ATOM   304   P  P     . DG  B 2 6   ? 28.703  29.889 -116.126 1.00 23.91  ? 6   DG  D P     1 
ATOM   305   O  OP1   . DG  B 2 6   ? 28.039  29.964 -117.440 1.00 24.64  ? 6   DG  D OP1   1 
ATOM   306   O  OP2   . DG  B 2 6   ? 27.890  29.592 -114.903 1.00 22.42  ? 6   DG  D OP2   1 
ATOM   307   O  "O5'" . DG  B 2 6   ? 29.921  28.865 -116.215 1.00 23.54  ? 6   DG  D "O5'" 1 
ATOM   308   C  "C5'" . DG  B 2 6   ? 29.753  27.446 -116.079 1.00 24.66  ? 6   DG  D "C5'" 1 
ATOM   309   C  "C4'" . DG  B 2 6   ? 31.110  26.772 -116.103 1.00 26.33  ? 6   DG  D "C4'" 1 
ATOM   310   O  "O4'" . DG  B 2 6   ? 31.962  27.309 -115.064 1.00 25.67  ? 6   DG  D "O4'" 1 
ATOM   311   C  "C3'" . DG  B 2 6   ? 31.096  25.265 -115.881 1.00 27.24  ? 6   DG  D "C3'" 1 
ATOM   312   O  "O3'" . DG  B 2 6   ? 30.959  24.616 -117.153 1.00 27.63  ? 6   DG  D "O3'" 1 
ATOM   313   C  "C2'" . DG  B 2 6   ? 32.463  25.001 -115.273 1.00 26.84  ? 6   DG  D "C2'" 1 
ATOM   314   C  "C1'" . DG  B 2 6   ? 32.796  26.292 -114.523 1.00 26.30  ? 6   DG  D "C1'" 1 
ATOM   315   N  N9    . DG  B 2 6   ? 32.598  26.263 -113.071 1.00 26.77  ? 6   DG  D N9    1 
ATOM   316   C  C8    . DG  B 2 6   ? 31.664  26.972 -112.347 1.00 26.14  ? 6   DG  D C8    1 
ATOM   317   N  N7    . DG  B 2 6   ? 31.725  26.737 -111.063 1.00 27.56  ? 6   DG  D N7    1 
ATOM   318   C  C5    . DG  B 2 6   ? 32.757  25.818 -110.926 1.00 26.60  ? 6   DG  D C5    1 
ATOM   319   C  C6    . DG  B 2 6   ? 33.290  25.193 -109.759 1.00 27.10  ? 6   DG  D C6    1 
ATOM   320   O  O6    . DG  B 2 6   ? 32.954  25.340 -108.584 1.00 26.97  ? 6   DG  D O6    1 
ATOM   321   N  N1    . DG  B 2 6   ? 34.331  24.325 -110.075 1.00 27.64  ? 6   DG  D N1    1 
ATOM   322   C  C2    . DG  B 2 6   ? 34.808  24.094 -111.341 1.00 26.23  ? 6   DG  D C2    1 
ATOM   323   N  N2    . DG  B 2 6   ? 35.816  23.229 -111.435 1.00 26.35  ? 6   DG  D N2    1 
ATOM   324   N  N3    . DG  B 2 6   ? 34.328  24.670 -112.431 1.00 26.64  ? 6   DG  D N3    1 
ATOM   325   C  C4    . DG  B 2 6   ? 33.310  25.514 -112.153 1.00 26.32  ? 6   DG  D C4    1 
ATOM   326   P  P     . DC  B 2 7   ? 30.326  23.142 -117.240 1.00 31.54  ? 7   DC  D P     1 
ATOM   327   O  OP1   . DC  B 2 7   ? 30.341  22.732 -118.674 1.00 29.18  ? 7   DC  D OP1   1 
ATOM   328   O  OP2   . DC  B 2 7   ? 29.028  23.179 -116.490 1.00 30.44  ? 7   DC  D OP2   1 
ATOM   329   O  "O5'" . DC  B 2 7   ? 31.338  22.208 -116.440 1.00 31.50  ? 7   DC  D "O5'" 1 
ATOM   330   C  "C5'" . DC  B 2 7   ? 32.653  21.936 -116.970 1.00 35.69  ? 7   DC  D "C5'" 1 
ATOM   331   C  "C4'" . DC  B 2 7   ? 33.233  20.692 -116.339 1.00 36.79  ? 7   DC  D "C4'" 1 
ATOM   332   O  "O4'" . DC  B 2 7   ? 33.539  20.978 -114.956 1.00 38.50  ? 7   DC  D "O4'" 1 
ATOM   333   C  "C3'" . DC  B 2 7   ? 32.309  19.475 -116.335 1.00 37.97  ? 7   DC  D "C3'" 1 
ATOM   334   O  "O3'" . DC  B 2 7   ? 33.058  18.284 -116.621 1.00 38.78  ? 7   DC  D "O3'" 1 
ATOM   335   C  "C2'" . DC  B 2 7   ? 31.738  19.463 -114.924 1.00 38.95  ? 7   DC  D "C2'" 1 
ATOM   336   C  "C1'" . DC  B 2 7   ? 32.843  20.102 -114.086 1.00 39.30  ? 7   DC  D "C1'" 1 
ATOM   337   N  N1    . DC  B 2 7   ? 32.357  20.904 -112.946 1.00 40.37  ? 7   DC  D N1    1 
ATOM   338   C  C2    . DC  B 2 7   ? 32.750  20.552 -111.641 1.00 40.80  ? 7   DC  D C2    1 
ATOM   339   O  O2    . DC  B 2 7   ? 33.508  19.579 -111.474 1.00 40.40  ? 7   DC  D O2    1 
ATOM   340   N  N3    . DC  B 2 7   ? 32.295  21.284 -110.597 1.00 41.34  ? 7   DC  D N3    1 
ATOM   341   C  C4    . DC  B 2 7   ? 31.487  22.327 -110.812 1.00 41.30  ? 7   DC  D C4    1 
ATOM   342   N  N4    . DC  B 2 7   ? 31.057  23.019 -109.747 1.00 41.66  ? 7   DC  D N4    1 
ATOM   343   C  C5    . DC  B 2 7   ? 31.081  22.709 -112.124 1.00 40.84  ? 7   DC  D C5    1 
ATOM   344   C  C6    . DC  B 2 7   ? 31.533  21.978 -113.150 1.00 40.54  ? 7   DC  D C6    1 
ATOM   345   P  P     . DT  B 2 8   ? 32.305  16.857 -116.717 1.00 38.97  ? 8   DT  D P     1 
ATOM   346   O  OP1   . DT  B 2 8   ? 32.938  16.034 -117.777 1.00 39.24  ? 8   DT  D OP1   1 
ATOM   347   O  OP2   . DT  B 2 8   ? 30.843  17.117 -116.770 1.00 38.79  ? 8   DT  D OP2   1 
ATOM   348   O  "O5'" . DT  B 2 8   ? 32.666  16.184 -115.325 1.00 41.20  ? 8   DT  D "O5'" 1 
ATOM   349   C  "C5'" . DT  B 2 8   ? 34.040  15.941 -114.982 1.00 45.11  ? 8   DT  D "C5'" 1 
ATOM   350   C  "C4'" . DT  B 2 8   ? 34.133  15.199 -113.671 1.00 47.18  ? 8   DT  D "C4'" 1 
ATOM   351   O  "O4'" . DT  B 2 8   ? 33.713  16.061 -112.592 1.00 46.95  ? 8   DT  D "O4'" 1 
ATOM   352   C  "C3'" . DT  B 2 8   ? 33.276  13.937 -113.577 1.00 49.06  ? 8   DT  D "C3'" 1 
ATOM   353   O  "O3'" . DT  B 2 8   ? 34.009  12.924 -112.884 1.00 52.15  ? 8   DT  D "O3'" 1 
ATOM   354   C  "C2'" . DT  B 2 8   ? 32.080  14.383 -112.753 1.00 48.47  ? 8   DT  D "C2'" 1 
ATOM   355   C  "C1'" . DT  B 2 8   ? 32.680  15.444 -111.842 1.00 47.58  ? 8   DT  D "C1'" 1 
ATOM   356   N  N1    . DT  B 2 8   ? 31.763  16.509 -111.380 1.00 47.04  ? 8   DT  D N1    1 
ATOM   357   C  C2    . DT  B 2 8   ? 31.835  16.894 -110.057 1.00 46.91  ? 8   DT  D C2    1 
ATOM   358   O  O2    . DT  B 2 8   ? 32.588  16.373 -109.244 1.00 46.93  ? 8   DT  D O2    1 
ATOM   359   N  N3    . DT  B 2 8   ? 30.990  17.922 -109.715 1.00 46.05  ? 8   DT  D N3    1 
ATOM   360   C  C4    . DT  B 2 8   ? 30.100  18.583 -110.538 1.00 46.30  ? 8   DT  D C4    1 
ATOM   361   O  O4    . DT  B 2 8   ? 29.424  19.509 -110.090 1.00 46.25  ? 8   DT  D O4    1 
ATOM   362   C  C5    . DT  B 2 8   ? 30.055  18.108 -111.905 1.00 46.12  ? 8   DT  D C5    1 
ATOM   363   C  C7    . DT  B 2 8   ? 29.103  18.742 -112.868 1.00 45.65  ? 8   DT  D C7    1 
ATOM   364   C  C6    . DT  B 2 8   ? 30.877  17.110 -112.251 1.00 46.76  ? 8   DT  D C6    1 
ATOM   365   P  P     . DG  B 2 9   ? 33.577  11.381 -113.023 1.00 54.85  ? 9   DG  D P     1 
ATOM   366   O  OP1   . DG  B 2 9   ? 34.725  10.624 -113.586 1.00 54.83  ? 9   DG  D OP1   1 
ATOM   367   O  OP2   . DG  B 2 9   ? 32.250  11.305 -113.691 1.00 54.96  ? 9   DG  D OP2   1 
ATOM   368   O  "O5'" . DG  B 2 9   ? 33.393  10.926 -111.508 1.00 55.87  ? 9   DG  D "O5'" 1 
ATOM   369   C  "C5'" . DG  B 2 9   ? 34.475  11.068 -110.571 1.00 57.81  ? 9   DG  D "C5'" 1 
ATOM   370   C  "C4'" . DG  B 2 9   ? 33.959  11.035 -109.150 1.00 59.19  ? 9   DG  D "C4'" 1 
ATOM   371   O  "O4'" . DG  B 2 9   ? 33.190  12.227 -108.852 1.00 58.78  ? 9   DG  D "O4'" 1 
ATOM   372   C  "C3'" . DG  B 2 9   ? 33.065  9.847  -108.793 1.00 60.31  ? 9   DG  D "C3'" 1 
ATOM   373   O  "O3'" . DG  B 2 9   ? 33.432  9.348  -107.502 1.00 63.20  ? 9   DG  D "O3'" 1 
ATOM   374   C  "C2'" . DG  B 2 9   ? 31.667  10.444 -108.765 1.00 59.40  ? 9   DG  D "C2'" 1 
ATOM   375   C  "C1'" . DG  B 2 9   ? 31.916  11.876 -108.325 1.00 58.30  ? 9   DG  D "C1'" 1 
ATOM   376   N  N9    . DG  B 2 9   ? 30.945  12.845 -108.827 1.00 57.34  ? 9   DG  D N9    1 
ATOM   377   C  C8    . DG  B 2 9   ? 30.536  13.006 -110.130 1.00 57.20  ? 9   DG  D C8    1 
ATOM   378   N  N7    . DG  B 2 9   ? 29.678  13.977 -110.283 1.00 56.62  ? 9   DG  D N7    1 
ATOM   379   C  C5    . DG  B 2 9   ? 29.502  14.486 -109.003 1.00 56.35  ? 9   DG  D C5    1 
ATOM   380   C  C6    . DG  B 2 9   ? 28.691  15.556 -108.547 1.00 55.80  ? 9   DG  D C6    1 
ATOM   381   O  O6    . DG  B 2 9   ? 27.953  16.296 -109.204 1.00 56.09  ? 9   DG  D O6    1 
ATOM   382   N  N1    . DG  B 2 9   ? 28.802  15.732 -107.173 1.00 55.49  ? 9   DG  D N1    1 
ATOM   383   C  C2    . DG  B 2 9   ? 29.595  14.982 -106.344 1.00 55.81  ? 9   DG  D C2    1 
ATOM   384   N  N2    . DG  B 2 9   ? 29.559  15.309 -105.047 1.00 55.99  ? 9   DG  D N2    1 
ATOM   385   N  N3    . DG  B 2 9   ? 30.365  13.985 -106.755 1.00 56.02  ? 9   DG  D N3    1 
ATOM   386   C  C4    . DG  B 2 9   ? 30.269  13.793 -108.090 1.00 56.63  ? 9   DG  D C4    1 
ATOM   387   P  P     . DA  B 2 10  ? 32.557  8.192  -106.812 1.00 65.12  ? 10  DA  D P     1 
ATOM   388   O  OP1   . DA  B 2 10  ? 33.443  7.436  -105.889 1.00 65.17  ? 10  DA  D OP1   1 
ATOM   389   O  OP2   . DA  B 2 10  ? 31.816  7.464  -107.877 1.00 65.01  ? 10  DA  D OP2   1 
ATOM   390   O  "O5'" . DA  B 2 10  ? 31.511  9.015  -105.941 1.00 66.18  ? 10  DA  D "O5'" 1 
ATOM   391   C  "C5'" . DA  B 2 10  ? 31.925  9.660  -104.727 1.00 68.66  ? 10  DA  D "C5'" 1 
ATOM   392   C  "C4'" . DA  B 2 10  ? 30.782  9.705  -103.740 1.00 70.51  ? 10  DA  D "C4'" 1 
ATOM   393   O  "O4'" . DA  B 2 10  ? 29.869  10.775 -104.082 1.00 70.40  ? 10  DA  D "O4'" 1 
ATOM   394   C  "C3'" . DA  B 2 10  ? 29.947  8.425  -103.667 1.00 71.91  ? 10  DA  D "C3'" 1 
ATOM   395   O  "O3'" . DA  B 2 10  ? 29.625  8.144  -102.302 1.00 74.71  ? 10  DA  D "O3'" 1 
ATOM   396   C  "C2'" . DA  B 2 10  ? 28.704  8.769  -104.473 1.00 71.27  ? 10  DA  D "C2'" 1 
ATOM   397   C  "C1'" . DA  B 2 10  ? 28.553  10.268 -104.252 1.00 70.32  ? 10  DA  D "C1'" 1 
ATOM   398   N  N9    . DA  B 2 10  ? 27.935  10.997 -105.362 1.00 69.49  ? 10  DA  D N9    1 
ATOM   399   C  C8    . DA  B 2 10  ? 27.959  10.696 -106.704 1.00 69.13  ? 10  DA  D C8    1 
ATOM   400   N  N7    . DA  B 2 10  ? 27.307  11.554 -107.450 1.00 68.93  ? 10  DA  D N7    1 
ATOM   401   C  C5    . DA  B 2 10  ? 26.820  12.483 -106.541 1.00 68.78  ? 10  DA  D C5    1 
ATOM   402   C  C6    . DA  B 2 10  ? 26.041  13.644 -106.701 1.00 68.58  ? 10  DA  D C6    1 
ATOM   403   N  N6    . DA  B 2 10  ? 25.599  14.083 -107.882 1.00 68.50  ? 10  DA  D N6    1 
ATOM   404   N  N1    . DA  B 2 10  ? 25.727  14.345 -105.591 1.00 68.48  ? 10  DA  D N1    1 
ATOM   405   C  C2    . DA  B 2 10  ? 26.168  13.902 -104.406 1.00 68.46  ? 10  DA  D C2    1 
ATOM   406   N  N3    . DA  B 2 10  ? 26.904  12.829 -104.128 1.00 68.57  ? 10  DA  D N3    1 
ATOM   407   C  C4    . DA  B 2 10  ? 27.199  12.153 -105.252 1.00 68.87  ? 10  DA  D C4    1 
ATOM   408   P  P     . DT  B 2 11  ? 28.689  6.887  -101.931 1.00 76.95  ? 11  DT  D P     1 
ATOM   409   O  OP1   . DT  B 2 11  ? 29.325  6.180  -100.789 1.00 77.00  ? 11  DT  D OP1   1 
ATOM   410   O  OP2   . DT  B 2 11  ? 28.354  6.129  -103.169 1.00 76.52  ? 11  DT  D OP2   1 
ATOM   411   O  "O5'" . DT  B 2 11  ? 27.364  7.589  -101.402 1.00 78.13  ? 11  DT  D "O5'" 1 
ATOM   412   C  "C5'" . DT  B 2 11  ? 27.449  8.708  -100.506 1.00 80.78  ? 11  DT  D "C5'" 1 
ATOM   413   C  "C4'" . DT  B 2 11  ? 26.109  9.391  -100.386 1.00 82.78  ? 11  DT  D "C4'" 1 
ATOM   414   O  "O4'" . DT  B 2 11  ? 25.750  9.999  -101.650 1.00 83.16  ? 11  DT  D "O4'" 1 
ATOM   415   C  "C3'" . DT  B 2 11  ? 24.954  8.463  -100.009 1.00 84.18  ? 11  DT  D "C3'" 1 
ATOM   416   O  "O3'" . DT  B 2 11  ? 24.075  9.131  -99.105  1.00 86.11  ? 11  DT  D "O3'" 1 
ATOM   417   C  "C2'" . DT  B 2 11  ? 24.238  8.231  -101.327 1.00 84.06  ? 11  DT  D "C2'" 1 
ATOM   418   C  "C1'" . DT  B 2 11  ? 24.474  9.539  -102.068 1.00 83.64  ? 11  DT  D "C1'" 1 
ATOM   419   N  N1    . DT  B 2 11  ? 24.480  9.431  -103.548 1.00 83.61  ? 11  DT  D N1    1 
ATOM   420   C  C2    . DT  B 2 11  ? 23.900  10.451 -104.284 1.00 83.57  ? 11  DT  D C2    1 
ATOM   421   O  O2    . DT  B 2 11  ? 23.396  11.446 -103.783 1.00 83.31  ? 11  DT  D O2    1 
ATOM   422   N  N3    . DT  B 2 11  ? 23.929  10.258 -105.644 1.00 83.57  ? 11  DT  D N3    1 
ATOM   423   C  C4    . DT  B 2 11  ? 24.463  9.181  -106.328 1.00 83.66  ? 11  DT  D C4    1 
ATOM   424   O  O4    . DT  B 2 11  ? 24.405  9.145  -107.556 1.00 83.73  ? 11  DT  D O4    1 
ATOM   425   C  C5    . DT  B 2 11  ? 25.059  8.157  -105.497 1.00 83.66  ? 11  DT  D C5    1 
ATOM   426   C  C7    . DT  B 2 11  ? 25.663  6.952  -106.146 1.00 83.77  ? 11  DT  D C7    1 
ATOM   427   C  C6    . DT  B 2 11  ? 25.042  8.334  -104.171 1.00 83.65  ? 11  DT  D C6    1 
ATOM   428   P  P     . DC  B 2 12  ? 23.040  8.280  -98.218  1.00 87.59  ? 12  DC  D P     1 
ATOM   429   O  OP1   . DC  B 2 12  ? 23.596  8.184  -96.843  1.00 87.54  ? 12  DC  D OP1   1 
ATOM   430   O  OP2   . DC  B 2 12  ? 22.696  7.037  -98.962  1.00 87.14  ? 12  DC  D OP2   1 
ATOM   431   O  "O5'" . DC  B 2 12  ? 21.755  9.221  -98.168  1.00 88.69  ? 12  DC  D "O5'" 1 
ATOM   432   C  "C5'" . DC  B 2 12  ? 21.868  10.593 -97.731  1.00 90.54  ? 12  DC  D "C5'" 1 
ATOM   433   C  "C4'" . DC  B 2 12  ? 20.769  11.436 -98.337  1.00 91.82  ? 12  DC  D "C4'" 1 
ATOM   434   O  "O4'" . DC  B 2 12  ? 20.950  11.532 -99.773  1.00 92.16  ? 12  DC  D "O4'" 1 
ATOM   435   C  "C3'" . DC  B 2 12  ? 19.349  10.910 -98.116  1.00 92.68  ? 12  DC  D "C3'" 1 
ATOM   436   O  "O3'" . DC  B 2 12  ? 18.454  11.995 -97.837  1.00 93.78  ? 12  DC  D "O3'" 1 
ATOM   437   C  "C2'" . DC  B 2 12  ? 18.993  10.274 -99.447  1.00 92.64  ? 12  DC  D "C2'" 1 
ATOM   438   C  "C1'" . DC  B 2 12  ? 19.758  11.135 -100.439 1.00 92.45  ? 12  DC  D "C1'" 1 
ATOM   439   N  N1    . DC  B 2 12  ? 20.129  10.456 -101.697 1.00 92.38  ? 12  DC  D N1    1 
ATOM   440   C  C2    . DC  B 2 12  ? 19.713  11.020 -102.917 1.00 92.28  ? 12  DC  D C2    1 
ATOM   441   O  O2    . DC  B 2 12  ? 19.060  12.079 -102.905 1.00 91.97  ? 12  DC  D O2    1 
ATOM   442   N  N3    . DC  B 2 12  ? 20.035  10.398 -104.076 1.00 92.27  ? 12  DC  D N3    1 
ATOM   443   C  C4    . DC  B 2 12  ? 20.739  9.263  -104.053 1.00 92.34  ? 12  DC  D C4    1 
ATOM   444   N  N4    . DC  B 2 12  ? 21.030  8.685  -105.223 1.00 92.13  ? 12  DC  D N4    1 
ATOM   445   C  C5    . DC  B 2 12  ? 21.176  8.670  -102.831 1.00 92.37  ? 12  DC  D C5    1 
ATOM   446   C  C6    . DC  B 2 12  ? 20.855  9.294  -101.688 1.00 92.38  ? 12  DC  D C6    1 
ATOM   447   P  P     . DC  B 2 13  ? 16.931  11.687 -97.417  1.00 94.60  ? 13  DC  D P     1 
ATOM   448   O  OP1   . DC  B 2 13  ? 16.355  12.943 -96.863  1.00 94.49  ? 13  DC  D OP1   1 
ATOM   449   O  OP2   . DC  B 2 13  ? 16.936  10.453 -96.584  1.00 94.51  ? 13  DC  D OP2   1 
ATOM   450   O  "O5'" . DC  B 2 13  ? 16.208  11.349 -98.803  1.00 95.28  ? 13  DC  D "O5'" 1 
ATOM   451   C  "C5'" . DC  B 2 13  ? 15.755  12.408 -99.676  1.00 96.49  ? 13  DC  D "C5'" 1 
ATOM   452   C  "C4'" . DC  B 2 13  ? 14.836  11.876 -100.757 1.00 97.27  ? 13  DC  D "C4'" 1 
ATOM   453   O  "O4'" . DC  B 2 13  ? 15.578  11.305 -101.865 1.00 97.35  ? 13  DC  D "O4'" 1 
ATOM   454   C  "C3'" . DC  B 2 13  ? 13.784  10.835 -100.351 1.00 97.74  ? 13  DC  D "C3'" 1 
ATOM   455   O  "O3'" . DC  B 2 13  ? 12.529  11.156 -100.975 1.00 98.49  ? 13  DC  D "O3'" 1 
ATOM   456   C  "C2'" . DC  B 2 13  ? 14.308  9.552  -100.974 1.00 97.57  ? 13  DC  D "C2'" 1 
ATOM   457   C  "C1'" . DC  B 2 13  ? 14.963  10.084 -102.240 1.00 97.42  ? 13  DC  D "C1'" 1 
ATOM   458   N  N1    . DC  B 2 13  ? 15.965  9.232  -102.918 1.00 97.34  ? 13  DC  D N1    1 
ATOM   459   C  C2    . DC  B 2 13  ? 16.178  9.412  -104.299 1.00 97.09  ? 13  DC  D C2    1 
ATOM   460   O  O2    . DC  B 2 13  ? 15.554  10.304 -104.898 1.00 96.80  ? 13  DC  D O2    1 
ATOM   461   N  N3    . DC  B 2 13  ? 17.060  8.613  -104.942 1.00 96.94  ? 13  DC  D N3    1 
ATOM   462   C  C4    . DC  B 2 13  ? 17.724  7.671  -104.267 1.00 96.98  ? 13  DC  D C4    1 
ATOM   463   N  N4    . DC  B 2 13  ? 18.576  6.900  -104.946 1.00 96.81  ? 13  DC  D N4    1 
ATOM   464   C  C5    . DC  B 2 13  ? 17.542  7.477  -102.865 1.00 97.11  ? 13  DC  D C5    1 
ATOM   465   C  C6    . DC  B 2 13  ? 16.665  8.273  -102.236 1.00 97.23  ? 13  DC  D C6    1 
ATOM   466   P  P     . DG  B 2 14  ? 11.188  10.355 -100.568 1.00 98.99  ? 14  DG  D P     1 
ATOM   467   O  OP1   . DG  B 2 14  ? 10.427  11.194 -99.606  1.00 98.95  ? 14  DG  D OP1   1 
ATOM   468   O  OP2   . DG  B 2 14  ? 11.552  8.960  -100.195 1.00 98.95  ? 14  DG  D OP2   1 
ATOM   469   O  "O5'" . DG  B 2 14  ? 10.366  10.293 -101.936 1.00 99.31  ? 14  DG  D "O5'" 1 
ATOM   470   C  "C5'" . DG  B 2 14  ? 10.059  11.500 -102.671 1.00 99.75  ? 14  DG  D "C5'" 1 
ATOM   471   C  "C4'" . DG  B 2 14  ? 9.601   11.179 -104.078 1.00 99.93  ? 14  DG  D "C4'" 1 
ATOM   472   O  "O4'" . DG  B 2 14  ? 10.692  10.625 -104.855 1.00 99.95  ? 14  DG  D "O4'" 1 
ATOM   473   C  "C3'" . DG  B 2 14  ? 8.437   10.193 -104.204 1.00 100.01 ? 14  DG  D "C3'" 1 
ATOM   474   O  "O3'" . DG  B 2 14  ? 7.549   10.614 -105.247 1.00 99.97  ? 14  DG  D "O3'" 1 
ATOM   475   C  "C2'" . DG  B 2 14  ? 9.107   8.902  -104.640 1.00 100.02 ? 14  DG  D "C2'" 1 
ATOM   476   C  "C1'" . DG  B 2 14  ? 10.295  9.399  -105.452 1.00 100.00 ? 14  DG  D "C1'" 1 
ATOM   477   N  N9    . DG  B 2 14  ? 11.456  8.510  -105.471 1.00 100.02 ? 14  DG  D N9    1 
ATOM   478   C  C8    . DG  B 2 14  ? 11.935  7.735  -104.439 1.00 100.02 ? 14  DG  D C8    1 
ATOM   479   N  N7    . DG  B 2 14  ? 12.993  7.043  -104.766 1.00 100.02 ? 14  DG  D N7    1 
ATOM   480   C  C5    . DG  B 2 14  ? 13.231  7.380  -106.092 1.00 100.01 ? 14  DG  D C5    1 
ATOM   481   C  C6    . DG  B 2 14  ? 14.246  6.944  -106.985 1.00 100.01 ? 14  DG  D C6    1 
ATOM   482   O  O6    . DG  B 2 14  ? 15.168  6.145  -106.776 1.00 100.00 ? 14  DG  D O6    1 
ATOM   483   N  N1    . DG  B 2 14  ? 14.115  7.538  -108.237 1.00 100.01 ? 14  DG  D N1    1 
ATOM   484   C  C2    . DG  B 2 14  ? 13.137  8.435  -108.587 1.00 99.98  ? 14  DG  D C2    1 
ATOM   485   N  N2    . DG  B 2 14  ? 13.181  8.896  -109.847 1.00 99.99  ? 14  DG  D N2    1 
ATOM   486   N  N3    . DG  B 2 14  ? 12.186  8.850  -107.766 1.00 100.02 ? 14  DG  D N3    1 
ATOM   487   C  C4    . DG  B 2 14  ? 12.292  8.285  -106.543 1.00 100.02 ? 14  DG  D C4    1 
ATOM   488   O  "O5'" . DG  C 1 1   ? -0.069  19.689 -74.713  1.00 96.33  ? 20  DG  E "O5'" 1 
ATOM   489   C  "C5'" . DG  C 1 1   ? 1.035   20.550 -75.002  1.00 96.14  ? 20  DG  E "C5'" 1 
ATOM   490   C  "C4'" . DG  C 1 1   ? 2.258   19.792 -75.465  1.00 96.01  ? 20  DG  E "C4'" 1 
ATOM   491   O  "O4'" . DG  C 1 1   ? 1.914   19.011 -76.635  1.00 95.88  ? 20  DG  E "O4'" 1 
ATOM   492   C  "C3'" . DG  C 1 1   ? 3.427   20.689 -75.877  1.00 95.93  ? 20  DG  E "C3'" 1 
ATOM   493   O  "O3'" . DG  C 1 1   ? 4.680   20.128 -75.467  1.00 95.64  ? 20  DG  E "O3'" 1 
ATOM   494   C  "C2'" . DG  C 1 1   ? 3.332   20.727 -77.391  1.00 96.01  ? 20  DG  E "C2'" 1 
ATOM   495   C  "C1'" . DG  C 1 1   ? 2.714   19.387 -77.749  1.00 95.99  ? 20  DG  E "C1'" 1 
ATOM   496   N  N9    . DG  C 1 1   ? 1.844   19.457 -78.922  1.00 95.99  ? 20  DG  E N9    1 
ATOM   497   C  C8    . DG  C 1 1   ? 0.473   19.566 -78.928  1.00 96.14  ? 20  DG  E C8    1 
ATOM   498   N  N7    . DG  C 1 1   ? -0.033  19.611 -80.130  1.00 96.22  ? 20  DG  E N7    1 
ATOM   499   C  C5    . DG  C 1 1   ? 1.067   19.526 -80.971  1.00 96.11  ? 20  DG  E C5    1 
ATOM   500   C  C6    . DG  C 1 1   ? 1.141   19.525 -82.390  1.00 96.10  ? 20  DG  E C6    1 
ATOM   501   O  O6    . DG  C 1 1   ? 0.217   19.596 -83.211  1.00 96.04  ? 20  DG  E O6    1 
ATOM   502   N  N1    . DG  C 1 1   ? 2.456   19.427 -82.833  1.00 96.08  ? 20  DG  E N1    1 
ATOM   503   C  C2    . DG  C 1 1   ? 3.559   19.337 -82.020  1.00 96.12  ? 20  DG  E C2    1 
ATOM   504   N  N2    . DG  C 1 1   ? 4.745   19.249 -82.642  1.00 96.07  ? 20  DG  E N2    1 
ATOM   505   N  N3    . DG  C 1 1   ? 3.504   19.333 -80.696  1.00 96.16  ? 20  DG  E N3    1 
ATOM   506   C  C4    . DG  C 1 1   ? 2.235   19.431 -80.243  1.00 96.11  ? 20  DG  E C4    1 
ATOM   507   P  P     . DG  C 1 2   ? 5.927   21.099 -75.157  1.00 95.48  ? 21  DG  E P     1 
ATOM   508   O  OP1   . DG  C 1 2   ? 7.042   20.260 -74.654  1.00 95.52  ? 21  DG  E OP1   1 
ATOM   509   O  OP2   . DG  C 1 2   ? 5.435   22.235 -74.330  1.00 95.37  ? 21  DG  E OP2   1 
ATOM   510   O  "O5'" . DG  C 1 2   ? 6.340   21.665 -76.588  1.00 95.14  ? 21  DG  E "O5'" 1 
ATOM   511   C  "C5'" . DG  C 1 2   ? 7.099   20.853 -77.506  1.00 94.69  ? 21  DG  E "C5'" 1 
ATOM   512   C  "C4'" . DG  C 1 2   ? 7.255   21.553 -78.837  1.00 94.18  ? 21  DG  E "C4'" 1 
ATOM   513   O  "O4'" . DG  C 1 2   ? 5.986   21.615 -79.532  1.00 94.21  ? 21  DG  E "O4'" 1 
ATOM   514   C  "C3'" . DG  C 1 2   ? 7.786   22.986 -78.787  1.00 93.84  ? 21  DG  E "C3'" 1 
ATOM   515   O  "O3'" . DG  C 1 2   ? 8.669   23.184 -79.895  1.00 93.24  ? 21  DG  E "O3'" 1 
ATOM   516   C  "C2'" . DG  C 1 2   ? 6.541   23.832 -78.995  1.00 93.89  ? 21  DG  E "C2'" 1 
ATOM   517   C  "C1'" . DG  C 1 2   ? 5.710   22.954 -79.917  1.00 94.03  ? 21  DG  E "C1'" 1 
ATOM   518   N  N9    . DG  C 1 2   ? 4.261   23.143 -79.881  1.00 93.90  ? 21  DG  E N9    1 
ATOM   519   C  C8    . DG  C 1 2   ? 3.476   23.446 -78.793  1.00 93.84  ? 21  DG  E C8    1 
ATOM   520   N  N7    . DG  C 1 2   ? 2.204   23.508 -79.080  1.00 93.76  ? 21  DG  E N7    1 
ATOM   521   C  C5    . DG  C 1 2   ? 2.146   23.243 -80.442  1.00 93.70  ? 21  DG  E C5    1 
ATOM   522   C  C6    . DG  C 1 2   ? 1.031   23.168 -81.317  1.00 93.59  ? 21  DG  E C6    1 
ATOM   523   O  O6    . DG  C 1 2   ? -0.168  23.317 -81.054  1.00 93.27  ? 21  DG  E O6    1 
ATOM   524   N  N1    . DG  C 1 2   ? 1.424   22.882 -82.621  1.00 93.66  ? 21  DG  E N1    1 
ATOM   525   C  C2    . DG  C 1 2   ? 2.720   22.687 -83.032  1.00 93.79  ? 21  DG  E C2    1 
ATOM   526   N  N2    . DG  C 1 2   ? 2.897   22.425 -84.336  1.00 93.80  ? 21  DG  E N2    1 
ATOM   527   N  N3    . DG  C 1 2   ? 3.765   22.747 -82.225  1.00 93.79  ? 21  DG  E N3    1 
ATOM   528   C  C4    . DG  C 1 2   ? 3.407   23.027 -80.953  1.00 93.80  ? 21  DG  E C4    1 
ATOM   529   P  P     . DA  C 1 3   ? 9.866   24.250 -79.792  1.00 92.94  ? 22  DA  E P     1 
ATOM   530   O  OP1   . DA  C 1 3   ? 11.080  23.543 -79.302  1.00 92.81  ? 22  DA  E OP1   1 
ATOM   531   O  OP2   . DA  C 1 3   ? 9.365   25.444 -79.059  1.00 93.01  ? 22  DA  E OP2   1 
ATOM   532   O  "O5'" . DA  C 1 3   ? 10.113  24.662 -81.311  1.00 92.29  ? 22  DA  E "O5'" 1 
ATOM   533   C  "C5'" . DA  C 1 3   ? 10.426  23.661 -82.299  1.00 91.15  ? 22  DA  E "C5'" 1 
ATOM   534   C  "C4'" . DA  C 1 3   ? 9.902   24.068 -83.658  1.00 90.28  ? 22  DA  E "C4'" 1 
ATOM   535   O  "O4'" . DA  C 1 3   ? 8.453   24.062 -83.669  1.00 90.36  ? 22  DA  E "O4'" 1 
ATOM   536   C  "C3'" . DA  C 1 3   ? 10.328  25.452 -84.150  1.00 89.48  ? 22  DA  E "C3'" 1 
ATOM   537   O  "O3'" . DA  C 1 3   ? 10.623  25.381 -85.551  1.00 87.63  ? 22  DA  E "O3'" 1 
ATOM   538   C  "C2'" . DA  C 1 3   ? 9.093   26.308 -83.924  1.00 89.83  ? 22  DA  E "C2'" 1 
ATOM   539   C  "C1'" . DA  C 1 3   ? 7.963   25.314 -84.132  1.00 90.32  ? 22  DA  E "C1'" 1 
ATOM   540   N  N9    . DA  C 1 3   ? 6.724   25.609 -83.410  1.00 90.60  ? 22  DA  E N9    1 
ATOM   541   C  C8    . DA  C 1 3   ? 6.550   25.871 -82.072  1.00 90.71  ? 22  DA  E C8    1 
ATOM   542   N  N7    . DA  C 1 3   ? 5.300   26.070 -81.730  1.00 90.82  ? 22  DA  E N7    1 
ATOM   543   C  C5    . DA  C 1 3   ? 4.602   25.935 -82.922  1.00 90.73  ? 22  DA  E C5    1 
ATOM   544   C  C6    . DA  C 1 3   ? 3.233   26.024 -83.233  1.00 90.71  ? 22  DA  E C6    1 
ATOM   545   N  N6    . DA  C 1 3   ? 2.284   26.275 -82.331  1.00 90.73  ? 22  DA  E N6    1 
ATOM   546   N  N1    . DA  C 1 3   ? 2.869   25.841 -84.520  1.00 90.82  ? 22  DA  E N1    1 
ATOM   547   C  C2    . DA  C 1 3   ? 3.821   25.585 -85.426  1.00 90.79  ? 22  DA  E C2    1 
ATOM   548   N  N3    . DA  C 1 3   ? 5.136   25.475 -85.258  1.00 90.74  ? 22  DA  E N3    1 
ATOM   549   C  C4    . DA  C 1 3   ? 5.466   25.661 -83.967  1.00 90.73  ? 22  DA  E C4    1 
ATOM   550   P  P     . DT  C 1 4   ? 11.436  26.572 -86.263  1.00 86.37  ? 23  DT  E P     1 
ATOM   551   O  OP1   . DT  C 1 4   ? 12.538  25.964 -87.056  1.00 86.17  ? 23  DT  E OP1   1 
ATOM   552   O  OP2   . DT  C 1 4   ? 11.748  27.618 -85.248  1.00 86.35  ? 23  DT  E OP2   1 
ATOM   553   O  "O5'" . DT  C 1 4   ? 10.373  27.189 -87.275  1.00 84.50  ? 23  DT  E "O5'" 1 
ATOM   554   C  "C5'" . DT  C 1 4   ? 9.832   26.394 -88.342  1.00 81.38  ? 23  DT  E "C5'" 1 
ATOM   555   C  "C4'" . DT  C 1 4   ? 8.738   27.147 -89.063  1.00 79.14  ? 23  DT  E "C4'" 1 
ATOM   556   O  "O4'" . DT  C 1 4   ? 7.526   27.192 -88.266  1.00 79.21  ? 23  DT  E "O4'" 1 
ATOM   557   C  "C3'" . DT  C 1 4   ? 9.064   28.594 -89.441  1.00 77.21  ? 23  DT  E "C3'" 1 
ATOM   558   O  "O3'" . DT  C 1 4   ? 8.622   28.859 -90.778  1.00 73.79  ? 23  DT  E "O3'" 1 
ATOM   559   C  "C2'" . DT  C 1 4   ? 8.270   29.414 -88.438  1.00 77.88  ? 23  DT  E "C2'" 1 
ATOM   560   C  "C1'" . DT  C 1 4   ? 7.062   28.530 -88.160  1.00 78.75  ? 23  DT  E "C1'" 1 
ATOM   561   N  N1    . DT  C 1 4   ? 6.425   28.697 -86.826  1.00 79.11  ? 23  DT  E N1    1 
ATOM   562   C  C2    . DT  C 1 4   ? 5.045   28.646 -86.758  1.00 79.18  ? 23  DT  E C2    1 
ATOM   563   O  O2    . DT  C 1 4   ? 4.329   28.453 -87.730  1.00 79.39  ? 23  DT  E O2    1 
ATOM   564   N  N3    . DT  C 1 4   ? 4.527   28.829 -85.500  1.00 79.03  ? 23  DT  E N3    1 
ATOM   565   C  C4    . DT  C 1 4   ? 5.225   29.048 -84.329  1.00 79.00  ? 23  DT  E C4    1 
ATOM   566   O  O4    . DT  C 1 4   ? 4.613   29.199 -83.272  1.00 78.99  ? 23  DT  E O4    1 
ATOM   567   C  C5    . DT  C 1 4   ? 6.667   29.081 -84.468  1.00 78.93  ? 23  DT  E C5    1 
ATOM   568   C  C7    . DT  C 1 4   ? 7.511   29.310 -83.253  1.00 78.93  ? 23  DT  E C7    1 
ATOM   569   C  C6    . DT  C 1 4   ? 7.186   28.904 -85.690  1.00 79.04  ? 23  DT  E C6    1 
ATOM   570   P  P     . DC  C 1 5   ? 8.927   30.284 -91.458  1.00 70.72  ? 24  DC  E P     1 
ATOM   571   O  OP1   . DC  C 1 5   ? 9.026   30.073 -92.924  1.00 70.63  ? 24  DC  E OP1   1 
ATOM   572   O  OP2   . DC  C 1 5   ? 10.051  30.928 -90.736  1.00 70.86  ? 24  DC  E OP2   1 
ATOM   573   O  "O5'" . DC  C 1 5   ? 7.596   31.102 -91.162  1.00 68.93  ? 24  DC  E "O5'" 1 
ATOM   574   C  "C5'" . DC  C 1 5   ? 6.326   30.590 -91.601  1.00 65.66  ? 24  DC  E "C5'" 1 
ATOM   575   C  "C4'" . DC  C 1 5   ? 5.226   31.599 -91.365  1.00 63.23  ? 24  DC  E "C4'" 1 
ATOM   576   O  "O4'" . DC  C 1 5   ? 4.772   31.559 -89.989  1.00 62.62  ? 24  DC  E "O4'" 1 
ATOM   577   C  "C3'" . DC  C 1 5   ? 5.573   33.058 -91.676  1.00 61.78  ? 24  DC  E "C3'" 1 
ATOM   578   O  "O3'" . DC  C 1 5   ? 4.513   33.683 -92.410  1.00 59.36  ? 24  DC  E "O3'" 1 
ATOM   579   C  "C2'" . DC  C 1 5   ? 5.699   33.692 -90.301  1.00 61.90  ? 24  DC  E "C2'" 1 
ATOM   580   C  "C1'" . DC  C 1 5   ? 4.712   32.878 -89.473  1.00 62.19  ? 24  DC  E "C1'" 1 
ATOM   581   N  N1    . DC  C 1 5   ? 4.950   32.824 -88.012  1.00 61.95  ? 24  DC  E N1    1 
ATOM   582   C  C2    . DC  C 1 5   ? 3.844   32.661 -87.152  1.00 61.79  ? 24  DC  E C2    1 
ATOM   583   O  O2    . DC  C 1 5   ? 2.709   32.507 -87.641  1.00 61.52  ? 24  DC  E O2    1 
ATOM   584   N  N3    . DC  C 1 5   ? 4.043   32.672 -85.814  1.00 61.21  ? 24  DC  E N3    1 
ATOM   585   C  C4    . DC  C 1 5   ? 5.275   32.820 -85.322  1.00 61.21  ? 24  DC  E C4    1 
ATOM   586   N  N4    . DC  C 1 5   ? 5.421   32.842 -83.992  1.00 61.13  ? 24  DC  E N4    1 
ATOM   587   C  C5    . DC  C 1 5   ? 6.415   32.956 -86.167  1.00 61.26  ? 24  DC  E C5    1 
ATOM   588   C  C6    . DC  C 1 5   ? 6.210   32.951 -87.491  1.00 61.58  ? 24  DC  E C6    1 
ATOM   589   P  P     . DA  C 1 6   ? 4.709   35.170 -92.999  1.00 57.59  ? 25  DA  E P     1 
ATOM   590   O  OP1   . DA  C 1 6   ? 4.349   35.124 -94.434  1.00 57.34  ? 25  DA  E OP1   1 
ATOM   591   O  OP2   . DA  C 1 6   ? 6.047   35.687 -92.602  1.00 57.10  ? 25  DA  E OP2   1 
ATOM   592   O  "O5'" . DA  C 1 6   ? 3.601   36.016 -92.220  1.00 55.96  ? 25  DA  E "O5'" 1 
ATOM   593   C  "C5'" . DA  C 1 6   ? 2.197   35.716 -92.387  1.00 53.48  ? 25  DA  E "C5'" 1 
ATOM   594   C  "C4'" . DA  C 1 6   ? 1.386   36.223 -91.214  1.00 51.88  ? 25  DA  E "C4'" 1 
ATOM   595   O  "O4'" . DA  C 1 6   ? 1.752   35.536 -89.998  1.00 51.94  ? 25  DA  E "O4'" 1 
ATOM   596   C  "C3'" . DA  C 1 6   ? 1.501   37.705 -90.871  1.00 50.47  ? 25  DA  E "C3'" 1 
ATOM   597   O  "O3'" . DA  C 1 6   ? 0.576   38.452 -91.674  1.00 48.34  ? 25  DA  E "O3'" 1 
ATOM   598   C  "C2'" . DA  C 1 6   ? 1.062   37.741 -89.417  1.00 51.48  ? 25  DA  E "C2'" 1 
ATOM   599   C  "C1'" . DA  C 1 6   ? 1.340   36.334 -88.892  1.00 52.00  ? 25  DA  E "C1'" 1 
ATOM   600   N  N9    . DA  C 1 6   ? 2.343   36.230 -87.830  1.00 52.19  ? 25  DA  E N9    1 
ATOM   601   C  C8    . DA  C 1 6   ? 3.713   36.138 -87.921  1.00 51.90  ? 25  DA  E C8    1 
ATOM   602   N  N7    . DA  C 1 6   ? 4.313   36.035 -86.761  1.00 51.74  ? 25  DA  E N7    1 
ATOM   603   C  C5    . DA  C 1 6   ? 3.270   36.067 -85.842  1.00 52.28  ? 25  DA  E C5    1 
ATOM   604   C  C6    . DA  C 1 6   ? 3.241   35.992 -84.434  1.00 52.72  ? 25  DA  E C6    1 
ATOM   605   N  N6    . DA  C 1 6   ? 4.335   35.857 -83.676  1.00 52.94  ? 25  DA  E N6    1 
ATOM   606   N  N1    . DA  C 1 6   ? 2.035   36.058 -83.825  1.00 52.68  ? 25  DA  E N1    1 
ATOM   607   C  C2    . DA  C 1 6   ? 0.939   36.191 -84.586  1.00 52.62  ? 25  DA  E C2    1 
ATOM   608   N  N3    . DA  C 1 6   ? 0.838   36.268 -85.912  1.00 52.33  ? 25  DA  E N3    1 
ATOM   609   C  C4    . DA  C 1 6   ? 2.054   36.197 -86.486  1.00 52.17  ? 25  DA  E C4    1 
ATOM   610   P  P     . DG  C 1 7   ? 0.547   40.061 -91.590  1.00 46.39  ? 26  DG  E P     1 
ATOM   611   O  OP1   . DG  C 1 7   ? -0.540  40.534 -92.479  1.00 46.29  ? 26  DG  E OP1   1 
ATOM   612   O  OP2   . DG  C 1 7   ? 1.928   40.578 -91.778  1.00 45.96  ? 26  DG  E OP2   1 
ATOM   613   O  "O5'" . DG  C 1 7   ? 0.133   40.362 -90.084  1.00 45.67  ? 26  DG  E "O5'" 1 
ATOM   614   C  "C5'" . DG  C 1 7   ? -1.188  40.059 -89.600  1.00 43.42  ? 26  DG  E "C5'" 1 
ATOM   615   C  "C4'" . DG  C 1 7   ? -1.419  40.741 -88.272  1.00 42.40  ? 26  DG  E "C4'" 1 
ATOM   616   O  "O4'" . DG  C 1 7   ? -0.600  40.144 -87.238  1.00 42.17  ? 26  DG  E "O4'" 1 
ATOM   617   C  "C3'" . DG  C 1 7   ? -1.083  42.233 -88.265  1.00 41.40  ? 26  DG  E "C3'" 1 
ATOM   618   O  "O3'" . DG  C 1 7   ? -2.034  42.909 -87.441  1.00 39.49  ? 26  DG  E "O3'" 1 
ATOM   619   C  "C2'" . DG  C 1 7   ? 0.275   42.287 -87.590  1.00 41.25  ? 26  DG  E "C2'" 1 
ATOM   620   C  "C1'" . DG  C 1 7   ? 0.132   41.164 -86.587  1.00 41.48  ? 26  DG  E "C1'" 1 
ATOM   621   N  N9    . DG  C 1 7   ? 1.349   40.585 -86.026  1.00 41.90  ? 26  DG  E N9    1 
ATOM   622   C  C8    . DG  C 1 7   ? 2.580   40.434 -86.623  1.00 41.75  ? 26  DG  E C8    1 
ATOM   623   N  N7    . DG  C 1 7   ? 3.472   39.910 -85.826  1.00 41.31  ? 26  DG  E N7    1 
ATOM   624   C  C5    . DG  C 1 7   ? 2.787   39.699 -84.636  1.00 41.32  ? 26  DG  E C5    1 
ATOM   625   C  C6    . DG  C 1 7   ? 3.234   39.158 -83.394  1.00 41.33  ? 26  DG  E C6    1 
ATOM   626   O  O6    . DG  C 1 7   ? 4.370   38.754 -83.089  1.00 41.21  ? 26  DG  E O6    1 
ATOM   627   N  N1    . DG  C 1 7   ? 2.203   39.117 -82.454  1.00 40.27  ? 26  DG  E N1    1 
ATOM   628   C  C2    . DG  C 1 7   ? 0.913   39.547 -82.673  1.00 41.19  ? 26  DG  E C2    1 
ATOM   629   N  N2    . DG  C 1 7   ? 0.052   39.429 -81.643  1.00 40.41  ? 26  DG  E N2    1 
ATOM   630   N  N3    . DG  C 1 7   ? 0.492   40.057 -83.820  1.00 40.89  ? 26  DG  E N3    1 
ATOM   631   C  C4    . DG  C 1 7   ? 1.474   40.100 -84.749  1.00 41.31  ? 26  DG  E C4    1 
ATOM   632   P  P     . DC  C 1 8   ? -2.254  44.489 -87.609  1.00 39.06  ? 27  DC  E P     1 
ATOM   633   O  OP1   . DC  C 1 8   ? -3.658  44.677 -88.075  1.00 37.60  ? 27  DC  E OP1   1 
ATOM   634   O  OP2   . DC  C 1 8   ? -1.133  45.031 -88.405  1.00 38.02  ? 27  DC  E OP2   1 
ATOM   635   O  "O5'" . DC  C 1 8   ? -2.100  45.039 -86.123  1.00 37.42  ? 27  DC  E "O5'" 1 
ATOM   636   C  "C5'" . DC  C 1 8   ? -3.209  45.030 -85.215  1.00 36.69  ? 27  DC  E "C5'" 1 
ATOM   637   C  "C4'" . DC  C 1 8   ? -2.724  45.114 -83.785  1.00 36.85  ? 27  DC  E "C4'" 1 
ATOM   638   O  "O4'" . DC  C 1 8   ? -2.103  43.873 -83.379  1.00 37.84  ? 27  DC  E "O4'" 1 
ATOM   639   C  "C3'" . DC  C 1 8   ? -1.672  46.171 -83.468  1.00 36.52  ? 27  DC  E "C3'" 1 
ATOM   640   O  "O3'" . DC  C 1 8   ? -2.214  47.477 -83.306  1.00 34.68  ? 27  DC  E "O3'" 1 
ATOM   641   C  "C2'" . DC  C 1 8   ? -1.091  45.659 -82.167  1.00 36.65  ? 27  DC  E "C2'" 1 
ATOM   642   C  "C1'" . DC  C 1 8   ? -1.133  44.145 -82.363  1.00 38.17  ? 27  DC  E "C1'" 1 
ATOM   643   N  N1    . DC  C 1 8   ? 0.182   43.651 -82.810  1.00 38.77  ? 27  DC  E N1    1 
ATOM   644   C  C2    . DC  C 1 8   ? 1.032   43.086 -81.856  1.00 39.12  ? 27  DC  E C2    1 
ATOM   645   O  O2    . DC  C 1 8   ? 0.611   42.930 -80.699  1.00 39.88  ? 27  DC  E O2    1 
ATOM   646   N  N3    . DC  C 1 8   ? 2.284   42.726 -82.214  1.00 39.04  ? 27  DC  E N3    1 
ATOM   647   C  C4    . DC  C 1 8   ? 2.691   42.898 -83.474  1.00 39.43  ? 27  DC  E C4    1 
ATOM   648   N  N4    . DC  C 1 8   ? 3.948   42.564 -83.779  1.00 39.40  ? 27  DC  E N4    1 
ATOM   649   C  C5    . DC  C 1 8   ? 1.829   43.428 -84.478  1.00 39.90  ? 27  DC  E C5    1 
ATOM   650   C  C6    . DC  C 1 8   ? 0.593   43.782 -84.108  1.00 38.86  ? 27  DC  E C6    1 
ATOM   651   P  P     . DG  C 1 9   ? -1.244  48.746 -83.430  1.00 34.18  ? 28  DG  E P     1 
ATOM   652   O  OP1   . DG  C 1 9   ? -2.133  49.950 -83.500  1.00 34.22  ? 28  DG  E OP1   1 
ATOM   653   O  OP2   . DG  C 1 9   ? -0.268  48.504 -84.518  1.00 33.86  ? 28  DG  E OP2   1 
ATOM   654   O  "O5'" . DG  C 1 9   ? -0.425  48.757 -82.059  1.00 32.58  ? 28  DG  E "O5'" 1 
ATOM   655   C  "C5'" . DG  C 1 9   ? -1.097  48.980 -80.804  1.00 32.25  ? 28  DG  E "C5'" 1 
ATOM   656   C  "C4'" . DG  C 1 9   ? -0.134  48.904 -79.642  1.00 30.83  ? 28  DG  E "C4'" 1 
ATOM   657   O  "O4'" . DG  C 1 9   ? 0.378   47.559 -79.496  1.00 32.16  ? 28  DG  E "O4'" 1 
ATOM   658   C  "C3'" . DG  C 1 9   ? 1.109   49.783 -79.697  1.00 31.47  ? 28  DG  E "C3'" 1 
ATOM   659   O  "O3'" . DG  C 1 9   ? 0.858   51.131 -79.277  1.00 30.07  ? 28  DG  E "O3'" 1 
ATOM   660   C  "C2'" . DG  C 1 9   ? 2.043   49.068 -78.736  1.00 31.13  ? 28  DG  E "C2'" 1 
ATOM   661   C  "C1'" . DG  C 1 9   ? 1.694   47.598 -78.942  1.00 31.44  ? 28  DG  E "C1'" 1 
ATOM   662   N  N9    . DG  C 1 9   ? 2.617   46.986 -79.895  1.00 31.88  ? 28  DG  E N9    1 
ATOM   663   C  C8    . DG  C 1 9   ? 2.470   46.879 -81.254  1.00 32.68  ? 28  DG  E C8    1 
ATOM   664   N  N7    . DG  C 1 9   ? 3.518   46.370 -81.843  1.00 33.41  ? 28  DG  E N7    1 
ATOM   665   C  C5    . DG  C 1 9   ? 4.400   46.101 -80.809  1.00 33.08  ? 28  DG  E C5    1 
ATOM   666   C  C6    . DG  C 1 9   ? 5.718   45.551 -80.833  1.00 33.51  ? 28  DG  E C6    1 
ATOM   667   O  O6    . DG  C 1 9   ? 6.390   45.190 -81.812  1.00 33.62  ? 28  DG  E O6    1 
ATOM   668   N  N1    . DG  C 1 9   ? 6.249   45.449 -79.552  1.00 32.54  ? 28  DG  E N1    1 
ATOM   669   C  C2    . DG  C 1 9   ? 5.605   45.821 -78.398  1.00 32.89  ? 28  DG  E C2    1 
ATOM   670   N  N2    . DG  C 1 9   ? 6.282   45.631 -77.247  1.00 32.22  ? 28  DG  E N2    1 
ATOM   671   N  N3    . DG  C 1 9   ? 4.385   46.338 -78.366  1.00 32.29  ? 28  DG  E N3    1 
ATOM   672   C  C4    . DG  C 1 9   ? 3.849   46.451 -79.597  1.00 32.71  ? 28  DG  E C4    1 
ATOM   673   P  P     . DA  C 1 10  ? 2.005   52.247 -79.478  1.00 31.21  ? 29  DA  E P     1 
ATOM   674   O  OP1   . DA  C 1 10  ? 1.479   53.572 -79.070  1.00 32.18  ? 29  DA  E OP1   1 
ATOM   675   O  OP2   . DA  C 1 10  ? 2.630   52.093 -80.820  1.00 29.33  ? 29  DA  E OP2   1 
ATOM   676   O  "O5'" . DA  C 1 10  ? 3.131   51.830 -78.437  1.00 29.77  ? 29  DA  E "O5'" 1 
ATOM   677   C  "C5'" . DA  C 1 10  ? 2.858   51.774 -77.025  1.00 27.91  ? 29  DA  E "C5'" 1 
ATOM   678   C  "C4'" . DA  C 1 10  ? 4.083   51.288 -76.291  1.00 26.61  ? 29  DA  E "C4'" 1 
ATOM   679   O  "O4'" . DA  C 1 10  ? 4.404   49.967 -76.785  1.00 25.60  ? 29  DA  E "O4'" 1 
ATOM   680   C  "C3'" . DA  C 1 10  ? 5.329   52.127 -76.556  1.00 25.45  ? 29  DA  E "C3'" 1 
ATOM   681   C  "C2'" . DA  C 1 10  ? 6.453   51.112 -76.430  1.00 23.92  ? 29  DA  E "C2'" 1 
ATOM   682   C  "C1'" . DA  C 1 10  ? 5.816   49.819 -76.920  1.00 25.29  ? 29  DA  E "C1'" 1 
ATOM   683   N  N9    . DA  C 1 10  ? 6.109   49.519 -78.324  1.00 27.36  ? 29  DA  E N9    1 
ATOM   684   C  C8    . DA  C 1 10  ? 5.402   49.888 -79.444  1.00 26.97  ? 29  DA  E C8    1 
ATOM   685   N  N7    . DA  C 1 10  ? 5.948   49.491 -80.568  1.00 28.41  ? 29  DA  E N7    1 
ATOM   686   C  C5    . DA  C 1 10  ? 7.088   48.803 -80.163  1.00 28.00  ? 29  DA  E C5    1 
ATOM   687   C  C6    . DA  C 1 10  ? 8.100   48.133 -80.880  1.00 28.63  ? 29  DA  E C6    1 
ATOM   688   N  N6    . DA  C 1 10  ? 8.147   48.053 -82.209  1.00 29.24  ? 29  DA  E N6    1 
ATOM   689   N  N1    . DA  C 1 10  ? 9.083   47.542 -80.170  1.00 29.99  ? 29  DA  E N1    1 
ATOM   690   C  C2    . DA  C 1 10  ? 9.049   47.628 -78.832  1.00 29.45  ? 29  DA  E C2    1 
ATOM   691   N  N3    . DA  C 1 10  ? 8.161   48.229 -78.049  1.00 28.26  ? 29  DA  E N3    1 
ATOM   692   C  C4    . DA  C 1 10  ? 7.194   48.805 -78.784  1.00 27.99  ? 29  DA  E C4    1 
ATOM   693   O  "O5'" . DA  D 2 1   ? 24.192  35.748 -91.389  1.00 48.18  ? 1   DA  F "O5'" 1 
ATOM   694   C  "C5'" . DA  D 2 1   ? 24.917  36.678 -92.198  1.00 47.95  ? 1   DA  F "C5'" 1 
ATOM   695   C  "C4'" . DA  D 2 1   ? 24.075  37.872 -92.580  1.00 48.16  ? 1   DA  F "C4'" 1 
ATOM   696   O  "O4'" . DA  D 2 1   ? 22.972  37.441 -93.415  1.00 49.19  ? 1   DA  F "O4'" 1 
ATOM   697   C  "C3'" . DA  D 2 1   ? 23.452  38.612 -91.394  1.00 47.96  ? 1   DA  F "C3'" 1 
ATOM   698   O  "O3'" . DA  D 2 1   ? 23.453  40.021 -91.632  1.00 46.74  ? 1   DA  F "O3'" 1 
ATOM   699   C  "C2'" . DA  D 2 1   ? 22.021  38.116 -91.374  1.00 48.33  ? 1   DA  F "C2'" 1 
ATOM   700   C  "C1'" . DA  D 2 1   ? 21.737  37.864 -92.845  1.00 49.51  ? 1   DA  F "C1'" 1 
ATOM   701   N  N9    . DA  D 2 1   ? 20.740  36.817 -93.078  1.00 49.67  ? 1   DA  F N9    1 
ATOM   702   C  C8    . DA  D 2 1   ? 19.495  36.956 -93.646  1.00 50.19  ? 1   DA  F C8    1 
ATOM   703   N  N7    . DA  D 2 1   ? 18.806  35.841 -93.692  1.00 50.16  ? 1   DA  F N7    1 
ATOM   704   C  C5    . DA  D 2 1   ? 19.657  34.902 -93.126  1.00 50.76  ? 1   DA  F C5    1 
ATOM   705   C  C6    . DA  D 2 1   ? 19.520  33.523 -92.877  1.00 50.65  ? 1   DA  F C6    1 
ATOM   706   N  N6    . DA  D 2 1   ? 18.430  32.816 -93.178  1.00 51.13  ? 1   DA  F N6    1 
ATOM   707   N  N1    . DA  D 2 1   ? 20.556  32.886 -92.298  1.00 51.02  ? 1   DA  F N1    1 
ATOM   708   C  C2    . DA  D 2 1   ? 21.651  33.591 -91.990  1.00 51.32  ? 1   DA  F C2    1 
ATOM   709   N  N3    . DA  D 2 1   ? 21.900  34.884 -92.171  1.00 50.77  ? 1   DA  F N3    1 
ATOM   710   C  C4    . DA  D 2 1   ? 20.853  35.490 -92.749  1.00 50.35  ? 1   DA  F C4    1 
ATOM   711   P  P     . DC  D 2 2   ? 23.212  41.030 -90.410  1.00 46.36  ? 2   DC  F P     1 
ATOM   712   O  OP1   . DC  D 2 2   ? 23.693  42.372 -90.825  1.00 46.59  ? 2   DC  F OP1   1 
ATOM   713   O  OP2   . DC  D 2 2   ? 23.765  40.404 -89.178  1.00 46.44  ? 2   DC  F OP2   1 
ATOM   714   O  "O5'" . DC  D 2 2   ? 21.624  41.084 -90.276  1.00 44.56  ? 2   DC  F "O5'" 1 
ATOM   715   C  "C5'" . DC  D 2 2   ? 20.821  41.638 -91.337  1.00 42.52  ? 2   DC  F "C5'" 1 
ATOM   716   C  "C4'" . DC  D 2 2   ? 19.350  41.438 -91.053  1.00 41.51  ? 2   DC  F "C4'" 1 
ATOM   717   O  "O4'" . DC  D 2 2   ? 18.996  40.036 -91.135  1.00 41.71  ? 2   DC  F "O4'" 1 
ATOM   718   C  "C3'" . DC  D 2 2   ? 18.871  41.924 -89.685  1.00 40.67  ? 2   DC  F "C3'" 1 
ATOM   719   O  "O3'" . DC  D 2 2   ? 17.566  42.497 -89.829  1.00 39.55  ? 2   DC  F "O3'" 1 
ATOM   720   C  "C2'" . DC  D 2 2   ? 18.760  40.641 -88.879  1.00 40.54  ? 2   DC  F "C2'" 1 
ATOM   721   C  "C1'" . DC  D 2 2   ? 18.357  39.625 -89.939  1.00 42.14  ? 2   DC  F "C1'" 1 
ATOM   722   N  N1    . DC  D 2 2   ? 18.724  38.214 -89.682  1.00 43.38  ? 2   DC  F N1    1 
ATOM   723   C  C2    . DC  D 2 2   ? 17.821  37.207 -90.052  1.00 44.34  ? 2   DC  F C2    1 
ATOM   724   O  O2    . DC  D 2 2   ? 16.747  37.527 -90.591  1.00 45.26  ? 2   DC  F O2    1 
ATOM   725   N  N3    . DC  D 2 2   ? 18.140  35.911 -89.817  1.00 45.21  ? 2   DC  F N3    1 
ATOM   726   C  C4    . DC  D 2 2   ? 19.306  35.605 -89.245  1.00 45.47  ? 2   DC  F C4    1 
ATOM   727   N  N4    . DC  D 2 2   ? 19.583  34.315 -89.033  1.00 46.30  ? 2   DC  F N4    1 
ATOM   728   C  C5    . DC  D 2 2   ? 20.242  36.608 -88.864  1.00 45.00  ? 2   DC  F C5    1 
ATOM   729   C  C6    . DC  D 2 2   ? 19.915  37.886 -89.097  1.00 44.17  ? 2   DC  F C6    1 
ATOM   730   P  P     . DG  D 2 3   ? 17.406  44.080 -90.071  1.00 39.02  ? 3   DG  F P     1 
ATOM   731   O  OP1   . DG  D 2 3   ? 15.956  44.317 -90.310  1.00 39.14  ? 3   DG  F OP1   1 
ATOM   732   O  OP2   . DG  D 2 3   ? 18.409  44.530 -91.071  1.00 38.15  ? 3   DG  F OP2   1 
ATOM   733   O  "O5'" . DG  D 2 3   ? 17.822  44.761 -88.694  1.00 37.34  ? 3   DG  F "O5'" 1 
ATOM   734   C  "C5'" . DG  D 2 3   ? 17.161  44.441 -87.461  1.00 36.00  ? 3   DG  F "C5'" 1 
ATOM   735   C  "C4'" . DG  D 2 3   ? 17.644  45.368 -86.368  1.00 34.86  ? 3   DG  F "C4'" 1 
ATOM   736   O  "O4'" . DG  D 2 3   ? 17.199  46.718 -86.627  1.00 36.14  ? 3   DG  F "O4'" 1 
ATOM   737   C  "C3'" . DG  D 2 3   ? 17.109  45.029 -84.986  1.00 35.26  ? 3   DG  F "C3'" 1 
ATOM   738   O  "O3'" . DG  D 2 3   ? 17.999  44.093 -84.375  1.00 32.76  ? 3   DG  F "O3'" 1 
ATOM   739   C  "C2'" . DG  D 2 3   ? 17.110  46.374 -84.279  1.00 35.30  ? 3   DG  F "C2'" 1 
ATOM   740   C  "C1'" . DG  D 2 3   ? 16.795  47.354 -85.417  1.00 36.73  ? 3   DG  F "C1'" 1 
ATOM   741   N  N9    . DG  D 2 3   ? 15.378  47.690 -85.555  1.00 38.15  ? 3   DG  F N9    1 
ATOM   742   C  C8    . DG  D 2 3   ? 14.599  47.524 -86.679  1.00 39.08  ? 3   DG  F C8    1 
ATOM   743   N  N7    . DG  D 2 3   ? 13.365  47.909 -86.511  1.00 39.85  ? 3   DG  F N7    1 
ATOM   744   C  C5    . DG  D 2 3   ? 13.323  48.364 -85.200  1.00 39.37  ? 3   DG  F C5    1 
ATOM   745   C  C6    . DG  D 2 3   ? 12.244  48.918 -84.450  1.00 40.25  ? 3   DG  F C6    1 
ATOM   746   O  O6    . DG  D 2 3   ? 11.068  49.135 -84.818  1.00 39.72  ? 3   DG  F O6    1 
ATOM   747   N  N1    . DG  D 2 3   ? 12.640  49.234 -83.153  1.00 39.41  ? 3   DG  F N1    1 
ATOM   748   C  C2    . DG  D 2 3   ? 13.902  49.047 -82.643  1.00 38.90  ? 3   DG  F C2    1 
ATOM   749   N  N2    . DG  D 2 3   ? 14.081  49.391 -81.362  1.00 38.85  ? 3   DG  F N2    1 
ATOM   750   N  N3    . DG  D 2 3   ? 14.914  48.551 -83.334  1.00 39.05  ? 3   DG  F N3    1 
ATOM   751   C  C4    . DG  D 2 3   ? 14.556  48.232 -84.596  1.00 38.78  ? 3   DG  F C4    1 
ATOM   752   P  P     . DT  D 2 4   ? 17.411  42.812 -83.619  1.00 31.64  ? 4   DT  F P     1 
ATOM   753   O  OP1   . DT  D 2 4   ? 18.558  41.910 -83.328  1.00 30.78  ? 4   DT  F OP1   1 
ATOM   754   O  OP2   . DT  D 2 4   ? 16.248  42.288 -84.374  1.00 30.63  ? 4   DT  F OP2   1 
ATOM   755   O  "O5'" . DT  D 2 4   ? 16.859  43.409 -82.248  1.00 31.20  ? 4   DT  F "O5'" 1 
ATOM   756   C  "C5'" . DT  D 2 4   ? 17.747  44.008 -81.287  1.00 30.14  ? 4   DT  F "C5'" 1 
ATOM   757   C  "C4'" . DT  D 2 4   ? 16.955  44.558 -80.124  1.00 31.30  ? 4   DT  F "C4'" 1 
ATOM   758   O  "O4'" . DT  D 2 4   ? 16.156  45.677 -80.582  1.00 32.20  ? 4   DT  F "O4'" 1 
ATOM   759   C  "C3'" . DT  D 2 4   ? 15.957  43.579 -79.504  1.00 31.22  ? 4   DT  F "C3'" 1 
ATOM   760   O  "O3'" . DT  D 2 4   ? 16.587  42.765 -78.488  1.00 30.69  ? 4   DT  F "O3'" 1 
ATOM   761   C  "C2'" . DT  D 2 4   ? 14.899  44.502 -78.924  1.00 31.20  ? 4   DT  F "C2'" 1 
ATOM   762   C  "C1'" . DT  D 2 4   ? 14.924  45.715 -79.857  1.00 31.88  ? 4   DT  F "C1'" 1 
ATOM   763   N  N1    . DT  D 2 4   ? 13.802  45.804 -80.824  1.00 32.00  ? 4   DT  F N1    1 
ATOM   764   C  C2    . DT  D 2 4   ? 12.680  46.512 -80.428  1.00 32.16  ? 4   DT  F C2    1 
ATOM   765   O  O2    . DT  D 2 4   ? 12.558  47.024 -79.322  1.00 31.42  ? 4   DT  F O2    1 
ATOM   766   N  N3    . DT  D 2 4   ? 11.692  46.591 -81.374  1.00 32.65  ? 4   DT  F N3    1 
ATOM   767   C  C4    . DT  D 2 4   ? 11.696  46.040 -82.640  1.00 31.86  ? 4   DT  F C4    1 
ATOM   768   O  O4    . DT  D 2 4   ? 10.730  46.205 -83.376  1.00 31.58  ? 4   DT  F O4    1 
ATOM   769   C  C5    . DT  D 2 4   ? 12.887  45.296 -82.987  1.00 31.82  ? 4   DT  F C5    1 
ATOM   770   C  C7    . DT  D 2 4   ? 12.975  44.659 -84.339  1.00 31.18  ? 4   DT  F C7    1 
ATOM   771   C  C6    . DT  D 2 4   ? 13.869  45.215 -82.073  1.00 32.08  ? 4   DT  F C6    1 
ATOM   772   P  P     . DC  D 2 5   ? 15.865  41.424 -77.980  1.00 30.77  ? 5   DC  F P     1 
ATOM   773   O  OP1   . DC  D 2 5   ? 16.744  40.736 -77.009  1.00 31.05  ? 5   DC  F OP1   1 
ATOM   774   O  OP2   . DC  D 2 5   ? 15.357  40.683 -79.163  1.00 31.30  ? 5   DC  F OP2   1 
ATOM   775   O  "O5'" . DC  D 2 5   ? 14.609  41.979 -77.177  1.00 30.84  ? 5   DC  F "O5'" 1 
ATOM   776   C  "C5'" . DC  D 2 5   ? 14.809  42.888 -76.089  1.00 28.92  ? 5   DC  F "C5'" 1 
ATOM   777   C  "C4'" . DC  D 2 5   ? 13.486  43.391 -75.567  1.00 28.76  ? 5   DC  F "C4'" 1 
ATOM   778   O  "O4'" . DC  D 2 5   ? 12.880  44.327 -76.487  1.00 28.69  ? 5   DC  F "O4'" 1 
ATOM   779   C  "C3'" . DC  D 2 5   ? 12.430  42.322 -75.367  1.00 27.92  ? 5   DC  F "C3'" 1 
ATOM   780   O  "O3'" . DC  D 2 5   ? 12.615  41.581 -74.160  1.00 28.34  ? 5   DC  F "O3'" 1 
ATOM   781   C  "C2'" . DC  D 2 5   ? 11.146  43.124 -75.370  1.00 27.88  ? 5   DC  F "C2'" 1 
ATOM   782   C  "C1'" . DC  D 2 5   ? 11.458  44.236 -76.372  1.00 28.27  ? 5   DC  F "C1'" 1 
ATOM   783   N  N1    . DC  D 2 5   ? 10.880  43.998 -77.710  1.00 28.26  ? 5   DC  F N1    1 
ATOM   784   C  C2    . DC  D 2 5   ? 9.618   44.535 -77.976  1.00 28.39  ? 5   DC  F C2    1 
ATOM   785   O  O2    . DC  D 2 5   ? 9.052   45.178 -77.092  1.00 28.76  ? 5   DC  F O2    1 
ATOM   786   N  N3    . DC  D 2 5   ? 9.046   44.335 -79.183  1.00 28.90  ? 5   DC  F N3    1 
ATOM   787   C  C4    . DC  D 2 5   ? 9.678   43.620 -80.109  1.00 28.59  ? 5   DC  F C4    1 
ATOM   788   N  N4    . DC  D 2 5   ? 9.056   43.437 -81.276  1.00 27.66  ? 5   DC  F N4    1 
ATOM   789   C  C5    . DC  D 2 5   ? 10.971  43.054 -79.873  1.00 28.12  ? 5   DC  F C5    1 
ATOM   790   C  C6    . DC  D 2 5   ? 11.532  43.270 -78.668  1.00 27.56  ? 5   DC  F C6    1 
ATOM   791   P  P     . DG  D 2 6   ? 11.891  40.161 -74.019  1.00 27.28  ? 6   DG  F P     1 
ATOM   792   O  OP1   . DG  D 2 6   ? 12.557  39.348 -72.971  1.00 27.20  ? 6   DG  F OP1   1 
ATOM   793   O  OP2   . DG  D 2 6   ? 11.741  39.619 -75.391  1.00 29.00  ? 6   DG  F OP2   1 
ATOM   794   O  "O5'" . DG  D 2 6   ? 10.436  40.543 -73.504  1.00 27.77  ? 6   DG  F "O5'" 1 
ATOM   795   C  "C5'" . DG  D 2 6   ? 9.290   39.774 -73.878  1.00 29.10  ? 6   DG  F "C5'" 1 
ATOM   796   C  "C4'" . DG  D 2 6   ? 8.083   40.678 -73.965  1.00 31.14  ? 6   DG  F "C4'" 1 
ATOM   797   O  "O4'" . DG  D 2 6   ? 8.211   41.595 -75.076  1.00 31.03  ? 6   DG  F "O4'" 1 
ATOM   798   C  "C3'" . DG  D 2 6   ? 6.773   39.940 -74.192  1.00 31.28  ? 6   DG  F "C3'" 1 
ATOM   799   O  "O3'" . DG  D 2 6   ? 6.262   39.597 -72.893  1.00 31.33  ? 6   DG  F "O3'" 1 
ATOM   800   C  "C2'" . DG  D 2 6   ? 5.919   40.986 -74.889  1.00 31.21  ? 6   DG  F "C2'" 1 
ATOM   801   C  "C1'" . DG  D 2 6   ? 6.932   41.874 -75.620  1.00 31.99  ? 6   DG  F "C1'" 1 
ATOM   802   N  N9    . DG  D 2 6   ? 7.022   41.759 -77.075  1.00 33.84  ? 6   DG  F N9    1 
ATOM   803   C  C8    . DG  D 2 6   ? 8.104   41.334 -77.813  1.00 33.97  ? 6   DG  F C8    1 
ATOM   804   N  N7    . DG  D 2 6   ? 7.892   41.366 -79.100  1.00 34.95  ? 6   DG  F N7    1 
ATOM   805   C  C5    . DG  D 2 6   ? 6.590   41.834 -79.224  1.00 35.20  ? 6   DG  F C5    1 
ATOM   806   C  C6    . DG  D 2 6   ? 5.802   42.068 -80.384  1.00 35.61  ? 6   DG  F C6    1 
ATOM   807   O  O6    . DG  D 2 6   ? 6.107   41.908 -81.571  1.00 36.06  ? 6   DG  F O6    1 
ATOM   808   N  N1    . DG  D 2 6   ? 4.533   42.529 -80.052  1.00 35.49  ? 6   DG  F N1    1 
ATOM   809   C  C2    . DG  D 2 6   ? 4.074   42.732 -78.773  1.00 35.32  ? 6   DG  F C2    1 
ATOM   810   N  N2    . DG  D 2 6   ? 2.808   43.150 -78.659  1.00 34.35  ? 6   DG  F N2    1 
ATOM   811   N  N3    . DG  D 2 6   ? 4.800   42.530 -77.686  1.00 34.84  ? 6   DG  F N3    1 
ATOM   812   C  C4    . DG  D 2 6   ? 6.038   42.080 -77.984  1.00 34.77  ? 6   DG  F C4    1 
ATOM   813   P  P     . DC  D 2 7   ? 5.418   38.245 -72.680  1.00 32.84  ? 7   DC  F P     1 
ATOM   814   O  OP1   . DC  D 2 7   ? 5.034   38.149 -71.247  1.00 32.20  ? 7   DC  F OP1   1 
ATOM   815   O  OP2   . DC  D 2 7   ? 6.153   37.122 -73.316  1.00 33.10  ? 7   DC  F OP2   1 
ATOM   816   O  "O5'" . DC  D 2 7   ? 4.102   38.484 -73.539  1.00 32.39  ? 7   DC  F "O5'" 1 
ATOM   817   C  "C5'" . DC  D 2 7   ? 3.227   39.578 -73.247  1.00 32.69  ? 7   DC  F "C5'" 1 
ATOM   818   C  "C4'" . DC  D 2 7   ? 1.941   39.433 -74.022  1.00 31.80  ? 7   DC  F "C4'" 1 
ATOM   819   O  "O4'" . DC  D 2 7   ? 2.174   39.731 -75.421  1.00 31.08  ? 7   DC  F "O4'" 1 
ATOM   820   C  "C3'" . DC  D 2 7   ? 1.321   38.035 -73.969  1.00 32.28  ? 7   DC  F "C3'" 1 
ATOM   821   O  "O3'" . DC  D 2 7   ? -0.108  38.133 -73.772  1.00 33.43  ? 7   DC  F "O3'" 1 
ATOM   822   C  "C2'" . DC  D 2 7   ? 1.701   37.428 -75.312  1.00 30.94  ? 7   DC  F "C2'" 1 
ATOM   823   C  "C1'" . DC  D 2 7   ? 1.782   38.636 -76.241  1.00 30.11  ? 7   DC  F "C1'" 1 
ATOM   824   N  N1    . DC  D 2 7   ? 2.764   38.535 -77.351  1.00 30.22  ? 7   DC  F N1    1 
ATOM   825   C  C2    . DC  D 2 7   ? 2.338   38.806 -78.663  1.00 29.17  ? 7   DC  F C2    1 
ATOM   826   O  O2    . DC  D 2 7   ? 1.133   39.007 -78.878  1.00 29.09  ? 7   DC  F O2    1 
ATOM   827   N  N3    . DC  D 2 7   ? 3.248   38.822 -79.663  1.00 28.66  ? 7   DC  F N3    1 
ATOM   828   C  C4    . DC  D 2 7   ? 4.531   38.542 -79.406  1.00 28.95  ? 7   DC  F C4    1 
ATOM   829   N  N4    . DC  D 2 7   ? 5.407   38.603 -80.424  1.00 26.86  ? 7   DC  F N4    1 
ATOM   830   C  C5    . DC  D 2 7   ? 4.979   38.200 -78.093  1.00 28.37  ? 7   DC  F C5    1 
ATOM   831   C  C6    . DC  D 2 7   ? 4.073   38.212 -77.108  1.00 28.96  ? 7   DC  F C6    1 
ATOM   832   P  P     . DT  D 2 8   ? -1.015  36.797 -73.720  1.00 35.13  ? 8   DT  F P     1 
ATOM   833   O  OP1   . DT  D 2 8   ? -2.245  37.070 -72.925  1.00 35.57  ? 8   DT  F OP1   1 
ATOM   834   O  OP2   . DT  D 2 8   ? -0.162  35.641 -73.351  1.00 34.28  ? 8   DT  F OP2   1 
ATOM   835   O  "O5'" . DT  D 2 8   ? -1.483  36.632 -75.230  1.00 35.96  ? 8   DT  F "O5'" 1 
ATOM   836   C  "C5'" . DT  D 2 8   ? -2.268  37.670 -75.859  1.00 38.60  ? 8   DT  F "C5'" 1 
ATOM   837   C  "C4'" . DT  D 2 8   ? -2.775  37.221 -77.209  1.00 39.93  ? 8   DT  F "C4'" 1 
ATOM   838   O  "O4'" . DT  D 2 8   ? -1.757  37.339 -78.234  1.00 40.99  ? 8   DT  F "O4'" 1 
ATOM   839   C  "C3'" . DT  D 2 8   ? -3.301  35.788 -77.277  1.00 41.91  ? 8   DT  F "C3'" 1 
ATOM   840   O  "O3'" . DT  D 2 8   ? -4.518  35.763 -78.022  1.00 43.79  ? 8   DT  F "O3'" 1 
ATOM   841   C  "C2'" . DT  D 2 8   ? -2.211  35.043 -78.032  1.00 41.59  ? 8   DT  F "C2'" 1 
ATOM   842   C  "C1'" . DT  D 2 8   ? -1.662  36.119 -78.960  1.00 41.49  ? 8   DT  F "C1'" 1 
ATOM   843   N  N1    . DT  D 2 8   ? -0.256  35.964 -79.431  1.00 41.22  ? 8   DT  F N1    1 
ATOM   844   C  C2    . DT  D 2 8   ? 0.028   36.314 -80.740  1.00 41.41  ? 8   DT  F C2    1 
ATOM   845   O  O2    . DT  D 2 8   ? -0.810  36.745 -81.523  1.00 41.82  ? 8   DT  F O2    1 
ATOM   846   N  N3    . DT  D 2 8   ? 1.338   36.143 -81.106  1.00 41.05  ? 8   DT  F N3    1 
ATOM   847   C  C4    . DT  D 2 8   ? 2.372   35.677 -80.324  1.00 41.39  ? 8   DT  F C4    1 
ATOM   848   O  O4    . DT  D 2 8   ? 3.505   35.585 -80.800  1.00 41.68  ? 8   DT  F O4    1 
ATOM   849   C  C5    . DT  D 2 8   ? 2.009   35.330 -78.967  1.00 41.45  ? 8   DT  F C5    1 
ATOM   850   C  C7    . DT  D 2 8   ? 3.066   34.814 -78.041  1.00 41.78  ? 8   DT  F C7    1 
ATOM   851   C  C6    . DT  D 2 8   ? 0.732   35.489 -78.594  1.00 41.24  ? 8   DT  F C6    1 
ATOM   852   P  P     . DG  D 2 9   ? -5.500  34.498 -77.907  1.00 46.39  ? 9   DG  F P     1 
ATOM   853   O  OP1   . DG  D 2 9   ? -6.801  34.976 -77.362  1.00 46.05  ? 9   DG  F OP1   1 
ATOM   854   O  OP2   . DG  D 2 9   ? -4.782  33.379 -77.223  1.00 46.04  ? 9   DG  F OP2   1 
ATOM   855   O  "O5'" . DG  D 2 9   ? -5.701  34.042 -79.419  1.00 47.43  ? 9   DG  F "O5'" 1 
ATOM   856   C  "C5'" . DG  D 2 9   ? -6.058  34.989 -80.442  1.00 50.30  ? 9   DG  F "C5'" 1 
ATOM   857   C  "C4'" . DG  D 2 9   ? -5.841  34.390 -81.814  1.00 51.89  ? 9   DG  F "C4'" 1 
ATOM   858   O  "O4'" . DG  D 2 9   ? -4.448  34.468 -82.210  1.00 51.82  ? 9   DG  F "O4'" 1 
ATOM   859   C  "C3'" . DG  D 2 9   ? -6.252  32.925 -81.958  1.00 53.06  ? 9   DG  F "C3'" 1 
ATOM   860   O  "O3'" . DG  D 2 9   ? -6.925  32.739 -83.207  1.00 55.97  ? 9   DG  F "O3'" 1 
ATOM   861   C  "C2'" . DG  D 2 9   ? -4.924  32.185 -81.953  1.00 52.52  ? 9   DG  F "C2'" 1 
ATOM   862   C  "C1'" . DG  D 2 9   ? -3.976  33.188 -82.598  1.00 52.19  ? 9   DG  F "C1'" 1 
ATOM   863   N  N9    . DG  D 2 9   ? -2.573  33.077 -82.194  1.00 52.07  ? 9   DG  F N9    1 
ATOM   864   C  C8    . DG  D 2 9   ? -2.078  32.969 -80.914  1.00 51.87  ? 9   DG  F C8    1 
ATOM   865   N  N7    . DG  D 2 9   ? -0.775  32.874 -80.872  1.00 51.31  ? 9   DG  F N7    1 
ATOM   866   C  C5    . DG  D 2 9   ? -0.380  32.922 -82.203  1.00 51.54  ? 9   DG  F C5    1 
ATOM   867   C  C6    . DG  D 2 9   ? 0.921   32.855 -82.784  1.00 51.72  ? 9   DG  F C6    1 
ATOM   868   O  O6    . DG  D 2 9   ? 2.017   32.739 -82.220  1.00 51.43  ? 9   DG  F O6    1 
ATOM   869   N  N1    . DG  D 2 9   ? 0.866   32.941 -84.170  1.00 52.14  ? 9   DG  F N1    1 
ATOM   870   C  C2    . DG  D 2 9   ? -0.283  33.083 -84.910  1.00 52.26  ? 9   DG  F C2    1 
ATOM   871   N  N2    . DG  D 2 9   ? -0.119  33.173 -86.244  1.00 51.87  ? 9   DG  F N2    1 
ATOM   872   N  N3    . DG  D 2 9   ? -1.500  33.139 -84.384  1.00 52.17  ? 9   DG  F N3    1 
ATOM   873   C  C4    . DG  D 2 9   ? -1.474  33.053 -83.035  1.00 51.98  ? 9   DG  F C4    1 
ATOM   874   P  P     . DA  D 2 10  ? -7.697  31.355 -83.513  1.00 57.96  ? 10  DA  F P     1 
ATOM   875   O  OP1   . DA  D 2 10  ? -9.030  31.711 -84.061  1.00 57.58  ? 10  DA  F OP1   1 
ATOM   876   O  OP2   . DA  D 2 10  ? -7.607  30.466 -82.324  1.00 57.28  ? 10  DA  F OP2   1 
ATOM   877   O  "O5'" . DA  D 2 10  ? -6.824  30.712 -84.682  1.00 59.70  ? 10  DA  F "O5'" 1 
ATOM   878   C  "C5'" . DA  D 2 10  ? -6.616  31.436 -85.911  1.00 62.41  ? 10  DA  F "C5'" 1 
ATOM   879   C  "C4'" . DA  D 2 10  ? -5.343  30.990 -86.594  1.00 64.12  ? 10  DA  F "C4'" 1 
ATOM   880   O  "O4'" . DA  D 2 10  ? -4.176  31.345 -85.819  1.00 64.60  ? 10  DA  F "O4'" 1 
ATOM   881   C  "C3'" . DA  D 2 10  ? -5.200  29.496 -86.846  1.00 65.16  ? 10  DA  F "C3'" 1 
ATOM   882   O  "O3'" . DA  D 2 10  ? -5.889  29.154 -88.056  1.00 67.22  ? 10  DA  F "O3'" 1 
ATOM   883   C  "C2'" . DA  D 2 10  ? -3.698  29.336 -87.010  1.00 64.96  ? 10  DA  F "C2'" 1 
ATOM   884   C  "C1'" . DA  D 2 10  ? -3.101  30.491 -86.205  1.00 64.55  ? 10  DA  F "C1'" 1 
ATOM   885   N  N9    . DA  D 2 10  ? -2.335  30.127 -85.011  1.00 64.21  ? 10  DA  F N9    1 
ATOM   886   C  C8    . DA  D 2 10  ? -2.771  29.933 -83.722  1.00 64.03  ? 10  DA  F C8    1 
ATOM   887   N  N7    . DA  D 2 10  ? -1.811  29.632 -82.879  1.00 63.78  ? 10  DA  F N7    1 
ATOM   888   C  C5    . DA  D 2 10  ? -0.666  29.624 -83.664  1.00 63.94  ? 10  DA  F C5    1 
ATOM   889   C  C6    . DA  D 2 10  ? 0.692   29.380 -83.366  1.00 63.77  ? 10  DA  F C6    1 
ATOM   890   N  N6    . DA  D 2 10  ? 1.146   29.100 -82.142  1.00 63.93  ? 10  DA  F N6    1 
ATOM   891   N  N1    . DA  D 2 10  ? 1.579   29.444 -84.382  1.00 63.76  ? 10  DA  F N1    1 
ATOM   892   C  C2    . DA  D 2 10  ? 1.130   29.740 -85.607  1.00 63.95  ? 10  DA  F C2    1 
ATOM   893   N  N3    . DA  D 2 10  ? -0.114  29.996 -86.012  1.00 64.18  ? 10  DA  F N3    1 
ATOM   894   C  C4    . DA  D 2 10  ? -0.975  29.919 -84.980  1.00 64.19  ? 10  DA  F C4    1 
ATOM   895   P  P     . DT  D 2 11  ? -6.188  27.613 -88.409  1.00 68.38  ? 11  DT  F P     1 
ATOM   896   O  OP1   . DT  D 2 11  ? -7.299  27.592 -89.392  1.00 68.42  ? 11  DT  F OP1   1 
ATOM   897   O  OP2   . DT  D 2 11  ? -6.314  26.842 -87.143  1.00 68.44  ? 11  DT  F OP2   1 
ATOM   898   O  "O5'" . DT  D 2 11  ? -4.858  27.121 -89.137  1.00 70.31  ? 11  DT  F "O5'" 1 
ATOM   899   C  "C5'" . DT  D 2 11  ? -4.357  27.799 -90.305  1.00 72.93  ? 11  DT  F "C5'" 1 
ATOM   900   C  "C4'" . DT  D 2 11  ? -2.898  27.467 -90.521  1.00 75.02  ? 11  DT  F "C4'" 1 
ATOM   901   O  "O4'" . DT  D 2 11  ? -2.123  27.906 -89.386  1.00 74.93  ? 11  DT  F "O4'" 1 
ATOM   902   C  "C3'" . DT  D 2 11  ? -2.578  25.983 -90.680  1.00 76.58  ? 11  DT  F "C3'" 1 
ATOM   903   O  "O3'" . DT  D 2 11  ? -2.676  25.623 -92.067  1.00 79.60  ? 11  DT  F "O3'" 1 
ATOM   904   C  "C2'" . DT  D 2 11  ? -1.144  25.892 -90.190  1.00 75.81  ? 11  DT  F "C2'" 1 
ATOM   905   C  "C1'" . DT  D 2 11  ? -1.040  27.009 -89.154  1.00 75.06  ? 11  DT  F "C1'" 1 
ATOM   906   N  N1    . DT  D 2 11  ? -1.074  26.605 -87.727  1.00 74.44  ? 11  DT  F N1    1 
ATOM   907   C  C2    . DT  D 2 11  ? 0.126   26.358 -87.089  1.00 74.01  ? 11  DT  F C2    1 
ATOM   908   O  O2    . DT  D 2 11  ? 1.208   26.382 -87.657  1.00 73.70  ? 11  DT  F O2    1 
ATOM   909   N  N3    . DT  D 2 11  ? 0.010   26.074 -85.749  1.00 73.67  ? 11  DT  F N3    1 
ATOM   910   C  C4    . DT  D 2 11  ? -1.153  26.000 -85.006  1.00 73.54  ? 11  DT  F C4    1 
ATOM   911   O  O4    . DT  D 2 11  ? -1.095  25.767 -83.802  1.00 73.35  ? 11  DT  F O4    1 
ATOM   912   C  C5    . DT  D 2 11  ? -2.373  26.223 -85.747  1.00 73.61  ? 11  DT  F C5    1 
ATOM   913   C  C7    . DT  D 2 11  ? -3.686  26.131 -85.035  1.00 73.54  ? 11  DT  F C7    1 
ATOM   914   C  C6    . DT  D 2 11  ? -2.273  26.507 -87.051  1.00 74.01  ? 11  DT  F C6    1 
ATOM   915   P  P     . DC  D 2 12  ? -2.977  24.098 -92.488  1.00 81.94  ? 12  DC  F P     1 
ATOM   916   O  OP1   . DC  D 2 12  ? -2.888  24.007 -93.968  1.00 81.79  ? 12  DC  F OP1   1 
ATOM   917   O  OP2   . DC  D 2 12  ? -4.226  23.677 -91.801  1.00 81.89  ? 12  DC  F OP2   1 
ATOM   918   O  "O5'" . DC  D 2 12  ? -1.762  23.273 -91.865  1.00 83.67  ? 12  DC  F "O5'" 1 
ATOM   919   C  "C5'" . DC  D 2 12  ? -0.402  23.565 -92.240  1.00 86.61  ? 12  DC  F "C5'" 1 
ATOM   920   C  "C4'" . DC  D 2 12  ? 0.558   22.682 -91.475  1.00 88.79  ? 12  DC  F "C4'" 1 
ATOM   921   O  "O4'" . DC  D 2 12  ? 0.472   22.965 -90.055  1.00 89.13  ? 12  DC  F "O4'" 1 
ATOM   922   C  "C3'" . DC  D 2 12  ? 0.330   21.175 -91.626  1.00 90.09  ? 12  DC  F "C3'" 1 
ATOM   923   O  "O3'" . DC  D 2 12  ? 1.595   20.501 -91.680  1.00 92.11  ? 12  DC  F "O3'" 1 
ATOM   924   C  "C2'" . DC  D 2 12  ? -0.372  20.791 -90.337  1.00 89.80  ? 12  DC  F "C2'" 1 
ATOM   925   C  "C1'" . DC  D 2 12  ? 0.238   21.762 -89.339  1.00 89.45  ? 12  DC  F "C1'" 1 
ATOM   926   N  N1    . DC  D 2 12  ? -0.590  22.075 -88.156  1.00 89.40  ? 12  DC  F N1    1 
ATOM   927   C  C2    . DC  D 2 12  ? 0.048   22.271 -86.919  1.00 89.31  ? 12  DC  F C2    1 
ATOM   928   O  O2    . DC  D 2 12  ? 1.291   22.224 -86.864  1.00 89.06  ? 12  DC  F O2    1 
ATOM   929   N  N3    . DC  D 2 12  ? -0.704  22.511 -85.819  1.00 89.20  ? 12  DC  F N3    1 
ATOM   930   C  C4    . DC  D 2 12  ? -2.035  22.570 -85.919  1.00 89.29  ? 12  DC  F C4    1 
ATOM   931   N  N4    . DC  D 2 12  ? -2.737  22.791 -84.804  1.00 89.14  ? 12  DC  F N4    1 
ATOM   932   C  C5    . DC  D 2 12  ? -2.707  22.400 -87.165  1.00 89.33  ? 12  DC  F C5    1 
ATOM   933   C  C6    . DC  D 2 12  ? -1.954  22.159 -88.247  1.00 89.45  ? 12  DC  F C6    1 
ATOM   934   P  P     . DC  D 2 13  ? 1.667   18.966 -92.155  1.00 93.50  ? 13  DC  F P     1 
ATOM   935   O  OP1   . DC  D 2 13  ? 1.785   18.951 -93.637  1.00 93.61  ? 13  DC  F OP1   1 
ATOM   936   O  OP2   . DC  D 2 13  ? 0.549   18.236 -91.499  1.00 93.45  ? 13  DC  F OP2   1 
ATOM   937   O  "O5'" . DC  D 2 13  ? 3.033   18.434 -91.526  1.00 94.32  ? 13  DC  F "O5'" 1 
ATOM   938   C  "C5'" . DC  D 2 13  ? 4.282   19.115 -91.769  1.00 95.88  ? 13  DC  F "C5'" 1 
ATOM   939   C  "C4'" . DC  D 2 13  ? 5.076   19.227 -90.487  1.00 97.03  ? 13  DC  F "C4'" 1 
ATOM   940   O  "O4'" . DC  D 2 13  ? 4.328   20.004 -89.526  1.00 97.30  ? 13  DC  F "O4'" 1 
ATOM   941   C  "C3'" . DC  D 2 13  ? 5.374   17.901 -89.789  1.00 97.75  ? 13  DC  F "C3'" 1 
ATOM   942   O  "O3'" . DC  D 2 13  ? 6.613   17.362 -90.270  1.00 98.61  ? 13  DC  F "O3'" 1 
ATOM   943   C  "C2'" . DC  D 2 13  ? 5.495   18.308 -88.332  1.00 97.68  ? 13  DC  F "C2'" 1 
ATOM   944   C  "C1'" . DC  D 2 13  ? 4.539   19.494 -88.210  1.00 97.53  ? 13  DC  F "C1'" 1 
ATOM   945   N  N1    . DC  D 2 13  ? 3.220   19.183 -87.620  1.00 97.54  ? 13  DC  F N1    1 
ATOM   946   C  C2    . DC  D 2 13  ? 3.039   19.340 -86.232  1.00 97.46  ? 13  DC  F C2    1 
ATOM   947   O  O2    . DC  D 2 13  ? 3.996   19.716 -85.531  1.00 97.40  ? 13  DC  F O2    1 
ATOM   948   N  N3    . DC  D 2 13  ? 1.827   19.078 -85.691  1.00 97.38  ? 13  DC  F N3    1 
ATOM   949   C  C4    . DC  D 2 13  ? 0.821   18.669 -86.469  1.00 97.43  ? 13  DC  F C4    1 
ATOM   950   N  N4    . DC  D 2 13  ? -0.357  18.429 -85.891  1.00 97.38  ? 13  DC  F N4    1 
ATOM   951   C  C5    . DC  D 2 13  ? 0.979   18.490 -87.876  1.00 97.51  ? 13  DC  F C5    1 
ATOM   952   C  C6    . DC  D 2 13  ? 2.181   18.754 -88.404  1.00 97.57  ? 13  DC  F C6    1 
ATOM   953   P  P     . DG  D 2 14  ? 6.708   15.809 -90.685  1.00 99.34  ? 14  DG  F P     1 
ATOM   954   O  OP1   . DG  D 2 14  ? 8.137   15.502 -90.952  1.00 99.34  ? 14  DG  F OP1   1 
ATOM   955   O  OP2   . DG  D 2 14  ? 5.694   15.561 -91.745  1.00 99.45  ? 14  DG  F OP2   1 
ATOM   956   O  "O5'" . DG  D 2 14  ? 6.258   15.014 -89.379  1.00 99.41  ? 14  DG  F "O5'" 1 
ATOM   957   C  "C5'" . DG  D 2 14  ? 6.906   15.239 -88.114  1.00 99.71  ? 14  DG  F "C5'" 1 
ATOM   958   C  "C4'" . DG  D 2 14  ? 6.470   14.201 -87.105  1.00 99.94  ? 14  DG  F "C4'" 1 
ATOM   959   O  "O4'" . DG  D 2 14  ? 5.048   14.331 -86.849  1.00 100.02 ? 14  DG  F "O4'" 1 
ATOM   960   C  "C3'" . DG  D 2 14  ? 6.702   12.745 -87.518  1.00 100.02 ? 14  DG  F "C3'" 1 
ATOM   961   O  "O3'" . DG  D 2 14  ? 7.124   11.963 -86.395  1.00 100.02 ? 14  DG  F "O3'" 1 
ATOM   962   C  "C2'" . DG  D 2 14  ? 5.324   12.268 -87.942  1.00 100.02 ? 14  DG  F "C2'" 1 
ATOM   963   C  "C1'" . DG  D 2 14  ? 4.398   13.082 -87.049  1.00 100.02 ? 14  DG  F "C1'" 1 
ATOM   964   N  N9    . DG  D 2 14  ? 3.059   13.342 -87.585  1.00 100.02 ? 14  DG  F N9    1 
ATOM   965   C  C8    . DG  D 2 14  ? 2.514   12.841 -88.747  1.00 100.02 ? 14  DG  F C8    1 
ATOM   966   N  N7    . DG  D 2 14  ? 1.279   13.217 -88.940  1.00 100.02 ? 14  DG  F N7    1 
ATOM   967   C  C5    . DG  D 2 14  ? 0.987   14.021 -87.846  1.00 99.98  ? 14  DG  F C5    1 
ATOM   968   C  C6    . DG  D 2 14  ? -0.210  14.703 -87.500  1.00 99.95  ? 14  DG  F C6    1 
ATOM   969   O  O6    . DG  D 2 14  ? -1.288  14.724 -88.106  1.00 100.01 ? 14  DG  F O6    1 
ATOM   970   N  N1    . DG  D 2 14  ? -0.071  15.410 -86.311  1.00 99.79  ? 14  DG  F N1    1 
ATOM   971   C  C2    . DG  D 2 14  ? 1.067   15.450 -85.545  1.00 99.76  ? 14  DG  F C2    1 
ATOM   972   N  N2    . DG  D 2 14  ? 0.998   16.191 -84.431  1.00 99.64  ? 14  DG  F N2    1 
ATOM   973   N  N3    . DG  D 2 14  ? 2.188   14.813 -85.849  1.00 99.85  ? 14  DG  F N3    1 
ATOM   974   C  C4    . DG  D 2 14  ? 2.077   14.121 -87.005  1.00 99.98  ? 14  DG  F C4    1 
ATOM   975   N  N     . ALA E 3 1   ? 4.501   20.425 -142.001 1.00 52.31  ? 297 ALA A N     1 
ATOM   976   C  CA    . ALA E 3 1   ? 4.111   20.122 -143.407 1.00 52.67  ? 297 ALA A CA    1 
ATOM   977   C  C     . ALA E 3 1   ? 5.322   19.734 -144.257 1.00 52.75  ? 297 ALA A C     1 
ATOM   978   O  O     . ALA E 3 1   ? 6.155   20.577 -144.607 1.00 53.05  ? 297 ALA A O     1 
ATOM   979   C  CB    . ALA E 3 1   ? 3.399   21.323 -144.022 1.00 52.36  ? 297 ALA A CB    1 
ATOM   980   N  N     . LYS E 3 2   ? 5.397   18.449 -144.587 1.00 52.80  ? 298 LYS A N     1 
ATOM   981   C  CA    . LYS E 3 2   ? 6.480   17.886 -145.386 1.00 52.33  ? 298 LYS A CA    1 
ATOM   982   C  C     . LYS E 3 2   ? 7.249   18.865 -146.267 1.00 52.01  ? 298 LYS A C     1 
ATOM   983   O  O     . LYS E 3 2   ? 6.721   19.380 -147.252 1.00 52.31  ? 298 LYS A O     1 
ATOM   984   C  CB    . LYS E 3 2   ? 5.940   16.750 -146.247 1.00 52.40  ? 298 LYS A CB    1 
ATOM   985   N  N     . MET E 3 3   ? 8.498   19.126 -145.893 1.00 51.32  ? 299 MET A N     1 
ATOM   986   C  CA    . MET E 3 3   ? 9.373   19.985 -146.683 1.00 50.75  ? 299 MET A CA    1 
ATOM   987   C  C     . MET E 3 3   ? 9.955   19.006 -147.701 1.00 50.95  ? 299 MET A C     1 
ATOM   988   O  O     . MET E 3 3   ? 10.548  17.991 -147.321 1.00 51.12  ? 299 MET A O     1 
ATOM   989   C  CB    . MET E 3 3   ? 10.486  20.572 -145.809 1.00 49.40  ? 299 MET A CB    1 
ATOM   990   C  CG    . MET E 3 3   ? 11.538  21.352 -146.572 1.00 47.64  ? 299 MET A CG    1 
ATOM   991   S  SD    . MET E 3 3   ? 12.727  22.148 -145.469 1.00 45.46  ? 299 MET A SD    1 
ATOM   992   C  CE    . MET E 3 3   ? 11.884  23.722 -145.099 1.00 45.60  ? 299 MET A CE    1 
ATOM   993   N  N     . ALA E 3 4   ? 9.776   19.283 -148.988 1.00 51.13  ? 300 ALA A N     1 
ATOM   994   C  CA    . ALA E 3 4   ? 10.266  18.363 -150.014 1.00 51.21  ? 300 ALA A CA    1 
ATOM   995   C  C     . ALA E 3 4   ? 11.770  18.407 -150.240 1.00 50.87  ? 300 ALA A C     1 
ATOM   996   O  O     . ALA E 3 4   ? 12.332  19.464 -150.514 1.00 51.82  ? 300 ALA A O     1 
ATOM   997   C  CB    . ALA E 3 4   ? 9.542   18.616 -151.328 1.00 50.95  ? 300 ALA A CB    1 
ATOM   998   N  N     . PHE E 3 5   ? 12.411  17.248 -150.129 1.00 50.45  ? 301 PHE A N     1 
ATOM   999   C  CA    . PHE E 3 5   ? 13.855  17.133 -150.335 1.00 49.95  ? 301 PHE A CA    1 
ATOM   1000  C  C     . PHE E 3 5   ? 14.120  15.825 -151.067 1.00 49.55  ? 301 PHE A C     1 
ATOM   1001  O  O     . PHE E 3 5   ? 13.332  14.883 -150.969 1.00 49.51  ? 301 PHE A O     1 
ATOM   1002  C  CB    . PHE E 3 5   ? 14.590  17.111 -148.989 1.00 49.15  ? 301 PHE A CB    1 
ATOM   1003  C  CG    . PHE E 3 5   ? 14.328  15.871 -148.180 1.00 48.31  ? 301 PHE A CG    1 
ATOM   1004  C  CD1   . PHE E 3 5   ? 15.068  14.713 -148.392 1.00 48.14  ? 301 PHE A CD1   1 
ATOM   1005  C  CD2   . PHE E 3 5   ? 13.316  15.850 -147.232 1.00 48.01  ? 301 PHE A CD2   1 
ATOM   1006  C  CE1   . PHE E 3 5   ? 14.801  13.551 -147.670 1.00 47.61  ? 301 PHE A CE1   1 
ATOM   1007  C  CE2   . PHE E 3 5   ? 13.041  14.691 -146.503 1.00 47.96  ? 301 PHE A CE2   1 
ATOM   1008  C  CZ    . PHE E 3 5   ? 13.783  13.541 -146.723 1.00 47.43  ? 301 PHE A CZ    1 
ATOM   1009  N  N     . THR E 3 6   ? 15.228  15.757 -151.792 1.00 49.12  ? 302 THR A N     1 
ATOM   1010  C  CA    . THR E 3 6   ? 15.562  14.534 -152.506 1.00 49.15  ? 302 THR A CA    1 
ATOM   1011  C  C     . THR E 3 6   ? 16.569  13.702 -151.713 1.00 49.45  ? 302 THR A C     1 
ATOM   1012  O  O     . THR E 3 6   ? 17.726  14.092 -151.562 1.00 49.95  ? 302 THR A O     1 
ATOM   1013  C  CB    . THR E 3 6   ? 16.148  14.839 -153.904 1.00 48.52  ? 302 THR A CB    1 
ATOM   1014  O  OG1   . THR E 3 6   ? 17.417  14.185 -154.042 1.00 48.30  ? 302 THR A OG1   1 
ATOM   1015  C  CG2   . THR E 3 6   ? 16.317  16.340 -154.102 1.00 47.80  ? 302 THR A CG2   1 
ATOM   1016  N  N     . LEU E 3 7   ? 16.125  12.565 -151.185 1.00 49.43  ? 303 LEU A N     1 
ATOM   1017  C  CA    . LEU E 3 7   ? 17.029  11.700 -150.442 1.00 49.33  ? 303 LEU A CA    1 
ATOM   1018  C  C     . LEU E 3 7   ? 18.024  11.158 -151.467 1.00 49.23  ? 303 LEU A C     1 
ATOM   1019  O  O     . LEU E 3 7   ? 17.725  10.215 -152.203 1.00 49.22  ? 303 LEU A O     1 
ATOM   1020  C  CB    . LEU E 3 7   ? 16.258  10.549 -149.782 1.00 49.26  ? 303 LEU A CB    1 
ATOM   1021  C  CG    . LEU E 3 7   ? 16.989  9.739  -148.699 1.00 49.28  ? 303 LEU A CG    1 
ATOM   1022  C  CD1   . LEU E 3 7   ? 16.033  8.743  -148.076 1.00 49.26  ? 303 LEU A CD1   1 
ATOM   1023  C  CD2   . LEU E 3 7   ? 18.191  9.016  -149.293 1.00 49.78  ? 303 LEU A CD2   1 
ATOM   1024  N  N     . ALA E 3 8   ? 19.203  11.771 -151.516 1.00 49.09  ? 304 ALA A N     1 
ATOM   1025  C  CA    . ALA E 3 8   ? 20.244  11.380 -152.460 1.00 48.67  ? 304 ALA A CA    1 
ATOM   1026  C  C     . ALA E 3 8   ? 20.884  10.027 -152.168 1.00 48.78  ? 304 ALA A C     1 
ATOM   1027  O  O     . ALA E 3 8   ? 21.240  9.720  -151.028 1.00 48.72  ? 304 ALA A O     1 
ATOM   1028  C  CB    . ALA E 3 8   ? 21.313  12.456 -152.516 1.00 48.59  ? 304 ALA A CB    1 
ATOM   1029  N  N     . ASP E 3 9   ? 21.029  9.221  -153.216 1.00 48.61  ? 305 ASP A N     1 
ATOM   1030  C  CA    . ASP E 3 9   ? 21.633  7.904  -153.095 1.00 48.61  ? 305 ASP A CA    1 
ATOM   1031  C  C     . ASP E 3 9   ? 23.025  7.922  -153.706 1.00 48.36  ? 305 ASP A C     1 
ATOM   1032  O  O     . ASP E 3 9   ? 23.732  6.908  -153.713 1.00 47.85  ? 305 ASP A O     1 
ATOM   1033  C  CB    . ASP E 3 9   ? 20.759  6.869  -153.786 1.00 49.53  ? 305 ASP A CB    1 
ATOM   1034  C  CG    . ASP E 3 9   ? 19.405  6.735  -153.127 1.00 50.68  ? 305 ASP A CG    1 
ATOM   1035  O  OD1   . ASP E 3 9   ? 19.374  6.323  -151.948 1.00 50.83  ? 305 ASP A OD1   1 
ATOM   1036  O  OD2   . ASP E 3 9   ? 18.377  7.047  -153.778 1.00 51.17  ? 305 ASP A OD2   1 
ATOM   1037  N  N     . ARG E 3 10  ? 23.398  9.094  -154.216 1.00 48.03  ? 306 ARG A N     1 
ATOM   1038  C  CA    . ARG E 3 10  ? 24.706  9.336  -154.823 1.00 47.98  ? 306 ARG A CA    1 
ATOM   1039  C  C     . ARG E 3 10  ? 24.900  10.853 -154.858 1.00 47.73  ? 306 ARG A C     1 
ATOM   1040  O  O     . ARG E 3 10  ? 23.922  11.608 -154.904 1.00 47.48  ? 306 ARG A O     1 
ATOM   1041  C  CB    . ARG E 3 10  ? 24.773  8.779  -156.255 1.00 48.26  ? 306 ARG A CB    1 
ATOM   1042  C  CG    . ARG E 3 10  ? 23.914  9.533  -157.267 1.00 48.77  ? 306 ARG A CG    1 
ATOM   1043  C  CD    . ARG E 3 10  ? 24.542  9.538  -158.659 1.00 49.06  ? 306 ARG A CD    1 
ATOM   1044  N  NE    . ARG E 3 10  ? 23.821  10.422 -159.578 1.00 49.28  ? 306 ARG A NE    1 
ATOM   1045  C  CZ    . ARG E 3 10  ? 24.336  10.938 -160.691 1.00 49.45  ? 306 ARG A CZ    1 
ATOM   1046  N  NH1   . ARG E 3 10  ? 25.589  10.663 -161.038 1.00 49.37  ? 306 ARG A NH1   1 
ATOM   1047  N  NH2   . ARG E 3 10  ? 23.603  11.740 -161.455 1.00 49.44  ? 306 ARG A NH2   1 
ATOM   1048  N  N     . VAL E 3 11  ? 26.151  11.301 -154.833 1.00 47.09  ? 307 VAL A N     1 
ATOM   1049  C  CA    . VAL E 3 11  ? 26.430  12.735 -154.870 1.00 46.98  ? 307 VAL A CA    1 
ATOM   1050  C  C     . VAL E 3 11  ? 26.218  13.253 -156.294 1.00 46.68  ? 307 VAL A C     1 
ATOM   1051  O  O     . VAL E 3 11  ? 26.111  12.455 -157.226 1.00 46.97  ? 307 VAL A O     1 
ATOM   1052  C  CB    . VAL E 3 11  ? 27.882  13.029 -154.426 1.00 46.74  ? 307 VAL A CB    1 
ATOM   1053  C  CG1   . VAL E 3 11  ? 28.115  14.528 -154.357 1.00 47.15  ? 307 VAL A CG1   1 
ATOM   1054  C  CG2   . VAL E 3 11  ? 28.149  12.395 -153.084 1.00 46.59  ? 307 VAL A CG2   1 
ATOM   1055  N  N     . THR E 3 12  ? 26.135  14.575 -156.456 1.00 46.16  ? 308 THR A N     1 
ATOM   1056  C  CA    . THR E 3 12  ? 25.947  15.193 -157.770 1.00 46.23  ? 308 THR A CA    1 
ATOM   1057  C  C     . THR E 3 12  ? 26.551  16.599 -157.831 1.00 46.61  ? 308 THR A C     1 
ATOM   1058  O  O     . THR E 3 12  ? 26.863  17.209 -156.803 1.00 46.29  ? 308 THR A O     1 
ATOM   1059  C  CB    . THR E 3 12  ? 24.453  15.312 -158.155 1.00 46.38  ? 308 THR A CB    1 
ATOM   1060  O  OG1   . THR E 3 12  ? 23.823  16.290 -157.323 1.00 45.86  ? 308 THR A OG1   1 
ATOM   1061  C  CG2   . THR E 3 12  ? 23.743  13.979 -157.993 1.00 46.22  ? 308 THR A CG2   1 
ATOM   1062  N  N     . GLU E 3 13  ? 26.695  17.114 -159.047 1.00 46.74  ? 309 GLU A N     1 
ATOM   1063  C  CA    . GLU E 3 13  ? 27.278  18.431 -159.267 1.00 47.24  ? 309 GLU A CA    1 
ATOM   1064  C  C     . GLU E 3 13  ? 26.501  19.608 -158.691 1.00 46.65  ? 309 GLU A C     1 
ATOM   1065  O  O     . GLU E 3 13  ? 27.099  20.549 -158.162 1.00 46.53  ? 309 GLU A O     1 
ATOM   1066  C  CB    . GLU E 3 13  ? 27.494  18.664 -160.764 1.00 48.40  ? 309 GLU A CB    1 
ATOM   1067  C  CG    . GLU E 3 13  ? 27.791  20.117 -161.129 1.00 50.09  ? 309 GLU A CG    1 
ATOM   1068  C  CD    . GLU E 3 13  ? 29.059  20.656 -160.484 1.00 51.42  ? 309 GLU A CD    1 
ATOM   1069  O  OE1   . GLU E 3 13  ? 29.273  21.889 -160.540 1.00 51.84  ? 309 GLU A OE1   1 
ATOM   1070  O  OE2   . GLU E 3 13  ? 29.845  19.853 -159.930 1.00 52.26  ? 309 GLU A OE2   1 
ATOM   1071  N  N     . GLU E 3 14  ? 25.177  19.562 -158.796 1.00 45.86  ? 310 GLU A N     1 
ATOM   1072  C  CA    . GLU E 3 14  ? 24.348  20.654 -158.297 1.00 45.12  ? 310 GLU A CA    1 
ATOM   1073  C  C     . GLU E 3 14  ? 24.291  20.749 -156.773 1.00 44.43  ? 310 GLU A C     1 
ATOM   1074  O  O     . GLU E 3 14  ? 23.773  21.727 -156.235 1.00 44.12  ? 310 GLU A O     1 
ATOM   1075  C  CB    . GLU E 3 14  ? 22.931  20.544 -158.853 1.00 45.13  ? 310 GLU A CB    1 
ATOM   1076  C  CG    . GLU E 3 14  ? 22.130  19.385 -158.306 1.00 45.29  ? 310 GLU A CG    1 
ATOM   1077  C  CD    . GLU E 3 14  ? 20.659  19.525 -158.615 1.00 45.55  ? 310 GLU A CD    1 
ATOM   1078  O  OE1   . GLU E 3 14  ? 20.245  20.639 -159.003 1.00 45.29  ? 310 GLU A OE1   1 
ATOM   1079  O  OE2   . GLU E 3 14  ? 19.918  18.531 -158.459 1.00 45.74  ? 310 GLU A OE2   1 
ATOM   1080  N  N     . MET E 3 15  ? 24.818  19.746 -156.077 1.00 43.37  ? 311 MET A N     1 
ATOM   1081  C  CA    . MET E 3 15  ? 24.811  19.781 -154.621 1.00 43.01  ? 311 MET A CA    1 
ATOM   1082  C  C     . MET E 3 15  ? 26.191  20.118 -154.058 1.00 42.30  ? 311 MET A C     1 
ATOM   1083  O  O     . MET E 3 15  ? 26.388  20.153 -152.843 1.00 42.33  ? 311 MET A O     1 
ATOM   1084  C  CB    . MET E 3 15  ? 24.292  18.458 -154.044 1.00 43.33  ? 311 MET A CB    1 
ATOM   1085  C  CG    . MET E 3 15  ? 24.951  17.203 -154.571 1.00 43.72  ? 311 MET A CG    1 
ATOM   1086  S  SD    . MET E 3 15  ? 24.312  15.725 -153.746 1.00 44.23  ? 311 MET A SD    1 
ATOM   1087  C  CE    . MET E 3 15  ? 22.866  15.351 -154.728 1.00 44.77  ? 311 MET A CE    1 
ATOM   1088  N  N     . LEU E 3 16  ? 27.138  20.389 -154.953 1.00 41.26  ? 312 LEU A N     1 
ATOM   1089  C  CA    . LEU E 3 16  ? 28.495  20.748 -154.556 1.00 40.68  ? 312 LEU A CA    1 
ATOM   1090  C  C     . LEU E 3 16  ? 28.783  22.178 -155.003 1.00 40.01  ? 312 LEU A C     1 
ATOM   1091  O  O     . LEU E 3 16  ? 29.795  22.433 -155.644 1.00 40.49  ? 312 LEU A O     1 
ATOM   1092  C  CB    . LEU E 3 16  ? 29.515  19.802 -155.197 1.00 40.62  ? 312 LEU A CB    1 
ATOM   1093  C  CG    . LEU E 3 16  ? 29.273  18.295 -155.100 1.00 40.37  ? 312 LEU A CG    1 
ATOM   1094  C  CD1   . LEU E 3 16  ? 30.448  17.562 -155.728 1.00 41.07  ? 312 LEU A CD1   1 
ATOM   1095  C  CD2   . LEU E 3 16  ? 29.110  17.877 -153.650 1.00 41.16  ? 312 LEU A CD2   1 
ATOM   1096  N  N     . ALA E 3 17  ? 27.884  23.099 -154.664 1.00 39.51  ? 313 ALA A N     1 
ATOM   1097  C  CA    . ALA E 3 17  ? 28.013  24.511 -155.030 1.00 38.96  ? 313 ALA A CA    1 
ATOM   1098  C  C     . ALA E 3 17  ? 28.925  25.253 -154.052 1.00 38.63  ? 313 ALA A C     1 
ATOM   1099  O  O     . ALA E 3 17  ? 29.227  24.738 -152.977 1.00 38.23  ? 313 ALA A O     1 
ATOM   1100  C  CB    . ALA E 3 17  ? 26.630  25.163 -155.062 1.00 38.79  ? 313 ALA A CB    1 
ATOM   1101  N  N     . ASP E 3 18  ? 29.358  26.458 -154.422 1.00 38.41  ? 314 ASP A N     1 
ATOM   1102  C  CA    . ASP E 3 18  ? 30.249  27.236 -153.562 1.00 38.50  ? 314 ASP A CA    1 
ATOM   1103  C  C     . ASP E 3 18  ? 29.556  27.971 -152.425 1.00 37.62  ? 314 ASP A C     1 
ATOM   1104  O  O     . ASP E 3 18  ? 29.977  29.058 -152.012 1.00 36.85  ? 314 ASP A O     1 
ATOM   1105  C  CB    . ASP E 3 18  ? 31.111  28.221 -154.383 1.00 39.41  ? 314 ASP A CB    1 
ATOM   1106  C  CG    . ASP E 3 18  ? 30.415  28.732 -155.626 1.00 40.13  ? 314 ASP A CG    1 
ATOM   1107  O  OD1   . ASP E 3 18  ? 30.116  27.912 -156.521 1.00 41.30  ? 314 ASP A OD1   1 
ATOM   1108  O  OD2   . ASP E 3 18  ? 30.179  29.957 -155.719 1.00 39.97  ? 314 ASP A OD2   1 
ATOM   1109  N  N     . LYS E 3 19  ? 28.486  27.355 -151.927 1.00 36.70  ? 315 LYS A N     1 
ATOM   1110  C  CA    . LYS E 3 19  ? 27.717  27.877 -150.809 1.00 35.86  ? 315 LYS A CA    1 
ATOM   1111  C  C     . LYS E 3 19  ? 26.533  26.972 -150.488 1.00 35.46  ? 315 LYS A C     1 
ATOM   1112  O  O     . LYS E 3 19  ? 25.659  26.765 -151.326 1.00 35.83  ? 315 LYS A O     1 
ATOM   1113  C  CB    . LYS E 3 19  ? 27.211  29.293 -151.091 1.00 35.58  ? 315 LYS A CB    1 
ATOM   1114  C  CG    . LYS E 3 19  ? 26.501  29.900 -149.887 1.00 35.27  ? 315 LYS A CG    1 
ATOM   1115  C  CD    . LYS E 3 19  ? 27.360  29.747 -148.646 1.00 34.90  ? 315 LYS A CD    1 
ATOM   1116  C  CE    . LYS E 3 19  ? 26.638  30.127 -147.375 1.00 34.89  ? 315 LYS A CE    1 
ATOM   1117  N  NZ    . LYS E 3 19  ? 27.512  29.901 -146.202 1.00 35.16  ? 315 LYS A NZ    1 
ATOM   1118  N  N     . ALA E 3 20  ? 26.515  26.425 -149.277 1.00 34.49  ? 316 ALA A N     1 
ATOM   1119  C  CA    . ALA E 3 20  ? 25.424  25.549 -148.863 1.00 33.87  ? 316 ALA A CA    1 
ATOM   1120  C  C     . ALA E 3 20  ? 25.340  25.391 -147.347 1.00 33.25  ? 316 ALA A C     1 
ATOM   1121  O  O     . ALA E 3 20  ? 26.300  25.682 -146.628 1.00 32.44  ? 316 ALA A O     1 
ATOM   1122  C  CB    . ALA E 3 20  ? 25.586  24.178 -149.512 1.00 33.34  ? 316 ALA A CB    1 
ATOM   1123  N  N     . ALA E 3 21  ? 24.174  24.948 -146.875 1.00 32.36  ? 317 ALA A N     1 
ATOM   1124  C  CA    . ALA E 3 21  ? 23.959  24.683 -145.465 1.00 31.52  ? 317 ALA A CA    1 
ATOM   1125  C  C     . ALA E 3 21  ? 24.297  23.204 -145.319 1.00 31.27  ? 317 ALA A C     1 
ATOM   1126  O  O     . ALA E 3 21  ? 23.801  22.352 -146.066 1.00 31.84  ? 317 ALA A O     1 
ATOM   1127  C  CB    . ALA E 3 21  ? 22.508  24.938 -145.074 1.00 31.43  ? 317 ALA A CB    1 
ATOM   1128  N  N     . LEU E 3 22  ? 25.154  22.889 -144.370 1.00 29.91  ? 318 LEU A N     1 
ATOM   1129  C  CA    . LEU E 3 22  ? 25.555  21.507 -144.189 1.00 29.80  ? 318 LEU A CA    1 
ATOM   1130  C  C     . LEU E 3 22  ? 25.260  21.003 -142.806 1.00 29.43  ? 318 LEU A C     1 
ATOM   1131  O  O     . LEU E 3 22  ? 25.295  21.754 -141.836 1.00 30.08  ? 318 LEU A O     1 
ATOM   1132  C  CB    . LEU E 3 22  ? 27.063  21.358 -144.473 1.00 29.52  ? 318 LEU A CB    1 
ATOM   1133  C  CG    . LEU E 3 22  ? 27.782  20.132 -143.876 1.00 30.05  ? 318 LEU A CG    1 
ATOM   1134  C  CD1   . LEU E 3 22  ? 27.247  18.857 -144.516 1.00 29.71  ? 318 LEU A CD1   1 
ATOM   1135  C  CD2   . LEU E 3 22  ? 29.301  20.258 -144.110 1.00 29.56  ? 318 LEU A CD2   1 
ATOM   1136  N  N     . VAL E 3 23  ? 24.975  19.712 -142.728 1.00 29.16  ? 319 VAL A N     1 
ATOM   1137  C  CA    . VAL E 3 23  ? 24.724  19.064 -141.472 1.00 29.39  ? 319 VAL A CA    1 
ATOM   1138  C  C     . VAL E 3 23  ? 25.338  17.682 -141.505 1.00 30.21  ? 319 VAL A C     1 
ATOM   1139  O  O     . VAL E 3 23  ? 24.897  16.802 -142.251 1.00 31.12  ? 319 VAL A O     1 
ATOM   1140  C  CB    . VAL E 3 23  ? 23.208  18.939 -141.165 1.00 29.51  ? 319 VAL A CB    1 
ATOM   1141  C  CG1   . VAL E 3 23  ? 22.979  17.917 -140.050 1.00 27.78  ? 319 VAL A CG1   1 
ATOM   1142  C  CG2   . VAL E 3 23  ? 22.659  20.299 -140.749 1.00 28.93  ? 319 VAL A CG2   1 
ATOM   1143  N  N     . VAL E 3 24  ? 26.387  17.508 -140.717 1.00 31.03  ? 320 VAL A N     1 
ATOM   1144  C  CA    . VAL E 3 24  ? 27.044  16.216 -140.592 1.00 32.10  ? 320 VAL A CA    1 
ATOM   1145  C  C     . VAL E 3 24  ? 26.627  15.868 -139.178 1.00 33.26  ? 320 VAL A C     1 
ATOM   1146  O  O     . VAL E 3 24  ? 27.278  16.264 -138.219 1.00 33.13  ? 320 VAL A O     1 
ATOM   1147  C  CB    . VAL E 3 24  ? 28.573  16.341 -140.709 1.00 31.90  ? 320 VAL A CB    1 
ATOM   1148  C  CG1   . VAL E 3 24  ? 29.224  14.971 -140.578 1.00 31.34  ? 320 VAL A CG1   1 
ATOM   1149  C  CG2   . VAL E 3 24  ? 28.931  16.978 -142.038 1.00 30.75  ? 320 VAL A CG2   1 
ATOM   1150  N  N     . GLU E 3 25  ? 25.500  15.156 -139.073 1.00 34.48  ? 321 GLU A N     1 
ATOM   1151  C  CA    . GLU E 3 25  ? 24.891  14.780 -137.796 1.00 35.27  ? 321 GLU A CA    1 
ATOM   1152  C  C     . GLU E 3 25  ? 25.627  13.818 -136.876 1.00 35.66  ? 321 GLU A C     1 
ATOM   1153  O  O     . GLU E 3 25  ? 25.819  12.644 -137.195 1.00 36.00  ? 321 GLU A O     1 
ATOM   1154  C  CB    . GLU E 3 25  ? 23.487  14.214 -138.041 1.00 36.67  ? 321 GLU A CB    1 
ATOM   1155  C  CG    . GLU E 3 25  ? 22.681  13.999 -136.763 1.00 38.48  ? 321 GLU A CG    1 
ATOM   1156  C  CD    . GLU E 3 25  ? 22.126  15.290 -136.198 1.00 38.95  ? 321 GLU A CD    1 
ATOM   1157  O  OE1   . GLU E 3 25  ? 22.593  16.371 -136.614 1.00 40.47  ? 321 GLU A OE1   1 
ATOM   1158  O  OE2   . GLU E 3 25  ? 21.225  15.228 -135.336 1.00 39.28  ? 321 GLU A OE2   1 
ATOM   1159  N  N     . VAL E 3 26  ? 25.996  14.320 -135.705 1.00 35.94  ? 322 VAL A N     1 
ATOM   1160  C  CA    . VAL E 3 26  ? 26.679  13.520 -134.692 1.00 36.18  ? 322 VAL A CA    1 
ATOM   1161  C  C     . VAL E 3 26  ? 25.775  13.526 -133.462 1.00 36.51  ? 322 VAL A C     1 
ATOM   1162  O  O     . VAL E 3 26  ? 25.864  14.411 -132.612 1.00 35.90  ? 322 VAL A O     1 
ATOM   1163  C  CB    . VAL E 3 26  ? 28.070  14.120 -134.342 1.00 35.84  ? 322 VAL A CB    1 
ATOM   1164  C  CG1   . VAL E 3 26  ? 28.693  13.367 -133.183 1.00 35.78  ? 322 VAL A CG1   1 
ATOM   1165  C  CG2   . VAL E 3 26  ? 28.980  14.035 -135.559 1.00 35.54  ? 322 VAL A CG2   1 
ATOM   1166  N  N     . VAL E 3 27  ? 24.884  12.541 -133.404 1.00 37.52  ? 323 VAL A N     1 
ATOM   1167  C  CA    . VAL E 3 27  ? 23.926  12.394 -132.312 1.00 38.56  ? 323 VAL A CA    1 
ATOM   1168  C  C     . VAL E 3 27  ? 24.633  12.251 -130.966 1.00 39.53  ? 323 VAL A C     1 
ATOM   1169  O  O     . VAL E 3 27  ? 24.272  12.921 -130.004 1.00 39.19  ? 323 VAL A O     1 
ATOM   1170  C  CB    . VAL E 3 27  ? 23.018  11.153 -132.553 1.00 39.05  ? 323 VAL A CB    1 
ATOM   1171  C  CG1   . VAL E 3 27  ? 22.001  11.008 -131.435 1.00 39.33  ? 323 VAL A CG1   1 
ATOM   1172  C  CG2   . VAL E 3 27  ? 22.317  11.281 -133.896 1.00 39.06  ? 323 VAL A CG2   1 
ATOM   1173  N  N     . GLU E 3 28  ? 25.636  11.373 -130.908 1.00 40.32  ? 324 GLU A N     1 
ATOM   1174  C  CA    . GLU E 3 28  ? 26.406  11.135 -129.688 1.00 41.38  ? 324 GLU A CA    1 
ATOM   1175  C  C     . GLU E 3 28  ? 26.789  12.443 -128.994 1.00 41.43  ? 324 GLU A C     1 
ATOM   1176  O  O     . GLU E 3 28  ? 27.269  13.370 -129.643 1.00 42.11  ? 324 GLU A O     1 
ATOM   1177  C  CB    . GLU E 3 28  ? 27.690  10.363 -130.015 1.00 42.70  ? 324 GLU A CB    1 
ATOM   1178  C  CG    . GLU E 3 28  ? 27.632  8.860  -129.811 1.00 43.81  ? 324 GLU A CG    1 
ATOM   1179  C  CD    . GLU E 3 28  ? 29.006  8.217  -129.932 1.00 44.19  ? 324 GLU A CD    1 
ATOM   1180  O  OE1   . GLU E 3 28  ? 29.949  8.710  -129.283 1.00 45.47  ? 324 GLU A OE1   1 
ATOM   1181  O  OE2   . GLU E 3 28  ? 29.150  7.219  -130.667 1.00 44.73  ? 324 GLU A OE2   1 
ATOM   1182  N  N     . GLU E 3 29  ? 26.583  12.515 -127.681 1.00 40.96  ? 325 GLU A N     1 
ATOM   1183  C  CA    . GLU E 3 29  ? 26.926  13.717 -126.923 1.00 41.19  ? 325 GLU A CA    1 
ATOM   1184  C  C     . GLU E 3 29  ? 28.411  14.044 -127.118 1.00 40.58  ? 325 GLU A C     1 
ATOM   1185  O  O     . GLU E 3 29  ? 28.771  15.171 -127.471 1.00 40.95  ? 325 GLU A O     1 
ATOM   1186  C  CB    . GLU E 3 29  ? 26.617  13.504 -125.443 1.00 42.38  ? 325 GLU A CB    1 
ATOM   1187  C  CG    . GLU E 3 29  ? 25.147  13.183 -125.175 1.00 44.51  ? 325 GLU A CG    1 
ATOM   1188  C  CD    . GLU E 3 29  ? 24.223  14.370 -125.436 1.00 45.64  ? 325 GLU A CD    1 
ATOM   1189  O  OE1   . GLU E 3 29  ? 24.298  14.953 -126.541 1.00 46.03  ? 325 GLU A OE1   1 
ATOM   1190  O  OE2   . GLU E 3 29  ? 23.421  14.714 -124.534 1.00 46.04  ? 325 GLU A OE2   1 
ATOM   1191  N  N     . ASN E 3 30  ? 29.271  13.056 -126.886 1.00 39.55  ? 326 ASN A N     1 
ATOM   1192  C  CA    . ASN E 3 30  ? 30.703  13.249 -127.081 1.00 38.94  ? 326 ASN A CA    1 
ATOM   1193  C  C     . ASN E 3 30  ? 31.036  12.835 -128.512 1.00 38.40  ? 326 ASN A C     1 
ATOM   1194  O  O     . ASN E 3 30  ? 30.995  11.649 -128.854 1.00 38.72  ? 326 ASN A O     1 
ATOM   1195  C  CB    . ASN E 3 30  ? 31.507  12.402 -126.101 1.00 38.41  ? 326 ASN A CB    1 
ATOM   1196  C  CG    . ASN E 3 30  ? 32.941  12.864 -125.994 1.00 37.65  ? 326 ASN A CG    1 
ATOM   1197  O  OD1   . ASN E 3 30  ? 33.658  12.947 -126.994 1.00 37.13  ? 326 ASN A OD1   1 
ATOM   1198  N  ND2   . ASN E 3 30  ? 33.365  13.176 -124.781 1.00 38.81  ? 326 ASN A ND2   1 
ATOM   1199  N  N     . TYR E 3 31  ? 31.366  13.819 -129.343 1.00 37.68  ? 327 TYR A N     1 
ATOM   1200  C  CA    . TYR E 3 31  ? 31.674  13.576 -130.744 1.00 36.99  ? 327 TYR A CA    1 
ATOM   1201  C  C     . TYR E 3 31  ? 33.055  12.997 -131.081 1.00 36.90  ? 327 TYR A C     1 
ATOM   1202  O  O     . TYR E 3 31  ? 33.340  12.727 -132.245 1.00 36.64  ? 327 TYR A O     1 
ATOM   1203  C  CB    . TYR E 3 31  ? 31.446  14.856 -131.553 1.00 36.63  ? 327 TYR A CB    1 
ATOM   1204  C  CG    . TYR E 3 31  ? 32.146  16.089 -131.020 1.00 35.64  ? 327 TYR A CG    1 
ATOM   1205  C  CD1   . TYR E 3 31  ? 33.532  16.218 -131.082 1.00 35.70  ? 327 TYR A CD1   1 
ATOM   1206  C  CD2   . TYR E 3 31  ? 31.414  17.140 -130.479 1.00 36.02  ? 327 TYR A CD2   1 
ATOM   1207  C  CE1   . TYR E 3 31  ? 34.166  17.362 -130.623 1.00 35.06  ? 327 TYR A CE1   1 
ATOM   1208  C  CE2   . TYR E 3 31  ? 32.039  18.291 -130.018 1.00 35.13  ? 327 TYR A CE2   1 
ATOM   1209  C  CZ    . TYR E 3 31  ? 33.414  18.395 -130.095 1.00 35.43  ? 327 TYR A CZ    1 
ATOM   1210  O  OH    . TYR E 3 31  ? 34.023  19.540 -129.646 1.00 35.36  ? 327 TYR A OH    1 
ATOM   1211  N  N     . HIS E 3 32  ? 33.904  12.792 -130.086 1.00 36.97  ? 328 HIS A N     1 
ATOM   1212  C  CA    . HIS E 3 32  ? 35.230  12.229 -130.363 1.00 37.04  ? 328 HIS A CA    1 
ATOM   1213  C  C     . HIS E 3 32  ? 35.137  10.823 -130.930 1.00 36.75  ? 328 HIS A C     1 
ATOM   1214  O  O     . HIS E 3 32  ? 34.796  9.873  -130.217 1.00 37.84  ? 328 HIS A O     1 
ATOM   1215  C  CB    . HIS E 3 32  ? 36.080  12.224 -129.097 1.00 36.56  ? 328 HIS A CB    1 
ATOM   1216  C  CG    . HIS E 3 32  ? 36.616  13.573 -128.743 1.00 35.72  ? 328 HIS A CG    1 
ATOM   1217  N  ND1   . HIS E 3 32  ? 37.464  14.270 -129.573 1.00 34.65  ? 328 HIS A ND1   1 
ATOM   1218  C  CD2   . HIS E 3 32  ? 36.420  14.358 -127.657 1.00 35.68  ? 328 HIS A CD2   1 
ATOM   1219  C  CE1   . HIS E 3 32  ? 37.770  15.428 -129.014 1.00 35.75  ? 328 HIS A CE1   1 
ATOM   1220  N  NE2   . HIS E 3 32  ? 37.149  15.507 -127.851 1.00 35.26  ? 328 HIS A NE2   1 
ATOM   1221  N  N     . ALA E 3 33  ? 35.439  10.707 -132.220 1.00 36.33  ? 329 ALA A N     1 
ATOM   1222  C  CA    . ALA E 3 33  ? 35.385  9.438  -132.937 1.00 35.97  ? 329 ALA A CA    1 
ATOM   1223  C  C     . ALA E 3 33  ? 33.961  8.897  -132.927 1.00 36.11  ? 329 ALA A C     1 
ATOM   1224  O  O     . ALA E 3 33  ? 33.738  7.684  -132.892 1.00 35.48  ? 329 ALA A O     1 
ATOM   1225  C  CB    . ALA E 3 33  ? 36.346  8.429  -132.310 1.00 35.75  ? 329 ALA A CB    1 
ATOM   1226  N  N     . ALA E 3 34  ? 32.997  9.812  -132.960 1.00 36.78  ? 330 ALA A N     1 
ATOM   1227  C  CA    . ALA E 3 34  ? 31.589  9.430  -132.957 1.00 36.74  ? 330 ALA A CA    1 
ATOM   1228  C  C     . ALA E 3 34  ? 31.136  9.202  -134.385 1.00 36.60  ? 330 ALA A C     1 
ATOM   1229  O  O     . ALA E 3 34  ? 31.554  9.905  -135.303 1.00 36.48  ? 330 ALA A O     1 
ATOM   1230  C  CB    . ALA E 3 34  ? 30.740  10.526 -132.304 1.00 36.49  ? 330 ALA A CB    1 
ATOM   1231  N  N     . PRO E 3 35  ? 30.279  8.201  -134.603 1.00 36.89  ? 331 PRO A N     1 
ATOM   1232  C  CA    . PRO E 3 35  ? 29.851  8.002  -135.985 1.00 36.80  ? 331 PRO A CA    1 
ATOM   1233  C  C     . PRO E 3 35  ? 29.012  9.178  -136.479 1.00 36.37  ? 331 PRO A C     1 
ATOM   1234  O  O     . PRO E 3 35  ? 28.500  9.972  -135.689 1.00 36.07  ? 331 PRO A O     1 
ATOM   1235  C  CB    . PRO E 3 35  ? 29.054  6.701  -135.914 1.00 36.43  ? 331 PRO A CB    1 
ATOM   1236  C  CG    . PRO E 3 35  ? 28.494  6.726  -134.518 1.00 37.40  ? 331 PRO A CG    1 
ATOM   1237  C  CD    . PRO E 3 35  ? 29.664  7.212  -133.702 1.00 36.81  ? 331 PRO A CD    1 
ATOM   1238  N  N     . ILE E 3 36  ? 28.905  9.303  -137.795 1.00 36.40  ? 332 ILE A N     1 
ATOM   1239  C  CA    . ILE E 3 36  ? 28.091  10.346 -138.391 1.00 36.09  ? 332 ILE A CA    1 
ATOM   1240  C  C     . ILE E 3 36  ? 26.859  9.574  -138.856 1.00 36.06  ? 332 ILE A C     1 
ATOM   1241  O  O     . ILE E 3 36  ? 26.978  8.632  -139.648 1.00 36.41  ? 332 ILE A O     1 
ATOM   1242  C  CB    . ILE E 3 36  ? 28.795  10.980 -139.591 1.00 36.29  ? 332 ILE A CB    1 
ATOM   1243  C  CG1   . ILE E 3 36  ? 30.156  11.531 -139.167 1.00 36.77  ? 332 ILE A CG1   1 
ATOM   1244  C  CG2   . ILE E 3 36  ? 27.959  12.100 -140.141 1.00 36.19  ? 332 ILE A CG2   1 
ATOM   1245  C  CD1   . ILE E 3 36  ? 31.066  11.845 -140.335 1.00 36.62  ? 332 ILE A CD1   1 
ATOM   1246  N  N     . VAL E 3 37  ? 25.690  9.956  -138.348 1.00 34.79  ? 333 VAL A N     1 
ATOM   1247  C  CA    . VAL E 3 37  ? 24.451  9.271  -138.691 1.00 34.33  ? 333 VAL A CA    1 
ATOM   1248  C  C     . VAL E 3 37  ? 23.812  9.731  -139.995 1.00 33.89  ? 333 VAL A C     1 
ATOM   1249  O  O     . VAL E 3 37  ? 23.076  8.976  -140.625 1.00 33.83  ? 333 VAL A O     1 
ATOM   1250  C  CB    . VAL E 3 37  ? 23.408  9.395  -137.547 1.00 33.61  ? 333 VAL A CB    1 
ATOM   1251  C  CG1   . VAL E 3 37  ? 24.037  8.983  -136.234 1.00 33.69  ? 333 VAL A CG1   1 
ATOM   1252  C  CG2   . VAL E 3 37  ? 22.872  10.809 -137.459 1.00 34.15  ? 333 VAL A CG2   1 
ATOM   1253  N  N     . GLY E 3 38  ? 24.081  10.966 -140.398 1.00 33.54  ? 334 GLY A N     1 
ATOM   1254  C  CA    . GLY E 3 38  ? 23.512  11.462 -141.634 1.00 34.16  ? 334 GLY A CA    1 
ATOM   1255  C  C     . GLY E 3 38  ? 24.082  12.795 -142.085 1.00 34.59  ? 334 GLY A C     1 
ATOM   1256  O  O     . GLY E 3 38  ? 24.697  13.516 -141.299 1.00 34.14  ? 334 GLY A O     1 
ATOM   1257  N  N     . ILE E 3 39  ? 23.865  13.112 -143.357 1.00 34.74  ? 335 ILE A N     1 
ATOM   1258  C  CA    . ILE E 3 39  ? 24.328  14.355 -143.957 1.00 35.12  ? 335 ILE A CA    1 
ATOM   1259  C  C     . ILE E 3 39  ? 23.150  15.050 -144.658 1.00 35.15  ? 335 ILE A C     1 
ATOM   1260  O  O     . ILE E 3 39  ? 22.229  14.397 -145.137 1.00 36.12  ? 335 ILE A O     1 
ATOM   1261  C  CB    . ILE E 3 39  ? 25.441  14.091 -145.013 1.00 35.23  ? 335 ILE A CB    1 
ATOM   1262  C  CG1   . ILE E 3 39  ? 26.574  13.263 -144.402 1.00 34.77  ? 335 ILE A CG1   1 
ATOM   1263  C  CG2   . ILE E 3 39  ? 25.973  15.411 -145.554 1.00 35.46  ? 335 ILE A CG2   1 
ATOM   1264  C  CD1   . ILE E 3 39  ? 27.169  13.862 -143.158 1.00 36.32  ? 335 ILE A CD1   1 
ATOM   1265  N  N     . ALA E 3 40  ? 23.183  16.375 -144.714 1.00 35.02  ? 336 ALA A N     1 
ATOM   1266  C  CA    . ALA E 3 40  ? 22.126  17.133 -145.376 1.00 34.75  ? 336 ALA A CA    1 
ATOM   1267  C  C     . ALA E 3 40  ? 22.763  18.317 -146.069 1.00 34.81  ? 336 ALA A C     1 
ATOM   1268  O  O     . ALA E 3 40  ? 23.743  18.882 -145.570 1.00 35.25  ? 336 ALA A O     1 
ATOM   1269  C  CB    . ALA E 3 40  ? 21.099  17.617 -144.365 1.00 35.17  ? 336 ALA A CB    1 
ATOM   1270  N  N     . VAL E 3 41  ? 22.211  18.696 -147.216 1.00 34.26  ? 337 VAL A N     1 
ATOM   1271  C  CA    . VAL E 3 41  ? 22.752  19.814 -147.972 1.00 33.84  ? 337 VAL A CA    1 
ATOM   1272  C  C     . VAL E 3 41  ? 21.696  20.697 -148.627 1.00 33.18  ? 337 VAL A C     1 
ATOM   1273  O  O     . VAL E 3 41  ? 20.908  20.242 -149.450 1.00 32.48  ? 337 VAL A O     1 
ATOM   1274  C  CB    . VAL E 3 41  ? 23.711  19.315 -149.080 1.00 33.43  ? 337 VAL A CB    1 
ATOM   1275  C  CG1   . VAL E 3 41  ? 24.235  20.483 -149.875 1.00 34.24  ? 337 VAL A CG1   1 
ATOM   1276  C  CG2   . VAL E 3 41  ? 24.861  18.534 -148.463 1.00 34.75  ? 337 VAL A CG2   1 
ATOM   1277  N  N     . VAL E 3 42  ? 21.686  21.966 -148.248 1.00 33.00  ? 338 VAL A N     1 
ATOM   1278  C  CA    . VAL E 3 42  ? 20.777  22.925 -148.840 1.00 32.81  ? 338 VAL A CA    1 
ATOM   1279  C  C     . VAL E 3 42  ? 21.659  23.947 -149.530 1.00 34.57  ? 338 VAL A C     1 
ATOM   1280  O  O     . VAL E 3 42  ? 22.633  24.429 -148.956 1.00 34.54  ? 338 VAL A O     1 
ATOM   1281  C  CB    . VAL E 3 42  ? 19.908  23.654 -147.789 1.00 31.37  ? 338 VAL A CB    1 
ATOM   1282  C  CG1   . VAL E 3 42  ? 19.110  24.770 -148.462 1.00 30.57  ? 338 VAL A CG1   1 
ATOM   1283  C  CG2   . VAL E 3 42  ? 18.976  22.684 -147.128 1.00 29.36  ? 338 VAL A CG2   1 
ATOM   1284  N  N     . ASN E 3 43  ? 21.334  24.247 -150.778 1.00 36.55  ? 339 ASN A N     1 
ATOM   1285  C  CA    . ASN E 3 43  ? 22.082  25.222 -151.546 1.00 38.78  ? 339 ASN A CA    1 
ATOM   1286  C  C     . ASN E 3 43  ? 21.110  25.744 -152.586 1.00 40.03  ? 339 ASN A C     1 
ATOM   1287  O  O     . ASN E 3 43  ? 20.038  25.156 -152.777 1.00 41.01  ? 339 ASN A O     1 
ATOM   1288  C  CB    . ASN E 3 43  ? 23.318  24.570 -152.189 1.00 38.72  ? 339 ASN A CB    1 
ATOM   1289  C  CG    . ASN E 3 43  ? 22.972  23.613 -153.315 1.00 39.52  ? 339 ASN A CG    1 
ATOM   1290  O  OD1   . ASN E 3 43  ? 21.985  22.879 -153.250 1.00 40.27  ? 339 ASN A OD1   1 
ATOM   1291  N  ND2   . ASN E 3 43  ? 23.804  23.602 -154.350 1.00 39.24  ? 339 ASN A ND2   1 
ATOM   1292  N  N     . GLU E 3 44  ? 21.465  26.843 -153.245 1.00 41.21  ? 340 GLU A N     1 
ATOM   1293  C  CA    . GLU E 3 44  ? 20.594  27.450 -154.247 1.00 42.47  ? 340 GLU A CA    1 
ATOM   1294  C  C     . GLU E 3 44  ? 19.980  26.452 -155.222 1.00 42.97  ? 340 GLU A C     1 
ATOM   1295  O  O     . GLU E 3 44  ? 18.949  26.729 -155.834 1.00 42.90  ? 340 GLU A O     1 
ATOM   1296  C  CB    . GLU E 3 44  ? 21.363  28.520 -155.022 1.00 43.90  ? 340 GLU A CB    1 
ATOM   1297  C  CG    . GLU E 3 44  ? 20.543  29.284 -156.054 1.00 46.09  ? 340 GLU A CG    1 
ATOM   1298  C  CD    . GLU E 3 44  ? 20.739  28.768 -157.472 1.00 47.93  ? 340 GLU A CD    1 
ATOM   1299  O  OE1   . GLU E 3 44  ? 20.146  27.725 -157.834 1.00 48.88  ? 340 GLU A OE1   1 
ATOM   1300  O  OE2   . GLU E 3 44  ? 21.501  29.412 -158.229 1.00 49.24  ? 340 GLU A OE2   1 
ATOM   1301  N  N     . HIS E 3 45  ? 20.596  25.282 -155.347 1.00 43.18  ? 341 HIS A N     1 
ATOM   1302  C  CA    . HIS E 3 45  ? 20.102  24.272 -156.273 1.00 43.33  ? 341 HIS A CA    1 
ATOM   1303  C  C     . HIS E 3 45  ? 19.058  23.324 -155.713 1.00 43.52  ? 341 HIS A C     1 
ATOM   1304  O  O     . HIS E 3 45  ? 18.426  22.590 -156.471 1.00 43.67  ? 341 HIS A O     1 
ATOM   1305  C  CB    . HIS E 3 45  ? 21.277  23.474 -156.834 1.00 43.38  ? 341 HIS A CB    1 
ATOM   1306  C  CG    . HIS E 3 45  ? 22.113  24.244 -157.808 1.00 43.16  ? 341 HIS A CG    1 
ATOM   1307  N  ND1   . HIS E 3 45  ? 23.398  23.874 -158.142 1.00 42.98  ? 341 HIS A ND1   1 
ATOM   1308  C  CD2   . HIS E 3 45  ? 21.835  25.346 -158.544 1.00 42.97  ? 341 HIS A CD2   1 
ATOM   1309  C  CE1   . HIS E 3 45  ? 23.874  24.714 -159.042 1.00 43.42  ? 341 HIS A CE1   1 
ATOM   1310  N  NE2   . HIS E 3 45  ? 22.946  25.617 -159.304 1.00 43.60  ? 341 HIS A NE2   1 
ATOM   1311  N  N     . GLY E 3 46  ? 18.872  23.333 -154.396 1.00 43.72  ? 342 GLY A N     1 
ATOM   1312  C  CA    . GLY E 3 46  ? 17.879  22.456 -153.796 1.00 43.88  ? 342 GLY A CA    1 
ATOM   1313  C  C     . GLY E 3 46  ? 18.231  21.927 -152.416 1.00 43.87  ? 342 GLY A C     1 
ATOM   1314  O  O     . GLY E 3 46  ? 19.134  22.438 -151.757 1.00 44.48  ? 342 GLY A O     1 
ATOM   1315  N  N     . ARG E 3 47  ? 17.506  20.903 -151.976 1.00 43.63  ? 343 ARG A N     1 
ATOM   1316  C  CA    . ARG E 3 47  ? 17.735  20.288 -150.670 1.00 43.02  ? 343 ARG A CA    1 
ATOM   1317  C  C     . ARG E 3 47  ? 18.058  18.819 -150.889 1.00 42.32  ? 343 ARG A C     1 
ATOM   1318  O  O     . ARG E 3 47  ? 17.332  18.114 -151.590 1.00 42.12  ? 343 ARG A O     1 
ATOM   1319  C  CB    . ARG E 3 47  ? 16.483  20.399 -149.787 1.00 43.56  ? 343 ARG A CB    1 
ATOM   1320  C  CG    . ARG E 3 47  ? 15.755  21.731 -149.865 1.00 43.76  ? 343 ARG A CG    1 
ATOM   1321  C  CD    . ARG E 3 47  ? 15.015  22.010 -148.562 1.00 44.35  ? 343 ARG A CD    1 
ATOM   1322  N  NE    . ARG E 3 47  ? 14.019  23.065 -148.709 1.00 44.61  ? 343 ARG A NE    1 
ATOM   1323  C  CZ    . ARG E 3 47  ? 12.815  22.884 -149.248 1.00 45.20  ? 343 ARG A CZ    1 
ATOM   1324  N  NH1   . ARG E 3 47  ? 12.454  21.686 -149.688 1.00 44.94  ? 343 ARG A NH1   1 
ATOM   1325  N  NH2   . ARG E 3 47  ? 11.971  23.902 -149.355 1.00 44.17  ? 343 ARG A NH2   1 
ATOM   1326  N  N     . PHE E 3 48  ? 19.136  18.348 -150.281 1.00 41.76  ? 344 PHE A N     1 
ATOM   1327  C  CA    . PHE E 3 48  ? 19.528  16.959 -150.456 1.00 41.59  ? 344 PHE A CA    1 
ATOM   1328  C  C     . PHE E 3 48  ? 19.872  16.287 -149.144 1.00 41.62  ? 344 PHE A C     1 
ATOM   1329  O  O     . PHE E 3 48  ? 20.169  16.951 -148.150 1.00 41.58  ? 344 PHE A O     1 
ATOM   1330  C  CB    . PHE E 3 48  ? 20.736  16.863 -151.395 1.00 41.44  ? 344 PHE A CB    1 
ATOM   1331  C  CG    . PHE E 3 48  ? 20.636  17.750 -152.608 1.00 41.59  ? 344 PHE A CG    1 
ATOM   1332  C  CD1   . PHE E 3 48  ? 20.839  19.124 -152.505 1.00 41.53  ? 344 PHE A CD1   1 
ATOM   1333  C  CD2   . PHE E 3 48  ? 20.328  17.216 -153.853 1.00 41.69  ? 344 PHE A CD2   1 
ATOM   1334  C  CE1   . PHE E 3 48  ? 20.736  19.947 -153.621 1.00 40.98  ? 344 PHE A CE1   1 
ATOM   1335  C  CE2   . PHE E 3 48  ? 20.224  18.033 -154.976 1.00 40.60  ? 344 PHE A CE2   1 
ATOM   1336  C  CZ    . PHE E 3 48  ? 20.428  19.398 -154.858 1.00 41.22  ? 344 PHE A CZ    1 
ATOM   1337  N  N     . PHE E 3 49  ? 19.815  14.959 -149.148 1.00 41.72  ? 345 PHE A N     1 
ATOM   1338  C  CA    . PHE E 3 49  ? 20.150  14.163 -147.980 1.00 41.41  ? 345 PHE A CA    1 
ATOM   1339  C  C     . PHE E 3 49  ? 21.041  13.013 -148.433 1.00 42.36  ? 345 PHE A C     1 
ATOM   1340  O  O     . PHE E 3 49  ? 20.595  12.114 -149.158 1.00 41.96  ? 345 PHE A O     1 
ATOM   1341  C  CB    . PHE E 3 49  ? 18.908  13.570 -147.315 1.00 40.97  ? 345 PHE A CB    1 
ATOM   1342  C  CG    . PHE E 3 49  ? 19.236  12.646 -146.176 1.00 39.82  ? 345 PHE A CG    1 
ATOM   1343  C  CD1   . PHE E 3 49  ? 19.527  13.151 -144.914 1.00 39.93  ? 345 PHE A CD1   1 
ATOM   1344  C  CD2   . PHE E 3 49  ? 19.352  11.277 -146.388 1.00 39.61  ? 345 PHE A CD2   1 
ATOM   1345  C  CE1   . PHE E 3 49  ? 19.937  12.308 -143.884 1.00 39.16  ? 345 PHE A CE1   1 
ATOM   1346  C  CE2   . PHE E 3 49  ? 19.758  10.431 -145.366 1.00 39.39  ? 345 PHE A CE2   1 
ATOM   1347  C  CZ    . PHE E 3 49  ? 20.054  10.951 -144.109 1.00 39.59  ? 345 PHE A CZ    1 
ATOM   1348  N  N     . LEU E 3 50  ? 22.296  13.043 -148.002 1.00 42.32  ? 346 LEU A N     1 
ATOM   1349  C  CA    . LEU E 3 50  ? 23.242  11.998 -148.355 1.00 43.00  ? 346 LEU A CA    1 
ATOM   1350  C  C     . LEU E 3 50  ? 23.472  11.088 -147.156 1.00 43.55  ? 346 LEU A C     1 
ATOM   1351  O  O     . LEU E 3 50  ? 23.485  11.543 -146.008 1.00 43.18  ? 346 LEU A O     1 
ATOM   1352  C  CB    . LEU E 3 50  ? 24.575  12.614 -148.777 1.00 42.52  ? 346 LEU A CB    1 
ATOM   1353  C  CG    . LEU E 3 50  ? 24.553  13.574 -149.963 1.00 42.68  ? 346 LEU A CG    1 
ATOM   1354  C  CD1   . LEU E 3 50  ? 25.829  14.400 -149.974 1.00 42.74  ? 346 LEU A CD1   1 
ATOM   1355  C  CD2   . LEU E 3 50  ? 24.391  12.787 -151.254 1.00 43.12  ? 346 LEU A CD2   1 
ATOM   1356  N  N     . ARG E 3 51  ? 23.643  9.801  -147.428 1.00 44.74  ? 347 ARG A N     1 
ATOM   1357  C  CA    . ARG E 3 51  ? 23.914  8.829  -146.377 1.00 46.14  ? 347 ARG A CA    1 
ATOM   1358  C  C     . ARG E 3 51  ? 25.420  8.861  -146.130 1.00 46.61  ? 347 ARG A C     1 
ATOM   1359  O  O     . ARG E 3 51  ? 26.200  8.849  -147.077 1.00 47.14  ? 347 ARG A O     1 
ATOM   1360  C  CB    . ARG E 3 51  ? 23.503  7.420  -146.819 1.00 46.82  ? 347 ARG A CB    1 
ATOM   1361  C  CG    . ARG E 3 51  ? 22.042  7.286  -147.194 1.00 48.02  ? 347 ARG A CG    1 
ATOM   1362  C  CD    . ARG E 3 51  ? 21.567  5.846  -147.102 1.00 48.71  ? 347 ARG A CD    1 
ATOM   1363  N  NE    . ARG E 3 51  ? 20.151  5.730  -147.431 1.00 49.49  ? 347 ARG A NE    1 
ATOM   1364  C  CZ    . ARG E 3 51  ? 19.656  5.868  -148.658 1.00 50.34  ? 347 ARG A CZ    1 
ATOM   1365  N  NH1   . ARG E 3 51  ? 20.465  6.121  -149.678 1.00 50.82  ? 347 ARG A NH1   1 
ATOM   1366  N  NH2   . ARG E 3 51  ? 18.350  5.763  -148.867 1.00 50.53  ? 347 ARG A NH2   1 
ATOM   1367  N  N     . PRO E 3 52  ? 25.844  8.903  -144.856 1.00 47.15  ? 348 PRO A N     1 
ATOM   1368  C  CA    . PRO E 3 52  ? 27.266  8.937  -144.491 1.00 47.34  ? 348 PRO A CA    1 
ATOM   1369  C  C     . PRO E 3 52  ? 28.085  7.895  -145.248 1.00 47.72  ? 348 PRO A C     1 
ATOM   1370  O  O     . PRO E 3 52  ? 29.064  8.231  -145.923 1.00 47.42  ? 348 PRO A O     1 
ATOM   1371  C  CB    . PRO E 3 52  ? 27.241  8.668  -142.991 1.00 47.37  ? 348 PRO A CB    1 
ATOM   1372  C  CG    . PRO E 3 52  ? 25.967  9.306  -142.566 1.00 47.43  ? 348 PRO A CG    1 
ATOM   1373  C  CD    . PRO E 3 52  ? 24.997  8.874  -143.649 1.00 47.26  ? 348 PRO A CD    1 
ATOM   1374  N  N     . GLU E 3 53  ? 27.676  6.634  -145.125 1.00 47.99  ? 349 GLU A N     1 
ATOM   1375  C  CA    . GLU E 3 53  ? 28.347  5.523  -145.793 1.00 48.08  ? 349 GLU A CA    1 
ATOM   1376  C  C     . GLU E 3 53  ? 28.711  5.899  -147.220 1.00 47.78  ? 349 GLU A C     1 
ATOM   1377  O  O     . GLU E 3 53  ? 29.792  5.570  -147.706 1.00 47.87  ? 349 GLU A O     1 
ATOM   1378  C  CB    . GLU E 3 53  ? 27.438  4.290  -145.845 1.00 49.00  ? 349 GLU A CB    1 
ATOM   1379  C  CG    . GLU E 3 53  ? 27.145  3.624  -144.513 1.00 50.36  ? 349 GLU A CG    1 
ATOM   1380  C  CD    . GLU E 3 53  ? 26.359  4.511  -143.566 1.00 51.52  ? 349 GLU A CD    1 
ATOM   1381  O  OE1   . GLU E 3 53  ? 25.365  5.122  -144.018 1.00 51.33  ? 349 GLU A OE1   1 
ATOM   1382  O  OE2   . GLU E 3 53  ? 26.734  4.584  -142.368 1.00 51.64  ? 349 GLU A OE2   1 
ATOM   1383  N  N     . THR E 3 54  ? 27.796  6.597  -147.884 1.00 47.27  ? 350 THR A N     1 
ATOM   1384  C  CA    . THR E 3 54  ? 27.986  7.009  -149.266 1.00 46.73  ? 350 THR A CA    1 
ATOM   1385  C  C     . THR E 3 54  ? 28.910  8.217  -149.443 1.00 46.71  ? 350 THR A C     1 
ATOM   1386  O  O     . THR E 3 54  ? 30.074  8.074  -149.828 1.00 46.67  ? 350 THR A O     1 
ATOM   1387  C  CB    . THR E 3 54  ? 26.625  7.332  -149.921 1.00 46.48  ? 350 THR A CB    1 
ATOM   1388  O  OG1   . THR E 3 54  ? 25.730  6.230  -149.729 1.00 46.05  ? 350 THR A OG1   1 
ATOM   1389  C  CG2   . THR E 3 54  ? 26.793  7.582  -151.410 1.00 45.55  ? 350 THR A CG2   1 
ATOM   1390  N  N     . ALA E 3 55  ? 28.374  9.401  -149.159 1.00 46.49  ? 351 ALA A N     1 
ATOM   1391  C  CA    . ALA E 3 55  ? 29.096  10.665 -149.302 1.00 46.19  ? 351 ALA A CA    1 
ATOM   1392  C  C     . ALA E 3 55  ? 30.533  10.719 -148.769 1.00 46.09  ? 351 ALA A C     1 
ATOM   1393  O  O     . ALA E 3 55  ? 31.372  11.436 -149.320 1.00 45.45  ? 351 ALA A O     1 
ATOM   1394  C  CB    . ALA E 3 55  ? 28.279  11.784 -148.673 1.00 45.97  ? 351 ALA A CB    1 
ATOM   1395  N  N     . LEU E 3 56  ? 30.826  9.967  -147.713 1.00 46.20  ? 352 LEU A N     1 
ATOM   1396  C  CA    . LEU E 3 56  ? 32.164  9.999  -147.124 1.00 46.68  ? 352 LEU A CA    1 
ATOM   1397  C  C     . LEU E 3 56  ? 33.182  9.088  -147.808 1.00 47.49  ? 352 LEU A C     1 
ATOM   1398  O  O     . LEU E 3 56  ? 34.246  8.792  -147.258 1.00 47.42  ? 352 LEU A O     1 
ATOM   1399  C  CB    . LEU E 3 56  ? 32.079  9.685  -145.627 1.00 45.63  ? 352 LEU A CB    1 
ATOM   1400  C  CG    . LEU E 3 56  ? 31.173  10.648 -144.847 1.00 45.28  ? 352 LEU A CG    1 
ATOM   1401  C  CD1   . LEU E 3 56  ? 31.204  10.300 -143.374 1.00 44.92  ? 352 LEU A CD1   1 
ATOM   1402  C  CD2   . LEU E 3 56  ? 31.628  12.088 -145.060 1.00 44.52  ? 352 LEU A CD2   1 
ATOM   1403  N  N     . ALA E 3 57  ? 32.840  8.651  -149.015 1.00 48.45  ? 353 ALA A N     1 
ATOM   1404  C  CA    . ALA E 3 57  ? 33.709  7.798  -149.821 1.00 48.69  ? 353 ALA A CA    1 
ATOM   1405  C  C     . ALA E 3 57  ? 33.911  8.545  -151.134 1.00 48.90  ? 353 ALA A C     1 
ATOM   1406  O  O     . ALA E 3 57  ? 34.953  8.439  -151.781 1.00 49.09  ? 353 ALA A O     1 
ATOM   1407  C  CB    . ALA E 3 57  ? 33.042  6.452  -150.076 1.00 48.62  ? 353 ALA A CB    1 
ATOM   1408  N  N     . ASP E 3 58  ? 32.892  9.316  -151.503 1.00 49.11  ? 354 ASP A N     1 
ATOM   1409  C  CA    . ASP E 3 58  ? 32.892  10.113 -152.722 1.00 48.96  ? 354 ASP A CA    1 
ATOM   1410  C  C     . ASP E 3 58  ? 33.964  11.202 -152.640 1.00 48.62  ? 354 ASP A C     1 
ATOM   1411  O  O     . ASP E 3 58  ? 33.806  12.192 -151.920 1.00 48.27  ? 354 ASP A O     1 
ATOM   1412  C  CB    . ASP E 3 58  ? 31.504  10.741 -152.909 1.00 49.92  ? 354 ASP A CB    1 
ATOM   1413  C  CG    . ASP E 3 58  ? 31.336  11.410 -154.259 1.00 50.69  ? 354 ASP A CG    1 
ATOM   1414  O  OD1   . ASP E 3 58  ? 31.967  12.462 -154.500 1.00 50.91  ? 354 ASP A OD1   1 
ATOM   1415  O  OD2   . ASP E 3 58  ? 30.566  10.872 -155.083 1.00 51.77  ? 354 ASP A OD2   1 
ATOM   1416  N  N     . PRO E 3 59  ? 35.072  11.032 -153.387 1.00 48.09  ? 355 PRO A N     1 
ATOM   1417  C  CA    . PRO E 3 59  ? 36.170  12.004 -153.392 1.00 47.48  ? 355 PRO A CA    1 
ATOM   1418  C  C     . PRO E 3 59  ? 35.744  13.398 -153.844 1.00 47.17  ? 355 PRO A C     1 
ATOM   1419  O  O     . PRO E 3 59  ? 36.380  14.396 -153.489 1.00 47.21  ? 355 PRO A O     1 
ATOM   1420  C  CB    . PRO E 3 59  ? 37.187  11.366 -154.334 1.00 47.65  ? 355 PRO A CB    1 
ATOM   1421  C  CG    . PRO E 3 59  ? 36.311  10.612 -155.301 1.00 48.10  ? 355 PRO A CG    1 
ATOM   1422  C  CD    . PRO E 3 59  ? 35.308  9.968  -154.380 1.00 47.74  ? 355 PRO A CD    1 
ATOM   1423  N  N     . GLN E 3 60  ? 34.677  13.467 -154.635 1.00 46.23  ? 356 GLN A N     1 
ATOM   1424  C  CA    . GLN E 3 60  ? 34.184  14.756 -155.098 1.00 45.54  ? 356 GLN A CA    1 
ATOM   1425  C  C     . GLN E 3 60  ? 33.474  15.471 -153.954 1.00 44.67  ? 356 GLN A C     1 
ATOM   1426  O  O     . GLN E 3 60  ? 33.473  16.701 -153.896 1.00 45.06  ? 356 GLN A O     1 
ATOM   1427  C  CB    . GLN E 3 60  ? 33.239  14.584 -156.293 1.00 45.87  ? 356 GLN A CB    1 
ATOM   1428  C  CG    . GLN E 3 60  ? 33.912  14.775 -157.656 1.00 46.18  ? 356 GLN A CG    1 
ATOM   1429  C  CD    . GLN E 3 60  ? 35.208  13.992 -157.789 1.00 46.42  ? 356 GLN A CD    1 
ATOM   1430  O  OE1   . GLN E 3 60  ? 35.236  12.781 -157.585 1.00 47.25  ? 356 GLN A OE1   1 
ATOM   1431  N  NE2   . GLN E 3 60  ? 36.287  14.684 -158.131 1.00 46.63  ? 356 GLN A NE2   1 
ATOM   1432  N  N     . PHE E 3 61  ? 32.872  14.706 -153.045 1.00 43.34  ? 357 PHE A N     1 
ATOM   1433  C  CA    . PHE E 3 61  ? 32.194  15.306 -151.899 1.00 42.22  ? 357 PHE A CA    1 
ATOM   1434  C  C     . PHE E 3 61  ? 33.232  15.626 -150.832 1.00 41.55  ? 357 PHE A C     1 
ATOM   1435  O  O     . PHE E 3 61  ? 33.168  16.665 -150.172 1.00 41.02  ? 357 PHE A O     1 
ATOM   1436  C  CB    . PHE E 3 61  ? 31.152  14.361 -151.305 1.00 41.90  ? 357 PHE A CB    1 
ATOM   1437  C  CG    . PHE E 3 61  ? 30.366  14.966 -150.163 1.00 41.58  ? 357 PHE A CG    1 
ATOM   1438  C  CD1   . PHE E 3 61  ? 29.482  16.021 -150.391 1.00 41.13  ? 357 PHE A CD1   1 
ATOM   1439  C  CD2   . PHE E 3 61  ? 30.515  14.487 -148.863 1.00 41.31  ? 357 PHE A CD2   1 
ATOM   1440  C  CE1   . PHE E 3 61  ? 28.752  16.591 -149.343 1.00 41.08  ? 357 PHE A CE1   1 
ATOM   1441  C  CE2   . PHE E 3 61  ? 29.790  15.050 -147.808 1.00 41.39  ? 357 PHE A CE2   1 
ATOM   1442  C  CZ    . PHE E 3 61  ? 28.905  16.107 -148.053 1.00 40.88  ? 357 PHE A CZ    1 
ATOM   1443  N  N     . VAL E 3 62  ? 34.184  14.712 -150.661 1.00 41.09  ? 358 VAL A N     1 
ATOM   1444  C  CA    . VAL E 3 62  ? 35.253  14.895 -149.692 1.00 39.92  ? 358 VAL A CA    1 
ATOM   1445  C  C     . VAL E 3 62  ? 36.110  16.095 -150.098 1.00 39.18  ? 358 VAL A C     1 
ATOM   1446  O  O     . VAL E 3 62  ? 36.717  16.749 -149.252 1.00 38.99  ? 358 VAL A O     1 
ATOM   1447  C  CB    . VAL E 3 62  ? 36.148  13.639 -149.615 1.00 40.49  ? 358 VAL A CB    1 
ATOM   1448  C  CG1   . VAL E 3 62  ? 37.274  13.857 -148.610 1.00 40.23  ? 358 VAL A CG1   1 
ATOM   1449  C  CG2   . VAL E 3 62  ? 35.308  12.431 -149.225 1.00 40.79  ? 358 VAL A CG2   1 
ATOM   1450  N  N     . ALA E 3 63  ? 36.152  16.389 -151.394 1.00 38.10  ? 359 ALA A N     1 
ATOM   1451  C  CA    . ALA E 3 63  ? 36.948  17.516 -151.881 1.00 37.07  ? 359 ALA A CA    1 
ATOM   1452  C  C     . ALA E 3 63  ? 36.239  18.846 -151.634 1.00 36.15  ? 359 ALA A C     1 
ATOM   1453  O  O     . ALA E 3 63  ? 36.832  19.789 -151.100 1.00 35.81  ? 359 ALA A O     1 
ATOM   1454  C  CB    . ALA E 3 63  ? 37.245  17.346 -153.363 1.00 36.65  ? 359 ALA A CB    1 
ATOM   1455  N  N     . TRP E 3 64  ? 34.978  18.917 -152.043 1.00 35.47  ? 360 TRP A N     1 
ATOM   1456  C  CA    . TRP E 3 64  ? 34.157  20.111 -151.853 1.00 35.06  ? 360 TRP A CA    1 
ATOM   1457  C  C     . TRP E 3 64  ? 34.260  20.503 -150.371 1.00 35.41  ? 360 TRP A C     1 
ATOM   1458  O  O     . TRP E 3 64  ? 34.332  21.695 -150.024 1.00 34.65  ? 360 TRP A O     1 
ATOM   1459  C  CB    . TRP E 3 64  ? 32.709  19.787 -152.231 1.00 35.14  ? 360 TRP A CB    1 
ATOM   1460  C  CG    . TRP E 3 64  ? 31.735  20.886 -151.999 1.00 34.84  ? 360 TRP A CG    1 
ATOM   1461  C  CD1   . TRP E 3 64  ? 31.623  22.050 -152.699 1.00 35.03  ? 360 TRP A CD1   1 
ATOM   1462  C  CD2   . TRP E 3 64  ? 30.742  20.939 -150.968 1.00 34.20  ? 360 TRP A CD2   1 
ATOM   1463  N  NE1   . TRP E 3 64  ? 30.621  22.834 -152.164 1.00 33.97  ? 360 TRP A NE1   1 
ATOM   1464  C  CE2   . TRP E 3 64  ? 30.066  22.173 -151.101 1.00 34.25  ? 360 TRP A CE2   1 
ATOM   1465  C  CE3   . TRP E 3 64  ? 30.360  20.065 -149.943 1.00 34.63  ? 360 TRP A CE3   1 
ATOM   1466  C  CZ2   . TRP E 3 64  ? 29.030  22.555 -150.245 1.00 34.15  ? 360 TRP A CZ2   1 
ATOM   1467  C  CZ3   . TRP E 3 64  ? 29.328  20.445 -149.091 1.00 34.67  ? 360 TRP A CZ3   1 
ATOM   1468  C  CH2   . TRP E 3 64  ? 28.677  21.681 -149.251 1.00 34.01  ? 360 TRP A CH2   1 
ATOM   1469  N  N     . LEU E 3 65  ? 34.284  19.483 -149.514 1.00 34.99  ? 361 LEU A N     1 
ATOM   1470  C  CA    . LEU E 3 65  ? 34.401  19.670 -148.074 1.00 36.42  ? 361 LEU A CA    1 
ATOM   1471  C  C     . LEU E 3 65  ? 35.704  20.331 -147.695 1.00 37.52  ? 361 LEU A C     1 
ATOM   1472  O  O     . LEU E 3 65  ? 35.716  21.470 -147.231 1.00 38.16  ? 361 LEU A O     1 
ATOM   1473  C  CB    . LEU E 3 65  ? 34.332  18.337 -147.336 1.00 35.07  ? 361 LEU A CB    1 
ATOM   1474  C  CG    . LEU E 3 65  ? 32.964  17.687 -147.150 1.00 35.27  ? 361 LEU A CG    1 
ATOM   1475  C  CD1   . LEU E 3 65  ? 33.089  16.535 -146.155 1.00 33.32  ? 361 LEU A CD1   1 
ATOM   1476  C  CD2   . LEU E 3 65  ? 31.969  18.721 -146.647 1.00 34.39  ? 361 LEU A CD2   1 
ATOM   1477  N  N     . GLY E 3 66  ? 36.799  19.597 -147.888 1.00 38.62  ? 362 GLY A N     1 
ATOM   1478  C  CA    . GLY E 3 66  ? 38.118  20.097 -147.540 1.00 39.52  ? 362 GLY A CA    1 
ATOM   1479  C  C     . GLY E 3 66  ? 38.516  21.357 -148.269 1.00 39.75  ? 362 GLY A C     1 
ATOM   1480  O  O     . GLY E 3 66  ? 39.509  21.991 -147.923 1.00 40.46  ? 362 GLY A O     1 
ATOM   1481  N  N     . ASP E 3 67  ? 37.733  21.714 -149.278 1.00 40.53  ? 363 ASP A N     1 
ATOM   1482  C  CA    . ASP E 3 67  ? 37.971  22.899 -150.096 1.00 40.96  ? 363 ASP A CA    1 
ATOM   1483  C  C     . ASP E 3 67  ? 37.461  24.126 -149.352 1.00 41.54  ? 363 ASP A C     1 
ATOM   1484  O  O     . ASP E 3 67  ? 36.254  24.280 -149.164 1.00 41.00  ? 363 ASP A O     1 
ATOM   1485  C  CB    . ASP E 3 67  ? 37.224  22.746 -151.427 1.00 41.25  ? 363 ASP A CB    1 
ATOM   1486  C  CG    . ASP E 3 67  ? 37.538  23.853 -152.417 1.00 41.37  ? 363 ASP A CG    1 
ATOM   1487  O  OD1   . ASP E 3 67  ? 37.996  24.936 -151.996 1.00 41.06  ? 363 ASP A OD1   1 
ATOM   1488  O  OD2   . ASP E 3 67  ? 37.310  23.635 -153.628 1.00 42.25  ? 363 ASP A OD2   1 
ATOM   1489  N  N     . GLU E 3 68  ? 38.373  24.996 -148.925 1.00 42.34  ? 364 GLU A N     1 
ATOM   1490  C  CA    . GLU E 3 68  ? 37.975  26.192 -148.188 1.00 43.05  ? 364 GLU A CA    1 
ATOM   1491  C  C     . GLU E 3 68  ? 37.278  27.248 -149.049 1.00 42.74  ? 364 GLU A C     1 
ATOM   1492  O  O     . GLU E 3 68  ? 36.702  28.196 -148.510 1.00 42.82  ? 364 GLU A O     1 
ATOM   1493  C  CB    . GLU E 3 68  ? 39.178  26.810 -147.460 1.00 44.29  ? 364 GLU A CB    1 
ATOM   1494  C  CG    . GLU E 3 68  ? 38.828  28.049 -146.621 1.00 46.01  ? 364 GLU A CG    1 
ATOM   1495  C  CD    . GLU E 3 68  ? 39.672  28.184 -145.354 1.00 47.00  ? 364 GLU A CD    1 
ATOM   1496  O  OE1   . GLU E 3 68  ? 40.915  28.270 -145.465 1.00 47.87  ? 364 GLU A OE1   1 
ATOM   1497  O  OE2   . GLU E 3 68  ? 39.085  28.207 -144.244 1.00 47.20  ? 364 GLU A OE2   1 
ATOM   1498  N  N     . THR E 3 69  ? 37.326  27.099 -150.372 1.00 41.88  ? 365 THR A N     1 
ATOM   1499  C  CA    . THR E 3 69  ? 36.646  28.059 -151.247 1.00 41.26  ? 365 THR A CA    1 
ATOM   1500  C  C     . THR E 3 69  ? 35.194  27.644 -151.449 1.00 40.34  ? 365 THR A C     1 
ATOM   1501  O  O     . THR E 3 69  ? 34.400  28.389 -152.013 1.00 40.72  ? 365 THR A O     1 
ATOM   1502  C  CB    . THR E 3 69  ? 37.338  28.212 -152.633 1.00 40.90  ? 365 THR A CB    1 
ATOM   1503  O  OG1   . THR E 3 69  ? 37.657  26.924 -153.161 1.00 42.68  ? 365 THR A OG1   1 
ATOM   1504  C  CG2   . THR E 3 69  ? 38.607  29.038 -152.510 1.00 40.33  ? 365 THR A CG2   1 
ATOM   1505  N  N     . LYS E 3 70  ? 34.853  26.444 -150.996 1.00 39.68  ? 366 LYS A N     1 
ATOM   1506  C  CA    . LYS E 3 70  ? 33.477  25.964 -151.085 1.00 39.31  ? 366 LYS A CA    1 
ATOM   1507  C  C     . LYS E 3 70  ? 32.879  26.287 -149.713 1.00 39.10  ? 366 LYS A C     1 
ATOM   1508  O  O     . LYS E 3 70  ? 33.201  25.628 -148.722 1.00 39.02  ? 366 LYS A O     1 
ATOM   1509  C  CB    . LYS E 3 70  ? 33.460  24.458 -151.341 1.00 38.96  ? 366 LYS A CB    1 
ATOM   1510  C  CG    . LYS E 3 70  ? 34.106  24.062 -152.668 1.00 39.10  ? 366 LYS A CG    1 
ATOM   1511  C  CD    . LYS E 3 70  ? 33.277  24.530 -153.854 1.00 38.73  ? 366 LYS A CD    1 
ATOM   1512  C  CE    . LYS E 3 70  ? 33.946  24.192 -155.185 1.00 39.35  ? 366 LYS A CE    1 
ATOM   1513  N  NZ    . LYS E 3 70  ? 35.225  24.936 -155.366 1.00 40.16  ? 366 LYS A NZ    1 
ATOM   1514  N  N     . LYS E 3 71  ? 32.020  27.302 -149.661 1.00 38.00  ? 367 LYS A N     1 
ATOM   1515  C  CA    . LYS E 3 71  ? 31.426  27.753 -148.403 1.00 37.94  ? 367 LYS A CA    1 
ATOM   1516  C  C     . LYS E 3 71  ? 30.338  26.893 -147.768 1.00 37.34  ? 367 LYS A C     1 
ATOM   1517  O  O     . LYS E 3 71  ? 29.446  26.389 -148.449 1.00 37.09  ? 367 LYS A O     1 
ATOM   1518  C  CB    . LYS E 3 71  ? 30.879  29.178 -148.568 1.00 38.54  ? 367 LYS A CB    1 
ATOM   1519  C  CG    . LYS E 3 71  ? 31.880  30.181 -149.118 1.00 38.57  ? 367 LYS A CG    1 
ATOM   1520  C  CD    . LYS E 3 71  ? 33.141  30.176 -148.314 1.00 40.18  ? 367 LYS A CD    1 
ATOM   1521  C  CE    . LYS E 3 71  ? 34.095  31.252 -148.780 1.00 40.93  ? 367 LYS A CE    1 
ATOM   1522  N  NZ    . LYS E 3 71  ? 35.286  31.270 -147.887 1.00 42.46  ? 367 LYS A NZ    1 
ATOM   1523  N  N     . LYS E 3 72  ? 30.424  26.740 -146.446 1.00 36.96  ? 368 LYS A N     1 
ATOM   1524  C  CA    . LYS E 3 72  ? 29.435  25.985 -145.695 1.00 36.20  ? 368 LYS A CA    1 
ATOM   1525  C  C     . LYS E 3 72  ? 28.922  26.797 -144.519 1.00 35.68  ? 368 LYS A C     1 
ATOM   1526  O  O     . LYS E 3 72  ? 29.696  27.424 -143.782 1.00 36.07  ? 368 LYS A O     1 
ATOM   1527  C  CB    . LYS E 3 72  ? 30.005  24.667 -145.167 1.00 36.67  ? 368 LYS A CB    1 
ATOM   1528  C  CG    . LYS E 3 72  ? 30.491  23.709 -146.240 1.00 38.38  ? 368 LYS A CG    1 
ATOM   1529  C  CD    . LYS E 3 72  ? 31.933  24.003 -146.635 1.00 37.69  ? 368 LYS A CD    1 
ATOM   1530  C  CE    . LYS E 3 72  ? 32.464  22.922 -147.576 1.00 38.14  ? 368 LYS A CE    1 
ATOM   1531  N  NZ    . LYS E 3 72  ? 33.889  23.154 -147.951 1.00 37.21  ? 368 LYS A NZ    1 
ATOM   1532  N  N     . SER E 3 73  ? 27.601  26.792 -144.369 1.00 34.99  ? 369 SER A N     1 
ATOM   1533  C  CA    . SER E 3 73  ? 26.916  27.484 -143.286 1.00 33.50  ? 369 SER A CA    1 
ATOM   1534  C  C     . SER E 3 73  ? 26.503  26.340 -142.379 1.00 32.23  ? 369 SER A C     1 
ATOM   1535  O  O     . SER E 3 73  ? 25.941  25.344 -142.859 1.00 30.64  ? 369 SER A O     1 
ATOM   1536  C  CB    . SER E 3 73  ? 25.688  28.210 -143.828 1.00 34.33  ? 369 SER A CB    1 
ATOM   1537  O  OG    . SER E 3 73  ? 25.295  29.243 -142.948 1.00 35.99  ? 369 SER A OG    1 
ATOM   1538  N  N     . MET E 3 74  ? 26.782  26.459 -141.082 1.00 30.95  ? 370 MET A N     1 
ATOM   1539  C  CA    . MET E 3 74  ? 26.470  25.367 -140.157 1.00 30.38  ? 370 MET A CA    1 
ATOM   1540  C  C     . MET E 3 74  ? 26.105  25.771 -138.716 1.00 30.52  ? 370 MET A C     1 
ATOM   1541  O  O     . MET E 3 74  ? 26.051  26.957 -138.367 1.00 30.21  ? 370 MET A O     1 
ATOM   1542  C  CB    . MET E 3 74  ? 27.677  24.417 -140.082 1.00 29.39  ? 370 MET A CB    1 
ATOM   1543  C  CG    . MET E 3 74  ? 28.217  23.927 -141.419 1.00 28.93  ? 370 MET A CG    1 
ATOM   1544  S  SD    . MET E 3 74  ? 29.820  23.044 -141.265 1.00 28.03  ? 370 MET A SD    1 
ATOM   1545  C  CE    . MET E 3 74  ? 29.348  21.489 -140.614 1.00 25.03  ? 370 MET A CE    1 
ATOM   1546  N  N     . PHE E 3 75  ? 25.861  24.748 -137.895 1.00 30.57  ? 371 PHE A N     1 
ATOM   1547  C  CA    . PHE E 3 75  ? 25.555  24.899 -136.472 1.00 31.12  ? 371 PHE A CA    1 
ATOM   1548  C  C     . PHE E 3 75  ? 26.489  23.943 -135.737 1.00 31.63  ? 371 PHE A C     1 
ATOM   1549  O  O     . PHE E 3 75  ? 26.425  22.733 -135.945 1.00 31.70  ? 371 PHE A O     1 
ATOM   1550  C  CB    . PHE E 3 75  ? 24.109  24.506 -136.160 1.00 30.68  ? 371 PHE A CB    1 
ATOM   1551  C  CG    . PHE E 3 75  ? 23.785  24.501 -134.690 1.00 30.17  ? 371 PHE A CG    1 
ATOM   1552  C  CD1   . PHE E 3 75  ? 23.245  25.629 -134.076 1.00 30.42  ? 371 PHE A CD1   1 
ATOM   1553  C  CD2   . PHE E 3 75  ? 24.007  23.360 -133.918 1.00 30.80  ? 371 PHE A CD2   1 
ATOM   1554  C  CE1   . PHE E 3 75  ? 22.923  25.622 -132.714 1.00 28.98  ? 371 PHE A CE1   1 
ATOM   1555  C  CE2   . PHE E 3 75  ? 23.689  23.343 -132.548 1.00 30.55  ? 371 PHE A CE2   1 
ATOM   1556  C  CZ    . PHE E 3 75  ? 23.145  24.477 -131.952 1.00 30.49  ? 371 PHE A CZ    1 
ATOM   1557  N  N     . ASP E 3 76  ? 27.336  24.487 -134.867 1.00 32.05  ? 372 ASP A N     1 
ATOM   1558  C  CA    . ASP E 3 76  ? 28.309  23.684 -134.122 1.00 32.64  ? 372 ASP A CA    1 
ATOM   1559  C  C     . ASP E 3 76  ? 29.211  22.959 -135.127 1.00 32.18  ? 372 ASP A C     1 
ATOM   1560  O  O     . ASP E 3 76  ? 29.172  21.729 -135.257 1.00 32.21  ? 372 ASP A O     1 
ATOM   1561  C  CB    . ASP E 3 76  ? 27.619  22.656 -133.228 1.00 32.62  ? 372 ASP A CB    1 
ATOM   1562  C  CG    . ASP E 3 76  ? 28.553  22.090 -132.171 1.00 32.86  ? 372 ASP A CG    1 
ATOM   1563  O  OD1   . ASP E 3 76  ? 29.786  22.213 -132.353 1.00 33.28  ? 372 ASP A OD1   1 
ATOM   1564  O  OD2   . ASP E 3 76  ? 28.064  21.518 -131.166 1.00 31.92  ? 372 ASP A OD2   1 
ATOM   1565  N  N     . SER E 3 77  ? 30.014  23.736 -135.842 1.00 31.53  ? 373 SER A N     1 
ATOM   1566  C  CA    . SER E 3 77  ? 30.915  23.185 -136.849 1.00 31.07  ? 373 SER A CA    1 
ATOM   1567  C  C     . SER E 3 77  ? 32.043  22.339 -136.241 1.00 30.70  ? 373 SER A C     1 
ATOM   1568  O  O     . SER E 3 77  ? 32.532  21.397 -136.868 1.00 31.63  ? 373 SER A O     1 
ATOM   1569  C  CB    . SER E 3 77  ? 31.485  24.324 -137.677 1.00 29.80  ? 373 SER A CB    1 
ATOM   1570  O  OG    . SER E 3 77  ? 32.086  25.277 -136.824 1.00 31.15  ? 373 SER A OG    1 
ATOM   1571  N  N     . LYS E 3 78  ? 32.446  22.660 -135.014 1.00 30.44  ? 374 LYS A N     1 
ATOM   1572  C  CA    . LYS E 3 78  ? 33.507  21.914 -134.346 1.00 29.02  ? 374 LYS A CA    1 
ATOM   1573  C  C     . LYS E 3 78  ? 33.030  20.494 -134.055 1.00 28.99  ? 374 LYS A C     1 
ATOM   1574  O  O     . LYS E 3 78  ? 33.791  19.523 -134.123 1.00 28.71  ? 374 LYS A O     1 
ATOM   1575  C  CB    . LYS E 3 78  ? 33.901  22.620 -133.042 1.00 28.04  ? 374 LYS A CB    1 
ATOM   1576  C  CG    . LYS E 3 78  ? 34.940  21.871 -132.211 1.00 26.47  ? 374 LYS A CG    1 
ATOM   1577  C  CD    . LYS E 3 78  ? 35.682  22.815 -131.267 1.00 23.91  ? 374 LYS A CD    1 
ATOM   1578  C  CE    . LYS E 3 78  ? 34.813  23.279 -130.100 1.00 22.33  ? 374 LYS A CE    1 
ATOM   1579  N  NZ    . LYS E 3 78  ? 34.287  22.151 -129.284 1.00 21.31  ? 374 LYS A NZ    1 
ATOM   1580  N  N     . ARG E 3 79  ? 31.756  20.372 -133.721 1.00 28.13  ? 375 ARG A N     1 
ATOM   1581  C  CA    . ARG E 3 79  ? 31.188  19.070 -133.426 1.00 27.77  ? 375 ARG A CA    1 
ATOM   1582  C  C     . ARG E 3 79  ? 31.395  18.135 -134.609 1.00 27.02  ? 375 ARG A C     1 
ATOM   1583  O  O     . ARG E 3 79  ? 31.816  16.985 -134.449 1.00 27.53  ? 375 ARG A O     1 
ATOM   1584  C  CB    . ARG E 3 79  ? 29.688  19.218 -133.112 1.00 26.51  ? 375 ARG A CB    1 
ATOM   1585  C  CG    . ARG E 3 79  ? 28.882  17.949 -133.295 1.00 26.51  ? 375 ARG A CG    1 
ATOM   1586  C  CD    . ARG E 3 79  ? 27.492  18.110 -132.660 1.00 24.73  ? 375 ARG A CD    1 
ATOM   1587  N  NE    . ARG E 3 79  ? 27.600  18.450 -131.244 1.00 23.19  ? 375 ARG A NE    1 
ATOM   1588  C  CZ    . ARG E 3 79  ? 27.733  17.564 -130.269 1.00 23.44  ? 375 ARG A CZ    1 
ATOM   1589  N  NH1   . ARG E 3 79  ? 27.765  16.267 -130.544 1.00 23.62  ? 375 ARG A NH1   1 
ATOM   1590  N  NH2   . ARG E 3 79  ? 27.847  17.978 -129.017 1.00 25.16  ? 375 ARG A NH2   1 
ATOM   1591  N  N     . ALA E 3 80  ? 31.105  18.640 -135.798 1.00 27.41  ? 376 ALA A N     1 
ATOM   1592  C  CA    . ALA E 3 80  ? 31.256  17.867 -137.020 1.00 27.83  ? 376 ALA A CA    1 
ATOM   1593  C  C     . ALA E 3 80  ? 32.728  17.744 -137.402 1.00 28.73  ? 376 ALA A C     1 
ATOM   1594  O  O     . ALA E 3 80  ? 33.203  16.648 -137.694 1.00 27.97  ? 376 ALA A O     1 
ATOM   1595  C  CB    . ALA E 3 80  ? 30.493  18.527 -138.146 1.00 28.66  ? 376 ALA A CB    1 
ATOM   1596  N  N     . ALA E 3 81  ? 33.438  18.876 -137.387 1.00 28.68  ? 377 ALA A N     1 
ATOM   1597  C  CA    . ALA E 3 81  ? 34.859  18.920 -137.747 1.00 28.84  ? 377 ALA A CA    1 
ATOM   1598  C  C     . ALA E 3 81  ? 35.674  17.851 -137.037 1.00 29.10  ? 377 ALA A C     1 
ATOM   1599  O  O     . ALA E 3 81  ? 36.410  17.104 -137.681 1.00 30.59  ? 377 ALA A O     1 
ATOM   1600  C  CB    . ALA E 3 81  ? 35.440  20.301 -137.435 1.00 28.20  ? 377 ALA A CB    1 
ATOM   1601  N  N     . VAL E 3 82  ? 35.552  17.791 -135.713 1.00 29.30  ? 378 VAL A N     1 
ATOM   1602  C  CA    . VAL E 3 82  ? 36.273  16.808 -134.914 1.00 29.96  ? 378 VAL A CA    1 
ATOM   1603  C  C     . VAL E 3 82  ? 35.816  15.380 -135.230 1.00 30.77  ? 378 VAL A C     1 
ATOM   1604  O  O     . VAL E 3 82  ? 36.636  14.479 -135.306 1.00 32.06  ? 378 VAL A O     1 
ATOM   1605  C  CB    . VAL E 3 82  ? 36.119  17.105 -133.389 1.00 29.72  ? 378 VAL A CB    1 
ATOM   1606  C  CG1   . VAL E 3 82  ? 36.737  15.987 -132.548 1.00 27.67  ? 378 VAL A CG1   1 
ATOM   1607  C  CG2   . VAL E 3 82  ? 36.792  18.434 -133.053 1.00 30.39  ? 378 VAL A CG2   1 
ATOM   1608  N  N     . ALA E 3 83  ? 34.517  15.171 -135.423 1.00 31.94  ? 379 ALA A N     1 
ATOM   1609  C  CA    . ALA E 3 83  ? 34.001  13.837 -135.738 1.00 32.58  ? 379 ALA A CA    1 
ATOM   1610  C  C     . ALA E 3 83  ? 34.603  13.334 -137.046 1.00 33.38  ? 379 ALA A C     1 
ATOM   1611  O  O     . ALA E 3 83  ? 34.971  12.162 -137.168 1.00 33.50  ? 379 ALA A O     1 
ATOM   1612  C  CB    . ALA E 3 83  ? 32.483  13.869 -135.847 1.00 31.96  ? 379 ALA A CB    1 
ATOM   1613  N  N     . LEU E 3 84  ? 34.680  14.227 -138.026 1.00 34.08  ? 380 LEU A N     1 
ATOM   1614  C  CA    . LEU E 3 84  ? 35.244  13.905 -139.327 1.00 34.38  ? 380 LEU A CA    1 
ATOM   1615  C  C     . LEU E 3 84  ? 36.747  13.673 -139.214 1.00 34.56  ? 380 LEU A C     1 
ATOM   1616  O  O     . LEU E 3 84  ? 37.282  12.762 -139.851 1.00 34.63  ? 380 LEU A O     1 
ATOM   1617  C  CB    . LEU E 3 84  ? 34.981  15.040 -140.315 1.00 34.86  ? 380 LEU A CB    1 
ATOM   1618  C  CG    . LEU E 3 84  ? 33.621  15.088 -141.016 1.00 35.87  ? 380 LEU A CG    1 
ATOM   1619  C  CD1   . LEU E 3 84  ? 32.497  14.819 -140.032 1.00 36.48  ? 380 LEU A CD1   1 
ATOM   1620  C  CD2   . LEU E 3 84  ? 33.446  16.461 -141.663 1.00 36.71  ? 380 LEU A CD2   1 
ATOM   1621  N  N     . LYS E 3 85  ? 37.419  14.502 -138.410 1.00 34.20  ? 381 LYS A N     1 
ATOM   1622  C  CA    . LYS E 3 85  ? 38.858  14.387 -138.221 1.00 33.92  ? 381 LYS A CA    1 
ATOM   1623  C  C     . LYS E 3 85  ? 39.177  12.942 -137.915 1.00 33.91  ? 381 LYS A C     1 
ATOM   1624  O  O     . LYS E 3 85  ? 40.055  12.349 -138.534 1.00 33.93  ? 381 LYS A O     1 
ATOM   1625  C  CB    . LYS E 3 85  ? 39.341  15.260 -137.058 1.00 33.87  ? 381 LYS A CB    1 
ATOM   1626  C  CG    . LYS E 3 85  ? 39.710  16.695 -137.403 1.00 33.13  ? 381 LYS A CG    1 
ATOM   1627  C  CD    . LYS E 3 85  ? 40.107  17.417 -136.129 1.00 33.46  ? 381 LYS A CD    1 
ATOM   1628  C  CE    . LYS E 3 85  ? 40.717  18.794 -136.370 1.00 32.64  ? 381 LYS A CE    1 
ATOM   1629  N  NZ    . LYS E 3 85  ? 39.777  19.768 -136.972 1.00 33.85  ? 381 LYS A NZ    1 
ATOM   1630  N  N     . TRP E 3 86  ? 38.450  12.379 -136.959 1.00 33.53  ? 382 TRP A N     1 
ATOM   1631  C  CA    . TRP E 3 86  ? 38.644  10.991 -136.569 1.00 33.87  ? 382 TRP A CA    1 
ATOM   1632  C  C     . TRP E 3 86  ? 38.345  9.995  -137.685 1.00 34.54  ? 382 TRP A C     1 
ATOM   1633  O  O     . TRP E 3 86  ? 38.470  8.788  -137.486 1.00 34.91  ? 382 TRP A O     1 
ATOM   1634  C  CB    . TRP E 3 86  ? 37.770  10.647 -135.368 1.00 33.39  ? 382 TRP A CB    1 
ATOM   1635  C  CG    . TRP E 3 86  ? 38.233  11.243 -134.088 1.00 32.48  ? 382 TRP A CG    1 
ATOM   1636  C  CD1   . TRP E 3 86  ? 37.938  12.484 -133.599 1.00 31.91  ? 382 TRP A CD1   1 
ATOM   1637  C  CD2   . TRP E 3 86  ? 39.051  10.607 -133.102 1.00 32.32  ? 382 TRP A CD2   1 
ATOM   1638  N  NE1   . TRP E 3 86  ? 38.514  12.656 -132.363 1.00 31.53  ? 382 TRP A NE1   1 
ATOM   1639  C  CE2   . TRP E 3 86  ? 39.204  11.519 -132.034 1.00 31.48  ? 382 TRP A CE2   1 
ATOM   1640  C  CE3   . TRP E 3 86  ? 39.673  9.350  -133.018 1.00 31.67  ? 382 TRP A CE3   1 
ATOM   1641  C  CZ2   . TRP E 3 86  ? 39.948  11.217 -130.894 1.00 31.67  ? 382 TRP A CZ2   1 
ATOM   1642  C  CZ3   . TRP E 3 86  ? 40.413  9.048  -131.888 1.00 31.34  ? 382 TRP A CZ3   1 
ATOM   1643  C  CH2   . TRP E 3 86  ? 40.544  9.979  -130.838 1.00 31.79  ? 382 TRP A CH2   1 
ATOM   1644  N  N     . LYS E 3 87  ? 37.935  10.494 -138.847 1.00 35.08  ? 383 LYS A N     1 
ATOM   1645  C  CA    . LYS E 3 87  ? 37.630  9.634  -139.988 1.00 36.00  ? 383 LYS A CA    1 
ATOM   1646  C  C     . LYS E 3 87  ? 38.625  9.946  -141.104 1.00 36.04  ? 383 LYS A C     1 
ATOM   1647  O  O     . LYS E 3 87  ? 38.488  9.453  -142.221 1.00 36.11  ? 383 LYS A O     1 
ATOM   1648  C  CB    . LYS E 3 87  ? 36.212  9.897  -140.508 1.00 36.93  ? 383 LYS A CB    1 
ATOM   1649  C  CG    . LYS E 3 87  ? 35.091  9.780  -139.489 1.00 38.04  ? 383 LYS A CG    1 
ATOM   1650  C  CD    . LYS E 3 87  ? 34.747  8.338  -139.148 1.00 39.12  ? 383 LYS A CD    1 
ATOM   1651  C  CE    . LYS E 3 87  ? 33.532  8.292  -138.222 1.00 39.46  ? 383 LYS A CE    1 
ATOM   1652  N  NZ    . LYS E 3 87  ? 33.129  6.907  -137.814 1.00 40.10  ? 383 LYS A NZ    1 
ATOM   1653  N  N     . GLY E 3 88  ? 39.622  10.774 -140.793 1.00 36.05  ? 384 GLY A N     1 
ATOM   1654  C  CA    . GLY E 3 88  ? 40.614  11.158 -141.783 1.00 36.49  ? 384 GLY A CA    1 
ATOM   1655  C  C     . GLY E 3 88  ? 40.080  12.164 -142.793 1.00 36.91  ? 384 GLY A C     1 
ATOM   1656  O  O     . GLY E 3 88  ? 40.703  12.415 -143.828 1.00 36.72  ? 384 GLY A O     1 
ATOM   1657  N  N     . ILE E 3 89  ? 38.931  12.760 -142.491 1.00 37.06  ? 385 ILE A N     1 
ATOM   1658  C  CA    . ILE E 3 89  ? 38.310  13.718 -143.403 1.00 37.42  ? 385 ILE A CA    1 
ATOM   1659  C  C     . ILE E 3 89  ? 38.453  15.175 -142.931 1.00 38.03  ? 385 ILE A C     1 
ATOM   1660  O  O     . ILE E 3 89  ? 38.169  15.506 -141.775 1.00 37.37  ? 385 ILE A O     1 
ATOM   1661  C  CB    . ILE E 3 89  ? 36.818  13.338 -143.612 1.00 37.67  ? 385 ILE A CB    1 
ATOM   1662  C  CG1   . ILE E 3 89  ? 36.745  11.865 -144.059 1.00 37.37  ? 385 ILE A CG1   1 
ATOM   1663  C  CG2   . ILE E 3 89  ? 36.163  14.248 -144.643 1.00 36.78  ? 385 ILE A CG2   1 
ATOM   1664  C  CD1   . ILE E 3 89  ? 35.353  11.294 -144.177 1.00 37.60  ? 385 ILE A CD1   1 
ATOM   1665  N  N     . GLU E 3 90  ? 38.904  16.038 -143.840 1.00 38.28  ? 386 GLU A N     1 
ATOM   1666  C  CA    . GLU E 3 90  ? 39.110  17.454 -143.540 1.00 38.97  ? 386 GLU A CA    1 
ATOM   1667  C  C     . GLU E 3 90  ? 37.909  18.311 -143.924 1.00 38.51  ? 386 GLU A C     1 
ATOM   1668  O  O     . GLU E 3 90  ? 37.401  18.217 -145.042 1.00 38.67  ? 386 GLU A O     1 
ATOM   1669  C  CB    . GLU E 3 90  ? 40.357  17.979 -144.272 1.00 39.68  ? 386 GLU A CB    1 
ATOM   1670  C  CG    . GLU E 3 90  ? 40.573  19.496 -144.142 1.00 41.34  ? 386 GLU A CG    1 
ATOM   1671  C  CD    . GLU E 3 90  ? 41.837  20.003 -144.853 1.00 42.36  ? 386 GLU A CD    1 
ATOM   1672  O  OE1   . GLU E 3 90  ? 41.922  19.927 -146.101 1.00 42.35  ? 386 GLU A OE1   1 
ATOM   1673  O  OE2   . GLU E 3 90  ? 42.749  20.491 -144.151 1.00 44.17  ? 386 GLU A OE2   1 
ATOM   1674  N  N     . LEU E 3 91  ? 37.476  19.158 -142.992 1.00 38.15  ? 387 LEU A N     1 
ATOM   1675  C  CA    . LEU E 3 91  ? 36.337  20.051 -143.208 1.00 37.16  ? 387 LEU A CA    1 
ATOM   1676  C  C     . LEU E 3 91  ? 36.744  21.522 -143.186 1.00 36.72  ? 387 LEU A C     1 
ATOM   1677  O  O     . LEU E 3 91  ? 37.028  22.076 -142.129 1.00 37.55  ? 387 LEU A O     1 
ATOM   1678  C  CB    . LEU E 3 91  ? 35.279  19.815 -142.129 1.00 36.90  ? 387 LEU A CB    1 
ATOM   1679  C  CG    . LEU E 3 91  ? 34.069  20.750 -142.168 1.00 36.43  ? 387 LEU A CG    1 
ATOM   1680  C  CD1   . LEU E 3 91  ? 33.353  20.603 -143.496 1.00 36.73  ? 387 LEU A CD1   1 
ATOM   1681  C  CD2   . LEU E 3 91  ? 33.133  20.423 -141.006 1.00 36.43  ? 387 LEU A CD2   1 
ATOM   1682  N  N     . CYS E 3 92  ? 36.761  22.154 -144.351 1.00 35.87  ? 388 CYS A N     1 
ATOM   1683  C  CA    . CYS E 3 92  ? 37.120  23.565 -144.459 1.00 35.28  ? 388 CYS A CA    1 
ATOM   1684  C  C     . CYS E 3 92  ? 35.960  24.328 -145.088 1.00 33.47  ? 388 CYS A C     1 
ATOM   1685  O  O     . CYS E 3 92  ? 34.992  23.728 -145.554 1.00 33.81  ? 388 CYS A O     1 
ATOM   1686  C  CB    . CYS E 3 92  ? 38.348  23.747 -145.360 1.00 35.74  ? 388 CYS A CB    1 
ATOM   1687  S  SG    . CYS E 3 92  ? 39.889  23.018 -144.755 1.00 40.09  ? 388 CYS A SG    1 
ATOM   1688  N  N     . GLY E 3 93  ? 36.064  25.649 -145.103 1.00 31.62  ? 389 GLY A N     1 
ATOM   1689  C  CA    . GLY E 3 93  ? 35.042  26.457 -145.730 1.00 30.54  ? 389 GLY A CA    1 
ATOM   1690  C  C     . GLY E 3 93  ? 33.871  26.933 -144.893 1.00 29.54  ? 389 GLY A C     1 
ATOM   1691  O  O     . GLY E 3 93  ? 33.023  27.653 -145.415 1.00 29.55  ? 389 GLY A O     1 
ATOM   1692  N  N     . VAL E 3 94  ? 33.811  26.548 -143.622 1.00 29.38  ? 390 VAL A N     1 
ATOM   1693  C  CA    . VAL E 3 94  ? 32.707  26.968 -142.746 1.00 28.87  ? 390 VAL A CA    1 
ATOM   1694  C  C     . VAL E 3 94  ? 32.782  28.474 -142.523 1.00 29.31  ? 390 VAL A C     1 
ATOM   1695  O  O     . VAL E 3 94  ? 33.583  28.948 -141.719 1.00 29.72  ? 390 VAL A O     1 
ATOM   1696  C  CB    . VAL E 3 94  ? 32.777  26.273 -141.369 1.00 28.58  ? 390 VAL A CB    1 
ATOM   1697  C  CG1   . VAL E 3 94  ? 31.615  26.735 -140.483 1.00 27.06  ? 390 VAL A CG1   1 
ATOM   1698  C  CG2   . VAL E 3 94  ? 32.743  24.764 -141.544 1.00 28.92  ? 390 VAL A CG2   1 
ATOM   1699  N  N     . SER E 3 95  ? 31.948  29.220 -143.235 1.00 29.35  ? 391 SER A N     1 
ATOM   1700  C  CA    . SER E 3 95  ? 31.927  30.680 -143.130 1.00 30.14  ? 391 SER A CA    1 
ATOM   1701  C  C     . SER E 3 95  ? 30.938  31.203 -142.085 1.00 30.31  ? 391 SER A C     1 
ATOM   1702  O  O     . SER E 3 95  ? 31.035  32.345 -141.626 1.00 30.80  ? 391 SER A O     1 
ATOM   1703  C  CB    . SER E 3 95  ? 31.584  31.283 -144.485 1.00 30.35  ? 391 SER A CB    1 
ATOM   1704  O  OG    . SER E 3 95  ? 30.341  30.789 -144.954 1.00 30.65  ? 391 SER A OG    1 
ATOM   1705  N  N     . PHE E 3 96  ? 29.980  30.370 -141.710 1.00 30.34  ? 392 PHE A N     1 
ATOM   1706  C  CA    . PHE E 3 96  ? 28.992  30.787 -140.721 1.00 30.64  ? 392 PHE A CA    1 
ATOM   1707  C  C     . PHE E 3 96  ? 28.641  29.686 -139.755 1.00 30.60  ? 392 PHE A C     1 
ATOM   1708  O  O     . PHE E 3 96  ? 28.415  28.540 -140.152 1.00 30.61  ? 392 PHE A O     1 
ATOM   1709  C  CB    . PHE E 3 96  ? 27.706  31.271 -141.403 1.00 30.48  ? 392 PHE A CB    1 
ATOM   1710  C  CG    . PHE E 3 96  ? 26.603  31.624 -140.434 1.00 30.98  ? 392 PHE A CG    1 
ATOM   1711  C  CD1   . PHE E 3 96  ? 26.714  32.736 -139.602 1.00 31.13  ? 392 PHE A CD1   1 
ATOM   1712  C  CD2   . PHE E 3 96  ? 25.454  30.850 -140.358 1.00 30.91  ? 392 PHE A CD2   1 
ATOM   1713  C  CE1   . PHE E 3 96  ? 25.689  33.073 -138.708 1.00 31.42  ? 392 PHE A CE1   1 
ATOM   1714  C  CE2   . PHE E 3 96  ? 24.420  31.180 -139.465 1.00 31.15  ? 392 PHE A CE2   1 
ATOM   1715  C  CZ    . PHE E 3 96  ? 24.540  32.291 -138.643 1.00 30.07  ? 392 PHE A CZ    1 
ATOM   1716  N  N     . ASP E 3 97  ? 28.601  30.041 -138.474 1.00 30.67  ? 393 ASP A N     1 
ATOM   1717  C  CA    . ASP E 3 97  ? 28.229  29.093 -137.444 1.00 30.17  ? 393 ASP A CA    1 
ATOM   1718  C  C     . ASP E 3 97  ? 27.050  29.695 -136.690 1.00 29.86  ? 393 ASP A C     1 
ATOM   1719  O  O     . ASP E 3 97  ? 27.200  30.682 -135.972 1.00 29.78  ? 393 ASP A O     1 
ATOM   1720  C  CB    . ASP E 3 97  ? 29.391  28.846 -136.485 1.00 29.95  ? 393 ASP A CB    1 
ATOM   1721  C  CG    . ASP E 3 97  ? 29.179  27.621 -135.638 1.00 29.55  ? 393 ASP A CG    1 
ATOM   1722  O  OD1   . ASP E 3 97  ? 28.123  27.537 -134.971 1.00 30.59  ? 393 ASP A OD1   1 
ATOM   1723  O  OD2   . ASP E 3 97  ? 30.053  26.733 -135.635 1.00 28.23  ? 393 ASP A OD2   1 
ATOM   1724  N  N     . LEU E 3 98  ? 25.875  29.104 -136.889 1.00 28.68  ? 394 LEU A N     1 
ATOM   1725  C  CA    . LEU E 3 98  ? 24.628  29.545 -136.251 1.00 27.12  ? 394 LEU A CA    1 
ATOM   1726  C  C     . LEU E 3 98  ? 24.682  29.496 -134.724 1.00 26.12  ? 394 LEU A C     1 
ATOM   1727  O  O     . LEU E 3 98  ? 24.119  30.363 -134.053 1.00 26.10  ? 394 LEU A O     1 
ATOM   1728  C  CB    . LEU E 3 98  ? 23.471  28.670 -136.740 1.00 26.13  ? 394 LEU A CB    1 
ATOM   1729  C  CG    . LEU E 3 98  ? 22.116  28.831 -136.040 1.00 26.62  ? 394 LEU A CG    1 
ATOM   1730  C  CD1   . LEU E 3 98  ? 21.644  30.289 -136.111 1.00 24.50  ? 394 LEU A CD1   1 
ATOM   1731  C  CD2   . LEU E 3 98  ? 21.122  27.899 -136.702 1.00 25.31  ? 394 LEU A CD2   1 
ATOM   1732  N  N     . LEU E 3 99  ? 25.352  28.476 -134.184 1.00 24.75  ? 395 LEU A N     1 
ATOM   1733  C  CA    . LEU E 3 99  ? 25.478  28.306 -132.745 1.00 23.50  ? 395 LEU A CA    1 
ATOM   1734  C  C     . LEU E 3 99  ? 26.241  29.444 -132.078 1.00 22.62  ? 395 LEU A C     1 
ATOM   1735  O  O     . LEU E 3 99  ? 25.764  30.005 -131.114 1.00 21.78  ? 395 LEU A O     1 
ATOM   1736  C  CB    . LEU E 3 99  ? 26.155  26.962 -132.416 1.00 23.04  ? 395 LEU A CB    1 
ATOM   1737  C  CG    . LEU E 3 99  ? 26.588  26.677 -130.968 1.00 23.76  ? 395 LEU A CG    1 
ATOM   1738  C  CD1   . LEU E 3 99  ? 25.373  26.604 -130.022 1.00 23.56  ? 395 LEU A CD1   1 
ATOM   1739  C  CD2   . LEU E 3 99  ? 27.351  25.347 -130.914 1.00 24.01  ? 395 LEU A CD2   1 
ATOM   1740  N  N     . LEU E 3 100 ? 27.423  29.784 -132.594 1.00 22.65  ? 396 LEU A N     1 
ATOM   1741  C  CA    . LEU E 3 100 ? 28.231  30.846 -132.003 1.00 22.11  ? 396 LEU A CA    1 
ATOM   1742  C  C     . LEU E 3 100 ? 27.573  32.201 -132.233 1.00 22.42  ? 396 LEU A C     1 
ATOM   1743  O  O     . LEU E 3 100 ? 27.751  33.128 -131.444 1.00 22.19  ? 396 LEU A O     1 
ATOM   1744  C  CB    . LEU E 3 100 ? 29.665  30.822 -132.597 1.00 20.25  ? 396 LEU A CB    1 
ATOM   1745  C  CG    . LEU E 3 100 ? 30.371  29.455 -132.598 1.00 18.68  ? 396 LEU A CG    1 
ATOM   1746  C  CD1   . LEU E 3 100 ? 31.732  29.561 -133.327 1.00 20.75  ? 396 LEU A CD1   1 
ATOM   1747  C  CD2   . LEU E 3 100 ? 30.586  28.975 -131.218 1.00 16.77  ? 396 LEU A CD2   1 
ATOM   1748  N  N     . ALA E 3 101 ? 26.813  32.310 -133.318 1.00 24.34  ? 397 ALA A N     1 
ATOM   1749  C  CA    . ALA E 3 101 ? 26.098  33.549 -133.639 1.00 25.63  ? 397 ALA A CA    1 
ATOM   1750  C  C     . ALA E 3 101 ? 25.037  33.858 -132.567 1.00 25.80  ? 397 ALA A C     1 
ATOM   1751  O  O     . ALA E 3 101 ? 24.922  34.996 -132.104 1.00 25.26  ? 397 ALA A O     1 
ATOM   1752  C  CB    . ALA E 3 101 ? 25.433  33.433 -135.013 1.00 25.54  ? 397 ALA A CB    1 
ATOM   1753  N  N     . ALA E 3 102 ? 24.277  32.843 -132.175 1.00 26.63  ? 398 ALA A N     1 
ATOM   1754  C  CA    . ALA E 3 102 ? 23.228  33.002 -131.156 1.00 27.54  ? 398 ALA A CA    1 
ATOM   1755  C  C     . ALA E 3 102 ? 23.822  33.205 -129.759 1.00 29.01  ? 398 ALA A C     1 
ATOM   1756  O  O     . ALA E 3 102 ? 23.181  33.785 -128.878 1.00 28.97  ? 398 ALA A O     1 
ATOM   1757  C  CB    . ALA E 3 102 ? 22.310  31.791 -131.154 1.00 26.97  ? 398 ALA A CB    1 
ATOM   1758  N  N     . TYR E 3 103 ? 25.050  32.721 -129.569 1.00 30.71  ? 399 TYR A N     1 
ATOM   1759  C  CA    . TYR E 3 103 ? 25.765  32.851 -128.301 1.00 31.46  ? 399 TYR A CA    1 
ATOM   1760  C  C     . TYR E 3 103 ? 26.130  34.318 -128.081 1.00 31.85  ? 399 TYR A C     1 
ATOM   1761  O  O     . TYR E 3 103 ? 25.905  34.866 -127.001 1.00 32.17  ? 399 TYR A O     1 
ATOM   1762  C  CB    . TYR E 3 103 ? 27.030  31.985 -128.339 1.00 32.29  ? 399 TYR A CB    1 
ATOM   1763  C  CG    . TYR E 3 103 ? 27.877  31.979 -127.078 1.00 32.26  ? 399 TYR A CG    1 
ATOM   1764  C  CD1   . TYR E 3 103 ? 27.299  31.830 -125.813 1.00 31.90  ? 399 TYR A CD1   1 
ATOM   1765  C  CD2   . TYR E 3 103 ? 29.268  32.022 -127.162 1.00 31.78  ? 399 TYR A CD2   1 
ATOM   1766  C  CE1   . TYR E 3 103 ? 28.092  31.714 -124.661 1.00 31.66  ? 399 TYR A CE1   1 
ATOM   1767  C  CE2   . TYR E 3 103 ? 30.067  31.903 -126.027 1.00 31.38  ? 399 TYR A CE2   1 
ATOM   1768  C  CZ    . TYR E 3 103 ? 29.481  31.746 -124.783 1.00 31.44  ? 399 TYR A CZ    1 
ATOM   1769  O  OH    . TYR E 3 103 ? 30.282  31.582 -123.679 1.00 30.57  ? 399 TYR A OH    1 
ATOM   1770  N  N     . LEU E 3 104 ? 26.677  34.953 -129.115 1.00 31.89  ? 400 LEU A N     1 
ATOM   1771  C  CA    . LEU E 3 104 ? 27.070  36.354 -129.031 1.00 32.07  ? 400 LEU A CA    1 
ATOM   1772  C  C     . LEU E 3 104 ? 25.860  37.269 -128.860 1.00 32.45  ? 400 LEU A C     1 
ATOM   1773  O  O     . LEU E 3 104 ? 25.907  38.240 -128.097 1.00 31.94  ? 400 LEU A O     1 
ATOM   1774  C  CB    . LEU E 3 104 ? 27.848  36.768 -130.284 1.00 32.03  ? 400 LEU A CB    1 
ATOM   1775  C  CG    . LEU E 3 104 ? 29.196  36.060 -130.467 1.00 31.12  ? 400 LEU A CG    1 
ATOM   1776  C  CD1   . LEU E 3 104 ? 29.918  36.626 -131.683 1.00 30.37  ? 400 LEU A CD1   1 
ATOM   1777  C  CD2   . LEU E 3 104 ? 30.042  36.245 -129.215 1.00 30.01  ? 400 LEU A CD2   1 
ATOM   1778  N  N     . LEU E 3 105 ? 24.786  36.959 -129.578 1.00 32.51  ? 401 LEU A N     1 
ATOM   1779  C  CA    . LEU E 3 105 ? 23.566  37.749 -129.493 1.00 33.12  ? 401 LEU A CA    1 
ATOM   1780  C  C     . LEU E 3 105 ? 22.887  37.614 -128.135 1.00 33.18  ? 401 LEU A C     1 
ATOM   1781  O  O     . LEU E 3 105 ? 22.281  38.562 -127.656 1.00 34.58  ? 401 LEU A O     1 
ATOM   1782  C  CB    . LEU E 3 105 ? 22.602  37.361 -130.608 1.00 33.17  ? 401 LEU A CB    1 
ATOM   1783  C  CG    . LEU E 3 105 ? 22.910  38.057 -131.937 1.00 33.47  ? 401 LEU A CG    1 
ATOM   1784  C  CD1   . LEU E 3 105 ? 21.872  37.663 -132.979 1.00 32.78  ? 401 LEU A CD1   1 
ATOM   1785  C  CD2   . LEU E 3 105 ? 22.911  39.573 -131.722 1.00 33.09  ? 401 LEU A CD2   1 
ATOM   1786  N  N     . ASP E 3 106 ? 22.986  36.444 -127.516 1.00 33.54  ? 402 ASP A N     1 
ATOM   1787  C  CA    . ASP E 3 106 ? 22.396  36.243 -126.195 1.00 33.77  ? 402 ASP A CA    1 
ATOM   1788  C  C     . ASP E 3 106 ? 22.764  34.889 -125.591 1.00 33.63  ? 402 ASP A C     1 
ATOM   1789  O  O     . ASP E 3 106 ? 22.085  33.883 -125.822 1.00 33.09  ? 402 ASP A O     1 
ATOM   1790  C  CB    . ASP E 3 106 ? 20.873  36.391 -126.263 1.00 33.67  ? 402 ASP A CB    1 
ATOM   1791  C  CG    . ASP E 3 106 ? 20.243  36.481 -124.891 1.00 34.50  ? 402 ASP A CG    1 
ATOM   1792  O  OD1   . ASP E 3 106 ? 20.744  37.266 -124.057 1.00 33.47  ? 402 ASP A OD1   1 
ATOM   1793  O  OD2   . ASP E 3 106 ? 19.249  35.772 -124.643 1.00 35.23  ? 402 ASP A OD2   1 
ATOM   1794  N  N     . PRO E 3 107 ? 23.843  34.850 -124.784 1.00 33.43  ? 403 PRO A N     1 
ATOM   1795  C  CA    . PRO E 3 107 ? 24.256  33.584 -124.176 1.00 33.70  ? 403 PRO A CA    1 
ATOM   1796  C  C     . PRO E 3 107 ? 23.233  32.945 -123.239 1.00 34.01  ? 403 PRO A C     1 
ATOM   1797  O  O     . PRO E 3 107 ? 23.275  31.736 -123.012 1.00 33.81  ? 403 PRO A O     1 
ATOM   1798  C  CB    . PRO E 3 107 ? 25.572  33.939 -123.480 1.00 34.02  ? 403 PRO A CB    1 
ATOM   1799  C  CG    . PRO E 3 107 ? 25.426  35.396 -123.176 1.00 34.18  ? 403 PRO A CG    1 
ATOM   1800  C  CD    . PRO E 3 107 ? 24.731  35.957 -124.386 1.00 33.45  ? 403 PRO A CD    1 
ATOM   1801  N  N     . ALA E 3 108 ? 22.307  33.752 -122.721 1.00 34.00  ? 404 ALA A N     1 
ATOM   1802  C  CA    . ALA E 3 108 ? 21.272  33.268 -121.810 1.00 34.59  ? 404 ALA A CA    1 
ATOM   1803  C  C     . ALA E 3 108 ? 20.212  32.423 -122.513 1.00 34.73  ? 404 ALA A C     1 
ATOM   1804  O  O     . ALA E 3 108 ? 19.487  31.672 -121.865 1.00 35.46  ? 404 ALA A O     1 
ATOM   1805  C  CB    . ALA E 3 108 ? 20.606  34.439 -121.098 1.00 34.42  ? 404 ALA A CB    1 
ATOM   1806  N  N     . GLN E 3 109 ? 20.119  32.548 -123.832 1.00 35.14  ? 405 GLN A N     1 
ATOM   1807  C  CA    . GLN E 3 109 ? 19.144  31.773 -124.598 1.00 35.92  ? 405 GLN A CA    1 
ATOM   1808  C  C     . GLN E 3 109 ? 19.343  30.275 -124.417 1.00 36.36  ? 405 GLN A C     1 
ATOM   1809  O  O     . GLN E 3 109 ? 18.427  29.488 -124.648 1.00 37.51  ? 405 GLN A O     1 
ATOM   1810  C  CB    . GLN E 3 109 ? 19.232  32.125 -126.085 1.00 35.62  ? 405 GLN A CB    1 
ATOM   1811  C  CG    . GLN E 3 109 ? 18.642  33.474 -126.423 1.00 34.84  ? 405 GLN A CG    1 
ATOM   1812  C  CD    . GLN E 3 109 ? 17.198  33.590 -125.959 1.00 34.58  ? 405 GLN A CD    1 
ATOM   1813  O  OE1   . GLN E 3 109 ? 16.348  32.773 -126.322 1.00 34.89  ? 405 GLN A OE1   1 
ATOM   1814  N  NE2   . GLN E 3 109 ? 16.917  34.606 -125.153 1.00 34.43  ? 405 GLN A NE2   1 
ATOM   1815  N  N     . GLY E 3 110 ? 20.542  29.880 -124.008 1.00 37.08  ? 406 GLY A N     1 
ATOM   1816  C  CA    . GLY E 3 110 ? 20.824  28.466 -123.819 1.00 37.37  ? 406 GLY A CA    1 
ATOM   1817  C  C     . GLY E 3 110 ? 20.487  27.623 -125.038 1.00 37.36  ? 406 GLY A C     1 
ATOM   1818  O  O     . GLY E 3 110 ? 19.618  26.758 -124.988 1.00 39.03  ? 406 GLY A O     1 
ATOM   1819  N  N     . VAL E 3 111 ? 21.171  27.872 -126.145 1.00 37.23  ? 407 VAL A N     1 
ATOM   1820  C  CA    . VAL E 3 111 ? 20.924  27.118 -127.367 1.00 35.84  ? 407 VAL A CA    1 
ATOM   1821  C  C     . VAL E 3 111 ? 21.679  25.783 -127.353 1.00 35.35  ? 407 VAL A C     1 
ATOM   1822  O  O     . VAL E 3 111 ? 22.903  25.755 -127.239 1.00 34.72  ? 407 VAL A O     1 
ATOM   1823  C  CB    . VAL E 3 111 ? 21.353  27.934 -128.594 1.00 36.07  ? 407 VAL A CB    1 
ATOM   1824  C  CG1   . VAL E 3 111 ? 21.038  27.162 -129.867 1.00 36.46  ? 407 VAL A CG1   1 
ATOM   1825  C  CG2   . VAL E 3 111 ? 20.630  29.280 -128.598 1.00 35.92  ? 407 VAL A CG2   1 
ATOM   1826  N  N     . ASP E 3 112 ? 20.941  24.681 -127.469 1.00 34.58  ? 408 ASP A N     1 
ATOM   1827  C  CA    . ASP E 3 112 ? 21.540  23.347 -127.471 1.00 34.00  ? 408 ASP A CA    1 
ATOM   1828  C  C     . ASP E 3 112 ? 21.252  22.580 -128.761 1.00 32.98  ? 408 ASP A C     1 
ATOM   1829  O  O     . ASP E 3 112 ? 21.534  21.374 -128.863 1.00 32.65  ? 408 ASP A O     1 
ATOM   1830  C  CB    . ASP E 3 112 ? 21.051  22.544 -126.265 1.00 35.88  ? 408 ASP A CB    1 
ATOM   1831  C  CG    . ASP E 3 112 ? 19.696  23.014 -125.764 1.00 37.31  ? 408 ASP A CG    1 
ATOM   1832  O  OD1   . ASP E 3 112 ? 18.838  23.362 -126.602 1.00 39.16  ? 408 ASP A OD1   1 
ATOM   1833  O  OD2   . ASP E 3 112 ? 19.486  23.032 -124.533 1.00 38.91  ? 408 ASP A OD2   1 
ATOM   1834  N  N     . ASP E 3 113 ? 20.679  23.278 -129.740 1.00 30.97  ? 409 ASP A N     1 
ATOM   1835  C  CA    . ASP E 3 113 ? 20.382  22.685 -131.035 1.00 29.52  ? 409 ASP A CA    1 
ATOM   1836  C  C     . ASP E 3 113 ? 19.903  23.747 -132.016 1.00 28.27  ? 409 ASP A C     1 
ATOM   1837  O  O     . ASP E 3 113 ? 19.738  24.901 -131.643 1.00 29.21  ? 409 ASP A O     1 
ATOM   1838  C  CB    . ASP E 3 113 ? 19.376  21.525 -130.898 1.00 29.79  ? 409 ASP A CB    1 
ATOM   1839  C  CG    . ASP E 3 113 ? 18.001  21.955 -130.374 1.00 29.48  ? 409 ASP A CG    1 
ATOM   1840  O  OD1   . ASP E 3 113 ? 17.225  21.034 -130.048 1.00 29.45  ? 409 ASP A OD1   1 
ATOM   1841  O  OD2   . ASP E 3 113 ? 17.679  23.166 -130.297 1.00 28.12  ? 409 ASP A OD2   1 
ATOM   1842  N  N     . VAL E 3 114 ? 19.726  23.383 -133.278 1.00 27.32  ? 410 VAL A N     1 
ATOM   1843  C  CA    . VAL E 3 114 ? 19.291  24.352 -134.278 1.00 25.96  ? 410 VAL A CA    1 
ATOM   1844  C  C     . VAL E 3 114 ? 17.898  24.919 -133.935 1.00 25.85  ? 410 VAL A C     1 
ATOM   1845  O  O     . VAL E 3 114 ? 17.670  26.134 -133.983 1.00 24.68  ? 410 VAL A O     1 
ATOM   1846  C  CB    . VAL E 3 114 ? 19.284  23.703 -135.690 1.00 25.98  ? 410 VAL A CB    1 
ATOM   1847  C  CG1   . VAL E 3 114 ? 19.013  24.743 -136.738 1.00 25.54  ? 410 VAL A CG1   1 
ATOM   1848  C  CG2   . VAL E 3 114 ? 20.636  23.030 -135.968 1.00 26.62  ? 410 VAL A CG2   1 
ATOM   1849  N  N     . ALA E 3 115 ? 16.973  24.044 -133.566 1.00 25.90  ? 411 ALA A N     1 
ATOM   1850  C  CA    . ALA E 3 115 ? 15.626  24.502 -133.204 1.00 26.25  ? 411 ALA A CA    1 
ATOM   1851  C  C     . ALA E 3 115 ? 15.667  25.649 -132.179 1.00 26.48  ? 411 ALA A C     1 
ATOM   1852  O  O     . ALA E 3 115 ? 15.138  26.733 -132.430 1.00 25.42  ? 411 ALA A O     1 
ATOM   1853  C  CB    . ALA E 3 115 ? 14.818  23.341 -132.668 1.00 25.21  ? 411 ALA A CB    1 
ATOM   1854  N  N     . ALA E 3 116 ? 16.310  25.424 -131.035 1.00 27.39  ? 412 ALA A N     1 
ATOM   1855  C  CA    . ALA E 3 116 ? 16.402  26.454 -130.007 1.00 26.73  ? 412 ALA A CA    1 
ATOM   1856  C  C     . ALA E 3 116 ? 17.018  27.738 -130.564 1.00 26.81  ? 412 ALA A C     1 
ATOM   1857  O  O     . ALA E 3 116 ? 16.603  28.841 -130.214 1.00 25.92  ? 412 ALA A O     1 
ATOM   1858  C  CB    . ALA E 3 116 ? 17.225  25.941 -128.814 1.00 27.92  ? 412 ALA A CB    1 
ATOM   1859  N  N     . ALA E 3 117 ? 18.012  27.602 -131.435 1.00 27.16  ? 413 ALA A N     1 
ATOM   1860  C  CA    . ALA E 3 117 ? 18.637  28.771 -132.033 1.00 27.40  ? 413 ALA A CA    1 
ATOM   1861  C  C     . ALA E 3 117 ? 17.633  29.440 -132.980 1.00 27.86  ? 413 ALA A C     1 
ATOM   1862  O  O     . ALA E 3 117 ? 17.451  30.650 -132.968 1.00 27.26  ? 413 ALA A O     1 
ATOM   1863  C  CB    . ALA E 3 117 ? 19.883  28.364 -132.811 1.00 27.35  ? 413 ALA A CB    1 
ATOM   1864  N  N     . ALA E 3 118 ? 16.990  28.628 -133.807 1.00 28.76  ? 414 ALA A N     1 
ATOM   1865  C  CA    . ALA E 3 118 ? 16.028  29.123 -134.773 1.00 29.76  ? 414 ALA A CA    1 
ATOM   1866  C  C     . ALA E 3 118 ? 14.853  29.838 -134.097 1.00 30.50  ? 414 ALA A C     1 
ATOM   1867  O  O     . ALA E 3 118 ? 14.426  30.917 -134.547 1.00 29.84  ? 414 ALA A O     1 
ATOM   1868  C  CB    . ALA E 3 118 ? 15.517  27.955 -135.624 1.00 29.92  ? 414 ALA A CB    1 
ATOM   1869  N  N     . LYS E 3 119 ? 14.345  29.241 -133.019 1.00 31.14  ? 415 LYS A N     1 
ATOM   1870  C  CA    . LYS E 3 119 ? 13.200  29.807 -132.303 1.00 32.23  ? 415 LYS A CA    1 
ATOM   1871  C  C     . LYS E 3 119 ? 13.498  31.232 -131.922 1.00 33.16  ? 415 LYS A C     1 
ATOM   1872  O  O     . LYS E 3 119 ? 12.609  32.083 -131.895 1.00 32.59  ? 415 LYS A O     1 
ATOM   1873  C  CB    . LYS E 3 119 ? 12.893  29.013 -131.035 1.00 33.38  ? 415 LYS A CB    1 
ATOM   1874  C  CG    . LYS E 3 119 ? 11.748  29.610 -130.220 1.00 33.62  ? 415 LYS A CG    1 
ATOM   1875  C  CD    . LYS E 3 119 ? 11.517  28.857 -128.927 1.00 35.25  ? 415 LYS A CD    1 
ATOM   1876  C  CE    . LYS E 3 119 ? 10.340  29.451 -128.139 1.00 36.24  ? 415 LYS A CE    1 
ATOM   1877  N  NZ    . LYS E 3 119 ? 10.082  28.706 -126.868 1.00 37.40  ? 415 LYS A NZ    1 
ATOM   1878  N  N     . MET E 3 120 ? 14.770  31.485 -131.632 1.00 32.57  ? 416 MET A N     1 
ATOM   1879  C  CA    . MET E 3 120 ? 15.219  32.807 -131.242 1.00 33.14  ? 416 MET A CA    1 
ATOM   1880  C  C     . MET E 3 120 ? 14.952  33.822 -132.348 1.00 32.57  ? 416 MET A C     1 
ATOM   1881  O  O     . MET E 3 120 ? 15.032  35.028 -132.110 1.00 33.39  ? 416 MET A O     1 
ATOM   1882  C  CB    . MET E 3 120 ? 16.717  32.752 -130.906 1.00 33.71  ? 416 MET A CB    1 
ATOM   1883  C  CG    . MET E 3 120 ? 17.360  34.077 -130.541 1.00 34.80  ? 416 MET A CG    1 
ATOM   1884  S  SD    . MET E 3 120 ? 19.134  33.854 -130.205 1.00 35.18  ? 416 MET A SD    1 
ATOM   1885  C  CE    . MET E 3 120 ? 19.513  35.317 -129.271 1.00 34.28  ? 416 MET A CE    1 
ATOM   1886  N  N     . LYS E 3 121 ? 14.639  33.333 -133.550 1.00 32.00  ? 417 LYS A N     1 
ATOM   1887  C  CA    . LYS E 3 121 ? 14.368  34.195 -134.705 1.00 32.43  ? 417 LYS A CA    1 
ATOM   1888  C  C     . LYS E 3 121 ? 12.992  33.926 -135.355 1.00 32.57  ? 417 LYS A C     1 
ATOM   1889  O  O     . LYS E 3 121 ? 12.843  34.007 -136.572 1.00 32.70  ? 417 LYS A O     1 
ATOM   1890  C  CB    . LYS E 3 121 ? 15.466  34.006 -135.761 1.00 33.06  ? 417 LYS A CB    1 
ATOM   1891  C  CG    . LYS E 3 121 ? 16.038  35.301 -136.325 1.00 33.02  ? 417 LYS A CG    1 
ATOM   1892  C  CD    . LYS E 3 121 ? 16.771  36.065 -135.248 1.00 32.25  ? 417 LYS A CD    1 
ATOM   1893  C  CE    . LYS E 3 121 ? 17.108  37.464 -135.710 1.00 33.45  ? 417 LYS A CE    1 
ATOM   1894  N  NZ    . LYS E 3 121 ? 17.329  38.394 -134.571 1.00 32.47  ? 417 LYS A NZ    1 
ATOM   1895  N  N     . GLN E 3 122 ? 11.992  33.607 -134.543 1.00 32.74  ? 418 GLN A N     1 
ATOM   1896  C  CA    . GLN E 3 122 ? 10.653  33.335 -135.052 1.00 32.95  ? 418 GLN A CA    1 
ATOM   1897  C  C     . GLN E 3 122 ? 10.635  32.353 -136.226 1.00 33.33  ? 418 GLN A C     1 
ATOM   1898  O  O     . GLN E 3 122 ? 9.844   32.501 -137.154 1.00 33.59  ? 418 GLN A O     1 
ATOM   1899  C  CB    . GLN E 3 122 ? 9.977   34.634 -135.481 1.00 32.58  ? 418 GLN A CB    1 
ATOM   1900  C  CG    . GLN E 3 122 ? 9.822   35.654 -134.387 1.00 32.53  ? 418 GLN A CG    1 
ATOM   1901  C  CD    . GLN E 3 122 ? 11.065  36.492 -134.187 1.00 32.22  ? 418 GLN A CD    1 
ATOM   1902  O  OE1   . GLN E 3 122 ? 11.712  36.900 -135.152 1.00 32.35  ? 418 GLN A OE1   1 
ATOM   1903  N  NE2   . GLN E 3 122 ? 11.397  36.769 -132.934 1.00 31.97  ? 418 GLN A NE2   1 
ATOM   1904  N  N     . TYR E 3 123 ? 11.529  31.370 -136.197 1.00 33.19  ? 419 TYR A N     1 
ATOM   1905  C  CA    . TYR E 3 123 ? 11.574  30.350 -137.233 1.00 32.97  ? 419 TYR A CA    1 
ATOM   1906  C  C     . TYR E 3 123 ? 11.394  29.074 -136.452 1.00 33.75  ? 419 TYR A C     1 
ATOM   1907  O  O     . TYR E 3 123 ? 12.231  28.734 -135.608 1.00 35.36  ? 419 TYR A O     1 
ATOM   1908  C  CB    . TYR E 3 123 ? 12.930  30.332 -137.957 1.00 31.65  ? 419 TYR A CB    1 
ATOM   1909  C  CG    . TYR E 3 123 ? 12.980  29.381 -139.139 1.00 29.83  ? 419 TYR A CG    1 
ATOM   1910  C  CD1   . TYR E 3 123 ? 12.958  29.857 -140.452 1.00 29.66  ? 419 TYR A CD1   1 
ATOM   1911  C  CD2   . TYR E 3 123 ? 13.011  28.003 -138.942 1.00 28.91  ? 419 TYR A CD2   1 
ATOM   1912  C  CE1   . TYR E 3 123 ? 12.959  28.969 -141.543 1.00 29.76  ? 419 TYR A CE1   1 
ATOM   1913  C  CE2   . TYR E 3 123 ? 13.013  27.118 -140.011 1.00 28.79  ? 419 TYR A CE2   1 
ATOM   1914  C  CZ    . TYR E 3 123 ? 12.985  27.595 -141.307 1.00 29.69  ? 419 TYR A CZ    1 
ATOM   1915  O  OH    . TYR E 3 123 ? 12.968  26.688 -142.355 1.00 30.19  ? 419 TYR A OH    1 
ATOM   1916  N  N     . GLU E 3 124 ? 10.307  28.366 -136.718 1.00 33.48  ? 420 GLU A N     1 
ATOM   1917  C  CA    . GLU E 3 124 ? 10.037  27.146 -135.985 1.00 33.40  ? 420 GLU A CA    1 
ATOM   1918  C  C     . GLU E 3 124 ? 9.740   25.939 -136.871 1.00 32.65  ? 420 GLU A C     1 
ATOM   1919  O  O     . GLU E 3 124 ? 9.212   24.932 -136.400 1.00 32.56  ? 420 GLU A O     1 
ATOM   1920  C  CB    . GLU E 3 124 ? 8.878   27.389 -135.007 1.00 34.63  ? 420 GLU A CB    1 
ATOM   1921  C  CG    . GLU E 3 124 ? 9.011   28.684 -134.187 1.00 35.56  ? 420 GLU A CG    1 
ATOM   1922  C  CD    . GLU E 3 124 ? 8.120   28.698 -132.953 1.00 36.86  ? 420 GLU A CD    1 
ATOM   1923  O  OE1   . GLU E 3 124 ? 6.983   28.188 -133.029 1.00 36.98  ? 420 GLU A OE1   1 
ATOM   1924  O  OE2   . GLU E 3 124 ? 8.551   29.225 -131.904 1.00 37.54  ? 420 GLU A OE2   1 
ATOM   1925  N  N     . ALA E 3 125 ? 10.104  26.027 -138.147 1.00 32.21  ? 421 ALA A N     1 
ATOM   1926  C  CA    . ALA E 3 125 ? 9.865   24.926 -139.078 1.00 31.75  ? 421 ALA A CA    1 
ATOM   1927  C  C     . ALA E 3 125 ? 10.898  23.826 -138.880 1.00 31.72  ? 421 ALA A C     1 
ATOM   1928  O  O     . ALA E 3 125 ? 11.372  23.229 -139.845 1.00 31.46  ? 421 ALA A O     1 
ATOM   1929  C  CB    . ALA E 3 125 ? 9.911   25.429 -140.515 1.00 31.75  ? 421 ALA A CB    1 
ATOM   1930  N  N     . VAL E 3 126 ? 11.243  23.570 -137.623 1.00 31.40  ? 422 VAL A N     1 
ATOM   1931  C  CA    . VAL E 3 126 ? 12.220  22.551 -137.292 1.00 32.06  ? 422 VAL A CA    1 
ATOM   1932  C  C     . VAL E 3 126 ? 11.950  22.011 -135.893 1.00 32.71  ? 422 VAL A C     1 
ATOM   1933  O  O     . VAL E 3 126 ? 11.623  22.763 -134.982 1.00 33.68  ? 422 VAL A O     1 
ATOM   1934  C  CB    . VAL E 3 126 ? 13.674  23.115 -137.381 1.00 30.99  ? 422 VAL A CB    1 
ATOM   1935  C  CG1   . VAL E 3 126 ? 13.810  24.388 -136.554 1.00 30.36  ? 422 VAL A CG1   1 
ATOM   1936  C  CG2   . VAL E 3 126 ? 14.667  22.072 -136.913 1.00 30.14  ? 422 VAL A CG2   1 
ATOM   1937  N  N     . ARG E 3 127 ? 12.086  20.702 -135.727 1.00 33.47  ? 423 ARG A N     1 
ATOM   1938  C  CA    . ARG E 3 127 ? 11.846  20.070 -134.438 1.00 34.58  ? 423 ARG A CA    1 
ATOM   1939  C  C     . ARG E 3 127 ? 13.084  20.014 -133.538 1.00 35.10  ? 423 ARG A C     1 
ATOM   1940  O  O     . ARG E 3 127 ? 14.208  19.802 -134.009 1.00 34.51  ? 423 ARG A O     1 
ATOM   1941  C  CB    . ARG E 3 127 ? 11.323  18.643 -134.642 1.00 34.85  ? 423 ARG A CB    1 
ATOM   1942  C  CG    . ARG E 3 127 ? 10.007  18.548 -135.400 1.00 35.28  ? 423 ARG A CG    1 
ATOM   1943  C  CD    . ARG E 3 127 ? 9.770   17.128 -135.903 1.00 36.93  ? 423 ARG A CD    1 
ATOM   1944  N  NE    . ARG E 3 127 ? 9.547   16.165 -134.823 1.00 38.43  ? 423 ARG A NE    1 
ATOM   1945  C  CZ    . ARG E 3 127 ? 9.708   14.848 -134.949 1.00 38.62  ? 423 ARG A CZ    1 
ATOM   1946  N  NH1   . ARG E 3 127 ? 9.478   14.049 -133.919 1.00 39.67  ? 423 ARG A NH1   1 
ATOM   1947  N  NH2   . ARG E 3 127 ? 10.121  14.329 -136.096 1.00 38.78  ? 423 ARG A NH2   1 
ATOM   1948  N  N     . PRO E 3 128 ? 12.888  20.219 -132.224 1.00 35.48  ? 424 PRO A N     1 
ATOM   1949  C  CA    . PRO E 3 128 ? 13.986  20.177 -131.260 1.00 35.83  ? 424 PRO A CA    1 
ATOM   1950  C  C     . PRO E 3 128 ? 14.639  18.800 -131.351 1.00 36.70  ? 424 PRO A C     1 
ATOM   1951  O  O     . PRO E 3 128 ? 13.971  17.803 -131.647 1.00 35.49  ? 424 PRO A O     1 
ATOM   1952  C  CB    . PRO E 3 128 ? 13.271  20.402 -129.934 1.00 35.67  ? 424 PRO A CB    1 
ATOM   1953  C  CG    . PRO E 3 128 ? 12.225  21.392 -130.321 1.00 34.66  ? 424 PRO A CG    1 
ATOM   1954  C  CD    . PRO E 3 128 ? 11.682  20.807 -131.607 1.00 35.48  ? 424 PRO A CD    1 
ATOM   1955  N  N     . ASP E 3 129 ? 15.942  18.742 -131.103 1.00 37.81  ? 425 ASP A N     1 
ATOM   1956  C  CA    . ASP E 3 129 ? 16.651  17.475 -131.194 1.00 39.96  ? 425 ASP A CA    1 
ATOM   1957  C  C     . ASP E 3 129 ? 16.128  16.406 -130.244 1.00 40.39  ? 425 ASP A C     1 
ATOM   1958  O  O     . ASP E 3 129 ? 15.974  15.253 -130.640 1.00 40.92  ? 425 ASP A O     1 
ATOM   1959  C  CB    . ASP E 3 129 ? 18.155  17.697 -130.978 1.00 40.43  ? 425 ASP A CB    1 
ATOM   1960  C  CG    . ASP E 3 129 ? 18.791  18.479 -132.115 1.00 40.97  ? 425 ASP A CG    1 
ATOM   1961  O  OD1   . ASP E 3 129 ? 18.058  18.845 -133.053 1.00 41.06  ? 425 ASP A OD1   1 
ATOM   1962  O  OD2   . ASP E 3 129 ? 20.015  18.728 -132.077 1.00 42.31  ? 425 ASP A OD2   1 
ATOM   1963  N  N     . GLU E 3 130 ? 15.838  16.783 -129.003 1.00 41.38  ? 426 GLU A N     1 
ATOM   1964  C  CA    . GLU E 3 130 ? 15.351  15.818 -128.021 1.00 42.26  ? 426 GLU A CA    1 
ATOM   1965  C  C     . GLU E 3 130 ? 14.041  15.152 -128.439 1.00 42.56  ? 426 GLU A C     1 
ATOM   1966  O  O     . GLU E 3 130 ? 13.732  14.052 -128.000 1.00 42.09  ? 426 GLU A O     1 
ATOM   1967  C  CB    . GLU E 3 130 ? 15.163  16.480 -126.658 1.00 42.94  ? 426 GLU A CB    1 
ATOM   1968  C  CG    . GLU E 3 130 ? 14.925  15.478 -125.539 1.00 43.61  ? 426 GLU A CG    1 
ATOM   1969  C  CD    . GLU E 3 130 ? 14.490  16.123 -124.244 1.00 44.15  ? 426 GLU A CD    1 
ATOM   1970  O  OE1   . GLU E 3 130 ? 15.225  16.991 -123.728 1.00 45.17  ? 426 GLU A OE1   1 
ATOM   1971  O  OE2   . GLU E 3 130 ? 13.409  15.756 -123.736 1.00 44.97  ? 426 GLU A OE2   1 
ATOM   1972  N  N     . ALA E 3 131 ? 13.274  15.821 -129.290 1.00 43.43  ? 427 ALA A N     1 
ATOM   1973  C  CA    . ALA E 3 131 ? 12.001  15.278 -129.749 1.00 43.76  ? 427 ALA A CA    1 
ATOM   1974  C  C     . ALA E 3 131 ? 12.221  14.171 -130.775 1.00 44.68  ? 427 ALA A C     1 
ATOM   1975  O  O     . ALA E 3 131 ? 11.481  13.189 -130.812 1.00 44.54  ? 427 ALA A O     1 
ATOM   1976  C  CB    . ALA E 3 131 ? 11.153  16.389 -130.354 1.00 42.72  ? 427 ALA A CB    1 
ATOM   1977  N  N     . VAL E 3 132 ? 13.256  14.334 -131.593 1.00 45.31  ? 428 VAL A N     1 
ATOM   1978  C  CA    . VAL E 3 132 ? 13.567  13.377 -132.640 1.00 46.16  ? 428 VAL A CA    1 
ATOM   1979  C  C     . VAL E 3 132 ? 14.327  12.143 -132.158 1.00 47.04  ? 428 VAL A C     1 
ATOM   1980  O  O     . VAL E 3 132 ? 13.996  11.019 -132.540 1.00 47.14  ? 428 VAL A O     1 
ATOM   1981  C  CB    . VAL E 3 132 ? 14.360  14.064 -133.773 1.00 45.96  ? 428 VAL A CB    1 
ATOM   1982  C  CG1   . VAL E 3 132 ? 14.621  13.083 -134.897 1.00 46.31  ? 428 VAL A CG1   1 
ATOM   1983  C  CG2   . VAL E 3 132 ? 13.580  15.267 -134.291 1.00 45.45  ? 428 VAL A CG2   1 
ATOM   1984  N  N     . TYR E 3 133 ? 15.342  12.337 -131.324 1.00 47.93  ? 429 TYR A N     1 
ATOM   1985  C  CA    . TYR E 3 133 ? 16.106  11.197 -130.829 1.00 49.07  ? 429 TYR A CA    1 
ATOM   1986  C  C     . TYR E 3 133 ? 15.798  10.885 -129.372 1.00 50.03  ? 429 TYR A C     1 
ATOM   1987  O  O     . TYR E 3 133 ? 16.275  9.887  -128.838 1.00 50.18  ? 429 TYR A O     1 
ATOM   1988  C  CB    . TYR E 3 133 ? 17.609  11.443 -130.970 1.00 48.81  ? 429 TYR A CB    1 
ATOM   1989  C  CG    . TYR E 3 133 ? 18.016  12.119 -132.256 1.00 48.25  ? 429 TYR A CG    1 
ATOM   1990  C  CD1   . TYR E 3 133 ? 17.994  13.507 -132.367 1.00 47.86  ? 429 TYR A CD1   1 
ATOM   1991  C  CD2   . TYR E 3 133 ? 18.433  11.373 -133.356 1.00 47.90  ? 429 TYR A CD2   1 
ATOM   1992  C  CE1   . TYR E 3 133 ? 18.381  14.138 -133.538 1.00 48.15  ? 429 TYR A CE1   1 
ATOM   1993  C  CE2   . TYR E 3 133 ? 18.824  11.996 -134.537 1.00 48.12  ? 429 TYR A CE2   1 
ATOM   1994  C  CZ    . TYR E 3 133 ? 18.797  13.378 -134.618 1.00 47.88  ? 429 TYR A CZ    1 
ATOM   1995  O  OH    . TYR E 3 133 ? 19.201  14.004 -135.769 1.00 48.04  ? 429 TYR A OH    1 
ATOM   1996  N  N     . GLY E 3 134 ? 15.008  11.740 -128.729 1.00 51.05  ? 430 GLY A N     1 
ATOM   1997  C  CA    . GLY E 3 134 ? 14.669  11.519 -127.335 1.00 52.65  ? 430 GLY A CA    1 
ATOM   1998  C  C     . GLY E 3 134 ? 15.857  11.680 -126.403 1.00 54.13  ? 430 GLY A C     1 
ATOM   1999  O  O     . GLY E 3 134 ? 16.778  12.453 -126.677 1.00 54.22  ? 430 GLY A O     1 
ATOM   2000  N  N     . LYS E 3 135 ? 15.835  10.946 -125.296 1.00 55.35  ? 431 LYS A N     1 
ATOM   2001  C  CA    . LYS E 3 135 ? 16.908  10.997 -124.311 1.00 56.71  ? 431 LYS A CA    1 
ATOM   2002  C  C     . LYS E 3 135 ? 16.777  9.854  -123.307 1.00 57.51  ? 431 LYS A C     1 
ATOM   2003  O  O     . LYS E 3 135 ? 15.927  8.977  -123.460 1.00 57.60  ? 431 LYS A O     1 
ATOM   2004  C  CB    . LYS E 3 135 ? 16.882  12.333 -123.566 1.00 56.97  ? 431 LYS A CB    1 
ATOM   2005  C  CG    . LYS E 3 135 ? 15.520  12.692 -122.992 1.00 57.28  ? 431 LYS A CG    1 
ATOM   2006  C  CD    . LYS E 3 135 ? 15.653  13.441 -121.677 1.00 57.62  ? 431 LYS A CD    1 
ATOM   2007  C  CE    . LYS E 3 135 ? 16.525  14.680 -121.800 1.00 57.45  ? 431 LYS A CE    1 
ATOM   2008  N  NZ    . LYS E 3 135 ? 16.783  15.272 -120.453 1.00 57.92  ? 431 LYS A NZ    1 
ATOM   2009  N  N     . GLY E 3 136 ? 17.623  9.872  -122.281 1.00 58.16  ? 432 GLY A N     1 
ATOM   2010  C  CA    . GLY E 3 136 ? 17.579  8.830  -121.269 1.00 58.97  ? 432 GLY A CA    1 
ATOM   2011  C  C     . GLY E 3 136 ? 17.892  7.457  -121.830 1.00 59.26  ? 432 GLY A C     1 
ATOM   2012  O  O     . GLY E 3 136 ? 18.605  7.338  -122.826 1.00 59.37  ? 432 GLY A O     1 
ATOM   2013  N  N     . ALA E 3 137 ? 17.353  6.420  -121.194 1.00 59.69  ? 433 ALA A N     1 
ATOM   2014  C  CA    . ALA E 3 137 ? 17.580  5.041  -121.627 1.00 59.80  ? 433 ALA A CA    1 
ATOM   2015  C  C     . ALA E 3 137 ? 16.749  4.672  -122.852 1.00 59.84  ? 433 ALA A C     1 
ATOM   2016  O  O     . ALA E 3 137 ? 16.592  3.491  -123.175 1.00 60.13  ? 433 ALA A O     1 
ATOM   2017  C  CB    . ALA E 3 137 ? 17.275  4.076  -120.481 1.00 59.92  ? 433 ALA A CB    1 
ATOM   2018  N  N     . LYS E 3 138 ? 16.216  5.684  -123.530 1.00 59.77  ? 434 LYS A N     1 
ATOM   2019  C  CA    . LYS E 3 138 ? 15.403  5.469  -124.724 1.00 59.43  ? 434 LYS A CA    1 
ATOM   2020  C  C     . LYS E 3 138 ? 16.085  6.019  -125.977 1.00 58.74  ? 434 LYS A C     1 
ATOM   2021  O  O     . LYS E 3 138 ? 15.836  5.545  -127.087 1.00 58.59  ? 434 LYS A O     1 
ATOM   2022  C  CB    . LYS E 3 138 ? 14.033  6.147  -124.572 1.00 59.79  ? 434 LYS A CB    1 
ATOM   2023  C  CG    . LYS E 3 138 ? 13.084  5.507  -123.561 1.00 60.12  ? 434 LYS A CG    1 
ATOM   2024  C  CD    . LYS E 3 138 ? 13.042  6.264  -122.234 1.00 60.67  ? 434 LYS A CD    1 
ATOM   2025  C  CE    . LYS E 3 138 ? 14.221  5.926  -121.336 1.00 61.02  ? 434 LYS A CE    1 
ATOM   2026  N  NZ    . LYS E 3 138 ? 14.228  4.480  -120.964 1.00 61.05  ? 434 LYS A NZ    1 
ATOM   2027  N  N     . ARG E 3 139 ? 16.946  7.016  -125.779 1.00 58.05  ? 435 ARG A N     1 
ATOM   2028  C  CA    . ARG E 3 139 ? 17.658  7.690  -126.864 1.00 57.15  ? 435 ARG A CA    1 
ATOM   2029  C  C     . ARG E 3 139 ? 18.080  6.802  -128.024 1.00 56.40  ? 435 ARG A C     1 
ATOM   2030  O  O     . ARG E 3 139 ? 18.695  5.757  -127.835 1.00 56.15  ? 435 ARG A O     1 
ATOM   2031  C  CB    . ARG E 3 139 ? 18.882  8.428  -126.315 1.00 57.36  ? 435 ARG A CB    1 
ATOM   2032  C  CG    . ARG E 3 139 ? 19.450  9.439  -127.286 1.00 57.04  ? 435 ARG A CG    1 
ATOM   2033  C  CD    . ARG E 3 139 ? 20.522  10.287 -126.645 1.00 57.18  ? 435 ARG A CD    1 
ATOM   2034  N  NE    . ARG E 3 139 ? 20.852  11.432 -127.485 1.00 57.48  ? 435 ARG A NE    1 
ATOM   2035  C  CZ    . ARG E 3 139 ? 21.719  12.381 -127.153 1.00 57.83  ? 435 ARG A CZ    1 
ATOM   2036  N  NH1   . ARG E 3 139 ? 22.355  12.323 -125.991 1.00 58.09  ? 435 ARG A NH1   1 
ATOM   2037  N  NH2   . ARG E 3 139 ? 21.939  13.395 -127.976 1.00 57.59  ? 435 ARG A NH2   1 
ATOM   2038  N  N     . ALA E 3 140 ? 17.750  7.244  -129.233 1.00 55.81  ? 436 ALA A N     1 
ATOM   2039  C  CA    . ALA E 3 140 ? 18.071  6.493  -130.435 1.00 55.40  ? 436 ALA A CA    1 
ATOM   2040  C  C     . ALA E 3 140 ? 17.942  7.361  -131.680 1.00 55.10  ? 436 ALA A C     1 
ATOM   2041  O  O     . ALA E 3 140 ? 17.461  8.493  -131.617 1.00 54.96  ? 436 ALA A O     1 
ATOM   2042  C  CB    . ALA E 3 140 ? 17.147  5.290  -130.549 1.00 55.08  ? 436 ALA A CB    1 
ATOM   2043  N  N     . VAL E 3 141 ? 18.379  6.817  -132.813 1.00 54.92  ? 437 VAL A N     1 
ATOM   2044  C  CA    . VAL E 3 141 ? 18.299  7.523  -134.083 1.00 54.58  ? 437 VAL A CA    1 
ATOM   2045  C  C     . VAL E 3 141 ? 17.020  7.065  -134.772 1.00 54.61  ? 437 VAL A C     1 
ATOM   2046  O  O     . VAL E 3 141 ? 16.807  5.867  -134.974 1.00 54.63  ? 437 VAL A O     1 
ATOM   2047  C  CB    . VAL E 3 141 ? 19.499  7.186  -134.997 1.00 54.72  ? 437 VAL A CB    1 
ATOM   2048  C  CG1   . VAL E 3 141 ? 19.458  8.050  -136.253 1.00 54.74  ? 437 VAL A CG1   1 
ATOM   2049  C  CG2   . VAL E 3 141 ? 20.800  7.393  -134.244 1.00 54.76  ? 437 VAL A CG2   1 
ATOM   2050  N  N     . PRO E 3 142 ? 16.144  8.013  -135.137 1.00 54.40  ? 438 PRO A N     1 
ATOM   2051  C  CA    . PRO E 3 142 ? 14.900  7.625  -135.802 1.00 54.15  ? 438 PRO A CA    1 
ATOM   2052  C  C     . PRO E 3 142 ? 15.194  6.930  -137.130 1.00 54.11  ? 438 PRO A C     1 
ATOM   2053  O  O     . PRO E 3 142 ? 16.327  6.948  -137.612 1.00 53.93  ? 438 PRO A O     1 
ATOM   2054  C  CB    . PRO E 3 142 ? 14.177  8.957  -135.972 1.00 54.14  ? 438 PRO A CB    1 
ATOM   2055  C  CG    . PRO E 3 142 ? 15.311  9.927  -136.139 1.00 54.36  ? 438 PRO A CG    1 
ATOM   2056  C  CD    . PRO E 3 142 ? 16.276  9.479  -135.077 1.00 54.06  ? 438 PRO A CD    1 
ATOM   2057  N  N     . ASP E 3 143 ? 14.176  6.315  -137.720 1.00 53.98  ? 439 ASP A N     1 
ATOM   2058  C  CA    . ASP E 3 143 ? 14.362  5.620  -138.981 1.00 53.42  ? 439 ASP A CA    1 
ATOM   2059  C  C     . ASP E 3 143 ? 14.648  6.567  -140.131 1.00 52.69  ? 439 ASP A C     1 
ATOM   2060  O  O     . ASP E 3 143 ? 14.261  7.740  -140.104 1.00 52.75  ? 439 ASP A O     1 
ATOM   2061  C  CB    . ASP E 3 143 ? 13.140  4.755  -139.305 1.00 54.43  ? 439 ASP A CB    1 
ATOM   2062  C  CG    . ASP E 3 143 ? 13.272  3.339  -138.774 1.00 54.74  ? 439 ASP A CG    1 
ATOM   2063  O  OD1   . ASP E 3 143 ? 14.239  2.648  -139.159 1.00 54.78  ? 439 ASP A OD1   1 
ATOM   2064  O  OD2   . ASP E 3 143 ? 12.413  2.916  -137.974 1.00 55.50  ? 439 ASP A OD2   1 
ATOM   2065  N  N     . GLU E 3 144 ? 15.331  6.025  -141.136 1.00 51.55  ? 440 GLU A N     1 
ATOM   2066  C  CA    . GLU E 3 144 ? 15.739  6.735  -142.341 1.00 50.75  ? 440 GLU A CA    1 
ATOM   2067  C  C     . GLU E 3 144 ? 14.927  7.964  -142.748 1.00 50.33  ? 440 GLU A C     1 
ATOM   2068  O  O     . GLU E 3 144 ? 15.463  9.074  -142.788 1.00 50.22  ? 440 GLU A O     1 
ATOM   2069  C  CB    . GLU E 3 144 ? 15.802  5.747  -143.506 1.00 50.81  ? 440 GLU A CB    1 
ATOM   2070  C  CG    . GLU E 3 144 ? 16.081  6.366  -144.858 1.00 50.85  ? 440 GLU A CG    1 
ATOM   2071  C  CD    . GLU E 3 144 ? 17.421  7.048  -144.915 1.00 51.02  ? 440 GLU A CD    1 
ATOM   2072  O  OE1   . GLU E 3 144 ? 17.567  8.114  -144.285 1.00 51.18  ? 440 GLU A OE1   1 
ATOM   2073  O  OE2   . GLU E 3 144 ? 18.330  6.513  -145.587 1.00 51.17  ? 440 GLU A OE2   1 
ATOM   2074  N  N     . PRO E 3 145 ? 13.630  7.793  -143.061 1.00 49.88  ? 441 PRO A N     1 
ATOM   2075  C  CA    . PRO E 3 145 ? 12.837  8.962  -143.461 1.00 48.97  ? 441 PRO A CA    1 
ATOM   2076  C  C     . PRO E 3 145 ? 12.562  10.003 -142.370 1.00 48.02  ? 441 PRO A C     1 
ATOM   2077  O  O     . PRO E 3 145 ? 12.176  11.128 -142.675 1.00 48.06  ? 441 PRO A O     1 
ATOM   2078  C  CB    . PRO E 3 145 ? 11.561  8.334  -144.025 1.00 49.06  ? 441 PRO A CB    1 
ATOM   2079  C  CG    . PRO E 3 145 ? 11.419  7.089  -143.214 1.00 49.88  ? 441 PRO A CG    1 
ATOM   2080  C  CD    . PRO E 3 145 ? 12.829  6.557  -143.166 1.00 49.97  ? 441 PRO A CD    1 
ATOM   2081  N  N     . VAL E 3 146 ? 12.746  9.636  -141.105 1.00 47.26  ? 442 VAL A N     1 
ATOM   2082  C  CA    . VAL E 3 146 ? 12.530  10.585 -140.015 1.00 46.04  ? 442 VAL A CA    1 
ATOM   2083  C  C     . VAL E 3 146 ? 13.818  11.387 -139.830 1.00 44.83  ? 442 VAL A C     1 
ATOM   2084  O  O     . VAL E 3 146 ? 13.807  12.616 -139.787 1.00 44.54  ? 442 VAL A O     1 
ATOM   2085  C  CB    . VAL E 3 146 ? 12.206  9.874  -138.689 1.00 46.18  ? 442 VAL A CB    1 
ATOM   2086  C  CG1   . VAL E 3 146 ? 11.927  10.906 -137.616 1.00 45.91  ? 442 VAL A CG1   1 
ATOM   2087  C  CG2   . VAL E 3 146 ? 11.011  8.951  -138.867 1.00 46.56  ? 442 VAL A CG2   1 
ATOM   2088  N  N     . LEU E 3 147 ? 14.928  10.666 -139.719 1.00 43.92  ? 443 LEU A N     1 
ATOM   2089  C  CA    . LEU E 3 147 ? 16.245  11.272 -139.564 1.00 42.54  ? 443 LEU A CA    1 
ATOM   2090  C  C     . LEU E 3 147 ? 16.485  12.205 -140.741 1.00 42.03  ? 443 LEU A C     1 
ATOM   2091  O  O     . LEU E 3 147 ? 17.012  13.307 -140.584 1.00 41.52  ? 443 LEU A O     1 
ATOM   2092  C  CB    . LEU E 3 147 ? 17.312  10.176 -139.545 1.00 41.98  ? 443 LEU A CB    1 
ATOM   2093  C  CG    . LEU E 3 147 ? 18.791  10.561 -139.499 1.00 41.96  ? 443 LEU A CG    1 
ATOM   2094  C  CD1   . LEU E 3 147 ? 19.099  11.321 -138.214 1.00 41.12  ? 443 LEU A CD1   1 
ATOM   2095  C  CD2   . LEU E 3 147 ? 19.631  9.295  -139.587 1.00 41.51  ? 443 LEU A CD2   1 
ATOM   2096  N  N     . ALA E 3 148 ? 16.075  11.755 -141.922 1.00 41.65  ? 444 ALA A N     1 
ATOM   2097  C  CA    . ALA E 3 148 ? 16.240  12.526 -143.145 1.00 41.16  ? 444 ALA A CA    1 
ATOM   2098  C  C     . ALA E 3 148 ? 15.467  13.838 -143.114 1.00 40.97  ? 444 ALA A C     1 
ATOM   2099  O  O     . ALA E 3 148 ? 16.036  14.907 -143.343 1.00 40.66  ? 444 ALA A O     1 
ATOM   2100  C  CB    . ALA E 3 148 ? 15.806  11.694 -144.339 1.00 41.25  ? 444 ALA A CB    1 
ATOM   2101  N  N     . GLU E 3 149 ? 14.165  13.744 -142.837 1.00 40.61  ? 445 GLU A N     1 
ATOM   2102  C  CA    . GLU E 3 149 ? 13.290  14.911 -142.775 1.00 39.70  ? 445 GLU A CA    1 
ATOM   2103  C  C     . GLU E 3 149 ? 13.808  15.942 -141.774 1.00 38.73  ? 445 GLU A C     1 
ATOM   2104  O  O     . GLU E 3 149 ? 13.705  17.146 -142.009 1.00 38.02  ? 445 GLU A O     1 
ATOM   2105  C  CB    . GLU E 3 149 ? 11.862  14.459 -142.418 1.00 40.84  ? 445 GLU A CB    1 
ATOM   2106  C  CG    . GLU E 3 149 ? 10.936  15.515 -141.811 1.00 41.90  ? 445 GLU A CG    1 
ATOM   2107  C  CD    . GLU E 3 149 ? 10.520  16.603 -142.783 1.00 42.93  ? 445 GLU A CD    1 
ATOM   2108  O  OE1   . GLU E 3 149 ? 9.498   17.272 -142.519 1.00 43.14  ? 445 GLU A OE1   1 
ATOM   2109  O  OE2   . GLU E 3 149 ? 11.209  16.803 -143.805 1.00 43.99  ? 445 GLU A OE2   1 
ATOM   2110  N  N     . HIS E 3 150 ? 14.377  15.476 -140.665 1.00 37.65  ? 446 HIS A N     1 
ATOM   2111  C  CA    . HIS E 3 150 ? 14.906  16.400 -139.667 1.00 37.57  ? 446 HIS A CA    1 
ATOM   2112  C  C     . HIS E 3 150 ? 16.220  17.052 -140.137 1.00 37.13  ? 446 HIS A C     1 
ATOM   2113  O  O     . HIS E 3 150 ? 16.330  18.279 -140.169 1.00 37.17  ? 446 HIS A O     1 
ATOM   2114  C  CB    . HIS E 3 150 ? 15.129  15.690 -138.329 1.00 36.56  ? 446 HIS A CB    1 
ATOM   2115  C  CG    . HIS E 3 150 ? 15.457  16.625 -137.207 1.00 35.42  ? 446 HIS A CG    1 
ATOM   2116  N  ND1   . HIS E 3 150 ? 16.238  16.258 -136.133 1.00 35.56  ? 446 HIS A ND1   1 
ATOM   2117  C  CD2   . HIS E 3 150 ? 15.111  17.916 -136.997 1.00 34.60  ? 446 HIS A CD2   1 
ATOM   2118  C  CE1   . HIS E 3 150 ? 16.360  17.285 -135.309 1.00 34.80  ? 446 HIS A CE1   1 
ATOM   2119  N  NE2   . HIS E 3 150 ? 15.686  18.303 -135.812 1.00 34.70  ? 446 HIS A NE2   1 
ATOM   2120  N  N     . LEU E 3 151 ? 17.209  16.248 -140.516 1.00 37.07  ? 447 LEU A N     1 
ATOM   2121  C  CA    . LEU E 3 151 ? 18.476  16.817 -140.980 1.00 36.61  ? 447 LEU A CA    1 
ATOM   2122  C  C     . LEU E 3 151 ? 18.270  17.872 -142.065 1.00 36.26  ? 447 LEU A C     1 
ATOM   2123  O  O     . LEU E 3 151 ? 18.974  18.881 -142.101 1.00 35.61  ? 447 LEU A O     1 
ATOM   2124  C  CB    . LEU E 3 151 ? 19.410  15.716 -141.492 1.00 37.05  ? 447 LEU A CB    1 
ATOM   2125  C  CG    . LEU E 3 151 ? 19.857  14.718 -140.424 1.00 36.89  ? 447 LEU A CG    1 
ATOM   2126  C  CD1   . LEU E 3 151 ? 20.873  13.751 -141.011 1.00 37.13  ? 447 LEU A CD1   1 
ATOM   2127  C  CD2   . LEU E 3 151 ? 20.457  15.478 -139.241 1.00 36.89  ? 447 LEU A CD2   1 
ATOM   2128  N  N     . VAL E 3 152 ? 17.298  17.647 -142.945 1.00 36.47  ? 448 VAL A N     1 
ATOM   2129  C  CA    . VAL E 3 152 ? 17.012  18.600 -144.015 1.00 35.94  ? 448 VAL A CA    1 
ATOM   2130  C  C     . VAL E 3 152 ? 16.364  19.873 -143.483 1.00 35.87  ? 448 VAL A C     1 
ATOM   2131  O  O     . VAL E 3 152 ? 16.587  20.963 -144.029 1.00 36.41  ? 448 VAL A O     1 
ATOM   2132  C  CB    . VAL E 3 152 ? 16.103  17.976 -145.107 1.00 36.32  ? 448 VAL A CB    1 
ATOM   2133  C  CG1   . VAL E 3 152 ? 15.638  19.056 -146.086 1.00 35.96  ? 448 VAL A CG1   1 
ATOM   2134  C  CG2   . VAL E 3 152 ? 16.868  16.904 -145.853 1.00 35.36  ? 448 VAL A CG2   1 
ATOM   2135  N  N     . ARG E 3 153 ? 15.563  19.744 -142.424 1.00 35.19  ? 449 ARG A N     1 
ATOM   2136  C  CA    . ARG E 3 153 ? 14.928  20.913 -141.827 1.00 34.11  ? 449 ARG A CA    1 
ATOM   2137  C  C     . ARG E 3 153 ? 15.983  21.708 -141.066 1.00 33.21  ? 449 ARG A C     1 
ATOM   2138  O  O     . ARG E 3 153 ? 15.979  22.945 -141.090 1.00 32.17  ? 449 ARG A O     1 
ATOM   2139  C  CB    . ARG E 3 153 ? 13.786  20.507 -140.880 1.00 34.27  ? 449 ARG A CB    1 
ATOM   2140  C  CG    . ARG E 3 153 ? 12.512  20.060 -141.608 1.00 35.11  ? 449 ARG A CG    1 
ATOM   2141  C  CD    . ARG E 3 153 ? 11.373  19.751 -140.638 1.00 36.61  ? 449 ARG A CD    1 
ATOM   2142  N  NE    . ARG E 3 153 ? 10.138  19.415 -141.342 1.00 36.78  ? 449 ARG A NE    1 
ATOM   2143  C  CZ    . ARG E 3 153 ? 9.406   20.293 -142.018 1.00 37.88  ? 449 ARG A CZ    1 
ATOM   2144  N  NH1   . ARG E 3 153 ? 9.780   21.569 -142.072 1.00 38.04  ? 449 ARG A NH1   1 
ATOM   2145  N  NH2   . ARG E 3 153 ? 8.315   19.898 -142.658 1.00 36.93  ? 449 ARG A NH2   1 
ATOM   2146  N  N     . LYS E 3 154 ? 16.881  21.005 -140.385 1.00 32.22  ? 450 LYS A N     1 
ATOM   2147  C  CA    . LYS E 3 154 ? 17.938  21.691 -139.655 1.00 32.38  ? 450 LYS A CA    1 
ATOM   2148  C  C     . LYS E 3 154 ? 18.804  22.432 -140.666 1.00 31.29  ? 450 LYS A C     1 
ATOM   2149  O  O     . LYS E 3 154 ? 19.133  23.606 -140.476 1.00 31.86  ? 450 LYS A O     1 
ATOM   2150  C  CB    . LYS E 3 154 ? 18.780  20.696 -138.838 1.00 32.72  ? 450 LYS A CB    1 
ATOM   2151  C  CG    . LYS E 3 154 ? 18.127  20.300 -137.521 1.00 33.16  ? 450 LYS A CG    1 
ATOM   2152  C  CD    . LYS E 3 154 ? 19.134  19.785 -136.477 1.00 33.86  ? 450 LYS A CD    1 
ATOM   2153  C  CE    . LYS E 3 154 ? 19.676  18.417 -136.820 1.00 34.58  ? 450 LYS A CE    1 
ATOM   2154  N  NZ    . LYS E 3 154 ? 20.437  17.828 -135.682 1.00 32.80  ? 450 LYS A NZ    1 
ATOM   2155  N  N     . ALA E 3 155 ? 19.162  21.752 -141.750 1.00 30.83  ? 451 ALA A N     1 
ATOM   2156  C  CA    . ALA E 3 155 ? 19.969  22.382 -142.787 1.00 30.72  ? 451 ALA A CA    1 
ATOM   2157  C  C     . ALA E 3 155 ? 19.170  23.540 -143.397 1.00 30.20  ? 451 ALA A C     1 
ATOM   2158  O  O     . ALA E 3 155 ? 19.698  24.633 -143.571 1.00 29.66  ? 451 ALA A O     1 
ATOM   2159  C  CB    . ALA E 3 155 ? 20.349  21.366 -143.864 1.00 29.82  ? 451 ALA A CB    1 
ATOM   2160  N  N     . ALA E 3 156 ? 17.895  23.314 -143.705 1.00 29.95  ? 452 ALA A N     1 
ATOM   2161  C  CA    . ALA E 3 156 ? 17.078  24.392 -144.283 1.00 29.96  ? 452 ALA A CA    1 
ATOM   2162  C  C     . ALA E 3 156 ? 16.979  25.574 -143.319 1.00 29.76  ? 452 ALA A C     1 
ATOM   2163  O  O     . ALA E 3 156 ? 16.956  26.739 -143.734 1.00 29.83  ? 452 ALA A O     1 
ATOM   2164  C  CB    . ALA E 3 156 ? 15.675  23.875 -144.621 1.00 30.29  ? 452 ALA A CB    1 
ATOM   2165  N  N     . ALA E 3 157 ? 16.893  25.255 -142.032 1.00 29.74  ? 453 ALA A N     1 
ATOM   2166  C  CA    . ALA E 3 157 ? 16.801  26.252 -140.985 1.00 30.44  ? 453 ALA A CA    1 
ATOM   2167  C  C     . ALA E 3 157 ? 18.074  27.103 -141.002 1.00 30.63  ? 453 ALA A C     1 
ATOM   2168  O  O     . ALA E 3 157 ? 18.003  28.328 -140.968 1.00 31.33  ? 453 ALA A O     1 
ATOM   2169  C  CB    . ALA E 3 157 ? 16.627  25.564 -139.637 1.00 30.37  ? 453 ALA A CB    1 
ATOM   2170  N  N     . ILE E 3 158 ? 19.230  26.441 -141.080 1.00 30.38  ? 454 ILE A N     1 
ATOM   2171  C  CA    . ILE E 3 158 ? 20.524  27.115 -141.127 1.00 30.11  ? 454 ILE A CA    1 
ATOM   2172  C  C     . ILE E 3 158 ? 20.616  28.001 -142.361 1.00 30.02  ? 454 ILE A C     1 
ATOM   2173  O  O     . ILE E 3 158 ? 21.119  29.117 -142.304 1.00 29.28  ? 454 ILE A O     1 
ATOM   2174  C  CB    . ILE E 3 158 ? 21.684  26.093 -141.169 1.00 29.95  ? 454 ILE A CB    1 
ATOM   2175  C  CG1   . ILE E 3 158 ? 21.802  25.373 -139.820 1.00 30.32  ? 454 ILE A CG1   1 
ATOM   2176  C  CG2   . ILE E 3 158 ? 22.985  26.797 -141.513 1.00 30.47  ? 454 ILE A CG2   1 
ATOM   2177  C  CD1   . ILE E 3 158 ? 22.735  24.183 -139.843 1.00 30.08  ? 454 ILE A CD1   1 
ATOM   2178  N  N     . TRP E 3 159 ? 20.121  27.495 -143.482 1.00 30.04  ? 455 TRP A N     1 
ATOM   2179  C  CA    . TRP E 3 159 ? 20.150  28.251 -144.722 1.00 30.97  ? 455 TRP A CA    1 
ATOM   2180  C  C     . TRP E 3 159 ? 19.483  29.626 -144.571 1.00 31.01  ? 455 TRP A C     1 
ATOM   2181  O  O     . TRP E 3 159 ? 20.043  30.639 -144.978 1.00 30.26  ? 455 TRP A O     1 
ATOM   2182  C  CB    . TRP E 3 159 ? 19.475  27.422 -145.828 1.00 31.88  ? 455 TRP A CB    1 
ATOM   2183  C  CG    . TRP E 3 159 ? 19.466  28.048 -147.197 1.00 33.17  ? 455 TRP A CG    1 
ATOM   2184  C  CD1   . TRP E 3 159 ? 18.400  28.619 -147.829 1.00 34.29  ? 455 TRP A CD1   1 
ATOM   2185  C  CD2   . TRP E 3 159 ? 20.565  28.131 -148.114 1.00 33.93  ? 455 TRP A CD2   1 
ATOM   2186  N  NE1   . TRP E 3 159 ? 18.764  29.050 -149.088 1.00 34.55  ? 455 TRP A NE1   1 
ATOM   2187  C  CE2   . TRP E 3 159 ? 20.089  28.764 -149.286 1.00 34.07  ? 455 TRP A CE2   1 
ATOM   2188  C  CE3   . TRP E 3 159 ? 21.908  27.733 -148.061 1.00 33.75  ? 455 TRP A CE3   1 
ATOM   2189  C  CZ2   . TRP E 3 159 ? 20.909  29.006 -150.398 1.00 33.81  ? 455 TRP A CZ2   1 
ATOM   2190  C  CZ3   . TRP E 3 159 ? 22.721  27.973 -149.169 1.00 33.66  ? 455 TRP A CZ3   1 
ATOM   2191  C  CH2   . TRP E 3 159 ? 22.214  28.606 -150.320 1.00 33.37  ? 455 TRP A CH2   1 
ATOM   2192  N  N     . GLU E 3 160 ? 18.299  29.658 -143.959 1.00 31.09  ? 456 GLU A N     1 
ATOM   2193  C  CA    . GLU E 3 160 ? 17.558  30.904 -143.775 1.00 31.27  ? 456 GLU A CA    1 
ATOM   2194  C  C     . GLU E 3 160 ? 17.967  31.796 -142.599 1.00 30.44  ? 456 GLU A C     1 
ATOM   2195  O  O     . GLU E 3 160 ? 17.780  33.008 -142.653 1.00 29.42  ? 456 GLU A O     1 
ATOM   2196  C  CB    . GLU E 3 160 ? 16.063  30.595 -143.633 1.00 32.87  ? 456 GLU A CB    1 
ATOM   2197  C  CG    . GLU E 3 160 ? 15.527  29.637 -144.685 1.00 35.06  ? 456 GLU A CG    1 
ATOM   2198  C  CD    . GLU E 3 160 ? 15.571  30.222 -146.091 1.00 37.00  ? 456 GLU A CD    1 
ATOM   2199  O  OE1   . GLU E 3 160 ? 15.460  29.435 -147.057 1.00 37.90  ? 456 GLU A OE1   1 
ATOM   2200  O  OE2   . GLU E 3 160 ? 15.706  31.461 -146.230 1.00 37.73  ? 456 GLU A OE2   1 
ATOM   2201  N  N     . LEU E 3 161 ? 18.526  31.225 -141.539 1.00 30.72  ? 457 LEU A N     1 
ATOM   2202  C  CA    . LEU E 3 161 ? 18.858  32.053 -140.375 1.00 32.29  ? 457 LEU A CA    1 
ATOM   2203  C  C     . LEU E 3 161 ? 20.117  32.924 -140.446 1.00 33.33  ? 457 LEU A C     1 
ATOM   2204  O  O     . LEU E 3 161 ? 20.252  33.879 -139.683 1.00 34.08  ? 457 LEU A O     1 
ATOM   2205  C  CB    . LEU E 3 161 ? 18.889  31.174 -139.125 1.00 31.63  ? 457 LEU A CB    1 
ATOM   2206  C  CG    . LEU E 3 161 ? 17.528  30.552 -138.793 1.00 32.47  ? 457 LEU A CG    1 
ATOM   2207  C  CD1   . LEU E 3 161 ? 17.666  29.600 -137.632 1.00 31.43  ? 457 LEU A CD1   1 
ATOM   2208  C  CD2   . LEU E 3 161 ? 16.513  31.650 -138.478 1.00 31.51  ? 457 LEU A CD2   1 
ATOM   2209  N  N     . GLU E 3 162 ? 21.011  32.618 -141.382 1.00 33.95  ? 458 GLU A N     1 
ATOM   2210  C  CA    . GLU E 3 162 ? 22.261  33.361 -141.552 1.00 34.36  ? 458 GLU A CA    1 
ATOM   2211  C  C     . GLU E 3 162 ? 22.071  34.886 -141.655 1.00 34.81  ? 458 GLU A C     1 
ATOM   2212  O  O     . GLU E 3 162 ? 22.696  35.647 -140.911 1.00 34.41  ? 458 GLU A O     1 
ATOM   2213  C  CB    . GLU E 3 162 ? 22.994  32.821 -142.786 1.00 34.49  ? 458 GLU A CB    1 
ATOM   2214  C  CG    . GLU E 3 162 ? 24.427  33.283 -142.958 1.00 35.85  ? 458 GLU A CG    1 
ATOM   2215  C  CD    . GLU E 3 162 ? 25.124  32.568 -144.118 1.00 37.22  ? 458 GLU A CD    1 
ATOM   2216  O  OE1   . GLU E 3 162 ? 26.276  32.923 -144.436 1.00 36.13  ? 458 GLU A OE1   1 
ATOM   2217  O  OE2   . GLU E 3 162 ? 24.516  31.645 -144.713 1.00 38.21  ? 458 GLU A OE2   1 
ATOM   2218  N  N     . ARG E 3 163 ? 21.215  35.335 -142.570 1.00 35.00  ? 459 ARG A N     1 
ATOM   2219  C  CA    . ARG E 3 163 ? 20.954  36.769 -142.741 1.00 34.92  ? 459 ARG A CA    1 
ATOM   2220  C  C     . ARG E 3 163 ? 20.438  37.478 -141.482 1.00 33.93  ? 459 ARG A C     1 
ATOM   2221  O  O     . ARG E 3 163 ? 20.995  38.505 -141.076 1.00 33.83  ? 459 ARG A O     1 
ATOM   2222  C  CB    . ARG E 3 163 ? 19.961  37.005 -143.889 1.00 36.08  ? 459 ARG A CB    1 
ATOM   2223  C  CG    . ARG E 3 163 ? 19.249  38.369 -143.841 1.00 38.60  ? 459 ARG A CG    1 
ATOM   2224  C  CD    . ARG E 3 163 ? 20.105  39.505 -144.378 1.00 38.81  ? 459 ARG A CD    1 
ATOM   2225  N  NE    . ARG E 3 163 ? 21.497  39.388 -143.955 1.00 40.54  ? 459 ARG A NE    1 
ATOM   2226  C  CZ    . ARG E 3 163 ? 22.455  40.256 -144.275 1.00 39.91  ? 459 ARG A CZ    1 
ATOM   2227  N  NH1   . ARG E 3 163 ? 22.173  41.316 -145.026 1.00 38.46  ? 459 ARG A NH1   1 
ATOM   2228  N  NH2   . ARG E 3 163 ? 23.697  40.059 -143.847 1.00 39.43  ? 459 ARG A NH2   1 
ATOM   2229  N  N     . PRO E 3 164 ? 19.349  36.966 -140.871 1.00 32.66  ? 460 PRO A N     1 
ATOM   2230  C  CA    . PRO E 3 164 ? 18.763  37.557 -139.659 1.00 31.59  ? 460 PRO A CA    1 
ATOM   2231  C  C     . PRO E 3 164 ? 19.769  37.654 -138.510 1.00 30.22  ? 460 PRO A C     1 
ATOM   2232  O  O     . PRO E 3 164 ? 19.922  38.709 -137.875 1.00 29.89  ? 460 PRO A O     1 
ATOM   2233  C  CB    . PRO E 3 164 ? 17.620  36.598 -139.323 1.00 31.95  ? 460 PRO A CB    1 
ATOM   2234  C  CG    . PRO E 3 164 ? 17.218  36.065 -140.636 1.00 32.20  ? 460 PRO A CG    1 
ATOM   2235  C  CD    . PRO E 3 164 ? 18.544  35.816 -141.319 1.00 32.97  ? 460 PRO A CD    1 
ATOM   2236  N  N     . PHE E 3 165 ? 20.448  36.538 -138.248 1.00 29.38  ? 461 PHE A N     1 
ATOM   2237  C  CA    . PHE E 3 165 ? 21.447  36.472 -137.190 1.00 27.70  ? 461 PHE A CA    1 
ATOM   2238  C  C     . PHE E 3 165 ? 22.633  37.390 -137.446 1.00 27.81  ? 461 PHE A C     1 
ATOM   2239  O  O     . PHE E 3 165 ? 23.139  37.999 -136.517 1.00 28.15  ? 461 PHE A O     1 
ATOM   2240  C  CB    . PHE E 3 165 ? 21.934  35.027 -136.990 1.00 25.88  ? 461 PHE A CB    1 
ATOM   2241  C  CG    . PHE E 3 165 ? 21.109  34.247 -136.005 1.00 23.85  ? 461 PHE A CG    1 
ATOM   2242  C  CD1   . PHE E 3 165 ? 19.993  33.515 -136.424 1.00 23.42  ? 461 PHE A CD1   1 
ATOM   2243  C  CD2   . PHE E 3 165 ? 21.383  34.331 -134.643 1.00 21.93  ? 461 PHE A CD2   1 
ATOM   2244  C  CE1   . PHE E 3 165 ? 19.156  32.887 -135.496 1.00 22.30  ? 461 PHE A CE1   1 
ATOM   2245  C  CE2   . PHE E 3 165 ? 20.560  33.715 -133.700 1.00 21.58  ? 461 PHE A CE2   1 
ATOM   2246  C  CZ    . PHE E 3 165 ? 19.434  32.985 -134.121 1.00 21.85  ? 461 PHE A CZ    1 
ATOM   2247  N  N     . LEU E 3 166 ? 23.075  37.507 -138.696 1.00 28.03  ? 462 LEU A N     1 
ATOM   2248  C  CA    . LEU E 3 166 ? 24.212  38.372 -138.993 1.00 29.10  ? 462 LEU A CA    1 
ATOM   2249  C  C     . LEU E 3 166 ? 23.875  39.854 -138.902 1.00 29.96  ? 462 LEU A C     1 
ATOM   2250  O  O     . LEU E 3 166 ? 24.724  40.664 -138.531 1.00 29.13  ? 462 LEU A O     1 
ATOM   2251  C  CB    . LEU E 3 166 ? 24.796  38.062 -140.375 1.00 28.65  ? 462 LEU A CB    1 
ATOM   2252  C  CG    . LEU E 3 166 ? 25.751  36.865 -140.414 1.00 29.10  ? 462 LEU A CG    1 
ATOM   2253  C  CD1   . LEU E 3 166 ? 26.163  36.551 -141.843 1.00 29.22  ? 462 LEU A CD1   1 
ATOM   2254  C  CD2   . LEU E 3 166 ? 26.964  37.177 -139.557 1.00 28.70  ? 462 LEU A CD2   1 
ATOM   2255  N  N     . ASP E 3 167 ? 22.636  40.208 -139.230 1.00 31.49  ? 463 ASP A N     1 
ATOM   2256  C  CA    . ASP E 3 167 ? 22.220  41.602 -139.169 1.00 33.24  ? 463 ASP A CA    1 
ATOM   2257  C  C     . ASP E 3 167 ? 22.195  42.114 -137.736 1.00 33.84  ? 463 ASP A C     1 
ATOM   2258  O  O     . ASP E 3 167 ? 22.769  43.164 -137.451 1.00 34.14  ? 463 ASP A O     1 
ATOM   2259  C  CB    . ASP E 3 167 ? 20.846  41.791 -139.831 1.00 34.26  ? 463 ASP A CB    1 
ATOM   2260  C  CG    . ASP E 3 167 ? 20.959  42.193 -141.294 1.00 35.98  ? 463 ASP A CG    1 
ATOM   2261  O  OD1   . ASP E 3 167 ? 19.940  42.144 -142.014 1.00 36.63  ? 463 ASP A OD1   1 
ATOM   2262  O  OD2   . ASP E 3 167 ? 22.073  42.563 -141.729 1.00 37.16  ? 463 ASP A OD2   1 
ATOM   2263  N  N     . GLU E 3 168 ? 21.546  41.378 -136.831 1.00 34.82  ? 464 GLU A N     1 
ATOM   2264  C  CA    . GLU E 3 168 ? 21.492  41.799 -135.438 1.00 35.21  ? 464 GLU A CA    1 
ATOM   2265  C  C     . GLU E 3 168 ? 22.917  41.885 -134.876 1.00 35.15  ? 464 GLU A C     1 
ATOM   2266  O  O     . GLU E 3 168 ? 23.221  42.740 -134.042 1.00 35.31  ? 464 GLU A O     1 
ATOM   2267  C  CB    . GLU E 3 168 ? 20.647  40.837 -134.596 1.00 36.02  ? 464 GLU A CB    1 
ATOM   2268  C  CG    . GLU E 3 168 ? 20.319  41.416 -133.219 1.00 37.69  ? 464 GLU A CG    1 
ATOM   2269  C  CD    . GLU E 3 168 ? 19.682  40.425 -132.252 1.00 39.20  ? 464 GLU A CD    1 
ATOM   2270  O  OE1   . GLU E 3 168 ? 19.497  40.808 -131.075 1.00 40.00  ? 464 GLU A OE1   1 
ATOM   2271  O  OE2   . GLU E 3 168 ? 19.364  39.276 -132.651 1.00 39.61  ? 464 GLU A OE2   1 
ATOM   2272  N  N     . LEU E 3 169 ? 23.793  40.996 -135.328 1.00 34.97  ? 465 LEU A N     1 
ATOM   2273  C  CA    . LEU E 3 169 ? 25.183  41.037 -134.885 1.00 34.37  ? 465 LEU A CA    1 
ATOM   2274  C  C     . LEU E 3 169 ? 25.792  42.345 -135.401 1.00 34.51  ? 465 LEU A C     1 
ATOM   2275  O  O     . LEU E 3 169 ? 26.449  43.087 -134.664 1.00 33.74  ? 465 LEU A O     1 
ATOM   2276  C  CB    . LEU E 3 169 ? 25.947  39.822 -135.424 1.00 32.99  ? 465 LEU A CB    1 
ATOM   2277  C  CG    . LEU E 3 169 ? 25.716  38.534 -134.626 1.00 32.64  ? 465 LEU A CG    1 
ATOM   2278  C  CD1   . LEU E 3 169 ? 26.202  37.315 -135.392 1.00 31.99  ? 465 LEU A CD1   1 
ATOM   2279  C  CD2   . LEU E 3 169 ? 26.435  38.653 -133.299 1.00 31.50  ? 465 LEU A CD2   1 
ATOM   2280  N  N     . ARG E 3 170 ? 25.539  42.637 -136.671 1.00 35.60  ? 466 ARG A N     1 
ATOM   2281  C  CA    . ARG E 3 170 ? 26.039  43.853 -137.288 1.00 36.83  ? 466 ARG A CA    1 
ATOM   2282  C  C     . ARG E 3 170 ? 25.591  45.093 -136.512 1.00 37.12  ? 466 ARG A C     1 
ATOM   2283  O  O     . ARG E 3 170 ? 26.396  45.996 -136.256 1.00 37.00  ? 466 ARG A O     1 
ATOM   2284  C  CB    . ARG E 3 170 ? 25.553  43.929 -138.734 1.00 38.67  ? 466 ARG A CB    1 
ATOM   2285  C  CG    . ARG E 3 170 ? 26.093  45.112 -139.511 1.00 41.04  ? 466 ARG A CG    1 
ATOM   2286  C  CD    . ARG E 3 170 ? 25.701  45.024 -140.983 1.00 43.44  ? 466 ARG A CD    1 
ATOM   2287  N  NE    . ARG E 3 170 ? 26.305  46.099 -141.763 1.00 45.52  ? 466 ARG A NE    1 
ATOM   2288  C  CZ    . ARG E 3 170 ? 26.015  47.388 -141.614 1.00 46.50  ? 466 ARG A CZ    1 
ATOM   2289  N  NH1   . ARG E 3 170 ? 25.116  47.771 -140.711 1.00 46.93  ? 466 ARG A NH1   1 
ATOM   2290  N  NH2   . ARG E 3 170 ? 26.640  48.296 -142.356 1.00 47.09  ? 466 ARG A NH2   1 
ATOM   2291  N  N     . ARG E 3 171 ? 24.310  45.145 -136.143 1.00 36.97  ? 467 ARG A N     1 
ATOM   2292  C  CA    . ARG E 3 171 ? 23.790  46.284 -135.385 1.00 37.35  ? 467 ARG A CA    1 
ATOM   2293  C  C     . ARG E 3 171 ? 24.391  46.323 -133.971 1.00 36.96  ? 467 ARG A C     1 
ATOM   2294  O  O     . ARG E 3 171 ? 24.566  47.393 -133.396 1.00 37.07  ? 467 ARG A O     1 
ATOM   2295  C  CB    . ARG E 3 171 ? 22.254  46.221 -135.287 1.00 37.81  ? 467 ARG A CB    1 
ATOM   2296  C  CG    . ARG E 3 171 ? 21.503  46.328 -136.616 1.00 37.82  ? 467 ARG A CG    1 
ATOM   2297  C  CD    . ARG E 3 171 ? 19.979  46.349 -136.386 1.00 37.67  ? 467 ARG A CD    1 
ATOM   2298  N  NE    . ARG E 3 171 ? 19.490  45.107 -135.786 1.00 37.05  ? 467 ARG A NE    1 
ATOM   2299  C  CZ    . ARG E 3 171 ? 19.015  44.073 -136.479 1.00 36.12  ? 467 ARG A CZ    1 
ATOM   2300  N  NH1   . ARG E 3 171 ? 18.947  44.128 -137.806 1.00 35.65  ? 467 ARG A NH1   1 
ATOM   2301  N  NH2   . ARG E 3 171 ? 18.637  42.974 -135.849 1.00 34.52  ? 467 ARG A NH2   1 
ATOM   2302  N  N     . ASN E 3 172 ? 24.698  45.152 -133.422 1.00 37.00  ? 468 ASN A N     1 
ATOM   2303  C  CA    . ASN E 3 172 ? 25.287  45.025 -132.083 1.00 37.19  ? 468 ASN A CA    1 
ATOM   2304  C  C     . ASN E 3 172 ? 26.808  45.153 -132.085 1.00 37.74  ? 468 ASN A C     1 
ATOM   2305  O  O     . ASN E 3 172 ? 27.441  44.963 -131.044 1.00 38.07  ? 468 ASN A O     1 
ATOM   2306  C  CB    . ASN E 3 172 ? 24.963  43.653 -131.492 1.00 36.72  ? 468 ASN A CB    1 
ATOM   2307  C  CG    . ASN E 3 172 ? 23.555  43.552 -130.980 1.00 36.28  ? 468 ASN A CG    1 
ATOM   2308  O  OD1   . ASN E 3 172 ? 23.061  42.453 -130.735 1.00 37.72  ? 468 ASN A OD1   1 
ATOM   2309  N  ND2   . ASN E 3 172 ? 22.900  44.688 -130.803 1.00 35.49  ? 468 ASN A ND2   1 
ATOM   2310  N  N     . GLU E 3 173 ? 27.389  45.460 -133.244 1.00 37.62  ? 469 GLU A N     1 
ATOM   2311  C  CA    . GLU E 3 173 ? 28.843  45.558 -133.376 1.00 37.24  ? 469 GLU A CA    1 
ATOM   2312  C  C     . GLU E 3 173 ? 29.505  44.252 -132.931 1.00 36.55  ? 469 GLU A C     1 
ATOM   2313  O  O     . GLU E 3 173 ? 30.548  44.277 -132.286 1.00 36.35  ? 469 GLU A O     1 
ATOM   2314  C  CB    . GLU E 3 173 ? 29.404  46.711 -132.541 1.00 38.27  ? 469 GLU A CB    1 
ATOM   2315  C  CG    . GLU E 3 173 ? 29.295  48.081 -133.180 1.00 38.92  ? 469 GLU A CG    1 
ATOM   2316  C  CD    . GLU E 3 173 ? 30.187  49.103 -132.493 1.00 40.01  ? 469 GLU A CD    1 
ATOM   2317  O  OE1   . GLU E 3 173 ? 29.963  49.389 -131.298 1.00 39.74  ? 469 GLU A OE1   1 
ATOM   2318  O  OE2   . GLU E 3 173 ? 31.122  49.613 -133.151 1.00 41.55  ? 469 GLU A OE2   1 
ATOM   2319  N  N     . GLN E 3 174 ? 28.889  43.122 -133.281 1.00 35.91  ? 470 GLN A N     1 
ATOM   2320  C  CA    . GLN E 3 174 ? 29.391  41.789 -132.932 1.00 35.30  ? 470 GLN A CA    1 
ATOM   2321  C  C     . GLN E 3 174 ? 29.646  40.911 -134.160 1.00 34.33  ? 470 GLN A C     1 
ATOM   2322  O  O     . GLN E 3 174 ? 29.964  39.725 -134.026 1.00 33.20  ? 470 GLN A O     1 
ATOM   2323  C  CB    . GLN E 3 174 ? 28.393  41.057 -132.036 1.00 35.74  ? 470 GLN A CB    1 
ATOM   2324  C  CG    . GLN E 3 174 ? 28.048  41.763 -130.743 1.00 37.17  ? 470 GLN A CG    1 
ATOM   2325  C  CD    . GLN E 3 174 ? 27.102  40.946 -129.900 1.00 37.03  ? 470 GLN A CD    1 
ATOM   2326  O  OE1   . GLN E 3 174 ? 26.025  40.571 -130.351 1.00 38.50  ? 470 GLN A OE1   1 
ATOM   2327  N  NE2   . GLN E 3 174 ? 27.500  40.660 -128.669 1.00 37.73  ? 470 GLN A NE2   1 
ATOM   2328  N  N     . ASP E 3 175 ? 29.484  41.482 -135.350 1.00 33.69  ? 471 ASP A N     1 
ATOM   2329  C  CA    . ASP E 3 175 ? 29.693  40.731 -136.580 1.00 33.06  ? 471 ASP A CA    1 
ATOM   2330  C  C     . ASP E 3 175 ? 31.157  40.301 -136.705 1.00 32.04  ? 471 ASP A C     1 
ATOM   2331  O  O     . ASP E 3 175 ? 31.442  39.158 -137.056 1.00 31.33  ? 471 ASP A O     1 
ATOM   2332  C  CB    . ASP E 3 175 ? 29.253  41.562 -137.802 1.00 34.00  ? 471 ASP A CB    1 
ATOM   2333  C  CG    . ASP E 3 175 ? 29.878  42.938 -137.832 1.00 35.34  ? 471 ASP A CG    1 
ATOM   2334  O  OD1   . ASP E 3 175 ? 29.713  43.700 -136.857 1.00 36.82  ? 471 ASP A OD1   1 
ATOM   2335  O  OD2   . ASP E 3 175 ? 30.538  43.269 -138.838 1.00 37.16  ? 471 ASP A OD2   1 
ATOM   2336  N  N     . ARG E 3 176 ? 32.082  41.204 -136.401 1.00 30.73  ? 472 ARG A N     1 
ATOM   2337  C  CA    . ARG E 3 176 ? 33.498  40.860 -136.473 1.00 30.19  ? 472 ARG A CA    1 
ATOM   2338  C  C     . ARG E 3 176 ? 33.848  39.923 -135.323 1.00 29.25  ? 472 ARG A C     1 
ATOM   2339  O  O     . ARG E 3 176 ? 34.692  39.039 -135.466 1.00 28.87  ? 472 ARG A O     1 
ATOM   2340  C  CB    . ARG E 3 176 ? 34.370  42.118 -136.383 1.00 31.06  ? 472 ARG A CB    1 
ATOM   2341  C  CG    . ARG E 3 176 ? 34.111  43.164 -137.461 1.00 32.04  ? 472 ARG A CG    1 
ATOM   2342  C  CD    . ARG E 3 176 ? 35.058  44.342 -137.273 1.00 33.44  ? 472 ARG A CD    1 
ATOM   2343  N  NE    . ARG E 3 176 ? 36.443  43.961 -137.553 1.00 35.05  ? 472 ARG A NE    1 
ATOM   2344  C  CZ    . ARG E 3 176 ? 37.515  44.574 -137.059 1.00 34.91  ? 472 ARG A CZ    1 
ATOM   2345  N  NH1   . ARG E 3 176 ? 37.381  45.609 -136.242 1.00 36.16  ? 472 ARG A NH1   1 
ATOM   2346  N  NH2   . ARG E 3 176 ? 38.724  44.155 -137.393 1.00 35.74  ? 472 ARG A NH2   1 
ATOM   2347  N  N     . LEU E 3 177 ? 33.195  40.122 -134.177 1.00 27.92  ? 473 LEU A N     1 
ATOM   2348  C  CA    . LEU E 3 177 ? 33.447  39.297 -133.004 1.00 26.05  ? 473 LEU A CA    1 
ATOM   2349  C  C     . LEU E 3 177 ? 33.068  37.855 -133.346 1.00 25.73  ? 473 LEU A C     1 
ATOM   2350  O  O     . LEU E 3 177 ? 33.629  36.898 -132.802 1.00 25.16  ? 473 LEU A O     1 
ATOM   2351  C  CB    . LEU E 3 177 ? 32.630  39.818 -131.810 1.00 25.95  ? 473 LEU A CB    1 
ATOM   2352  C  CG    . LEU E 3 177 ? 32.624  39.095 -130.452 1.00 25.97  ? 473 LEU A CG    1 
ATOM   2353  C  CD1   . LEU E 3 177 ? 34.017  38.758 -129.958 1.00 25.25  ? 473 LEU A CD1   1 
ATOM   2354  C  CD2   . LEU E 3 177 ? 31.921  39.993 -129.448 1.00 25.49  ? 473 LEU A CD2   1 
ATOM   2355  N  N     . LEU E 3 178 ? 32.126  37.705 -134.260 1.00 24.32  ? 474 LEU A N     1 
ATOM   2356  C  CA    . LEU E 3 178 ? 31.716  36.366 -134.678 1.00 25.76  ? 474 LEU A CA    1 
ATOM   2357  C  C     . LEU E 3 178 ? 32.694  35.770 -135.688 1.00 26.22  ? 474 LEU A C     1 
ATOM   2358  O  O     . LEU E 3 178 ? 33.320  34.737 -135.436 1.00 26.36  ? 474 LEU A O     1 
ATOM   2359  C  CB    . LEU E 3 178 ? 30.331  36.385 -135.314 1.00 24.26  ? 474 LEU A CB    1 
ATOM   2360  C  CG    . LEU E 3 178 ? 29.959  35.072 -136.027 1.00 24.06  ? 474 LEU A CG    1 
ATOM   2361  C  CD1   . LEU E 3 178 ? 30.087  33.904 -135.054 1.00 23.64  ? 474 LEU A CD1   1 
ATOM   2362  C  CD2   . LEU E 3 178 ? 28.554  35.155 -136.576 1.00 24.33  ? 474 LEU A CD2   1 
ATOM   2363  N  N     . VAL E 3 179 ? 32.806  36.453 -136.822 1.00 27.18  ? 475 VAL A N     1 
ATOM   2364  C  CA    . VAL E 3 179 ? 33.637  36.057 -137.948 1.00 28.49  ? 475 VAL A CA    1 
ATOM   2365  C  C     . VAL E 3 179 ? 35.153  36.071 -137.740 1.00 29.25  ? 475 VAL A C     1 
ATOM   2366  O  O     . VAL E 3 179 ? 35.833  35.117 -138.093 1.00 28.93  ? 475 VAL A O     1 
ATOM   2367  C  CB    . VAL E 3 179 ? 33.303  36.939 -139.179 1.00 29.17  ? 475 VAL A CB    1 
ATOM   2368  C  CG1   . VAL E 3 179 ? 34.246  36.630 -140.331 1.00 29.76  ? 475 VAL A CG1   1 
ATOM   2369  C  CG2   . VAL E 3 179 ? 31.857  36.704 -139.601 1.00 29.15  ? 475 VAL A CG2   1 
ATOM   2370  N  N     . GLU E 3 180 ? 35.677  37.153 -137.177 1.00 30.07  ? 476 GLU A N     1 
ATOM   2371  C  CA    . GLU E 3 180 ? 37.108  37.265 -136.955 1.00 30.80  ? 476 GLU A CA    1 
ATOM   2372  C  C     . GLU E 3 180 ? 37.611  36.744 -135.604 1.00 30.94  ? 476 GLU A C     1 
ATOM   2373  O  O     . GLU E 3 180 ? 38.816  36.670 -135.396 1.00 30.87  ? 476 GLU A O     1 
ATOM   2374  C  CB    . GLU E 3 180 ? 37.532  38.720 -137.163 1.00 31.04  ? 476 GLU A CB    1 
ATOM   2375  C  CG    . GLU E 3 180 ? 37.106  39.243 -138.519 1.00 31.92  ? 476 GLU A CG    1 
ATOM   2376  C  CD    . GLU E 3 180 ? 37.046  40.743 -138.568 1.00 33.14  ? 476 GLU A CD    1 
ATOM   2377  O  OE1   . GLU E 3 180 ? 36.316  41.285 -139.430 1.00 35.02  ? 476 GLU A OE1   1 
ATOM   2378  O  OE2   . GLU E 3 180 ? 37.732  41.388 -137.752 1.00 34.02  ? 476 GLU A OE2   1 
ATOM   2379  N  N     . LEU E 3 181 ? 36.716  36.384 -134.680 1.00 30.65  ? 477 LEU A N     1 
ATOM   2380  C  CA    . LEU E 3 181 ? 37.190  35.846 -133.399 1.00 29.90  ? 477 LEU A CA    1 
ATOM   2381  C  C     . LEU E 3 181 ? 36.621  34.468 -133.055 1.00 29.88  ? 477 LEU A C     1 
ATOM   2382  O  O     . LEU E 3 181 ? 37.346  33.474 -133.078 1.00 29.33  ? 477 LEU A O     1 
ATOM   2383  C  CB    . LEU E 3 181 ? 36.919  36.822 -132.253 1.00 30.87  ? 477 LEU A CB    1 
ATOM   2384  C  CG    . LEU E 3 181 ? 37.637  36.541 -130.927 1.00 31.11  ? 477 LEU A CG    1 
ATOM   2385  C  CD1   . LEU E 3 181 ? 38.533  37.739 -130.579 1.00 31.61  ? 477 LEU A CD1   1 
ATOM   2386  C  CD2   . LEU E 3 181 ? 36.631  36.307 -129.805 1.00 31.96  ? 477 LEU A CD2   1 
ATOM   2387  N  N     . GLU E 3 182 ? 35.332  34.396 -132.733 1.00 29.05  ? 478 GLU A N     1 
ATOM   2388  C  CA    . GLU E 3 182 ? 34.719  33.118 -132.381 1.00 28.83  ? 478 GLU A CA    1 
ATOM   2389  C  C     . GLU E 3 182 ? 34.842  32.003 -133.428 1.00 28.46  ? 478 GLU A C     1 
ATOM   2390  O  O     . GLU E 3 182 ? 35.149  30.855 -133.082 1.00 29.20  ? 478 GLU A O     1 
ATOM   2391  C  CB    . GLU E 3 182 ? 33.229  33.302 -132.046 1.00 29.36  ? 478 GLU A CB    1 
ATOM   2392  C  CG    . GLU E 3 182 ? 32.885  34.384 -131.016 1.00 29.76  ? 478 GLU A CG    1 
ATOM   2393  C  CD    . GLU E 3 182 ? 33.512  34.182 -129.646 1.00 30.01  ? 478 GLU A CD    1 
ATOM   2394  O  OE1   . GLU E 3 182 ? 33.715  33.024 -129.226 1.00 31.46  ? 478 GLU A OE1   1 
ATOM   2395  O  OE2   . GLU E 3 182 ? 33.785  35.200 -128.970 1.00 31.01  ? 478 GLU A OE2   1 
ATOM   2396  N  N     . GLN E 3 183 ? 34.579  32.301 -134.697 1.00 27.84  ? 479 GLN A N     1 
ATOM   2397  C  CA    . GLN E 3 183 ? 34.685  31.242 -135.701 1.00 27.71  ? 479 GLN A CA    1 
ATOM   2398  C  C     . GLN E 3 183 ? 36.144  30.815 -135.915 1.00 27.16  ? 479 GLN A C     1 
ATOM   2399  O  O     . GLN E 3 183 ? 36.430  29.626 -136.049 1.00 25.91  ? 479 GLN A O     1 
ATOM   2400  C  CB    . GLN E 3 183 ? 34.003  31.656 -137.020 1.00 28.00  ? 479 GLN A CB    1 
ATOM   2401  C  CG    . GLN E 3 183 ? 32.459  31.491 -136.964 1.00 29.58  ? 479 GLN A CG    1 
ATOM   2402  C  CD    . GLN E 3 183 ? 31.686  32.286 -138.036 1.00 29.90  ? 479 GLN A CD    1 
ATOM   2403  O  OE1   . GLN E 3 183 ? 30.451  32.248 -138.077 1.00 29.43  ? 479 GLN A OE1   1 
ATOM   2404  N  NE2   . GLN E 3 183 ? 32.404  33.001 -138.891 1.00 30.44  ? 479 GLN A NE2   1 
ATOM   2405  N  N     . PRO E 3 184 ? 37.087  31.771 -135.934 1.00 26.01  ? 480 PRO A N     1 
ATOM   2406  C  CA    . PRO E 3 184 ? 38.464  31.294 -136.131 1.00 26.66  ? 480 PRO A CA    1 
ATOM   2407  C  C     . PRO E 3 184 ? 38.887  30.336 -135.012 1.00 27.11  ? 480 PRO A C     1 
ATOM   2408  O  O     . PRO E 3 184 ? 39.495  29.302 -135.283 1.00 28.66  ? 480 PRO A O     1 
ATOM   2409  C  CB    . PRO E 3 184 ? 39.279  32.591 -136.136 1.00 26.78  ? 480 PRO A CB    1 
ATOM   2410  C  CG    . PRO E 3 184 ? 38.338  33.550 -136.843 1.00 26.51  ? 480 PRO A CG    1 
ATOM   2411  C  CD    . PRO E 3 184 ? 36.994  33.227 -136.160 1.00 26.24  ? 480 PRO A CD    1 
ATOM   2412  N  N     . LEU E 3 185 ? 38.549  30.680 -133.766 1.00 26.73  ? 481 LEU A N     1 
ATOM   2413  C  CA    . LEU E 3 185 ? 38.879  29.867 -132.591 1.00 26.70  ? 481 LEU A CA    1 
ATOM   2414  C  C     . LEU E 3 185 ? 38.292  28.451 -132.620 1.00 27.16  ? 481 LEU A C     1 
ATOM   2415  O  O     . LEU E 3 185 ? 38.875  27.511 -132.076 1.00 25.87  ? 481 LEU A O     1 
ATOM   2416  C  CB    . LEU E 3 185 ? 38.404  30.575 -131.313 1.00 26.54  ? 481 LEU A CB    1 
ATOM   2417  C  CG    . LEU E 3 185 ? 38.604  29.811 -129.997 1.00 26.12  ? 481 LEU A CG    1 
ATOM   2418  C  CD1   . LEU E 3 185 ? 40.085  29.610 -129.748 1.00 25.13  ? 481 LEU A CD1   1 
ATOM   2419  C  CD2   . LEU E 3 185 ? 37.976  30.553 -128.839 1.00 26.44  ? 481 LEU A CD2   1 
ATOM   2420  N  N     . SER E 3 186 ? 37.129  28.302 -133.241 1.00 28.41  ? 482 SER A N     1 
ATOM   2421  C  CA    . SER E 3 186 ? 36.483  26.995 -133.325 1.00 29.24  ? 482 SER A CA    1 
ATOM   2422  C  C     . SER E 3 186 ? 37.360  25.955 -134.046 1.00 29.23  ? 482 SER A C     1 
ATOM   2423  O  O     . SER E 3 186 ? 37.360  24.779 -133.683 1.00 29.14  ? 482 SER A O     1 
ATOM   2424  C  CB    . SER E 3 186 ? 35.119  27.123 -134.022 1.00 29.86  ? 482 SER A CB    1 
ATOM   2425  O  OG    . SER E 3 186 ? 34.505  25.849 -134.175 1.00 29.61  ? 482 SER A OG    1 
ATOM   2426  N  N     . SER E 3 187 ? 38.111  26.382 -135.058 1.00 29.49  ? 483 SER A N     1 
ATOM   2427  C  CA    . SER E 3 187 ? 38.983  25.458 -135.795 1.00 29.15  ? 483 SER A CA    1 
ATOM   2428  C  C     . SER E 3 187 ? 40.221  25.071 -134.983 1.00 28.11  ? 483 SER A C     1 
ATOM   2429  O  O     . SER E 3 187 ? 40.707  23.931 -135.061 1.00 27.05  ? 483 SER A O     1 
ATOM   2430  C  CB    . SER E 3 187 ? 39.393  26.080 -137.131 1.00 30.14  ? 483 SER A CB    1 
ATOM   2431  O  OG    . SER E 3 187 ? 39.745  27.446 -136.961 1.00 33.42  ? 483 SER A OG    1 
ATOM   2432  N  N     . ILE E 3 188 ? 40.703  26.025 -134.189 1.00 27.16  ? 484 ILE A N     1 
ATOM   2433  C  CA    . ILE E 3 188 ? 41.859  25.836 -133.326 1.00 25.93  ? 484 ILE A CA    1 
ATOM   2434  C  C     . ILE E 3 188 ? 41.532  24.902 -132.164 1.00 25.60  ? 484 ILE A C     1 
ATOM   2435  O  O     . ILE E 3 188 ? 42.351  24.061 -131.789 1.00 24.09  ? 484 ILE A O     1 
ATOM   2436  C  CB    . ILE E 3 188 ? 42.349  27.193 -132.761 1.00 26.17  ? 484 ILE A CB    1 
ATOM   2437  C  CG1   . ILE E 3 188 ? 42.627  28.167 -133.913 1.00 25.56  ? 484 ILE A CG1   1 
ATOM   2438  C  CG2   . ILE E 3 188 ? 43.594  26.988 -131.939 1.00 26.90  ? 484 ILE A CG2   1 
ATOM   2439  C  CD1   . ILE E 3 188 ? 43.015  29.570 -133.461 1.00 25.92  ? 484 ILE A CD1   1 
ATOM   2440  N  N     . LEU E 3 189 ? 40.333  25.046 -131.592 1.00 24.97  ? 485 LEU A N     1 
ATOM   2441  C  CA    . LEU E 3 189 ? 39.905  24.193 -130.490 1.00 24.73  ? 485 LEU A CA    1 
ATOM   2442  C  C     . LEU E 3 189 ? 39.668  22.781 -131.015 1.00 24.84  ? 485 LEU A C     1 
ATOM   2443  O  O     . LEU E 3 189 ? 39.854  21.808 -130.289 1.00 25.48  ? 485 LEU A O     1 
ATOM   2444  C  CB    . LEU E 3 189 ? 38.602  24.730 -129.849 1.00 24.47  ? 485 LEU A CB    1 
ATOM   2445  C  CG    . LEU E 3 189 ? 38.648  26.066 -129.085 1.00 23.85  ? 485 LEU A CG    1 
ATOM   2446  C  CD1   . LEU E 3 189 ? 37.220  26.584 -128.729 1.00 23.98  ? 485 LEU A CD1   1 
ATOM   2447  C  CD2   . LEU E 3 189 ? 39.441  25.860 -127.831 1.00 22.38  ? 485 LEU A CD2   1 
ATOM   2448  N  N     . ALA E 3 190 ? 39.268  22.664 -132.279 1.00 25.56  ? 486 ALA A N     1 
ATOM   2449  C  CA    . ALA E 3 190 ? 39.024  21.339 -132.859 1.00 26.25  ? 486 ALA A CA    1 
ATOM   2450  C  C     . ALA E 3 190 ? 40.353  20.569 -132.905 1.00 26.72  ? 486 ALA A C     1 
ATOM   2451  O  O     . ALA E 3 190 ? 40.407  19.384 -132.562 1.00 25.59  ? 486 ALA A O     1 
ATOM   2452  C  CB    . ALA E 3 190 ? 38.431  21.468 -134.260 1.00 24.97  ? 486 ALA A CB    1 
ATOM   2453  N  N     . GLU E 3 191 ? 41.421  21.265 -133.300 1.00 27.64  ? 487 GLU A N     1 
ATOM   2454  C  CA    . GLU E 3 191 ? 42.755  20.663 -133.374 1.00 28.65  ? 487 GLU A CA    1 
ATOM   2455  C  C     . GLU E 3 191 ? 43.199  20.215 -131.996 1.00 29.18  ? 487 GLU A C     1 
ATOM   2456  O  O     . GLU E 3 191 ? 43.716  19.109 -131.825 1.00 29.47  ? 487 GLU A O     1 
ATOM   2457  C  CB    . GLU E 3 191 ? 43.798  21.666 -133.886 1.00 29.60  ? 487 GLU A CB    1 
ATOM   2458  C  CG    . GLU E 3 191 ? 43.789  21.951 -135.367 1.00 31.89  ? 487 GLU A CG    1 
ATOM   2459  C  CD    . GLU E 3 191 ? 45.149  22.430 -135.864 1.00 33.42  ? 487 GLU A CD    1 
ATOM   2460  O  OE1   . GLU E 3 191 ? 45.852  23.128 -135.092 1.00 34.91  ? 487 GLU A OE1   1 
ATOM   2461  O  OE2   . GLU E 3 191 ? 45.512  22.120 -137.028 1.00 34.60  ? 487 GLU A OE2   1 
ATOM   2462  N  N     . MET E 3 192 ? 43.020  21.099 -131.018 1.00 29.70  ? 488 MET A N     1 
ATOM   2463  C  CA    . MET E 3 192 ? 43.405  20.819 -129.637 1.00 29.71  ? 488 MET A CA    1 
ATOM   2464  C  C     . MET E 3 192 ? 42.722  19.571 -129.088 1.00 30.20  ? 488 MET A C     1 
ATOM   2465  O  O     . MET E 3 192 ? 43.332  18.769 -128.381 1.00 30.39  ? 488 MET A O     1 
ATOM   2466  C  CB    . MET E 3 192 ? 43.082  22.030 -128.770 1.00 28.95  ? 488 MET A CB    1 
ATOM   2467  C  CG    . MET E 3 192 ? 43.891  23.247 -129.156 1.00 29.39  ? 488 MET A CG    1 
ATOM   2468  S  SD    . MET E 3 192 ? 43.186  24.803 -128.580 1.00 27.37  ? 488 MET A SD    1 
ATOM   2469  C  CE    . MET E 3 192 ? 43.476  24.651 -126.773 1.00 27.21  ? 488 MET A CE    1 
ATOM   2470  N  N     . GLU E 3 193 ? 41.444  19.416 -129.412 1.00 30.79  ? 489 GLU A N     1 
ATOM   2471  C  CA    . GLU E 3 193 ? 40.679  18.260 -128.968 1.00 30.02  ? 489 GLU A CA    1 
ATOM   2472  C  C     . GLU E 3 193 ? 41.138  17.017 -129.722 1.00 29.40  ? 489 GLU A C     1 
ATOM   2473  O  O     . GLU E 3 193 ? 41.424  15.976 -129.123 1.00 29.40  ? 489 GLU A O     1 
ATOM   2474  C  CB    . GLU E 3 193 ? 39.181  18.503 -129.210 1.00 30.03  ? 489 GLU A CB    1 
ATOM   2475  C  CG    . GLU E 3 193 ? 38.601  19.661 -128.411 1.00 29.59  ? 489 GLU A CG    1 
ATOM   2476  C  CD    . GLU E 3 193 ? 37.132  19.946 -128.748 1.00 31.69  ? 489 GLU A CD    1 
ATOM   2477  O  OE1   . GLU E 3 193 ? 36.589  20.944 -128.213 1.00 30.15  ? 489 GLU A OE1   1 
ATOM   2478  O  OE2   . GLU E 3 193 ? 36.530  19.173 -129.540 1.00 29.75  ? 489 GLU A OE2   1 
ATOM   2479  N  N     . PHE E 3 194 ? 41.214  17.119 -131.044 1.00 29.31  ? 490 PHE A N     1 
ATOM   2480  C  CA    . PHE E 3 194 ? 41.637  15.974 -131.846 1.00 29.48  ? 490 PHE A CA    1 
ATOM   2481  C  C     . PHE E 3 194 ? 43.074  15.607 -131.512 1.00 29.19  ? 490 PHE A C     1 
ATOM   2482  O  O     . PHE E 3 194 ? 43.444  14.443 -131.579 1.00 29.12  ? 490 PHE A O     1 
ATOM   2483  C  CB    . PHE E 3 194 ? 41.542  16.285 -133.337 1.00 29.25  ? 490 PHE A CB    1 
ATOM   2484  C  CG    . PHE E 3 194 ? 41.822  15.111 -134.207 1.00 29.75  ? 490 PHE A CG    1 
ATOM   2485  C  CD1   . PHE E 3 194 ? 40.906  14.068 -134.303 1.00 27.78  ? 490 PHE A CD1   1 
ATOM   2486  C  CD2   . PHE E 3 194 ? 43.009  15.033 -134.932 1.00 28.76  ? 490 PHE A CD2   1 
ATOM   2487  C  CE1   . PHE E 3 194 ? 41.164  12.979 -135.100 1.00 29.37  ? 490 PHE A CE1   1 
ATOM   2488  C  CE2   . PHE E 3 194 ? 43.270  13.938 -135.736 1.00 29.65  ? 490 PHE A CE2   1 
ATOM   2489  C  CZ    . PHE E 3 194 ? 42.355  12.911 -135.824 1.00 28.77  ? 490 PHE A CZ    1 
ATOM   2490  N  N     . ALA E 3 195 ? 43.876  16.609 -131.170 1.00 28.66  ? 491 ALA A N     1 
ATOM   2491  C  CA    . ALA E 3 195 ? 45.273  16.383 -130.811 1.00 30.21  ? 491 ALA A CA    1 
ATOM   2492  C  C     . ALA E 3 195 ? 45.319  15.651 -129.480 1.00 30.99  ? 491 ALA A C     1 
ATOM   2493  O  O     . ALA E 3 195 ? 46.056  14.677 -129.316 1.00 29.63  ? 491 ALA A O     1 
ATOM   2494  C  CB    . ALA E 3 195 ? 46.008  17.712 -130.697 1.00 29.28  ? 491 ALA A CB    1 
ATOM   2495  N  N     . GLY E 3 196 ? 44.514  16.132 -128.529 1.00 31.83  ? 492 GLY A N     1 
ATOM   2496  C  CA    . GLY E 3 196 ? 44.475  15.514 -127.215 1.00 33.21  ? 492 GLY A CA    1 
ATOM   2497  C  C     . GLY E 3 196 ? 45.810  15.565 -126.497 1.00 34.48  ? 492 GLY A C     1 
ATOM   2498  O  O     . GLY E 3 196 ? 46.825  15.937 -127.093 1.00 34.65  ? 492 GLY A O     1 
ATOM   2499  N  N     . VAL E 3 197 ? 45.812  15.197 -125.217 1.00 35.08  ? 493 VAL A N     1 
ATOM   2500  C  CA    . VAL E 3 197 ? 47.038  15.208 -124.421 1.00 35.69  ? 493 VAL A CA    1 
ATOM   2501  C  C     . VAL E 3 197 ? 47.465  13.792 -124.036 1.00 36.29  ? 493 VAL A C     1 
ATOM   2502  O  O     . VAL E 3 197 ? 46.632  12.948 -123.698 1.00 35.13  ? 493 VAL A O     1 
ATOM   2503  C  CB    . VAL E 3 197 ? 46.872  16.036 -123.133 1.00 35.42  ? 493 VAL A CB    1 
ATOM   2504  C  CG1   . VAL E 3 197 ? 48.205  16.135 -122.403 1.00 35.70  ? 493 VAL A CG1   1 
ATOM   2505  C  CG2   . VAL E 3 197 ? 46.355  17.425 -123.466 1.00 35.16  ? 493 VAL A CG2   1 
ATOM   2506  N  N     . LYS E 3 198 ? 48.773  13.552 -124.098 1.00 37.05  ? 494 LYS A N     1 
ATOM   2507  C  CA    . LYS E 3 198 ? 49.361  12.257 -123.775 1.00 38.53  ? 494 LYS A CA    1 
ATOM   2508  C  C     . LYS E 3 198 ? 49.225  11.991 -122.281 1.00 39.11  ? 494 LYS A C     1 
ATOM   2509  O  O     . LYS E 3 198 ? 49.405  12.898 -121.460 1.00 38.34  ? 494 LYS A O     1 
ATOM   2510  C  CB    . LYS E 3 198 ? 50.842  12.254 -124.165 1.00 39.49  ? 494 LYS A CB    1 
ATOM   2511  C  CG    . LYS E 3 198 ? 51.504  10.891 -124.162 1.00 40.29  ? 494 LYS A CG    1 
ATOM   2512  C  CD    . LYS E 3 198 ? 51.084  10.066 -125.358 1.00 41.39  ? 494 LYS A CD    1 
ATOM   2513  C  CE    . LYS E 3 198 ? 51.965  8.842  -125.477 1.00 41.21  ? 494 LYS A CE    1 
ATOM   2514  N  NZ    . LYS E 3 198 ? 52.068  8.180  -124.141 1.00 42.41  ? 494 LYS A NZ    1 
ATOM   2515  N  N     . VAL E 3 199 ? 48.918  10.745 -121.932 1.00 39.61  ? 495 VAL A N     1 
ATOM   2516  C  CA    . VAL E 3 199 ? 48.742  10.379 -120.537 1.00 40.79  ? 495 VAL A CA    1 
ATOM   2517  C  C     . VAL E 3 199 ? 49.660  9.275  -120.015 1.00 41.64  ? 495 VAL A C     1 
ATOM   2518  O  O     . VAL E 3 199 ? 49.583  8.132  -120.452 1.00 41.04  ? 495 VAL A O     1 
ATOM   2519  C  CB    . VAL E 3 199 ? 47.285  9.948  -120.263 1.00 40.69  ? 495 VAL A CB    1 
ATOM   2520  C  CG1   . VAL E 3 199 ? 47.155  9.428  -118.846 1.00 40.50  ? 495 VAL A CG1   1 
ATOM   2521  C  CG2   . VAL E 3 199 ? 46.345  11.127 -120.479 1.00 41.08  ? 495 VAL A CG2   1 
ATOM   2522  N  N     . ASP E 3 200 ? 50.526  9.635  -119.072 1.00 43.15  ? 496 ASP A N     1 
ATOM   2523  C  CA    . ASP E 3 200 ? 51.429  8.679  -118.440 1.00 44.79  ? 496 ASP A CA    1 
ATOM   2524  C  C     . ASP E 3 200 ? 50.495  7.775  -117.634 1.00 45.60  ? 496 ASP A C     1 
ATOM   2525  O  O     . ASP E 3 200 ? 50.317  7.975  -116.435 1.00 45.45  ? 496 ASP A O     1 
ATOM   2526  C  CB    . ASP E 3 200 ? 52.379  9.416  -117.487 1.00 44.57  ? 496 ASP A CB    1 
ATOM   2527  C  CG    . ASP E 3 200 ? 53.374  8.491  -116.810 1.00 44.79  ? 496 ASP A CG    1 
ATOM   2528  O  OD1   . ASP E 3 200 ? 53.094  7.277  -116.675 1.00 44.25  ? 496 ASP A OD1   1 
ATOM   2529  O  OD2   . ASP E 3 200 ? 54.441  8.989  -116.394 1.00 45.11  ? 496 ASP A OD2   1 
ATOM   2530  N  N     . THR E 3 201 ? 49.893  6.789  -118.289 1.00 47.23  ? 497 THR A N     1 
ATOM   2531  C  CA    . THR E 3 201 ? 48.958  5.907  -117.601 1.00 49.06  ? 497 THR A CA    1 
ATOM   2532  C  C     . THR E 3 201 ? 49.590  4.992  -116.565 1.00 50.05  ? 497 THR A C     1 
ATOM   2533  O  O     . THR E 3 201 ? 49.042  4.824  -115.475 1.00 50.00  ? 497 THR A O     1 
ATOM   2534  C  CB    . THR E 3 201 ? 48.166  5.044  -118.596 1.00 49.03  ? 497 THR A CB    1 
ATOM   2535  O  OG1   . THR E 3 201 ? 49.073  4.286  -119.403 1.00 50.24  ? 497 THR A OG1   1 
ATOM   2536  C  CG2   . THR E 3 201 ? 47.314  5.919  -119.485 1.00 49.47  ? 497 THR A CG2   1 
ATOM   2537  N  N     . LYS E 3 202 ? 50.732  4.395  -116.898 1.00 51.52  ? 498 LYS A N     1 
ATOM   2538  C  CA    . LYS E 3 202 ? 51.404  3.498  -115.966 1.00 52.66  ? 498 LYS A CA    1 
ATOM   2539  C  C     . LYS E 3 202 ? 51.563  4.185  -114.612 1.00 53.49  ? 498 LYS A C     1 
ATOM   2540  O  O     . LYS E 3 202 ? 51.145  3.645  -113.587 1.00 54.00  ? 498 LYS A O     1 
ATOM   2541  C  CB    . LYS E 3 202 ? 52.773  3.077  -116.518 1.00 52.80  ? 498 LYS A CB    1 
ATOM   2542  C  CG    . LYS E 3 202 ? 53.503  2.052  -115.656 1.00 53.11  ? 498 LYS A CG    1 
ATOM   2543  C  CD    . LYS E 3 202 ? 54.844  1.614  -116.261 1.00 53.37  ? 498 LYS A CD    1 
ATOM   2544  C  CE    . LYS E 3 202 ? 54.686  0.664  -117.445 1.00 53.07  ? 498 LYS A CE    1 
ATOM   2545  N  NZ    . LYS E 3 202 ? 54.117  1.314  -118.656 1.00 54.14  ? 498 LYS A NZ    1 
ATOM   2546  N  N     . ARG E 3 203 ? 52.142  5.384  -114.615 1.00 54.31  ? 499 ARG A N     1 
ATOM   2547  C  CA    . ARG E 3 203 ? 52.351  6.147  -113.382 1.00 55.39  ? 499 ARG A CA    1 
ATOM   2548  C  C     . ARG E 3 203 ? 51.041  6.411  -112.653 1.00 56.16  ? 499 ARG A C     1 
ATOM   2549  O  O     . ARG E 3 203 ? 50.880  6.069  -111.481 1.00 55.81  ? 499 ARG A O     1 
ATOM   2550  C  CB    . ARG E 3 203 ? 53.002  7.498  -113.682 1.00 55.20  ? 499 ARG A CB    1 
ATOM   2551  C  CG    . ARG E 3 203 ? 53.398  8.258  -112.427 1.00 56.16  ? 499 ARG A CG    1 
ATOM   2552  C  CD    . ARG E 3 203 ? 53.667  9.731  -112.687 1.00 57.02  ? 499 ARG A CD    1 
ATOM   2553  N  NE    . ARG E 3 203 ? 54.539  10.304 -111.664 1.00 57.41  ? 499 ARG A NE    1 
ATOM   2554  C  CZ    . ARG E 3 203 ? 55.865  10.204 -111.680 1.00 57.85  ? 499 ARG A CZ    1 
ATOM   2555  N  NH1   . ARG E 3 203 ? 56.472  9.563  -112.670 1.00 57.79  ? 499 ARG A NH1   1 
ATOM   2556  N  NH2   . ARG E 3 203 ? 56.586  10.731 -110.700 1.00 58.47  ? 499 ARG A NH2   1 
ATOM   2557  N  N     . LEU E 3 204 ? 50.114  7.043  -113.365 1.00 57.17  ? 500 LEU A N     1 
ATOM   2558  C  CA    . LEU E 3 204 ? 48.808  7.395  -112.829 1.00 58.27  ? 500 LEU A CA    1 
ATOM   2559  C  C     . LEU E 3 204 ? 48.175  6.240  -112.063 1.00 59.23  ? 500 LEU A C     1 
ATOM   2560  O  O     . LEU E 3 204 ? 47.514  6.451  -111.050 1.00 59.33  ? 500 LEU A O     1 
ATOM   2561  C  CB    . LEU E 3 204 ? 47.899  7.840  -113.975 1.00 57.96  ? 500 LEU A CB    1 
ATOM   2562  C  CG    . LEU E 3 204 ? 46.793  8.845  -113.661 1.00 57.77  ? 500 LEU A CG    1 
ATOM   2563  C  CD1   . LEU E 3 204 ? 47.301  9.947  -112.747 1.00 57.53  ? 500 LEU A CD1   1 
ATOM   2564  C  CD2   . LEU E 3 204 ? 46.302  9.430  -114.970 1.00 57.62  ? 500 LEU A CD2   1 
ATOM   2565  N  N     . GLU E 3 205 ? 48.391  5.020  -112.551 1.00 60.39  ? 501 GLU A N     1 
ATOM   2566  C  CA    . GLU E 3 205 ? 47.855  3.823  -111.913 1.00 61.61  ? 501 GLU A CA    1 
ATOM   2567  C  C     . GLU E 3 205 ? 48.605  3.537  -110.616 1.00 62.40  ? 501 GLU A C     1 
ATOM   2568  O  O     . GLU E 3 205 ? 47.994  3.380  -109.560 1.00 62.32  ? 501 GLU A O     1 
ATOM   2569  C  CB    . GLU E 3 205 ? 47.976  2.624  -112.857 1.00 61.88  ? 501 GLU A CB    1 
ATOM   2570  C  CG    . GLU E 3 205 ? 47.182  2.779  -114.146 1.00 62.62  ? 501 GLU A CG    1 
ATOM   2571  C  CD    . GLU E 3 205 ? 47.560  1.754  -115.199 1.00 62.86  ? 501 GLU A CD    1 
ATOM   2572  O  OE1   . GLU E 3 205 ? 48.754  1.690  -115.560 1.00 63.29  ? 501 GLU A OE1   1 
ATOM   2573  O  OE2   . GLU E 3 205 ? 46.666  1.018  -115.669 1.00 63.12  ? 501 GLU A OE2   1 
ATOM   2574  N  N     . GLN E 3 206 ? 49.931  3.472  -110.703 1.00 63.37  ? 502 GLN A N     1 
ATOM   2575  C  CA    . GLN E 3 206 ? 50.764  3.215  -109.533 1.00 64.16  ? 502 GLN A CA    1 
ATOM   2576  C  C     . GLN E 3 206 ? 50.583  4.320  -108.495 1.00 64.60  ? 502 GLN A C     1 
ATOM   2577  O  O     . GLN E 3 206 ? 51.240  4.325  -107.451 1.00 64.73  ? 502 GLN A O     1 
ATOM   2578  C  CB    . GLN E 3 206 ? 52.234  3.094  -109.944 1.00 64.73  ? 502 GLN A CB    1 
ATOM   2579  C  CG    . GLN E 3 206 ? 52.512  1.867  -110.808 1.00 65.60  ? 502 GLN A CG    1 
ATOM   2580  C  CD    . GLN E 3 206 ? 53.972  1.721  -111.190 1.00 66.16  ? 502 GLN A CD    1 
ATOM   2581  O  OE1   . GLN E 3 206 ? 54.514  2.529  -111.948 1.00 66.41  ? 502 GLN A OE1   1 
ATOM   2582  N  NE2   . GLN E 3 206 ? 54.620  0.685  -110.663 1.00 66.39  ? 502 GLN A NE2   1 
ATOM   2583  N  N     . MET E 3 207 ? 49.691  5.259  -108.801 1.00 64.85  ? 503 MET A N     1 
ATOM   2584  C  CA    . MET E 3 207 ? 49.372  6.350  -107.893 1.00 64.94  ? 503 MET A CA    1 
ATOM   2585  C  C     . MET E 3 207 ? 48.107  5.897  -107.180 1.00 65.19  ? 503 MET A C     1 
ATOM   2586  O  O     . MET E 3 207 ? 48.012  5.957  -105.954 1.00 65.23  ? 503 MET A O     1 
ATOM   2587  C  CB    . MET E 3 207 ? 49.095  7.644  -108.661 1.00 64.99  ? 503 MET A CB    1 
ATOM   2588  C  CG    . MET E 3 207 ? 50.263  8.138  -109.497 1.00 65.33  ? 503 MET A CG    1 
ATOM   2589  S  SD    . MET E 3 207 ? 49.950  9.748  -110.257 1.00 65.47  ? 503 MET A SD    1 
ATOM   2590  C  CE    . MET E 3 207 ? 50.959  10.820 -109.227 1.00 65.71  ? 503 MET A CE    1 
ATOM   2591  N  N     . GLY E 3 208 ? 47.139  5.432  -107.965 1.00 65.38  ? 504 GLY A N     1 
ATOM   2592  C  CA    . GLY E 3 208 ? 45.896  4.950  -107.396 1.00 65.83  ? 504 GLY A CA    1 
ATOM   2593  C  C     . GLY E 3 208 ? 46.202  3.832  -106.418 1.00 66.25  ? 504 GLY A C     1 
ATOM   2594  O  O     . GLY E 3 208 ? 45.434  3.580  -105.487 1.00 66.30  ? 504 GLY A O     1 
ATOM   2595  N  N     . LYS E 3 209 ? 47.331  3.159  -106.635 1.00 66.50  ? 505 LYS A N     1 
ATOM   2596  C  CA    . LYS E 3 209 ? 47.766  2.071  -105.765 1.00 66.63  ? 505 LYS A CA    1 
ATOM   2597  C  C     . LYS E 3 209 ? 47.837  2.569  -104.330 1.00 66.62  ? 505 LYS A C     1 
ATOM   2598  O  O     . LYS E 3 209 ? 46.975  2.264  -103.512 1.00 66.86  ? 505 LYS A O     1 
ATOM   2599  C  CB    . LYS E 3 209 ? 49.154  1.565  -106.177 1.00 66.72  ? 505 LYS A CB    1 
ATOM   2600  C  CG    . LYS E 3 209 ? 49.202  0.703  -107.434 1.00 67.01  ? 505 LYS A CG    1 
ATOM   2601  C  CD    . LYS E 3 209 ? 48.502  -0.633 -107.229 1.00 67.08  ? 505 LYS A CD    1 
ATOM   2602  C  CE    . LYS E 3 209 ? 48.951  -1.665 -108.258 1.00 67.37  ? 505 LYS A CE    1 
ATOM   2603  N  NZ    . LYS E 3 209 ? 48.772  -1.201 -109.661 1.00 67.48  ? 505 LYS A NZ    1 
ATOM   2604  N  N     . GLU E 3 210 ? 48.873  3.346  -104.039 1.00 66.79  ? 506 GLU A N     1 
ATOM   2605  C  CA    . GLU E 3 210 ? 49.080  3.885  -102.703 1.00 67.10  ? 506 GLU A CA    1 
ATOM   2606  C  C     . GLU E 3 210 ? 47.886  4.643  -102.133 1.00 67.32  ? 506 GLU A C     1 
ATOM   2607  O  O     . GLU E 3 210 ? 47.609  4.549  -100.938 1.00 67.34  ? 506 GLU A O     1 
ATOM   2608  C  CB    . GLU E 3 210 ? 50.322  4.783  -102.688 1.00 67.04  ? 506 GLU A CB    1 
ATOM   2609  C  CG    . GLU E 3 210 ? 51.626  4.017  -102.865 1.00 66.95  ? 506 GLU A CG    1 
ATOM   2610  C  CD    . GLU E 3 210 ? 52.849  4.878  -102.633 1.00 67.06  ? 506 GLU A CD    1 
ATOM   2611  O  OE1   . GLU E 3 210 ? 53.971  4.326  -102.604 1.00 66.64  ? 506 GLU A OE1   1 
ATOM   2612  O  OE2   . GLU E 3 210 ? 52.688  6.108  -102.482 1.00 67.00  ? 506 GLU A OE2   1 
ATOM   2613  N  N     . LEU E 3 211 ? 47.180  5.391  -102.977 1.00 67.65  ? 507 LEU A N     1 
ATOM   2614  C  CA    . LEU E 3 211 ? 46.020  6.152  -102.515 1.00 68.19  ? 507 LEU A CA    1 
ATOM   2615  C  C     . LEU E 3 211 ? 45.071  5.291  -101.693 1.00 68.57  ? 507 LEU A C     1 
ATOM   2616  O  O     . LEU E 3 211 ? 44.779  5.607  -100.538 1.00 68.47  ? 507 LEU A O     1 
ATOM   2617  C  CB    . LEU E 3 211 ? 45.256  6.755  -103.697 1.00 68.08  ? 507 LEU A CB    1 
ATOM   2618  C  CG    . LEU E 3 211 ? 45.707  8.127  -104.198 1.00 68.11  ? 507 LEU A CG    1 
ATOM   2619  C  CD1   . LEU E 3 211 ? 44.922  8.483  -105.443 1.00 68.27  ? 507 LEU A CD1   1 
ATOM   2620  C  CD2   . LEU E 3 211 ? 45.490  9.177  -103.119 1.00 67.81  ? 507 LEU A CD2   1 
ATOM   2621  N  N     . ALA E 3 212 ? 44.591  4.207  -102.294 1.00 69.06  ? 508 ALA A N     1 
ATOM   2622  C  CA    . ALA E 3 212 ? 43.677  3.298  -101.615 1.00 69.62  ? 508 ALA A CA    1 
ATOM   2623  C  C     . ALA E 3 212 ? 44.245  2.930  -100.249 1.00 70.16  ? 508 ALA A C     1 
ATOM   2624  O  O     . ALA E 3 212 ? 43.500  2.737  -99.285  1.00 70.17  ? 508 ALA A O     1 
ATOM   2625  C  CB    . ALA E 3 212 ? 43.468  2.043  -102.456 1.00 69.56  ? 508 ALA A CB    1 
ATOM   2626  N  N     . GLU E 3 213 ? 45.571  2.846  -100.175 1.00 70.66  ? 509 GLU A N     1 
ATOM   2627  C  CA    . GLU E 3 213 ? 46.257  2.509  -98.933  1.00 71.11  ? 509 GLU A CA    1 
ATOM   2628  C  C     . GLU E 3 213 ? 46.013  3.593  -97.891  1.00 71.32  ? 509 GLU A C     1 
ATOM   2629  O  O     . GLU E 3 213 ? 45.408  3.348  -96.850  1.00 71.29  ? 509 GLU A O     1 
ATOM   2630  C  CB    . GLU E 3 213 ? 47.761  2.378  -99.179  1.00 71.35  ? 509 GLU A CB    1 
ATOM   2631  C  CG    . GLU E 3 213 ? 48.561  1.992  -97.946  1.00 71.83  ? 509 GLU A CG    1 
ATOM   2632  C  CD    . GLU E 3 213 ? 50.009  2.446  -98.022  1.00 71.98  ? 509 GLU A CD    1 
ATOM   2633  O  OE1   . GLU E 3 213 ? 50.702  2.096  -99.002  1.00 71.77  ? 509 GLU A OE1   1 
ATOM   2634  O  OE2   . GLU E 3 213 ? 50.452  3.157  -97.094  1.00 72.42  ? 509 GLU A OE2   1 
ATOM   2635  N  N     . GLN E 3 214 ? 46.492  4.796  -98.186  1.00 71.77  ? 510 GLN A N     1 
ATOM   2636  C  CA    . GLN E 3 214 ? 46.341  5.928  -97.282  1.00 72.17  ? 510 GLN A CA    1 
ATOM   2637  C  C     . GLN E 3 214 ? 44.879  6.331  -97.114  1.00 72.60  ? 510 GLN A C     1 
ATOM   2638  O  O     . GLN E 3 214 ? 44.570  7.294  -96.413  1.00 72.61  ? 510 GLN A O     1 
ATOM   2639  C  CB    . GLN E 3 214 ? 47.153  7.115  -97.801  1.00 72.04  ? 510 GLN A CB    1 
ATOM   2640  C  CG    . GLN E 3 214 ? 48.604  6.769  -98.091  1.00 72.10  ? 510 GLN A CG    1 
ATOM   2641  C  CD    . GLN E 3 214 ? 49.436  7.983  -98.447  1.00 72.00  ? 510 GLN A CD    1 
ATOM   2642  O  OE1   . GLN E 3 214 ? 49.619  8.885  -97.629  1.00 72.04  ? 510 GLN A OE1   1 
ATOM   2643  N  NE2   . GLN E 3 214 ? 49.946  8.011  -99.673  1.00 71.80  ? 510 GLN A NE2   1 
ATOM   2644  N  N     . LEU E 3 215 ? 43.983  5.591  -97.761  1.00 72.94  ? 511 LEU A N     1 
ATOM   2645  C  CA    . LEU E 3 215 ? 42.555  5.869  -97.670  1.00 73.34  ? 511 LEU A CA    1 
ATOM   2646  C  C     . LEU E 3 215 ? 41.922  5.133  -96.489  1.00 73.77  ? 511 LEU A C     1 
ATOM   2647  O  O     . LEU E 3 215 ? 41.576  5.751  -95.481  1.00 73.88  ? 511 LEU A O     1 
ATOM   2648  C  CB    . LEU E 3 215 ? 41.855  5.476  -98.974  1.00 73.33  ? 511 LEU A CB    1 
ATOM   2649  C  CG    . LEU E 3 215 ? 41.927  6.506  -100.107 1.00 73.39  ? 511 LEU A CG    1 
ATOM   2650  C  CD1   . LEU E 3 215 ? 41.412  5.902  -101.404 1.00 73.52  ? 511 LEU A CD1   1 
ATOM   2651  C  CD2   . LEU E 3 215 ? 41.108  7.731  -99.725  1.00 73.09  ? 511 LEU A CD2   1 
ATOM   2652  N  N     . GLY E 3 216 ? 41.772  3.817  -96.616  1.00 73.97  ? 512 GLY A N     1 
ATOM   2653  C  CA    . GLY E 3 216 ? 41.185  3.036  -95.541  1.00 74.40  ? 512 GLY A CA    1 
ATOM   2654  C  C     . GLY E 3 216 ? 41.897  3.274  -94.222  1.00 74.66  ? 512 GLY A C     1 
ATOM   2655  O  O     . GLY E 3 216 ? 41.281  3.257  -93.155  1.00 74.55  ? 512 GLY A O     1 
ATOM   2656  N  N     . THR E 3 217 ? 43.205  3.498  -94.300  1.00 74.87  ? 513 THR A N     1 
ATOM   2657  C  CA    . THR E 3 217 ? 44.017  3.751  -93.119  1.00 75.11  ? 513 THR A CA    1 
ATOM   2658  C  C     . THR E 3 217 ? 43.559  5.044  -92.457  1.00 75.44  ? 513 THR A C     1 
ATOM   2659  O  O     . THR E 3 217 ? 43.884  5.314  -91.300  1.00 75.44  ? 513 THR A O     1 
ATOM   2660  C  CB    . THR E 3 217 ? 45.509  3.873  -93.494  1.00 75.07  ? 513 THR A CB    1 
ATOM   2661  O  OG1   . THR E 3 217 ? 45.947  2.652  -94.103  1.00 74.89  ? 513 THR A OG1   1 
ATOM   2662  C  CG2   . THR E 3 217 ? 46.354  4.147  -92.255  1.00 74.92  ? 513 THR A CG2   1 
ATOM   2663  N  N     . VAL E 3 218 ? 42.800  5.840  -93.202  1.00 75.84  ? 514 VAL A N     1 
ATOM   2664  C  CA    . VAL E 3 218 ? 42.280  7.106  -92.698  1.00 76.37  ? 514 VAL A CA    1 
ATOM   2665  C  C     . VAL E 3 218 ? 40.757  7.028  -92.650  1.00 76.73  ? 514 VAL A C     1 
ATOM   2666  O  O     . VAL E 3 218 ? 40.077  8.011  -92.350  1.00 76.86  ? 514 VAL A O     1 
ATOM   2667  C  CB    . VAL E 3 218 ? 42.707  8.287  -93.605  1.00 76.32  ? 514 VAL A CB    1 
ATOM   2668  C  CG1   . VAL E 3 218 ? 42.256  9.613  -92.997  1.00 76.06  ? 514 VAL A CG1   1 
ATOM   2669  C  CG2   . VAL E 3 218 ? 44.217  8.275  -93.789  1.00 76.20  ? 514 VAL A CG2   1 
ATOM   2670  N  N     . GLU E 3 219 ? 40.232  5.844  -92.949  1.00 77.10  ? 515 GLU A N     1 
ATOM   2671  C  CA    . GLU E 3 219 ? 38.793  5.605  -92.945  1.00 77.47  ? 515 GLU A CA    1 
ATOM   2672  C  C     . GLU E 3 219 ? 38.376  4.909  -91.654  1.00 77.72  ? 515 GLU A C     1 
ATOM   2673  O  O     . GLU E 3 219 ? 37.323  5.209  -91.085  1.00 77.62  ? 515 GLU A O     1 
ATOM   2674  C  CB    . GLU E 3 219 ? 38.399  4.733  -94.142  1.00 77.36  ? 515 GLU A CB    1 
ATOM   2675  C  CG    . GLU E 3 219 ? 36.946  4.281  -94.131  1.00 77.49  ? 515 GLU A CG    1 
ATOM   2676  C  CD    . GLU E 3 219 ? 36.633  3.291  -95.238  1.00 77.56  ? 515 GLU A CD    1 
ATOM   2677  O  OE1   . GLU E 3 219 ? 35.491  2.784  -95.279  1.00 77.66  ? 515 GLU A OE1   1 
ATOM   2678  O  OE2   . GLU E 3 219 ? 37.527  3.020  -96.067  1.00 77.70  ? 515 GLU A OE2   1 
ATOM   2679  N  N     . GLN E 3 220 ? 39.209  3.976  -91.200  1.00 77.95  ? 516 GLN A N     1 
ATOM   2680  C  CA    . GLN E 3 220 ? 38.932  3.229  -89.983  1.00 78.09  ? 516 GLN A CA    1 
ATOM   2681  C  C     . GLN E 3 220 ? 39.171  4.095  -88.758  1.00 78.30  ? 516 GLN A C     1 
ATOM   2682  O  O     . GLN E 3 220 ? 38.472  3.970  -87.752  1.00 78.31  ? 516 GLN A O     1 
ATOM   2683  C  CB    . GLN E 3 220 ? 39.804  1.975  -89.932  1.00 78.00  ? 516 GLN A CB    1 
ATOM   2684  C  CG    . GLN E 3 220 ? 39.647  1.100  -91.163  1.00 77.81  ? 516 GLN A CG    1 
ATOM   2685  C  CD    . GLN E 3 220 ? 38.199  0.988  -91.608  1.00 77.71  ? 516 GLN A CD    1 
ATOM   2686  O  OE1   . GLN E 3 220 ? 37.328  0.590  -90.835  1.00 77.39  ? 516 GLN A OE1   1 
ATOM   2687  N  NE2   . GLN E 3 220 ? 37.935  1.344  -92.860  1.00 77.54  ? 516 GLN A NE2   1 
ATOM   2688  N  N     . ARG E 3 221 ? 40.164  4.972  -88.848  1.00 78.60  ? 517 ARG A N     1 
ATOM   2689  C  CA    . ARG E 3 221 ? 40.468  5.878  -87.752  1.00 78.95  ? 517 ARG A CA    1 
ATOM   2690  C  C     . ARG E 3 221 ? 39.205  6.701  -87.516  1.00 79.23  ? 517 ARG A C     1 
ATOM   2691  O  O     . ARG E 3 221 ? 38.907  7.095  -86.389  1.00 79.25  ? 517 ARG A O     1 
ATOM   2692  C  CB    . ARG E 3 221 ? 41.631  6.801  -88.132  1.00 78.94  ? 517 ARG A CB    1 
ATOM   2693  C  CG    . ARG E 3 221 ? 42.028  7.796  -87.046  1.00 78.97  ? 517 ARG A CG    1 
ATOM   2694  C  CD    . ARG E 3 221 ? 42.615  7.096  -85.831  1.00 78.78  ? 517 ARG A CD    1 
ATOM   2695  N  NE    . ARG E 3 221 ? 42.832  8.005  -84.707  1.00 78.70  ? 517 ARG A NE    1 
ATOM   2696  C  CZ    . ARG E 3 221 ? 43.663  9.043  -84.721  1.00 78.78  ? 517 ARG A CZ    1 
ATOM   2697  N  NH1   . ARG E 3 221 ? 44.372  9.323  -85.807  1.00 78.76  ? 517 ARG A NH1   1 
ATOM   2698  N  NH2   . ARG E 3 221 ? 43.790  9.801  -83.639  1.00 78.79  ? 517 ARG A NH2   1 
ATOM   2699  N  N     . ILE E 3 222 ? 38.465  6.943  -88.598  1.00 79.57  ? 518 ILE A N     1 
ATOM   2700  C  CA    . ILE E 3 222 ? 37.223  7.711  -88.551  1.00 79.83  ? 518 ILE A CA    1 
ATOM   2701  C  C     . ILE E 3 222 ? 36.159  6.974  -87.740  1.00 79.91  ? 518 ILE A C     1 
ATOM   2702  O  O     . ILE E 3 222 ? 35.461  7.584  -86.930  1.00 79.97  ? 518 ILE A O     1 
ATOM   2703  C  CB    . ILE E 3 222 ? 36.665  7.976  -89.978  1.00 79.89  ? 518 ILE A CB    1 
ATOM   2704  C  CG1   . ILE E 3 222 ? 37.680  8.772  -90.805  1.00 79.96  ? 518 ILE A CG1   1 
ATOM   2705  C  CG2   . ILE E 3 222 ? 35.348  8.746  -89.895  1.00 79.98  ? 518 ILE A CG2   1 
ATOM   2706  C  CD1   . ILE E 3 222 ? 37.958  10.166 -90.280  1.00 80.05  ? 518 ILE A CD1   1 
ATOM   2707  N  N     . TYR E 3 223 ? 36.029  5.669  -87.965  1.00 80.00  ? 519 TYR A N     1 
ATOM   2708  C  CA    . TYR E 3 223 ? 35.049  4.872  -87.231  1.00 80.27  ? 519 TYR A CA    1 
ATOM   2709  C  C     . TYR E 3 223 ? 35.525  4.751  -85.789  1.00 80.39  ? 519 TYR A C     1 
ATOM   2710  O  O     . TYR E 3 223 ? 34.727  4.609  -84.863  1.00 80.43  ? 519 TYR A O     1 
ATOM   2711  C  CB    . TYR E 3 223 ? 34.909  3.473  -87.842  1.00 80.09  ? 519 TYR A CB    1 
ATOM   2712  C  CG    . TYR E 3 223 ? 34.605  3.464  -89.323  1.00 80.06  ? 519 TYR A CG    1 
ATOM   2713  C  CD1   . TYR E 3 223 ? 33.643  4.316  -89.866  1.00 80.25  ? 519 TYR A CD1   1 
ATOM   2714  C  CD2   . TYR E 3 223 ? 35.268  2.590  -90.183  1.00 80.00  ? 519 TYR A CD2   1 
ATOM   2715  C  CE1   . TYR E 3 223 ? 33.350  4.299  -91.232  1.00 80.10  ? 519 TYR A CE1   1 
ATOM   2716  C  CE2   . TYR E 3 223 ? 34.983  2.564  -91.548  1.00 79.95  ? 519 TYR A CE2   1 
ATOM   2717  C  CZ    . TYR E 3 223 ? 34.025  3.421  -92.065  1.00 79.98  ? 519 TYR A CZ    1 
ATOM   2718  O  OH    . TYR E 3 223 ? 33.747  3.405  -93.412  1.00 79.88  ? 519 TYR A OH    1 
ATOM   2719  N  N     . GLU E 3 224 ? 36.840  4.810  -85.616  1.00 80.50  ? 520 GLU A N     1 
ATOM   2720  C  CA    . GLU E 3 224 ? 37.459  4.722  -84.304  1.00 80.54  ? 520 GLU A CA    1 
ATOM   2721  C  C     . GLU E 3 224 ? 37.111  5.993  -83.528  1.00 80.74  ? 520 GLU A C     1 
ATOM   2722  O  O     . GLU E 3 224 ? 36.417  5.947  -82.511  1.00 80.71  ? 520 GLU A O     1 
ATOM   2723  C  CB    . GLU E 3 224 ? 38.977  4.597  -84.470  1.00 80.24  ? 520 GLU A CB    1 
ATOM   2724  C  CG    . GLU E 3 224 ? 39.742  4.251  -83.205  1.00 80.13  ? 520 GLU A CG    1 
ATOM   2725  C  CD    . GLU E 3 224 ? 41.237  4.141  -83.448  1.00 79.99  ? 520 GLU A CD    1 
ATOM   2726  O  OE1   . GLU E 3 224 ? 41.640  3.363  -84.337  1.00 80.10  ? 520 GLU A OE1   1 
ATOM   2727  O  OE2   . GLU E 3 224 ? 42.011  4.830  -82.751  1.00 79.68  ? 520 GLU A OE2   1 
ATOM   2728  N  N     . LEU E 3 225 ? 37.591  7.125  -84.034  1.00 81.11  ? 521 LEU A N     1 
ATOM   2729  C  CA    . LEU E 3 225 ? 37.356  8.434  -83.427  1.00 81.42  ? 521 LEU A CA    1 
ATOM   2730  C  C     . LEU E 3 225 ? 35.873  8.693  -83.168  1.00 81.62  ? 521 LEU A C     1 
ATOM   2731  O  O     . LEU E 3 225 ? 35.507  9.311  -82.169  1.00 81.67  ? 521 LEU A O     1 
ATOM   2732  C  CB    . LEU E 3 225 ? 37.913  9.524  -84.342  1.00 81.54  ? 521 LEU A CB    1 
ATOM   2733  C  CG    . LEU E 3 225 ? 39.405  9.414  -84.659  1.00 81.66  ? 521 LEU A CG    1 
ATOM   2734  C  CD1   . LEU E 3 225 ? 39.676  10.000 -86.029  1.00 81.69  ? 521 LEU A CD1   1 
ATOM   2735  C  CD2   . LEU E 3 225 ? 40.217  10.111 -83.580  1.00 81.69  ? 521 LEU A CD2   1 
ATOM   2736  N  N     . ALA E 3 226 ? 35.022  8.229  -84.076  1.00 81.82  ? 522 ALA A N     1 
ATOM   2737  C  CA    . ALA E 3 226 ? 33.584  8.407  -83.925  1.00 82.05  ? 522 ALA A CA    1 
ATOM   2738  C  C     . ALA E 3 226 ? 33.044  7.299  -83.029  1.00 82.20  ? 522 ALA A C     1 
ATOM   2739  O  O     . ALA E 3 226 ? 32.161  7.532  -82.203  1.00 82.21  ? 522 ALA A O     1 
ATOM   2740  C  CB    . ALA E 3 226 ? 32.900  8.366  -85.287  1.00 82.09  ? 522 ALA A CB    1 
ATOM   2741  N  N     . GLY E 3 227 ? 33.585  6.095  -83.202  1.00 82.35  ? 523 GLY A N     1 
ATOM   2742  C  CA    . GLY E 3 227 ? 33.164  4.960  -82.400  1.00 82.67  ? 523 GLY A CA    1 
ATOM   2743  C  C     . GLY E 3 227 ? 31.989  4.172  -82.951  1.00 82.89  ? 523 GLY A C     1 
ATOM   2744  O  O     . GLY E 3 227 ? 31.309  3.471  -82.200  1.00 82.73  ? 523 GLY A O     1 
ATOM   2745  N  N     . GLN E 3 228 ? 31.748  4.277  -84.256  1.00 83.16  ? 524 GLN A N     1 
ATOM   2746  C  CA    . GLN E 3 228 ? 30.638  3.565  -84.890  1.00 83.49  ? 524 GLN A CA    1 
ATOM   2747  C  C     . GLN E 3 228 ? 30.974  3.143  -86.322  1.00 83.67  ? 524 GLN A C     1 
ATOM   2748  O  O     . GLN E 3 228 ? 32.096  2.720  -86.607  1.00 83.88  ? 524 GLN A O     1 
ATOM   2749  C  CB    . GLN E 3 228 ? 29.384  4.447  -84.894  1.00 83.42  ? 524 GLN A CB    1 
ATOM   2750  C  CG    . GLN E 3 228 ? 29.001  4.978  -83.523  1.00 83.38  ? 524 GLN A CG    1 
ATOM   2751  C  CD    . GLN E 3 228 ? 27.794  5.891  -83.556  1.00 83.32  ? 524 GLN A CD    1 
ATOM   2752  O  OE1   . GLN E 3 228 ? 27.433  6.490  -82.544  1.00 83.19  ? 524 GLN A OE1   1 
ATOM   2753  N  NE2   . GLN E 3 228 ? 27.159  5.999  -84.718  1.00 83.35  ? 524 GLN A NE2   1 
ATOM   2754  N  N     . GLU E 3 229 ? 29.995  3.260  -87.217  1.00 83.73  ? 525 GLU A N     1 
ATOM   2755  C  CA    . GLU E 3 229 ? 30.178  2.892  -88.619  1.00 83.74  ? 525 GLU A CA    1 
ATOM   2756  C  C     . GLU E 3 229 ? 29.412  3.797  -89.582  1.00 83.74  ? 525 GLU A C     1 
ATOM   2757  O  O     . GLU E 3 229 ? 28.719  3.311  -90.479  1.00 83.83  ? 525 GLU A O     1 
ATOM   2758  C  CB    . GLU E 3 229 ? 29.748  1.440  -88.845  1.00 83.70  ? 525 GLU A CB    1 
ATOM   2759  C  CG    . GLU E 3 229 ? 30.837  0.415  -88.585  1.00 83.63  ? 525 GLU A CG    1 
ATOM   2760  C  CD    . GLU E 3 229 ? 31.974  0.516  -89.583  1.00 83.52  ? 525 GLU A CD    1 
ATOM   2761  O  OE1   . GLU E 3 229 ? 32.915  -0.301 -89.501  1.00 83.44  ? 525 GLU A OE1   1 
ATOM   2762  O  OE2   . GLU E 3 229 ? 31.927  1.414  -90.452  1.00 83.45  ? 525 GLU A OE2   1 
ATOM   2763  N  N     . PHE E 3 230 ? 29.540  5.109  -89.407  1.00 83.56  ? 526 PHE A N     1 
ATOM   2764  C  CA    . PHE E 3 230 ? 28.845  6.048  -90.279  1.00 83.47  ? 526 PHE A CA    1 
ATOM   2765  C  C     . PHE E 3 230 ? 29.625  6.249  -91.575  1.00 83.31  ? 526 PHE A C     1 
ATOM   2766  O  O     . PHE E 3 230 ? 30.843  6.059  -91.610  1.00 83.24  ? 526 PHE A O     1 
ATOM   2767  C  CB    . PHE E 3 230 ? 28.626  7.390  -89.556  1.00 83.61  ? 526 PHE A CB    1 
ATOM   2768  C  CG    . PHE E 3 230 ? 29.570  8.489  -89.977  1.00 83.54  ? 526 PHE A CG    1 
ATOM   2769  C  CD1   . PHE E 3 230 ? 30.925  8.428  -89.667  1.00 83.51  ? 526 PHE A CD1   1 
ATOM   2770  C  CD2   . PHE E 3 230 ? 29.092  9.597  -90.674  1.00 83.34  ? 526 PHE A CD2   1 
ATOM   2771  C  CE1   . PHE E 3 230 ? 31.789  9.458  -90.043  1.00 83.57  ? 526 PHE A CE1   1 
ATOM   2772  C  CE2   . PHE E 3 230 ? 29.943  10.629 -91.054  1.00 83.26  ? 526 PHE A CE2   1 
ATOM   2773  C  CZ    . PHE E 3 230 ? 31.295  10.561 -90.738  1.00 83.42  ? 526 PHE A CZ    1 
ATOM   2774  N  N     . ASN E 3 231 ? 28.918  6.620  -92.640  1.00 83.03  ? 527 ASN A N     1 
ATOM   2775  C  CA    . ASN E 3 231 ? 29.555  6.840  -93.935  1.00 82.76  ? 527 ASN A CA    1 
ATOM   2776  C  C     . ASN E 3 231 ? 29.938  8.304  -94.115  1.00 82.18  ? 527 ASN A C     1 
ATOM   2777  O  O     . ASN E 3 231 ? 29.080  9.181  -94.241  1.00 82.01  ? 527 ASN A O     1 
ATOM   2778  C  CB    . ASN E 3 231 ? 28.632  6.419  -95.079  1.00 83.27  ? 527 ASN A CB    1 
ATOM   2779  C  CG    . ASN E 3 231 ? 29.363  6.324  -96.405  1.00 83.59  ? 527 ASN A CG    1 
ATOM   2780  O  OD1   . ASN E 3 231 ? 28.744  6.324  -97.468  1.00 84.00  ? 527 ASN A OD1   1 
ATOM   2781  N  ND2   . ASN E 3 231 ? 30.690  6.232  -96.347  1.00 83.53  ? 527 ASN A ND2   1 
ATOM   2782  N  N     . ILE E 3 232 ? 31.243  8.543  -94.134  1.00 81.44  ? 528 ILE A N     1 
ATOM   2783  C  CA    . ILE E 3 232 ? 31.820  9.871  -94.282  1.00 80.45  ? 528 ILE A CA    1 
ATOM   2784  C  C     . ILE E 3 232 ? 31.272  10.692 -95.452  1.00 79.83  ? 528 ILE A C     1 
ATOM   2785  O  O     . ILE E 3 232 ? 31.592  11.873 -95.583  1.00 79.78  ? 528 ILE A O     1 
ATOM   2786  C  CB    . ILE E 3 232 ? 33.352  9.769  -94.440  1.00 80.50  ? 528 ILE A CB    1 
ATOM   2787  C  CG1   . ILE E 3 232 ? 33.693  8.918  -95.668  1.00 80.51  ? 528 ILE A CG1   1 
ATOM   2788  C  CG2   . ILE E 3 232 ? 33.968  9.153  -93.188  1.00 80.23  ? 528 ILE A CG2   1 
ATOM   2789  C  CD1   . ILE E 3 232 ? 33.371  7.434  -95.536  1.00 80.41  ? 528 ILE A CD1   1 
ATOM   2790  N  N     . ASN E 3 233 ? 30.449  10.079 -96.298  1.00 79.07  ? 529 ASN A N     1 
ATOM   2791  C  CA    . ASN E 3 233 ? 29.898  10.786 -97.452  1.00 78.31  ? 529 ASN A CA    1 
ATOM   2792  C  C     . ASN E 3 233 ? 28.524  11.417 -97.226  1.00 77.78  ? 529 ASN A C     1 
ATOM   2793  O  O     . ASN E 3 233 ? 28.087  12.249 -98.020  1.00 77.60  ? 529 ASN A O     1 
ATOM   2794  C  CB    . ASN E 3 233 ? 29.829  9.850  -98.664  1.00 78.33  ? 529 ASN A CB    1 
ATOM   2795  C  CG    . ASN E 3 233 ? 31.201  9.443  -99.169  1.00 78.13  ? 529 ASN A CG    1 
ATOM   2796  O  OD1   . ASN E 3 233 ? 32.048  10.291 -99.454  1.00 77.78  ? 529 ASN A OD1   1 
ATOM   2797  N  ND2   . ASN E 3 233 ? 31.423  8.138  -99.292  1.00 78.07  ? 529 ASN A ND2   1 
ATOM   2798  N  N     . SER E 3 234 ? 27.843  11.028 -96.155  1.00 77.09  ? 530 SER A N     1 
ATOM   2799  C  CA    . SER E 3 234 ? 26.525  11.581 -95.868  1.00 76.54  ? 530 SER A CA    1 
ATOM   2800  C  C     . SER E 3 234 ? 26.610  12.805 -94.968  1.00 76.45  ? 530 SER A C     1 
ATOM   2801  O  O     . SER E 3 234 ? 26.773  12.676 -93.757  1.00 76.31  ? 530 SER A O     1 
ATOM   2802  C  CB    . SER E 3 234 ? 25.640  10.526 -95.200  1.00 76.45  ? 530 SER A CB    1 
ATOM   2803  O  OG    . SER E 3 234 ? 24.397  11.081 -94.805  1.00 75.68  ? 530 SER A OG    1 
ATOM   2804  N  N     . PRO E 3 235 ? 26.500  14.013 -95.550  1.00 76.46  ? 531 PRO A N     1 
ATOM   2805  C  CA    . PRO E 3 235 ? 26.567  15.252 -94.763  1.00 76.29  ? 531 PRO A CA    1 
ATOM   2806  C  C     . PRO E 3 235 ? 25.567  15.212 -93.608  1.00 76.06  ? 531 PRO A C     1 
ATOM   2807  O  O     . PRO E 3 235 ? 25.759  15.857 -92.577  1.00 76.12  ? 531 PRO A O     1 
ATOM   2808  C  CB    . PRO E 3 235 ? 26.232  16.329 -95.792  1.00 76.35  ? 531 PRO A CB    1 
ATOM   2809  C  CG    . PRO E 3 235 ? 26.795  15.759 -97.058  1.00 76.41  ? 531 PRO A CG    1 
ATOM   2810  C  CD    . PRO E 3 235 ? 26.339  14.315 -96.983  1.00 76.49  ? 531 PRO A CD    1 
ATOM   2811  N  N     . LYS E 3 236 ? 24.497  14.448 -93.802  1.00 75.83  ? 532 LYS A N     1 
ATOM   2812  C  CA    . LYS E 3 236 ? 23.464  14.279 -92.791  1.00 75.48  ? 532 LYS A CA    1 
ATOM   2813  C  C     . LYS E 3 236 ? 24.077  13.483 -91.647  1.00 75.31  ? 532 LYS A C     1 
ATOM   2814  O  O     . LYS E 3 236 ? 23.824  13.759 -90.472  1.00 75.23  ? 532 LYS A O     1 
ATOM   2815  C  CB    . LYS E 3 236 ? 22.282  13.510 -93.380  1.00 75.55  ? 532 LYS A CB    1 
ATOM   2816  C  CG    . LYS E 3 236 ? 21.242  13.073 -92.363  1.00 75.79  ? 532 LYS A CG    1 
ATOM   2817  C  CD    . LYS E 3 236 ? 20.225  12.120 -92.982  1.00 76.02  ? 532 LYS A CD    1 
ATOM   2818  C  CE    . LYS E 3 236 ? 20.858  10.787 -93.385  1.00 75.94  ? 532 LYS A CE    1 
ATOM   2819  N  NZ    . LYS E 3 236 ? 21.889  10.910 -94.458  1.00 75.80  ? 532 LYS A NZ    1 
ATOM   2820  N  N     . GLN E 3 237 ? 24.881  12.486 -92.009  1.00 75.10  ? 533 GLN A N     1 
ATOM   2821  C  CA    . GLN E 3 237 ? 25.559  11.645 -91.032  1.00 74.81  ? 533 GLN A CA    1 
ATOM   2822  C  C     . GLN E 3 237 ? 26.711  12.427 -90.428  1.00 74.71  ? 533 GLN A C     1 
ATOM   2823  O  O     . GLN E 3 237 ? 26.949  12.374 -89.222  1.00 74.93  ? 533 GLN A O     1 
ATOM   2824  C  CB    . GLN E 3 237 ? 26.099  10.378 -91.693  1.00 74.53  ? 533 GLN A CB    1 
ATOM   2825  C  CG    . GLN E 3 237 ? 25.041  9.368  -92.070  1.00 74.37  ? 533 GLN A CG    1 
ATOM   2826  C  CD    . GLN E 3 237 ? 25.647  8.064  -92.537  1.00 74.32  ? 533 GLN A CD    1 
ATOM   2827  O  OE1   . GLN E 3 237 ? 26.490  7.483  -91.856  1.00 74.18  ? 533 GLN A OE1   1 
ATOM   2828  N  NE2   . GLN E 3 237 ? 25.219  7.592  -93.701  1.00 74.47  ? 533 GLN A NE2   1 
ATOM   2829  N  N     . LEU E 3 238 ? 27.428  13.153 -91.276  1.00 74.49  ? 534 LEU A N     1 
ATOM   2830  C  CA    . LEU E 3 238 ? 28.547  13.952 -90.812  1.00 74.54  ? 534 LEU A CA    1 
ATOM   2831  C  C     . LEU E 3 238 ? 28.010  15.046 -89.891  1.00 74.38  ? 534 LEU A C     1 
ATOM   2832  O  O     . LEU E 3 238 ? 28.759  15.651 -89.133  1.00 74.57  ? 534 LEU A O     1 
ATOM   2833  C  CB    . LEU E 3 238 ? 29.290  14.577 -91.998  1.00 74.60  ? 534 LEU A CB    1 
ATOM   2834  C  CG    . LEU E 3 238 ? 30.635  15.239 -91.667  1.00 74.72  ? 534 LEU A CG    1 
ATOM   2835  C  CD1   . LEU E 3 238 ? 31.598  14.191 -91.119  1.00 74.47  ? 534 LEU A CD1   1 
ATOM   2836  C  CD2   . LEU E 3 238 ? 31.215  15.894 -92.911  1.00 74.40  ? 534 LEU A CD2   1 
ATOM   2837  N  N     . GLY E 3 239 ? 26.708  15.297 -89.965  1.00 74.15  ? 535 GLY A N     1 
ATOM   2838  C  CA    . GLY E 3 239 ? 26.105  16.310 -89.118  1.00 73.78  ? 535 GLY A CA    1 
ATOM   2839  C  C     . GLY E 3 239 ? 25.764  15.736 -87.755  1.00 73.53  ? 535 GLY A C     1 
ATOM   2840  O  O     . GLY E 3 239 ? 26.101  16.318 -86.721  1.00 73.47  ? 535 GLY A O     1 
ATOM   2841  N  N     . VAL E 3 240 ? 25.101  14.582 -87.756  1.00 73.10  ? 536 VAL A N     1 
ATOM   2842  C  CA    . VAL E 3 240 ? 24.705  13.911 -86.521  1.00 72.83  ? 536 VAL A CA    1 
ATOM   2843  C  C     . VAL E 3 240 ? 25.917  13.351 -85.776  1.00 72.59  ? 536 VAL A C     1 
ATOM   2844  O  O     . VAL E 3 240 ? 26.147  13.679 -84.612  1.00 72.50  ? 536 VAL A O     1 
ATOM   2845  C  CB    . VAL E 3 240 ? 23.710  12.760 -86.814  1.00 72.71  ? 536 VAL A CB    1 
ATOM   2846  C  CG1   . VAL E 3 240 ? 23.285  12.085 -85.514  1.00 72.69  ? 536 VAL A CG1   1 
ATOM   2847  C  CG2   . VAL E 3 240 ? 22.498  13.308 -87.549  1.00 72.46  ? 536 VAL A CG2   1 
ATOM   2848  N  N     . ILE E 3 241 ? 26.690  12.505 -86.452  1.00 72.35  ? 537 ILE A N     1 
ATOM   2849  C  CA    . ILE E 3 241 ? 27.886  11.901 -85.866  1.00 72.03  ? 537 ILE A CA    1 
ATOM   2850  C  C     . ILE E 3 241 ? 28.939  12.973 -85.761  1.00 72.13  ? 537 ILE A C     1 
ATOM   2851  O  O     . ILE E 3 241 ? 30.120  12.760 -86.066  1.00 72.18  ? 537 ILE A O     1 
ATOM   2852  C  CB    . ILE E 3 241 ? 28.431  10.743 -86.763  1.00 71.77  ? 537 ILE A CB    1 
ATOM   2853  C  CG1   . ILE E 3 241 ? 27.381  9.633  -86.905  1.00 71.74  ? 537 ILE A CG1   1 
ATOM   2854  C  CG2   . ILE E 3 241 ? 29.718  10.169 -86.182  1.00 71.38  ? 537 ILE A CG2   1 
ATOM   2855  C  CD1   . ILE E 3 241 ? 26.131  10.060 -87.637  1.00 71.45  ? 537 ILE A CD1   1 
ATOM   2856  N  N     . LEU E 3 242 ? 28.524  14.127 -85.325  1.00 72.17  ? 538 LEU A N     1 
ATOM   2857  C  CA    . LEU E 3 242 ? 29.408  15.306 -85.271  1.00 72.25  ? 538 LEU A CA    1 
ATOM   2858  C  C     . LEU E 3 242 ? 29.073  16.302 -84.138  1.00 72.21  ? 538 LEU A C     1 
ATOM   2859  O  O     . LEU E 3 242 ? 29.691  16.377 -83.077  1.00 72.29  ? 538 LEU A O     1 
ATOM   2860  C  CB    . LEU E 3 242 ? 29.230  16.054 -86.603  1.00 72.40  ? 538 LEU A CB    1 
ATOM   2861  C  CG    . LEU E 3 242 ? 30.312  17.015 -87.072  1.00 72.66  ? 538 LEU A CG    1 
ATOM   2862  C  CD1   . LEU E 3 242 ? 31.385  17.190 -86.003  1.00 72.78  ? 538 LEU A CD1   1 
ATOM   2863  C  CD2   . LEU E 3 242 ? 30.922  16.532 -88.373  1.00 72.59  ? 538 LEU A CD2   1 
ATOM   2864  N  N     . PHE E 3 243 ? 28.028  17.100 -84.472  1.00 71.85  ? 539 PHE A N     1 
ATOM   2865  C  CA    . PHE E 3 243 ? 27.467  18.158 -83.615  1.00 71.58  ? 539 PHE A CA    1 
ATOM   2866  C  C     . PHE E 3 243 ? 26.351  17.582 -82.712  1.00 71.41  ? 539 PHE A C     1 
ATOM   2867  O  O     . PHE E 3 243 ? 25.999  18.166 -81.681  1.00 71.28  ? 539 PHE A O     1 
ATOM   2868  C  CB    . PHE E 3 243 ? 26.847  19.299 -84.434  1.00 71.24  ? 539 PHE A CB    1 
ATOM   2869  C  CG    . PHE E 3 243 ? 27.790  19.933 -85.411  1.00 70.83  ? 539 PHE A CG    1 
ATOM   2870  C  CD1   . PHE E 3 243 ? 29.001  20.500 -85.019  1.00 70.68  ? 539 PHE A CD1   1 
ATOM   2871  C  CD2   . PHE E 3 243 ? 27.443  19.956 -86.760  1.00 70.65  ? 539 PHE A CD2   1 
ATOM   2872  C  CE1   . PHE E 3 243 ? 29.849  21.082 -85.960  1.00 70.54  ? 539 PHE A CE1   1 
ATOM   2873  C  CE2   . PHE E 3 243 ? 28.281  20.532 -87.704  1.00 70.31  ? 539 PHE A CE2   1 
ATOM   2874  C  CZ    . PHE E 3 243 ? 29.484  21.096 -87.305  1.00 70.38  ? 539 PHE A CZ    1 
ATOM   2875  N  N     . GLU E 3 244 ? 25.798  16.434 -83.092  1.00 71.34  ? 540 GLU A N     1 
ATOM   2876  C  CA    . GLU E 3 244 ? 24.715  15.835 -82.326  1.00 71.08  ? 540 GLU A CA    1 
ATOM   2877  C  C     . GLU E 3 244 ? 24.983  14.488 -81.653  1.00 71.22  ? 540 GLU A C     1 
ATOM   2878  O  O     . GLU E 3 244 ? 24.245  14.086 -80.753  1.00 71.13  ? 540 GLU A O     1 
ATOM   2879  C  CB    . GLU E 3 244 ? 23.477  15.774 -83.211  1.00 70.73  ? 540 GLU A CB    1 
ATOM   2880  C  CG    . GLU E 3 244 ? 22.867  17.151 -83.374  1.00 69.95  ? 540 GLU A CG    1 
ATOM   2881  C  CD    . GLU E 3 244 ? 21.696  17.166 -84.310  1.00 69.39  ? 540 GLU A CD    1 
ATOM   2882  O  OE1   . GLU E 3 244 ? 21.019  18.210 -84.383  1.00 69.07  ? 540 GLU A OE1   1 
ATOM   2883  O  OE2   . GLU E 3 244 ? 21.454  16.139 -84.977  1.00 69.09  ? 540 GLU A OE2   1 
ATOM   2884  N  N     . LYS E 3 245 ? 26.025  13.789 -82.088  1.00 71.53  ? 541 LYS A N     1 
ATOM   2885  C  CA    . LYS E 3 245 ? 26.406  12.519 -81.466  1.00 71.73  ? 541 LYS A CA    1 
ATOM   2886  C  C     . LYS E 3 245 ? 27.674  12.887 -80.707  1.00 72.02  ? 541 LYS A C     1 
ATOM   2887  O  O     . LYS E 3 245 ? 27.835  12.561 -79.531  1.00 72.36  ? 541 LYS A O     1 
ATOM   2888  C  CB    . LYS E 3 245 ? 26.747  11.445 -82.507  1.00 71.36  ? 541 LYS A CB    1 
ATOM   2889  C  CG    . LYS E 3 245 ? 27.115  10.080 -81.898  1.00 71.11  ? 541 LYS A CG    1 
ATOM   2890  C  CD    . LYS E 3 245 ? 28.045  9.269  -82.798  1.00 70.71  ? 541 LYS A CD    1 
ATOM   2891  C  CE    . LYS E 3 245 ? 29.507  9.673  -82.615  1.00 70.64  ? 541 LYS A CE    1 
ATOM   2892  N  NZ    . LYS E 3 245 ? 29.982  9.383  -81.230  1.00 70.41  ? 541 LYS A NZ    1 
ATOM   2893  N  N     . LEU E 3 246 ? 28.553  13.605 -81.405  1.00 72.26  ? 542 LEU A N     1 
ATOM   2894  C  CA    . LEU E 3 246 ? 29.828  14.058 -80.863  1.00 72.74  ? 542 LEU A CA    1 
ATOM   2895  C  C     . LEU E 3 246 ? 29.920  15.481 -80.332  1.00 73.05  ? 542 LEU A C     1 
ATOM   2896  O  O     . LEU E 3 246 ? 31.015  15.990 -80.104  1.00 73.06  ? 542 LEU A O     1 
ATOM   2897  C  CB    . LEU E 3 246 ? 30.926  13.839 -81.898  1.00 72.71  ? 542 LEU A CB    1 
ATOM   2898  C  CG    . LEU E 3 246 ? 31.683  12.542 -81.624  1.00 72.67  ? 542 LEU A CG    1 
ATOM   2899  C  CD1   . LEU E 3 246 ? 32.657  12.290 -82.756  1.00 72.64  ? 542 LEU A CD1   1 
ATOM   2900  C  CD2   . LEU E 3 246 ? 32.405  12.641 -80.278  1.00 72.43  ? 542 LEU A CD2   1 
ATOM   2901  N  N     . GLN E 3 247 ? 28.776  16.125 -80.166  1.00 73.52  ? 543 GLN A N     1 
ATOM   2902  C  CA    . GLN E 3 247 ? 28.723  17.479 -79.628  1.00 74.05  ? 543 GLN A CA    1 
ATOM   2903  C  C     . GLN E 3 247 ? 29.852  18.462 -79.972  1.00 74.36  ? 543 GLN A C     1 
ATOM   2904  O  O     . GLN E 3 247 ? 30.851  18.538 -79.247  1.00 74.70  ? 543 GLN A O     1 
ATOM   2905  C  CB    . GLN E 3 247 ? 28.603  17.426 -78.099  1.00 73.94  ? 543 GLN A CB    1 
ATOM   2906  C  CG    . GLN E 3 247 ? 27.339  16.797 -77.560  1.00 73.91  ? 543 GLN A CG    1 
ATOM   2907  C  CD    . GLN E 3 247 ? 26.104  17.572 -77.965  1.00 73.97  ? 543 GLN A CD    1 
ATOM   2908  O  OE1   . GLN E 3 247 ? 26.011  18.775 -77.733  1.00 73.77  ? 543 GLN A OE1   1 
ATOM   2909  N  NE2   . GLN E 3 247 ? 25.155  16.888 -78.579  1.00 73.74  ? 543 GLN A NE2   1 
ATOM   2910  N  N     . LEU E 3 248 ? 29.705  19.201 -81.075  1.00 74.47  ? 544 LEU A N     1 
ATOM   2911  C  CA    . LEU E 3 248 ? 30.656  20.275 -81.437  1.00 74.75  ? 544 LEU A CA    1 
ATOM   2912  C  C     . LEU E 3 248 ? 29.839  21.512 -81.808  1.00 75.11  ? 544 LEU A C     1 
ATOM   2913  O  O     . LEU E 3 248 ? 28.640  21.410 -82.077  1.00 75.11  ? 544 LEU A O     1 
ATOM   2914  C  CB    . LEU E 3 248 ? 31.489  19.867 -82.645  1.00 74.79  ? 544 LEU A CB    1 
ATOM   2915  C  CG    . LEU E 3 248 ? 32.836  19.172 -82.461  1.00 74.93  ? 544 LEU A CG    1 
ATOM   2916  C  CD1   . LEU E 3 248 ? 32.638  17.728 -82.021  1.00 75.02  ? 544 LEU A CD1   1 
ATOM   2917  C  CD2   . LEU E 3 248 ? 33.589  19.219 -83.789  1.00 75.05  ? 544 LEU A CD2   1 
ATOM   2918  N  N     . PRO E 3 249 ? 30.468  22.700 -81.827  1.00 75.48  ? 545 PRO A N     1 
ATOM   2919  C  CA    . PRO E 3 249 ? 29.708  23.910 -82.171  1.00 75.91  ? 545 PRO A CA    1 
ATOM   2920  C  C     . PRO E 3 249 ? 29.429  24.186 -83.658  1.00 76.24  ? 545 PRO A C     1 
ATOM   2921  O  O     . PRO E 3 249 ? 30.261  23.914 -84.527  1.00 76.33  ? 545 PRO A O     1 
ATOM   2922  C  CB    . PRO E 3 249 ? 30.526  25.023 -81.512  1.00 75.70  ? 545 PRO A CB    1 
ATOM   2923  C  CG    . PRO E 3 249 ? 31.923  24.522 -81.628  1.00 75.55  ? 545 PRO A CG    1 
ATOM   2924  C  CD    . PRO E 3 249 ? 31.782  23.053 -81.257  1.00 75.47  ? 545 PRO A CD    1 
ATOM   2925  N  N     . VAL E 3 250 ? 28.244  24.732 -83.934  1.00 76.58  ? 546 VAL A N     1 
ATOM   2926  C  CA    . VAL E 3 250 ? 27.820  25.065 -85.298  1.00 77.03  ? 546 VAL A CA    1 
ATOM   2927  C  C     . VAL E 3 250 ? 28.078  26.541 -85.617  1.00 77.08  ? 546 VAL A C     1 
ATOM   2928  O  O     . VAL E 3 250 ? 27.303  27.414 -85.219  1.00 77.25  ? 546 VAL A O     1 
ATOM   2929  C  CB    . VAL E 3 250 ? 26.309  24.782 -85.497  1.00 77.07  ? 546 VAL A CB    1 
ATOM   2930  C  CG1   . VAL E 3 250 ? 25.898  25.117 -86.923  1.00 77.16  ? 546 VAL A CG1   1 
ATOM   2931  C  CG2   . VAL E 3 250 ? 26.007  23.325 -85.183  1.00 77.03  ? 546 VAL A CG2   1 
ATOM   2932  N  N     . LEU E 3 251 ? 29.160  26.810 -86.344  1.00 77.01  ? 547 LEU A N     1 
ATOM   2933  C  CA    . LEU E 3 251 ? 29.528  28.178 -86.709  1.00 76.92  ? 547 LEU A CA    1 
ATOM   2934  C  C     . LEU E 3 251 ? 28.834  28.661 -87.978  1.00 77.03  ? 547 LEU A C     1 
ATOM   2935  O  O     . LEU E 3 251 ? 28.957  29.830 -88.352  1.00 77.03  ? 547 LEU A O     1 
ATOM   2936  C  CB    . LEU E 3 251 ? 31.045  28.287 -86.901  1.00 76.74  ? 547 LEU A CB    1 
ATOM   2937  C  CG    . LEU E 3 251 ? 31.965  27.944 -85.725  1.00 76.69  ? 547 LEU A CG    1 
ATOM   2938  C  CD1   . LEU E 3 251 ? 33.411  28.155 -86.148  1.00 76.17  ? 547 LEU A CD1   1 
ATOM   2939  C  CD2   . LEU E 3 251 ? 31.630  28.811 -84.521  1.00 76.32  ? 547 LEU A CD2   1 
ATOM   2940  N  N     . LYS E 3 252 ? 28.110  27.760 -88.638  1.00 77.11  ? 548 LYS A N     1 
ATOM   2941  C  CA    . LYS E 3 252 ? 27.408  28.095 -89.873  1.00 77.04  ? 548 LYS A CA    1 
ATOM   2942  C  C     . LYS E 3 252 ? 26.391  27.003 -90.200  1.00 76.93  ? 548 LYS A C     1 
ATOM   2943  O  O     . LYS E 3 252 ? 26.551  25.854 -89.784  1.00 76.82  ? 548 LYS A O     1 
ATOM   2944  C  CB    . LYS E 3 252 ? 28.418  28.238 -91.016  1.00 77.10  ? 548 LYS A CB    1 
ATOM   2945  C  CG    . LYS E 3 252 ? 27.837  28.787 -92.310  1.00 77.50  ? 548 LYS A CG    1 
ATOM   2946  C  CD    . LYS E 3 252 ? 28.902  28.913 -93.396  1.00 77.68  ? 548 LYS A CD    1 
ATOM   2947  C  CE    . LYS E 3 252 ? 29.501  27.558 -93.750  1.00 78.03  ? 548 LYS A CE    1 
ATOM   2948  N  NZ    . LYS E 3 252 ? 30.402  27.603 -94.937  1.00 78.21  ? 548 LYS A NZ    1 
ATOM   2949  N  N     . LYS E 3 253 ? 25.347  27.360 -90.944  1.00 76.91  ? 549 LYS A N     1 
ATOM   2950  C  CA    . LYS E 3 253 ? 24.307  26.398 -91.305  1.00 76.97  ? 549 LYS A CA    1 
ATOM   2951  C  C     . LYS E 3 253 ? 23.940  26.413 -92.789  1.00 76.93  ? 549 LYS A C     1 
ATOM   2952  O  O     . LYS E 3 253 ? 24.085  27.429 -93.468  1.00 76.86  ? 549 LYS A O     1 
ATOM   2953  C  CB    . LYS E 3 253 ? 23.052  26.648 -90.463  1.00 77.00  ? 549 LYS A CB    1 
ATOM   2954  C  CG    . LYS E 3 253 ? 23.284  26.512 -88.967  1.00 77.30  ? 549 LYS A CG    1 
ATOM   2955  C  CD    . LYS E 3 253 ? 22.007  26.707 -88.166  1.00 77.21  ? 549 LYS A CD    1 
ATOM   2956  C  CE    . LYS E 3 253 ? 22.278  26.542 -86.679  1.00 77.31  ? 549 LYS A CE    1 
ATOM   2957  N  NZ    . LYS E 3 253 ? 21.045  26.669 -85.859  1.00 77.34  ? 549 LYS A NZ    1 
ATOM   2958  N  N     . THR E 3 254 ? 23.461  25.275 -93.283  1.00 76.98  ? 550 THR A N     1 
ATOM   2959  C  CA    . THR E 3 254 ? 23.067  25.143 -94.684  1.00 77.06  ? 550 THR A CA    1 
ATOM   2960  C  C     . THR E 3 254 ? 21.550  25.229 -94.831  1.00 77.16  ? 550 THR A C     1 
ATOM   2961  O  O     . THR E 3 254 ? 20.821  25.248 -93.839  1.00 77.22  ? 550 THR A O     1 
ATOM   2962  C  CB    . THR E 3 254 ? 23.536  23.791 -95.281  1.00 76.95  ? 550 THR A CB    1 
ATOM   2963  O  OG1   . THR E 3 254 ? 22.882  22.709 -94.606  1.00 76.45  ? 550 THR A OG1   1 
ATOM   2964  C  CG2   . THR E 3 254 ? 25.041  23.638 -95.136  1.00 76.81  ? 550 THR A CG2   1 
ATOM   2965  N  N     . LYS E 3 255 ? 21.078  25.278 -96.074  1.00 77.21  ? 551 LYS A N     1 
ATOM   2966  C  CA    . LYS E 3 255 ? 19.648  25.354 -96.340  1.00 77.16  ? 551 LYS A CA    1 
ATOM   2967  C  C     . LYS E 3 255 ? 18.980  24.001 -96.095  1.00 77.05  ? 551 LYS A C     1 
ATOM   2968  O  O     . LYS E 3 255 ? 17.868  23.750 -96.559  1.00 77.20  ? 551 LYS A O     1 
ATOM   2969  C  CB    . LYS E 3 255 ? 19.401  25.828 -97.779  1.00 77.29  ? 551 LYS A CB    1 
ATOM   2970  C  CG    . LYS E 3 255 ? 20.096  24.999 -98.852  1.00 77.54  ? 551 LYS A CG    1 
ATOM   2971  C  CD    . LYS E 3 255 ? 20.119  25.722 -100.200 1.00 77.50  ? 551 LYS A CD    1 
ATOM   2972  C  CE    . LYS E 3 255 ? 18.720  26.009 -100.725 1.00 77.38  ? 551 LYS A CE    1 
ATOM   2973  N  NZ    . LYS E 3 255 ? 18.755  26.714 -102.036 1.00 77.08  ? 551 LYS A NZ    1 
ATOM   2974  N  N     . THR E 3 256 ? 19.672  23.137 -95.358  1.00 76.79  ? 552 THR A N     1 
ATOM   2975  C  CA    . THR E 3 256 ? 19.164  21.812 -95.014  1.00 76.42  ? 552 THR A CA    1 
ATOM   2976  C  C     . THR E 3 256 ? 19.499  21.506 -93.556  1.00 76.28  ? 552 THR A C     1 
ATOM   2977  O  O     . THR E 3 256 ? 18.715  20.876 -92.846  1.00 75.95  ? 552 THR A O     1 
ATOM   2978  C  CB    . THR E 3 256 ? 19.786  20.723 -95.901  1.00 76.22  ? 552 THR A CB    1 
ATOM   2979  O  OG1   . THR E 3 256 ? 21.211  20.873 -95.911  1.00 76.35  ? 552 THR A OG1   1 
ATOM   2980  C  CG2   . THR E 3 256 ? 19.249  20.818 -97.316  1.00 76.18  ? 552 THR A CG2   1 
ATOM   2981  N  N     . GLY E 3 257 ? 20.671  21.964 -93.122  1.00 76.18  ? 553 GLY A N     1 
ATOM   2982  C  CA    . GLY E 3 257 ? 21.109  21.745 -91.755  1.00 76.29  ? 553 GLY A CA    1 
ATOM   2983  C  C     . GLY E 3 257 ? 22.215  22.713 -91.381  1.00 76.36  ? 553 GLY A C     1 
ATOM   2984  O  O     . GLY E 3 257 ? 21.983  23.919 -91.304  1.00 76.62  ? 553 GLY A O     1 
ATOM   2985  N  N     . TYR E 3 258 ? 23.415  22.188 -91.145  1.00 76.28  ? 554 TYR A N     1 
ATOM   2986  C  CA    . TYR E 3 258 ? 24.571  23.009 -90.792  1.00 76.09  ? 554 TYR A CA    1 
ATOM   2987  C  C     . TYR E 3 258 ? 25.792  22.563 -91.593  1.00 75.59  ? 554 TYR A C     1 
ATOM   2988  O  O     . TYR E 3 258 ? 26.161  21.390 -91.596  1.00 75.71  ? 554 TYR A O     1 
ATOM   2989  C  CB    . TYR E 3 258 ? 24.859  22.917 -89.286  1.00 76.79  ? 554 TYR A CB    1 
ATOM   2990  C  CG    . TYR E 3 258 ? 24.419  21.618 -88.649  1.00 77.44  ? 554 TYR A CG    1 
ATOM   2991  C  CD1   . TYR E 3 258 ? 24.865  20.392 -89.143  1.00 77.62  ? 554 TYR A CD1   1 
ATOM   2992  C  CD2   . TYR E 3 258 ? 23.554  21.613 -87.553  1.00 77.56  ? 554 TYR A CD2   1 
ATOM   2993  C  CE1   . TYR E 3 258 ? 24.461  19.192 -88.565  1.00 77.97  ? 554 TYR A CE1   1 
ATOM   2994  C  CE2   . TYR E 3 258 ? 23.144  20.417 -86.966  1.00 77.91  ? 554 TYR A CE2   1 
ATOM   2995  C  CZ    . TYR E 3 258 ? 23.602  19.212 -87.477  1.00 78.08  ? 554 TYR A CZ    1 
ATOM   2996  O  OH    . TYR E 3 258 ? 23.204  18.029 -86.897  1.00 78.34  ? 554 TYR A OH    1 
ATOM   2997  N  N     . SER E 3 259 ? 26.400  23.519 -92.280  1.00 74.92  ? 555 SER A N     1 
ATOM   2998  C  CA    . SER E 3 259 ? 27.570  23.270 -93.107  1.00 74.32  ? 555 SER A CA    1 
ATOM   2999  C  C     . SER E 3 259 ? 28.611  22.293 -92.536  1.00 73.76  ? 555 SER A C     1 
ATOM   3000  O  O     . SER E 3 259 ? 28.981  22.370 -91.361  1.00 73.64  ? 555 SER A O     1 
ATOM   3001  C  CB    . SER E 3 259 ? 28.248  24.611 -93.453  1.00 74.30  ? 555 SER A CB    1 
ATOM   3002  O  OG    . SER E 3 259 ? 27.506  25.342 -94.427  1.00 74.45  ? 555 SER A OG    1 
ATOM   3003  N  N     . THR E 3 260 ? 29.064  21.368 -93.382  1.00 73.23  ? 556 THR A N     1 
ATOM   3004  C  CA    . THR E 3 260 ? 30.102  20.409 -93.016  1.00 72.76  ? 556 THR A CA    1 
ATOM   3005  C  C     . THR E 3 260 ? 31.172  20.601 -94.085  1.00 72.52  ? 556 THR A C     1 
ATOM   3006  O  O     . THR E 3 260 ? 31.994  19.715 -94.366  1.00 72.49  ? 556 THR A O     1 
ATOM   3007  C  CB    . THR E 3 260 ? 29.613  18.960 -93.050  1.00 72.60  ? 556 THR A CB    1 
ATOM   3008  O  OG1   . THR E 3 260 ? 29.418  18.542 -94.406  1.00 72.22  ? 556 THR A OG1   1 
ATOM   3009  C  CG2   . THR E 3 260 ? 28.310  18.837 -92.286  1.00 72.32  ? 556 THR A CG2   1 
ATOM   3010  N  N     . SER E 3 261 ? 31.122  21.789 -94.684  1.00 72.19  ? 557 SER A N     1 
ATOM   3011  C  CA    . SER E 3 261 ? 32.075  22.197 -95.695  1.00 71.86  ? 557 SER A CA    1 
ATOM   3012  C  C     . SER E 3 261 ? 33.440  22.117 -95.034  1.00 71.87  ? 557 SER A C     1 
ATOM   3013  O  O     . SER E 3 261 ? 33.548  21.972 -93.816  1.00 71.78  ? 557 SER A O     1 
ATOM   3014  C  CB    . SER E 3 261 ? 31.794  23.636 -96.147  1.00 71.77  ? 557 SER A CB    1 
ATOM   3015  O  OG    . SER E 3 261 ? 32.204  24.598 -95.185  1.00 71.81  ? 557 SER A OG    1 
ATOM   3016  N  N     . ALA E 3 262 ? 34.486  22.211 -95.836  1.00 71.78  ? 558 ALA A N     1 
ATOM   3017  C  CA    . ALA E 3 262 ? 35.823  22.128 -95.294  1.00 71.40  ? 558 ALA A CA    1 
ATOM   3018  C  C     . ALA E 3 262 ? 36.149  23.367 -94.463  1.00 71.23  ? 558 ALA A C     1 
ATOM   3019  O  O     . ALA E 3 262 ? 36.970  23.306 -93.554  1.00 71.32  ? 558 ALA A O     1 
ATOM   3020  C  CB    . ALA E 3 262 ? 36.819  21.950 -96.416  1.00 71.50  ? 558 ALA A CB    1 
ATOM   3021  N  N     . ASP E 3 263 ? 35.492  24.487 -94.751  1.00 71.01  ? 559 ASP A N     1 
ATOM   3022  C  CA    . ASP E 3 263 ? 35.746  25.711 -93.993  1.00 71.07  ? 559 ASP A CA    1 
ATOM   3023  C  C     . ASP E 3 263 ? 35.085  25.658 -92.620  1.00 70.99  ? 559 ASP A C     1 
ATOM   3024  O  O     . ASP E 3 263 ? 34.975  26.674 -91.931  1.00 70.86  ? 559 ASP A O     1 
ATOM   3025  C  CB    . ASP E 3 263 ? 35.257  26.942 -94.769  1.00 71.23  ? 559 ASP A CB    1 
ATOM   3026  C  CG    . ASP E 3 263 ? 36.274  27.429 -95.796  1.00 71.44  ? 559 ASP A CG    1 
ATOM   3027  O  OD1   . ASP E 3 263 ? 37.312  28.001 -95.395  1.00 71.43  ? 559 ASP A OD1   1 
ATOM   3028  O  OD2   . ASP E 3 263 ? 36.038  27.231 -97.006  1.00 71.44  ? 559 ASP A OD2   1 
ATOM   3029  N  N     . VAL E 3 264 ? 34.658  24.458 -92.230  1.00 70.91  ? 560 VAL A N     1 
ATOM   3030  C  CA    . VAL E 3 264 ? 34.012  24.231 -90.942  1.00 70.87  ? 560 VAL A CA    1 
ATOM   3031  C  C     . VAL E 3 264 ? 34.729  23.112 -90.185  1.00 70.95  ? 560 VAL A C     1 
ATOM   3032  O  O     . VAL E 3 264 ? 35.093  23.280 -89.023  1.00 71.09  ? 560 VAL A O     1 
ATOM   3033  C  CB    . VAL E 3 264 ? 32.524  23.859 -91.119  1.00 70.74  ? 560 VAL A CB    1 
ATOM   3034  C  CG1   . VAL E 3 264 ? 31.926  23.449 -89.786  1.00 70.70  ? 560 VAL A CG1   1 
ATOM   3035  C  CG2   . VAL E 3 264 ? 31.759  25.048 -91.690  1.00 70.53  ? 560 VAL A CG2   1 
ATOM   3036  N  N     . LEU E 3 265 ? 34.926  21.968 -90.839  1.00 70.91  ? 561 LEU A N     1 
ATOM   3037  C  CA    . LEU E 3 265 ? 35.628  20.855 -90.205  1.00 70.75  ? 561 LEU A CA    1 
ATOM   3038  C  C     . LEU E 3 265 ? 36.947  21.431 -89.714  1.00 70.75  ? 561 LEU A C     1 
ATOM   3039  O  O     . LEU E 3 265 ? 37.477  21.046 -88.674  1.00 70.56  ? 561 LEU A O     1 
ATOM   3040  C  CB    . LEU E 3 265 ? 35.903  19.741 -91.216  1.00 70.47  ? 561 LEU A CB    1 
ATOM   3041  C  CG    . LEU E 3 265 ? 34.712  18.996 -91.822  1.00 70.19  ? 561 LEU A CG    1 
ATOM   3042  C  CD1   . LEU E 3 265 ? 35.198  18.085 -92.933  1.00 69.98  ? 561 LEU A CD1   1 
ATOM   3043  C  CD2   . LEU E 3 265 ? 34.005  18.194 -90.748  1.00 70.10  ? 561 LEU A CD2   1 
ATOM   3044  N  N     . GLU E 3 266 ? 37.457  22.374 -90.492  1.00 70.96  ? 562 GLU A N     1 
ATOM   3045  C  CA    . GLU E 3 266 ? 38.701  23.061 -90.193  1.00 71.06  ? 562 GLU A CA    1 
ATOM   3046  C  C     . GLU E 3 266 ? 38.583  23.726 -88.821  1.00 71.20  ? 562 GLU A C     1 
ATOM   3047  O  O     . GLU E 3 266 ? 39.253  23.331 -87.865  1.00 71.12  ? 562 GLU A O     1 
ATOM   3048  C  CB    . GLU E 3 266 ? 38.945  24.109 -91.278  1.00 70.97  ? 562 GLU A CB    1 
ATOM   3049  C  CG    . GLU E 3 266 ? 40.208  24.922 -91.144  1.00 71.11  ? 562 GLU A CG    1 
ATOM   3050  C  CD    . GLU E 3 266 ? 40.271  26.022 -92.186  1.00 71.07  ? 562 GLU A CD    1 
ATOM   3051  O  OE1   . GLU E 3 266 ? 41.308  26.714 -92.271  1.00 71.23  ? 562 GLU A OE1   1 
ATOM   3052  O  OE2   . GLU E 3 266 ? 39.273  26.195 -92.918  1.00 71.01  ? 562 GLU A OE2   1 
ATOM   3053  N  N     . LYS E 3 267 ? 37.711  24.727 -88.737  1.00 71.46  ? 563 LYS A N     1 
ATOM   3054  C  CA    . LYS E 3 267 ? 37.478  25.473 -87.504  1.00 71.33  ? 563 LYS A CA    1 
ATOM   3055  C  C     . LYS E 3 267 ? 37.010  24.571 -86.362  1.00 71.45  ? 563 LYS A C     1 
ATOM   3056  O  O     . LYS E 3 267 ? 37.276  24.847 -85.188  1.00 71.46  ? 563 LYS A O     1 
ATOM   3057  C  CB    . LYS E 3 267 ? 36.438  26.571 -87.756  1.00 71.42  ? 563 LYS A CB    1 
ATOM   3058  C  CG    . LYS E 3 267 ? 36.786  27.515 -88.903  1.00 71.11  ? 563 LYS A CG    1 
ATOM   3059  C  CD    . LYS E 3 267 ? 35.687  28.541 -89.132  1.00 70.91  ? 563 LYS A CD    1 
ATOM   3060  C  CE    . LYS E 3 267 ? 36.031  29.481 -90.277  1.00 70.96  ? 563 LYS A CE    1 
ATOM   3061  N  NZ    . LYS E 3 267 ? 34.973  30.510 -90.485  1.00 70.85  ? 563 LYS A NZ    1 
ATOM   3062  N  N     . LEU E 3 268 ? 36.310  23.495 -86.708  1.00 71.26  ? 564 LEU A N     1 
ATOM   3063  C  CA    . LEU E 3 268 ? 35.807  22.557 -85.713  1.00 71.22  ? 564 LEU A CA    1 
ATOM   3064  C  C     . LEU E 3 268 ? 36.645  21.285 -85.707  1.00 71.23  ? 564 LEU A C     1 
ATOM   3065  O  O     . LEU E 3 268 ? 36.103  20.180 -85.720  1.00 71.15  ? 564 LEU A O     1 
ATOM   3066  C  CB    . LEU E 3 268 ? 34.345  22.201 -86.006  1.00 71.40  ? 564 LEU A CB    1 
ATOM   3067  C  CG    . LEU E 3 268 ? 33.287  23.298 -85.855  1.00 71.46  ? 564 LEU A CG    1 
ATOM   3068  C  CD1   . LEU E 3 268 ? 33.371  23.875 -84.452  1.00 71.39  ? 564 LEU A CD1   1 
ATOM   3069  C  CD2   . LEU E 3 268 ? 33.495  24.388 -86.891  1.00 71.37  ? 564 LEU A CD2   1 
ATOM   3070  N  N     . ALA E 3 269 ? 37.966  21.445 -85.679  1.00 71.20  ? 565 ALA A N     1 
ATOM   3071  C  CA    . ALA E 3 269 ? 38.872  20.300 -85.691  1.00 71.02  ? 565 ALA A CA    1 
ATOM   3072  C  C     . ALA E 3 269 ? 39.337  19.852 -84.302  1.00 70.81  ? 565 ALA A C     1 
ATOM   3073  O  O     . ALA E 3 269 ? 39.083  18.718 -83.896  1.00 70.96  ? 565 ALA A O     1 
ATOM   3074  C  CB    . ALA E 3 269 ? 40.083  20.602 -86.580  1.00 71.01  ? 565 ALA A CB    1 
ATOM   3075  N  N     . PRO E 3 270 ? 40.022  20.736 -83.556  1.00 70.32  ? 566 PRO A N     1 
ATOM   3076  C  CA    . PRO E 3 270 ? 40.516  20.402 -82.216  1.00 70.02  ? 566 PRO A CA    1 
ATOM   3077  C  C     . PRO E 3 270 ? 39.483  19.788 -81.270  1.00 69.69  ? 566 PRO A C     1 
ATOM   3078  O  O     . PRO E 3 270 ? 39.841  19.213 -80.243  1.00 69.62  ? 566 PRO A O     1 
ATOM   3079  C  CB    . PRO E 3 270 ? 41.036  21.740 -81.703  1.00 70.12  ? 566 PRO A CB    1 
ATOM   3080  C  CG    . PRO E 3 270 ? 41.520  22.400 -82.952  1.00 70.33  ? 566 PRO A CG    1 
ATOM   3081  C  CD    . PRO E 3 270 ? 40.387  22.120 -83.908  1.00 70.27  ? 566 PRO A CD    1 
ATOM   3082  N  N     . TYR E 3 271 ? 38.205  19.910 -81.609  1.00 69.41  ? 567 TYR A N     1 
ATOM   3083  C  CA    . TYR E 3 271 ? 37.155  19.358 -80.763  1.00 69.00  ? 567 TYR A CA    1 
ATOM   3084  C  C     . TYR E 3 271 ? 37.080  17.846 -80.888  1.00 68.68  ? 567 TYR A C     1 
ATOM   3085  O  O     . TYR E 3 271 ? 36.170  17.221 -80.346  1.00 68.85  ? 567 TYR A O     1 
ATOM   3086  C  CB    . TYR E 3 271 ? 35.799  19.973 -81.116  1.00 69.03  ? 567 TYR A CB    1 
ATOM   3087  C  CG    . TYR E 3 271 ? 35.717  21.449 -80.824  1.00 68.91  ? 567 TYR A CG    1 
ATOM   3088  C  CD1   . TYR E 3 271 ? 36.557  22.352 -81.470  1.00 68.89  ? 567 TYR A CD1   1 
ATOM   3089  C  CD2   . TYR E 3 271 ? 34.813  21.944 -79.890  1.00 68.88  ? 567 TYR A CD2   1 
ATOM   3090  C  CE1   . TYR E 3 271 ? 36.503  23.710 -81.194  1.00 68.97  ? 567 TYR A CE1   1 
ATOM   3091  C  CE2   . TYR E 3 271 ? 34.750  23.303 -79.605  1.00 68.96  ? 567 TYR A CE2   1 
ATOM   3092  C  CZ    . TYR E 3 271 ? 35.598  24.180 -80.262  1.00 68.91  ? 567 TYR A CZ    1 
ATOM   3093  O  OH    . TYR E 3 271 ? 35.545  25.526 -79.990  1.00 68.96  ? 567 TYR A OH    1 
ATOM   3094  N  N     . HIS E 3 272 ? 38.040  17.268 -81.607  1.00 68.10  ? 568 HIS A N     1 
ATOM   3095  C  CA    . HIS E 3 272 ? 38.108  15.824 -81.806  1.00 67.72  ? 568 HIS A CA    1 
ATOM   3096  C  C     . HIS E 3 272 ? 39.083  15.488 -82.931  1.00 67.60  ? 568 HIS A C     1 
ATOM   3097  O  O     . HIS E 3 272 ? 39.124  16.174 -83.952  1.00 67.55  ? 568 HIS A O     1 
ATOM   3098  C  CB    . HIS E 3 272 ? 36.728  15.264 -82.152  1.00 67.34  ? 568 HIS A CB    1 
ATOM   3099  C  CG    . HIS E 3 272 ? 36.569  13.813 -81.824  1.00 67.08  ? 568 HIS A CG    1 
ATOM   3100  N  ND1   . HIS E 3 272 ? 37.506  12.865 -82.169  1.00 66.69  ? 568 HIS A ND1   1 
ATOM   3101  C  CD2   . HIS E 3 272 ? 35.576  13.148 -81.187  1.00 67.06  ? 568 HIS A CD2   1 
ATOM   3102  C  CE1   . HIS E 3 272 ? 37.099  11.677 -81.758  1.00 66.78  ? 568 HIS A CE1   1 
ATOM   3103  N  NE2   . HIS E 3 272 ? 35.931  11.821 -81.160  1.00 66.81  ? 568 HIS A NE2   1 
ATOM   3104  N  N     . GLU E 3 273 ? 39.862  14.426 -82.748  1.00 67.63  ? 569 GLU A N     1 
ATOM   3105  C  CA    . GLU E 3 273 ? 40.833  14.017 -83.760  1.00 67.46  ? 569 GLU A CA    1 
ATOM   3106  C  C     . GLU E 3 273 ? 40.175  13.242 -84.903  1.00 67.31  ? 569 GLU A C     1 
ATOM   3107  O  O     . GLU E 3 273 ? 40.800  12.398 -85.543  1.00 67.12  ? 569 GLU A O     1 
ATOM   3108  C  CB    . GLU E 3 273 ? 41.947  13.180 -83.117  1.00 67.41  ? 569 GLU A CB    1 
ATOM   3109  C  CG    . GLU E 3 273 ? 43.010  12.687 -84.095  1.00 67.32  ? 569 GLU A CG    1 
ATOM   3110  C  CD    . GLU E 3 273 ? 43.538  13.785 -84.998  1.00 67.00  ? 569 GLU A CD    1 
ATOM   3111  O  OE1   . GLU E 3 273 ? 44.186  14.721 -84.487  1.00 67.34  ? 569 GLU A OE1   1 
ATOM   3112  O  OE2   . GLU E 3 273 ? 43.304  13.713 -86.222  1.00 66.72  ? 569 GLU A OE2   1 
ATOM   3113  N  N     . ILE E 3 274 ? 38.907  13.546 -85.155  1.00 67.11  ? 570 ILE A N     1 
ATOM   3114  C  CA    . ILE E 3 274 ? 38.155  12.904 -86.225  1.00 67.04  ? 570 ILE A CA    1 
ATOM   3115  C  C     . ILE E 3 274 ? 37.989  13.915 -87.353  1.00 67.44  ? 570 ILE A C     1 
ATOM   3116  O  O     . ILE E 3 274 ? 37.927  13.559 -88.528  1.00 67.53  ? 570 ILE A O     1 
ATOM   3117  C  CB    . ILE E 3 274 ? 36.755  12.478 -85.747  1.00 66.40  ? 570 ILE A CB    1 
ATOM   3118  C  CG1   . ILE E 3 274 ? 36.024  11.727 -86.862  1.00 66.08  ? 570 ILE A CG1   1 
ATOM   3119  C  CG2   . ILE E 3 274 ? 35.963  13.706 -85.333  1.00 66.18  ? 570 ILE A CG2   1 
ATOM   3120  C  CD1   . ILE E 3 274 ? 34.657  11.205 -86.463  1.00 65.66  ? 570 ILE A CD1   1 
ATOM   3121  N  N     . VAL E 3 275 ? 37.928  15.185 -86.977  1.00 67.92  ? 571 VAL A N     1 
ATOM   3122  C  CA    . VAL E 3 275 ? 37.753  16.259 -87.938  1.00 68.37  ? 571 VAL A CA    1 
ATOM   3123  C  C     . VAL E 3 275 ? 39.005  16.481 -88.775  1.00 68.61  ? 571 VAL A C     1 
ATOM   3124  O  O     . VAL E 3 275 ? 38.949  17.132 -89.817  1.00 68.73  ? 571 VAL A O     1 
ATOM   3125  C  CB    . VAL E 3 275 ? 37.398  17.572 -87.235  1.00 68.38  ? 571 VAL A CB    1 
ATOM   3126  C  CG1   . VAL E 3 275 ? 36.673  18.476 -88.197  1.00 68.66  ? 571 VAL A CG1   1 
ATOM   3127  C  CG2   . VAL E 3 275 ? 36.548  17.298 -86.003  1.00 68.88  ? 571 VAL A CG2   1 
ATOM   3128  N  N     . GLU E 3 276 ? 40.135  15.950 -88.316  1.00 68.76  ? 572 GLU A N     1 
ATOM   3129  C  CA    . GLU E 3 276 ? 41.383  16.098 -89.057  1.00 68.67  ? 572 GLU A CA    1 
ATOM   3130  C  C     . GLU E 3 276 ? 41.515  14.950 -90.047  1.00 68.47  ? 572 GLU A C     1 
ATOM   3131  O  O     . GLU E 3 276 ? 41.935  15.149 -91.189  1.00 68.38  ? 572 GLU A O     1 
ATOM   3132  C  CB    . GLU E 3 276 ? 42.590  16.103 -88.114  1.00 68.84  ? 572 GLU A CB    1 
ATOM   3133  C  CG    . GLU E 3 276 ? 42.574  17.206 -87.066  1.00 69.07  ? 572 GLU A CG    1 
ATOM   3134  C  CD    . GLU E 3 276 ? 43.959  17.498 -86.505  1.00 69.07  ? 572 GLU A CD    1 
ATOM   3135  O  OE1   . GLU E 3 276 ? 44.683  16.541 -86.158  1.00 68.88  ? 572 GLU A OE1   1 
ATOM   3136  O  OE2   . GLU E 3 276 ? 44.321  18.690 -86.406  1.00 69.08  ? 572 GLU A OE2   1 
ATOM   3137  N  N     . ASN E 3 277 ? 41.150  13.750 -89.608  1.00 68.32  ? 573 ASN A N     1 
ATOM   3138  C  CA    . ASN E 3 277 ? 41.226  12.576 -90.468  1.00 68.28  ? 573 ASN A CA    1 
ATOM   3139  C  C     . ASN E 3 277 ? 40.133  12.602 -91.525  1.00 68.02  ? 573 ASN A C     1 
ATOM   3140  O  O     . ASN E 3 277 ? 40.167  11.826 -92.482  1.00 68.12  ? 573 ASN A O     1 
ATOM   3141  C  CB    . ASN E 3 277 ? 41.111  11.298 -89.641  1.00 68.81  ? 573 ASN A CB    1 
ATOM   3142  C  CG    . ASN E 3 277 ? 42.286  11.105 -88.708  1.00 69.44  ? 573 ASN A CG    1 
ATOM   3143  O  OD1   . ASN E 3 277 ? 42.459  11.855 -87.743  1.00 69.60  ? 573 ASN A OD1   1 
ATOM   3144  N  ND2   . ASN E 3 277 ? 43.108  10.100 -88.995  1.00 69.61  ? 573 ASN A ND2   1 
ATOM   3145  N  N     . ILE E 3 278 ? 39.160  13.490 -91.339  1.00 67.30  ? 574 ILE A N     1 
ATOM   3146  C  CA    . ILE E 3 278 ? 38.065  13.639 -92.290  1.00 66.66  ? 574 ILE A CA    1 
ATOM   3147  C  C     . ILE E 3 278 ? 38.510  14.617 -93.370  1.00 66.03  ? 574 ILE A C     1 
ATOM   3148  O  O     . ILE E 3 278 ? 38.169  14.460 -94.541  1.00 65.96  ? 574 ILE A O     1 
ATOM   3149  C  CB    . ILE E 3 278 ? 36.779  14.163 -91.598  1.00 66.80  ? 574 ILE A CB    1 
ATOM   3150  C  CG1   . ILE E 3 278 ? 36.097  13.016 -90.844  1.00 66.97  ? 574 ILE A CG1   1 
ATOM   3151  C  CG2   . ILE E 3 278 ? 35.831  14.768 -92.624  1.00 66.76  ? 574 ILE A CG2   1 
ATOM   3152  C  CD1   . ILE E 3 278 ? 34.793  13.403 -90.167  1.00 66.89  ? 574 ILE A CD1   1 
ATOM   3153  N  N     . LEU E 3 279 ? 39.278  15.626 -92.973  1.00 65.26  ? 575 LEU A N     1 
ATOM   3154  C  CA    . LEU E 3 279 ? 39.782  16.602 -93.927  1.00 64.45  ? 575 LEU A CA    1 
ATOM   3155  C  C     . LEU E 3 279 ? 40.729  15.910 -94.904  1.00 63.91  ? 575 LEU A C     1 
ATOM   3156  O  O     . LEU E 3 279 ? 40.632  16.099 -96.117  1.00 63.65  ? 575 LEU A O     1 
ATOM   3157  C  CB    . LEU E 3 279 ? 40.530  17.723 -93.204  1.00 64.52  ? 575 LEU A CB    1 
ATOM   3158  C  CG    . LEU E 3 279 ? 39.710  18.693 -92.353  1.00 64.48  ? 575 LEU A CG    1 
ATOM   3159  C  CD1   . LEU E 3 279 ? 40.641  19.711 -91.712  1.00 64.50  ? 575 LEU A CD1   1 
ATOM   3160  C  CD2   . LEU E 3 279 ? 38.674  19.392 -93.222  1.00 64.77  ? 575 LEU A CD2   1 
ATOM   3161  N  N     . HIS E 3 280 ? 41.637  15.102 -94.363  1.00 63.10  ? 576 HIS A N     1 
ATOM   3162  C  CA    . HIS E 3 280 ? 42.617  14.381 -95.167  1.00 62.23  ? 576 HIS A CA    1 
ATOM   3163  C  C     . HIS E 3 280 ? 41.995  13.248 -95.976  1.00 61.76  ? 576 HIS A C     1 
ATOM   3164  O  O     . HIS E 3 280 ? 42.310  13.076 -97.151  1.00 61.62  ? 576 HIS A O     1 
ATOM   3165  C  CB    . HIS E 3 280 ? 43.715  13.807 -94.267  1.00 62.11  ? 576 HIS A CB    1 
ATOM   3166  C  CG    . HIS E 3 280 ? 44.797  13.089 -95.014  1.00 62.13  ? 576 HIS A CG    1 
ATOM   3167  N  ND1   . HIS E 3 280 ? 45.591  12.125 -94.429  1.00 61.96  ? 576 HIS A ND1   1 
ATOM   3168  C  CD2   . HIS E 3 280 ? 45.225  13.202 -96.294  1.00 62.05  ? 576 HIS A CD2   1 
ATOM   3169  C  CE1   . HIS E 3 280 ? 46.458  11.673 -95.317  1.00 61.57  ? 576 HIS A CE1   1 
ATOM   3170  N  NE2   . HIS E 3 280 ? 46.258  12.310 -96.456  1.00 61.87  ? 576 HIS A NE2   1 
ATOM   3171  N  N     . TYR E 3 281 ? 41.121  12.468 -95.350  1.00 61.25  ? 577 TYR A N     1 
ATOM   3172  C  CA    . TYR E 3 281 ? 40.488  11.357 -96.048  1.00 60.83  ? 577 TYR A CA    1 
ATOM   3173  C  C     . TYR E 3 281 ? 39.604  11.801 -97.209  1.00 60.25  ? 577 TYR A C     1 
ATOM   3174  O  O     . TYR E 3 281 ? 39.428  11.062 -98.179  1.00 60.54  ? 577 TYR A O     1 
ATOM   3175  C  CB    . TYR E 3 281 ? 39.652  10.508 -95.090  1.00 61.33  ? 577 TYR A CB    1 
ATOM   3176  C  CG    . TYR E 3 281 ? 38.794  9.509  -95.832  1.00 61.78  ? 577 TYR A CG    1 
ATOM   3177  C  CD1   . TYR E 3 281 ? 39.374  8.523  -96.629  1.00 61.84  ? 577 TYR A CD1   1 
ATOM   3178  C  CD2   . TYR E 3 281 ? 37.404  9.603  -95.809  1.00 62.10  ? 577 TYR A CD2   1 
ATOM   3179  C  CE1   . TYR E 3 281 ? 38.595  7.662  -97.390  1.00 62.12  ? 577 TYR A CE1   1 
ATOM   3180  C  CE2   . TYR E 3 281 ? 36.617  8.746  -96.568  1.00 62.30  ? 577 TYR A CE2   1 
ATOM   3181  C  CZ    . TYR E 3 281 ? 37.215  7.780  -97.357  1.00 62.27  ? 577 TYR A CZ    1 
ATOM   3182  O  OH    . TYR E 3 281 ? 36.434  6.944  -98.119  1.00 62.34  ? 577 TYR A OH    1 
ATOM   3183  N  N     . ARG E 3 282 ? 39.034  12.995 -97.110  1.00 59.11  ? 578 ARG A N     1 
ATOM   3184  C  CA    . ARG E 3 282 ? 38.179  13.494 -98.176  1.00 58.19  ? 578 ARG A CA    1 
ATOM   3185  C  C     . ARG E 3 282 ? 38.999  13.993 -99.350  1.00 57.67  ? 578 ARG A C     1 
ATOM   3186  O  O     . ARG E 3 282 ? 38.549  13.952 -100.495 1.00 57.41  ? 578 ARG A O     1 
ATOM   3187  C  CB    . ARG E 3 282 ? 37.289  14.624 -97.670  1.00 58.21  ? 578 ARG A CB    1 
ATOM   3188  C  CG    . ARG E 3 282 ? 35.903  14.181 -97.275  1.00 57.52  ? 578 ARG A CG    1 
ATOM   3189  C  CD    . ARG E 3 282 ? 35.046  15.382 -96.942  1.00 57.45  ? 578 ARG A CD    1 
ATOM   3190  N  NE    . ARG E 3 282 ? 33.677  14.999 -96.619  1.00 57.18  ? 578 ARG A NE    1 
ATOM   3191  C  CZ    . ARG E 3 282 ? 32.750  15.851 -96.201  1.00 57.40  ? 578 ARG A CZ    1 
ATOM   3192  N  NH1   . ARG E 3 282 ? 33.047  17.137 -96.056  1.00 56.77  ? 578 ARG A NH1   1 
ATOM   3193  N  NH2   . ARG E 3 282 ? 31.527  15.416 -95.925  1.00 57.33  ? 578 ARG A NH2   1 
ATOM   3194  N  N     . GLN E 3 283 ? 40.201  14.477 -99.060  1.00 57.06  ? 579 GLN A N     1 
ATOM   3195  C  CA    . GLN E 3 283 ? 41.078  14.976 -100.104 1.00 56.37  ? 579 GLN A CA    1 
ATOM   3196  C  C     . GLN E 3 283 ? 41.564  13.794 -100.922 1.00 55.99  ? 579 GLN A C     1 
ATOM   3197  O  O     . GLN E 3 283 ? 41.546  13.834 -102.151 1.00 56.28  ? 579 GLN A O     1 
ATOM   3198  C  CB    . GLN E 3 283 ? 42.259  15.722 -99.490  1.00 56.26  ? 579 GLN A CB    1 
ATOM   3199  C  CG    . GLN E 3 283 ? 41.839  16.895 -98.626  1.00 56.48  ? 579 GLN A CG    1 
ATOM   3200  C  CD    . GLN E 3 283 ? 43.013  17.723 -98.162  1.00 56.71  ? 579 GLN A CD    1 
ATOM   3201  O  OE1   . GLN E 3 283 ? 44.037  17.184 -97.737  1.00 57.03  ? 579 GLN A OE1   1 
ATOM   3202  N  NE2   . GLN E 3 283 ? 42.870  19.042 -98.228  1.00 56.46  ? 579 GLN A NE2   1 
ATOM   3203  N  N     . LEU E 3 284 ? 41.994  12.742 -100.234 1.00 55.30  ? 580 LEU A N     1 
ATOM   3204  C  CA    . LEU E 3 284 ? 42.470  11.534 -100.898 1.00 54.97  ? 580 LEU A CA    1 
ATOM   3205  C  C     . LEU E 3 284 ? 41.325  10.886 -101.668 1.00 54.70  ? 580 LEU A C     1 
ATOM   3206  O  O     . LEU E 3 284 ? 41.540  10.236 -102.692 1.00 54.59  ? 580 LEU A O     1 
ATOM   3207  C  CB    . LEU E 3 284 ? 43.025  10.537 -99.872  1.00 54.83  ? 580 LEU A CB    1 
ATOM   3208  C  CG    . LEU E 3 284 ? 44.369  10.848 -99.205  1.00 54.65  ? 580 LEU A CG    1 
ATOM   3209  C  CD1   . LEU E 3 284 ? 44.700  9.752  -98.202  1.00 54.53  ? 580 LEU A CD1   1 
ATOM   3210  C  CD2   . LEU E 3 284 ? 45.458  10.941 -100.254 1.00 53.81  ? 580 LEU A CD2   1 
ATOM   3211  N  N     . GLY E 3 285 ? 40.108  11.059 -101.163 1.00 54.31  ? 581 GLY A N     1 
ATOM   3212  C  CA    . GLY E 3 285 ? 38.951  10.495 -101.827 1.00 53.71  ? 581 GLY A CA    1 
ATOM   3213  C  C     . GLY E 3 285 ? 38.750  11.193 -103.155 1.00 53.13  ? 581 GLY A C     1 
ATOM   3214  O  O     . GLY E 3 285 ? 38.807  10.569 -104.212 1.00 53.41  ? 581 GLY A O     1 
ATOM   3215  N  N     . LYS E 3 286 ? 38.515  12.499 -103.094 1.00 52.85  ? 582 LYS A N     1 
ATOM   3216  C  CA    . LYS E 3 286 ? 38.316  13.307 -104.289 1.00 52.49  ? 582 LYS A CA    1 
ATOM   3217  C  C     . LYS E 3 286 ? 39.381  12.938 -105.311 1.00 52.59  ? 582 LYS A C     1 
ATOM   3218  O  O     . LYS E 3 286 ? 39.086  12.394 -106.372 1.00 52.60  ? 582 LYS A O     1 
ATOM   3219  C  CB    . LYS E 3 286 ? 38.451  14.788 -103.941 1.00 52.11  ? 582 LYS A CB    1 
ATOM   3220  C  CG    . LYS E 3 286 ? 38.300  15.738 -105.117 1.00 51.16  ? 582 LYS A CG    1 
ATOM   3221  C  CD    . LYS E 3 286 ? 36.857  15.837 -105.557 1.00 50.76  ? 582 LYS A CD    1 
ATOM   3222  C  CE    . LYS E 3 286 ? 36.665  16.945 -106.578 1.00 50.59  ? 582 LYS A CE    1 
ATOM   3223  N  NZ    . LYS E 3 286 ? 35.226  17.132 -106.900 1.00 50.07  ? 582 LYS A NZ    1 
ATOM   3224  N  N     . LEU E 3 287 ? 40.626  13.230 -104.960 1.00 52.58  ? 583 LEU A N     1 
ATOM   3225  C  CA    . LEU E 3 287 ? 41.766  12.962 -105.818 1.00 53.03  ? 583 LEU A CA    1 
ATOM   3226  C  C     . LEU E 3 287 ? 41.830  11.525 -106.334 1.00 53.19  ? 583 LEU A C     1 
ATOM   3227  O  O     . LEU E 3 287 ? 42.419  11.266 -107.383 1.00 53.43  ? 583 LEU A O     1 
ATOM   3228  C  CB    . LEU E 3 287 ? 43.049  13.323 -105.064 1.00 52.97  ? 583 LEU A CB    1 
ATOM   3229  C  CG    . LEU E 3 287 ? 44.396  13.162 -105.761 1.00 53.20  ? 583 LEU A CG    1 
ATOM   3230  C  CD1   . LEU E 3 287 ? 45.428  14.022 -105.054 1.00 53.79  ? 583 LEU A CD1   1 
ATOM   3231  C  CD2   . LEU E 3 287 ? 44.815  11.704 -105.755 1.00 53.38  ? 583 LEU A CD2   1 
ATOM   3232  N  N     . GLN E 3 288 ? 41.216  10.595 -105.610 1.00 53.09  ? 584 GLN A N     1 
ATOM   3233  C  CA    . GLN E 3 288 ? 41.225  9.187  -106.004 1.00 52.99  ? 584 GLN A CA    1 
ATOM   3234  C  C     . GLN E 3 288 ? 40.219  8.868  -107.108 1.00 52.69  ? 584 GLN A C     1 
ATOM   3235  O  O     . GLN E 3 288 ? 40.571  8.299  -108.142 1.00 52.32  ? 584 GLN A O     1 
ATOM   3236  C  CB    . GLN E 3 288 ? 40.930  8.301  -104.788 1.00 53.49  ? 584 GLN A CB    1 
ATOM   3237  C  CG    . GLN E 3 288 ? 40.861  6.809  -105.088 1.00 53.86  ? 584 GLN A CG    1 
ATOM   3238  C  CD    . GLN E 3 288 ? 42.216  6.198  -105.378 1.00 54.13  ? 584 GLN A CD    1 
ATOM   3239  O  OE1   . GLN E 3 288 ? 42.913  6.611  -106.303 1.00 54.74  ? 584 GLN A OE1   1 
ATOM   3240  N  NE2   . GLN E 3 288 ? 42.595  5.205  -104.586 1.00 54.26  ? 584 GLN A NE2   1 
ATOM   3241  N  N     . SER E 3 289 ? 38.963  9.231  -106.876 1.00 52.24  ? 585 SER A N     1 
ATOM   3242  C  CA    . SER E 3 289 ? 37.913  8.964  -107.844 1.00 51.98  ? 585 SER A CA    1 
ATOM   3243  C  C     . SER E 3 289 ? 37.825  10.024 -108.943 1.00 51.64  ? 585 SER A C     1 
ATOM   3244  O  O     . SER E 3 289 ? 37.972  9.712  -110.120 1.00 51.79  ? 585 SER A O     1 
ATOM   3245  C  CB    . SER E 3 289 ? 36.559  8.847  -107.133 1.00 51.56  ? 585 SER A CB    1 
ATOM   3246  O  OG    . SER E 3 289 ? 36.173  10.083 -106.561 1.00 51.18  ? 585 SER A OG    1 
ATOM   3247  N  N     . THR E 3 290 ? 37.599  11.273 -108.550 1.00 51.26  ? 586 THR A N     1 
ATOM   3248  C  CA    . THR E 3 290 ? 37.459  12.369 -109.503 1.00 51.05  ? 586 THR A CA    1 
ATOM   3249  C  C     . THR E 3 290 ? 38.692  12.652 -110.373 1.00 50.75  ? 586 THR A C     1 
ATOM   3250  O  O     . THR E 3 290 ? 38.715  13.637 -111.114 1.00 50.29  ? 586 THR A O     1 
ATOM   3251  C  CB    . THR E 3 290 ? 37.042  13.674 -108.776 1.00 51.21  ? 586 THR A CB    1 
ATOM   3252  O  OG1   . THR E 3 290 ? 35.932  13.405 -107.910 1.00 51.26  ? 586 THR A OG1   1 
ATOM   3253  C  CG2   . THR E 3 290 ? 36.619  14.737 -109.779 1.00 51.07  ? 586 THR A CG2   1 
ATOM   3254  N  N     . TYR E 3 291 ? 39.714  11.803 -110.303 1.00 50.31  ? 587 TYR A N     1 
ATOM   3255  C  CA    . TYR E 3 291 ? 40.900  12.031 -111.130 1.00 50.14  ? 587 TYR A CA    1 
ATOM   3256  C  C     . TYR E 3 291 ? 41.599  10.774 -111.642 1.00 50.27  ? 587 TYR A C     1 
ATOM   3257  O  O     . TYR E 3 291 ? 41.482  10.445 -112.817 1.00 50.84  ? 587 TYR A O     1 
ATOM   3258  C  CB    . TYR E 3 291 ? 41.906  12.934 -110.401 1.00 49.62  ? 587 TYR A CB    1 
ATOM   3259  C  CG    . TYR E 3 291 ? 41.393  14.339 -110.151 1.00 49.44  ? 587 TYR A CG    1 
ATOM   3260  C  CD1   . TYR E 3 291 ? 40.827  14.687 -108.923 1.00 49.38  ? 587 TYR A CD1   1 
ATOM   3261  C  CD2   . TYR E 3 291 ? 41.421  15.307 -111.158 1.00 49.11  ? 587 TYR A CD2   1 
ATOM   3262  C  CE1   . TYR E 3 291 ? 40.300  15.959 -108.702 1.00 49.35  ? 587 TYR A CE1   1 
ATOM   3263  C  CE2   . TYR E 3 291 ? 40.892  16.586 -110.947 1.00 49.14  ? 587 TYR A CE2   1 
ATOM   3264  C  CZ    . TYR E 3 291 ? 40.333  16.902 -109.714 1.00 49.22  ? 587 TYR A CZ    1 
ATOM   3265  O  OH    . TYR E 3 291 ? 39.804  18.154 -109.486 1.00 49.60  ? 587 TYR A OH    1 
ATOM   3266  N  N     . ILE E 3 292 ? 42.325  10.073 -110.778 1.00 50.26  ? 588 ILE A N     1 
ATOM   3267  C  CA    . ILE E 3 292 ? 43.031  8.862  -111.197 1.00 50.58  ? 588 ILE A CA    1 
ATOM   3268  C  C     . ILE E 3 292 ? 42.161  7.984  -112.094 1.00 50.67  ? 588 ILE A C     1 
ATOM   3269  O  O     . ILE E 3 292 ? 42.501  7.726  -113.246 1.00 50.93  ? 588 ILE A O     1 
ATOM   3270  C  CB    . ILE E 3 292 ? 43.491  8.039  -109.976 1.00 50.62  ? 588 ILE A CB    1 
ATOM   3271  C  CG1   . ILE E 3 292 ? 44.416  8.891  -109.111 1.00 50.84  ? 588 ILE A CG1   1 
ATOM   3272  C  CG2   . ILE E 3 292 ? 44.212  6.776  -110.423 1.00 50.26  ? 588 ILE A CG2   1 
ATOM   3273  C  CD1   . ILE E 3 292 ? 45.611  9.435  -109.857 1.00 51.68  ? 588 ILE A CD1   1 
ATOM   3274  N  N     . GLU E 3 293 ? 41.031  7.533  -111.565 1.00 50.95  ? 589 GLU A N     1 
ATOM   3275  C  CA    . GLU E 3 293 ? 40.115  6.695  -112.328 1.00 50.80  ? 589 GLU A CA    1 
ATOM   3276  C  C     . GLU E 3 293 ? 39.390  7.568  -113.356 1.00 50.64  ? 589 GLU A C     1 
ATOM   3277  O  O     . GLU E 3 293 ? 39.305  7.218  -114.536 1.00 50.84  ? 589 GLU A O     1 
ATOM   3278  C  CB    . GLU E 3 293 ? 39.099  6.057  -111.385 1.00 51.62  ? 589 GLU A CB    1 
ATOM   3279  C  CG    . GLU E 3 293 ? 39.720  5.389  -110.174 1.00 52.47  ? 589 GLU A CG    1 
ATOM   3280  C  CD    . GLU E 3 293 ? 38.691  5.022  -109.123 1.00 53.55  ? 589 GLU A CD    1 
ATOM   3281  O  OE1   . GLU E 3 293 ? 37.979  5.937  -108.652 1.00 53.95  ? 589 GLU A OE1   1 
ATOM   3282  O  OE2   . GLU E 3 293 ? 38.595  3.824  -108.768 1.00 54.09  ? 589 GLU A OE2   1 
ATOM   3283  N  N     . GLY E 3 294 ? 38.880  8.709  -112.894 1.00 50.05  ? 590 GLY A N     1 
ATOM   3284  C  CA    . GLY E 3 294 ? 38.163  9.631  -113.760 1.00 49.01  ? 590 GLY A CA    1 
ATOM   3285  C  C     . GLY E 3 294 ? 38.879  9.978  -115.050 1.00 48.51  ? 590 GLY A C     1 
ATOM   3286  O  O     . GLY E 3 294 ? 38.244  10.197 -116.082 1.00 48.17  ? 590 GLY A O     1 
ATOM   3287  N  N     . LEU E 3 295 ? 40.206  10.034 -114.996 1.00 48.17  ? 591 LEU A N     1 
ATOM   3288  C  CA    . LEU E 3 295 ? 41.008  10.350 -116.171 1.00 47.36  ? 591 LEU A CA    1 
ATOM   3289  C  C     . LEU E 3 295 ? 41.271  9.092  -116.983 1.00 46.90  ? 591 LEU A C     1 
ATOM   3290  O  O     . LEU E 3 295 ? 41.101  9.081  -118.197 1.00 46.65  ? 591 LEU A O     1 
ATOM   3291  C  CB    . LEU E 3 295 ? 42.342  10.973 -115.760 1.00 47.00  ? 591 LEU A CB    1 
ATOM   3292  C  CG    . LEU E 3 295 ? 42.350  12.422 -115.281 1.00 47.08  ? 591 LEU A CG    1 
ATOM   3293  C  CD1   . LEU E 3 295 ? 43.753  12.797 -114.820 1.00 46.71  ? 591 LEU A CD1   1 
ATOM   3294  C  CD2   . LEU E 3 295 ? 41.901  13.339 -116.411 1.00 46.81  ? 591 LEU A CD2   1 
ATOM   3295  N  N     . LEU E 3 296 ? 41.696  8.034  -116.302 1.00 46.70  ? 592 LEU A N     1 
ATOM   3296  C  CA    . LEU E 3 296 ? 41.988  6.762  -116.956 1.00 46.39  ? 592 LEU A CA    1 
ATOM   3297  C  C     . LEU E 3 296 ? 40.747  6.187  -117.636 1.00 46.05  ? 592 LEU A C     1 
ATOM   3298  O  O     . LEU E 3 296 ? 40.847  5.338  -118.523 1.00 45.96  ? 592 LEU A O     1 
ATOM   3299  C  CB    . LEU E 3 296 ? 42.535  5.769  -115.923 1.00 46.53  ? 592 LEU A CB    1 
ATOM   3300  C  CG    . LEU E 3 296 ? 43.845  6.227  -115.268 1.00 46.11  ? 592 LEU A CG    1 
ATOM   3301  C  CD1   . LEU E 3 296 ? 44.216  5.296  -114.130 1.00 46.63  ? 592 LEU A CD1   1 
ATOM   3302  C  CD2   . LEU E 3 296 ? 44.946  6.271  -116.315 1.00 45.84  ? 592 LEU A CD2   1 
ATOM   3303  N  N     . LYS E 3 297 ? 39.582  6.665  -117.210 1.00 45.62  ? 593 LYS A N     1 
ATOM   3304  C  CA    . LYS E 3 297 ? 38.300  6.229  -117.752 1.00 45.20  ? 593 LYS A CA    1 
ATOM   3305  C  C     . LYS E 3 297 ? 38.096  6.831  -119.144 1.00 44.81  ? 593 LYS A C     1 
ATOM   3306  O  O     . LYS E 3 297 ? 37.372  6.279  -119.971 1.00 44.84  ? 593 LYS A O     1 
ATOM   3307  C  CB    . LYS E 3 297 ? 37.179  6.682  -116.813 1.00 45.38  ? 593 LYS A CB    1 
ATOM   3308  C  CG    . LYS E 3 297 ? 35.845  5.973  -116.981 1.00 45.35  ? 593 LYS A CG    1 
ATOM   3309  C  CD    . LYS E 3 297 ? 34.855  6.467  -115.920 1.00 45.87  ? 593 LYS A CD    1 
ATOM   3310  C  CE    . LYS E 3 297 ? 35.478  6.430  -114.521 1.00 46.01  ? 593 LYS A CE    1 
ATOM   3311  N  NZ    . LYS E 3 297 ? 34.588  6.984  -113.468 1.00 46.24  ? 593 LYS A NZ    1 
ATOM   3312  N  N     . VAL E 3 298 ? 38.740  7.966  -119.400 1.00 44.05  ? 594 VAL A N     1 
ATOM   3313  C  CA    . VAL E 3 298 ? 38.616  8.626  -120.694 1.00 44.00  ? 594 VAL A CA    1 
ATOM   3314  C  C     . VAL E 3 298 ? 39.871  8.489  -121.565 1.00 43.35  ? 594 VAL A C     1 
ATOM   3315  O  O     . VAL E 3 298 ? 39.918  8.994  -122.686 1.00 42.55  ? 594 VAL A O     1 
ATOM   3316  C  CB    . VAL E 3 298 ? 38.267  10.127 -120.520 1.00 43.88  ? 594 VAL A CB    1 
ATOM   3317  C  CG1   . VAL E 3 298 ? 37.061  10.266 -119.610 1.00 44.54  ? 594 VAL A CG1   1 
ATOM   3318  C  CG2   . VAL E 3 298 ? 39.447  10.888 -119.959 1.00 44.19  ? 594 VAL A CG2   1 
ATOM   3319  N  N     . VAL E 3 299 ? 40.880  7.792  -121.052 1.00 43.41  ? 595 VAL A N     1 
ATOM   3320  C  CA    . VAL E 3 299 ? 42.125  7.590  -121.796 1.00 43.82  ? 595 VAL A CA    1 
ATOM   3321  C  C     . VAL E 3 299 ? 41.907  6.487  -122.827 1.00 44.30  ? 595 VAL A C     1 
ATOM   3322  O  O     . VAL E 3 299 ? 41.542  5.366  -122.476 1.00 44.57  ? 595 VAL A O     1 
ATOM   3323  C  CB    . VAL E 3 299 ? 43.291  7.174  -120.848 1.00 43.40  ? 595 VAL A CB    1 
ATOM   3324  C  CG1   . VAL E 3 299 ? 44.547  6.861  -121.650 1.00 42.42  ? 595 VAL A CG1   1 
ATOM   3325  C  CG2   . VAL E 3 299 ? 43.571  8.282  -119.854 1.00 42.66  ? 595 VAL A CG2   1 
ATOM   3326  N  N     . ARG E 3 300 ? 42.114  6.805  -124.101 1.00 44.78  ? 596 ARG A N     1 
ATOM   3327  C  CA    . ARG E 3 300 ? 41.932  5.806  -125.148 1.00 45.39  ? 596 ARG A CA    1 
ATOM   3328  C  C     . ARG E 3 300 ? 43.030  4.755  -125.010 1.00 45.93  ? 596 ARG A C     1 
ATOM   3329  O  O     . ARG E 3 300 ? 44.123  5.055  -124.546 1.00 46.43  ? 596 ARG A O     1 
ATOM   3330  C  CB    . ARG E 3 300 ? 41.968  6.470  -126.531 1.00 45.09  ? 596 ARG A CB    1 
ATOM   3331  C  CG    . ARG E 3 300 ? 40.797  7.423  -126.786 1.00 44.71  ? 596 ARG A CG    1 
ATOM   3332  C  CD    . ARG E 3 300 ? 40.820  7.990  -128.200 1.00 44.67  ? 596 ARG A CD    1 
ATOM   3333  N  NE    . ARG E 3 300 ? 40.478  6.990  -129.211 1.00 45.48  ? 596 ARG A NE    1 
ATOM   3334  C  CZ    . ARG E 3 300 ? 39.234  6.631  -129.522 1.00 45.68  ? 596 ARG A CZ    1 
ATOM   3335  N  NH1   . ARG E 3 300 ? 38.203  7.195  -128.905 1.00 45.65  ? 596 ARG A NH1   1 
ATOM   3336  N  NH2   . ARG E 3 300 ? 39.019  5.701  -130.441 1.00 45.04  ? 596 ARG A NH2   1 
ATOM   3337  N  N     . PRO E 3 301 ? 42.749  3.503  -125.401 1.00 46.67  ? 597 PRO A N     1 
ATOM   3338  C  CA    . PRO E 3 301 ? 43.740  2.428  -125.301 1.00 46.95  ? 597 PRO A CA    1 
ATOM   3339  C  C     . PRO E 3 301 ? 45.045  2.650  -126.065 1.00 47.34  ? 597 PRO A C     1 
ATOM   3340  O  O     . PRO E 3 301 ? 46.116  2.695  -125.461 1.00 47.86  ? 597 PRO A O     1 
ATOM   3341  C  CB    . PRO E 3 301 ? 42.971  1.204  -125.802 1.00 47.25  ? 597 PRO A CB    1 
ATOM   3342  C  CG    . PRO E 3 301 ? 42.018  1.794  -126.795 1.00 47.22  ? 597 PRO A CG    1 
ATOM   3343  C  CD    . PRO E 3 301 ? 41.519  3.014  -126.049 1.00 47.33  ? 597 PRO A CD    1 
ATOM   3344  N  N     . ASP E 3 302 ? 44.970  2.788  -127.385 1.00 47.33  ? 598 ASP A N     1 
ATOM   3345  C  CA    . ASP E 3 302 ? 46.184  2.982  -128.166 1.00 47.09  ? 598 ASP A CA    1 
ATOM   3346  C  C     . ASP E 3 302 ? 46.953  4.267  -127.858 1.00 46.83  ? 598 ASP A C     1 
ATOM   3347  O  O     . ASP E 3 302 ? 47.837  4.262  -127.002 1.00 48.18  ? 598 ASP A O     1 
ATOM   3348  C  CB    . ASP E 3 302 ? 45.893  2.875  -129.676 1.00 47.48  ? 598 ASP A CB    1 
ATOM   3349  C  CG    . ASP E 3 302 ? 44.626  3.600  -130.097 1.00 48.18  ? 598 ASP A CG    1 
ATOM   3350  O  OD1   . ASP E 3 302 ? 44.392  3.707  -131.321 1.00 48.74  ? 598 ASP A OD1   1 
ATOM   3351  O  OD2   . ASP E 3 302 ? 43.861  4.051  -129.220 1.00 48.23  ? 598 ASP A OD2   1 
ATOM   3352  N  N     . THR E 3 303 ? 46.617  5.359  -128.537 1.00 46.19  ? 599 THR A N     1 
ATOM   3353  C  CA    . THR E 3 303 ? 47.294  6.643  -128.360 1.00 44.85  ? 599 THR A CA    1 
ATOM   3354  C  C     . THR E 3 303 ? 47.564  7.113  -126.929 1.00 44.49  ? 599 THR A C     1 
ATOM   3355  O  O     . THR E 3 303 ? 48.330  8.059  -126.730 1.00 44.50  ? 599 THR A O     1 
ATOM   3356  C  CB    . THR E 3 303 ? 46.523  7.773  -129.068 1.00 45.04  ? 599 THR A CB    1 
ATOM   3357  O  OG1   . THR E 3 303 ? 45.293  8.025  -128.373 1.00 45.14  ? 599 THR A OG1   1 
ATOM   3358  C  CG2   . THR E 3 303 ? 46.221  7.390  -130.510 1.00 43.90  ? 599 THR A CG2   1 
ATOM   3359  N  N     . LYS E 3 304 ? 46.942  6.468  -125.941 1.00 43.50  ? 600 LYS A N     1 
ATOM   3360  C  CA    . LYS E 3 304 ? 47.115  6.849  -124.537 1.00 41.88  ? 600 LYS A CA    1 
ATOM   3361  C  C     . LYS E 3 304 ? 46.863  8.334  -124.295 1.00 40.48  ? 600 LYS A C     1 
ATOM   3362  O  O     . LYS E 3 304 ? 47.463  8.933  -123.403 1.00 40.41  ? 600 LYS A O     1 
ATOM   3363  C  CB    . LYS E 3 304 ? 48.519  6.486  -124.040 1.00 42.85  ? 600 LYS A CB    1 
ATOM   3364  C  CG    . LYS E 3 304 ? 48.687  5.015  -123.657 1.00 43.84  ? 600 LYS A CG    1 
ATOM   3365  C  CD    . LYS E 3 304 ? 50.153  4.656  -123.448 1.00 45.16  ? 600 LYS A CD    1 
ATOM   3366  C  CE    . LYS E 3 304 ? 50.793  5.454  -122.319 1.00 46.09  ? 600 LYS A CE    1 
ATOM   3367  N  NZ    . LYS E 3 304 ? 52.280  5.270  -122.290 1.00 46.69  ? 600 LYS A NZ    1 
ATOM   3368  N  N     . LYS E 3 305 ? 45.976  8.928  -125.089 1.00 38.70  ? 601 LYS A N     1 
ATOM   3369  C  CA    . LYS E 3 305 ? 45.642  10.343 -124.934 1.00 36.65  ? 601 LYS A CA    1 
ATOM   3370  C  C     . LYS E 3 305 ? 44.208  10.500 -124.438 1.00 35.98  ? 601 LYS A C     1 
ATOM   3371  O  O     . LYS E 3 305 ? 43.406  9.571  -124.527 1.00 34.77  ? 601 LYS A O     1 
ATOM   3372  C  CB    . LYS E 3 305 ? 45.718  11.086 -126.269 1.00 36.32  ? 601 LYS A CB    1 
ATOM   3373  C  CG    . LYS E 3 305 ? 47.034  11.074 -127.011 1.00 35.92  ? 601 LYS A CG    1 
ATOM   3374  C  CD    . LYS E 3 305 ? 46.907  11.995 -128.230 1.00 35.41  ? 601 LYS A CD    1 
ATOM   3375  C  CE    . LYS E 3 305 ? 48.140  11.960 -129.115 1.00 35.04  ? 601 LYS A CE    1 
ATOM   3376  N  NZ    . LYS E 3 305 ? 48.029  12.952 -130.231 1.00 35.34  ? 601 LYS A NZ    1 
ATOM   3377  N  N     . VAL E 3 306 ? 43.904  11.677 -123.901 1.00 34.86  ? 602 VAL A N     1 
ATOM   3378  C  CA    . VAL E 3 306 ? 42.549  11.993 -123.476 1.00 35.00  ? 602 VAL A CA    1 
ATOM   3379  C  C     . VAL E 3 306 ? 42.171  13.155 -124.413 1.00 34.14  ? 602 VAL A C     1 
ATOM   3380  O  O     . VAL E 3 306 ? 43.040  13.908 -124.842 1.00 33.46  ? 602 VAL A O     1 
ATOM   3381  C  CB    . VAL E 3 306 ? 42.463  12.430 -121.973 1.00 35.61  ? 602 VAL A CB    1 
ATOM   3382  C  CG1   . VAL E 3 306 ? 42.839  11.261 -121.063 1.00 36.26  ? 602 VAL A CG1   1 
ATOM   3383  C  CG2   . VAL E 3 306 ? 43.366  13.618 -121.699 1.00 36.43  ? 602 VAL A CG2   1 
ATOM   3384  N  N     . HIS E 3 307 ? 40.897  13.275 -124.768 1.00 33.59  ? 603 HIS A N     1 
ATOM   3385  C  CA    . HIS E 3 307 ? 40.467  14.343 -125.673 1.00 32.96  ? 603 HIS A CA    1 
ATOM   3386  C  C     . HIS E 3 307 ? 39.307  15.142 -125.096 1.00 32.91  ? 603 HIS A C     1 
ATOM   3387  O  O     . HIS E 3 307 ? 38.134  14.757 -125.207 1.00 32.66  ? 603 HIS A O     1 
ATOM   3388  C  CB    . HIS E 3 307 ? 40.069  13.745 -127.021 1.00 32.76  ? 603 HIS A CB    1 
ATOM   3389  C  CG    . HIS E 3 307 ? 41.163  12.960 -127.676 1.00 33.01  ? 603 HIS A CG    1 
ATOM   3390  N  ND1   . HIS E 3 307 ? 41.948  13.475 -128.685 1.00 32.07  ? 603 HIS A ND1   1 
ATOM   3391  C  CD2   . HIS E 3 307 ? 41.618  11.704 -127.449 1.00 33.20  ? 603 HIS A CD2   1 
ATOM   3392  C  CE1   . HIS E 3 307 ? 42.838  12.570 -129.050 1.00 33.04  ? 603 HIS A CE1   1 
ATOM   3393  N  NE2   . HIS E 3 307 ? 42.660  11.487 -128.317 1.00 32.56  ? 603 HIS A NE2   1 
ATOM   3394  N  N     . THR E 3 308 ? 39.643  16.257 -124.468 1.00 31.84  ? 604 THR A N     1 
ATOM   3395  C  CA    . THR E 3 308 ? 38.640  17.106 -123.874 1.00 31.41  ? 604 THR A CA    1 
ATOM   3396  C  C     . THR E 3 308 ? 37.825  17.753 -124.971 1.00 31.18  ? 604 THR A C     1 
ATOM   3397  O  O     . THR E 3 308 ? 38.222  17.760 -126.135 1.00 31.23  ? 604 THR A O     1 
ATOM   3398  C  CB    . THR E 3 308 ? 39.273  18.232 -123.032 1.00 31.01  ? 604 THR A CB    1 
ATOM   3399  O  OG1   . THR E 3 308 ? 38.236  19.043 -122.469 1.00 30.80  ? 604 THR A OG1   1 
ATOM   3400  C  CG2   . THR E 3 308 ? 40.157  19.121 -123.900 1.00 30.28  ? 604 THR A CG2   1 
ATOM   3401  N  N     . ILE E 3 309 ? 36.672  18.287 -124.595 1.00 30.74  ? 605 ILE A N     1 
ATOM   3402  C  CA    . ILE E 3 309 ? 35.823  18.984 -125.542 1.00 30.24  ? 605 ILE A CA    1 
ATOM   3403  C  C     . ILE E 3 309 ? 35.678  20.373 -124.960 1.00 30.07  ? 605 ILE A C     1 
ATOM   3404  O  O     . ILE E 3 309 ? 35.179  20.549 -123.844 1.00 31.31  ? 605 ILE A O     1 
ATOM   3405  C  CB    . ILE E 3 309 ? 34.434  18.307 -125.705 1.00 29.77  ? 605 ILE A CB    1 
ATOM   3406  C  CG1   . ILE E 3 309 ? 34.567  17.078 -126.606 1.00 29.85  ? 605 ILE A CG1   1 
ATOM   3407  C  CG2   . ILE E 3 309 ? 33.445  19.274 -126.337 1.00 29.47  ? 605 ILE A CG2   1 
ATOM   3408  C  CD1   . ILE E 3 309 ? 33.228  16.413 -127.002 1.00 29.36  ? 605 ILE A CD1   1 
ATOM   3409  N  N     . PHE E 3 310 ? 36.182  21.350 -125.697 1.00 28.73  ? 606 PHE A N     1 
ATOM   3410  C  CA    . PHE E 3 310 ? 36.113  22.732 -125.279 1.00 27.43  ? 606 PHE A CA    1 
ATOM   3411  C  C     . PHE E 3 310 ? 34.797  23.329 -125.735 1.00 25.17  ? 606 PHE A C     1 
ATOM   3412  O  O     . PHE E 3 310 ? 34.647  23.696 -126.889 1.00 23.33  ? 606 PHE A O     1 
ATOM   3413  C  CB    . PHE E 3 310 ? 37.280  23.526 -125.877 1.00 28.79  ? 606 PHE A CB    1 
ATOM   3414  C  CG    . PHE E 3 310 ? 38.595  23.259 -125.206 1.00 30.40  ? 606 PHE A CG    1 
ATOM   3415  C  CD1   . PHE E 3 310 ? 38.797  23.626 -123.881 1.00 30.57  ? 606 PHE A CD1   1 
ATOM   3416  C  CD2   . PHE E 3 310 ? 39.641  22.661 -125.902 1.00 31.29  ? 606 PHE A CD2   1 
ATOM   3417  C  CE1   . PHE E 3 310 ? 40.020  23.407 -123.258 1.00 31.46  ? 606 PHE A CE1   1 
ATOM   3418  C  CE2   . PHE E 3 310 ? 40.865  22.440 -125.284 1.00 30.68  ? 606 PHE A CE2   1 
ATOM   3419  C  CZ    . PHE E 3 310 ? 41.057  22.814 -123.964 1.00 30.86  ? 606 PHE A CZ    1 
ATOM   3420  N  N     . ASN E 3 311 ? 33.847  23.387 -124.807 1.00 24.28  ? 607 ASN A N     1 
ATOM   3421  C  CA    . ASN E 3 311 ? 32.520  23.954 -125.041 1.00 22.60  ? 607 ASN A CA    1 
ATOM   3422  C  C     . ASN E 3 311 ? 32.720  25.472 -125.180 1.00 21.27  ? 607 ASN A C     1 
ATOM   3423  O  O     . ASN E 3 311 ? 33.131  26.140 -124.243 1.00 21.05  ? 607 ASN A O     1 
ATOM   3424  C  CB    . ASN E 3 311 ? 31.622  23.578 -123.851 1.00 22.01  ? 607 ASN A CB    1 
ATOM   3425  C  CG    . ASN E 3 311 ? 31.645  22.067 -123.556 1.00 22.77  ? 607 ASN A CG    1 
ATOM   3426  O  OD1   . ASN E 3 311 ? 31.994  21.636 -122.456 1.00 23.80  ? 607 ASN A OD1   1 
ATOM   3427  N  ND2   . ASN E 3 311 ? 31.271  21.267 -124.540 1.00 22.67  ? 607 ASN A ND2   1 
ATOM   3428  N  N     . GLN E 3 312 ? 32.424  25.995 -126.363 1.00 21.72  ? 608 GLN A N     1 
ATOM   3429  C  CA    . GLN E 3 312 ? 32.640  27.395 -126.707 1.00 23.21  ? 608 GLN A CA    1 
ATOM   3430  C  C     . GLN E 3 312 ? 31.462  28.344 -126.523 1.00 24.46  ? 608 GLN A C     1 
ATOM   3431  O  O     . GLN E 3 312 ? 31.647  29.552 -126.413 1.00 25.33  ? 608 GLN A O     1 
ATOM   3432  C  CB    . GLN E 3 312 ? 33.122  27.459 -128.171 1.00 22.75  ? 608 GLN A CB    1 
ATOM   3433  C  CG    . GLN E 3 312 ? 33.792  28.755 -128.604 1.00 20.43  ? 608 GLN A CG    1 
ATOM   3434  C  CD    . GLN E 3 312 ? 34.271  28.687 -130.053 1.00 20.46  ? 608 GLN A CD    1 
ATOM   3435  O  OE1   . GLN E 3 312 ? 34.517  27.604 -130.582 1.00 19.72  ? 608 GLN A OE1   1 
ATOM   3436  N  NE2   . GLN E 3 312 ? 34.404  29.836 -130.692 1.00 18.05  ? 608 GLN A NE2   1 
ATOM   3437  N  N     . ALA E 3 313 ? 30.251  27.813 -126.506 1.00 25.98  ? 609 ALA A N     1 
ATOM   3438  C  CA    . ALA E 3 313 ? 29.076  28.661 -126.325 1.00 26.45  ? 609 ALA A CA    1 
ATOM   3439  C  C     . ALA E 3 313 ? 28.250  28.148 -125.152 1.00 27.63  ? 609 ALA A C     1 
ATOM   3440  O  O     . ALA E 3 313 ? 27.056  27.853 -125.298 1.00 28.10  ? 609 ALA A O     1 
ATOM   3441  C  CB    . ALA E 3 313 ? 28.250  28.670 -127.590 1.00 26.26  ? 609 ALA A CB    1 
ATOM   3442  N  N     . LEU E 3 314 ? 28.888  28.061 -123.987 1.00 28.20  ? 610 LEU A N     1 
ATOM   3443  C  CA    . LEU E 3 314 ? 28.234  27.562 -122.788 1.00 28.86  ? 610 LEU A CA    1 
ATOM   3444  C  C     . LEU E 3 314 ? 28.167  28.538 -121.616 1.00 29.42  ? 610 LEU A C     1 
ATOM   3445  O  O     . LEU E 3 314 ? 27.091  28.757 -121.055 1.00 29.19  ? 610 LEU A O     1 
ATOM   3446  C  CB    . LEU E 3 314 ? 28.918  26.268 -122.328 1.00 28.84  ? 610 LEU A CB    1 
ATOM   3447  C  CG    . LEU E 3 314 ? 28.314  25.499 -121.153 1.00 29.42  ? 610 LEU A CG    1 
ATOM   3448  C  CD1   . LEU E 3 314 ? 28.891  24.093 -121.122 1.00 30.60  ? 610 LEU A CD1   1 
ATOM   3449  C  CD2   . LEU E 3 314 ? 28.581  26.221 -119.840 1.00 29.88  ? 610 LEU A CD2   1 
ATOM   3450  N  N     . THR E 3 315 ? 29.309  29.111 -121.235 1.00 29.64  ? 611 THR A N     1 
ATOM   3451  C  CA    . THR E 3 315 ? 29.354  30.018 -120.088 1.00 29.15  ? 611 THR A CA    1 
ATOM   3452  C  C     . THR E 3 315 ? 28.686  31.332 -120.438 1.00 29.29  ? 611 THR A C     1 
ATOM   3453  O  O     . THR E 3 315 ? 28.620  31.709 -121.604 1.00 27.92  ? 611 THR A O     1 
ATOM   3454  C  CB    . THR E 3 315 ? 30.802  30.325 -119.635 1.00 29.21  ? 611 THR A CB    1 
ATOM   3455  O  OG1   . THR E 3 315 ? 31.433  31.128 -120.628 1.00 28.25  ? 611 THR A OG1   1 
ATOM   3456  C  CG2   . THR E 3 315 ? 31.604  29.047 -119.431 1.00 29.26  ? 611 THR A CG2   1 
ATOM   3457  N  N     . GLN E 3 316 ? 28.210  32.034 -119.416 1.00 29.43  ? 612 GLN A N     1 
ATOM   3458  C  CA    . GLN E 3 316 ? 27.528  33.300 -119.631 1.00 30.31  ? 612 GLN A CA    1 
ATOM   3459  C  C     . GLN E 3 316 ? 28.447  34.513 -119.772 1.00 30.55  ? 612 GLN A C     1 
ATOM   3460  O  O     . GLN E 3 316 ? 27.965  35.611 -120.082 1.00 30.15  ? 612 GLN A O     1 
ATOM   3461  C  CB    . GLN E 3 316 ? 26.518  33.551 -118.500 1.00 30.42  ? 612 GLN A CB    1 
ATOM   3462  C  CG    . GLN E 3 316 ? 25.405  32.525 -118.413 1.00 30.00  ? 612 GLN A CG    1 
ATOM   3463  C  CD    . GLN E 3 316 ? 24.699  32.314 -119.753 1.00 29.52  ? 612 GLN A CD    1 
ATOM   3464  O  OE1   . GLN E 3 316 ? 24.187  33.258 -120.360 1.00 27.81  ? 612 GLN A OE1   1 
ATOM   3465  N  NE2   . GLN E 3 316 ? 24.670  31.066 -120.213 1.00 29.43  ? 612 GLN A NE2   1 
ATOM   3466  N  N     . THR E 3 317 ? 29.755  34.334 -119.580 1.00 29.54  ? 613 THR A N     1 
ATOM   3467  C  CA    . THR E 3 317 ? 30.674  35.477 -119.689 1.00 30.27  ? 613 THR A CA    1 
ATOM   3468  C  C     . THR E 3 317 ? 31.687  35.479 -120.848 1.00 29.69  ? 613 THR A C     1 
ATOM   3469  O  O     . THR E 3 317 ? 32.400  36.457 -121.039 1.00 29.92  ? 613 THR A O     1 
ATOM   3470  C  CB    . THR E 3 317 ? 31.467  35.668 -118.395 1.00 30.68  ? 613 THR A CB    1 
ATOM   3471  O  OG1   . THR E 3 317 ? 32.238  34.491 -118.139 1.00 32.33  ? 613 THR A OG1   1 
ATOM   3472  C  CG2   . THR E 3 317 ? 30.527  35.929 -117.222 1.00 30.30  ? 613 THR A CG2   1 
ATOM   3473  N  N     . GLY E 3 318 ? 31.757  34.399 -121.617 1.00 29.45  ? 614 GLY A N     1 
ATOM   3474  C  CA    . GLY E 3 318 ? 32.689  34.367 -122.737 1.00 28.61  ? 614 GLY A CA    1 
ATOM   3475  C  C     . GLY E 3 318 ? 33.794  33.339 -122.560 1.00 27.67  ? 614 GLY A C     1 
ATOM   3476  O  O     . GLY E 3 318 ? 34.529  33.027 -123.507 1.00 27.71  ? 614 GLY A O     1 
ATOM   3477  N  N     . ARG E 3 319 ? 33.922  32.822 -121.346 1.00 26.68  ? 615 ARG A N     1 
ATOM   3478  C  CA    . ARG E 3 319 ? 34.928  31.808 -121.051 1.00 27.03  ? 615 ARG A CA    1 
ATOM   3479  C  C     . ARG E 3 319 ? 34.602  30.483 -121.726 1.00 27.33  ? 615 ARG A C     1 
ATOM   3480  O  O     . ARG E 3 319 ? 33.453  30.216 -122.068 1.00 25.51  ? 615 ARG A O     1 
ATOM   3481  C  CB    . ARG E 3 319 ? 35.022  31.567 -119.541 1.00 26.85  ? 615 ARG A CB    1 
ATOM   3482  C  CG    . ARG E 3 319 ? 35.766  32.637 -118.747 1.00 26.88  ? 615 ARG A CG    1 
ATOM   3483  C  CD    . ARG E 3 319 ? 36.143  32.119 -117.360 1.00 26.29  ? 615 ARG A CD    1 
ATOM   3484  N  NE    . ARG E 3 319 ? 36.848  33.142 -116.593 1.00 25.92  ? 615 ARG A NE    1 
ATOM   3485  C  CZ    . ARG E 3 319 ? 37.450  32.942 -115.425 1.00 26.32  ? 615 ARG A CZ    1 
ATOM   3486  N  NH1   . ARG E 3 319 ? 37.444  31.739 -114.853 1.00 24.40  ? 615 ARG A NH1   1 
ATOM   3487  N  NH2   . ARG E 3 319 ? 38.081  33.952 -114.838 1.00 23.25  ? 615 ARG A NH2   1 
ATOM   3488  N  N     . LEU E 3 320 ? 35.629  29.655 -121.904 1.00 28.22  ? 616 LEU A N     1 
ATOM   3489  C  CA    . LEU E 3 320 ? 35.469  28.334 -122.488 1.00 29.36  ? 616 LEU A CA    1 
ATOM   3490  C  C     . LEU E 3 320 ? 35.165  27.332 -121.376 1.00 29.81  ? 616 LEU A C     1 
ATOM   3491  O  O     . LEU E 3 320 ? 35.340  27.613 -120.190 1.00 30.18  ? 616 LEU A O     1 
ATOM   3492  C  CB    . LEU E 3 320 ? 36.753  27.899 -123.197 1.00 29.08  ? 616 LEU A CB    1 
ATOM   3493  C  CG    . LEU E 3 320 ? 37.259  28.721 -124.376 1.00 29.16  ? 616 LEU A CG    1 
ATOM   3494  C  CD1   . LEU E 3 320 ? 38.524  28.068 -124.898 1.00 28.95  ? 616 LEU A CD1   1 
ATOM   3495  C  CD2   . LEU E 3 320 ? 36.191  28.790 -125.479 1.00 28.70  ? 616 LEU A CD2   1 
ATOM   3496  N  N     . SER E 3 321 ? 34.733  26.144 -121.762 1.00 30.20  ? 617 SER A N     1 
ATOM   3497  C  CA    . SER E 3 321 ? 34.421  25.126 -120.783 1.00 30.67  ? 617 SER A CA    1 
ATOM   3498  C  C     . SER E 3 321 ? 35.024  23.813 -121.236 1.00 30.64  ? 617 SER A C     1 
ATOM   3499  O  O     . SER E 3 321 ? 35.186  23.581 -122.437 1.00 31.02  ? 617 SER A O     1 
ATOM   3500  C  CB    . SER E 3 321 ? 32.898  25.000 -120.629 1.00 30.43  ? 617 SER A CB    1 
ATOM   3501  O  OG    . SER E 3 321 ? 32.572  23.927 -119.777 1.00 31.67  ? 617 SER A OG    1 
ATOM   3502  N  N     . SER E 3 322 ? 35.360  22.953 -120.283 1.00 30.18  ? 618 SER A N     1 
ATOM   3503  C  CA    . SER E 3 322 ? 35.950  21.669 -120.618 1.00 30.56  ? 618 SER A CA    1 
ATOM   3504  C  C     . SER E 3 322 ? 35.229  20.506 -119.936 1.00 30.28  ? 618 SER A C     1 
ATOM   3505  O  O     . SER E 3 322 ? 34.891  20.579 -118.756 1.00 30.09  ? 618 SER A O     1 
ATOM   3506  C  CB    . SER E 3 322 ? 37.438  21.669 -120.244 1.00 31.07  ? 618 SER A CB    1 
ATOM   3507  O  OG    . SER E 3 322 ? 38.014  20.396 -120.462 1.00 29.10  ? 618 SER A OG    1 
ATOM   3508  N  N     . THR E 3 323 ? 35.019  19.421 -120.673 1.00 30.32  ? 619 THR A N     1 
ATOM   3509  C  CA    . THR E 3 323 ? 34.310  18.273 -120.120 1.00 30.64  ? 619 THR A CA    1 
ATOM   3510  C  C     . THR E 3 323 ? 34.792  16.916 -120.620 1.00 31.06  ? 619 THR A C     1 
ATOM   3511  O  O     . THR E 3 323 ? 35.209  16.776 -121.768 1.00 31.87  ? 619 THR A O     1 
ATOM   3512  C  CB    . THR E 3 323 ? 32.795  18.359 -120.431 1.00 29.32  ? 619 THR A CB    1 
ATOM   3513  O  OG1   . THR E 3 323 ? 32.616  18.491 -121.845 1.00 29.15  ? 619 THR A OG1   1 
ATOM   3514  C  CG2   . THR E 3 323 ? 32.160  19.559 -119.741 1.00 29.78  ? 619 THR A CG2   1 
ATOM   3515  N  N     . GLU E 3 324 ? 34.710  15.919 -119.745 1.00 32.11  ? 620 GLU A N     1 
ATOM   3516  C  CA    . GLU E 3 324 ? 35.094  14.548 -120.068 1.00 33.57  ? 620 GLU A CA    1 
ATOM   3517  C  C     . GLU E 3 324 ? 36.470  14.469 -120.729 1.00 34.21  ? 620 GLU A C     1 
ATOM   3518  O  O     . GLU E 3 324 ? 36.597  14.013 -121.871 1.00 35.08  ? 620 GLU A O     1 
ATOM   3519  C  CB    . GLU E 3 324 ? 34.052  13.937 -121.005 1.00 34.26  ? 620 GLU A CB    1 
ATOM   3520  C  CG    . GLU E 3 324 ? 32.616  14.046 -120.497 1.00 36.21  ? 620 GLU A CG    1 
ATOM   3521  C  CD    . GLU E 3 324 ? 31.624  13.430 -121.451 1.00 36.68  ? 620 GLU A CD    1 
ATOM   3522  O  OE1   . GLU E 3 324 ? 30.403  13.511 -121.181 1.00 38.28  ? 620 GLU A OE1   1 
ATOM   3523  O  OE2   . GLU E 3 324 ? 32.066  12.866 -122.472 1.00 37.15  ? 620 GLU A OE2   1 
ATOM   3524  N  N     . PRO E 3 325 ? 37.521  14.874 -120.005 1.00 33.99  ? 621 PRO A N     1 
ATOM   3525  C  CA    . PRO E 3 325 ? 37.456  15.380 -118.632 1.00 33.30  ? 621 PRO A CA    1 
ATOM   3526  C  C     . PRO E 3 325 ? 37.579  16.897 -118.573 1.00 33.06  ? 621 PRO A C     1 
ATOM   3527  O  O     . PRO E 3 325 ? 37.861  17.545 -119.575 1.00 32.41  ? 621 PRO A O     1 
ATOM   3528  C  CB    . PRO E 3 325 ? 38.652  14.715 -117.993 1.00 33.73  ? 621 PRO A CB    1 
ATOM   3529  C  CG    . PRO E 3 325 ? 39.685  14.889 -119.090 1.00 33.71  ? 621 PRO A CG    1 
ATOM   3530  C  CD    . PRO E 3 325 ? 38.909  14.505 -120.351 1.00 34.22  ? 621 PRO A CD    1 
ATOM   3531  N  N     . ASN E 3 326 ? 37.371  17.452 -117.385 1.00 32.78  ? 622 ASN A N     1 
ATOM   3532  C  CA    . ASN E 3 326 ? 37.502  18.882 -117.188 1.00 33.06  ? 622 ASN A CA    1 
ATOM   3533  C  C     . ASN E 3 326 ? 38.988  19.142 -116.941 1.00 32.51  ? 622 ASN A C     1 
ATOM   3534  O  O     . ASN E 3 326 ? 39.455  19.039 -115.816 1.00 32.56  ? 622 ASN A O     1 
ATOM   3535  C  CB    . ASN E 3 326 ? 36.700  19.336 -115.968 1.00 32.86  ? 622 ASN A CB    1 
ATOM   3536  C  CG    . ASN E 3 326 ? 36.900  20.799 -115.674 1.00 32.58  ? 622 ASN A CG    1 
ATOM   3537  O  OD1   . ASN E 3 326 ? 37.699  21.455 -116.330 1.00 33.13  ? 622 ASN A OD1   1 
ATOM   3538  N  ND2   . ASN E 3 326 ? 36.180  21.322 -114.692 1.00 32.43  ? 622 ASN A ND2   1 
ATOM   3539  N  N     . LEU E 3 327 ? 39.729  19.465 -117.993 1.00 32.79  ? 623 LEU A N     1 
ATOM   3540  C  CA    . LEU E 3 327 ? 41.159  19.712 -117.843 1.00 32.75  ? 623 LEU A CA    1 
ATOM   3541  C  C     . LEU E 3 327 ? 41.466  21.104 -117.324 1.00 33.19  ? 623 LEU A C     1 
ATOM   3542  O  O     . LEU E 3 327 ? 42.621  21.519 -117.296 1.00 33.47  ? 623 LEU A O     1 
ATOM   3543  C  CB    . LEU E 3 327 ? 41.872  19.472 -119.169 1.00 32.75  ? 623 LEU A CB    1 
ATOM   3544  C  CG    . LEU E 3 327 ? 41.747  18.014 -119.609 1.00 32.11  ? 623 LEU A CG    1 
ATOM   3545  C  CD1   . LEU E 3 327 ? 42.393  17.814 -120.961 1.00 32.20  ? 623 LEU A CD1   1 
ATOM   3546  C  CD2   . LEU E 3 327 ? 42.395  17.118 -118.550 1.00 31.89  ? 623 LEU A CD2   1 
ATOM   3547  N  N     . GLN E 3 328 ? 40.427  21.824 -116.914 1.00 32.47  ? 624 GLN A N     1 
ATOM   3548  C  CA    . GLN E 3 328 ? 40.606  23.158 -116.376 1.00 32.54  ? 624 GLN A CA    1 
ATOM   3549  C  C     . GLN E 3 328 ? 40.472  23.131 -114.855 1.00 32.87  ? 624 GLN A C     1 
ATOM   3550  O  O     . GLN E 3 328 ? 40.414  24.183 -114.204 1.00 32.27  ? 624 GLN A O     1 
ATOM   3551  C  CB    . GLN E 3 328 ? 39.591  24.121 -116.979 1.00 31.91  ? 624 GLN A CB    1 
ATOM   3552  C  CG    . GLN E 3 328 ? 39.613  24.152 -118.489 1.00 31.33  ? 624 GLN A CG    1 
ATOM   3553  C  CD    . GLN E 3 328 ? 38.667  25.194 -119.059 1.00 32.49  ? 624 GLN A CD    1 
ATOM   3554  O  OE1   . GLN E 3 328 ? 37.494  25.268 -118.675 1.00 31.69  ? 624 GLN A OE1   1 
ATOM   3555  N  NE2   . GLN E 3 328 ? 39.168  25.995 -119.986 1.00 31.31  ? 624 GLN A NE2   1 
ATOM   3556  N  N     . ASN E 3 329 ? 40.430  21.923 -114.294 1.00 32.79  ? 625 ASN A N     1 
ATOM   3557  C  CA    . ASN E 3 329 ? 40.333  21.765 -112.849 1.00 33.67  ? 625 ASN A CA    1 
ATOM   3558  C  C     . ASN E 3 329 ? 41.216  20.604 -112.348 1.00 33.86  ? 625 ASN A C     1 
ATOM   3559  O  O     . ASN E 3 329 ? 40.810  19.783 -111.524 1.00 34.12  ? 625 ASN A O     1 
ATOM   3560  C  CB    . ASN E 3 329 ? 38.854  21.608 -112.425 1.00 33.62  ? 625 ASN A CB    1 
ATOM   3561  C  CG    . ASN E 3 329 ? 38.374  20.163 -112.416 1.00 34.55  ? 625 ASN A CG    1 
ATOM   3562  O  OD1   . ASN E 3 329 ? 38.816  19.332 -113.215 1.00 35.09  ? 625 ASN A OD1   1 
ATOM   3563  N  ND2   . ASN E 3 329 ? 37.444  19.864 -111.514 1.00 34.64  ? 625 ASN A ND2   1 
ATOM   3564  N  N     . ILE E 3 330 ? 42.440  20.556 -112.865 1.00 34.47  ? 626 ILE A N     1 
ATOM   3565  C  CA    . ILE E 3 330 ? 43.417  19.551 -112.469 1.00 34.81  ? 626 ILE A CA    1 
ATOM   3566  C  C     . ILE E 3 330 ? 44.087  20.162 -111.235 1.00 35.94  ? 626 ILE A C     1 
ATOM   3567  O  O     . ILE E 3 330 ? 44.475  21.328 -111.260 1.00 35.60  ? 626 ILE A O     1 
ATOM   3568  C  CB    . ILE E 3 330 ? 44.456  19.319 -113.605 1.00 34.17  ? 626 ILE A CB    1 
ATOM   3569  C  CG1   . ILE E 3 330 ? 43.743  18.809 -114.858 1.00 33.82  ? 626 ILE A CG1   1 
ATOM   3570  C  CG2   . ILE E 3 330 ? 45.513  18.291 -113.169 1.00 34.71  ? 626 ILE A CG2   1 
ATOM   3571  C  CD1   . ILE E 3 330 ? 43.157  17.419 -114.714 1.00 31.74  ? 626 ILE A CD1   1 
ATOM   3572  N  N     . PRO E 3 331 ? 44.215  19.392 -110.133 1.00 37.45  ? 627 PRO A N     1 
ATOM   3573  C  CA    . PRO E 3 331 ? 44.836  19.871 -108.884 1.00 38.56  ? 627 PRO A CA    1 
ATOM   3574  C  C     . PRO E 3 331 ? 46.110  20.687 -109.085 1.00 39.78  ? 627 PRO A C     1 
ATOM   3575  O  O     . PRO E 3 331 ? 46.870  20.431 -110.009 1.00 40.17  ? 627 PRO A O     1 
ATOM   3576  C  CB    . PRO E 3 331 ? 45.088  18.582 -108.115 1.00 38.48  ? 627 PRO A CB    1 
ATOM   3577  C  CG    . PRO E 3 331 ? 43.910  17.734 -108.526 1.00 38.53  ? 627 PRO A CG    1 
ATOM   3578  C  CD    . PRO E 3 331 ? 43.849  17.967 -110.022 1.00 37.30  ? 627 PRO A CD    1 
ATOM   3579  N  N     . ILE E 3 332 ? 46.338  21.666 -108.214 1.00 41.39  ? 628 ILE A N     1 
ATOM   3580  C  CA    . ILE E 3 332 ? 47.513  22.523 -108.314 1.00 43.18  ? 628 ILE A CA    1 
ATOM   3581  C  C     . ILE E 3 332 ? 47.760  23.290 -107.008 1.00 44.55  ? 628 ILE A C     1 
ATOM   3582  O  O     . ILE E 3 332 ? 48.863  23.775 -106.762 1.00 45.25  ? 628 ILE A O     1 
ATOM   3583  C  CB    . ILE E 3 332 ? 47.349  23.548 -109.477 1.00 43.40  ? 628 ILE A CB    1 
ATOM   3584  C  CG1   . ILE E 3 332 ? 48.635  24.366 -109.662 1.00 42.80  ? 628 ILE A CG1   1 
ATOM   3585  C  CG2   . ILE E 3 332 ? 46.180  24.469 -109.189 1.00 42.80  ? 628 ILE A CG2   1 
ATOM   3586  C  CD1   . ILE E 3 332 ? 49.777  23.591 -110.235 1.00 43.57  ? 628 ILE A CD1   1 
ATOM   3587  N  N     . ARG E 3 333 ? 46.725  23.388 -106.181 1.00 45.53  ? 629 ARG A N     1 
ATOM   3588  C  CA    . ARG E 3 333 ? 46.774  24.100 -104.904 1.00 46.76  ? 629 ARG A CA    1 
ATOM   3589  C  C     . ARG E 3 333 ? 47.665  23.460 -103.835 1.00 47.34  ? 629 ARG A C     1 
ATOM   3590  O  O     . ARG E 3 333 ? 48.493  24.133 -103.216 1.00 47.41  ? 629 ARG A O     1 
ATOM   3591  C  CB    . ARG E 3 333 ? 45.344  24.258 -104.362 1.00 47.15  ? 629 ARG A CB    1 
ATOM   3592  C  CG    . ARG E 3 333 ? 45.223  24.711 -102.918 1.00 48.04  ? 629 ARG A CG    1 
ATOM   3593  C  CD    . ARG E 3 333 ? 43.783  25.112 -102.594 1.00 48.60  ? 629 ARG A CD    1 
ATOM   3594  N  NE    . ARG E 3 333 ? 42.818  24.032 -102.791 1.00 48.82  ? 629 ARG A NE    1 
ATOM   3595  C  CZ    . ARG E 3 333 ? 42.448  23.170 -101.848 1.00 49.32  ? 629 ARG A CZ    1 
ATOM   3596  N  NH1   . ARG E 3 333 ? 42.963  23.249 -100.629 1.00 49.19  ? 629 ARG A NH1   1 
ATOM   3597  N  NH2   . ARG E 3 333 ? 41.546  22.235 -102.119 1.00 50.03  ? 629 ARG A NH2   1 
ATOM   3598  N  N     . LEU E 3 334 ? 47.485  22.166 -103.610 1.00 47.60  ? 630 LEU A N     1 
ATOM   3599  C  CA    . LEU E 3 334 ? 48.271  21.455 -102.609 1.00 48.35  ? 630 LEU A CA    1 
ATOM   3600  C  C     . LEU E 3 334 ? 49.323  20.613 -103.329 1.00 48.92  ? 630 LEU A C     1 
ATOM   3601  O  O     . LEU E 3 334 ? 49.246  20.428 -104.544 1.00 49.27  ? 630 LEU A O     1 
ATOM   3602  C  CB    . LEU E 3 334 ? 47.347  20.566 -101.773 1.00 48.19  ? 630 LEU A CB    1 
ATOM   3603  C  CG    . LEU E 3 334 ? 46.002  21.217 -101.418 1.00 47.88  ? 630 LEU A CG    1 
ATOM   3604  C  CD1   . LEU E 3 334 ? 45.118  20.217 -100.696 1.00 48.08  ? 630 LEU A CD1   1 
ATOM   3605  C  CD2   . LEU E 3 334 ? 46.224  22.446 -100.559 1.00 47.93  ? 630 LEU A CD2   1 
ATOM   3606  N  N     . GLU E 3 335 ? 50.300  20.099 -102.590 1.00 49.19  ? 631 GLU A N     1 
ATOM   3607  C  CA    . GLU E 3 335 ? 51.356  19.298 -103.200 1.00 49.74  ? 631 GLU A CA    1 
ATOM   3608  C  C     . GLU E 3 335 ? 50.933  17.885 -103.599 1.00 49.95  ? 631 GLU A C     1 
ATOM   3609  O  O     . GLU E 3 335 ? 51.366  17.377 -104.635 1.00 50.57  ? 631 GLU A O     1 
ATOM   3610  C  CB    . GLU E 3 335 ? 52.569  19.231 -102.264 1.00 50.12  ? 631 GLU A CB    1 
ATOM   3611  C  CG    . GLU E 3 335 ? 53.739  18.388 -102.778 1.00 50.17  ? 631 GLU A CG    1 
ATOM   3612  C  CD    . GLU E 3 335 ? 54.065  18.638 -104.240 1.00 50.46  ? 631 GLU A CD    1 
ATOM   3613  O  OE1   . GLU E 3 335 ? 54.009  19.807 -104.679 1.00 50.45  ? 631 GLU A OE1   1 
ATOM   3614  O  OE2   . GLU E 3 335 ? 54.390  17.661 -104.952 1.00 50.55  ? 631 GLU A OE2   1 
ATOM   3615  N  N     . GLU E 3 336 ? 50.092  17.247 -102.792 1.00 49.95  ? 632 GLU A N     1 
ATOM   3616  C  CA    . GLU E 3 336 ? 49.653  15.887 -103.107 1.00 49.82  ? 632 GLU A CA    1 
ATOM   3617  C  C     . GLU E 3 336 ? 48.954  15.844 -104.469 1.00 48.93  ? 632 GLU A C     1 
ATOM   3618  O  O     . GLU E 3 336 ? 49.317  15.056 -105.345 1.00 48.63  ? 632 GLU A O     1 
ATOM   3619  C  CB    . GLU E 3 336 ? 48.693  15.358 -102.034 1.00 51.33  ? 632 GLU A CB    1 
ATOM   3620  C  CG    . GLU E 3 336 ? 49.188  15.444 -100.589 1.00 53.53  ? 632 GLU A CG    1 
ATOM   3621  C  CD    . GLU E 3 336 ? 49.089  16.852 -100.008 1.00 55.13  ? 632 GLU A CD    1 
ATOM   3622  O  OE1   . GLU E 3 336 ? 49.917  17.715 -100.372 1.00 56.16  ? 632 GLU A OE1   1 
ATOM   3623  O  OE2   . GLU E 3 336 ? 48.173  17.096 -99.189  1.00 56.08  ? 632 GLU A OE2   1 
ATOM   3624  N  N     . GLY E 3 337 ? 47.949  16.700 -104.634 1.00 47.58  ? 633 GLY A N     1 
ATOM   3625  C  CA    . GLY E 3 337 ? 47.206  16.742 -105.877 1.00 45.64  ? 633 GLY A CA    1 
ATOM   3626  C  C     . GLY E 3 337 ? 48.021  17.193 -107.069 1.00 44.75  ? 633 GLY A C     1 
ATOM   3627  O  O     . GLY E 3 337 ? 47.893  16.635 -108.157 1.00 44.56  ? 633 GLY A O     1 
ATOM   3628  N  N     . ARG E 3 338 ? 48.859  18.205 -106.866 1.00 43.70  ? 634 ARG A N     1 
ATOM   3629  C  CA    . ARG E 3 338 ? 49.693  18.752 -107.933 1.00 43.15  ? 634 ARG A CA    1 
ATOM   3630  C  C     . ARG E 3 338 ? 50.510  17.729 -108.708 1.00 42.79  ? 634 ARG A C     1 
ATOM   3631  O  O     . ARG E 3 338 ? 50.694  17.871 -109.917 1.00 42.98  ? 634 ARG A O     1 
ATOM   3632  C  CB    . ARG E 3 338 ? 50.642  19.813 -107.376 1.00 42.08  ? 634 ARG A CB    1 
ATOM   3633  C  CG    . ARG E 3 338 ? 51.461  20.497 -108.447 1.00 41.45  ? 634 ARG A CG    1 
ATOM   3634  C  CD    . ARG E 3 338 ? 52.197  21.700 -107.884 1.00 40.71  ? 634 ARG A CD    1 
ATOM   3635  N  NE    . ARG E 3 338 ? 52.491  22.683 -108.925 1.00 39.83  ? 634 ARG A NE    1 
ATOM   3636  C  CZ    . ARG E 3 338 ? 52.715  23.971 -108.683 1.00 39.19  ? 634 ARG A CZ    1 
ATOM   3637  N  NH1   . ARG E 3 338 ? 52.682  24.423 -107.436 1.00 39.35  ? 634 ARG A NH1   1 
ATOM   3638  N  NH2   . ARG E 3 338 ? 52.953  24.809 -109.682 1.00 37.82  ? 634 ARG A NH2   1 
ATOM   3639  N  N     . LYS E 3 339 ? 50.994  16.701 -108.018 1.00 42.66  ? 635 LYS A N     1 
ATOM   3640  C  CA    . LYS E 3 339 ? 51.803  15.664 -108.651 1.00 42.22  ? 635 LYS A CA    1 
ATOM   3641  C  C     . LYS E 3 339 ? 51.092  14.899 -109.772 1.00 41.62  ? 635 LYS A C     1 
ATOM   3642  O  O     . LYS E 3 339 ? 51.743  14.257 -110.604 1.00 41.42  ? 635 LYS A O     1 
ATOM   3643  C  CB    . LYS E 3 339 ? 52.310  14.679 -107.588 1.00 42.78  ? 635 LYS A CB    1 
ATOM   3644  C  CG    . LYS E 3 339 ? 53.417  15.233 -106.696 1.00 43.01  ? 635 LYS A CG    1 
ATOM   3645  C  CD    . LYS E 3 339 ? 53.724  14.267 -105.553 1.00 43.99  ? 635 LYS A CD    1 
ATOM   3646  C  CE    . LYS E 3 339 ? 54.936  14.693 -104.736 1.00 43.69  ? 635 LYS A CE    1 
ATOM   3647  N  NZ    . LYS E 3 339 ? 56.223  14.499 -105.469 1.00 43.79  ? 635 LYS A NZ    1 
ATOM   3648  N  N     . ILE E 3 340 ? 49.763  14.958 -109.803 1.00 40.95  ? 636 ILE A N     1 
ATOM   3649  C  CA    . ILE E 3 340 ? 49.020  14.260 -110.851 1.00 40.08  ? 636 ILE A CA    1 
ATOM   3650  C  C     . ILE E 3 340 ? 49.387  14.857 -112.220 1.00 39.17  ? 636 ILE A C     1 
ATOM   3651  O  O     . ILE E 3 340 ? 49.254  14.206 -113.259 1.00 38.24  ? 636 ILE A O     1 
ATOM   3652  C  CB    . ILE E 3 340 ? 47.486  14.363 -110.620 1.00 40.34  ? 636 ILE A CB    1 
ATOM   3653  C  CG1   . ILE E 3 340 ? 46.744  13.508 -111.648 1.00 39.91  ? 636 ILE A CG1   1 
ATOM   3654  C  CG2   . ILE E 3 340 ? 47.034  15.817 -110.723 1.00 40.95  ? 636 ILE A CG2   1 
ATOM   3655  C  CD1   . ILE E 3 340 ? 45.246  13.538 -111.486 1.00 40.03  ? 636 ILE A CD1   1 
ATOM   3656  N  N     . ARG E 3 341 ? 49.863  16.098 -112.210 1.00 38.43  ? 637 ARG A N     1 
ATOM   3657  C  CA    . ARG E 3 341 ? 50.260  16.765 -113.441 1.00 37.85  ? 637 ARG A CA    1 
ATOM   3658  C  C     . ARG E 3 341 ? 51.519  16.130 -114.040 1.00 37.58  ? 637 ARG A C     1 
ATOM   3659  O  O     . ARG E 3 341 ? 51.873  16.398 -115.190 1.00 36.90  ? 637 ARG A O     1 
ATOM   3660  C  CB    . ARG E 3 341 ? 50.489  18.254 -113.182 1.00 38.52  ? 637 ARG A CB    1 
ATOM   3661  C  CG    . ARG E 3 341 ? 49.241  18.948 -112.679 1.00 39.07  ? 637 ARG A CG    1 
ATOM   3662  C  CD    . ARG E 3 341 ? 49.276  20.438 -112.911 1.00 38.81  ? 637 ARG A CD    1 
ATOM   3663  N  NE    . ARG E 3 341 ? 48.001  21.026 -112.526 1.00 39.19  ? 637 ARG A NE    1 
ATOM   3664  C  CZ    . ARG E 3 341 ? 47.601  22.247 -112.854 1.00 39.16  ? 637 ARG A CZ    1 
ATOM   3665  N  NH1   . ARG E 3 341 ? 48.377  23.037 -113.583 1.00 39.69  ? 637 ARG A NH1   1 
ATOM   3666  N  NH2   . ARG E 3 341 ? 46.411  22.671 -112.460 1.00 39.83  ? 637 ARG A NH2   1 
ATOM   3667  N  N     . GLN E 3 342 ? 52.186  15.290 -113.253 1.00 36.63  ? 638 GLN A N     1 
ATOM   3668  C  CA    . GLN E 3 342 ? 53.381  14.590 -113.711 1.00 36.84  ? 638 GLN A CA    1 
ATOM   3669  C  C     . GLN E 3 342 ? 52.899  13.467 -114.622 1.00 36.24  ? 638 GLN A C     1 
ATOM   3670  O  O     . GLN E 3 342 ? 53.692  12.797 -115.272 1.00 35.84  ? 638 GLN A O     1 
ATOM   3671  C  CB    . GLN E 3 342 ? 54.149  14.000 -112.518 1.00 36.98  ? 638 GLN A CB    1 
ATOM   3672  C  CG    . GLN E 3 342 ? 54.589  15.047 -111.511 1.00 37.86  ? 638 GLN A CG    1 
ATOM   3673  C  CD    . GLN E 3 342 ? 55.242  14.488 -110.251 1.00 38.44  ? 638 GLN A CD    1 
ATOM   3674  O  OE1   . GLN E 3 342 ? 55.457  15.221 -109.290 1.00 39.20  ? 638 GLN A OE1   1 
ATOM   3675  N  NE2   . GLN E 3 342 ? 55.566  13.201 -110.253 1.00 38.92  ? 638 GLN A NE2   1 
ATOM   3676  N  N     . ALA E 3 343 ? 51.583  13.267 -114.652 1.00 35.32  ? 639 ALA A N     1 
ATOM   3677  C  CA    . ALA E 3 343 ? 50.987  12.231 -115.485 1.00 35.33  ? 639 ALA A CA    1 
ATOM   3678  C  C     . ALA E 3 343 ? 50.637  12.804 -116.862 1.00 35.55  ? 639 ALA A C     1 
ATOM   3679  O  O     . ALA E 3 343 ? 50.238  12.074 -117.766 1.00 35.32  ? 639 ALA A O     1 
ATOM   3680  C  CB    . ALA E 3 343 ? 49.742  11.661 -114.804 1.00 34.88  ? 639 ALA A CB    1 
ATOM   3681  N  N     . PHE E 3 344 ? 50.788  14.118 -117.016 1.00 36.17  ? 640 PHE A N     1 
ATOM   3682  C  CA    . PHE E 3 344 ? 50.510  14.768 -118.297 1.00 37.15  ? 640 PHE A CA    1 
ATOM   3683  C  C     . PHE E 3 344 ? 51.846  15.068 -118.979 1.00 37.59  ? 640 PHE A C     1 
ATOM   3684  O  O     . PHE E 3 344 ? 52.651  15.851 -118.478 1.00 37.81  ? 640 PHE A O     1 
ATOM   3685  C  CB    . PHE E 3 344 ? 49.699  16.040 -118.070 1.00 37.33  ? 640 PHE A CB    1 
ATOM   3686  C  CG    . PHE E 3 344 ? 48.275  15.774 -117.676 1.00 37.75  ? 640 PHE A CG    1 
ATOM   3687  C  CD1   . PHE E 3 344 ? 47.259  15.820 -118.625 1.00 37.39  ? 640 PHE A CD1   1 
ATOM   3688  C  CD2   . PHE E 3 344 ? 47.958  15.419 -116.368 1.00 37.09  ? 640 PHE A CD2   1 
ATOM   3689  C  CE1   . PHE E 3 344 ? 45.946  15.512 -118.277 1.00 37.98  ? 640 PHE A CE1   1 
ATOM   3690  C  CE2   . PHE E 3 344 ? 46.651  15.108 -116.012 1.00 37.03  ? 640 PHE A CE2   1 
ATOM   3691  C  CZ    . PHE E 3 344 ? 45.642  15.153 -116.968 1.00 37.66  ? 640 PHE A CZ    1 
ATOM   3692  N  N     . VAL E 3 345 ? 52.063  14.443 -120.131 1.00 37.86  ? 641 VAL A N     1 
ATOM   3693  C  CA    . VAL E 3 345 ? 53.323  14.568 -120.845 1.00 38.47  ? 641 VAL A CA    1 
ATOM   3694  C  C     . VAL E 3 345 ? 53.218  14.993 -122.315 1.00 39.18  ? 641 VAL A C     1 
ATOM   3695  O  O     . VAL E 3 345 ? 52.121  15.240 -122.826 1.00 39.48  ? 641 VAL A O     1 
ATOM   3696  C  CB    . VAL E 3 345 ? 54.071  13.217 -120.760 1.00 38.32  ? 641 VAL A CB    1 
ATOM   3697  C  CG1   . VAL E 3 345 ? 54.213  12.797 -119.309 1.00 38.13  ? 641 VAL A CG1   1 
ATOM   3698  C  CG2   . VAL E 3 345 ? 53.308  12.148 -121.525 1.00 38.78  ? 641 VAL A CG2   1 
ATOM   3699  N  N     . PRO E 3 346 ? 54.371  15.109 -123.010 1.00 39.54  ? 642 PRO A N     1 
ATOM   3700  C  CA    . PRO E 3 346 ? 54.391  15.500 -124.423 1.00 39.89  ? 642 PRO A CA    1 
ATOM   3701  C  C     . PRO E 3 346 ? 53.860  14.349 -125.265 1.00 40.58  ? 642 PRO A C     1 
ATOM   3702  O  O     . PRO E 3 346 ? 53.979  13.195 -124.864 1.00 41.13  ? 642 PRO A O     1 
ATOM   3703  C  CB    . PRO E 3 346 ? 55.871  15.763 -124.690 1.00 39.76  ? 642 PRO A CB    1 
ATOM   3704  C  CG    . PRO E 3 346 ? 56.389  16.175 -123.368 1.00 39.81  ? 642 PRO A CG    1 
ATOM   3705  C  CD    . PRO E 3 346 ? 55.729  15.186 -122.448 1.00 39.46  ? 642 PRO A CD    1 
ATOM   3706  N  N     . SER E 3 347 ? 53.290  14.653 -126.428 1.00 41.31  ? 643 SER A N     1 
ATOM   3707  C  CA    . SER E 3 347 ? 52.739  13.608 -127.292 1.00 42.17  ? 643 SER A CA    1 
ATOM   3708  C  C     . SER E 3 347 ? 53.809  12.848 -128.077 1.00 43.00  ? 643 SER A C     1 
ATOM   3709  O  O     . SER E 3 347 ? 53.590  11.712 -128.496 1.00 43.62  ? 643 SER A O     1 
ATOM   3710  C  CB    . SER E 3 347 ? 51.718  14.204 -128.269 1.00 41.52  ? 643 SER A CB    1 
ATOM   3711  O  OG    . SER E 3 347 ? 52.352  14.989 -129.261 1.00 41.80  ? 643 SER A OG    1 
ATOM   3712  N  N     . GLU E 3 348 ? 54.965  13.468 -128.281 1.00 43.89  ? 644 GLU A N     1 
ATOM   3713  C  CA    . GLU E 3 348 ? 56.037  12.811 -129.022 1.00 44.62  ? 644 GLU A CA    1 
ATOM   3714  C  C     . GLU E 3 348 ? 57.274  12.621 -128.169 1.00 44.93  ? 644 GLU A C     1 
ATOM   3715  O  O     . GLU E 3 348 ? 57.406  13.224 -127.101 1.00 45.54  ? 644 GLU A O     1 
ATOM   3716  C  CB    . GLU E 3 348 ? 56.400  13.610 -130.276 1.00 44.85  ? 644 GLU A CB    1 
ATOM   3717  C  CG    . GLU E 3 348 ? 55.485  13.356 -131.462 1.00 45.76  ? 644 GLU A CG    1 
ATOM   3718  C  CD    . GLU E 3 348 ? 55.567  11.930 -131.981 1.00 46.52  ? 644 GLU A CD    1 
ATOM   3719  O  OE1   . GLU E 3 348 ? 54.988  11.023 -131.350 1.00 46.73  ? 644 GLU A OE1   1 
ATOM   3720  O  OE2   . GLU E 3 348 ? 56.221  11.712 -133.025 1.00 47.87  ? 644 GLU A OE2   1 
ATOM   3721  N  N     . SER E 3 349 ? 58.180  11.775 -128.650 1.00 45.01  ? 645 SER A N     1 
ATOM   3722  C  CA    . SER E 3 349 ? 59.416  11.495 -127.930 1.00 45.00  ? 645 SER A CA    1 
ATOM   3723  C  C     . SER E 3 349 ? 60.358  12.689 -128.050 1.00 43.77  ? 645 SER A C     1 
ATOM   3724  O  O     . SER E 3 349 ? 60.522  13.251 -129.129 1.00 43.70  ? 645 SER A O     1 
ATOM   3725  C  CB    . SER E 3 349 ? 60.079  10.231 -128.497 1.00 45.27  ? 645 SER A CB    1 
ATOM   3726  O  OG    . SER E 3 349 ? 60.893  9.606  -127.516 1.00 46.22  ? 645 SER A OG    1 
ATOM   3727  N  N     . ASP E 3 350 ? 60.957  13.079 -126.928 1.00 43.32  ? 646 ASP A N     1 
ATOM   3728  C  CA    . ASP E 3 350 ? 61.883  14.206 -126.888 1.00 42.56  ? 646 ASP A CA    1 
ATOM   3729  C  C     . ASP E 3 350 ? 61.192  15.552 -127.123 1.00 41.82  ? 646 ASP A C     1 
ATOM   3730  O  O     . ASP E 3 350 ? 61.708  16.412 -127.842 1.00 41.91  ? 646 ASP A O     1 
ATOM   3731  C  CB    . ASP E 3 350 ? 63.012  14.004 -127.912 1.00 43.23  ? 646 ASP A CB    1 
ATOM   3732  C  CG    . ASP E 3 350 ? 63.847  12.754 -127.624 1.00 43.69  ? 646 ASP A CG    1 
ATOM   3733  O  OD1   . ASP E 3 350 ? 64.405  12.656 -126.513 1.00 44.35  ? 646 ASP A OD1   1 
ATOM   3734  O  OD2   . ASP E 3 350 ? 63.945  11.871 -128.505 1.00 43.95  ? 646 ASP A OD2   1 
ATOM   3735  N  N     . TRP E 3 351 ? 60.027  15.725 -126.504 1.00 40.79  ? 647 TRP A N     1 
ATOM   3736  C  CA    . TRP E 3 351 ? 59.257  16.962 -126.616 1.00 39.74  ? 647 TRP A CA    1 
ATOM   3737  C  C     . TRP E 3 351 ? 59.092  17.581 -125.238 1.00 38.19  ? 647 TRP A C     1 
ATOM   3738  O  O     . TRP E 3 351 ? 59.467  16.976 -124.239 1.00 38.47  ? 647 TRP A O     1 
ATOM   3739  C  CB    . TRP E 3 351 ? 57.887  16.681 -127.253 1.00 39.84  ? 647 TRP A CB    1 
ATOM   3740  C  CG    . TRP E 3 351 ? 57.910  16.777 -128.747 1.00 40.30  ? 647 TRP A CG    1 
ATOM   3741  C  CD1   . TRP E 3 351 ? 58.874  16.288 -129.584 1.00 40.34  ? 647 TRP A CD1   1 
ATOM   3742  C  CD2   . TRP E 3 351 ? 56.939  17.415 -129.585 1.00 40.87  ? 647 TRP A CD2   1 
ATOM   3743  N  NE1   . TRP E 3 351 ? 58.567  16.586 -130.887 1.00 40.69  ? 647 TRP A NE1   1 
ATOM   3744  C  CE2   . TRP E 3 351 ? 57.384  17.275 -130.920 1.00 40.89  ? 647 TRP A CE2   1 
ATOM   3745  C  CE3   . TRP E 3 351 ? 55.735  18.089 -129.341 1.00 41.00  ? 647 TRP A CE3   1 
ATOM   3746  C  CZ2   . TRP E 3 351 ? 56.668  17.789 -132.008 1.00 41.22  ? 647 TRP A CZ2   1 
ATOM   3747  C  CZ3   . TRP E 3 351 ? 55.019  18.600 -130.427 1.00 41.39  ? 647 TRP A CZ3   1 
ATOM   3748  C  CH2   . TRP E 3 351 ? 55.489  18.446 -131.742 1.00 41.52  ? 647 TRP A CH2   1 
ATOM   3749  N  N     . LEU E 3 352 ? 58.528  18.783 -125.178 1.00 36.53  ? 648 LEU A N     1 
ATOM   3750  C  CA    . LEU E 3 352 ? 58.343  19.459 -123.898 1.00 35.26  ? 648 LEU A CA    1 
ATOM   3751  C  C     . LEU E 3 352 ? 57.017  20.210 -123.790 1.00 34.60  ? 648 LEU A C     1 
ATOM   3752  O  O     . LEU E 3 352 ? 56.451  20.636 -124.804 1.00 34.40  ? 648 LEU A O     1 
ATOM   3753  C  CB    . LEU E 3 352 ? 59.484  20.456 -123.673 1.00 34.54  ? 648 LEU A CB    1 
ATOM   3754  C  CG    . LEU E 3 352 ? 60.894  19.895 -123.479 1.00 35.03  ? 648 LEU A CG    1 
ATOM   3755  C  CD1   . LEU E 3 352 ? 61.899  21.015 -123.616 1.00 35.50  ? 648 LEU A CD1   1 
ATOM   3756  C  CD2   . LEU E 3 352 ? 61.007  19.243 -122.117 1.00 34.68  ? 648 LEU A CD2   1 
ATOM   3757  N  N     . ILE E 3 353 ? 56.539  20.382 -122.558 1.00 33.44  ? 649 ILE A N     1 
ATOM   3758  C  CA    . ILE E 3 353 ? 55.304  21.126 -122.320 1.00 32.32  ? 649 ILE A CA    1 
ATOM   3759  C  C     . ILE E 3 353 ? 55.654  22.582 -122.005 1.00 31.60  ? 649 ILE A C     1 
ATOM   3760  O  O     . ILE E 3 353 ? 56.517  22.855 -121.170 1.00 30.48  ? 649 ILE A O     1 
ATOM   3761  C  CB    . ILE E 3 353 ? 54.490  20.569 -121.138 1.00 31.90  ? 649 ILE A CB    1 
ATOM   3762  C  CG1   . ILE E 3 353 ? 54.053  19.135 -121.427 1.00 32.46  ? 649 ILE A CG1   1 
ATOM   3763  C  CG2   . ILE E 3 353 ? 53.272  21.457 -120.897 1.00 31.45  ? 649 ILE A CG2   1 
ATOM   3764  C  CD1   . ILE E 3 353 ? 53.296  18.981 -122.726 1.00 31.73  ? 649 ILE A CD1   1 
ATOM   3765  N  N     . PHE E 3 354 ? 54.974  23.503 -122.681 1.00 31.08  ? 650 PHE A N     1 
ATOM   3766  C  CA    . PHE E 3 354 ? 55.194  24.932 -122.511 1.00 30.69  ? 650 PHE A CA    1 
ATOM   3767  C  C     . PHE E 3 354 ? 53.909  25.651 -122.046 1.00 30.50  ? 650 PHE A C     1 
ATOM   3768  O  O     . PHE E 3 354 ? 53.064  26.003 -122.864 1.00 29.48  ? 650 PHE A O     1 
ATOM   3769  C  CB    . PHE E 3 354 ? 55.639  25.525 -123.846 1.00 31.30  ? 650 PHE A CB    1 
ATOM   3770  C  CG    . PHE E 3 354 ? 56.047  26.966 -123.771 1.00 31.65  ? 650 PHE A CG    1 
ATOM   3771  C  CD1   . PHE E 3 354 ? 57.392  27.312 -123.706 1.00 32.11  ? 650 PHE A CD1   1 
ATOM   3772  C  CD2   . PHE E 3 354 ? 55.095  27.979 -123.768 1.00 32.02  ? 650 PHE A CD2   1 
ATOM   3773  C  CE1   . PHE E 3 354 ? 57.786  28.644 -123.640 1.00 31.66  ? 650 PHE A CE1   1 
ATOM   3774  C  CE2   . PHE E 3 354 ? 55.479  29.315 -123.700 1.00 32.36  ? 650 PHE A CE2   1 
ATOM   3775  C  CZ    . PHE E 3 354 ? 56.833  29.647 -123.637 1.00 31.91  ? 650 PHE A CZ    1 
ATOM   3776  N  N     . ALA E 3 355 ? 53.783  25.885 -120.745 1.00 30.22  ? 651 ALA A N     1 
ATOM   3777  C  CA    . ALA E 3 355 ? 52.614  26.566 -120.196 1.00 31.12  ? 651 ALA A CA    1 
ATOM   3778  C  C     . ALA E 3 355 ? 52.868  28.058 -119.959 1.00 31.31  ? 651 ALA A C     1 
ATOM   3779  O  O     . ALA E 3 355 ? 53.850  28.427 -119.325 1.00 30.75  ? 651 ALA A O     1 
ATOM   3780  C  CB    . ALA E 3 355 ? 52.203  25.907 -118.901 1.00 31.08  ? 651 ALA A CB    1 
ATOM   3781  N  N     . ALA E 3 356 ? 51.972  28.905 -120.468 1.00 32.26  ? 652 ALA A N     1 
ATOM   3782  C  CA    . ALA E 3 356 ? 52.072  30.366 -120.309 1.00 33.03  ? 652 ALA A CA    1 
ATOM   3783  C  C     . ALA E 3 356 ? 50.799  30.890 -119.633 1.00 34.12  ? 652 ALA A C     1 
ATOM   3784  O  O     . ALA E 3 356 ? 49.698  30.527 -120.027 1.00 34.17  ? 652 ALA A O     1 
ATOM   3785  C  CB    . ALA E 3 356 ? 52.250  31.018 -121.654 1.00 32.76  ? 652 ALA A CB    1 
ATOM   3786  N  N     . ASP E 3 357 ? 50.960  31.775 -118.649 1.00 34.57  ? 653 ASP A N     1 
ATOM   3787  C  CA    . ASP E 3 357 ? 49.803  32.299 -117.872 1.00 35.07  ? 653 ASP A CA    1 
ATOM   3788  C  C     . ASP E 3 357 ? 49.139  33.611 -118.307 1.00 35.28  ? 653 ASP A C     1 
ATOM   3789  O  O     . ASP E 3 357 ? 48.588  33.724 -119.408 1.00 36.31  ? 653 ASP A O     1 
ATOM   3790  C  CB    . ASP E 3 357 ? 50.245  32.381 -116.400 1.00 35.94  ? 653 ASP A CB    1 
ATOM   3791  C  CG    . ASP E 3 357 ? 49.124  32.723 -115.435 1.00 36.07  ? 653 ASP A CG    1 
ATOM   3792  O  OD1   . ASP E 3 357 ? 48.724  33.895 -115.360 1.00 36.44  ? 653 ASP A OD1   1 
ATOM   3793  O  OD2   . ASP E 3 357 ? 48.633  31.809 -114.747 1.00 36.30  ? 653 ASP A OD2   1 
ATOM   3794  N  N     . TYR E 3 358 ? 49.192  34.583 -117.435 1.00 35.49  ? 654 TYR A N     1 
ATOM   3795  C  CA    . TYR E 3 358 ? 48.848  36.005 -117.674 1.00 35.12  ? 654 TYR A CA    1 
ATOM   3796  C  C     . TYR E 3 358 ? 48.908  36.557 -116.256 1.00 35.15  ? 654 TYR A C     1 
ATOM   3797  O  O     . TYR E 3 358 ? 48.121  36.163 -115.400 1.00 36.73  ? 654 TYR A O     1 
ATOM   3798  C  CB    . TYR E 3 358 ? 47.407  36.056 -118.182 1.00 34.38  ? 654 TYR A CB    1 
ATOM   3799  C  CG    . TYR E 3 358 ? 47.250  36.497 -119.624 1.00 33.96  ? 654 TYR A CG    1 
ATOM   3800  C  CD1   . TYR E 3 358 ? 46.614  35.678 -120.549 1.00 33.32  ? 654 TYR A CD1   1 
ATOM   3801  C  CD2   . TYR E 3 358 ? 47.734  37.736 -120.064 1.00 32.81  ? 654 TYR A CD2   1 
ATOM   3802  C  CE1   . TYR E 3 358 ? 46.462  36.076 -121.878 1.00 33.64  ? 654 TYR A CE1   1 
ATOM   3803  C  CE2   . TYR E 3 358 ? 47.588  38.139 -121.391 1.00 31.86  ? 654 TYR A CE2   1 
ATOM   3804  C  CZ    . TYR E 3 358 ? 46.952  37.301 -122.293 1.00 32.72  ? 654 TYR A CZ    1 
ATOM   3805  O  OH    . TYR E 3 358 ? 46.809  37.699 -123.618 1.00 32.28  ? 654 TYR A OH    1 
ATOM   3806  N  N     . SER E 3 359 ? 49.800  37.472 -115.977 1.00 34.41  ? 655 SER A N     1 
ATOM   3807  C  CA    . SER E 3 359 ? 49.917  38.025 -114.642 1.00 33.17  ? 655 SER A CA    1 
ATOM   3808  C  C     . SER E 3 359 ? 48.686  38.783 -114.161 1.00 32.37  ? 655 SER A C     1 
ATOM   3809  O  O     . SER E 3 359 ? 48.268  39.748 -114.802 1.00 32.82  ? 655 SER A O     1 
ATOM   3810  C  CB    . SER E 3 359 ? 51.159  38.931 -114.570 1.00 33.57  ? 655 SER A CB    1 
ATOM   3811  O  OG    . SER E 3 359 ? 51.225  39.623 -113.335 1.00 34.75  ? 655 SER A OG    1 
ATOM   3812  N  N     . GLN E 3 360 ? 48.121  38.351 -113.033 1.00 32.02  ? 656 GLN A N     1 
ATOM   3813  C  CA    . GLN E 3 360 ? 46.951  39.004 -112.420 1.00 30.58  ? 656 GLN A CA    1 
ATOM   3814  C  C     . GLN E 3 360 ? 46.096  39.643 -113.511 1.00 29.10  ? 656 GLN A C     1 
ATOM   3815  O  O     . GLN E 3 360 ? 45.940  40.857 -113.555 1.00 28.66  ? 656 GLN A O     1 
ATOM   3816  C  CB    . GLN E 3 360 ? 47.456  40.082 -111.456 1.00 31.26  ? 656 GLN A CB    1 
ATOM   3817  C  CG    . GLN E 3 360 ? 48.658  39.621 -110.654 1.00 30.39  ? 656 GLN A CG    1 
ATOM   3818  C  CD    . GLN E 3 360 ? 49.424  40.766 -110.050 1.00 31.25  ? 656 GLN A CD    1 
ATOM   3819  O  OE1   . GLN E 3 360 ? 48.950  41.409 -109.121 1.00 29.69  ? 656 GLN A OE1   1 
ATOM   3820  N  NE2   . GLN E 3 360 ? 50.628  41.029 -110.574 1.00 30.34  ? 656 GLN A NE2   1 
ATOM   3821  N  N     . ILE E 3 361 ? 45.608  38.888 -114.456 1.00 27.90  ? 657 ILE A N     1 
ATOM   3822  C  CA    . ILE E 3 361 ? 44.908  39.510 -115.558 1.00 26.12  ? 657 ILE A CA    1 
ATOM   3823  C  C     . ILE E 3 361 ? 43.590  40.264 -115.268 1.00 26.13  ? 657 ILE A C     1 
ATOM   3824  O  O     . ILE E 3 361 ? 43.459  41.425 -115.643 1.00 25.36  ? 657 ILE A O     1 
ATOM   3825  C  CB    . ILE E 3 361 ? 44.731  38.486 -116.682 1.00 26.38  ? 657 ILE A CB    1 
ATOM   3826  C  CG1   . ILE E 3 361 ? 44.140  39.140 -117.922 1.00 25.14  ? 657 ILE A CG1   1 
ATOM   3827  C  CG2   . ILE E 3 361 ? 43.849  37.334 -116.212 1.00 25.03  ? 657 ILE A CG2   1 
ATOM   3828  C  CD1   . ILE E 3 361 ? 45.112  40.024 -118.675 1.00 24.22  ? 657 ILE A CD1   1 
ATOM   3829  N  N     . GLU E 3 362 ? 42.648  39.619 -114.596 1.00 27.62  ? 658 GLU A N     1 
ATOM   3830  C  CA    . GLU E 3 362 ? 41.399  40.325 -114.322 1.00 27.84  ? 658 GLU A CA    1 
ATOM   3831  C  C     . GLU E 3 362 ? 41.706  41.605 -113.549 1.00 27.86  ? 658 GLU A C     1 
ATOM   3832  O  O     . GLU E 3 362 ? 41.122  42.661 -113.836 1.00 28.07  ? 658 GLU A O     1 
ATOM   3833  C  CB    . GLU E 3 362 ? 40.404  39.410 -113.594 1.00 28.41  ? 658 GLU A CB    1 
ATOM   3834  C  CG    . GLU E 3 362 ? 39.902  38.268 -114.518 1.00 27.50  ? 658 GLU A CG    1 
ATOM   3835  C  CD    . GLU E 3 362 ? 38.689  37.526 -113.980 1.00 30.33  ? 658 GLU A CD    1 
ATOM   3836  O  OE1   . GLU E 3 362 ? 38.375  36.438 -114.521 1.00 30.76  ? 658 GLU A OE1   1 
ATOM   3837  O  OE2   . GLU E 3 362 ? 38.045  38.021 -113.025 1.00 30.73  ? 658 GLU A OE2   1 
ATOM   3838  N  N     . LEU E 3 363 ? 42.645  41.538 -112.603 1.00 27.92  ? 659 LEU A N     1 
ATOM   3839  C  CA    . LEU E 3 363 ? 43.033  42.746 -111.872 1.00 28.73  ? 659 LEU A CA    1 
ATOM   3840  C  C     . LEU E 3 363 ? 43.608  43.797 -112.815 1.00 28.58  ? 659 LEU A C     1 
ATOM   3841  O  O     . LEU E 3 363 ? 43.397  44.988 -112.612 1.00 28.28  ? 659 LEU A O     1 
ATOM   3842  C  CB    . LEU E 3 363 ? 44.061  42.443 -110.775 1.00 28.93  ? 659 LEU A CB    1 
ATOM   3843  C  CG    . LEU E 3 363 ? 43.567  41.746 -109.508 1.00 30.13  ? 659 LEU A CG    1 
ATOM   3844  C  CD1   . LEU E 3 363 ? 44.688  41.658 -108.517 1.00 30.46  ? 659 LEU A CD1   1 
ATOM   3845  C  CD2   . LEU E 3 363 ? 42.379  42.514 -108.918 1.00 29.49  ? 659 LEU A CD2   1 
ATOM   3846  N  N     . ARG E 3 364 ? 44.362  43.363 -113.830 1.00 29.17  ? 660 ARG A N     1 
ATOM   3847  C  CA    . ARG E 3 364 ? 44.929  44.298 -114.801 1.00 29.50  ? 660 ARG A CA    1 
ATOM   3848  C  C     . ARG E 3 364 ? 43.785  44.812 -115.669 1.00 29.52  ? 660 ARG A C     1 
ATOM   3849  O  O     . ARG E 3 364 ? 43.700  46.003 -115.990 1.00 28.77  ? 660 ARG A O     1 
ATOM   3850  C  CB    . ARG E 3 364 ? 45.973  43.603 -115.693 1.00 31.08  ? 660 ARG A CB    1 
ATOM   3851  C  CG    . ARG E 3 364 ? 47.287  43.273 -114.977 1.00 31.73  ? 660 ARG A CG    1 
ATOM   3852  C  CD    . ARG E 3 364 ? 48.251  42.495 -115.875 1.00 31.85  ? 660 ARG A CD    1 
ATOM   3853  N  NE    . ARG E 3 364 ? 49.369  41.944 -115.106 1.00 31.35  ? 660 ARG A NE    1 
ATOM   3854  C  CZ    . ARG E 3 364 ? 50.481  42.613 -114.801 1.00 31.21  ? 660 ARG A CZ    1 
ATOM   3855  N  NH1   . ARG E 3 364 ? 50.645  43.862 -115.206 1.00 29.50  ? 660 ARG A NH1   1 
ATOM   3856  N  NH2   . ARG E 3 364 ? 51.421  42.035 -114.063 1.00 30.59  ? 660 ARG A NH2   1 
ATOM   3857  N  N     . VAL E 3 365 ? 42.912  43.893 -116.067 1.00 28.38  ? 661 VAL A N     1 
ATOM   3858  C  CA    . VAL E 3 365 ? 41.766  44.267 -116.876 1.00 28.90  ? 661 VAL A CA    1 
ATOM   3859  C  C     . VAL E 3 365 ? 40.865  45.239 -116.128 1.00 28.19  ? 661 VAL A C     1 
ATOM   3860  O  O     . VAL E 3 365 ? 40.319  46.158 -116.733 1.00 27.83  ? 661 VAL A O     1 
ATOM   3861  C  CB    . VAL E 3 365 ? 40.930  43.040 -117.288 1.00 28.62  ? 661 VAL A CB    1 
ATOM   3862  C  CG1   . VAL E 3 365 ? 39.574  43.491 -117.809 1.00 28.43  ? 661 VAL A CG1   1 
ATOM   3863  C  CG2   . VAL E 3 365 ? 41.674  42.267 -118.379 1.00 28.15  ? 661 VAL A CG2   1 
ATOM   3864  N  N     . LEU E 3 366 ? 40.704  45.040 -114.822 1.00 28.57  ? 662 LEU A N     1 
ATOM   3865  C  CA    . LEU E 3 366 ? 39.860  45.945 -114.027 1.00 29.66  ? 662 LEU A CA    1 
ATOM   3866  C  C     . LEU E 3 366 ? 40.522  47.315 -114.019 1.00 30.50  ? 662 LEU A C     1 
ATOM   3867  O  O     . LEU E 3 366 ? 39.865  48.342 -114.176 1.00 30.44  ? 662 LEU A O     1 
ATOM   3868  C  CB    . LEU E 3 366 ? 39.723  45.435 -112.586 1.00 29.17  ? 662 LEU A CB    1 
ATOM   3869  C  CG    . LEU E 3 366 ? 39.176  46.349 -111.486 1.00 28.08  ? 662 LEU A CG    1 
ATOM   3870  C  CD1   . LEU E 3 366 ? 37.831  46.957 -111.904 1.00 28.52  ? 662 LEU A CD1   1 
ATOM   3871  C  CD2   . LEU E 3 366 ? 39.043  45.548 -110.210 1.00 27.04  ? 662 LEU A CD2   1 
ATOM   3872  N  N     . ALA E 3 367 ? 41.840  47.311 -113.856 1.00 31.14  ? 663 ALA A N     1 
ATOM   3873  C  CA    . ALA E 3 367 ? 42.622  48.544 -113.830 1.00 31.91  ? 663 ALA A CA    1 
ATOM   3874  C  C     . ALA E 3 367 ? 42.374  49.400 -115.067 1.00 32.27  ? 663 ALA A C     1 
ATOM   3875  O  O     . ALA E 3 367 ? 42.238  50.620 -114.976 1.00 33.07  ? 663 ALA A O     1 
ATOM   3876  C  CB    . ALA E 3 367 ? 44.117  48.201 -113.709 1.00 31.08  ? 663 ALA A CB    1 
ATOM   3877  N  N     . HIS E 3 368 ? 42.317  48.756 -116.228 1.00 33.22  ? 664 HIS A N     1 
ATOM   3878  C  CA    . HIS E 3 368 ? 42.089  49.458 -117.481 1.00 33.24  ? 664 HIS A CA    1 
ATOM   3879  C  C     . HIS E 3 368 ? 40.650  49.969 -117.580 1.00 33.32  ? 664 HIS A C     1 
ATOM   3880  O  O     . HIS E 3 368 ? 40.414  51.146 -117.853 1.00 32.74  ? 664 HIS A O     1 
ATOM   3881  C  CB    . HIS E 3 368 ? 42.419  48.523 -118.648 1.00 34.32  ? 664 HIS A CB    1 
ATOM   3882  C  CG    . HIS E 3 368 ? 41.991  49.034 -119.989 1.00 35.53  ? 664 HIS A CG    1 
ATOM   3883  N  ND1   . HIS E 3 368 ? 42.548  50.148 -120.579 1.00 35.36  ? 664 HIS A ND1   1 
ATOM   3884  C  CD2   . HIS E 3 368 ? 41.058  48.575 -120.858 1.00 35.40  ? 664 HIS A CD2   1 
ATOM   3885  C  CE1   . HIS E 3 368 ? 41.978  50.351 -121.753 1.00 35.96  ? 664 HIS A CE1   1 
ATOM   3886  N  NE2   . HIS E 3 368 ? 41.069  49.412 -121.946 1.00 35.54  ? 664 HIS A NE2   1 
ATOM   3887  N  N     . ILE E 3 369 ? 39.679  49.091 -117.353 1.00 33.43  ? 665 ILE A N     1 
ATOM   3888  C  CA    . ILE E 3 369 ? 38.284  49.529 -117.442 1.00 33.01  ? 665 ILE A CA    1 
ATOM   3889  C  C     . ILE E 3 369 ? 37.955  50.529 -116.334 1.00 32.99  ? 665 ILE A C     1 
ATOM   3890  O  O     . ILE E 3 369 ? 37.607  51.680 -116.617 1.00 33.92  ? 665 ILE A O     1 
ATOM   3891  C  CB    . ILE E 3 369 ? 37.318  48.321 -117.393 1.00 32.74  ? 665 ILE A CB    1 
ATOM   3892  C  CG1   . ILE E 3 369 ? 37.600  47.407 -118.590 1.00 31.76  ? 665 ILE A CG1   1 
ATOM   3893  C  CG2   . ILE E 3 369 ? 35.851  48.810 -117.416 1.00 31.83  ? 665 ILE A CG2   1 
ATOM   3894  C  CD1   . ILE E 3 369 ? 36.599  46.282 -118.793 1.00 30.87  ? 665 ILE A CD1   1 
ATOM   3895  N  N     . ALA E 3 370 ? 38.095  50.110 -115.079 1.00 32.46  ? 666 ALA A N     1 
ATOM   3896  C  CA    . ALA E 3 370 ? 37.801  50.993 -113.953 1.00 33.01  ? 666 ALA A CA    1 
ATOM   3897  C  C     . ALA E 3 370 ? 38.595  52.288 -114.024 1.00 33.28  ? 666 ALA A C     1 
ATOM   3898  O  O     . ALA E 3 370 ? 38.107  53.346 -113.645 1.00 32.55  ? 666 ALA A O     1 
ATOM   3899  C  CB    . ALA E 3 370 ? 38.096  50.284 -112.628 1.00 32.87  ? 666 ALA A CB    1 
ATOM   3900  N  N     . GLU E 3 371 ? 39.827  52.200 -114.517 1.00 34.46  ? 667 GLU A N     1 
ATOM   3901  C  CA    . GLU E 3 371 ? 40.695  53.367 -114.610 1.00 34.40  ? 667 GLU A CA    1 
ATOM   3902  C  C     . GLU E 3 371 ? 41.014  53.993 -113.255 1.00 34.17  ? 667 GLU A C     1 
ATOM   3903  O  O     . GLU E 3 371 ? 41.078  55.216 -113.137 1.00 34.70  ? 667 GLU A O     1 
ATOM   3904  C  CB    . GLU E 3 371 ? 40.088  54.441 -115.521 1.00 34.83  ? 667 GLU A CB    1 
ATOM   3905  C  CG    . GLU E 3 371 ? 40.046  54.076 -116.992 1.00 36.02  ? 667 GLU A CG    1 
ATOM   3906  C  CD    . GLU E 3 371 ? 39.508  55.201 -117.852 1.00 37.10  ? 667 GLU A CD    1 
ATOM   3907  O  OE1   . GLU E 3 371 ? 40.014  56.333 -117.715 1.00 38.22  ? 667 GLU A OE1   1 
ATOM   3908  O  OE2   . GLU E 3 371 ? 38.594  54.957 -118.672 1.00 37.68  ? 667 GLU A OE2   1 
ATOM   3909  N  N     . ASP E 3 372 ? 41.203  53.184 -112.220 1.00 34.50  ? 668 ASP A N     1 
ATOM   3910  C  CA    . ASP E 3 372 ? 41.568  53.776 -110.941 1.00 35.03  ? 668 ASP A CA    1 
ATOM   3911  C  C     . ASP E 3 372 ? 43.027  54.198 -111.082 1.00 34.96  ? 668 ASP A C     1 
ATOM   3912  O  O     . ASP E 3 372 ? 43.854  53.419 -111.557 1.00 34.20  ? 668 ASP A O     1 
ATOM   3913  C  CB    . ASP E 3 372 ? 41.462  52.779 -109.801 1.00 37.39  ? 668 ASP A CB    1 
ATOM   3914  C  CG    . ASP E 3 372 ? 42.051  53.326 -108.511 1.00 38.86  ? 668 ASP A CG    1 
ATOM   3915  O  OD1   . ASP E 3 372 ? 42.707  52.557 -107.774 1.00 39.08  ? 668 ASP A OD1   1 
ATOM   3916  O  OD2   . ASP E 3 372 ? 41.861  54.534 -108.240 1.00 40.01  ? 668 ASP A OD2   1 
ATOM   3917  N  N     . ASP E 3 373 ? 43.342  55.423 -110.677 1.00 34.58  ? 669 ASP A N     1 
ATOM   3918  C  CA    . ASP E 3 373 ? 44.705  55.930 -110.776 1.00 34.35  ? 669 ASP A CA    1 
ATOM   3919  C  C     . ASP E 3 373 ? 45.737  54.966 -110.197 1.00 34.08  ? 669 ASP A C     1 
ATOM   3920  O  O     . ASP E 3 373 ? 46.650  54.511 -110.896 1.00 33.46  ? 669 ASP A O     1 
ATOM   3921  C  CB    . ASP E 3 373 ? 44.826  57.258 -110.038 1.00 35.19  ? 669 ASP A CB    1 
ATOM   3922  C  CG    . ASP E 3 373 ? 43.772  58.251 -110.454 1.00 36.57  ? 669 ASP A CG    1 
ATOM   3923  O  OD1   . ASP E 3 373 ? 43.817  58.721 -111.607 1.00 37.24  ? 669 ASP A OD1   1 
ATOM   3924  O  OD2   . ASP E 3 373 ? 42.891  58.564 -109.622 1.00 39.05  ? 669 ASP A OD2   1 
ATOM   3925  N  N     . ASN E 3 374 ? 45.573  54.661 -108.917 1.00 32.40  ? 670 ASN A N     1 
ATOM   3926  C  CA    . ASN E 3 374 ? 46.492  53.801 -108.198 1.00 32.37  ? 670 ASN A CA    1 
ATOM   3927  C  C     . ASN E 3 374 ? 46.580  52.330 -108.619 1.00 32.22  ? 670 ASN A C     1 
ATOM   3928  O  O     . ASN E 3 374 ? 47.621  51.696 -108.414 1.00 31.49  ? 670 ASN A O     1 
ATOM   3929  C  CB    . ASN E 3 374 ? 46.194  53.904 -106.702 1.00 32.88  ? 670 ASN A CB    1 
ATOM   3930  C  CG    . ASN E 3 374 ? 45.952  55.336 -106.258 1.00 33.58  ? 670 ASN A CG    1 
ATOM   3931  O  OD1   . ASN E 3 374 ? 46.764  56.226 -106.507 1.00 34.11  ? 670 ASN A OD1   1 
ATOM   3932  N  ND2   . ASN E 3 374 ? 44.823  55.566 -105.597 1.00 35.08  ? 670 ASN A ND2   1 
ATOM   3933  N  N     . LEU E 3 375 ? 45.513  51.773 -109.196 1.00 31.77  ? 671 LEU A N     1 
ATOM   3934  C  CA    . LEU E 3 375 ? 45.572  50.378 -109.627 1.00 31.16  ? 671 LEU A CA    1 
ATOM   3935  C  C     . LEU E 3 375 ? 46.380  50.295 -110.921 1.00 31.12  ? 671 LEU A C     1 
ATOM   3936  O  O     . LEU E 3 375 ? 47.074  49.302 -111.163 1.00 31.92  ? 671 LEU A O     1 
ATOM   3937  C  CB    . LEU E 3 375 ? 44.176  49.800 -109.858 1.00 30.07  ? 671 LEU A CB    1 
ATOM   3938  C  CG    . LEU E 3 375 ? 44.127  48.299 -110.158 1.00 30.12  ? 671 LEU A CG    1 
ATOM   3939  C  CD1   . LEU E 3 375 ? 44.814  47.508 -109.042 1.00 30.22  ? 671 LEU A CD1   1 
ATOM   3940  C  CD2   . LEU E 3 375 ? 42.676  47.871 -110.303 1.00 30.92  ? 671 LEU A CD2   1 
ATOM   3941  N  N     . MET E 3 376 ? 46.287  51.334 -111.748 1.00 30.83  ? 672 MET A N     1 
ATOM   3942  C  CA    . MET E 3 376 ? 47.029  51.374 -113.002 1.00 31.76  ? 672 MET A CA    1 
ATOM   3943  C  C     . MET E 3 376 ? 48.481  51.707 -112.691 1.00 31.93  ? 672 MET A C     1 
ATOM   3944  O  O     . MET E 3 376 ? 49.392  50.970 -113.078 1.00 32.25  ? 672 MET A O     1 
ATOM   3945  C  CB    . MET E 3 376 ? 46.462  52.439 -113.942 1.00 32.37  ? 672 MET A CB    1 
ATOM   3946  C  CG    . MET E 3 376 ? 45.021  52.208 -114.342 1.00 31.97  ? 672 MET A CG    1 
ATOM   3947  S  SD    . MET E 3 376 ? 44.512  53.288 -115.664 1.00 34.35  ? 672 MET A SD    1 
ATOM   3948  C  CE    . MET E 3 376 ? 44.716  54.914 -114.877 1.00 32.41  ? 672 MET A CE    1 
ATOM   3949  N  N     . GLU E 3 377 ? 48.680  52.831 -112.002 1.00 32.09  ? 673 GLU A N     1 
ATOM   3950  C  CA    . GLU E 3 377 ? 50.009  53.289 -111.602 1.00 32.38  ? 673 GLU A CA    1 
ATOM   3951  C  C     . GLU E 3 377 ? 50.755  52.117 -110.981 1.00 32.17  ? 673 GLU A C     1 
ATOM   3952  O  O     . GLU E 3 377 ? 51.946  51.924 -111.229 1.00 31.63  ? 673 GLU A O     1 
ATOM   3953  C  CB    . GLU E 3 377 ? 49.884  54.438 -110.590 1.00 32.74  ? 673 GLU A CB    1 
ATOM   3954  C  CG    . GLU E 3 377 ? 51.176  54.878 -109.869 1.00 33.29  ? 673 GLU A CG    1 
ATOM   3955  C  CD    . GLU E 3 377 ? 52.168  55.648 -110.753 1.00 35.55  ? 673 GLU A CD    1 
ATOM   3956  O  OE1   . GLU E 3 377 ? 51.727  56.485 -111.576 1.00 36.65  ? 673 GLU A OE1   1 
ATOM   3957  O  OE2   . GLU E 3 377 ? 53.396  55.436 -110.602 1.00 34.37  ? 673 GLU A OE2   1 
ATOM   3958  N  N     . ALA E 3 378 ? 50.045  51.326 -110.180 1.00 32.03  ? 674 ALA A N     1 
ATOM   3959  C  CA    . ALA E 3 378 ? 50.663  50.177 -109.540 1.00 31.85  ? 674 ALA A CA    1 
ATOM   3960  C  C     . ALA E 3 378 ? 51.232  49.217 -110.579 1.00 31.87  ? 674 ALA A C     1 
ATOM   3961  O  O     . ALA E 3 378 ? 52.399  48.816 -110.491 1.00 31.38  ? 674 ALA A O     1 
ATOM   3962  C  CB    . ALA E 3 378 ? 49.658  49.456 -108.654 1.00 31.79  ? 674 ALA A CB    1 
ATOM   3963  N  N     . PHE E 3 379 ? 50.418  48.846 -111.568 1.00 31.64  ? 675 PHE A N     1 
ATOM   3964  C  CA    . PHE E 3 379 ? 50.886  47.922 -112.598 1.00 31.79  ? 675 PHE A CA    1 
ATOM   3965  C  C     . PHE E 3 379 ? 51.960  48.566 -113.467 1.00 32.17  ? 675 PHE A C     1 
ATOM   3966  O  O     . PHE E 3 379 ? 52.914  47.912 -113.881 1.00 33.01  ? 675 PHE A O     1 
ATOM   3967  C  CB    . PHE E 3 379 ? 49.712  47.414 -113.437 1.00 30.34  ? 675 PHE A CB    1 
ATOM   3968  C  CG    . PHE E 3 379 ? 48.871  46.409 -112.723 1.00 29.38  ? 675 PHE A CG    1 
ATOM   3969  C  CD1   . PHE E 3 379 ? 47.502  46.613 -112.554 1.00 29.81  ? 675 PHE A CD1   1 
ATOM   3970  C  CD2   . PHE E 3 379 ? 49.451  45.264 -112.186 1.00 29.09  ? 675 PHE A CD2   1 
ATOM   3971  C  CE1   . PHE E 3 379 ? 46.731  45.699 -111.864 1.00 28.06  ? 675 PHE A CE1   1 
ATOM   3972  C  CE2   . PHE E 3 379 ? 48.691  44.344 -111.492 1.00 29.42  ? 675 PHE A CE2   1 
ATOM   3973  C  CZ    . PHE E 3 379 ? 47.320  44.560 -111.327 1.00 29.00  ? 675 PHE A CZ    1 
ATOM   3974  N  N     . ARG E 3 380 ? 51.808  49.855 -113.733 1.00 32.36  ? 676 ARG A N     1 
ATOM   3975  C  CA    . ARG E 3 380 ? 52.797  50.576 -114.512 1.00 32.84  ? 676 ARG A CA    1 
ATOM   3976  C  C     . ARG E 3 380 ? 54.126  50.515 -113.763 1.00 32.94  ? 676 ARG A C     1 
ATOM   3977  O  O     . ARG E 3 380 ? 55.183  50.771 -114.335 1.00 33.50  ? 676 ARG A O     1 
ATOM   3978  C  CB    . ARG E 3 380 ? 52.333  52.014 -114.732 1.00 31.73  ? 676 ARG A CB    1 
ATOM   3979  C  CG    . ARG E 3 380 ? 51.301  52.078 -115.847 1.00 31.23  ? 676 ARG A CG    1 
ATOM   3980  C  CD    . ARG E 3 380 ? 50.481  53.352 -115.856 1.00 30.84  ? 676 ARG A CD    1 
ATOM   3981  N  NE    . ARG E 3 380 ? 49.615  53.383 -117.027 1.00 31.21  ? 676 ARG A NE    1 
ATOM   3982  C  CZ    . ARG E 3 380 ? 48.635  54.258 -117.222 1.00 31.78  ? 676 ARG A CZ    1 
ATOM   3983  N  NH1   . ARG E 3 380 ? 48.373  55.185 -116.311 1.00 31.97  ? 676 ARG A NH1   1 
ATOM   3984  N  NH2   . ARG E 3 380 ? 47.942  54.225 -118.351 1.00 31.39  ? 676 ARG A NH2   1 
ATOM   3985  N  N     . ARG E 3 381 ? 54.038  50.151 -112.483 1.00 32.86  ? 677 ARG A N     1 
ATOM   3986  C  CA    . ARG E 3 381 ? 55.183  49.987 -111.588 1.00 32.41  ? 677 ARG A CA    1 
ATOM   3987  C  C     . ARG E 3 381 ? 55.519  48.508 -111.452 1.00 32.18  ? 677 ARG A C     1 
ATOM   3988  O  O     . ARG E 3 381 ? 56.454  48.136 -110.760 1.00 32.31  ? 677 ARG A O     1 
ATOM   3989  C  CB    . ARG E 3 381 ? 54.872  50.540 -110.191 1.00 31.51  ? 677 ARG A CB    1 
ATOM   3990  C  CG    . ARG E 3 381 ? 54.839  52.047 -110.113 1.00 30.91  ? 677 ARG A CG    1 
ATOM   3991  C  CD    . ARG E 3 381 ? 54.818  52.524 -108.676 1.00 31.41  ? 677 ARG A CD    1 
ATOM   3992  N  NE    . ARG E 3 381 ? 54.611  53.968 -108.585 1.00 29.63  ? 677 ARG A NE    1 
ATOM   3993  C  CZ    . ARG E 3 381 ? 54.630  54.650 -107.445 1.00 29.07  ? 677 ARG A CZ    1 
ATOM   3994  N  NH1   . ARG E 3 381 ? 54.851  54.024 -106.300 1.00 27.85  ? 677 ARG A NH1   1 
ATOM   3995  N  NH2   . ARG E 3 381 ? 54.402  55.955 -107.448 1.00 28.71  ? 677 ARG A NH2   1 
ATOM   3996  N  N     . ASP E 3 382 ? 54.738  47.669 -112.111 1.00 32.93  ? 678 ASP A N     1 
ATOM   3997  C  CA    . ASP E 3 382 ? 54.929  46.224 -112.067 1.00 33.12  ? 678 ASP A CA    1 
ATOM   3998  C  C     . ASP E 3 382 ? 54.941  45.615 -110.661 1.00 32.63  ? 678 ASP A C     1 
ATOM   3999  O  O     . ASP E 3 382 ? 55.929  45.020 -110.237 1.00 32.86  ? 678 ASP A O     1 
ATOM   4000  C  CB    . ASP E 3 382 ? 56.205  45.843 -112.817 1.00 34.88  ? 678 ASP A CB    1 
ATOM   4001  C  CG    . ASP E 3 382 ? 56.414  44.347 -112.879 1.00 36.50  ? 678 ASP A CG    1 
ATOM   4002  O  OD1   . ASP E 3 382 ? 55.407  43.611 -112.860 1.00 37.59  ? 678 ASP A OD1   1 
ATOM   4003  O  OD2   . ASP E 3 382 ? 57.585  43.905 -112.960 1.00 37.94  ? 678 ASP A OD2   1 
ATOM   4004  N  N     . LEU E 3 383 ? 53.832  45.746 -109.936 1.00 31.58  ? 679 LEU A N     1 
ATOM   4005  C  CA    . LEU E 3 383 ? 53.746  45.170 -108.594 1.00 30.49  ? 679 LEU A CA    1 
ATOM   4006  C  C     . LEU E 3 383 ? 52.884  43.906 -108.619 1.00 30.59  ? 679 LEU A C     1 
ATOM   4007  O  O     . LEU E 3 383 ? 52.137  43.686 -109.575 1.00 30.93  ? 679 LEU A O     1 
ATOM   4008  C  CB    . LEU E 3 383 ? 53.124  46.172 -107.631 1.00 30.92  ? 679 LEU A CB    1 
ATOM   4009  C  CG    . LEU E 3 383 ? 53.730  47.572 -107.521 1.00 30.01  ? 679 LEU A CG    1 
ATOM   4010  C  CD1   . LEU E 3 383 ? 52.851  48.396 -106.607 1.00 28.92  ? 679 LEU A CD1   1 
ATOM   4011  C  CD2   . LEU E 3 383 ? 55.157  47.497 -106.986 1.00 29.97  ? 679 LEU A CD2   1 
ATOM   4012  N  N     . ASP E 3 384 ? 53.001  43.070 -107.588 1.00 29.68  ? 680 ASP A N     1 
ATOM   4013  C  CA    . ASP E 3 384 ? 52.191  41.846 -107.484 1.00 29.41  ? 680 ASP A CA    1 
ATOM   4014  C  C     . ASP E 3 384 ? 51.154  42.110 -106.383 1.00 29.18  ? 680 ASP A C     1 
ATOM   4015  O  O     . ASP E 3 384 ? 51.405  41.845 -105.200 1.00 29.21  ? 680 ASP A O     1 
ATOM   4016  C  CB    . ASP E 3 384 ? 53.056  40.644 -107.088 1.00 28.63  ? 680 ASP A CB    1 
ATOM   4017  C  CG    . ASP E 3 384 ? 52.289  39.324 -107.133 1.00 29.71  ? 680 ASP A CG    1 
ATOM   4018  O  OD1   . ASP E 3 384 ? 51.098  39.301 -106.741 1.00 29.13  ? 680 ASP A OD1   1 
ATOM   4019  O  OD2   . ASP E 3 384 ? 52.881  38.304 -107.539 1.00 29.38  ? 680 ASP A OD2   1 
ATOM   4020  N  N     . ILE E 3 385 ? 50.001  42.653 -106.768 1.00 28.26  ? 681 ILE A N     1 
ATOM   4021  C  CA    . ILE E 3 385 ? 48.952  42.974 -105.794 1.00 27.54  ? 681 ILE A CA    1 
ATOM   4022  C  C     . ILE E 3 385 ? 48.493  41.783 -104.953 1.00 27.52  ? 681 ILE A C     1 
ATOM   4023  O  O     . ILE E 3 385 ? 47.997  41.950 -103.838 1.00 27.00  ? 681 ILE A O     1 
ATOM   4024  C  CB    . ILE E 3 385 ? 47.743  43.624 -106.493 1.00 27.31  ? 681 ILE A CB    1 
ATOM   4025  C  CG1   . ILE E 3 385 ? 48.195  44.915 -107.179 1.00 25.82  ? 681 ILE A CG1   1 
ATOM   4026  C  CG2   . ILE E 3 385 ? 46.642  43.929 -105.486 1.00 25.98  ? 681 ILE A CG2   1 
ATOM   4027  C  CD1   . ILE E 3 385 ? 48.830  45.903 -106.225 1.00 26.33  ? 681 ILE A CD1   1 
ATOM   4028  N  N     . HIS E 3 386 ? 48.654  40.577 -105.473 1.00 28.02  ? 682 HIS A N     1 
ATOM   4029  C  CA    . HIS E 3 386 ? 48.272  39.415 -104.699 1.00 29.52  ? 682 HIS A CA    1 
ATOM   4030  C  C     . HIS E 3 386 ? 49.213  39.288 -103.506 1.00 29.85  ? 682 HIS A C     1 
ATOM   4031  O  O     . HIS E 3 386 ? 48.768  39.114 -102.373 1.00 28.55  ? 682 HIS A O     1 
ATOM   4032  C  CB    . HIS E 3 386 ? 48.324  38.163 -105.564 1.00 30.50  ? 682 HIS A CB    1 
ATOM   4033  C  CG    . HIS E 3 386 ? 47.265  38.126 -106.617 1.00 32.26  ? 682 HIS A CG    1 
ATOM   4034  N  ND1   . HIS E 3 386 ? 47.399  37.403 -107.784 1.00 33.35  ? 682 HIS A ND1   1 
ATOM   4035  C  CD2   . HIS E 3 386 ? 46.049  38.720 -106.679 1.00 32.59  ? 682 HIS A CD2   1 
ATOM   4036  C  CE1   . HIS E 3 386 ? 46.313  37.557 -108.520 1.00 33.34  ? 682 HIS A CE1   1 
ATOM   4037  N  NE2   . HIS E 3 386 ? 45.478  38.351 -107.873 1.00 32.98  ? 682 HIS A NE2   1 
ATOM   4038  N  N     . THR E 3 387 ? 50.515  39.393 -103.760 1.00 31.19  ? 683 THR A N     1 
ATOM   4039  C  CA    . THR E 3 387 ? 51.505  39.288 -102.697 1.00 32.48  ? 683 THR A CA    1 
ATOM   4040  C  C     . THR E 3 387 ? 51.353  40.428 -101.700 1.00 33.77  ? 683 THR A C     1 
ATOM   4041  O  O     . THR E 3 387 ? 51.477  40.233 -100.490 1.00 33.97  ? 683 THR A O     1 
ATOM   4042  C  CB    . THR E 3 387 ? 52.949  39.296 -103.273 1.00 33.06  ? 683 THR A CB    1 
ATOM   4043  O  OG1   . THR E 3 387 ? 53.199  38.052 -103.938 1.00 31.71  ? 683 THR A OG1   1 
ATOM   4044  C  CG2   . THR E 3 387 ? 53.975  39.493 -102.159 1.00 31.69  ? 683 THR A CG2   1 
ATOM   4045  N  N     . LYS E 3 388 ? 51.074  41.623 -102.209 1.00 35.29  ? 684 LYS A N     1 
ATOM   4046  C  CA    . LYS E 3 388 ? 50.906  42.785 -101.353 1.00 36.63  ? 684 LYS A CA    1 
ATOM   4047  C  C     . LYS E 3 388 ? 49.758  42.547 -100.364 1.00 37.63  ? 684 LYS A C     1 
ATOM   4048  O  O     . LYS E 3 388 ? 49.957  42.564 -99.152  1.00 37.33  ? 684 LYS A O     1 
ATOM   4049  C  CB    . LYS E 3 388 ? 50.623  44.003 -102.227 1.00 37.31  ? 684 LYS A CB    1 
ATOM   4050  C  CG    . LYS E 3 388 ? 50.937  45.359 -101.616 1.00 37.58  ? 684 LYS A CG    1 
ATOM   4051  C  CD    . LYS E 3 388 ? 50.928  46.381 -102.747 1.00 39.52  ? 684 LYS A CD    1 
ATOM   4052  C  CE    . LYS E 3 388 ? 50.940  47.825 -102.285 1.00 39.96  ? 684 LYS A CE    1 
ATOM   4053  N  NZ    . LYS E 3 388 ? 50.536  48.697 -103.435 1.00 39.89  ? 684 LYS A NZ    1 
ATOM   4054  N  N     . THR E 3 389 ? 48.557  42.314 -100.885 1.00 38.71  ? 685 THR A N     1 
ATOM   4055  C  CA    . THR E 3 389 ? 47.399  42.067 -100.036 1.00 39.39  ? 685 THR A CA    1 
ATOM   4056  C  C     . THR E 3 389 ? 47.706  40.925 -99.064  1.00 40.73  ? 685 THR A C     1 
ATOM   4057  O  O     . THR E 3 389 ? 47.121  40.840 -97.977  1.00 39.98  ? 685 THR A O     1 
ATOM   4058  C  CB    . THR E 3 389 ? 46.166  41.737 -100.888 1.00 38.97  ? 685 THR A CB    1 
ATOM   4059  O  OG1   . THR E 3 389 ? 45.850  42.871 -101.709 1.00 38.69  ? 685 THR A OG1   1 
ATOM   4060  C  CG2   . THR E 3 389 ? 44.972  41.404 -100.004 1.00 38.91  ? 685 THR A CG2   1 
ATOM   4061  N  N     . ALA E 3 390 ? 48.634  40.053 -99.453  1.00 41.82  ? 686 ALA A N     1 
ATOM   4062  C  CA    . ALA E 3 390 ? 49.045  38.949 -98.593  1.00 43.62  ? 686 ALA A CA    1 
ATOM   4063  C  C     . ALA E 3 390 ? 49.842  39.572 -97.441  1.00 45.24  ? 686 ALA A C     1 
ATOM   4064  O  O     . ALA E 3 390 ? 49.739  39.146 -96.286  1.00 45.20  ? 686 ALA A O     1 
ATOM   4065  C  CB    . ALA E 3 390 ? 49.913  37.968 -99.369  1.00 43.23  ? 686 ALA A CB    1 
ATOM   4066  N  N     . MET E 3 391 ? 50.632  40.591 -97.774  1.00 46.73  ? 687 MET A N     1 
ATOM   4067  C  CA    . MET E 3 391 ? 51.438  41.312 -96.793  1.00 48.32  ? 687 MET A CA    1 
ATOM   4068  C  C     . MET E 3 391 ? 50.552  41.940 -95.714  1.00 49.55  ? 687 MET A C     1 
ATOM   4069  O  O     . MET E 3 391 ? 51.050  42.395 -94.686  1.00 49.80  ? 687 MET A O     1 
ATOM   4070  C  CB    . MET E 3 391 ? 52.254  42.416 -97.480  1.00 47.96  ? 687 MET A CB    1 
ATOM   4071  C  CG    . MET E 3 391 ? 53.377  41.910 -98.371  1.00 48.47  ? 687 MET A CG    1 
ATOM   4072  S  SD    . MET E 3 391 ? 54.152  43.248 -99.317  1.00 49.28  ? 687 MET A SD    1 
ATOM   4073  C  CE    . MET E 3 391 ? 55.130  44.030 -98.063  1.00 48.19  ? 687 MET A CE    1 
ATOM   4074  N  N     . ASP E 3 392 ? 49.245  41.979 -95.960  1.00 50.84  ? 688 ASP A N     1 
ATOM   4075  C  CA    . ASP E 3 392 ? 48.295  42.544 -95.002  1.00 51.99  ? 688 ASP A CA    1 
ATOM   4076  C  C     . ASP E 3 392 ? 47.471  41.438 -94.355  1.00 52.03  ? 688 ASP A C     1 
ATOM   4077  O  O     . ASP E 3 392 ? 47.380  41.352 -93.137  1.00 52.06  ? 688 ASP A O     1 
ATOM   4078  C  CB    . ASP E 3 392 ? 47.361  43.538 -95.692  1.00 52.72  ? 688 ASP A CB    1 
ATOM   4079  C  CG    . ASP E 3 392 ? 48.073  44.795 -96.131  1.00 53.79  ? 688 ASP A CG    1 
ATOM   4080  O  OD1   . ASP E 3 392 ? 48.973  44.704 -96.988  1.00 54.56  ? 688 ASP A OD1   1 
ATOM   4081  O  OD2   . ASP E 3 392 ? 47.732  45.880 -95.617  1.00 54.87  ? 688 ASP A OD2   1 
ATOM   4082  N  N     . ILE E 3 393 ? 46.877  40.588 -95.182  1.00 52.62  ? 689 ILE A N     1 
ATOM   4083  C  CA    . ILE E 3 393 ? 46.073  39.474 -94.695  1.00 53.18  ? 689 ILE A CA    1 
ATOM   4084  C  C     . ILE E 3 393 ? 46.941  38.602 -93.787  1.00 53.54  ? 689 ILE A C     1 
ATOM   4085  O  O     . ILE E 3 393 ? 46.482  37.602 -93.233  1.00 53.53  ? 689 ILE A O     1 
ATOM   4086  C  CB    . ILE E 3 393 ? 45.537  38.630 -95.878  1.00 53.22  ? 689 ILE A CB    1 
ATOM   4087  C  CG1   . ILE E 3 393 ? 44.712  39.521 -96.809  1.00 53.62  ? 689 ILE A CG1   1 
ATOM   4088  C  CG2   . ILE E 3 393 ? 44.676  37.487 -95.374  1.00 53.08  ? 689 ILE A CG2   1 
ATOM   4089  C  CD1   . ILE E 3 393 ? 43.565  40.231 -96.119  1.00 54.09  ? 689 ILE A CD1   1 
ATOM   4090  N  N     . PHE E 3 394 ? 48.200  39.003 -93.638  1.00 53.53  ? 690 PHE A N     1 
ATOM   4091  C  CA    . PHE E 3 394 ? 49.158  38.290 -92.806  1.00 53.58  ? 690 PHE A CA    1 
ATOM   4092  C  C     . PHE E 3 394 ? 50.124  39.290 -92.163  1.00 53.59  ? 690 PHE A C     1 
ATOM   4093  O  O     . PHE E 3 394 ? 50.998  38.912 -91.378  1.00 53.67  ? 690 PHE A O     1 
ATOM   4094  C  CB    . PHE E 3 394 ? 49.925  37.289 -93.662  1.00 53.65  ? 690 PHE A CB    1 
ATOM   4095  C  CG    . PHE E 3 394 ? 49.044  36.295 -94.357  1.00 54.11  ? 690 PHE A CG    1 
ATOM   4096  C  CD1   . PHE E 3 394 ? 48.437  35.269 -93.645  1.00 54.24  ? 690 PHE A CD1   1 
ATOM   4097  C  CD2   . PHE E 3 394 ? 48.816  36.388 -95.726  1.00 54.34  ? 690 PHE A CD2   1 
ATOM   4098  C  CE1   . PHE E 3 394 ? 47.614  34.343 -94.285  1.00 54.63  ? 690 PHE A CE1   1 
ATOM   4099  C  CE2   . PHE E 3 394 ? 47.995  35.468 -96.376  1.00 54.62  ? 690 PHE A CE2   1 
ATOM   4100  C  CZ    . PHE E 3 394 ? 47.393  34.443 -95.653  1.00 54.44  ? 690 PHE A CZ    1 
ATOM   4101  N  N     . GLN E 3 395 ? 49.957  40.564 -92.516  1.00 53.42  ? 691 GLN A N     1 
ATOM   4102  C  CA    . GLN E 3 395 ? 50.776  41.663 -91.996  1.00 53.53  ? 691 GLN A CA    1 
ATOM   4103  C  C     . GLN E 3 395 ? 52.275  41.501 -92.282  1.00 53.49  ? 691 GLN A C     1 
ATOM   4104  O  O     . GLN E 3 395 ? 53.062  42.417 -92.041  1.00 53.62  ? 691 GLN A O     1 
ATOM   4105  C  CB    . GLN E 3 395 ? 50.550  41.810 -90.488  1.00 53.62  ? 691 GLN A CB    1 
ATOM   4106  C  CG    . GLN E 3 395 ? 50.626  43.241 -89.959  1.00 53.66  ? 691 GLN A CG    1 
ATOM   4107  C  CD    . GLN E 3 395 ? 49.400  44.076 -90.314  1.00 54.26  ? 691 GLN A CD    1 
ATOM   4108  O  OE1   . GLN E 3 395 ? 49.277  44.587 -91.432  1.00 53.86  ? 691 GLN A OE1   1 
ATOM   4109  N  NE2   . GLN E 3 395 ? 48.479  44.206 -89.359  1.00 53.84  ? 691 GLN A NE2   1 
ATOM   4110  N  N     . VAL E 3 396 ? 52.658  40.341 -92.808  1.00 53.49  ? 692 VAL A N     1 
ATOM   4111  C  CA    . VAL E 3 396 ? 54.054  40.041 -93.125  1.00 53.04  ? 692 VAL A CA    1 
ATOM   4112  C  C     . VAL E 3 396 ? 54.627  40.955 -94.210  1.00 53.35  ? 692 VAL A C     1 
ATOM   4113  O  O     . VAL E 3 396 ? 53.897  41.729 -94.836  1.00 53.35  ? 692 VAL A O     1 
ATOM   4114  C  CB    . VAL E 3 396 ? 54.213  38.566 -93.582  1.00 52.79  ? 692 VAL A CB    1 
ATOM   4115  C  CG1   . VAL E 3 396 ? 53.759  37.623 -92.475  1.00 51.85  ? 692 VAL A CG1   1 
ATOM   4116  C  CG2   . VAL E 3 396 ? 53.399  38.320 -94.846  1.00 52.54  ? 692 VAL A CG2   1 
ATOM   4117  N  N     . SER E 3 397 ? 55.941  40.871 -94.421  1.00 53.47  ? 693 SER A N     1 
ATOM   4118  C  CA    . SER E 3 397 ? 56.607  41.681 -95.439  1.00 53.26  ? 693 SER A CA    1 
ATOM   4119  C  C     . SER E 3 397 ? 56.689  40.888 -96.744  1.00 53.54  ? 693 SER A C     1 
ATOM   4120  O  O     . SER E 3 397 ? 56.633  39.659 -96.730  1.00 53.46  ? 693 SER A O     1 
ATOM   4121  C  CB    . SER E 3 397 ? 58.013  42.079 -94.975  1.00 53.11  ? 693 SER A CB    1 
ATOM   4122  O  OG    . SER E 3 397 ? 58.817  40.944 -94.700  1.00 52.71  ? 693 SER A OG    1 
ATOM   4123  N  N     . GLU E 3 398 ? 56.825  41.591 -97.864  1.00 53.73  ? 694 GLU A N     1 
ATOM   4124  C  CA    . GLU E 3 398 ? 56.883  40.948 -99.174  1.00 54.15  ? 694 GLU A CA    1 
ATOM   4125  C  C     . GLU E 3 398 ? 57.684  39.653 -99.170  1.00 54.40  ? 694 GLU A C     1 
ATOM   4126  O  O     . GLU E 3 398 ? 57.258  38.639 -99.721  1.00 54.35  ? 694 GLU A O     1 
ATOM   4127  C  CB    . GLU E 3 398 ? 57.481  41.904 -100.213 1.00 54.26  ? 694 GLU A CB    1 
ATOM   4128  C  CG    . GLU E 3 398 ? 57.479  41.336 -101.631 1.00 54.38  ? 694 GLU A CG    1 
ATOM   4129  C  CD    . GLU E 3 398 ? 58.022  42.307 -102.667 1.00 54.92  ? 694 GLU A CD    1 
ATOM   4130  O  OE1   . GLU E 3 398 ? 58.059  41.934 -103.861 1.00 54.25  ? 694 GLU A OE1   1 
ATOM   4131  O  OE2   . GLU E 3 398 ? 58.409  43.439 -102.292 1.00 55.31  ? 694 GLU A OE2   1 
ATOM   4132  N  N     . ASP E 3 399 ? 58.843  39.696 -98.530  1.00 54.65  ? 695 ASP A N     1 
ATOM   4133  C  CA    . ASP E 3 399 ? 59.736  38.553 -98.462  1.00 54.83  ? 695 ASP A CA    1 
ATOM   4134  C  C     . ASP E 3 399 ? 59.185  37.416 -97.606  1.00 54.58  ? 695 ASP A C     1 
ATOM   4135  O  O     . ASP E 3 399 ? 59.735  36.318 -97.596  1.00 54.64  ? 695 ASP A O     1 
ATOM   4136  C  CB    . ASP E 3 399 ? 61.076  39.024 -97.912  1.00 55.46  ? 695 ASP A CB    1 
ATOM   4137  C  CG    . ASP E 3 399 ? 61.415  40.425 -98.369  1.00 56.00  ? 695 ASP A CG    1 
ATOM   4138  O  OD1   . ASP E 3 399 ? 61.665  40.610 -99.580  1.00 56.61  ? 695 ASP A OD1   1 
ATOM   4139  O  OD2   . ASP E 3 399 ? 61.414  41.344 -97.519  1.00 56.60  ? 695 ASP A OD2   1 
ATOM   4140  N  N     . GLU E 3 400 ? 58.096  37.679 -96.895  1.00 54.40  ? 696 GLU A N     1 
ATOM   4141  C  CA    . GLU E 3 400 ? 57.495  36.672 -96.031  1.00 54.13  ? 696 GLU A CA    1 
ATOM   4142  C  C     . GLU E 3 400 ? 56.152  36.144 -96.549  1.00 54.07  ? 696 GLU A C     1 
ATOM   4143  O  O     . GLU E 3 400 ? 55.371  35.562 -95.790  1.00 54.32  ? 696 GLU A O     1 
ATOM   4144  C  CB    . GLU E 3 400 ? 57.325  37.243 -94.612  1.00 54.64  ? 696 GLU A CB    1 
ATOM   4145  C  CG    . GLU E 3 400 ? 58.639  37.672 -93.942  1.00 54.58  ? 696 GLU A CG    1 
ATOM   4146  C  CD    . GLU E 3 400 ? 58.459  38.173 -92.506  1.00 55.11  ? 696 GLU A CD    1 
ATOM   4147  O  OE1   . GLU E 3 400 ? 59.476  38.510 -91.862  1.00 55.74  ? 696 GLU A OE1   1 
ATOM   4148  O  OE2   . GLU E 3 400 ? 57.311  38.237 -92.016  1.00 55.03  ? 696 GLU A OE2   1 
ATOM   4149  N  N     . VAL E 3 401 ? 55.885  36.339 -97.839  1.00 53.52  ? 697 VAL A N     1 
ATOM   4150  C  CA    . VAL E 3 401 ? 54.637  35.869 -98.441  1.00 53.06  ? 697 VAL A CA    1 
ATOM   4151  C  C     . VAL E 3 401 ? 54.839  34.522 -99.140  1.00 52.83  ? 697 VAL A C     1 
ATOM   4152  O  O     . VAL E 3 401 ? 55.685  34.392 -100.023 1.00 52.57  ? 697 VAL A O     1 
ATOM   4153  C  CB    . VAL E 3 401 ? 54.089  36.893 -99.465  1.00 52.59  ? 697 VAL A CB    1 
ATOM   4154  C  CG1   . VAL E 3 401 ? 52.888  36.313 -100.185 1.00 52.48  ? 697 VAL A CG1   1 
ATOM   4155  C  CG2   . VAL E 3 401 ? 53.705  38.186 -98.757  1.00 52.26  ? 697 VAL A CG2   1 
ATOM   4156  N  N     . THR E 3 402 ? 54.046  33.526 -98.751  1.00 52.72  ? 698 THR A N     1 
ATOM   4157  C  CA    . THR E 3 402 ? 54.161  32.188 -99.329  1.00 52.81  ? 698 THR A CA    1 
ATOM   4158  C  C     . THR E 3 402 ? 53.151  31.884 -100.438 1.00 52.85  ? 698 THR A C     1 
ATOM   4159  O  O     . THR E 3 402 ? 52.079  32.483 -100.497 1.00 53.10  ? 698 THR A O     1 
ATOM   4160  C  CB    . THR E 3 402 ? 54.010  31.111 -98.239  1.00 52.65  ? 698 THR A CB    1 
ATOM   4161  O  OG1   . THR E 3 402 ? 52.677  31.140 -97.712  1.00 52.26  ? 698 THR A OG1   1 
ATOM   4162  C  CG2   . THR E 3 402 ? 54.991  31.367 -97.113  1.00 53.08  ? 698 THR A CG2   1 
ATOM   4163  N  N     . PRO E 3 403 ? 53.488  30.936 -101.330 1.00 52.89  ? 699 PRO A N     1 
ATOM   4164  C  CA    . PRO E 3 403 ? 52.617  30.537 -102.441 1.00 53.11  ? 699 PRO A CA    1 
ATOM   4165  C  C     . PRO E 3 403 ? 51.214  30.242 -101.929 1.00 53.20  ? 699 PRO A C     1 
ATOM   4166  O  O     . PRO E 3 403 ? 50.217  30.640 -102.527 1.00 53.13  ? 699 PRO A O     1 
ATOM   4167  C  CB    . PRO E 3 403 ? 53.305  29.288 -102.978 1.00 53.04  ? 699 PRO A CB    1 
ATOM   4168  C  CG    . PRO E 3 403 ? 54.750  29.597 -102.751 1.00 52.83  ? 699 PRO A CG    1 
ATOM   4169  C  CD    . PRO E 3 403 ? 54.735  30.150 -101.345 1.00 53.06  ? 699 PRO A CD    1 
ATOM   4170  N  N     . ASN E 3 404 ? 51.159  29.541 -100.804 1.00 53.17  ? 700 ASN A N     1 
ATOM   4171  C  CA    . ASN E 3 404 ? 49.899  29.189 -100.175 1.00 52.82  ? 700 ASN A CA    1 
ATOM   4172  C  C     . ASN E 3 404 ? 49.200  30.493 -99.791  1.00 52.09  ? 700 ASN A C     1 
ATOM   4173  O  O     . ASN E 3 404 ? 47.998  30.662 -100.014 1.00 52.24  ? 700 ASN A O     1 
ATOM   4174  C  CB    . ASN E 3 404 ? 50.181  28.343 -98.930  1.00 53.86  ? 700 ASN A CB    1 
ATOM   4175  C  CG    . ASN E 3 404 ? 48.947  27.658 -98.388  1.00 54.58  ? 700 ASN A CG    1 
ATOM   4176  O  OD1   . ASN E 3 404 ? 48.308  26.861 -99.077  1.00 55.68  ? 700 ASN A OD1   1 
ATOM   4177  N  ND2   . ASN E 3 404 ? 48.610  27.954 -97.139  1.00 55.19  ? 700 ASN A ND2   1 
ATOM   4178  N  N     . MET E 3 405 ? 49.971  31.420 -99.228  1.00 50.72  ? 701 MET A N     1 
ATOM   4179  C  CA    . MET E 3 405 ? 49.442  32.707 -98.792  1.00 49.34  ? 701 MET A CA    1 
ATOM   4180  C  C     . MET E 3 405 ? 48.911  33.558 -99.939  1.00 48.04  ? 701 MET A C     1 
ATOM   4181  O  O     . MET E 3 405 ? 47.765  33.998 -99.908  1.00 47.05  ? 701 MET A O     1 
ATOM   4182  C  CB    . MET E 3 405 ? 50.520  33.479 -98.021  1.00 49.95  ? 701 MET A CB    1 
ATOM   4183  C  CG    . MET E 3 405 ? 50.764  32.953 -96.609  1.00 50.99  ? 701 MET A CG    1 
ATOM   4184  S  SD    . MET E 3 405 ? 52.320  33.504 -95.856  1.00 52.32  ? 701 MET A SD    1 
ATOM   4185  C  CE    . MET E 3 405 ? 51.917  35.146 -95.362  1.00 51.91  ? 701 MET A CE    1 
ATOM   4186  N  N     . ARG E 3 406 ? 49.743  33.782 -100.951 1.00 46.96  ? 702 ARG A N     1 
ATOM   4187  C  CA    . ARG E 3 406 ? 49.338  34.590 -102.095 1.00 45.85  ? 702 ARG A CA    1 
ATOM   4188  C  C     . ARG E 3 406 ? 48.005  34.120 -102.674 1.00 45.48  ? 702 ARG A C     1 
ATOM   4189  O  O     . ARG E 3 406 ? 47.301  34.896 -103.311 1.00 45.48  ? 702 ARG A O     1 
ATOM   4190  C  CB    . ARG E 3 406 ? 50.426  34.573 -103.176 1.00 44.69  ? 702 ARG A CB    1 
ATOM   4191  C  CG    . ARG E 3 406 ? 50.132  35.493 -104.361 1.00 43.35  ? 702 ARG A CG    1 
ATOM   4192  C  CD    . ARG E 3 406 ? 51.370  35.692 -105.229 1.00 41.80  ? 702 ARG A CD    1 
ATOM   4193  N  NE    . ARG E 3 406 ? 51.105  36.531 -106.396 1.00 39.45  ? 702 ARG A NE    1 
ATOM   4194  C  CZ    . ARG E 3 406 ? 50.452  36.121 -107.480 1.00 38.79  ? 702 ARG A CZ    1 
ATOM   4195  N  NH1   . ARG E 3 406 ? 49.995  34.876 -107.553 1.00 38.03  ? 702 ARG A NH1   1 
ATOM   4196  N  NH2   . ARG E 3 406 ? 50.270  36.949 -108.497 1.00 37.45  ? 702 ARG A NH2   1 
ATOM   4197  N  N     . ARG E 3 407 ? 47.652  32.859 -102.441 1.00 45.44  ? 703 ARG A N     1 
ATOM   4198  C  CA    . ARG E 3 407 ? 46.389  32.322 -102.942 1.00 45.64  ? 703 ARG A CA    1 
ATOM   4199  C  C     . ARG E 3 407 ? 45.194  32.996 -102.263 1.00 45.04  ? 703 ARG A C     1 
ATOM   4200  O  O     . ARG E 3 407 ? 44.334  33.564 -102.938 1.00 45.15  ? 703 ARG A O     1 
ATOM   4201  C  CB    . ARG E 3 407 ? 46.309  30.814 -102.710 1.00 46.61  ? 703 ARG A CB    1 
ATOM   4202  C  CG    . ARG E 3 407 ? 47.426  30.020 -103.351 1.00 48.97  ? 703 ARG A CG    1 
ATOM   4203  C  CD    . ARG E 3 407 ? 47.341  28.534 -103.005 1.00 50.74  ? 703 ARG A CD    1 
ATOM   4204  N  NE    . ARG E 3 407 ? 46.433  27.783 -103.876 1.00 52.59  ? 703 ARG A NE    1 
ATOM   4205  C  CZ    . ARG E 3 407 ? 45.103  27.870 -103.856 1.00 53.70  ? 703 ARG A CZ    1 
ATOM   4206  N  NH1   . ARG E 3 407 ? 44.491  28.683 -103.003 1.00 54.20  ? 703 ARG A NH1   1 
ATOM   4207  N  NH2   . ARG E 3 407 ? 44.380  27.141 -104.699 1.00 53.76  ? 703 ARG A NH2   1 
ATOM   4208  N  N     . GLN E 3 408 ? 45.143  32.936 -100.932 1.00 43.97  ? 704 GLN A N     1 
ATOM   4209  C  CA    . GLN E 3 408 ? 44.043  33.543 -100.188 1.00 43.04  ? 704 GLN A CA    1 
ATOM   4210  C  C     . GLN E 3 408 ? 43.937  35.039 -100.443 1.00 42.36  ? 704 GLN A C     1 
ATOM   4211  O  O     . GLN E 3 408 ? 42.834  35.577 -100.564 1.00 41.68  ? 704 GLN A O     1 
ATOM   4212  C  CB    . GLN E 3 408 ? 44.187  33.290 -98.680  1.00 43.40  ? 704 GLN A CB    1 
ATOM   4213  C  CG    . GLN E 3 408 ? 43.802  31.878 -98.245  1.00 43.72  ? 704 GLN A CG    1 
ATOM   4214  C  CD    . GLN E 3 408 ? 44.876  30.856 -98.554  1.00 44.00  ? 704 GLN A CD    1 
ATOM   4215  O  OE1   . GLN E 3 408 ? 45.869  30.744 -97.832  1.00 43.91  ? 704 GLN A OE1   1 
ATOM   4216  N  NE2   . GLN E 3 408 ? 44.688  30.108 -99.634  1.00 44.79  ? 704 GLN A NE2   1 
ATOM   4217  N  N     . ALA E 3 409 ? 45.082  35.711 -100.521 1.00 41.11  ? 705 ALA A N     1 
ATOM   4218  C  CA    . ALA E 3 409 ? 45.085  37.145 -100.770 1.00 40.38  ? 705 ALA A CA    1 
ATOM   4219  C  C     . ALA E 3 409 ? 44.514  37.363 -102.162 1.00 40.13  ? 705 ALA A C     1 
ATOM   4220  O  O     . ALA E 3 409 ? 43.858  38.372 -102.431 1.00 40.20  ? 705 ALA A O     1 
ATOM   4221  C  CB    . ALA E 3 409 ? 46.499  37.693 -100.687 1.00 39.75  ? 705 ALA A CB    1 
ATOM   4222  N  N     . LYS E 3 410 ? 44.774  36.405 -103.046 1.00 39.28  ? 706 LYS A N     1 
ATOM   4223  C  CA    . LYS E 3 410 ? 44.280  36.477 -104.412 1.00 38.78  ? 706 LYS A CA    1 
ATOM   4224  C  C     . LYS E 3 410 ? 42.763  36.357 -104.370 1.00 38.48  ? 706 LYS A C     1 
ATOM   4225  O  O     . LYS E 3 410 ? 42.055  37.164 -104.977 1.00 38.69  ? 706 LYS A O     1 
ATOM   4226  C  CB    . LYS E 3 410 ? 44.873  35.346 -105.255 1.00 38.24  ? 706 LYS A CB    1 
ATOM   4227  C  CG    . LYS E 3 410 ? 44.264  35.197 -106.639 1.00 37.31  ? 706 LYS A CG    1 
ATOM   4228  C  CD    . LYS E 3 410 ? 44.796  33.957 -107.363 1.00 35.96  ? 706 LYS A CD    1 
ATOM   4229  C  CE    . LYS E 3 410 ? 46.279  34.087 -107.679 1.00 35.69  ? 706 LYS A CE    1 
ATOM   4230  N  NZ    . LYS E 3 410 ? 46.727  33.132 -108.732 1.00 34.27  ? 706 LYS A NZ    1 
ATOM   4231  N  N     . ALA E 3 411 ? 42.276  35.351 -103.647 1.00 37.39  ? 707 ALA A N     1 
ATOM   4232  C  CA    . ALA E 3 411 ? 40.839  35.115 -103.514 1.00 36.62  ? 707 ALA A CA    1 
ATOM   4233  C  C     . ALA E 3 411 ? 40.158  36.278 -102.792 1.00 35.69  ? 707 ALA A C     1 
ATOM   4234  O  O     . ALA E 3 411 ? 38.990  36.584 -103.040 1.00 36.08  ? 707 ALA A O     1 
ATOM   4235  C  CB    . ALA E 3 411 ? 40.594  33.807 -102.770 1.00 36.86  ? 707 ALA A CB    1 
ATOM   4236  N  N     . VAL E 3 412 ? 40.897  36.927 -101.901 1.00 35.03  ? 708 VAL A N     1 
ATOM   4237  C  CA    . VAL E 3 412 ? 40.385  38.068 -101.152 1.00 33.65  ? 708 VAL A CA    1 
ATOM   4238  C  C     . VAL E 3 412 ? 40.247  39.244 -102.112 1.00 32.71  ? 708 VAL A C     1 
ATOM   4239  O  O     . VAL E 3 412 ? 39.228  39.923 -102.129 1.00 33.11  ? 708 VAL A O     1 
ATOM   4240  C  CB    . VAL E 3 412 ? 41.341  38.415 -99.977  1.00 33.48  ? 708 VAL A CB    1 
ATOM   4241  C  CG1   . VAL E 3 412 ? 41.143  39.864 -99.517  1.00 32.78  ? 708 VAL A CG1   1 
ATOM   4242  C  CG2   . VAL E 3 412 ? 41.096  37.443 -98.817  1.00 33.12  ? 708 VAL A CG2   1 
ATOM   4243  N  N     . ASN E 3 413 ? 41.276  39.455 -102.926 1.00 32.23  ? 709 ASN A N     1 
ATOM   4244  C  CA    . ASN E 3 413 ? 41.307  40.531 -103.919 1.00 30.31  ? 709 ASN A CA    1 
ATOM   4245  C  C     . ASN E 3 413 ? 40.118  40.460 -104.877 1.00 29.14  ? 709 ASN A C     1 
ATOM   4246  O  O     . ASN E 3 413 ? 39.489  41.476 -105.191 1.00 29.09  ? 709 ASN A O     1 
ATOM   4247  C  CB    . ASN E 3 413 ? 42.612  40.458 -104.739 1.00 30.68  ? 709 ASN A CB    1 
ATOM   4248  C  CG    . ASN E 3 413 ? 43.733  41.306 -104.148 1.00 30.55  ? 709 ASN A CG    1 
ATOM   4249  O  OD1   . ASN E 3 413 ? 43.503  42.430 -103.704 1.00 28.84  ? 709 ASN A OD1   1 
ATOM   4250  N  ND2   . ASN E 3 413 ? 44.959  40.776 -104.165 1.00 30.82  ? 709 ASN A ND2   1 
ATOM   4251  N  N     . PHE E 3 414 ? 39.816  39.264 -105.359 1.00 27.05  ? 710 PHE A N     1 
ATOM   4252  C  CA    . PHE E 3 414 ? 38.704  39.129 -106.276 1.00 26.63  ? 710 PHE A CA    1 
ATOM   4253  C  C     . PHE E 3 414 ? 37.405  39.100 -105.487 1.00 26.58  ? 710 PHE A C     1 
ATOM   4254  O  O     . PHE E 3 414 ? 36.413  39.670 -105.919 1.00 24.87  ? 710 PHE A O     1 
ATOM   4255  C  CB    . PHE E 3 414 ? 38.890  37.906 -107.161 1.00 24.47  ? 710 PHE A CB    1 
ATOM   4256  C  CG    . PHE E 3 414 ? 40.027  38.065 -108.151 1.00 25.35  ? 710 PHE A CG    1 
ATOM   4257  C  CD1   . PHE E 3 414 ? 40.031  39.134 -109.046 1.00 22.90  ? 710 PHE A CD1   1 
ATOM   4258  C  CD2   . PHE E 3 414 ? 41.118  37.206 -108.131 1.00 23.29  ? 710 PHE A CD2   1 
ATOM   4259  C  CE1   . PHE E 3 414 ? 41.106  39.353 -109.897 1.00 24.46  ? 710 PHE A CE1   1 
ATOM   4260  C  CE2   . PHE E 3 414 ? 42.211  37.417 -108.986 1.00 22.81  ? 710 PHE A CE2   1 
ATOM   4261  C  CZ    . PHE E 3 414 ? 42.202  38.491 -109.864 1.00 24.02  ? 710 PHE A CZ    1 
ATOM   4262  N  N     . GLY E 3 415 ? 37.437  38.482 -104.311 1.00 27.45  ? 711 GLY A N     1 
ATOM   4263  C  CA    . GLY E 3 415 ? 36.253  38.472 -103.478 1.00 29.25  ? 711 GLY A CA    1 
ATOM   4264  C  C     . GLY E 3 415 ? 35.842  39.920 -103.257 1.00 29.66  ? 711 GLY A C     1 
ATOM   4265  O  O     . GLY E 3 415 ? 34.675  40.274 -103.417 1.00 30.67  ? 711 GLY A O     1 
ATOM   4266  N  N     . ILE E 3 416 ? 36.807  40.772 -102.914 1.00 30.35  ? 712 ILE A N     1 
ATOM   4267  C  CA    . ILE E 3 416 ? 36.523  42.185 -102.671 1.00 30.14  ? 712 ILE A CA    1 
ATOM   4268  C  C     . ILE E 3 416 ? 36.008  42.980 -103.886 1.00 30.04  ? 712 ILE A C     1 
ATOM   4269  O  O     . ILE E 3 416 ? 34.970  43.624 -103.799 1.00 29.41  ? 712 ILE A O     1 
ATOM   4270  C  CB    . ILE E 3 416 ? 37.764  42.919 -102.084 1.00 30.58  ? 712 ILE A CB    1 
ATOM   4271  C  CG1   . ILE E 3 416 ? 38.084  42.385 -100.681 1.00 29.38  ? 712 ILE A CG1   1 
ATOM   4272  C  CG2   . ILE E 3 416 ? 37.498  44.433 -102.017 1.00 29.47  ? 712 ILE A CG2   1 
ATOM   4273  C  CD1   . ILE E 3 416 ? 39.139  43.210 -99.951  1.00 29.41  ? 712 ILE A CD1   1 
ATOM   4274  N  N     . VAL E 3 417 ? 36.709  42.945 -105.021 1.00 29.78  ? 713 VAL A N     1 
ATOM   4275  C  CA    . VAL E 3 417 ? 36.239  43.717 -106.177 1.00 29.32  ? 713 VAL A CA    1 
ATOM   4276  C  C     . VAL E 3 417 ? 34.962  43.190 -106.815 1.00 28.82  ? 713 VAL A C     1 
ATOM   4277  O  O     . VAL E 3 417 ? 34.239  43.946 -107.473 1.00 27.84  ? 713 VAL A O     1 
ATOM   4278  C  CB    . VAL E 3 417 ? 37.329  43.848 -107.301 1.00 29.63  ? 713 VAL A CB    1 
ATOM   4279  C  CG1   . VAL E 3 417 ? 38.402  44.813 -106.867 1.00 29.76  ? 713 VAL A CG1   1 
ATOM   4280  C  CG2   . VAL E 3 417 ? 37.930  42.500 -107.621 1.00 29.13  ? 713 VAL A CG2   1 
ATOM   4281  N  N     . TYR E 3 418 ? 34.668  41.908 -106.613 1.00 28.52  ? 714 TYR A N     1 
ATOM   4282  C  CA    . TYR E 3 418 ? 33.467  41.336 -107.210 1.00 29.15  ? 714 TYR A CA    1 
ATOM   4283  C  C     . TYR E 3 418 ? 32.243  41.169 -106.300 1.00 30.13  ? 714 TYR A C     1 
ATOM   4284  O  O     . TYR E 3 418 ? 31.445  40.246 -106.500 1.00 30.64  ? 714 TYR A O     1 
ATOM   4285  C  CB    . TYR E 3 418 ? 33.802  39.996 -107.869 1.00 28.34  ? 714 TYR A CB    1 
ATOM   4286  C  CG    . TYR E 3 418 ? 34.795  40.119 -109.019 1.00 27.28  ? 714 TYR A CG    1 
ATOM   4287  C  CD1   . TYR E 3 418 ? 34.768  41.225 -109.869 1.00 26.75  ? 714 TYR A CD1   1 
ATOM   4288  C  CD2   . TYR E 3 418 ? 35.732  39.114 -109.274 1.00 26.65  ? 714 TYR A CD2   1 
ATOM   4289  C  CE1   . TYR E 3 418 ? 35.644  41.334 -110.947 1.00 25.44  ? 714 TYR A CE1   1 
ATOM   4290  C  CE2   . TYR E 3 418 ? 36.615  39.212 -110.360 1.00 26.64  ? 714 TYR A CE2   1 
ATOM   4291  C  CZ    . TYR E 3 418 ? 36.558  40.327 -111.186 1.00 26.35  ? 714 TYR A CZ    1 
ATOM   4292  O  OH    . TYR E 3 418 ? 37.410  40.434 -112.265 1.00 27.11  ? 714 TYR A OH    1 
ATOM   4293  N  N     . GLY E 3 419 ? 32.086  42.032 -105.261 1.00 30.73  ? 715 GLY A N     1 
ATOM   4294  C  CA    . GLY E 3 419 ? 30.900  41.968 -104.401 1.00 31.60  ? 715 GLY A CA    1 
ATOM   4295  C  C     . GLY E 3 419 ? 31.051  41.592 -102.897 1.00 32.15  ? 715 GLY A C     1 
ATOM   4296  O  O     . GLY E 3 419 ? 30.448  42.215 -102.037 1.00 31.91  ? 715 GLY A O     1 
ATOM   4297  N  N     . ILE E 3 420 ? 31.854  40.578 -102.609 1.00 32.22  ? 716 ILE A N     1 
ATOM   4298  C  CA    . ILE E 3 420 ? 32.042  40.072 -101.201 1.00 32.95  ? 716 ILE A CA    1 
ATOM   4299  C  C     . ILE E 3 420 ? 31.459  40.969 -100.108 1.00 32.62  ? 716 ILE A C     1 
ATOM   4300  O  O     . ILE E 3 420 ? 31.544  42.194 -100.197 1.00 33.95  ? 716 ILE A O     1 
ATOM   4301  C  CB    . ILE E 3 420 ? 33.534  39.822 -100.927 1.00 33.18  ? 716 ILE A CB    1 
ATOM   4302  C  CG1   . ILE E 3 420 ? 33.716  38.774 -99.833  1.00 34.11  ? 716 ILE A CG1   1 
ATOM   4303  C  CG2   . ILE E 3 420 ? 34.226  41.124 -100.545 1.00 32.80  ? 716 ILE A CG2   1 
ATOM   4304  C  CD1   . ILE E 3 420 ? 33.534  37.339 -100.295 1.00 34.29  ? 716 ILE A CD1   1 
ATOM   4305  N  N     . SER E 3 421 ? 30.857  40.396 -99.090  1.00 32.73  ? 717 SER A N     1 
ATOM   4306  C  CA    . SER E 3 421 ? 30.362  41.186 -97.993  1.00 33.22  ? 717 SER A CA    1 
ATOM   4307  C  C     . SER E 3 421 ? 31.323  40.914 -96.827  1.00 33.34  ? 717 SER A C     1 
ATOM   4308  O  O     . SER E 3 421 ? 32.009  39.889 -96.802  1.00 33.15  ? 717 SER A O     1 
ATOM   4309  C  CB    . SER E 3 421 ? 28.963  40.756 -97.560  1.00 32.57  ? 717 SER A CB    1 
ATOM   4310  O  OG    . SER E 3 421 ? 28.967  39.450 -97.008  1.00 30.59  ? 717 SER A OG    1 
ATOM   4311  N  N     . ASP E 3 422 ? 31.356  41.819 -95.853  1.00 34.41  ? 718 ASP A N     1 
ATOM   4312  C  CA    . ASP E 3 422 ? 32.221  41.646 -94.693  1.00 35.18  ? 718 ASP A CA    1 
ATOM   4313  C  C     . ASP E 3 422 ? 32.060  40.256 -94.078  1.00 36.22  ? 718 ASP A C     1 
ATOM   4314  O  O     . ASP E 3 422 ? 33.017  39.695 -93.548  1.00 36.87  ? 718 ASP A O     1 
ATOM   4315  C  CB    . ASP E 3 422 ? 31.927  42.725 -93.656  1.00 34.61  ? 718 ASP A CB    1 
ATOM   4316  C  CG    . ASP E 3 422 ? 30.453  42.819 -93.316  1.00 34.90  ? 718 ASP A CG    1 
ATOM   4317  O  OD1   . ASP E 3 422 ? 29.689  41.916 -93.732  1.00 34.13  ? 718 ASP A OD1   1 
ATOM   4318  O  OD2   . ASP E 3 422 ? 30.066  43.786 -92.628  1.00 33.13  ? 718 ASP A OD2   1 
ATOM   4319  N  N     . TYR E 3 423 ? 30.857  39.694 -94.150  1.00 37.05  ? 719 TYR A N     1 
ATOM   4320  C  CA    . TYR E 3 423 ? 30.612  38.359 -93.605  1.00 38.03  ? 719 TYR A CA    1 
ATOM   4321  C  C     . TYR E 3 423 ? 31.290  37.298 -94.460  1.00 38.65  ? 719 TYR A C     1 
ATOM   4322  O  O     . TYR E 3 423 ? 31.914  36.368 -93.939  1.00 38.90  ? 719 TYR A O     1 
ATOM   4323  C  CB    . TYR E 3 423 ? 29.113  38.068 -93.545  1.00 38.09  ? 719 TYR A CB    1 
ATOM   4324  C  CG    . TYR E 3 423 ? 28.419  38.701 -92.368  1.00 38.19  ? 719 TYR A CG    1 
ATOM   4325  C  CD1   . TYR E 3 423 ? 28.668  38.257 -91.067  1.00 38.37  ? 719 TYR A CD1   1 
ATOM   4326  C  CD2   . TYR E 3 423 ? 27.511  39.741 -92.549  1.00 37.58  ? 719 TYR A CD2   1 
ATOM   4327  C  CE1   . TYR E 3 423 ? 28.029  38.832 -89.975  1.00 38.02  ? 719 TYR A CE1   1 
ATOM   4328  C  CE2   . TYR E 3 423 ? 26.867  40.319 -91.469  1.00 37.37  ? 719 TYR A CE2   1 
ATOM   4329  C  CZ    . TYR E 3 423 ? 27.126  39.864 -90.185  1.00 37.88  ? 719 TYR A CZ    1 
ATOM   4330  O  OH    . TYR E 3 423 ? 26.474  40.434 -89.113  1.00 36.67  ? 719 TYR A OH    1 
ATOM   4331  N  N     . GLY E 3 424 ? 31.148  37.439 -95.775  1.00 39.07  ? 720 GLY A N     1 
ATOM   4332  C  CA    . GLY E 3 424 ? 31.756  36.501 -96.692  1.00 39.70  ? 720 GLY A CA    1 
ATOM   4333  C  C     . GLY E 3 424 ? 33.255  36.512 -96.499  1.00 40.58  ? 720 GLY A C     1 
ATOM   4334  O  O     . GLY E 3 424 ? 33.879  35.453 -96.380  1.00 40.46  ? 720 GLY A O     1 
ATOM   4335  N  N     . LEU E 3 425 ? 33.832  37.711 -96.460  1.00 40.82  ? 721 LEU A N     1 
ATOM   4336  C  CA    . LEU E 3 425 ? 35.270  37.867 -96.269  1.00 42.18  ? 721 LEU A CA    1 
ATOM   4337  C  C     . LEU E 3 425 ? 35.639  37.291 -94.894  1.00 43.24  ? 721 LEU A C     1 
ATOM   4338  O  O     . LEU E 3 425 ? 36.526  36.441 -94.778  1.00 42.94  ? 721 LEU A O     1 
ATOM   4339  C  CB    . LEU E 3 425 ? 35.638  39.358 -96.358  1.00 41.99  ? 721 LEU A CB    1 
ATOM   4340  C  CG    . LEU E 3 425 ? 37.097  39.831 -96.289  1.00 41.98  ? 721 LEU A CG    1 
ATOM   4341  C  CD1   . LEU E 3 425 ? 37.914  39.189 -97.399  1.00 42.02  ? 721 LEU A CD1   1 
ATOM   4342  C  CD2   . LEU E 3 425 ? 37.149  41.354 -96.406  1.00 41.51  ? 721 LEU A CD2   1 
ATOM   4343  N  N     . ALA E 3 426 ? 34.923  37.736 -93.863  1.00 44.54  ? 722 ALA A N     1 
ATOM   4344  C  CA    . ALA E 3 426 ? 35.151  37.288 -92.487  1.00 45.84  ? 722 ALA A CA    1 
ATOM   4345  C  C     . ALA E 3 426 ? 35.301  35.776 -92.360  1.00 46.74  ? 722 ALA A C     1 
ATOM   4346  O  O     . ALA E 3 426 ? 36.191  35.294 -91.657  1.00 46.89  ? 722 ALA A O     1 
ATOM   4347  C  CB    . ALA E 3 426 ? 34.018  37.776 -91.583  1.00 45.50  ? 722 ALA A CB    1 
ATOM   4348  N  N     . GLN E 3 427 ? 34.436  35.023 -93.031  1.00 48.04  ? 723 GLN A N     1 
ATOM   4349  C  CA    . GLN E 3 427 ? 34.518  33.568 -92.963  1.00 49.40  ? 723 GLN A CA    1 
ATOM   4350  C  C     . GLN E 3 427 ? 35.699  33.026 -93.753  1.00 50.05  ? 723 GLN A C     1 
ATOM   4351  O  O     . GLN E 3 427 ? 36.288  32.014 -93.376  1.00 50.15  ? 723 GLN A O     1 
ATOM   4352  C  CB    . GLN E 3 427 ? 33.225  32.925 -93.477  1.00 50.30  ? 723 GLN A CB    1 
ATOM   4353  C  CG    . GLN E 3 427 ? 33.347  31.424 -93.727  1.00 51.47  ? 723 GLN A CG    1 
ATOM   4354  C  CD    . GLN E 3 427 ? 32.006  30.743 -93.949  1.00 52.34  ? 723 GLN A CD    1 
ATOM   4355  O  OE1   . GLN E 3 427 ? 31.954  29.607 -94.422  1.00 53.07  ? 723 GLN A OE1   1 
ATOM   4356  N  NE2   . GLN E 3 427 ? 30.916  31.427 -93.597  1.00 52.46  ? 723 GLN A NE2   1 
ATOM   4357  N  N     . ASN E 3 428 ? 36.034  33.697 -94.852  1.00 50.91  ? 724 ASN A N     1 
ATOM   4358  C  CA    . ASN E 3 428 ? 37.151  33.289 -95.700  1.00 51.77  ? 724 ASN A CA    1 
ATOM   4359  C  C     . ASN E 3 428 ? 38.449  33.281 -94.889  1.00 52.02  ? 724 ASN A C     1 
ATOM   4360  O  O     . ASN E 3 428 ? 38.907  32.224 -94.461  1.00 52.25  ? 724 ASN A O     1 
ATOM   4361  C  CB    . ASN E 3 428 ? 37.268  34.245 -96.894  1.00 52.56  ? 724 ASN A CB    1 
ATOM   4362  C  CG    . ASN E 3 428 ? 38.329  33.814 -97.896  1.00 53.12  ? 724 ASN A CG    1 
ATOM   4363  O  OD1   . ASN E 3 428 ? 38.289  32.701 -98.423  1.00 53.60  ? 724 ASN A OD1   1 
ATOM   4364  N  ND2   . ASN E 3 428 ? 39.279  34.702 -98.171  1.00 53.61  ? 724 ASN A ND2   1 
ATOM   4365  N  N     . LEU E 3 429 ? 39.031  34.457 -94.665  1.00 52.64  ? 725 LEU A N     1 
ATOM   4366  C  CA    . LEU E 3 429 ? 40.276  34.572 -93.899  1.00 52.89  ? 725 LEU A CA    1 
ATOM   4367  C  C     . LEU E 3 429 ? 40.068  34.380 -92.396  1.00 52.89  ? 725 LEU A C     1 
ATOM   4368  O  O     . LEU E 3 429 ? 40.926  34.735 -91.583  1.00 52.91  ? 725 LEU A O     1 
ATOM   4369  C  CB    . LEU E 3 429 ? 40.948  35.928 -94.168  1.00 53.23  ? 725 LEU A CB    1 
ATOM   4370  C  CG    . LEU E 3 429 ? 40.057  37.102 -94.585  1.00 53.38  ? 725 LEU A CG    1 
ATOM   4371  C  CD1   . LEU E 3 429 ? 38.937  37.260 -93.585  1.00 53.62  ? 725 LEU A CD1   1 
ATOM   4372  C  CD2   . LEU E 3 429 ? 40.881  38.382 -94.688  1.00 53.07  ? 725 LEU A CD2   1 
ATOM   4373  N  N     . ASN E 3 430 ? 38.921  33.805 -92.044  1.00 52.58  ? 726 ASN A N     1 
ATOM   4374  C  CA    . ASN E 3 430 ? 38.560  33.529 -90.660  1.00 51.95  ? 726 ASN A CA    1 
ATOM   4375  C  C     . ASN E 3 430 ? 38.850  34.664 -89.680  1.00 51.12  ? 726 ASN A C     1 
ATOM   4376  O  O     . ASN E 3 430 ? 39.687  34.528 -88.789  1.00 50.84  ? 726 ASN A O     1 
ATOM   4377  C  CB    . ASN E 3 430 ? 39.265  32.258 -90.184  1.00 52.77  ? 726 ASN A CB    1 
ATOM   4378  C  CG    . ASN E 3 430 ? 38.905  31.897 -88.762  1.00 53.38  ? 726 ASN A CG    1 
ATOM   4379  O  OD1   . ASN E 3 430 ? 37.751  31.578 -88.460  1.00 54.03  ? 726 ASN A OD1   1 
ATOM   4380  N  ND2   . ASN E 3 430 ? 39.890  31.954 -87.871  1.00 53.78  ? 726 ASN A ND2   1 
ATOM   4381  N  N     . ILE E 3 431 ? 38.155  35.784 -89.844  1.00 50.08  ? 727 ILE A N     1 
ATOM   4382  C  CA    . ILE E 3 431 ? 38.338  36.918 -88.948  1.00 49.24  ? 727 ILE A CA    1 
ATOM   4383  C  C     . ILE E 3 431 ? 36.972  37.437 -88.517  1.00 48.77  ? 727 ILE A C     1 
ATOM   4384  O  O     . ILE E 3 431 ? 35.949  36.816 -88.807  1.00 48.50  ? 727 ILE A O     1 
ATOM   4385  C  CB    . ILE E 3 431 ? 39.140  38.051 -89.628  1.00 48.97  ? 727 ILE A CB    1 
ATOM   4386  C  CG1   . ILE E 3 431 ? 38.337  38.649 -90.782  1.00 48.49  ? 727 ILE A CG1   1 
ATOM   4387  C  CG2   . ILE E 3 431 ? 40.464  37.499 -90.138  1.00 49.10  ? 727 ILE A CG2   1 
ATOM   4388  C  CD1   . ILE E 3 431 ? 39.032  39.793 -91.488  1.00 48.37  ? 727 ILE A CD1   1 
ATOM   4389  N  N     . SER E 3 432 ? 36.949  38.568 -87.820  1.00 48.41  ? 728 SER A N     1 
ATOM   4390  C  CA    . SER E 3 432 ? 35.684  39.127 -87.357  1.00 47.96  ? 728 SER A CA    1 
ATOM   4391  C  C     . SER E 3 432 ? 35.030  39.910 -88.483  1.00 47.50  ? 728 SER A C     1 
ATOM   4392  O  O     . SER E 3 432 ? 35.664  40.178 -89.503  1.00 47.18  ? 728 SER A O     1 
ATOM   4393  C  CB    . SER E 3 432 ? 35.915  40.046 -86.153  1.00 47.77  ? 728 SER A CB    1 
ATOM   4394  O  OG    . SER E 3 432 ? 36.560  41.251 -86.533  1.00 47.51  ? 728 SER A OG    1 
ATOM   4395  N  N     . ARG E 3 433 ? 33.763  40.271 -88.301  1.00 46.75  ? 729 ARG A N     1 
ATOM   4396  C  CA    . ARG E 3 433 ? 33.052  41.039 -89.315  1.00 46.18  ? 729 ARG A CA    1 
ATOM   4397  C  C     . ARG E 3 433 ? 33.471  42.500 -89.277  1.00 45.65  ? 729 ARG A C     1 
ATOM   4398  O  O     . ARG E 3 433 ? 33.476  43.175 -90.303  1.00 45.94  ? 729 ARG A O     1 
ATOM   4399  C  CB    . ARG E 3 433 ? 31.535  40.973 -89.108  1.00 46.00  ? 729 ARG A CB    1 
ATOM   4400  C  CG    . ARG E 3 433 ? 30.772  41.723 -90.196  1.00 46.18  ? 729 ARG A CG    1 
ATOM   4401  C  CD    . ARG E 3 433 ? 29.427  42.245 -89.720  1.00 45.44  ? 729 ARG A CD    1 
ATOM   4402  N  NE    . ARG E 3 433 ? 29.573  43.217 -88.642  1.00 46.10  ? 729 ARG A NE    1 
ATOM   4403  C  CZ    . ARG E 3 433 ? 30.286  44.335 -88.730  1.00 45.88  ? 729 ARG A CZ    1 
ATOM   4404  N  NH1   . ARG E 3 433 ? 30.928  44.635 -89.851  1.00 46.48  ? 729 ARG A NH1   1 
ATOM   4405  N  NH2   . ARG E 3 433 ? 30.363  45.155 -87.692  1.00 46.04  ? 729 ARG A NH2   1 
ATOM   4406  N  N     . LYS E 3 434 ? 33.808  42.989 -88.090  1.00 45.08  ? 730 LYS A N     1 
ATOM   4407  C  CA    . LYS E 3 434 ? 34.219  44.383 -87.928  1.00 44.62  ? 730 LYS A CA    1 
ATOM   4408  C  C     . LYS E 3 434 ? 35.588  44.628 -88.553  1.00 44.63  ? 730 LYS A C     1 
ATOM   4409  O  O     . LYS E 3 434 ? 35.849  45.699 -89.093  1.00 44.47  ? 730 LYS A O     1 
ATOM   4410  C  CB    . LYS E 3 434 ? 34.256  44.752 -86.442  1.00 44.17  ? 730 LYS A CB    1 
ATOM   4411  C  CG    . LYS E 3 434 ? 34.802  46.139 -86.162  1.00 43.62  ? 730 LYS A CG    1 
ATOM   4412  C  CD    . LYS E 3 434 ? 34.628  46.510 -84.697  1.00 44.46  ? 730 LYS A CD    1 
ATOM   4413  C  CE    . LYS E 3 434 ? 35.286  47.853 -84.376  1.00 44.97  ? 730 LYS A CE    1 
ATOM   4414  N  NZ    . LYS E 3 434 ? 36.777  47.789 -84.470  1.00 44.54  ? 730 LYS A NZ    1 
ATOM   4415  N  N     . GLU E 3 435 ? 36.465  43.633 -88.458  1.00 44.50  ? 731 GLU A N     1 
ATOM   4416  C  CA    . GLU E 3 435 ? 37.800  43.737 -89.030  1.00 45.02  ? 731 GLU A CA    1 
ATOM   4417  C  C     . GLU E 3 435 ? 37.669  43.701 -90.555  1.00 44.87  ? 731 GLU A C     1 
ATOM   4418  O  O     . GLU E 3 435 ? 38.104  44.620 -91.253  1.00 44.49  ? 731 GLU A O     1 
ATOM   4419  C  CB    . GLU E 3 435 ? 38.674  42.578 -88.530  1.00 45.73  ? 731 GLU A CB    1 
ATOM   4420  C  CG    . GLU E 3 435 ? 39.072  42.699 -87.054  1.00 47.42  ? 731 GLU A CG    1 
ATOM   4421  C  CD    . GLU E 3 435 ? 39.836  41.486 -86.537  1.00 48.51  ? 731 GLU A CD    1 
ATOM   4422  O  OE1   . GLU E 3 435 ? 39.192  40.524 -86.058  1.00 48.27  ? 731 GLU A OE1   1 
ATOM   4423  O  OE2   . GLU E 3 435 ? 41.087  41.492 -86.620  1.00 49.63  ? 731 GLU A OE2   1 
ATOM   4424  N  N     . ALA E 3 436 ? 37.048  42.638 -91.061  1.00 44.38  ? 732 ALA A N     1 
ATOM   4425  C  CA    . ALA E 3 436 ? 36.835  42.486 -92.494  1.00 43.63  ? 732 ALA A CA    1 
ATOM   4426  C  C     . ALA E 3 436 ? 36.220  43.763 -93.073  1.00 43.20  ? 732 ALA A C     1 
ATOM   4427  O  O     . ALA E 3 436 ? 36.670  44.273 -94.101  1.00 42.99  ? 732 ALA A O     1 
ATOM   4428  C  CB    . ALA E 3 436 ? 35.919  41.293 -92.755  1.00 43.31  ? 732 ALA A CB    1 
ATOM   4429  N  N     . ALA E 3 437 ? 35.200  44.279 -92.395  1.00 42.32  ? 733 ALA A N     1 
ATOM   4430  C  CA    . ALA E 3 437 ? 34.507  45.487 -92.831  1.00 42.61  ? 733 ALA A CA    1 
ATOM   4431  C  C     . ALA E 3 437 ? 35.439  46.683 -93.007  1.00 42.68  ? 733 ALA A C     1 
ATOM   4432  O  O     . ALA E 3 437 ? 35.344  47.412 -93.991  1.00 42.74  ? 733 ALA A O     1 
ATOM   4433  C  CB    . ALA E 3 437 ? 33.394  45.836 -91.839  1.00 42.66  ? 733 ALA A CB    1 
ATOM   4434  N  N     . GLU E 3 438 ? 36.334  46.896 -92.050  1.00 42.61  ? 734 GLU A N     1 
ATOM   4435  C  CA    . GLU E 3 438 ? 37.263  48.016 -92.139  1.00 42.41  ? 734 GLU A CA    1 
ATOM   4436  C  C     . GLU E 3 438 ? 38.354  47.768 -93.192  1.00 42.51  ? 734 GLU A C     1 
ATOM   4437  O  O     . GLU E 3 438 ? 38.828  48.707 -93.828  1.00 42.55  ? 734 GLU A O     1 
ATOM   4438  C  CB    . GLU E 3 438 ? 37.887  48.286 -90.765  1.00 41.65  ? 734 GLU A CB    1 
ATOM   4439  C  CG    . GLU E 3 438 ? 36.918  48.951 -89.779  1.00 41.56  ? 734 GLU A CG    1 
ATOM   4440  C  CD    . GLU E 3 438 ? 37.473  49.055 -88.362  1.00 40.93  ? 734 GLU A CD    1 
ATOM   4441  O  OE1   . GLU E 3 438 ? 38.682  49.338 -88.208  1.00 40.72  ? 734 GLU A OE1   1 
ATOM   4442  O  OE2   . GLU E 3 438 ? 36.690  48.868 -87.406  1.00 39.95  ? 734 GLU A OE2   1 
ATOM   4443  N  N     . PHE E 3 439 ? 38.735  46.505 -93.381  1.00 42.70  ? 735 PHE A N     1 
ATOM   4444  C  CA    . PHE E 3 439 ? 39.766  46.141 -94.363  1.00 42.82  ? 735 PHE A CA    1 
ATOM   4445  C  C     . PHE E 3 439 ? 39.294  46.408 -95.790  1.00 42.26  ? 735 PHE A C     1 
ATOM   4446  O  O     . PHE E 3 439 ? 40.105  46.597 -96.697  1.00 41.76  ? 735 PHE A O     1 
ATOM   4447  C  CB    . PHE E 3 439 ? 40.133  44.661 -94.221  1.00 43.39  ? 735 PHE A CB    1 
ATOM   4448  C  CG    . PHE E 3 439 ? 41.123  44.177 -95.247  1.00 44.69  ? 735 PHE A CG    1 
ATOM   4449  C  CD1   . PHE E 3 439 ? 42.483  44.432 -95.102  1.00 44.89  ? 735 PHE A CD1   1 
ATOM   4450  C  CD2   . PHE E 3 439 ? 40.692  43.451 -96.357  1.00 45.02  ? 735 PHE A CD2   1 
ATOM   4451  C  CE1   . PHE E 3 439 ? 43.405  43.967 -96.044  1.00 45.32  ? 735 PHE A CE1   1 
ATOM   4452  C  CE2   . PHE E 3 439 ? 41.601  42.982 -97.306  1.00 45.20  ? 735 PHE A CE2   1 
ATOM   4453  C  CZ    . PHE E 3 439 ? 42.963  43.240 -97.149  1.00 45.77  ? 735 PHE A CZ    1 
ATOM   4454  N  N     . ILE E 3 440 ? 37.976  46.413 -95.975  1.00 41.82  ? 736 ILE A N     1 
ATOM   4455  C  CA    . ILE E 3 440 ? 37.359  46.665 -97.274  1.00 41.03  ? 736 ILE A CA    1 
ATOM   4456  C  C     . ILE E 3 440 ? 37.245  48.170 -97.499  1.00 41.12  ? 736 ILE A C     1 
ATOM   4457  O  O     . ILE E 3 440 ? 37.308  48.644 -98.631  1.00 41.36  ? 736 ILE A O     1 
ATOM   4458  C  CB    . ILE E 3 440 ? 35.944  46.012 -97.356  1.00 40.16  ? 736 ILE A CB    1 
ATOM   4459  C  CG1   . ILE E 3 440 ? 36.085  44.505 -97.562  1.00 39.09  ? 736 ILE A CG1   1 
ATOM   4460  C  CG2   . ILE E 3 440 ? 35.124  46.636 -98.479  1.00 39.79  ? 736 ILE A CG2   1 
ATOM   4461  C  CD1   . ILE E 3 440 ? 34.779  43.752 -97.565  1.00 38.05  ? 736 ILE A CD1   1 
ATOM   4462  N  N     . GLU E 3 441 ? 37.075  48.925 -96.418  1.00 41.77  ? 737 GLU A N     1 
ATOM   4463  C  CA    . GLU E 3 441 ? 36.970  50.375 -96.543  1.00 41.72  ? 737 GLU A CA    1 
ATOM   4464  C  C     . GLU E 3 441 ? 38.324  50.911 -96.989  1.00 41.34  ? 737 GLU A C     1 
ATOM   4465  O  O     . GLU E 3 441 ? 38.404  51.756 -97.871  1.00 41.67  ? 737 GLU A O     1 
ATOM   4466  C  CB    . GLU E 3 441 ? 36.584  51.027 -95.207  1.00 42.83  ? 737 GLU A CB    1 
ATOM   4467  C  CG    . GLU E 3 441 ? 36.462  52.553 -95.306  1.00 43.93  ? 737 GLU A CG    1 
ATOM   4468  C  CD    . GLU E 3 441 ? 36.449  53.257 -93.953  1.00 45.56  ? 737 GLU A CD    1 
ATOM   4469  O  OE1   . GLU E 3 441 ? 36.340  54.509 -93.931  1.00 46.45  ? 737 GLU A OE1   1 
ATOM   4470  O  OE2   . GLU E 3 441 ? 36.550  52.570 -92.914  1.00 45.66  ? 737 GLU A OE2   1 
ATOM   4471  N  N     . ARG E 3 442 ? 39.387  50.405 -96.375  1.00 41.13  ? 738 ARG A N     1 
ATOM   4472  C  CA    . ARG E 3 442 ? 40.740  50.838 -96.703  1.00 41.14  ? 738 ARG A CA    1 
ATOM   4473  C  C     . ARG E 3 442 ? 41.124  50.379 -98.109  1.00 40.20  ? 738 ARG A C     1 
ATOM   4474  O  O     . ARG E 3 442 ? 41.919  51.027 -98.791  1.00 39.48  ? 738 ARG A O     1 
ATOM   4475  C  CB    . ARG E 3 442 ? 41.728  50.270 -95.679  1.00 42.07  ? 738 ARG A CB    1 
ATOM   4476  C  CG    . ARG E 3 442 ? 41.322  50.554 -94.246  1.00 43.69  ? 738 ARG A CG    1 
ATOM   4477  C  CD    . ARG E 3 442 ? 42.110  49.719 -93.264  1.00 44.55  ? 738 ARG A CD    1 
ATOM   4478  N  NE    . ARG E 3 442 ? 41.502  49.754 -91.936  1.00 45.61  ? 738 ARG A NE    1 
ATOM   4479  C  CZ    . ARG E 3 442 ? 41.922  49.027 -90.908  1.00 46.21  ? 738 ARG A CZ    1 
ATOM   4480  N  NH1   . ARG E 3 442 ? 42.953  48.205 -91.057  1.00 45.87  ? 738 ARG A NH1   1 
ATOM   4481  N  NH2   . ARG E 3 442 ? 41.317  49.123 -89.731  1.00 46.87  ? 738 ARG A NH2   1 
ATOM   4482  N  N     . TYR E 3 443 ? 40.562  49.255 -98.536  1.00 39.49  ? 739 TYR A N     1 
ATOM   4483  C  CA    . TYR E 3 443 ? 40.851  48.742 -99.868  1.00 39.25  ? 739 TYR A CA    1 
ATOM   4484  C  C     . TYR E 3 443 ? 40.390  49.801 -100.864 1.00 39.22  ? 739 TYR A C     1 
ATOM   4485  O  O     . TYR E 3 443 ? 41.149  50.219 -101.743 1.00 39.35  ? 739 TYR A O     1 
ATOM   4486  C  CB    . TYR E 3 443 ? 40.097  47.439 -100.112 1.00 38.67  ? 739 TYR A CB    1 
ATOM   4487  C  CG    . TYR E 3 443 ? 40.604  46.670 -101.302 1.00 38.61  ? 739 TYR A CG    1 
ATOM   4488  C  CD1   . TYR E 3 443 ? 41.613  45.716 -101.158 1.00 38.42  ? 739 TYR A CD1   1 
ATOM   4489  C  CD2   . TYR E 3 443 ? 40.083  46.897 -102.579 1.00 38.80  ? 739 TYR A CD2   1 
ATOM   4490  C  CE1   . TYR E 3 443 ? 42.088  44.999 -102.252 1.00 38.11  ? 739 TYR A CE1   1 
ATOM   4491  C  CE2   . TYR E 3 443 ? 40.556  46.186 -103.688 1.00 38.53  ? 739 TYR A CE2   1 
ATOM   4492  C  CZ    . TYR E 3 443 ? 41.555  45.236 -103.513 1.00 38.59  ? 739 TYR A CZ    1 
ATOM   4493  O  OH    . TYR E 3 443 ? 42.000  44.503 -104.587 1.00 37.70  ? 739 TYR A OH    1 
ATOM   4494  N  N     . PHE E 3 444 ? 39.144  50.244 -100.713 1.00 38.57  ? 740 PHE A N     1 
ATOM   4495  C  CA    . PHE E 3 444 ? 38.580  51.267 -101.595 1.00 38.37  ? 740 PHE A CA    1 
ATOM   4496  C  C     . PHE E 3 444 ? 39.116  52.644 -101.273 1.00 38.35  ? 740 PHE A C     1 
ATOM   4497  O  O     . PHE E 3 444 ? 38.719  53.652 -101.871 1.00 38.48  ? 740 PHE A O     1 
ATOM   4498  C  CB    . PHE E 3 444 ? 37.053  51.228 -101.532 1.00 38.49  ? 740 PHE A CB    1 
ATOM   4499  C  CG    . PHE E 3 444 ? 36.480  50.007 -102.185 1.00 39.31  ? 740 PHE A CG    1 
ATOM   4500  C  CD1   . PHE E 3 444 ? 36.625  49.814 -103.557 1.00 39.19  ? 740 PHE A CD1   1 
ATOM   4501  C  CD2   . PHE E 3 444 ? 35.864  49.017 -101.433 1.00 39.60  ? 740 PHE A CD2   1 
ATOM   4502  C  CE1   . PHE E 3 444 ? 36.170  48.652 -104.163 1.00 39.57  ? 740 PHE A CE1   1 
ATOM   4503  C  CE2   . PHE E 3 444 ? 35.405  47.849 -102.033 1.00 40.19  ? 740 PHE A CE2   1 
ATOM   4504  C  CZ    . PHE E 3 444 ? 35.560  47.668 -103.398 1.00 39.47  ? 740 PHE A CZ    1 
ATOM   4505  N  N     . GLU E 3 445 ? 40.012  52.682 -100.296 1.00 38.07  ? 741 GLU A N     1 
ATOM   4506  C  CA    . GLU E 3 445 ? 40.679  53.914 -99.947  1.00 38.45  ? 741 GLU A CA    1 
ATOM   4507  C  C     . GLU E 3 445 ? 41.892  53.866 -100.878 1.00 37.43  ? 741 GLU A C     1 
ATOM   4508  O  O     . GLU E 3 445 ? 42.342  54.883 -101.398 1.00 37.01  ? 741 GLU A O     1 
ATOM   4509  C  CB    . GLU E 3 445 ? 41.100  53.901 -98.473  1.00 39.73  ? 741 GLU A CB    1 
ATOM   4510  C  CG    . GLU E 3 445 ? 39.925  54.079 -97.514  1.00 42.41  ? 741 GLU A CG    1 
ATOM   4511  C  CD    . GLU E 3 445 ? 40.323  54.044 -96.047  1.00 43.58  ? 741 GLU A CD    1 
ATOM   4512  O  OE1   . GLU E 3 445 ? 39.479  54.419 -95.202  1.00 44.17  ? 741 GLU A OE1   1 
ATOM   4513  O  OE2   . GLU E 3 445 ? 41.467  53.639 -95.736  1.00 44.87  ? 741 GLU A OE2   1 
ATOM   4514  N  N     . SER E 3 446 ? 42.395  52.657 -101.114 1.00 36.51  ? 742 SER A N     1 
ATOM   4515  C  CA    . SER E 3 446 ? 43.547  52.480 -101.998 1.00 35.87  ? 742 SER A CA    1 
ATOM   4516  C  C     . SER E 3 446 ? 43.103  52.638 -103.454 1.00 34.86  ? 742 SER A C     1 
ATOM   4517  O  O     . SER E 3 446 ? 43.818  53.224 -104.272 1.00 34.44  ? 742 SER A O     1 
ATOM   4518  C  CB    . SER E 3 446 ? 44.168  51.086 -101.814 1.00 35.29  ? 742 SER A CB    1 
ATOM   4519  O  OG    . SER E 3 446 ? 44.644  50.894 -100.491 1.00 36.33  ? 742 SER A OG    1 
ATOM   4520  N  N     . PHE E 3 447 ? 41.910  52.129 -103.763 1.00 33.94  ? 743 PHE A N     1 
ATOM   4521  C  CA    . PHE E 3 447 ? 41.382  52.186 -105.123 1.00 33.24  ? 743 PHE A CA    1 
ATOM   4522  C  C     . PHE E 3 447 ? 39.998  52.830 -105.240 1.00 33.09  ? 743 PHE A C     1 
ATOM   4523  O  O     . PHE E 3 447 ? 38.994  52.142 -105.453 1.00 32.44  ? 743 PHE A O     1 
ATOM   4524  C  CB    . PHE E 3 447 ? 41.352  50.769 -105.700 1.00 32.42  ? 743 PHE A CB    1 
ATOM   4525  C  CG    . PHE E 3 447 ? 42.649  50.025 -105.524 1.00 32.26  ? 743 PHE A CG    1 
ATOM   4526  C  CD1   . PHE E 3 447 ? 43.845  50.554 -106.021 1.00 31.43  ? 743 PHE A CD1   1 
ATOM   4527  C  CD2   . PHE E 3 447 ? 42.684  48.811 -104.850 1.00 31.25  ? 743 PHE A CD2   1 
ATOM   4528  C  CE1   . PHE E 3 447 ? 45.053  49.878 -105.844 1.00 31.19  ? 743 PHE A CE1   1 
ATOM   4529  C  CE2   . PHE E 3 447 ? 43.889  48.129 -104.670 1.00 31.61  ? 743 PHE A CE2   1 
ATOM   4530  C  CZ    . PHE E 3 447 ? 45.075  48.669 -105.169 1.00 30.47  ? 743 PHE A CZ    1 
ATOM   4531  N  N     . PRO E 3 448 ? 39.934  54.164 -105.126 1.00 33.02  ? 744 PRO A N     1 
ATOM   4532  C  CA    . PRO E 3 448 ? 38.670  54.905 -105.218 1.00 33.41  ? 744 PRO A CA    1 
ATOM   4533  C  C     . PRO E 3 448 ? 38.055  54.871 -106.617 1.00 33.56  ? 744 PRO A C     1 
ATOM   4534  O  O     . PRO E 3 448 ? 36.844  54.723 -106.764 1.00 34.09  ? 744 PRO A O     1 
ATOM   4535  C  CB    . PRO E 3 448 ? 39.067  56.319 -104.786 1.00 33.30  ? 744 PRO A CB    1 
ATOM   4536  C  CG    . PRO E 3 448 ? 40.474  56.435 -105.297 1.00 32.54  ? 744 PRO A CG    1 
ATOM   4537  C  CD    . PRO E 3 448 ? 41.069  55.085 -104.917 1.00 32.89  ? 744 PRO A CD    1 
ATOM   4538  N  N     . GLY E 3 449 ? 38.894  55.013 -107.637 1.00 32.96  ? 745 GLY A N     1 
ATOM   4539  C  CA    . GLY E 3 449 ? 38.419  54.985 -109.004 1.00 32.73  ? 745 GLY A CA    1 
ATOM   4540  C  C     . GLY E 3 449 ? 37.723  53.675 -109.300 1.00 33.47  ? 745 GLY A C     1 
ATOM   4541  O  O     . GLY E 3 449 ? 36.882  53.596 -110.206 1.00 33.65  ? 745 GLY A O     1 
ATOM   4542  N  N     . VAL E 3 450 ? 38.072  52.640 -108.540 1.00 33.34  ? 746 VAL A N     1 
ATOM   4543  C  CA    . VAL E 3 450 ? 37.455  51.339 -108.725 1.00 34.07  ? 746 VAL A CA    1 
ATOM   4544  C  C     . VAL E 3 450 ? 36.076  51.311 -108.050 1.00 34.91  ? 746 VAL A C     1 
ATOM   4545  O  O     . VAL E 3 450 ? 35.156  50.648 -108.540 1.00 35.44  ? 746 VAL A O     1 
ATOM   4546  C  CB    . VAL E 3 450 ? 38.357  50.215 -108.174 1.00 33.42  ? 746 VAL A CB    1 
ATOM   4547  C  CG1   . VAL E 3 450 ? 37.589  48.908 -108.089 1.00 32.74  ? 746 VAL A CG1   1 
ATOM   4548  C  CG2   . VAL E 3 450 ? 39.572  50.036 -109.104 1.00 33.18  ? 746 VAL A CG2   1 
ATOM   4549  N  N     . LYS E 3 451 ? 35.934  52.032 -106.936 1.00 35.51  ? 747 LYS A N     1 
ATOM   4550  C  CA    . LYS E 3 451 ? 34.654  52.088 -106.227 1.00 36.49  ? 747 LYS A CA    1 
ATOM   4551  C  C     . LYS E 3 451 ? 33.661  52.676 -107.197 1.00 36.42  ? 747 LYS A C     1 
ATOM   4552  O  O     . LYS E 3 451 ? 32.557  52.166 -107.367 1.00 36.79  ? 747 LYS A O     1 
ATOM   4553  C  CB    . LYS E 3 451 ? 34.730  53.000 -104.999 1.00 36.96  ? 747 LYS A CB    1 
ATOM   4554  C  CG    . LYS E 3 451 ? 33.372  53.251 -104.326 1.00 37.47  ? 747 LYS A CG    1 
ATOM   4555  C  CD    . LYS E 3 451 ? 33.482  54.292 -103.212 1.00 38.74  ? 747 LYS A CD    1 
ATOM   4556  C  CE    . LYS E 3 451 ? 32.126  54.579 -102.562 1.00 39.24  ? 747 LYS A CE    1 
ATOM   4557  N  NZ    . LYS E 3 451 ? 32.255  55.551 -101.431 1.00 40.12  ? 747 LYS A NZ    1 
ATOM   4558  N  N     . ARG E 3 452 ? 34.075  53.764 -107.829 1.00 36.62  ? 748 ARG A N     1 
ATOM   4559  C  CA    . ARG E 3 452 ? 33.249  54.452 -108.805 1.00 36.90  ? 748 ARG A CA    1 
ATOM   4560  C  C     . ARG E 3 452 ? 32.810  53.490 -109.916 1.00 36.37  ? 748 ARG A C     1 
ATOM   4561  O  O     . ARG E 3 452 ? 31.728  53.651 -110.474 1.00 35.50  ? 748 ARG A O     1 
ATOM   4562  C  CB    . ARG E 3 452 ? 34.032  55.627 -109.387 1.00 38.43  ? 748 ARG A CB    1 
ATOM   4563  C  CG    . ARG E 3 452 ? 34.638  56.523 -108.321 1.00 40.52  ? 748 ARG A CG    1 
ATOM   4564  C  CD    . ARG E 3 452 ? 36.000  57.079 -108.748 1.00 42.01  ? 748 ARG A CD    1 
ATOM   4565  N  NE    . ARG E 3 452 ? 36.685  57.754 -107.644 1.00 43.36  ? 748 ARG A NE    1 
ATOM   4566  C  CZ    . ARG E 3 452 ? 37.943  58.182 -107.688 1.00 43.59  ? 748 ARG A CZ    1 
ATOM   4567  N  NH1   . ARG E 3 452 ? 38.671  58.010 -108.784 1.00 44.08  ? 748 ARG A NH1   1 
ATOM   4568  N  NH2   . ARG E 3 452 ? 38.477  58.778 -106.631 1.00 44.09  ? 748 ARG A NH2   1 
ATOM   4569  N  N     . TYR E 3 453 ? 33.637  52.485 -110.221 1.00 35.68  ? 749 TYR A N     1 
ATOM   4570  C  CA    . TYR E 3 453 ? 33.306  51.500 -111.264 1.00 34.95  ? 749 TYR A CA    1 
ATOM   4571  C  C     . TYR E 3 453 ? 32.213  50.519 -110.829 1.00 35.20  ? 749 TYR A C     1 
ATOM   4572  O  O     . TYR E 3 453 ? 31.353  50.154 -111.622 1.00 35.00  ? 749 TYR A O     1 
ATOM   4573  C  CB    . TYR E 3 453 ? 34.541  50.675 -111.675 1.00 33.05  ? 749 TYR A CB    1 
ATOM   4574  C  CG    . TYR E 3 453 ? 34.187  49.392 -112.423 1.00 30.99  ? 749 TYR A CG    1 
ATOM   4575  C  CD1   . TYR E 3 453 ? 33.809  49.419 -113.761 1.00 29.80  ? 749 TYR A CD1   1 
ATOM   4576  C  CD2   . TYR E 3 453 ? 34.176  48.160 -111.769 1.00 30.95  ? 749 TYR A CD2   1 
ATOM   4577  C  CE1   . TYR E 3 453 ? 33.428  48.249 -114.432 1.00 29.31  ? 749 TYR A CE1   1 
ATOM   4578  C  CE2   . TYR E 3 453 ? 33.788  46.978 -112.434 1.00 29.96  ? 749 TYR A CE2   1 
ATOM   4579  C  CZ    . TYR E 3 453 ? 33.415  47.035 -113.764 1.00 29.50  ? 749 TYR A CZ    1 
ATOM   4580  O  OH    . TYR E 3 453 ? 33.003  45.883 -114.425 1.00 29.39  ? 749 TYR A OH    1 
ATOM   4581  N  N     . MET E 3 454 ? 32.292  50.050 -109.587 1.00 36.09  ? 750 MET A N     1 
ATOM   4582  C  CA    . MET E 3 454 ? 31.307  49.108 -109.069 1.00 36.76  ? 750 MET A CA    1 
ATOM   4583  C  C     . MET E 3 454 ? 29.938  49.781 -109.034 1.00 36.88  ? 750 MET A C     1 
ATOM   4584  O  O     . MET E 3 454 ? 28.901  49.120 -109.138 1.00 37.37  ? 750 MET A O     1 
ATOM   4585  C  CB    . MET E 3 454 ? 31.701  48.640 -107.663 1.00 37.05  ? 750 MET A CB    1 
ATOM   4586  C  CG    . MET E 3 454 ? 32.896  47.689 -107.637 1.00 38.93  ? 750 MET A CG    1 
ATOM   4587  S  SD    . MET E 3 454 ? 33.463  47.275 -105.975 1.00 39.79  ? 750 MET A SD    1 
ATOM   4588  C  CE    . MET E 3 454 ? 32.671  45.697 -105.674 1.00 40.41  ? 750 MET A CE    1 
ATOM   4589  N  N     . GLU E 3 455 ? 29.953  51.104 -108.916 1.00 36.17  ? 751 GLU A N     1 
ATOM   4590  C  CA    . GLU E 3 455 ? 28.734  51.891 -108.847 1.00 35.75  ? 751 GLU A CA    1 
ATOM   4591  C  C     . GLU E 3 455 ? 28.120  52.318 -110.181 1.00 35.64  ? 751 GLU A C     1 
ATOM   4592  O  O     . GLU E 3 455 ? 26.891  52.358 -110.308 1.00 34.99  ? 751 GLU A O     1 
ATOM   4593  C  CB    . GLU E 3 455 ? 28.984  53.098 -107.937 1.00 36.00  ? 751 GLU A CB    1 
ATOM   4594  C  CG    . GLU E 3 455 ? 29.237  52.660 -106.494 1.00 34.99  ? 751 GLU A CG    1 
ATOM   4595  C  CD    . GLU E 3 455 ? 29.750  53.763 -105.596 1.00 35.56  ? 751 GLU A CD    1 
ATOM   4596  O  OE1   . GLU E 3 455 ? 29.980  53.481 -104.399 1.00 36.14  ? 751 GLU A OE1   1 
ATOM   4597  O  OE2   . GLU E 3 455 ? 29.921  54.903 -106.074 1.00 35.97  ? 751 GLU A OE2   1 
ATOM   4598  N  N     . ASN E 3 456 ? 28.948  52.611 -111.184 1.00 34.62  ? 752 ASN A N     1 
ATOM   4599  C  CA    . ASN E 3 456 ? 28.415  53.019 -112.482 1.00 34.00  ? 752 ASN A CA    1 
ATOM   4600  C  C     . ASN E 3 456 ? 28.045  51.842 -113.381 1.00 33.25  ? 752 ASN A C     1 
ATOM   4601  O  O     . ASN E 3 456 ? 27.154  51.960 -114.224 1.00 32.24  ? 752 ASN A O     1 
ATOM   4602  C  CB    . ASN E 3 456 ? 29.408  53.901 -113.233 1.00 34.51  ? 752 ASN A CB    1 
ATOM   4603  C  CG    . ASN E 3 456 ? 30.152  54.826 -112.321 1.00 35.52  ? 752 ASN A CG    1 
ATOM   4604  O  OD1   . ASN E 3 456 ? 29.589  55.344 -111.355 1.00 36.20  ? 752 ASN A OD1   1 
ATOM   4605  N  ND2   . ASN E 3 456 ? 31.432  55.047 -112.614 1.00 35.46  ? 752 ASN A ND2   1 
ATOM   4606  N  N     . ILE E 3 457 ? 28.736  50.716 -113.220 1.00 32.23  ? 753 ILE A N     1 
ATOM   4607  C  CA    . ILE E 3 457 ? 28.443  49.564 -114.054 1.00 31.71  ? 753 ILE A CA    1 
ATOM   4608  C  C     . ILE E 3 457 ? 27.114  48.961 -113.636 1.00 31.64  ? 753 ILE A C     1 
ATOM   4609  O  O     . ILE E 3 457 ? 26.499  48.218 -114.396 1.00 31.80  ? 753 ILE A O     1 
ATOM   4610  C  CB    . ILE E 3 457 ? 29.527  48.467 -113.964 1.00 30.28  ? 753 ILE A CB    1 
ATOM   4611  C  CG1   . ILE E 3 457 ? 29.351  47.485 -115.122 1.00 29.44  ? 753 ILE A CG1   1 
ATOM   4612  C  CG2   . ILE E 3 457 ? 29.420  47.727 -112.661 1.00 29.18  ? 753 ILE A CG2   1 
ATOM   4613  C  CD1   . ILE E 3 457 ? 29.673  48.088 -116.474 1.00 29.19  ? 753 ILE A CD1   1 
ATOM   4614  N  N     . VAL E 3 458 ? 26.702  49.254 -112.410 1.00 32.13  ? 754 VAL A N     1 
ATOM   4615  C  CA    . VAL E 3 458 ? 25.428  48.773 -111.880 1.00 32.84  ? 754 VAL A CA    1 
ATOM   4616  C  C     . VAL E 3 458 ? 24.332  49.638 -112.498 1.00 33.58  ? 754 VAL A C     1 
ATOM   4617  O  O     . VAL E 3 458 ? 23.249  49.157 -112.831 1.00 33.59  ? 754 VAL A O     1 
ATOM   4618  C  CB    . VAL E 3 458 ? 25.394  48.890 -110.335 1.00 32.38  ? 754 VAL A CB    1 
ATOM   4619  C  CG1   . VAL E 3 458 ? 23.966  48.866 -109.826 1.00 33.19  ? 754 VAL A CG1   1 
ATOM   4620  C  CG2   . VAL E 3 458 ? 26.172  47.749 -109.721 1.00 31.55  ? 754 VAL A CG2   1 
ATOM   4621  N  N     . GLN E 3 459 ? 24.632  50.923 -112.651 1.00 34.69  ? 755 GLN A N     1 
ATOM   4622  C  CA    . GLN E 3 459 ? 23.707  51.861 -113.258 1.00 36.22  ? 755 GLN A CA    1 
ATOM   4623  C  C     . GLN E 3 459 ? 23.648  51.571 -114.750 1.00 36.92  ? 755 GLN A C     1 
ATOM   4624  O  O     . GLN E 3 459 ? 22.578  51.574 -115.356 1.00 36.59  ? 755 GLN A O     1 
ATOM   4625  C  CB    . GLN E 3 459 ? 24.186  53.293 -113.013 1.00 37.44  ? 755 GLN A CB    1 
ATOM   4626  C  CG    . GLN E 3 459 ? 24.003  53.740 -111.587 1.00 39.22  ? 755 GLN A CG    1 
ATOM   4627  C  CD    . GLN E 3 459 ? 22.552  53.625 -111.163 1.00 40.56  ? 755 GLN A CD    1 
ATOM   4628  O  OE1   . GLN E 3 459 ? 21.663  54.174 -111.817 1.00 41.65  ? 755 GLN A OE1   1 
ATOM   4629  N  NE2   . GLN E 3 459 ? 22.301  52.905 -110.072 1.00 41.47  ? 755 GLN A NE2   1 
ATOM   4630  N  N     . GLU E 3 460 ? 24.815  51.313 -115.338 1.00 38.08  ? 756 GLU A N     1 
ATOM   4631  C  CA    . GLU E 3 460 ? 24.910  50.998 -116.761 1.00 38.96  ? 756 GLU A CA    1 
ATOM   4632  C  C     . GLU E 3 460 ? 23.975  49.842 -117.115 1.00 38.82  ? 756 GLU A C     1 
ATOM   4633  O  O     . GLU E 3 460 ? 23.174  49.947 -118.044 1.00 39.07  ? 756 GLU A O     1 
ATOM   4634  C  CB    . GLU E 3 460 ? 26.352  50.623 -117.126 1.00 40.02  ? 756 GLU A CB    1 
ATOM   4635  C  CG    . GLU E 3 460 ? 26.982  51.521 -118.172 1.00 41.56  ? 756 GLU A CG    1 
ATOM   4636  C  CD    . GLU E 3 460 ? 26.258  51.470 -119.502 1.00 42.72  ? 756 GLU A CD    1 
ATOM   4637  O  OE1   . GLU E 3 460 ? 26.330  50.424 -120.190 1.00 42.81  ? 756 GLU A OE1   1 
ATOM   4638  O  OE2   . GLU E 3 460 ? 25.611  52.483 -119.858 1.00 43.53  ? 756 GLU A OE2   1 
ATOM   4639  N  N     . ALA E 3 461 ? 24.077  48.744 -116.372 1.00 38.40  ? 757 ALA A N     1 
ATOM   4640  C  CA    . ALA E 3 461 ? 23.231  47.579 -116.613 1.00 38.80  ? 757 ALA A CA    1 
ATOM   4641  C  C     . ALA E 3 461 ? 21.762  47.944 -116.412 1.00 39.78  ? 757 ALA A C     1 
ATOM   4642  O  O     . ALA E 3 461 ? 20.889  47.530 -117.179 1.00 39.76  ? 757 ALA A O     1 
ATOM   4643  C  CB    . ALA E 3 461 ? 23.613  46.463 -115.671 1.00 37.74  ? 757 ALA A CB    1 
ATOM   4644  N  N     . LYS E 3 462 ? 21.504  48.722 -115.368 1.00 40.47  ? 758 LYS A N     1 
ATOM   4645  C  CA    . LYS E 3 462 ? 20.156  49.168 -115.027 1.00 41.21  ? 758 LYS A CA    1 
ATOM   4646  C  C     . LYS E 3 462 ? 19.508  49.985 -116.148 1.00 40.92  ? 758 LYS A C     1 
ATOM   4647  O  O     . LYS E 3 462 ? 18.292  49.924 -116.352 1.00 41.21  ? 758 LYS A O     1 
ATOM   4648  C  CB    . LYS E 3 462 ? 20.218  49.995 -113.737 1.00 42.20  ? 758 LYS A CB    1 
ATOM   4649  C  CG    . LYS E 3 462 ? 19.048  50.946 -113.494 1.00 44.24  ? 758 LYS A CG    1 
ATOM   4650  C  CD    . LYS E 3 462 ? 19.349  51.826 -112.278 1.00 45.19  ? 758 LYS A CD    1 
ATOM   4651  C  CE    . LYS E 3 462 ? 18.371  52.975 -112.125 1.00 45.99  ? 758 LYS A CE    1 
ATOM   4652  N  NZ    . LYS E 3 462 ? 18.827  53.918 -111.061 1.00 47.11  ? 758 LYS A NZ    1 
ATOM   4653  N  N     . GLN E 3 463 ? 20.318  50.750 -116.872 1.00 39.62  ? 759 GLN A N     1 
ATOM   4654  C  CA    . GLN E 3 463 ? 19.793  51.572 -117.949 1.00 38.99  ? 759 GLN A CA    1 
ATOM   4655  C  C     . GLN E 3 463 ? 19.705  50.816 -119.286 1.00 37.66  ? 759 GLN A C     1 
ATOM   4656  O  O     . GLN E 3 463 ? 18.643  50.770 -119.907 1.00 36.57  ? 759 GLN A O     1 
ATOM   4657  C  CB    . GLN E 3 463 ? 20.649  52.832 -118.104 1.00 39.73  ? 759 GLN A CB    1 
ATOM   4658  C  CG    . GLN E 3 463 ? 20.185  53.740 -119.227 1.00 41.79  ? 759 GLN A CG    1 
ATOM   4659  C  CD    . GLN E 3 463 ? 21.055  54.969 -119.385 1.00 42.79  ? 759 GLN A CD    1 
ATOM   4660  O  OE1   . GLN E 3 463 ? 21.211  55.756 -118.450 1.00 44.50  ? 759 GLN A OE1   1 
ATOM   4661  N  NE2   . GLN E 3 463 ? 21.628  55.144 -120.574 1.00 43.35  ? 759 GLN A NE2   1 
ATOM   4662  N  N     . LYS E 3 464 ? 20.815  50.213 -119.714 1.00 35.95  ? 760 LYS A N     1 
ATOM   4663  C  CA    . LYS E 3 464 ? 20.853  49.464 -120.973 1.00 34.82  ? 760 LYS A CA    1 
ATOM   4664  C  C     . LYS E 3 464 ? 20.239  48.058 -120.921 1.00 33.25  ? 760 LYS A C     1 
ATOM   4665  O  O     . LYS E 3 464 ? 19.708  47.572 -121.919 1.00 33.40  ? 760 LYS A O     1 
ATOM   4666  C  CB    . LYS E 3 464 ? 22.297  49.330 -121.469 1.00 34.27  ? 760 LYS A CB    1 
ATOM   4667  C  CG    . LYS E 3 464 ? 22.768  50.456 -122.352 1.00 34.71  ? 760 LYS A CG    1 
ATOM   4668  C  CD    . LYS E 3 464 ? 23.205  51.666 -121.561 1.00 35.57  ? 760 LYS A CD    1 
ATOM   4669  C  CE    . LYS E 3 464 ? 23.709  52.744 -122.507 1.00 35.68  ? 760 LYS A CE    1 
ATOM   4670  N  NZ    . LYS E 3 464 ? 24.640  52.185 -123.530 1.00 35.57  ? 760 LYS A NZ    1 
ATOM   4671  N  N     . GLY E 3 465 ? 20.341  47.399 -119.773 1.00 32.31  ? 761 GLY A N     1 
ATOM   4672  C  CA    . GLY E 3 465 ? 19.811  46.053 -119.639 1.00 30.89  ? 761 GLY A CA    1 
ATOM   4673  C  C     . GLY E 3 465 ? 20.845  44.996 -119.971 1.00 31.27  ? 761 GLY A C     1 
ATOM   4674  O  O     . GLY E 3 465 ? 20.585  43.788 -119.873 1.00 30.19  ? 761 GLY A O     1 
ATOM   4675  N  N     . TYR E 3 466 ? 22.031  45.448 -120.364 1.00 31.03  ? 762 TYR A N     1 
ATOM   4676  C  CA    . TYR E 3 466 ? 23.103  44.532 -120.722 1.00 31.13  ? 762 TYR A CA    1 
ATOM   4677  C  C     . TYR E 3 466 ? 24.470  45.147 -120.417 1.00 29.94  ? 762 TYR A C     1 
ATOM   4678  O  O     . TYR E 3 466 ? 24.622  46.361 -120.448 1.00 29.86  ? 762 TYR A O     1 
ATOM   4679  C  CB    . TYR E 3 466 ? 23.008  44.200 -122.221 1.00 31.92  ? 762 TYR A CB    1 
ATOM   4680  C  CG    . TYR E 3 466 ? 23.238  45.392 -123.131 1.00 33.64  ? 762 TYR A CG    1 
ATOM   4681  C  CD1   . TYR E 3 466 ? 24.523  45.719 -123.579 1.00 34.57  ? 762 TYR A CD1   1 
ATOM   4682  C  CD2   . TYR E 3 466 ? 22.179  46.205 -123.528 1.00 34.07  ? 762 TYR A CD2   1 
ATOM   4683  C  CE1   . TYR E 3 466 ? 24.744  46.821 -124.391 1.00 34.43  ? 762 TYR A CE1   1 
ATOM   4684  C  CE2   . TYR E 3 466 ? 22.388  47.322 -124.350 1.00 35.12  ? 762 TYR A CE2   1 
ATOM   4685  C  CZ    . TYR E 3 466 ? 23.674  47.622 -124.774 1.00 35.35  ? 762 TYR A CZ    1 
ATOM   4686  O  OH    . TYR E 3 466 ? 23.904  48.726 -125.564 1.00 35.68  ? 762 TYR A OH    1 
ATOM   4687  N  N     . VAL E 3 467 ? 25.450  44.307 -120.096 1.00 28.89  ? 763 VAL A N     1 
ATOM   4688  C  CA    . VAL E 3 467 ? 26.807  44.792 -119.845 1.00 28.95  ? 763 VAL A CA    1 
ATOM   4689  C  C     . VAL E 3 467 ? 27.602  44.409 -121.067 1.00 29.04  ? 763 VAL A C     1 
ATOM   4690  O  O     . VAL E 3 467 ? 27.133  43.615 -121.887 1.00 29.08  ? 763 VAL A O     1 
ATOM   4691  C  CB    . VAL E 3 467 ? 27.467  44.135 -118.623 1.00 28.28  ? 763 VAL A CB    1 
ATOM   4692  C  CG1   . VAL E 3 467 ? 27.053  44.860 -117.362 1.00 28.25  ? 763 VAL A CG1   1 
ATOM   4693  C  CG2   . VAL E 3 467 ? 27.077  42.657 -118.551 1.00 28.42  ? 763 VAL A CG2   1 
ATOM   4694  N  N     . THR E 3 468 ? 28.814  44.939 -121.186 1.00 29.32  ? 764 THR A N     1 
ATOM   4695  C  CA    . THR E 3 468 ? 29.614  44.641 -122.357 1.00 29.86  ? 764 THR A CA    1 
ATOM   4696  C  C     . THR E 3 468 ? 31.109  44.444 -122.092 1.00 29.62  ? 764 THR A C     1 
ATOM   4697  O  O     . THR E 3 468 ? 31.654  44.897 -121.073 1.00 28.93  ? 764 THR A O     1 
ATOM   4698  C  CB    . THR E 3 468 ? 29.421  45.742 -123.413 1.00 29.81  ? 764 THR A CB    1 
ATOM   4699  O  OG1   . THR E 3 468 ? 30.104  45.376 -124.614 1.00 32.87  ? 764 THR A OG1   1 
ATOM   4700  C  CG2   . THR E 3 468 ? 29.964  47.056 -122.915 1.00 31.20  ? 764 THR A CG2   1 
ATOM   4701  N  N     . THR E 3 469 ? 31.761  43.752 -123.017 1.00 29.44  ? 765 THR A N     1 
ATOM   4702  C  CA    . THR E 3 469 ? 33.191  43.483 -122.884 1.00 30.13  ? 765 THR A CA    1 
ATOM   4703  C  C     . THR E 3 469 ? 34.001  44.275 -123.881 1.00 29.26  ? 765 THR A C     1 
ATOM   4704  O  O     . THR E 3 469 ? 33.479  44.808 -124.858 1.00 30.14  ? 765 THR A O     1 
ATOM   4705  C  CB    . THR E 3 469 ? 33.534  42.003 -123.123 1.00 29.40  ? 765 THR A CB    1 
ATOM   4706  O  OG1   . THR E 3 469 ? 33.365  41.693 -124.511 1.00 29.53  ? 765 THR A OG1   1 
ATOM   4707  C  CG2   . THR E 3 469 ? 32.643  41.113 -122.296 1.00 30.17  ? 765 THR A CG2   1 
ATOM   4708  N  N     . LEU E 3 470 ? 35.297  44.328 -123.621 1.00 29.29  ? 766 LEU A N     1 
ATOM   4709  C  CA    . LEU E 3 470 ? 36.234  45.022 -124.480 1.00 28.61  ? 766 LEU A CA    1 
ATOM   4710  C  C     . LEU E 3 470 ? 36.010  44.681 -125.960 1.00 27.79  ? 766 LEU A C     1 
ATOM   4711  O  O     . LEU E 3 470 ? 35.981  45.570 -126.806 1.00 26.46  ? 766 LEU A O     1 
ATOM   4712  C  CB    . LEU E 3 470 ? 37.653  44.657 -124.042 1.00 28.78  ? 766 LEU A CB    1 
ATOM   4713  C  CG    . LEU E 3 470 ? 38.562  45.776 -123.506 1.00 30.31  ? 766 LEU A CG    1 
ATOM   4714  C  CD1   . LEU E 3 470 ? 37.770  46.923 -122.894 1.00 29.13  ? 766 LEU A CD1   1 
ATOM   4715  C  CD2   . LEU E 3 470 ? 39.511  45.167 -122.489 1.00 28.57  ? 766 LEU A CD2   1 
ATOM   4716  N  N     . LEU E 3 471 ? 35.824  43.402 -126.276 1.00 28.33  ? 767 LEU A N     1 
ATOM   4717  C  CA    . LEU E 3 471 ? 35.618  43.033 -127.664 1.00 29.86  ? 767 LEU A CA    1 
ATOM   4718  C  C     . LEU E 3 471 ? 34.137  42.976 -128.066 1.00 30.45  ? 767 LEU A C     1 
ATOM   4719  O  O     . LEU E 3 471 ? 33.752  42.263 -128.998 1.00 30.70  ? 767 LEU A O     1 
ATOM   4720  C  CB    . LEU E 3 471 ? 36.329  41.709 -127.972 1.00 30.57  ? 767 LEU A CB    1 
ATOM   4721  C  CG    . LEU E 3 471 ? 37.829  41.651 -127.631 1.00 30.90  ? 767 LEU A CG    1 
ATOM   4722  C  CD1   . LEU E 3 471 ? 38.496  40.620 -128.510 1.00 29.87  ? 767 LEU A CD1   1 
ATOM   4723  C  CD2   . LEU E 3 471 ? 38.491  43.024 -127.864 1.00 31.12  ? 767 LEU A CD2   1 
ATOM   4724  N  N     . HIS E 3 472 ? 33.315  43.733 -127.346 1.00 30.89  ? 768 HIS A N     1 
ATOM   4725  C  CA    . HIS E 3 472 ? 31.888  43.829 -127.644 1.00 31.17  ? 768 HIS A CA    1 
ATOM   4726  C  C     . HIS E 3 472 ? 30.989  42.622 -127.365 1.00 30.55  ? 768 HIS A C     1 
ATOM   4727  O  O     . HIS E 3 472 ? 29.930  42.474 -127.979 1.00 31.39  ? 768 HIS A O     1 
ATOM   4728  C  CB    . HIS E 3 472 ? 31.721  44.270 -129.103 1.00 31.59  ? 768 HIS A CB    1 
ATOM   4729  C  CG    . HIS E 3 472 ? 32.296  45.622 -129.390 1.00 32.41  ? 768 HIS A CG    1 
ATOM   4730  N  ND1   . HIS E 3 472 ? 32.552  46.067 -130.669 1.00 33.08  ? 768 HIS A ND1   1 
ATOM   4731  C  CD2   . HIS E 3 472 ? 32.631  46.640 -128.562 1.00 31.81  ? 768 HIS A CD2   1 
ATOM   4732  C  CE1   . HIS E 3 472 ? 33.018  47.302 -130.616 1.00 33.66  ? 768 HIS A CE1   1 
ATOM   4733  N  NE2   . HIS E 3 472 ? 33.074  47.673 -129.349 1.00 32.71  ? 768 HIS A NE2   1 
ATOM   4734  N  N     . ARG E 3 473 ? 31.404  41.758 -126.451 1.00 30.00  ? 769 ARG A N     1 
ATOM   4735  C  CA    . ARG E 3 473 ? 30.592  40.616 -126.077 1.00 29.30  ? 769 ARG A CA    1 
ATOM   4736  C  C     . ARG E 3 473 ? 29.605  41.220 -125.066 1.00 30.38  ? 769 ARG A C     1 
ATOM   4737  O  O     . ARG E 3 473 ? 30.025  41.847 -124.094 1.00 31.43  ? 769 ARG A O     1 
ATOM   4738  C  CB    . ARG E 3 473 ? 31.454  39.558 -125.394 1.00 27.62  ? 769 ARG A CB    1 
ATOM   4739  C  CG    . ARG E 3 473 ? 30.748  38.257 -125.101 1.00 26.16  ? 769 ARG A CG    1 
ATOM   4740  C  CD    . ARG E 3 473 ? 31.638  37.334 -124.286 1.00 27.68  ? 769 ARG A CD    1 
ATOM   4741  N  NE    . ARG E 3 473 ? 32.857  36.954 -125.015 1.00 28.40  ? 769 ARG A NE    1 
ATOM   4742  C  CZ    . ARG E 3 473 ? 32.908  35.974 -125.912 1.00 28.82  ? 769 ARG A CZ    1 
ATOM   4743  N  NH1   . ARG E 3 473 ? 31.814  35.269 -126.193 1.00 28.50  ? 769 ARG A NH1   1 
ATOM   4744  N  NH2   . ARG E 3 473 ? 34.049  35.689 -126.530 1.00 29.05  ? 769 ARG A NH2   1 
ATOM   4745  N  N     . ARG E 3 474 ? 28.307  41.058 -125.277 1.00 30.62  ? 770 ARG A N     1 
ATOM   4746  C  CA    . ARG E 3 474 ? 27.359  41.654 -124.324 1.00 30.74  ? 770 ARG A CA    1 
ATOM   4747  C  C     . ARG E 3 474 ? 26.619  40.635 -123.476 1.00 29.78  ? 770 ARG A C     1 
ATOM   4748  O  O     . ARG E 3 474 ? 26.437  39.497 -123.885 1.00 28.99  ? 770 ARG A O     1 
ATOM   4749  C  CB    . ARG E 3 474 ? 26.352  42.566 -125.060 1.00 31.14  ? 770 ARG A CB    1 
ATOM   4750  C  CG    . ARG E 3 474 ? 25.437  41.859 -126.053 1.00 33.37  ? 770 ARG A CG    1 
ATOM   4751  C  CD    . ARG E 3 474 ? 24.248  42.753 -126.496 1.00 34.06  ? 770 ARG A CD    1 
ATOM   4752  N  NE    . ARG E 3 474 ? 24.645  43.922 -127.278 1.00 34.08  ? 770 ARG A NE    1 
ATOM   4753  C  CZ    . ARG E 3 474 ? 23.809  44.891 -127.655 1.00 34.52  ? 770 ARG A CZ    1 
ATOM   4754  N  NH1   . ARG E 3 474 ? 22.523  44.831 -127.324 1.00 34.01  ? 770 ARG A NH1   1 
ATOM   4755  N  NH2   . ARG E 3 474 ? 24.258  45.925 -128.355 1.00 33.34  ? 770 ARG A NH2   1 
ATOM   4756  N  N     . ARG E 3 475 ? 26.213  41.046 -122.273 1.00 30.01  ? 771 ARG A N     1 
ATOM   4757  C  CA    . ARG E 3 475 ? 25.464  40.167 -121.384 1.00 29.92  ? 771 ARG A CA    1 
ATOM   4758  C  C     . ARG E 3 475 ? 24.228  40.884 -120.864 1.00 29.38  ? 771 ARG A C     1 
ATOM   4759  O  O     . ARG E 3 475 ? 24.336  41.871 -120.138 1.00 28.12  ? 771 ARG A O     1 
ATOM   4760  C  CB    . ARG E 3 475 ? 26.288  39.716 -120.174 1.00 29.15  ? 771 ARG A CB    1 
ATOM   4761  C  CG    . ARG E 3 475 ? 25.561  38.650 -119.374 1.00 28.83  ? 771 ARG A CG    1 
ATOM   4762  C  CD    . ARG E 3 475 ? 26.203  38.301 -118.031 1.00 27.78  ? 771 ARG A CD    1 
ATOM   4763  N  NE    . ARG E 3 475 ? 25.644  37.051 -117.522 1.00 27.12  ? 771 ARG A NE    1 
ATOM   4764  C  CZ    . ARG E 3 475 ? 25.941  36.491 -116.354 1.00 27.43  ? 771 ARG A CZ    1 
ATOM   4765  N  NH1   . ARG E 3 475 ? 26.808  37.059 -115.532 1.00 28.34  ? 771 ARG A NH1   1 
ATOM   4766  N  NH2   . ARG E 3 475 ? 25.357  35.355 -115.999 1.00 27.30  ? 771 ARG A NH2   1 
ATOM   4767  N  N     . TYR E 3 476 ? 23.055  40.378 -121.227 1.00 28.72  ? 772 TYR A N     1 
ATOM   4768  C  CA    . TYR E 3 476 ? 21.803  40.995 -120.776 1.00 29.07  ? 772 TYR A CA    1 
ATOM   4769  C  C     . TYR E 3 476 ? 21.518  40.698 -119.304 1.00 28.50  ? 772 TYR A C     1 
ATOM   4770  O  O     . TYR E 3 476 ? 21.633  39.555 -118.856 1.00 28.02  ? 772 TYR A O     1 
ATOM   4771  C  CB    . TYR E 3 476 ? 20.641  40.508 -121.640 1.00 29.33  ? 772 TYR A CB    1 
ATOM   4772  C  CG    . TYR E 3 476 ? 20.712  40.991 -123.068 1.00 30.28  ? 772 TYR A CG    1 
ATOM   4773  C  CD1   . TYR E 3 476 ? 21.121  40.143 -124.098 1.00 30.71  ? 772 TYR A CD1   1 
ATOM   4774  C  CD2   . TYR E 3 476 ? 20.379  42.304 -123.390 1.00 30.61  ? 772 TYR A CD2   1 
ATOM   4775  C  CE1   . TYR E 3 476 ? 21.193  40.595 -125.422 1.00 31.15  ? 772 TYR A CE1   1 
ATOM   4776  C  CE2   . TYR E 3 476 ? 20.451  42.767 -124.702 1.00 31.15  ? 772 TYR A CE2   1 
ATOM   4777  C  CZ    . TYR E 3 476 ? 20.856  41.911 -125.711 1.00 31.11  ? 772 TYR A CZ    1 
ATOM   4778  O  OH    . TYR E 3 476 ? 20.918  42.379 -126.997 1.00 31.07  ? 772 TYR A OH    1 
ATOM   4779  N  N     . LEU E 3 477 ? 21.155  41.735 -118.555 1.00 28.92  ? 773 LEU A N     1 
ATOM   4780  C  CA    . LEU E 3 477 ? 20.857  41.594 -117.136 1.00 29.39  ? 773 LEU A CA    1 
ATOM   4781  C  C     . LEU E 3 477 ? 19.478  42.161 -116.757 1.00 29.87  ? 773 LEU A C     1 
ATOM   4782  O  O     . LEU E 3 477 ? 19.370  43.247 -116.161 1.00 29.85  ? 773 LEU A O     1 
ATOM   4783  C  CB    . LEU E 3 477 ? 21.951  42.266 -116.302 1.00 28.69  ? 773 LEU A CB    1 
ATOM   4784  C  CG    . LEU E 3 477 ? 23.365  41.685 -116.508 1.00 29.46  ? 773 LEU A CG    1 
ATOM   4785  C  CD1   . LEU E 3 477 ? 24.384  42.528 -115.748 1.00 28.26  ? 773 LEU A CD1   1 
ATOM   4786  C  CD2   . LEU E 3 477 ? 23.408  40.230 -116.046 1.00 27.30  ? 773 LEU A CD2   1 
ATOM   4787  N  N     . PRO E 3 478 ? 18.409  41.426 -117.098 1.00 29.67  ? 774 PRO A N     1 
ATOM   4788  C  CA    . PRO E 3 478 ? 17.036  41.849 -116.797 1.00 29.66  ? 774 PRO A CA    1 
ATOM   4789  C  C     . PRO E 3 478 ? 16.659  41.756 -115.313 1.00 28.95  ? 774 PRO A C     1 
ATOM   4790  O  O     . PRO E 3 478 ? 15.707  42.402 -114.876 1.00 30.16  ? 774 PRO A O     1 
ATOM   4791  C  CB    . PRO E 3 478 ? 16.193  40.934 -117.679 1.00 29.75  ? 774 PRO A CB    1 
ATOM   4792  C  CG    . PRO E 3 478 ? 16.987  39.679 -117.715 1.00 30.13  ? 774 PRO A CG    1 
ATOM   4793  C  CD    . PRO E 3 478 ? 18.409  40.198 -117.914 1.00 30.48  ? 774 PRO A CD    1 
ATOM   4794  N  N     . ASP E 3 479 ? 17.385  40.951 -114.543 1.00 28.46  ? 775 ASP A N     1 
ATOM   4795  C  CA    . ASP E 3 479 ? 17.107  40.829 -113.117 1.00 28.59  ? 775 ASP A CA    1 
ATOM   4796  C  C     . ASP E 3 479 ? 17.660  42.055 -112.385 1.00 29.09  ? 775 ASP A C     1 
ATOM   4797  O  O     . ASP E 3 479 ? 17.437  42.219 -111.186 1.00 28.66  ? 775 ASP A O     1 
ATOM   4798  C  CB    . ASP E 3 479 ? 17.725  39.552 -112.537 1.00 28.97  ? 775 ASP A CB    1 
ATOM   4799  C  CG    . ASP E 3 479 ? 16.994  38.302 -112.976 1.00 29.48  ? 775 ASP A CG    1 
ATOM   4800  O  OD1   . ASP E 3 479 ? 17.311  37.205 -112.477 1.00 28.60  ? 775 ASP A OD1   1 
ATOM   4801  O  OD2   . ASP E 3 479 ? 16.095  38.420 -113.830 1.00 31.31  ? 775 ASP A OD2   1 
ATOM   4802  N  N     . ILE E 3 480 ? 18.379  42.910 -113.112 1.00 29.55  ? 776 ILE A N     1 
ATOM   4803  C  CA    . ILE E 3 480 ? 18.942  44.126 -112.526 1.00 31.01  ? 776 ILE A CA    1 
ATOM   4804  C  C     . ILE E 3 480 ? 17.798  45.016 -112.022 1.00 31.99  ? 776 ILE A C     1 
ATOM   4805  O  O     . ILE E 3 480 ? 17.978  45.785 -111.076 1.00 30.90  ? 776 ILE A O     1 
ATOM   4806  C  CB    . ILE E 3 480 ? 19.772  44.931 -113.561 1.00 31.09  ? 776 ILE A CB    1 
ATOM   4807  C  CG1   . ILE E 3 480 ? 20.781  45.835 -112.841 1.00 32.72  ? 776 ILE A CG1   1 
ATOM   4808  C  CG2   . ILE E 3 480 ? 18.854  45.792 -114.416 1.00 31.45  ? 776 ILE A CG2   1 
ATOM   4809  C  CD1   . ILE E 3 480 ? 22.035  45.089 -112.339 1.00 30.11  ? 776 ILE A CD1   1 
ATOM   4810  N  N     . THR E 3 481 ? 16.627  44.907 -112.653 1.00 32.97  ? 777 THR A N     1 
ATOM   4811  C  CA    . THR E 3 481 ? 15.470  45.721 -112.255 1.00 35.38  ? 777 THR A CA    1 
ATOM   4812  C  C     . THR E 3 481 ? 14.523  45.015 -111.294 1.00 36.38  ? 777 THR A C     1 
ATOM   4813  O  O     . THR E 3 481 ? 13.520  45.594 -110.866 1.00 37.03  ? 777 THR A O     1 
ATOM   4814  C  CB    . THR E 3 481 ? 14.628  46.170 -113.473 1.00 35.80  ? 777 THR A CB    1 
ATOM   4815  O  OG1   . THR E 3 481 ? 13.944  45.038 -114.033 1.00 36.40  ? 777 THR A OG1   1 
ATOM   4816  C  CG2   . THR E 3 481 ? 15.521  46.800 -114.535 1.00 36.08  ? 777 THR A CG2   1 
ATOM   4817  N  N     . SER E 3 482 ? 14.837  43.765 -110.964 1.00 37.08  ? 778 SER A N     1 
ATOM   4818  C  CA    . SER E 3 482 ? 14.013  42.959 -110.072 1.00 38.00  ? 778 SER A CA    1 
ATOM   4819  C  C     . SER E 3 482 ? 13.560  43.708 -108.825 1.00 38.86  ? 778 SER A C     1 
ATOM   4820  O  O     . SER E 3 482 ? 14.275  44.579 -108.321 1.00 39.08  ? 778 SER A O     1 
ATOM   4821  C  CB    . SER E 3 482 ? 14.788  41.711 -109.652 1.00 38.44  ? 778 SER A CB    1 
ATOM   4822  O  OG    . SER E 3 482 ? 14.080  40.977 -108.669 1.00 39.15  ? 778 SER A OG    1 
ATOM   4823  N  N     . ARG E 3 483 ? 12.365  43.375 -108.336 1.00 39.53  ? 779 ARG A N     1 
ATOM   4824  C  CA    . ARG E 3 483 ? 11.835  43.996 -107.126 1.00 39.71  ? 779 ARG A CA    1 
ATOM   4825  C  C     . ARG E 3 483 ? 12.194  43.124 -105.939 1.00 39.85  ? 779 ARG A C     1 
ATOM   4826  O  O     . ARG E 3 483 ? 11.846  43.422 -104.794 1.00 40.18  ? 779 ARG A O     1 
ATOM   4827  C  CB    . ARG E 3 483 ? 10.315  44.172 -107.208 1.00 40.47  ? 779 ARG A CB    1 
ATOM   4828  C  CG    . ARG E 3 483 ? 9.889   45.368 -108.031 1.00 40.64  ? 779 ARG A CG    1 
ATOM   4829  C  CD    . ARG E 3 483 ? 10.511  46.628 -107.484 1.00 41.99  ? 779 ARG A CD    1 
ATOM   4830  N  NE    . ARG E 3 483 ? 10.220  47.778 -108.331 1.00 43.57  ? 779 ARG A NE    1 
ATOM   4831  C  CZ    . ARG E 3 483 ? 9.012   48.309 -108.490 1.00 44.52  ? 779 ARG A CZ    1 
ATOM   4832  N  NH1   . ARG E 3 483 ? 7.961   47.800 -107.854 1.00 44.05  ? 779 ARG A NH1   1 
ATOM   4833  N  NH2   . ARG E 3 483 ? 8.853   49.350 -109.298 1.00 45.57  ? 779 ARG A NH2   1 
ATOM   4834  N  N     . ASN E 3 484 ? 12.873  42.021 -106.220 1.00 39.84  ? 780 ASN A N     1 
ATOM   4835  C  CA    . ASN E 3 484 ? 13.322  41.144 -105.156 1.00 39.66  ? 780 ASN A CA    1 
ATOM   4836  C  C     . ASN E 3 484 ? 14.733  41.636 -104.863 1.00 39.55  ? 780 ASN A C     1 
ATOM   4837  O  O     . ASN E 3 484 ? 15.527  41.847 -105.791 1.00 38.84  ? 780 ASN A O     1 
ATOM   4838  C  CB    . ASN E 3 484 ? 13.366  39.691 -105.607 1.00 39.64  ? 780 ASN A CB    1 
ATOM   4839  C  CG    . ASN E 3 484 ? 13.609  38.747 -104.451 1.00 40.64  ? 780 ASN A CG    1 
ATOM   4840  O  OD1   . ASN E 3 484 ? 12.774  38.632 -103.552 1.00 40.73  ? 780 ASN A OD1   1 
ATOM   4841  N  ND2   . ASN E 3 484 ? 14.759  38.079 -104.451 1.00 40.16  ? 780 ASN A ND2   1 
ATOM   4842  N  N     . PHE E 3 485 ? 15.043  41.825 -103.586 1.00 38.86  ? 781 PHE A N     1 
ATOM   4843  C  CA    . PHE E 3 485 ? 16.351  42.328 -103.198 1.00 39.35  ? 781 PHE A CA    1 
ATOM   4844  C  C     . PHE E 3 485 ? 17.531  41.425 -103.505 1.00 38.91  ? 781 PHE A C     1 
ATOM   4845  O  O     . PHE E 3 485 ? 18.602  41.915 -103.849 1.00 38.96  ? 781 PHE A O     1 
ATOM   4846  C  CB    . PHE E 3 485 ? 16.351  42.690 -101.714 1.00 39.74  ? 781 PHE A CB    1 
ATOM   4847  C  CG    . PHE E 3 485 ? 15.868  44.081 -101.440 1.00 40.90  ? 781 PHE A CG    1 
ATOM   4848  C  CD1   . PHE E 3 485 ? 16.699  45.176 -101.660 1.00 41.19  ? 781 PHE A CD1   1 
ATOM   4849  C  CD2   . PHE E 3 485 ? 14.568  44.306 -100.985 1.00 41.91  ? 781 PHE A CD2   1 
ATOM   4850  C  CE1   . PHE E 3 485 ? 16.242  46.483 -101.429 1.00 41.95  ? 781 PHE A CE1   1 
ATOM   4851  C  CE2   . PHE E 3 485 ? 14.101  45.607 -100.751 1.00 41.78  ? 781 PHE A CE2   1 
ATOM   4852  C  CZ    . PHE E 3 485 ? 14.940  46.695 -100.974 1.00 41.59  ? 781 PHE A CZ    1 
ATOM   4853  N  N     . ASN E 3 486 ? 17.350  40.114 -103.391 1.00 38.44  ? 782 ASN A N     1 
ATOM   4854  C  CA    . ASN E 3 486 ? 18.457  39.218 -103.660 1.00 39.05  ? 782 ASN A CA    1 
ATOM   4855  C  C     . ASN E 3 486 ? 18.640  38.901 -105.141 1.00 38.68  ? 782 ASN A C     1 
ATOM   4856  O  O     . ASN E 3 486 ? 19.747  38.584 -105.568 1.00 37.52  ? 782 ASN A O     1 
ATOM   4857  C  CB    . ASN E 3 486 ? 18.329  37.934 -102.831 1.00 40.15  ? 782 ASN A CB    1 
ATOM   4858  C  CG    . ASN E 3 486 ? 19.007  38.053 -101.474 1.00 41.06  ? 782 ASN A CG    1 
ATOM   4859  O  OD1   . ASN E 3 486 ? 20.201  38.355 -101.395 1.00 41.57  ? 782 ASN A OD1   1 
ATOM   4860  N  ND2   . ASN E 3 486 ? 18.252  37.818 -100.402 1.00 40.93  ? 782 ASN A ND2   1 
ATOM   4861  N  N     . VAL E 3 487 ? 17.564  38.998 -105.921 1.00 38.33  ? 783 VAL A N     1 
ATOM   4862  C  CA    . VAL E 3 487 ? 17.657  38.748 -107.354 1.00 37.67  ? 783 VAL A CA    1 
ATOM   4863  C  C     . VAL E 3 487 ? 18.417  39.936 -107.916 1.00 37.17  ? 783 VAL A C     1 
ATOM   4864  O  O     . VAL E 3 487 ? 19.325  39.789 -108.730 1.00 36.57  ? 783 VAL A O     1 
ATOM   4865  C  CB    . VAL E 3 487 ? 16.264  38.673 -108.028 1.00 37.92  ? 783 VAL A CB    1 
ATOM   4866  C  CG1   . VAL E 3 487 ? 16.410  38.806 -109.534 1.00 37.56  ? 783 VAL A CG1   1 
ATOM   4867  C  CG2   . VAL E 3 487 ? 15.586  37.343 -107.692 1.00 37.99  ? 783 VAL A CG2   1 
ATOM   4868  N  N     . ARG E 3 488 ? 18.034  41.117 -107.455 1.00 36.78  ? 784 ARG A N     1 
ATOM   4869  C  CA    . ARG E 3 488 ? 18.667  42.347 -107.879 1.00 37.03  ? 784 ARG A CA    1 
ATOM   4870  C  C     . ARG E 3 488 ? 20.152  42.322 -107.495 1.00 36.65  ? 784 ARG A C     1 
ATOM   4871  O  O     . ARG E 3 488 ? 21.012  42.712 -108.288 1.00 36.86  ? 784 ARG A O     1 
ATOM   4872  C  CB    . ARG E 3 488 ? 17.981  43.534 -107.210 1.00 37.11  ? 784 ARG A CB    1 
ATOM   4873  C  CG    . ARG E 3 488 ? 18.321  44.879 -107.803 1.00 39.30  ? 784 ARG A CG    1 
ATOM   4874  C  CD    . ARG E 3 488 ? 17.749  45.972 -106.936 1.00 41.25  ? 784 ARG A CD    1 
ATOM   4875  N  NE    . ARG E 3 488 ? 17.428  47.189 -107.680 1.00 44.07  ? 784 ARG A NE    1 
ATOM   4876  C  CZ    . ARG E 3 488 ? 18.320  48.018 -108.212 1.00 45.26  ? 784 ARG A CZ    1 
ATOM   4877  N  NH1   . ARG E 3 488 ? 19.619  47.779 -108.097 1.00 46.75  ? 784 ARG A NH1   1 
ATOM   4878  N  NH2   . ARG E 3 488 ? 17.906  49.103 -108.851 1.00 46.32  ? 784 ARG A NH2   1 
ATOM   4879  N  N     . SER E 3 489 ? 20.446  41.851 -106.283 1.00 35.41  ? 785 SER A N     1 
ATOM   4880  C  CA    . SER E 3 489 ? 21.824  41.801 -105.799 1.00 34.86  ? 785 SER A CA    1 
ATOM   4881  C  C     . SER E 3 489 ? 22.735  40.835 -106.540 1.00 33.79  ? 785 SER A C     1 
ATOM   4882  O  O     . SER E 3 489 ? 23.926  41.112 -106.701 1.00 33.32  ? 785 SER A O     1 
ATOM   4883  C  CB    . SER E 3 489 ? 21.852  41.493 -104.305 1.00 34.98  ? 785 SER A CB    1 
ATOM   4884  O  OG    . SER E 3 489 ? 21.529  42.663 -103.578 1.00 36.65  ? 785 SER A OG    1 
ATOM   4885  N  N     . PHE E 3 490 ? 22.193  39.696 -106.963 1.00 32.18  ? 786 PHE A N     1 
ATOM   4886  C  CA    . PHE E 3 490 ? 22.976  38.733 -107.723 1.00 31.63  ? 786 PHE A CA    1 
ATOM   4887  C  C     . PHE E 3 490 ? 23.197  39.324 -109.110 1.00 31.61  ? 786 PHE A C     1 
ATOM   4888  O  O     . PHE E 3 490 ? 24.260  39.147 -109.717 1.00 31.46  ? 786 PHE A O     1 
ATOM   4889  C  CB    . PHE E 3 490 ? 22.231  37.399 -107.835 1.00 31.24  ? 786 PHE A CB    1 
ATOM   4890  C  CG    . PHE E 3 490 ? 22.498  36.469 -106.695 1.00 31.62  ? 786 PHE A CG    1 
ATOM   4891  C  CD1   . PHE E 3 490 ? 23.729  35.829 -106.583 1.00 31.53  ? 786 PHE A CD1   1 
ATOM   4892  C  CD2   . PHE E 3 490 ? 21.534  36.248 -105.717 1.00 31.05  ? 786 PHE A CD2   1 
ATOM   4893  C  CE1   . PHE E 3 490 ? 23.996  34.980 -105.508 1.00 31.88  ? 786 PHE A CE1   1 
ATOM   4894  C  CE2   . PHE E 3 490 ? 21.789  35.406 -104.641 1.00 31.47  ? 786 PHE A CE2   1 
ATOM   4895  C  CZ    . PHE E 3 490 ? 23.021  34.769 -104.534 1.00 32.23  ? 786 PHE A CZ    1 
ATOM   4896  N  N     . ALA E 3 491 ? 22.185  40.040 -109.594 1.00 30.87  ? 787 ALA A N     1 
ATOM   4897  C  CA    . ALA E 3 491 ? 22.241  40.683 -110.893 1.00 31.14  ? 787 ALA A CA    1 
ATOM   4898  C  C     . ALA E 3 491 ? 23.359  41.708 -110.849 1.00 31.25  ? 787 ALA A C     1 
ATOM   4899  O  O     . ALA E 3 491 ? 24.218  41.744 -111.727 1.00 30.39  ? 787 ALA A O     1 
ATOM   4900  C  CB    . ALA E 3 491 ? 20.906  41.371 -111.211 1.00 31.76  ? 787 ALA A CB    1 
ATOM   4901  N  N     . GLU E 3 492 ? 23.357  42.531 -109.807 1.00 31.33  ? 788 GLU A N     1 
ATOM   4902  C  CA    . GLU E 3 492 ? 24.384  43.557 -109.668 1.00 31.04  ? 788 GLU A CA    1 
ATOM   4903  C  C     . GLU E 3 492 ? 25.805  42.979 -109.568 1.00 30.71  ? 788 GLU A C     1 
ATOM   4904  O  O     . GLU E 3 492 ? 26.740  43.545 -110.129 1.00 29.89  ? 788 GLU A O     1 
ATOM   4905  C  CB    . GLU E 3 492 ? 24.075  44.449 -108.461 1.00 32.18  ? 788 GLU A CB    1 
ATOM   4906  C  CG    . GLU E 3 492 ? 22.739  45.217 -108.586 1.00 32.40  ? 788 GLU A CG    1 
ATOM   4907  C  CD    . GLU E 3 492 ? 22.526  46.217 -107.454 1.00 33.49  ? 788 GLU A CD    1 
ATOM   4908  O  OE1   . GLU E 3 492 ? 22.869  45.869 -106.307 1.00 33.95  ? 788 GLU A OE1   1 
ATOM   4909  O  OE2   . GLU E 3 492 ? 22.015  47.341 -107.706 1.00 33.39  ? 788 GLU A OE2   1 
ATOM   4910  N  N     . ARG E 3 493 ? 25.971  41.857 -108.870 1.00 31.05  ? 789 ARG A N     1 
ATOM   4911  C  CA    . ARG E 3 493 ? 27.297  41.259 -108.746 1.00 31.34  ? 789 ARG A CA    1 
ATOM   4912  C  C     . ARG E 3 493 ? 27.726  40.621 -110.061 1.00 31.26  ? 789 ARG A C     1 
ATOM   4913  O  O     . ARG E 3 493 ? 28.897  40.252 -110.258 1.00 31.52  ? 789 ARG A O     1 
ATOM   4914  C  CB    . ARG E 3 493 ? 27.333  40.235 -107.610 1.00 31.73  ? 789 ARG A CB    1 
ATOM   4915  C  CG    . ARG E 3 493 ? 27.274  40.889 -106.221 1.00 33.14  ? 789 ARG A CG    1 
ATOM   4916  C  CD    . ARG E 3 493 ? 27.666  39.933 -105.109 1.00 33.24  ? 789 ARG A CD    1 
ATOM   4917  N  NE    . ARG E 3 493 ? 26.548  39.644 -104.217 1.00 35.22  ? 789 ARG A NE    1 
ATOM   4918  C  CZ    . ARG E 3 493 ? 25.557  38.814 -104.511 1.00 34.92  ? 789 ARG A CZ    1 
ATOM   4919  N  NH1   . ARG E 3 493 ? 25.544  38.179 -105.673 1.00 36.86  ? 789 ARG A NH1   1 
ATOM   4920  N  NH2   . ARG E 3 493 ? 24.567  38.642 -103.661 1.00 35.15  ? 789 ARG A NH2   1 
ATOM   4921  N  N     . MET E 3 494 ? 26.772  40.479 -110.964 1.00 30.98  ? 790 MET A N     1 
ATOM   4922  C  CA    . MET E 3 494 ? 27.083  39.923 -112.258 1.00 30.52  ? 790 MET A CA    1 
ATOM   4923  C  C     . MET E 3 494 ? 27.569  41.068 -113.123 1.00 30.33  ? 790 MET A C     1 
ATOM   4924  O  O     . MET E 3 494 ? 28.507  40.903 -113.902 1.00 30.31  ? 790 MET A O     1 
ATOM   4925  C  CB    . MET E 3 494 ? 25.862  39.223 -112.847 1.00 29.92  ? 790 MET A CB    1 
ATOM   4926  C  CG    . MET E 3 494 ? 25.797  37.778 -112.384 1.00 30.97  ? 790 MET A CG    1 
ATOM   4927  S  SD    . MET E 3 494 ? 24.324  36.864 -112.835 1.00 30.93  ? 790 MET A SD    1 
ATOM   4928  C  CE    . MET E 3 494 ? 23.632  36.640 -111.250 1.00 31.02  ? 790 MET A CE    1 
ATOM   4929  N  N     . ALA E 3 495 ? 26.958  42.242 -112.961 1.00 29.62  ? 791 ALA A N     1 
ATOM   4930  C  CA    . ALA E 3 495 ? 27.380  43.405 -113.730 1.00 29.41  ? 791 ALA A CA    1 
ATOM   4931  C  C     . ALA E 3 495 ? 28.798  43.818 -113.331 1.00 29.55  ? 791 ALA A C     1 
ATOM   4932  O  O     . ALA E 3 495 ? 29.463  44.550 -114.068 1.00 28.29  ? 791 ALA A O     1 
ATOM   4933  C  CB    . ALA E 3 495 ? 26.435  44.564 -113.510 1.00 29.27  ? 791 ALA A CB    1 
ATOM   4934  N  N     . MET E 3 496 ? 29.247  43.365 -112.160 1.00 29.00  ? 792 MET A N     1 
ATOM   4935  C  CA    . MET E 3 496 ? 30.587  43.705 -111.684 1.00 28.51  ? 792 MET A CA    1 
ATOM   4936  C  C     . MET E 3 496 ? 31.634  42.708 -112.164 1.00 27.99  ? 792 MET A C     1 
ATOM   4937  O  O     . MET E 3 496 ? 32.773  43.077 -112.414 1.00 27.56  ? 792 MET A O     1 
ATOM   4938  C  CB    . MET E 3 496 ? 30.627  43.772 -110.146 1.00 29.45  ? 792 MET A CB    1 
ATOM   4939  C  CG    . MET E 3 496 ? 29.687  44.796 -109.512 1.00 27.92  ? 792 MET A CG    1 
ATOM   4940  S  SD    . MET E 3 496 ? 29.633  44.704 -107.700 1.00 31.47  ? 792 MET A SD    1 
ATOM   4941  C  CE    . MET E 3 496 ? 28.544  46.120 -107.369 1.00 28.99  ? 792 MET A CE    1 
ATOM   4942  N  N     . ASN E 3 497 ? 31.250  41.446 -112.303 1.00 27.49  ? 793 ASN A N     1 
ATOM   4943  C  CA    . ASN E 3 497 ? 32.195  40.419 -112.725 1.00 27.79  ? 793 ASN A CA    1 
ATOM   4944  C  C     . ASN E 3 497 ? 32.221  40.075 -114.233 1.00 27.46  ? 793 ASN A C     1 
ATOM   4945  O  O     . ASN E 3 497 ? 33.293  39.835 -114.803 1.00 26.64  ? 793 ASN A O     1 
ATOM   4946  C  CB    . ASN E 3 497 ? 31.951  39.173 -111.884 1.00 27.60  ? 793 ASN A CB    1 
ATOM   4947  C  CG    . ASN E 3 497 ? 32.683  37.952 -112.406 1.00 27.76  ? 793 ASN A CG    1 
ATOM   4948  O  OD1   . ASN E 3 497 ? 32.204  37.259 -113.314 1.00 26.54  ? 793 ASN A OD1   1 
ATOM   4949  N  ND2   . ASN E 3 497 ? 33.845  37.677 -111.834 1.00 26.49  ? 793 ASN A ND2   1 
ATOM   4950  N  N     . THR E 3 498 ? 31.063  40.089 -114.888 1.00 27.26  ? 794 THR A N     1 
ATOM   4951  C  CA    . THR E 3 498 ? 31.005  39.756 -116.312 1.00 26.02  ? 794 THR A CA    1 
ATOM   4952  C  C     . THR E 3 498 ? 31.840  40.647 -117.246 1.00 25.45  ? 794 THR A C     1 
ATOM   4953  O  O     . THR E 3 498 ? 32.524  40.156 -118.136 1.00 24.40  ? 794 THR A O     1 
ATOM   4954  C  CB    . THR E 3 498 ? 29.551  39.730 -116.802 1.00 26.19  ? 794 THR A CB    1 
ATOM   4955  O  OG1   . THR E 3 498 ? 28.850  38.695 -116.100 1.00 25.00  ? 794 THR A OG1   1 
ATOM   4956  C  CG2   . THR E 3 498 ? 29.497  39.462 -118.311 1.00 25.25  ? 794 THR A CG2   1 
ATOM   4957  N  N     . PRO E 3 499 ? 31.791  41.971 -117.066 1.00 25.73  ? 795 PRO A N     1 
ATOM   4958  C  CA    . PRO E 3 499 ? 32.619  42.741 -117.994 1.00 25.32  ? 795 PRO A CA    1 
ATOM   4959  C  C     . PRO E 3 499 ? 34.093  42.366 -117.839 1.00 25.11  ? 795 PRO A C     1 
ATOM   4960  O  O     . PRO E 3 499 ? 34.808  42.263 -118.825 1.00 25.76  ? 795 PRO A O     1 
ATOM   4961  C  CB    . PRO E 3 499 ? 32.348  44.181 -117.588 1.00 24.59  ? 795 PRO A CB    1 
ATOM   4962  C  CG    . PRO E 3 499 ? 30.923  44.116 -117.063 1.00 24.29  ? 795 PRO A CG    1 
ATOM   4963  C  CD    . PRO E 3 499 ? 30.943  42.854 -116.245 1.00 25.52  ? 795 PRO A CD    1 
ATOM   4964  N  N     . ILE E 3 500 ? 34.532  42.149 -116.603 1.00 25.11  ? 796 ILE A N     1 
ATOM   4965  C  CA    . ILE E 3 500 ? 35.932  41.812 -116.346 1.00 24.81  ? 796 ILE A CA    1 
ATOM   4966  C  C     . ILE E 3 500 ? 36.273  40.357 -116.663 1.00 24.63  ? 796 ILE A C     1 
ATOM   4967  O  O     . ILE E 3 500 ? 37.247  40.085 -117.372 1.00 24.25  ? 796 ILE A O     1 
ATOM   4968  C  CB    . ILE E 3 500 ? 36.351  42.125 -114.880 1.00 24.06  ? 796 ILE A CB    1 
ATOM   4969  C  CG1   . ILE E 3 500 ? 35.756  43.464 -114.421 1.00 22.59  ? 796 ILE A CG1   1 
ATOM   4970  C  CG2   . ILE E 3 500 ? 37.879  42.249 -114.805 1.00 23.21  ? 796 ILE A CG2   1 
ATOM   4971  C  CD1   . ILE E 3 500 ? 36.167  44.629 -115.229 1.00 20.95  ? 796 ILE A CD1   1 
ATOM   4972  N  N     . GLN E 3 501 ? 35.489  39.420 -116.150 1.00 24.57  ? 797 GLN A N     1 
ATOM   4973  C  CA    . GLN E 3 501 ? 35.753  38.006 -116.446 1.00 25.19  ? 797 GLN A CA    1 
ATOM   4974  C  C     . GLN E 3 501 ? 35.676  37.801 -117.973 1.00 25.05  ? 797 GLN A C     1 
ATOM   4975  O  O     . GLN E 3 501 ? 36.491  37.075 -118.567 1.00 25.05  ? 797 GLN A O     1 
ATOM   4976  C  CB    . GLN E 3 501 ? 34.745  37.096 -115.702 1.00 26.15  ? 797 GLN A CB    1 
ATOM   4977  C  CG    . GLN E 3 501 ? 34.519  35.737 -116.376 1.00 27.03  ? 797 GLN A CG    1 
ATOM   4978  C  CD    . GLN E 3 501 ? 34.103  34.612 -115.446 1.00 27.16  ? 797 GLN A CD    1 
ATOM   4979  O  OE1   . GLN E 3 501 ? 33.587  33.589 -115.901 1.00 28.21  ? 797 GLN A OE1   1 
ATOM   4980  N  NE2   . GLN E 3 501 ? 34.342  34.774 -114.150 1.00 27.88  ? 797 GLN A NE2   1 
ATOM   4981  N  N     . GLY E 3 502 ? 34.735  38.504 -118.605 1.00 24.64  ? 798 GLY A N     1 
ATOM   4982  C  CA    . GLY E 3 502 ? 34.537  38.400 -120.043 1.00 24.07  ? 798 GLY A CA    1 
ATOM   4983  C  C     . GLY E 3 502 ? 35.614  39.028 -120.921 1.00 24.25  ? 798 GLY A C     1 
ATOM   4984  O  O     . GLY E 3 502 ? 35.970  38.475 -121.950 1.00 22.97  ? 798 GLY A O     1 
ATOM   4985  N  N     . SER E 3 503 ? 36.111  40.194 -120.535 1.00 24.54  ? 799 SER A N     1 
ATOM   4986  C  CA    . SER E 3 503 ? 37.141  40.855 -121.306 1.00 24.73  ? 799 SER A CA    1 
ATOM   4987  C  C     . SER E 3 503 ? 38.424  40.033 -121.254 1.00 24.57  ? 799 SER A C     1 
ATOM   4988  O  O     . SER E 3 503 ? 39.147  39.945 -122.236 1.00 25.40  ? 799 SER A O     1 
ATOM   4989  C  CB    . SER E 3 503 ? 37.363  42.259 -120.757 1.00 25.50  ? 799 SER A CB    1 
ATOM   4990  O  OG    . SER E 3 503 ? 36.211  43.050 -121.019 1.00 25.97  ? 799 SER A OG    1 
ATOM   4991  N  N     . ALA E 3 504 ? 38.688  39.436 -120.099 1.00 24.19  ? 800 ALA A N     1 
ATOM   4992  C  CA    . ALA E 3 504 ? 39.858  38.598 -119.907 1.00 24.93  ? 800 ALA A CA    1 
ATOM   4993  C  C     . ALA E 3 504 ? 39.758  37.354 -120.799 1.00 25.27  ? 800 ALA A C     1 
ATOM   4994  O  O     . ALA E 3 504 ? 40.768  36.862 -121.315 1.00 25.44  ? 800 ALA A O     1 
ATOM   4995  C  CB    . ALA E 3 504 ? 39.965  38.196 -118.442 1.00 23.48  ? 800 ALA A CB    1 
ATOM   4996  N  N     . ALA E 3 505 ? 38.539  36.852 -120.977 1.00 23.89  ? 801 ALA A N     1 
ATOM   4997  C  CA    . ALA E 3 505 ? 38.286  35.676 -121.803 1.00 23.73  ? 801 ALA A CA    1 
ATOM   4998  C  C     . ALA E 3 505 ? 38.379  36.028 -123.275 1.00 23.56  ? 801 ALA A C     1 
ATOM   4999  O  O     . ALA E 3 505 ? 38.705  35.183 -124.099 1.00 24.12  ? 801 ALA A O     1 
ATOM   5000  C  CB    . ALA E 3 505 ? 36.899  35.092 -121.493 1.00 24.36  ? 801 ALA A CB    1 
ATOM   5001  N  N     . ASP E 3 506 ? 38.073  37.278 -123.606 1.00 23.41  ? 802 ASP A N     1 
ATOM   5002  C  CA    . ASP E 3 506 ? 38.147  37.718 -124.981 1.00 23.59  ? 802 ASP A CA    1 
ATOM   5003  C  C     . ASP E 3 506 ? 39.621  37.799 -125.374 1.00 23.60  ? 802 ASP A C     1 
ATOM   5004  O  O     . ASP E 3 506 ? 39.993  37.434 -126.479 1.00 23.27  ? 802 ASP A O     1 
ATOM   5005  C  CB    . ASP E 3 506 ? 37.532  39.108 -125.133 1.00 21.57  ? 802 ASP A CB    1 
ATOM   5006  C  CG    . ASP E 3 506 ? 36.006  39.096 -125.165 1.00 23.24  ? 802 ASP A CG    1 
ATOM   5007  O  OD1   . ASP E 3 506 ? 35.449  40.201 -125.052 1.00 21.61  ? 802 ASP A OD1   1 
ATOM   5008  O  OD2   . ASP E 3 506 ? 35.375  38.018 -125.323 1.00 21.23  ? 802 ASP A OD2   1 
ATOM   5009  N  N     . ILE E 3 507 ? 40.442  38.309 -124.458 1.00 25.05  ? 803 ILE A N     1 
ATOM   5010  C  CA    . ILE E 3 507 ? 41.872  38.477 -124.706 1.00 26.63  ? 803 ILE A CA    1 
ATOM   5011  C  C     . ILE E 3 507 ? 42.619  37.162 -124.827 1.00 27.91  ? 803 ILE A C     1 
ATOM   5012  O  O     . ILE E 3 507 ? 43.543  37.051 -125.625 1.00 30.13  ? 803 ILE A O     1 
ATOM   5013  C  CB    . ILE E 3 507 ? 42.526  39.345 -123.594 1.00 27.07  ? 803 ILE A CB    1 
ATOM   5014  C  CG1   . ILE E 3 507 ? 42.020  40.785 -123.710 1.00 26.02  ? 803 ILE A CG1   1 
ATOM   5015  C  CG2   . ILE E 3 507 ? 44.068  39.313 -123.709 1.00 27.01  ? 803 ILE A CG2   1 
ATOM   5016  C  CD1   . ILE E 3 507 ? 42.459  41.673 -122.572 1.00 25.71  ? 803 ILE A CD1   1 
ATOM   5017  N  N     . ILE E 3 508 ? 42.249  36.157 -124.047 1.00 28.69  ? 804 ILE A N     1 
ATOM   5018  C  CA    . ILE E 3 508 ? 42.960  34.895 -124.172 1.00 30.41  ? 804 ILE A CA    1 
ATOM   5019  C  C     . ILE E 3 508 ? 42.517  34.205 -125.474 1.00 30.37  ? 804 ILE A C     1 
ATOM   5020  O  O     . ILE E 3 508 ? 43.214  33.327 -125.994 1.00 29.84  ? 804 ILE A O     1 
ATOM   5021  C  CB    . ILE E 3 508 ? 42.696  33.964 -122.966 1.00 30.58  ? 804 ILE A CB    1 
ATOM   5022  C  CG1   . ILE E 3 508 ? 43.569  32.705 -123.078 1.00 32.04  ? 804 ILE A CG1   1 
ATOM   5023  C  CG2   . ILE E 3 508 ? 41.225  33.595 -122.899 1.00 30.39  ? 804 ILE A CG2   1 
ATOM   5024  C  CD1   . ILE E 3 508 ? 44.764  32.690 -122.139 1.00 31.32  ? 804 ILE A CD1   1 
ATOM   5025  N  N     . LYS E 3 509 ? 41.363  34.626 -125.998 1.00 29.91  ? 805 LYS A N     1 
ATOM   5026  C  CA    . LYS E 3 509 ? 40.817  34.067 -127.232 1.00 28.75  ? 805 LYS A CA    1 
ATOM   5027  C  C     . LYS E 3 509 ? 41.514  34.688 -128.432 1.00 29.05  ? 805 LYS A C     1 
ATOM   5028  O  O     . LYS E 3 509 ? 41.804  34.005 -129.422 1.00 29.35  ? 805 LYS A O     1 
ATOM   5029  C  CB    . LYS E 3 509 ? 39.303  34.327 -127.317 1.00 29.16  ? 805 LYS A CB    1 
ATOM   5030  C  CG    . LYS E 3 509 ? 38.445  33.232 -126.681 1.00 27.35  ? 805 LYS A CG    1 
ATOM   5031  C  CD    . LYS E 3 509 ? 36.963  33.603 -126.665 1.00 27.95  ? 805 LYS A CD    1 
ATOM   5032  C  CE    . LYS E 3 509 ? 36.095  32.386 -126.361 1.00 26.90  ? 805 LYS A CE    1 
ATOM   5033  N  NZ    . LYS E 3 509 ? 34.652  32.768 -126.185 1.00 28.02  ? 805 LYS A NZ    1 
ATOM   5034  N  N     . LYS E 3 510 ? 41.795  35.982 -128.337 1.00 28.21  ? 806 LYS A N     1 
ATOM   5035  C  CA    . LYS E 3 510 ? 42.453  36.689 -129.415 1.00 27.92  ? 806 LYS A CA    1 
ATOM   5036  C  C     . LYS E 3 510 ? 43.923  36.286 -129.463 1.00 27.47  ? 806 LYS A C     1 
ATOM   5037  O  O     . LYS E 3 510 ? 44.478  36.108 -130.542 1.00 26.71  ? 806 LYS A O     1 
ATOM   5038  C  CB    . LYS E 3 510 ? 42.338  38.200 -129.219 1.00 26.52  ? 806 LYS A CB    1 
ATOM   5039  C  CG    . LYS E 3 510 ? 42.905  38.991 -130.382 1.00 29.31  ? 806 LYS A CG    1 
ATOM   5040  C  CD    . LYS E 3 510 ? 42.671  40.481 -130.220 1.00 28.22  ? 806 LYS A CD    1 
ATOM   5041  C  CE    . LYS E 3 510 ? 43.176  41.261 -131.413 1.00 30.17  ? 806 LYS A CE    1 
ATOM   5042  N  NZ    . LYS E 3 510 ? 44.659  41.148 -131.608 1.00 30.81  ? 806 LYS A NZ    1 
ATOM   5043  N  N     . ALA E 3 511 ? 44.539  36.173 -128.290 1.00 27.68  ? 807 ALA A N     1 
ATOM   5044  C  CA    . ALA E 3 511 ? 45.938  35.770 -128.186 1.00 28.31  ? 807 ALA A CA    1 
ATOM   5045  C  C     . ALA E 3 511 ? 46.057  34.418 -128.846 1.00 28.25  ? 807 ALA A C     1 
ATOM   5046  O  O     . ALA E 3 511 ? 47.015  34.154 -129.558 1.00 28.77  ? 807 ALA A O     1 
ATOM   5047  C  CB    . ALA E 3 511 ? 46.366  35.664 -126.723 1.00 26.95  ? 807 ALA A CB    1 
ATOM   5048  N  N     . MET E 3 512 ? 45.077  33.554 -128.597 1.00 28.73  ? 808 MET A N     1 
ATOM   5049  C  CA    . MET E 3 512 ? 45.081  32.222 -129.190 1.00 28.87  ? 808 MET A CA    1 
ATOM   5050  C  C     . MET E 3 512 ? 45.027  32.325 -130.708 1.00 28.52  ? 808 MET A C     1 
ATOM   5051  O  O     . MET E 3 512 ? 45.667  31.537 -131.413 1.00 27.99  ? 808 MET A O     1 
ATOM   5052  C  CB    . MET E 3 512 ? 43.901  31.405 -128.671 1.00 30.29  ? 808 MET A CB    1 
ATOM   5053  C  CG    . MET E 3 512 ? 44.131  30.787 -127.297 1.00 30.35  ? 808 MET A CG    1 
ATOM   5054  S  SD    . MET E 3 512 ? 42.605  30.167 -126.559 1.00 30.67  ? 808 MET A SD    1 
ATOM   5055  C  CE    . MET E 3 512 ? 42.630  28.462 -127.086 1.00 28.48  ? 808 MET A CE    1 
ATOM   5056  N  N     . ILE E 3 513 ? 44.280  33.312 -131.205 1.00 27.34  ? 809 ILE A N     1 
ATOM   5057  C  CA    . ILE E 3 513 ? 44.161  33.530 -132.640 1.00 26.94  ? 809 ILE A CA    1 
ATOM   5058  C  C     . ILE E 3 513 ? 45.503  33.990 -133.201 1.00 26.83  ? 809 ILE A C     1 
ATOM   5059  O  O     . ILE E 3 513 ? 45.906  33.549 -134.267 1.00 26.87  ? 809 ILE A O     1 
ATOM   5060  C  CB    . ILE E 3 513 ? 43.065  34.582 -132.963 1.00 26.70  ? 809 ILE A CB    1 
ATOM   5061  C  CG1   . ILE E 3 513 ? 41.672  33.970 -132.743 1.00 26.87  ? 809 ILE A CG1   1 
ATOM   5062  C  CG2   . ILE E 3 513 ? 43.187  35.056 -134.401 1.00 26.05  ? 809 ILE A CG2   1 
ATOM   5063  C  CD1   . ILE E 3 513 ? 40.545  34.986 -132.779 1.00 27.36  ? 809 ILE A CD1   1 
ATOM   5064  N  N     . ASP E 3 514 ? 46.192  34.878 -132.487 1.00 26.70  ? 810 ASP A N     1 
ATOM   5065  C  CA    . ASP E 3 514 ? 47.488  35.350 -132.955 1.00 28.43  ? 810 ASP A CA    1 
ATOM   5066  C  C     . ASP E 3 514 ? 48.552  34.256 -132.826 1.00 28.64  ? 810 ASP A C     1 
ATOM   5067  O  O     . ASP E 3 514 ? 49.485  34.192 -133.631 1.00 29.70  ? 810 ASP A O     1 
ATOM   5068  C  CB    . ASP E 3 514 ? 47.942  36.582 -132.162 1.00 28.72  ? 810 ASP A CB    1 
ATOM   5069  C  CG    . ASP E 3 514 ? 46.938  37.731 -132.221 1.00 28.85  ? 810 ASP A CG    1 
ATOM   5070  O  OD1   . ASP E 3 514 ? 46.406  38.015 -133.314 1.00 28.10  ? 810 ASP A OD1   1 
ATOM   5071  O  OD2   . ASP E 3 514 ? 46.703  38.364 -131.163 1.00 30.94  ? 810 ASP A OD2   1 
ATOM   5072  N  N     . LEU E 3 515 ? 48.421  33.409 -131.809 1.00 28.53  ? 811 LEU A N     1 
ATOM   5073  C  CA    . LEU E 3 515 ? 49.383  32.343 -131.582 1.00 29.57  ? 811 LEU A CA    1 
ATOM   5074  C  C     . LEU E 3 515 ? 49.369  31.260 -132.658 1.00 30.25  ? 811 LEU A C     1 
ATOM   5075  O  O     . LEU E 3 515 ? 50.431  30.754 -133.045 1.00 30.85  ? 811 LEU A O     1 
ATOM   5076  C  CB    . LEU E 3 515 ? 49.164  31.716 -130.208 1.00 29.32  ? 811 LEU A CB    1 
ATOM   5077  C  CG    . LEU E 3 515 ? 50.115  30.579 -129.826 1.00 29.99  ? 811 LEU A CG    1 
ATOM   5078  C  CD1   . LEU E 3 515 ? 51.575  31.048 -129.944 1.00 29.24  ? 811 LEU A CD1   1 
ATOM   5079  C  CD2   . LEU E 3 515 ? 49.800  30.129 -128.415 1.00 29.94  ? 811 LEU A CD2   1 
ATOM   5080  N  N     . ASN E 3 516 ? 48.181  30.891 -133.130 1.00 29.78  ? 812 ASN A N     1 
ATOM   5081  C  CA    . ASN E 3 516 ? 48.067  29.885 -134.184 1.00 30.50  ? 812 ASN A CA    1 
ATOM   5082  C  C     . ASN E 3 516 ? 48.526  30.544 -135.485 1.00 30.61  ? 812 ASN A C     1 
ATOM   5083  O  O     . ASN E 3 516 ? 49.237  29.939 -136.287 1.00 29.84  ? 812 ASN A O     1 
ATOM   5084  C  CB    . ASN E 3 516 ? 46.625  29.395 -134.321 1.00 31.03  ? 812 ASN A CB    1 
ATOM   5085  C  CG    . ASN E 3 516 ? 46.518  28.098 -135.116 1.00 30.79  ? 812 ASN A CG    1 
ATOM   5086  O  OD1   . ASN E 3 516 ? 46.963  27.037 -134.670 1.00 32.73  ? 812 ASN A OD1   1 
ATOM   5087  N  ND2   . ASN E 3 516 ? 45.925  28.178 -136.293 1.00 31.28  ? 812 ASN A ND2   1 
ATOM   5088  N  N     . ALA E 3 517 ? 48.138  31.802 -135.680 1.00 31.38  ? 813 ALA A N     1 
ATOM   5089  C  CA    . ALA E 3 517 ? 48.547  32.532 -136.871 1.00 31.79  ? 813 ALA A CA    1 
ATOM   5090  C  C     . ALA E 3 517 ? 50.086  32.680 -136.911 1.00 32.47  ? 813 ALA A C     1 
ATOM   5091  O  O     . ALA E 3 517 ? 50.686  32.636 -137.983 1.00 31.41  ? 813 ALA A O     1 
ATOM   5092  C  CB    . ALA E 3 517 ? 47.883  33.904 -136.892 1.00 32.32  ? 813 ALA A CB    1 
ATOM   5093  N  N     . ARG E 3 518 ? 50.714  32.839 -135.744 1.00 32.99  ? 814 ARG A N     1 
ATOM   5094  C  CA    . ARG E 3 518 ? 52.171  32.990 -135.666 1.00 34.19  ? 814 ARG A CA    1 
ATOM   5095  C  C     . ARG E 3 518 ? 52.881  31.651 -135.839 1.00 34.13  ? 814 ARG A C     1 
ATOM   5096  O  O     . ARG E 3 518 ? 53.833  31.537 -136.614 1.00 34.33  ? 814 ARG A O     1 
ATOM   5097  C  CB    . ARG E 3 518 ? 52.592  33.591 -134.322 1.00 34.29  ? 814 ARG A CB    1 
ATOM   5098  C  CG    . ARG E 3 518 ? 52.124  35.008 -134.074 1.00 35.49  ? 814 ARG A CG    1 
ATOM   5099  C  CD    . ARG E 3 518 ? 52.726  35.945 -135.075 1.00 37.01  ? 814 ARG A CD    1 
ATOM   5100  N  NE    . ARG E 3 518 ? 54.144  35.639 -135.264 1.00 37.06  ? 814 ARG A NE    1 
ATOM   5101  C  CZ    . ARG E 3 518 ? 54.986  36.419 -135.925 1.00 37.22  ? 814 ARG A CZ    1 
ATOM   5102  N  NH1   . ARG E 3 518 ? 54.553  37.558 -136.455 1.00 36.70  ? 814 ARG A NH1   1 
ATOM   5103  N  NH2   . ARG E 3 518 ? 56.254  36.048 -136.071 1.00 37.32  ? 814 ARG A NH2   1 
ATOM   5104  N  N     . LEU E 3 519 ? 52.425  30.649 -135.098 1.00 34.50  ? 815 LEU A N     1 
ATOM   5105  C  CA    . LEU E 3 519 ? 53.003  29.310 -135.169 1.00 35.25  ? 815 LEU A CA    1 
ATOM   5106  C  C     . LEU E 3 519 ? 52.905  28.758 -136.596 1.00 35.50  ? 815 LEU A C     1 
ATOM   5107  O  O     . LEU E 3 519 ? 53.742  27.966 -137.029 1.00 35.91  ? 815 LEU A O     1 
ATOM   5108  C  CB    . LEU E 3 519 ? 52.275  28.375 -134.200 1.00 35.11  ? 815 LEU A CB    1 
ATOM   5109  C  CG    . LEU E 3 519 ? 52.354  28.663 -132.695 1.00 35.54  ? 815 LEU A CG    1 
ATOM   5110  C  CD1   . LEU E 3 519 ? 51.318  27.826 -131.953 1.00 35.87  ? 815 LEU A CD1   1 
ATOM   5111  C  CD2   . LEU E 3 519 ? 53.747  28.373 -132.185 1.00 35.71  ? 815 LEU A CD2   1 
ATOM   5112  N  N     . LYS E 3 520 ? 51.890  29.201 -137.326 1.00 36.13  ? 816 LYS A N     1 
ATOM   5113  C  CA    . LYS E 3 520 ? 51.669  28.756 -138.699 1.00 36.95  ? 816 LYS A CA    1 
ATOM   5114  C  C     . LYS E 3 520 ? 52.515  29.494 -139.734 1.00 37.02  ? 816 LYS A C     1 
ATOM   5115  O  O     . LYS E 3 520 ? 53.058  28.882 -140.658 1.00 36.94  ? 816 LYS A O     1 
ATOM   5116  C  CB    . LYS E 3 520 ? 50.182  28.898 -139.065 1.00 37.49  ? 816 LYS A CB    1 
ATOM   5117  C  CG    . LYS E 3 520 ? 49.327  27.672 -138.740 1.00 38.05  ? 816 LYS A CG    1 
ATOM   5118  C  CD    . LYS E 3 520 ? 49.455  27.250 -137.290 1.00 38.84  ? 816 LYS A CD    1 
ATOM   5119  C  CE    . LYS E 3 520 ? 48.878  25.856 -137.060 1.00 38.75  ? 816 LYS A CE    1 
ATOM   5120  N  NZ    . LYS E 3 520 ? 49.132  25.401 -135.658 1.00 39.54  ? 816 LYS A NZ    1 
ATOM   5121  N  N     . GLU E 3 521 ? 52.625  30.807 -139.594 1.00 37.58  ? 817 GLU A N     1 
ATOM   5122  C  CA    . GLU E 3 521 ? 53.392  31.567 -140.558 1.00 39.01  ? 817 GLU A CA    1 
ATOM   5123  C  C     . GLU E 3 521 ? 54.883  31.423 -140.331 1.00 39.23  ? 817 GLU A C     1 
ATOM   5124  O  O     . GLU E 3 521 ? 55.688  31.886 -141.135 1.00 39.58  ? 817 GLU A O     1 
ATOM   5125  C  CB    . GLU E 3 521 ? 52.967  33.033 -140.545 1.00 40.14  ? 817 GLU A CB    1 
ATOM   5126  C  CG    . GLU E 3 521 ? 53.015  33.735 -139.207 1.00 42.06  ? 817 GLU A CG    1 
ATOM   5127  C  CD    . GLU E 3 521 ? 52.304  35.078 -139.265 1.00 42.58  ? 817 GLU A CD    1 
ATOM   5128  O  OE1   . GLU E 3 521 ? 52.502  35.915 -138.359 1.00 43.39  ? 817 GLU A OE1   1 
ATOM   5129  O  OE2   . GLU E 3 521 ? 51.540  35.290 -140.229 1.00 43.60  ? 817 GLU A OE2   1 
ATOM   5130  N  N     . GLU E 3 522 ? 55.229  30.741 -139.244 1.00 39.45  ? 818 GLU A N     1 
ATOM   5131  C  CA    . GLU E 3 522 ? 56.610  30.478 -138.870 1.00 39.70  ? 818 GLU A CA    1 
ATOM   5132  C  C     . GLU E 3 522 ? 56.813  28.967 -138.982 1.00 39.62  ? 818 GLU A C     1 
ATOM   5133  O  O     . GLU E 3 522 ? 57.921  28.452 -138.845 1.00 39.03  ? 818 GLU A O     1 
ATOM   5134  C  CB    . GLU E 3 522 ? 56.855  30.953 -137.440 1.00 39.24  ? 818 GLU A CB    1 
ATOM   5135  C  CG    . GLU E 3 522 ? 58.298  31.215 -137.126 1.00 38.97  ? 818 GLU A CG    1 
ATOM   5136  C  CD    . GLU E 3 522 ? 58.472  32.098 -135.909 1.00 37.95  ? 818 GLU A CD    1 
ATOM   5137  O  OE1   . GLU E 3 522 ? 57.970  33.238 -135.920 1.00 38.01  ? 818 GLU A OE1   1 
ATOM   5138  O  OE2   . GLU E 3 522 ? 59.115  31.655 -134.944 1.00 37.85  ? 818 GLU A OE2   1 
ATOM   5139  N  N     . ARG E 3 523 ? 55.709  28.274 -139.237 1.00 40.29  ? 819 ARG A N     1 
ATOM   5140  C  CA    . ARG E 3 523 ? 55.697  26.826 -139.405 1.00 40.70  ? 819 ARG A CA    1 
ATOM   5141  C  C     . ARG E 3 523 ? 56.528  26.074 -138.369 1.00 39.43  ? 819 ARG A C     1 
ATOM   5142  O  O     . ARG E 3 523 ? 57.670  25.710 -138.632 1.00 39.27  ? 819 ARG A O     1 
ATOM   5143  C  CB    . ARG E 3 523 ? 56.174  26.473 -140.821 1.00 43.50  ? 819 ARG A CB    1 
ATOM   5144  C  CG    . ARG E 3 523 ? 55.390  27.194 -141.915 1.00 46.63  ? 819 ARG A CG    1 
ATOM   5145  C  CD    . ARG E 3 523 ? 55.812  26.789 -143.320 1.00 50.49  ? 819 ARG A CD    1 
ATOM   5146  N  NE    . ARG E 3 523 ? 54.964  27.421 -144.340 1.00 53.48  ? 819 ARG A NE    1 
ATOM   5147  C  CZ    . ARG E 3 523 ? 55.113  27.255 -145.655 1.00 54.42  ? 819 ARG A CZ    1 
ATOM   5148  N  NH1   . ARG E 3 523 ? 56.079  26.472 -146.129 1.00 54.89  ? 819 ARG A NH1   1 
ATOM   5149  N  NH2   . ARG E 3 523 ? 54.297  27.876 -146.498 1.00 54.91  ? 819 ARG A NH2   1 
ATOM   5150  N  N     . LEU E 3 524 ? 55.949  25.851 -137.189 1.00 37.94  ? 820 LEU A N     1 
ATOM   5151  C  CA    . LEU E 3 524 ? 56.627  25.125 -136.118 1.00 36.52  ? 820 LEU A CA    1 
ATOM   5152  C  C     . LEU E 3 524 ? 55.866  23.836 -135.816 1.00 36.09  ? 820 LEU A C     1 
ATOM   5153  O  O     . LEU E 3 524 ? 54.677  23.734 -136.119 1.00 36.36  ? 820 LEU A O     1 
ATOM   5154  C  CB    . LEU E 3 524 ? 56.679  25.962 -134.836 1.00 35.22  ? 820 LEU A CB    1 
ATOM   5155  C  CG    . LEU E 3 524 ? 57.212  27.394 -134.887 1.00 34.62  ? 820 LEU A CG    1 
ATOM   5156  C  CD1   . LEU E 3 524 ? 57.094  28.004 -133.500 1.00 33.19  ? 820 LEU A CD1   1 
ATOM   5157  C  CD2   . LEU E 3 524 ? 58.657  27.411 -135.373 1.00 32.98  ? 820 LEU A CD2   1 
ATOM   5158  N  N     . GLN E 3 525 ? 56.555  22.869 -135.210 1.00 36.06  ? 821 GLN A N     1 
ATOM   5159  C  CA    . GLN E 3 525 ? 55.957  21.592 -134.821 1.00 36.38  ? 821 GLN A CA    1 
ATOM   5160  C  C     . GLN E 3 525 ? 55.103  21.771 -133.560 1.00 36.62  ? 821 GLN A C     1 
ATOM   5161  O  O     . GLN E 3 525 ? 54.334  20.880 -133.192 1.00 37.24  ? 821 GLN A O     1 
ATOM   5162  C  CB    . GLN E 3 525 ? 57.043  20.543 -134.519 1.00 36.69  ? 821 GLN A CB    1 
ATOM   5163  C  CG    . GLN E 3 525 ? 57.779  19.992 -135.733 1.00 38.00  ? 821 GLN A CG    1 
ATOM   5164  C  CD    . GLN E 3 525 ? 58.645  18.775 -135.402 1.00 38.57  ? 821 GLN A CD    1 
ATOM   5165  O  OE1   . GLN E 3 525 ? 59.814  18.906 -135.041 1.00 38.69  ? 821 GLN A OE1   1 
ATOM   5166  N  NE2   . GLN E 3 525 ? 58.064  17.584 -135.523 1.00 38.32  ? 821 GLN A NE2   1 
ATOM   5167  N  N     . ALA E 3 526 ? 55.249  22.920 -132.902 1.00 35.58  ? 822 ALA A N     1 
ATOM   5168  C  CA    . ALA E 3 526 ? 54.523  23.211 -131.669 1.00 35.48  ? 822 ALA A CA    1 
ATOM   5169  C  C     . ALA E 3 526 ? 53.068  23.589 -131.896 1.00 34.97  ? 822 ALA A C     1 
ATOM   5170  O  O     . ALA E 3 526 ? 52.721  24.194 -132.908 1.00 35.30  ? 822 ALA A O     1 
ATOM   5171  C  CB    . ALA E 3 526 ? 55.217  24.326 -130.910 1.00 34.96  ? 822 ALA A CB    1 
ATOM   5172  N  N     . HIS E 3 527 ? 52.222  23.245 -130.935 1.00 34.83  ? 823 HIS A N     1 
ATOM   5173  C  CA    . HIS E 3 527 ? 50.802  23.561 -131.032 1.00 34.13  ? 823 HIS A CA    1 
ATOM   5174  C  C     . HIS E 3 527 ? 50.138  23.614 -129.660 1.00 33.49  ? 823 HIS A C     1 
ATOM   5175  O  O     . HIS E 3 527 ? 50.646  23.066 -128.680 1.00 33.44  ? 823 HIS A O     1 
ATOM   5176  C  CB    . HIS E 3 527 ? 50.091  22.530 -131.927 1.00 33.79  ? 823 HIS A CB    1 
ATOM   5177  C  CG    . HIS E 3 527 ? 50.271  21.109 -131.483 1.00 33.69  ? 823 HIS A CG    1 
ATOM   5178  N  ND1   . HIS E 3 527 ? 49.377  20.465 -130.654 1.00 33.90  ? 823 HIS A ND1   1 
ATOM   5179  C  CD2   . HIS E 3 527 ? 51.252  20.212 -131.744 1.00 33.73  ? 823 HIS A CD2   1 
ATOM   5180  C  CE1   . HIS E 3 527 ? 49.799  19.233 -130.425 1.00 33.31  ? 823 HIS A CE1   1 
ATOM   5181  N  NE2   . HIS E 3 527 ? 50.935  19.055 -131.075 1.00 33.82  ? 823 HIS A NE2   1 
ATOM   5182  N  N     . LEU E 3 528 ? 49.000  24.289 -129.603 1.00 32.78  ? 824 LEU A N     1 
ATOM   5183  C  CA    . LEU E 3 528 ? 48.240  24.415 -128.372 1.00 32.49  ? 824 LEU A CA    1 
ATOM   5184  C  C     . LEU E 3 528 ? 47.667  23.071 -127.942 1.00 32.19  ? 824 LEU A C     1 
ATOM   5185  O  O     . LEU E 3 528 ? 47.295  22.248 -128.778 1.00 32.52  ? 824 LEU A O     1 
ATOM   5186  C  CB    . LEU E 3 528 ? 47.096  25.404 -128.575 1.00 32.01  ? 824 LEU A CB    1 
ATOM   5187  C  CG    . LEU E 3 528 ? 47.500  26.873 -128.530 1.00 32.01  ? 824 LEU A CG    1 
ATOM   5188  C  CD1   . LEU E 3 528 ? 46.482  27.711 -129.287 1.00 30.61  ? 824 LEU A CD1   1 
ATOM   5189  C  CD2   . LEU E 3 528 ? 47.616  27.314 -127.056 1.00 30.35  ? 824 LEU A CD2   1 
ATOM   5190  N  N     . LEU E 3 529 ? 47.610  22.851 -126.635 1.00 31.63  ? 825 LEU A N     1 
ATOM   5191  C  CA    . LEU E 3 529 ? 47.058  21.629 -126.101 1.00 31.17  ? 825 LEU A CA    1 
ATOM   5192  C  C     . LEU E 3 529 ? 45.850  21.946 -125.229 1.00 31.23  ? 825 LEU A C     1 
ATOM   5193  O  O     . LEU E 3 529 ? 44.846  21.230 -125.264 1.00 31.41  ? 825 LEU A O     1 
ATOM   5194  C  CB    . LEU E 3 529 ? 48.088  20.872 -125.264 1.00 31.34  ? 825 LEU A CB    1 
ATOM   5195  C  CG    . LEU E 3 529 ? 49.248  20.144 -125.946 1.00 31.09  ? 825 LEU A CG    1 
ATOM   5196  C  CD1   . LEU E 3 529 ? 49.935  19.290 -124.897 1.00 31.52  ? 825 LEU A CD1   1 
ATOM   5197  C  CD2   . LEU E 3 529 ? 48.763  19.263 -127.088 1.00 32.07  ? 825 LEU A CD2   1 
ATOM   5198  N  N     . LEU E 3 530 ? 45.950  23.019 -124.450 1.00 31.06  ? 826 LEU A N     1 
ATOM   5199  C  CA    . LEU E 3 530 ? 44.870  23.404 -123.550 1.00 30.38  ? 826 LEU A CA    1 
ATOM   5200  C  C     . LEU E 3 530 ? 44.774  24.901 -123.356 1.00 29.78  ? 826 LEU A C     1 
ATOM   5201  O  O     . LEU E 3 530 ? 45.724  25.635 -123.615 1.00 30.11  ? 826 LEU A O     1 
ATOM   5202  C  CB    . LEU E 3 530 ? 45.084  22.794 -122.154 1.00 30.58  ? 826 LEU A CB    1 
ATOM   5203  C  CG    . LEU E 3 530 ? 45.206  21.291 -121.906 1.00 32.05  ? 826 LEU A CG    1 
ATOM   5204  C  CD1   . LEU E 3 530 ? 45.560  21.063 -120.444 1.00 32.36  ? 826 LEU A CD1   1 
ATOM   5205  C  CD2   . LEU E 3 530 ? 43.893  20.589 -122.250 1.00 32.19  ? 826 LEU A CD2   1 
ATOM   5206  N  N     . GLN E 3 531 ? 43.608  25.344 -122.897 1.00 27.92  ? 827 GLN A N     1 
ATOM   5207  C  CA    . GLN E 3 531 ? 43.398  26.741 -122.552 1.00 26.69  ? 827 GLN A CA    1 
ATOM   5208  C  C     . GLN E 3 531 ? 42.823  26.641 -121.142 1.00 26.51  ? 827 GLN A C     1 
ATOM   5209  O  O     . GLN E 3 531 ? 41.863  25.899 -120.914 1.00 27.41  ? 827 GLN A O     1 
ATOM   5210  C  CB    . GLN E 3 531 ? 42.397  27.434 -123.480 1.00 25.93  ? 827 GLN A CB    1 
ATOM   5211  C  CG    . GLN E 3 531 ? 42.185  28.918 -123.120 1.00 24.76  ? 827 GLN A CG    1 
ATOM   5212  C  CD    . GLN E 3 531 ? 40.935  29.186 -122.246 1.00 25.49  ? 827 GLN A CD    1 
ATOM   5213  O  OE1   . GLN E 3 531 ? 40.426  28.291 -121.566 1.00 22.80  ? 827 GLN A OE1   1 
ATOM   5214  N  NE2   . GLN E 3 531 ? 40.455  30.438 -122.265 1.00 23.67  ? 827 GLN A NE2   1 
ATOM   5215  N  N     . VAL E 3 532 ? 43.423  27.343 -120.190 1.00 25.28  ? 828 VAL A N     1 
ATOM   5216  C  CA    . VAL E 3 532 ? 42.945  27.298 -118.820 1.00 26.16  ? 828 VAL A CA    1 
ATOM   5217  C  C     . VAL E 3 532 ? 42.599  28.700 -118.329 1.00 26.81  ? 828 VAL A C     1 
ATOM   5218  O  O     . VAL E 3 532 ? 43.227  29.231 -117.414 1.00 28.41  ? 828 VAL A O     1 
ATOM   5219  C  CB    . VAL E 3 532 ? 43.992  26.621 -117.891 1.00 26.34  ? 828 VAL A CB    1 
ATOM   5220  C  CG1   . VAL E 3 532 ? 43.492  26.583 -116.457 1.00 27.03  ? 828 VAL A CG1   1 
ATOM   5221  C  CG2   . VAL E 3 532 ? 44.263  25.195 -118.376 1.00 24.33  ? 828 VAL A CG2   1 
ATOM   5222  N  N     . HIS E 3 533 ? 41.603  29.295 -118.987 1.00 25.99  ? 829 HIS A N     1 
ATOM   5223  C  CA    . HIS E 3 533 ? 41.082  30.616 -118.673 1.00 25.95  ? 829 HIS A CA    1 
ATOM   5224  C  C     . HIS E 3 533 ? 42.027  31.778 -118.905 1.00 25.98  ? 829 HIS A C     1 
ATOM   5225  O  O     . HIS E 3 533 ? 41.632  32.807 -119.464 1.00 26.30  ? 829 HIS A O     1 
ATOM   5226  C  CB    . HIS E 3 533 ? 40.522  30.585 -117.252 1.00 26.39  ? 829 HIS A CB    1 
ATOM   5227  C  CG    . HIS E 3 533 ? 39.535  29.475 -117.060 1.00 27.01  ? 829 HIS A CG    1 
ATOM   5228  N  ND1   . HIS E 3 533 ? 39.669  28.512 -116.082 1.00 28.06  ? 829 HIS A ND1   1 
ATOM   5229  C  CD2   . HIS E 3 533 ? 38.504  29.075 -117.838 1.00 26.92  ? 829 HIS A CD2   1 
ATOM   5230  C  CE1   . HIS E 3 533 ? 38.775  27.561 -116.277 1.00 27.58  ? 829 HIS A CE1   1 
ATOM   5231  N  NE2   . HIS E 3 533 ? 38.056  27.877 -117.339 1.00 28.27  ? 829 HIS A NE2   1 
ATOM   5232  N  N     . ASP E 3 534 ? 43.274  31.647 -118.484 1.00 25.93  ? 830 ASP A N     1 
ATOM   5233  C  CA    . ASP E 3 534 ? 44.205  32.730 -118.748 1.00 25.25  ? 830 ASP A CA    1 
ATOM   5234  C  C     . ASP E 3 534 ? 45.615  32.158 -118.837 1.00 26.39  ? 830 ASP A C     1 
ATOM   5235  O  O     . ASP E 3 534 ? 46.603  32.802 -118.482 1.00 25.21  ? 830 ASP A O     1 
ATOM   5236  C  CB    . ASP E 3 534 ? 44.065  33.834 -117.691 1.00 24.18  ? 830 ASP A CB    1 
ATOM   5237  C  CG    . ASP E 3 534 ? 44.941  33.632 -116.484 1.00 23.21  ? 830 ASP A CG    1 
ATOM   5238  O  OD1   . ASP E 3 534 ? 45.086  32.493 -115.983 1.00 22.24  ? 830 ASP A OD1   1 
ATOM   5239  O  OD2   . ASP E 3 534 ? 45.485  34.654 -116.018 1.00 23.87  ? 830 ASP A OD2   1 
ATOM   5240  N  N     . GLU E 3 535 ? 45.660  30.930 -119.346 1.00 27.54  ? 831 GLU A N     1 
ATOM   5241  C  CA    . GLU E 3 535 ? 46.880  30.164 -119.539 1.00 30.03  ? 831 GLU A CA    1 
ATOM   5242  C  C     . GLU E 3 535 ? 46.739  29.215 -120.729 1.00 30.73  ? 831 GLU A C     1 
ATOM   5243  O  O     . GLU E 3 535 ? 45.712  28.538 -120.892 1.00 29.67  ? 831 GLU A O     1 
ATOM   5244  C  CB    . GLU E 3 535 ? 47.205  29.349 -118.280 1.00 32.14  ? 831 GLU A CB    1 
ATOM   5245  C  CG    . GLU E 3 535 ? 48.132  28.175 -118.562 1.00 35.83  ? 831 GLU A CG    1 
ATOM   5246  C  CD    . GLU E 3 535 ? 48.667  27.512 -117.314 1.00 37.72  ? 831 GLU A CD    1 
ATOM   5247  O  OE1   . GLU E 3 535 ? 49.663  28.022 -116.758 1.00 38.88  ? 831 GLU A OE1   1 
ATOM   5248  O  OE2   . GLU E 3 535 ? 48.090  26.486 -116.887 1.00 39.27  ? 831 GLU A OE2   1 
ATOM   5249  N  N     . LEU E 3 536 ? 47.774  29.174 -121.566 1.00 30.94  ? 832 LEU A N     1 
ATOM   5250  C  CA    . LEU E 3 536 ? 47.783  28.299 -122.736 1.00 31.08  ? 832 LEU A CA    1 
ATOM   5251  C  C     . LEU E 3 536 ? 48.871  27.267 -122.500 1.00 31.67  ? 832 LEU A C     1 
ATOM   5252  O  O     . LEU E 3 536 ? 49.903  27.568 -121.903 1.00 31.63  ? 832 LEU A O     1 
ATOM   5253  C  CB    . LEU E 3 536 ? 48.085  29.097 -124.007 1.00 29.82  ? 832 LEU A CB    1 
ATOM   5254  C  CG    . LEU E 3 536 ? 47.133  30.272 -124.261 1.00 30.47  ? 832 LEU A CG    1 
ATOM   5255  C  CD1   . LEU E 3 536 ? 47.469  30.938 -125.589 1.00 30.05  ? 832 LEU A CD1   1 
ATOM   5256  C  CD2   . LEU E 3 536 ? 45.698  29.768 -124.259 1.00 29.71  ? 832 LEU A CD2   1 
ATOM   5257  N  N     . ILE E 3 537 ? 48.638  26.043 -122.945 1.00 32.32  ? 833 ILE A N     1 
ATOM   5258  C  CA    . ILE E 3 537 ? 49.626  25.000 -122.744 1.00 32.72  ? 833 ILE A CA    1 
ATOM   5259  C  C     . ILE E 3 537 ? 49.922  24.303 -124.056 1.00 33.21  ? 833 ILE A C     1 
ATOM   5260  O  O     . ILE E 3 537 ? 49.081  23.569 -124.591 1.00 32.66  ? 833 ILE A O     1 
ATOM   5261  C  CB    . ILE E 3 537 ? 49.146  24.009 -121.690 1.00 32.68  ? 833 ILE A CB    1 
ATOM   5262  C  CG1   . ILE E 3 537 ? 48.912  24.763 -120.378 1.00 32.87  ? 833 ILE A CG1   1 
ATOM   5263  C  CG2   . ILE E 3 537 ? 50.177  22.923 -121.481 1.00 32.69  ? 833 ILE A CG2   1 
ATOM   5264  C  CD1   . ILE E 3 537 ? 48.331  23.932 -119.294 1.00 33.02  ? 833 ILE A CD1   1 
ATOM   5265  N  N     . LEU E 3 538 ? 51.126  24.562 -124.568 1.00 33.36  ? 834 LEU A N     1 
ATOM   5266  C  CA    . LEU E 3 538 ? 51.599  24.011 -125.833 1.00 34.35  ? 834 LEU A CA    1 
ATOM   5267  C  C     . LEU E 3 538 ? 52.606  22.888 -125.647 1.00 34.92  ? 834 LEU A C     1 
ATOM   5268  O  O     . LEU E 3 538 ? 53.202  22.735 -124.581 1.00 34.97  ? 834 LEU A O     1 
ATOM   5269  C  CB    . LEU E 3 538 ? 52.272  25.094 -126.680 1.00 34.12  ? 834 LEU A CB    1 
ATOM   5270  C  CG    . LEU E 3 538 ? 51.501  26.237 -127.347 1.00 35.08  ? 834 LEU A CG    1 
ATOM   5271  C  CD1   . LEU E 3 538 ? 51.092  27.287 -126.312 1.00 35.31  ? 834 LEU A CD1   1 
ATOM   5272  C  CD2   . LEU E 3 538 ? 52.399  26.876 -128.408 1.00 34.96  ? 834 LEU A CD2   1 
ATOM   5273  N  N     . GLU E 3 539 ? 52.771  22.087 -126.693 1.00 35.73  ? 835 GLU A N     1 
ATOM   5274  C  CA    . GLU E 3 539 ? 53.746  21.008 -126.685 1.00 35.91  ? 835 GLU A CA    1 
ATOM   5275  C  C     . GLU E 3 539 ? 54.567  21.176 -127.954 1.00 36.36  ? 835 GLU A C     1 
ATOM   5276  O  O     . GLU E 3 539 ? 54.018  21.497 -129.010 1.00 36.60  ? 835 GLU A O     1 
ATOM   5277  C  CB    . GLU E 3 539 ? 53.070  19.639 -126.660 1.00 36.33  ? 835 GLU A CB    1 
ATOM   5278  C  CG    . GLU E 3 539 ? 52.107  19.368 -127.799 1.00 36.51  ? 835 GLU A CG    1 
ATOM   5279  C  CD    . GLU E 3 539 ? 51.929  17.883 -128.023 1.00 36.63  ? 835 GLU A CD    1 
ATOM   5280  O  OE1   . GLU E 3 539 ? 51.872  17.136 -127.023 1.00 36.78  ? 835 GLU A OE1   1 
ATOM   5281  O  OE2   . GLU E 3 539 ? 51.849  17.461 -129.194 1.00 37.49  ? 835 GLU A OE2   1 
ATOM   5282  N  N     . ALA E 3 540 ? 55.881  20.975 -127.848 1.00 36.38  ? 836 ALA A N     1 
ATOM   5283  C  CA    . ALA E 3 540 ? 56.776  21.129 -128.988 1.00 36.34  ? 836 ALA A CA    1 
ATOM   5284  C  C     . ALA E 3 540 ? 58.086  20.381 -128.777 1.00 36.49  ? 836 ALA A C     1 
ATOM   5285  O  O     . ALA E 3 540 ? 58.401  19.953 -127.667 1.00 36.03  ? 836 ALA A O     1 
ATOM   5286  C  CB    . ALA E 3 540 ? 57.072  22.600 -129.212 1.00 36.46  ? 836 ALA A CB    1 
ATOM   5287  N  N     . PRO E 3 541 ? 58.860  20.192 -129.856 1.00 36.96  ? 837 PRO A N     1 
ATOM   5288  C  CA    . PRO E 3 541 ? 60.133  19.487 -129.678 1.00 37.09  ? 837 PRO A CA    1 
ATOM   5289  C  C     . PRO E 3 541 ? 61.047  20.411 -128.875 1.00 37.24  ? 837 PRO A C     1 
ATOM   5290  O  O     . PRO E 3 541 ? 60.872  21.635 -128.886 1.00 36.48  ? 837 PRO A O     1 
ATOM   5291  C  CB    . PRO E 3 541 ? 60.615  19.281 -131.110 1.00 36.91  ? 837 PRO A CB    1 
ATOM   5292  C  CG    . PRO E 3 541 ? 60.089  20.508 -131.814 1.00 36.39  ? 837 PRO A CG    1 
ATOM   5293  C  CD    . PRO E 3 541 ? 58.676  20.615 -131.257 1.00 36.99  ? 837 PRO A CD    1 
ATOM   5294  N  N     . LYS E 3 542 ? 62.015  19.829 -128.180 1.00 38.35  ? 838 LYS A N     1 
ATOM   5295  C  CA    . LYS E 3 542 ? 62.944  20.603 -127.364 1.00 38.52  ? 838 LYS A CA    1 
ATOM   5296  C  C     . LYS E 3 542 ? 63.626  21.725 -128.139 1.00 38.72  ? 838 LYS A C     1 
ATOM   5297  O  O     . LYS E 3 542 ? 63.900  22.791 -127.581 1.00 38.54  ? 838 LYS A O     1 
ATOM   5298  C  CB    . LYS E 3 542 ? 64.006  19.678 -126.773 1.00 40.28  ? 838 LYS A CB    1 
ATOM   5299  C  CG    . LYS E 3 542 ? 63.441  18.445 -126.097 1.00 40.78  ? 838 LYS A CG    1 
ATOM   5300  C  CD    . LYS E 3 542 ? 64.535  17.639 -125.424 1.00 41.99  ? 838 LYS A CD    1 
ATOM   5301  C  CE    . LYS E 3 542 ? 65.614  17.206 -126.415 1.00 42.94  ? 838 LYS A CE    1 
ATOM   5302  N  NZ    . LYS E 3 542 ? 66.658  16.371 -125.734 1.00 42.63  ? 838 LYS A NZ    1 
ATOM   5303  N  N     . GLU E 3 543 ? 63.883  21.483 -129.423 1.00 38.94  ? 839 GLU A N     1 
ATOM   5304  C  CA    . GLU E 3 543 ? 64.554  22.444 -130.303 1.00 39.24  ? 839 GLU A CA    1 
ATOM   5305  C  C     . GLU E 3 543 ? 63.790  23.732 -130.610 1.00 38.97  ? 839 GLU A C     1 
ATOM   5306  O  O     . GLU E 3 543 ? 64.344  24.642 -131.226 1.00 38.89  ? 839 GLU A O     1 
ATOM   5307  C  CB    . GLU E 3 543 ? 64.897  21.793 -131.645 1.00 40.44  ? 839 GLU A CB    1 
ATOM   5308  C  CG    . GLU E 3 543 ? 65.775  20.558 -131.574 1.00 42.07  ? 839 GLU A CG    1 
ATOM   5309  C  CD    . GLU E 3 543 ? 65.038  19.349 -131.053 1.00 42.91  ? 839 GLU A CD    1 
ATOM   5310  O  OE1   . GLU E 3 543 ? 63.800  19.436 -130.882 1.00 43.09  ? 839 GLU A OE1   1 
ATOM   5311  O  OE2   . GLU E 3 543 ? 65.699  18.309 -130.817 1.00 43.74  ? 839 GLU A OE2   1 
ATOM   5312  N  N     . GLU E 3 544 ? 62.523  23.809 -130.214 1.00 38.57  ? 840 GLU A N     1 
ATOM   5313  C  CA    . GLU E 3 544 ? 61.727  25.002 -130.491 1.00 37.80  ? 840 GLU A CA    1 
ATOM   5314  C  C     . GLU E 3 544 ? 61.511  25.853 -129.253 1.00 37.44  ? 840 GLU A C     1 
ATOM   5315  O  O     . GLU E 3 544 ? 61.088  27.002 -129.353 1.00 37.40  ? 840 GLU A O     1 
ATOM   5316  C  CB    . GLU E 3 544 ? 60.369  24.611 -131.101 1.00 37.41  ? 840 GLU A CB    1 
ATOM   5317  C  CG    . GLU E 3 544 ? 60.477  23.947 -132.479 1.00 36.39  ? 840 GLU A CG    1 
ATOM   5318  C  CD    . GLU E 3 544 ? 59.126  23.709 -133.167 1.00 36.31  ? 840 GLU A CD    1 
ATOM   5319  O  OE1   . GLU E 3 544 ? 59.142  23.171 -134.298 1.00 34.77  ? 840 GLU A OE1   1 
ATOM   5320  O  OE2   . GLU E 3 544 ? 58.059  24.057 -132.594 1.00 34.84  ? 840 GLU A OE2   1 
ATOM   5321  N  N     . MET E 3 545 ? 61.820  25.293 -128.090 1.00 37.47  ? 841 MET A N     1 
ATOM   5322  C  CA    . MET E 3 545 ? 61.643  26.002 -126.826 1.00 37.79  ? 841 MET A CA    1 
ATOM   5323  C  C     . MET E 3 545 ? 62.209  27.414 -126.809 1.00 37.08  ? 841 MET A C     1 
ATOM   5324  O  O     . MET E 3 545 ? 61.532  28.347 -126.380 1.00 37.12  ? 841 MET A O     1 
ATOM   5325  C  CB    . MET E 3 545 ? 62.261  25.201 -125.682 1.00 38.34  ? 841 MET A CB    1 
ATOM   5326  C  CG    . MET E 3 545 ? 61.573  23.884 -125.438 1.00 40.40  ? 841 MET A CG    1 
ATOM   5327  S  SD    . MET E 3 545 ? 59.807  24.148 -125.131 1.00 42.13  ? 841 MET A SD    1 
ATOM   5328  C  CE    . MET E 3 545 ? 59.125  23.590 -126.698 1.00 41.97  ? 841 MET A CE    1 
ATOM   5329  N  N     . GLU E 3 546 ? 63.437  27.584 -127.288 1.00 36.40  ? 842 GLU A N     1 
ATOM   5330  C  CA    . GLU E 3 546 ? 64.053  28.904 -127.271 1.00 35.97  ? 842 GLU A CA    1 
ATOM   5331  C  C     . GLU E 3 546 ? 63.278  29.935 -128.083 1.00 35.77  ? 842 GLU A C     1 
ATOM   5332  O  O     . GLU E 3 546 ? 63.301  31.120 -127.762 1.00 35.65  ? 842 GLU A O     1 
ATOM   5333  C  CB    . GLU E 3 546 ? 65.511  28.820 -127.742 1.00 36.35  ? 842 GLU A CB    1 
ATOM   5334  C  CG    . GLU E 3 546 ? 66.334  27.817 -126.943 1.00 36.93  ? 842 GLU A CG    1 
ATOM   5335  C  CD    . GLU E 3 546 ? 67.821  27.898 -127.251 1.00 38.98  ? 842 GLU A CD    1 
ATOM   5336  O  OE1   . GLU E 3 546 ? 68.445  28.931 -126.922 1.00 39.42  ? 842 GLU A OE1   1 
ATOM   5337  O  OE2   . GLU E 3 546 ? 68.364  26.931 -127.825 1.00 38.64  ? 842 GLU A OE2   1 
ATOM   5338  N  N     . ARG E 3 547 ? 62.584  29.498 -129.129 1.00 35.43  ? 843 ARG A N     1 
ATOM   5339  C  CA    . ARG E 3 547 ? 61.807  30.437 -129.924 1.00 35.67  ? 843 ARG A CA    1 
ATOM   5340  C  C     . ARG E 3 547 ? 60.438  30.627 -129.260 1.00 35.27  ? 843 ARG A C     1 
ATOM   5341  O  O     . ARG E 3 547 ? 59.820  31.672 -129.400 1.00 35.10  ? 843 ARG A O     1 
ATOM   5342  C  CB    . ARG E 3 547 ? 61.625  29.931 -131.356 1.00 35.96  ? 843 ARG A CB    1 
ATOM   5343  C  CG    . ARG E 3 547 ? 62.260  30.836 -132.424 1.00 36.50  ? 843 ARG A CG    1 
ATOM   5344  C  CD    . ARG E 3 547 ? 61.910  30.365 -133.827 1.00 36.64  ? 843 ARG A CD    1 
ATOM   5345  N  NE    . ARG E 3 547 ? 62.149  28.932 -133.963 1.00 37.55  ? 843 ARG A NE    1 
ATOM   5346  C  CZ    . ARG E 3 547 ? 61.818  28.203 -135.023 1.00 36.47  ? 843 ARG A CZ    1 
ATOM   5347  N  NH1   . ARG E 3 547 ? 61.230  28.768 -136.067 1.00 35.58  ? 843 ARG A NH1   1 
ATOM   5348  N  NH2   . ARG E 3 547 ? 62.069  26.899 -135.022 1.00 35.89  ? 843 ARG A NH2   1 
ATOM   5349  N  N     . LEU E 3 548 ? 59.987  29.610 -128.531 1.00 35.19  ? 844 LEU A N     1 
ATOM   5350  C  CA    . LEU E 3 548 ? 58.695  29.652 -127.837 1.00 35.32  ? 844 LEU A CA    1 
ATOM   5351  C  C     . LEU E 3 548 ? 58.773  30.666 -126.698 1.00 35.21  ? 844 LEU A C     1 
ATOM   5352  O  O     . LEU E 3 548 ? 57.950  31.584 -126.614 1.00 34.61  ? 844 LEU A O     1 
ATOM   5353  C  CB    . LEU E 3 548 ? 58.362  28.271 -127.269 1.00 34.99  ? 844 LEU A CB    1 
ATOM   5354  C  CG    . LEU E 3 548 ? 57.125  27.511 -127.757 1.00 34.72  ? 844 LEU A CG    1 
ATOM   5355  C  CD1   . LEU E 3 548 ? 57.084  27.412 -129.264 1.00 33.64  ? 844 LEU A CD1   1 
ATOM   5356  C  CD2   . LEU E 3 548 ? 57.149  26.142 -127.138 1.00 34.09  ? 844 LEU A CD2   1 
ATOM   5357  N  N     . CYS E 3 549 ? 59.778  30.497 -125.837 1.00 34.77  ? 845 CYS A N     1 
ATOM   5358  C  CA    . CYS E 3 549 ? 59.995  31.387 -124.688 1.00 34.61  ? 845 CYS A CA    1 
ATOM   5359  C  C     . CYS E 3 549 ? 59.888  32.859 -125.054 1.00 34.33  ? 845 CYS A C     1 
ATOM   5360  O  O     . CYS E 3 549 ? 59.773  33.718 -124.184 1.00 34.67  ? 845 CYS A O     1 
ATOM   5361  C  CB    . CYS E 3 549 ? 61.368  31.134 -124.053 1.00 33.80  ? 845 CYS A CB    1 
ATOM   5362  S  SG    . CYS E 3 549 ? 61.557  29.507 -123.281 1.00 35.75  ? 845 CYS A SG    1 
ATOM   5363  N  N     . ARG E 3 550 ? 59.936  33.170 -126.339 1.00 34.81  ? 846 ARG A N     1 
ATOM   5364  C  CA    . ARG E 3 550 ? 59.829  34.564 -126.725 1.00 35.14  ? 846 ARG A CA    1 
ATOM   5365  C  C     . ARG E 3 550 ? 58.566  34.846 -127.506 1.00 35.15  ? 846 ARG A C     1 
ATOM   5366  O  O     . ARG E 3 550 ? 57.918  35.867 -127.303 1.00 35.85  ? 846 ARG A O     1 
ATOM   5367  C  CB    . ARG E 3 550 ? 61.047  34.991 -127.541 1.00 35.35  ? 846 ARG A CB    1 
ATOM   5368  C  CG    . ARG E 3 550 ? 62.353  34.812 -126.794 1.00 36.84  ? 846 ARG A CG    1 
ATOM   5369  C  CD    . ARG E 3 550 ? 63.474  35.502 -127.511 1.00 36.53  ? 846 ARG A CD    1 
ATOM   5370  N  NE    . ARG E 3 550 ? 63.341  36.954 -127.426 1.00 38.11  ? 846 ARG A NE    1 
ATOM   5371  C  CZ    . ARG E 3 550 ? 63.495  37.655 -126.305 1.00 38.23  ? 846 ARG A CZ    1 
ATOM   5372  N  NH1   . ARG E 3 550 ? 63.792  37.040 -125.163 1.00 38.06  ? 846 ARG A NH1   1 
ATOM   5373  N  NH2   . ARG E 3 550 ? 63.360  38.977 -126.326 1.00 38.60  ? 846 ARG A NH2   1 
ATOM   5374  N  N     . LEU E 3 551 ? 58.201  33.933 -128.393 1.00 35.28  ? 847 LEU A N     1 
ATOM   5375  C  CA    . LEU E 3 551 ? 57.016  34.145 -129.199 1.00 35.28  ? 847 LEU A CA    1 
ATOM   5376  C  C     . LEU E 3 551 ? 55.712  33.986 -128.413 1.00 34.60  ? 847 LEU A C     1 
ATOM   5377  O  O     . LEU E 3 551 ? 54.796  34.791 -128.574 1.00 33.92  ? 847 LEU A O     1 
ATOM   5378  C  CB    . LEU E 3 551 ? 57.043  33.212 -130.416 1.00 35.52  ? 847 LEU A CB    1 
ATOM   5379  C  CG    . LEU E 3 551 ? 55.947  33.342 -131.478 1.00 36.00  ? 847 LEU A CG    1 
ATOM   5380  C  CD1   . LEU E 3 551 ? 55.790  34.793 -131.919 1.00 36.34  ? 847 LEU A CD1   1 
ATOM   5381  C  CD2   . LEU E 3 551 ? 56.320  32.459 -132.672 1.00 37.01  ? 847 LEU A CD2   1 
ATOM   5382  N  N     . VAL E 3 552 ? 55.625  32.981 -127.549 1.00 34.52  ? 848 VAL A N     1 
ATOM   5383  C  CA    . VAL E 3 552 ? 54.387  32.779 -126.794 1.00 35.80  ? 848 VAL A CA    1 
ATOM   5384  C  C     . VAL E 3 552 ? 54.043  33.931 -125.852 1.00 36.36  ? 848 VAL A C     1 
ATOM   5385  O  O     . VAL E 3 552 ? 52.888  34.360 -125.786 1.00 36.34  ? 848 VAL A O     1 
ATOM   5386  C  CB    . VAL E 3 552 ? 54.413  31.462 -125.996 1.00 35.13  ? 848 VAL A CB    1 
ATOM   5387  C  CG1   . VAL E 3 552 ? 53.141  31.339 -125.137 1.00 35.46  ? 848 VAL A CG1   1 
ATOM   5388  C  CG2   . VAL E 3 552 ? 54.496  30.297 -126.958 1.00 34.67  ? 848 VAL A CG2   1 
ATOM   5389  N  N     . PRO E 3 553 ? 55.032  34.443 -125.098 1.00 37.00  ? 849 PRO A N     1 
ATOM   5390  C  CA    . PRO E 3 553 ? 54.699  35.553 -124.200 1.00 37.33  ? 849 PRO A CA    1 
ATOM   5391  C  C     . PRO E 3 553 ? 54.400  36.827 -124.972 1.00 37.49  ? 849 PRO A C     1 
ATOM   5392  O  O     . PRO E 3 553 ? 53.427  37.528 -124.680 1.00 37.68  ? 849 PRO A O     1 
ATOM   5393  C  CB    . PRO E 3 553 ? 55.948  35.684 -123.333 1.00 37.29  ? 849 PRO A CB    1 
ATOM   5394  C  CG    . PRO E 3 553 ? 56.437  34.290 -123.262 1.00 37.36  ? 849 PRO A CG    1 
ATOM   5395  C  CD    . PRO E 3 553 ? 56.314  33.838 -124.705 1.00 37.34  ? 849 PRO A CD    1 
ATOM   5396  N  N     . GLU E 3 554 ? 55.229  37.109 -125.973 1.00 36.85  ? 850 GLU A N     1 
ATOM   5397  C  CA    . GLU E 3 554 ? 55.069  38.307 -126.786 1.00 36.34  ? 850 GLU A CA    1 
ATOM   5398  C  C     . GLU E 3 554 ? 53.707  38.400 -127.456 1.00 35.48  ? 850 GLU A C     1 
ATOM   5399  O  O     . GLU E 3 554 ? 53.106  39.467 -127.487 1.00 34.38  ? 850 GLU A O     1 
ATOM   5400  C  CB    . GLU E 3 554 ? 56.170  38.375 -127.851 1.00 37.67  ? 850 GLU A CB    1 
ATOM   5401  C  CG    . GLU E 3 554 ? 55.988  39.479 -128.892 1.00 39.25  ? 850 GLU A CG    1 
ATOM   5402  C  CD    . GLU E 3 554 ? 56.269  40.873 -128.358 1.00 40.33  ? 850 GLU A CD    1 
ATOM   5403  O  OE1   . GLU E 3 554 ? 56.806  41.699 -129.132 1.00 41.17  ? 850 GLU A OE1   1 
ATOM   5404  O  OE2   . GLU E 3 554 ? 55.949  41.154 -127.180 1.00 42.02  ? 850 GLU A OE2   1 
ATOM   5405  N  N     . VAL E 3 555 ? 53.225  37.289 -128.003 1.00 34.93  ? 851 VAL A N     1 
ATOM   5406  C  CA    . VAL E 3 555 ? 51.933  37.281 -128.673 1.00 34.82  ? 851 VAL A CA    1 
ATOM   5407  C  C     . VAL E 3 555 ? 50.826  37.653 -127.679 1.00 34.72  ? 851 VAL A C     1 
ATOM   5408  O  O     . VAL E 3 555 ? 49.988  38.515 -127.954 1.00 34.64  ? 851 VAL A O     1 
ATOM   5409  C  CB    . VAL E 3 555 ? 51.648  35.882 -129.296 1.00 34.51  ? 851 VAL A CB    1 
ATOM   5410  C  CG1   . VAL E 3 555 ? 50.204  35.783 -129.751 1.00 34.18  ? 851 VAL A CG1   1 
ATOM   5411  C  CG2   . VAL E 3 555 ? 52.564  35.657 -130.484 1.00 33.65  ? 851 VAL A CG2   1 
ATOM   5412  N  N     . MET E 3 556 ? 50.856  37.011 -126.517 1.00 34.53  ? 852 MET A N     1 
ATOM   5413  C  CA    . MET E 3 556 ? 49.870  37.235 -125.461 1.00 34.99  ? 852 MET A CA    1 
ATOM   5414  C  C     . MET E 3 556 ? 49.838  38.643 -124.876 1.00 35.28  ? 852 MET A C     1 
ATOM   5415  O  O     . MET E 3 556 ? 48.773  39.163 -124.554 1.00 35.51  ? 852 MET A O     1 
ATOM   5416  C  CB    . MET E 3 556 ? 50.095  36.218 -124.344 1.00 34.11  ? 852 MET A CB    1 
ATOM   5417  C  CG    . MET E 3 556 ? 49.721  34.807 -124.757 1.00 32.78  ? 852 MET A CG    1 
ATOM   5418  S  SD    . MET E 3 556 ? 50.222  33.623 -123.530 1.00 34.10  ? 852 MET A SD    1 
ATOM   5419  C  CE    . MET E 3 556 ? 48.957  33.878 -122.276 1.00 31.96  ? 852 MET A CE    1 
ATOM   5420  N  N     . GLU E 3 557 ? 50.996  39.271 -124.742 1.00 35.06  ? 853 GLU A N     1 
ATOM   5421  C  CA    . GLU E 3 557 ? 51.032  40.609 -124.184 1.00 35.76  ? 853 GLU A CA    1 
ATOM   5422  C  C     . GLU E 3 557 ? 50.626  41.665 -125.200 1.00 36.08  ? 853 GLU A C     1 
ATOM   5423  O  O     . GLU E 3 557 ? 50.234  42.773 -124.827 1.00 36.41  ? 853 GLU A O     1 
ATOM   5424  C  CB    . GLU E 3 557 ? 52.437  40.900 -123.637 1.00 36.45  ? 853 GLU A CB    1 
ATOM   5425  C  CG    . GLU E 3 557 ? 52.852  39.955 -122.508 1.00 37.29  ? 853 GLU A CG    1 
ATOM   5426  C  CD    . GLU E 3 557 ? 54.274  40.194 -122.018 1.00 38.20  ? 853 GLU A CD    1 
ATOM   5427  O  OE1   . GLU E 3 557 ? 54.717  39.473 -121.091 1.00 38.02  ? 853 GLU A OE1   1 
ATOM   5428  O  OE2   . GLU E 3 557 ? 54.948  41.095 -122.564 1.00 38.58  ? 853 GLU A OE2   1 
ATOM   5429  N  N     . GLN E 3 558 ? 50.709  41.310 -126.481 1.00 36.35  ? 854 GLN A N     1 
ATOM   5430  C  CA    . GLN E 3 558 ? 50.379  42.206 -127.589 1.00 36.54  ? 854 GLN A CA    1 
ATOM   5431  C  C     . GLN E 3 558 ? 48.915  42.179 -128.025 1.00 36.35  ? 854 GLN A C     1 
ATOM   5432  O  O     . GLN E 3 558 ? 48.426  43.154 -128.593 1.00 35.47  ? 854 GLN A O     1 
ATOM   5433  C  CB    . GLN E 3 558 ? 51.238  41.864 -128.807 1.00 37.52  ? 854 GLN A CB    1 
ATOM   5434  C  CG    . GLN E 3 558 ? 52.730  41.906 -128.568 1.00 38.66  ? 854 GLN A CG    1 
ATOM   5435  C  CD    . GLN E 3 558 ? 53.287  43.312 -128.548 1.00 39.49  ? 854 GLN A CD    1 
ATOM   5436  O  OE1   . GLN E 3 558 ? 52.814  44.169 -127.798 1.00 39.63  ? 854 GLN A OE1   1 
ATOM   5437  N  NE2   . GLN E 3 558 ? 54.311  43.555 -129.367 1.00 39.31  ? 854 GLN A NE2   1 
ATOM   5438  N  N     . ALA E 3 559 ? 48.240  41.054 -127.793 1.00 36.20  ? 855 ALA A N     1 
ATOM   5439  C  CA    . ALA E 3 559 ? 46.835  40.886 -128.162 1.00 36.61  ? 855 ALA A CA    1 
ATOM   5440  C  C     . ALA E 3 559 ? 46.042  42.199 -128.157 1.00 36.70  ? 855 ALA A C     1 
ATOM   5441  O  O     . ALA E 3 559 ? 45.471  42.586 -129.179 1.00 36.76  ? 855 ALA A O     1 
ATOM   5442  C  CB    . ALA E 3 559 ? 46.176  39.878 -127.236 1.00 36.85  ? 855 ALA A CB    1 
ATOM   5443  N  N     . VAL E 3 560 ? 46.000  42.880 -127.015 1.00 36.89  ? 856 VAL A N     1 
ATOM   5444  C  CA    . VAL E 3 560 ? 45.285  44.155 -126.921 1.00 37.68  ? 856 VAL A CA    1 
ATOM   5445  C  C     . VAL E 3 560 ? 46.112  45.149 -126.129 1.00 37.95  ? 856 VAL A C     1 
ATOM   5446  O  O     . VAL E 3 560 ? 46.854  44.770 -125.220 1.00 39.26  ? 856 VAL A O     1 
ATOM   5447  C  CB    . VAL E 3 560 ? 43.904  44.034 -126.197 1.00 37.65  ? 856 VAL A CB    1 
ATOM   5448  C  CG1   . VAL E 3 560 ? 43.026  42.986 -126.874 1.00 37.76  ? 856 VAL A CG1   1 
ATOM   5449  C  CG2   . VAL E 3 560 ? 44.120  43.712 -124.731 1.00 37.55  ? 856 VAL A CG2   1 
ATOM   5450  N  N     . THR E 3 561 ? 45.979  46.423 -126.474 1.00 37.83  ? 857 THR A N     1 
ATOM   5451  C  CA    . THR E 3 561 ? 46.703  47.476 -125.780 1.00 37.86  ? 857 THR A CA    1 
ATOM   5452  C  C     . THR E 3 561 ? 45.801  48.083 -124.706 1.00 37.02  ? 857 THR A C     1 
ATOM   5453  O  O     . THR E 3 561 ? 44.817  48.743 -125.027 1.00 37.45  ? 857 THR A O     1 
ATOM   5454  C  CB    . THR E 3 561 ? 47.119  48.601 -126.749 1.00 38.29  ? 857 THR A CB    1 
ATOM   5455  O  OG1   . THR E 3 561 ? 47.853  48.048 -127.847 1.00 39.01  ? 857 THR A OG1   1 
ATOM   5456  C  CG2   . THR E 3 561 ? 47.985  49.622 -126.029 1.00 37.91  ? 857 THR A CG2   1 
ATOM   5457  N  N     . LEU E 3 562 ? 46.134  47.856 -123.440 1.00 36.20  ? 858 LEU A N     1 
ATOM   5458  C  CA    . LEU E 3 562 ? 45.349  48.402 -122.334 1.00 36.20  ? 858 LEU A CA    1 
ATOM   5459  C  C     . LEU E 3 562 ? 46.100  49.628 -121.823 1.00 36.17  ? 858 LEU A C     1 
ATOM   5460  O  O     . LEU E 3 562 ? 47.124  50.010 -122.396 1.00 35.87  ? 858 LEU A O     1 
ATOM   5461  C  CB    . LEU E 3 562 ? 45.235  47.376 -121.202 1.00 36.45  ? 858 LEU A CB    1 
ATOM   5462  C  CG    . LEU E 3 562 ? 44.704  45.973 -121.526 1.00 36.17  ? 858 LEU A CG    1 
ATOM   5463  C  CD1   . LEU E 3 562 ? 44.617  45.149 -120.257 1.00 36.30  ? 858 LEU A CD1   1 
ATOM   5464  C  CD2   . LEU E 3 562 ? 43.330  46.080 -122.164 1.00 37.18  ? 858 LEU A CD2   1 
ATOM   5465  N  N     . ARG E 3 563 ? 45.591  50.250 -120.763 1.00 35.26  ? 859 ARG A N     1 
ATOM   5466  C  CA    . ARG E 3 563 ? 46.273  51.393 -120.170 1.00 34.97  ? 859 ARG A CA    1 
ATOM   5467  C  C     . ARG E 3 563 ? 47.344  50.834 -119.230 1.00 33.94  ? 859 ARG A C     1 
ATOM   5468  O  O     . ARG E 3 563 ? 48.176  51.566 -118.701 1.00 33.95  ? 859 ARG A O     1 
ATOM   5469  C  CB    . ARG E 3 563 ? 45.294  52.275 -119.394 1.00 35.47  ? 859 ARG A CB    1 
ATOM   5470  C  CG    . ARG E 3 563 ? 44.280  52.981 -120.268 1.00 36.26  ? 859 ARG A CG    1 
ATOM   5471  C  CD    . ARG E 3 563 ? 43.433  53.972 -119.485 1.00 36.89  ? 859 ARG A CD    1 
ATOM   5472  N  NE    . ARG E 3 563 ? 42.501  54.661 -120.372 1.00 37.62  ? 859 ARG A NE    1 
ATOM   5473  C  CZ    . ARG E 3 563 ? 41.442  54.080 -120.925 1.00 38.59  ? 859 ARG A CZ    1 
ATOM   5474  N  NH1   . ARG E 3 563 ? 41.177  52.809 -120.664 1.00 39.08  ? 859 ARG A NH1   1 
ATOM   5475  N  NH2   . ARG E 3 563 ? 40.672  54.754 -121.767 1.00 38.87  ? 859 ARG A NH2   1 
ATOM   5476  N  N     . VAL E 3 564 ? 47.310  49.524 -119.023 1.00 33.74  ? 860 VAL A N     1 
ATOM   5477  C  CA    . VAL E 3 564 ? 48.285  48.858 -118.171 1.00 33.40  ? 860 VAL A CA    1 
ATOM   5478  C  C     . VAL E 3 564 ? 48.983  47.814 -119.029 1.00 33.59  ? 860 VAL A C     1 
ATOM   5479  O  O     . VAL E 3 564 ? 48.475  47.443 -120.093 1.00 33.36  ? 860 VAL A O     1 
ATOM   5480  C  CB    . VAL E 3 564 ? 47.618  48.167 -116.950 1.00 33.46  ? 860 VAL A CB    1 
ATOM   5481  C  CG1   . VAL E 3 564 ? 46.806  49.183 -116.174 1.00 32.75  ? 860 VAL A CG1   1 
ATOM   5482  C  CG2   . VAL E 3 564 ? 46.733  47.012 -117.398 1.00 32.70  ? 860 VAL A CG2   1 
ATOM   5483  N  N     . PRO E 3 565 ? 50.169  47.344 -118.594 1.00 32.92  ? 861 PRO A N     1 
ATOM   5484  C  CA    . PRO E 3 565 ? 50.894  46.340 -119.375 1.00 32.77  ? 861 PRO A CA    1 
ATOM   5485  C  C     . PRO E 3 565 ? 50.408  44.938 -119.061 1.00 32.62  ? 861 PRO A C     1 
ATOM   5486  O  O     . PRO E 3 565 ? 50.069  44.636 -117.917 1.00 32.01  ? 861 PRO A O     1 
ATOM   5487  C  CB    . PRO E 3 565 ? 52.357  46.527 -118.936 1.00 32.46  ? 861 PRO A CB    1 
ATOM   5488  C  CG    . PRO E 3 565 ? 52.378  47.881 -118.234 1.00 32.69  ? 861 PRO A CG    1 
ATOM   5489  C  CD    . PRO E 3 565 ? 51.041  47.913 -117.553 1.00 32.87  ? 861 PRO A CD    1 
ATOM   5490  N  N     . LEU E 3 566 ? 50.350  44.097 -120.086 1.00 32.05  ? 862 LEU A N     1 
ATOM   5491  C  CA    . LEU E 3 566 ? 49.974  42.714 -119.887 1.00 32.40  ? 862 LEU A CA    1 
ATOM   5492  C  C     . LEU E 3 566 ? 51.314  42.075 -119.571 1.00 32.12  ? 862 LEU A C     1 
ATOM   5493  O  O     . LEU E 3 566 ? 52.356  42.612 -119.953 1.00 31.99  ? 862 LEU A O     1 
ATOM   5494  C  CB    . LEU E 3 566 ? 49.391  42.111 -121.166 1.00 32.61  ? 862 LEU A CB    1 
ATOM   5495  C  CG    . LEU E 3 566 ? 48.090  42.738 -121.664 1.00 32.67  ? 862 LEU A CG    1 
ATOM   5496  C  CD1   . LEU E 3 566 ? 47.610  41.958 -122.869 1.00 33.55  ? 862 LEU A CD1   1 
ATOM   5497  C  CD2   . LEU E 3 566 ? 47.036  42.728 -120.553 1.00 32.73  ? 862 LEU A CD2   1 
ATOM   5498  N  N     . LYS E 3 567 ? 51.300  40.947 -118.872 1.00 32.50  ? 863 LYS A N     1 
ATOM   5499  C  CA    . LYS E 3 567 ? 52.541  40.278 -118.512 1.00 31.87  ? 863 LYS A CA    1 
ATOM   5500  C  C     . LYS E 3 567 ? 52.309  38.780 -118.401 1.00 32.07  ? 863 LYS A C     1 
ATOM   5501  O  O     . LYS E 3 567 ? 51.362  38.331 -117.756 1.00 31.32  ? 863 LYS A O     1 
ATOM   5502  C  CB    . LYS E 3 567 ? 53.058  40.842 -117.188 1.00 32.64  ? 863 LYS A CB    1 
ATOM   5503  C  CG    . LYS E 3 567 ? 54.405  40.289 -116.724 1.00 33.68  ? 863 LYS A CG    1 
ATOM   5504  C  CD    . LYS E 3 567 ? 54.654  40.669 -115.272 1.00 34.17  ? 863 LYS A CD    1 
ATOM   5505  C  CE    . LYS E 3 567 ? 55.910  40.017 -114.721 1.00 33.96  ? 863 LYS A CE    1 
ATOM   5506  N  NZ    . LYS E 3 567 ? 55.981  40.163 -113.234 1.00 34.64  ? 863 LYS A NZ    1 
ATOM   5507  N  N     . VAL E 3 568 ? 53.175  38.003 -119.037 1.00 32.23  ? 864 VAL A N     1 
ATOM   5508  C  CA    . VAL E 3 568 ? 53.051  36.557 -119.006 1.00 33.19  ? 864 VAL A CA    1 
ATOM   5509  C  C     . VAL E 3 568 ? 54.184  35.854 -118.258 1.00 34.05  ? 864 VAL A C     1 
ATOM   5510  O  O     . VAL E 3 568 ? 55.348  36.275 -118.300 1.00 34.23  ? 864 VAL A O     1 
ATOM   5511  C  CB    . VAL E 3 568 ? 52.990  35.974 -120.435 1.00 33.22  ? 864 VAL A CB    1 
ATOM   5512  C  CG1   . VAL E 3 568 ? 52.895  34.461 -120.385 1.00 33.72  ? 864 VAL A CG1   1 
ATOM   5513  C  CG2   . VAL E 3 568 ? 51.809  36.549 -121.174 1.00 33.83  ? 864 VAL A CG2   1 
ATOM   5514  N  N     . ASP E 3 569 ? 53.813  34.784 -117.565 1.00 33.96  ? 865 ASP A N     1 
ATOM   5515  C  CA    . ASP E 3 569 ? 54.749  33.952 -116.834 1.00 33.95  ? 865 ASP A CA    1 
ATOM   5516  C  C     . ASP E 3 569 ? 54.737  32.687 -117.659 1.00 33.74  ? 865 ASP A C     1 
ATOM   5517  O  O     . ASP E 3 569 ? 53.686  32.290 -118.164 1.00 32.88  ? 865 ASP A O     1 
ATOM   5518  C  CB    . ASP E 3 569 ? 54.235  33.667 -115.427 1.00 35.10  ? 865 ASP A CB    1 
ATOM   5519  C  CG    . ASP E 3 569 ? 53.946  34.933 -114.651 1.00 36.81  ? 865 ASP A CG    1 
ATOM   5520  O  OD1   . ASP E 3 569 ? 54.905  35.684 -114.365 1.00 38.38  ? 865 ASP A OD1   1 
ATOM   5521  O  OD2   . ASP E 3 569 ? 52.757  35.179 -114.334 1.00 37.49  ? 865 ASP A OD2   1 
ATOM   5522  N  N     . TYR E 3 570 ? 55.897  32.063 -117.821 1.00 33.27  ? 866 TYR A N     1 
ATOM   5523  C  CA    . TYR E 3 570 ? 55.970  30.859 -118.627 1.00 33.40  ? 866 TYR A CA    1 
ATOM   5524  C  C     . TYR E 3 570 ? 57.077  29.932 -118.174 1.00 33.36  ? 866 TYR A C     1 
ATOM   5525  O  O     . TYR E 3 570 ? 58.122  30.371 -117.693 1.00 32.52  ? 866 TYR A O     1 
ATOM   5526  C  CB    . TYR E 3 570 ? 56.191  31.229 -120.094 1.00 33.32  ? 866 TYR A CB    1 
ATOM   5527  C  CG    . TYR E 3 570 ? 57.540  31.869 -120.367 1.00 33.60  ? 866 TYR A CG    1 
ATOM   5528  C  CD1   . TYR E 3 570 ? 58.650  31.095 -120.681 1.00 33.91  ? 866 TYR A CD1   1 
ATOM   5529  C  CD2   . TYR E 3 570 ? 57.699  33.254 -120.304 1.00 33.14  ? 866 TYR A CD2   1 
ATOM   5530  C  CE1   . TYR E 3 570 ? 59.882  31.682 -120.932 1.00 34.80  ? 866 TYR A CE1   1 
ATOM   5531  C  CE2   . TYR E 3 570 ? 58.919  33.848 -120.549 1.00 34.64  ? 866 TYR A CE2   1 
ATOM   5532  C  CZ    . TYR E 3 570 ? 60.007  33.058 -120.865 1.00 35.10  ? 866 TYR A CZ    1 
ATOM   5533  O  OH    . TYR E 3 570 ? 61.218  33.646 -121.130 1.00 37.59  ? 866 TYR A OH    1 
ATOM   5534  N  N     . HIS E 3 571 ? 56.833  28.643 -118.345 1.00 33.16  ? 867 HIS A N     1 
ATOM   5535  C  CA    . HIS E 3 571 ? 57.793  27.619 -117.977 1.00 33.16  ? 867 HIS A CA    1 
ATOM   5536  C  C     . HIS E 3 571 ? 57.533  26.402 -118.835 1.00 32.89  ? 867 HIS A C     1 
ATOM   5537  O  O     . HIS E 3 571 ? 56.489  26.307 -119.480 1.00 32.53  ? 867 HIS A O     1 
ATOM   5538  C  CB    . HIS E 3 571 ? 57.635  27.256 -116.506 1.00 33.86  ? 867 HIS A CB    1 
ATOM   5539  C  CG    . HIS E 3 571 ? 57.573  28.444 -115.603 1.00 35.24  ? 867 HIS A CG    1 
ATOM   5540  N  ND1   . HIS E 3 571 ? 56.381  28.988 -115.170 1.00 35.29  ? 867 HIS A ND1   1 
ATOM   5541  C  CD2   . HIS E 3 571 ? 58.550  29.248 -115.124 1.00 35.54  ? 867 HIS A CD2   1 
ATOM   5542  C  CE1   . HIS E 3 571 ? 56.629  30.077 -114.467 1.00 35.24  ? 867 HIS A CE1   1 
ATOM   5543  N  NE2   . HIS E 3 571 ? 57.937  30.258 -114.425 1.00 35.70  ? 867 HIS A NE2   1 
ATOM   5544  N  N     . TYR E 3 572 ? 58.487  25.478 -118.859 1.00 32.48  ? 868 TYR A N     1 
ATOM   5545  C  CA    . TYR E 3 572 ? 58.311  24.268 -119.630 1.00 31.95  ? 868 TYR A CA    1 
ATOM   5546  C  C     . TYR E 3 572 ? 59.027  23.086 -118.993 1.00 31.34  ? 868 TYR A C     1 
ATOM   5547  O  O     . TYR E 3 572 ? 59.742  23.250 -118.012 1.00 31.33  ? 868 TYR A O     1 
ATOM   5548  C  CB    . TYR E 3 572 ? 58.766  24.485 -121.071 1.00 33.67  ? 868 TYR A CB    1 
ATOM   5549  C  CG    . TYR E 3 572 ? 60.224  24.821 -121.258 1.00 34.63  ? 868 TYR A CG    1 
ATOM   5550  C  CD1   . TYR E 3 572 ? 61.189  23.814 -121.310 1.00 34.97  ? 868 TYR A CD1   1 
ATOM   5551  C  CD2   . TYR E 3 572 ? 60.633  26.140 -121.452 1.00 34.89  ? 868 TYR A CD2   1 
ATOM   5552  C  CE1   . TYR E 3 572 ? 62.527  24.113 -121.566 1.00 36.16  ? 868 TYR A CE1   1 
ATOM   5553  C  CE2   . TYR E 3 572 ? 61.975  26.451 -121.707 1.00 36.02  ? 868 TYR A CE2   1 
ATOM   5554  C  CZ    . TYR E 3 572 ? 62.912  25.433 -121.768 1.00 35.66  ? 868 TYR A CZ    1 
ATOM   5555  O  OH    . TYR E 3 572 ? 64.221  25.722 -122.078 1.00 36.34  ? 868 TYR A OH    1 
ATOM   5556  N  N     . GLY E 3 573 ? 58.807  21.891 -119.529 1.00 30.83  ? 869 GLY A N     1 
ATOM   5557  C  CA    . GLY E 3 573 ? 59.446  20.717 -118.962 1.00 30.66  ? 869 GLY A CA    1 
ATOM   5558  C  C     . GLY E 3 573 ? 58.913  19.431 -119.555 1.00 30.71  ? 869 GLY A C     1 
ATOM   5559  O  O     . GLY E 3 573 ? 58.085  19.454 -120.457 1.00 30.31  ? 869 GLY A O     1 
ATOM   5560  N  N     . SER E 3 574 ? 59.385  18.304 -119.033 1.00 30.93  ? 870 SER A N     1 
ATOM   5561  C  CA    . SER E 3 574 ? 58.977  16.997 -119.524 1.00 31.32  ? 870 SER A CA    1 
ATOM   5562  C  C     . SER E 3 574 ? 57.522  16.600 -119.243 1.00 32.26  ? 870 SER A C     1 
ATOM   5563  O  O     . SER E 3 574 ? 56.983  15.730 -119.928 1.00 32.91  ? 870 SER A O     1 
ATOM   5564  C  CB    . SER E 3 574 ? 59.919  15.930 -118.963 1.00 30.18  ? 870 SER A CB    1 
ATOM   5565  O  OG    . SER E 3 574 ? 59.981  16.012 -117.550 1.00 30.11  ? 870 SER A OG    1 
ATOM   5566  N  N     . THR E 3 575 ? 56.896  17.200 -118.234 1.00 33.47  ? 871 THR A N     1 
ATOM   5567  C  CA    . THR E 3 575 ? 55.492  16.892 -117.926 1.00 34.86  ? 871 THR A CA    1 
ATOM   5568  C  C     . THR E 3 575 ? 54.736  18.190 -117.643 1.00 35.56  ? 871 THR A C     1 
ATOM   5569  O  O     . THR E 3 575 ? 55.309  19.272 -117.721 1.00 35.42  ? 871 THR A O     1 
ATOM   5570  C  CB    . THR E 3 575 ? 55.349  15.971 -116.692 1.00 35.38  ? 871 THR A CB    1 
ATOM   5571  O  OG1   . THR E 3 575 ? 55.678  16.700 -115.501 1.00 36.24  ? 871 THR A OG1   1 
ATOM   5572  C  CG2   . THR E 3 575 ? 56.270  14.756 -116.819 1.00 36.06  ? 871 THR A CG2   1 
ATOM   5573  N  N     . TRP E 3 576 ? 53.449  18.093 -117.315 1.00 36.94  ? 872 TRP A N     1 
ATOM   5574  C  CA    . TRP E 3 576 ? 52.667  19.290 -117.022 1.00 37.84  ? 872 TRP A CA    1 
ATOM   5575  C  C     . TRP E 3 576 ? 53.185  19.856 -115.708 1.00 39.38  ? 872 TRP A C     1 
ATOM   5576  O  O     . TRP E 3 576 ? 53.248  21.075 -115.517 1.00 39.07  ? 872 TRP A O     1 
ATOM   5577  C  CB    . TRP E 3 576 ? 51.172  18.950 -116.889 1.00 37.66  ? 872 TRP A CB    1 
ATOM   5578  C  CG    . TRP E 3 576 ? 50.257  20.147 -116.960 1.00 36.75  ? 872 TRP A CG    1 
ATOM   5579  C  CD1   . TRP E 3 576 ? 50.623  21.459 -117.022 1.00 37.22  ? 872 TRP A CD1   1 
ATOM   5580  C  CD2   . TRP E 3 576 ? 48.824  20.131 -116.988 1.00 37.25  ? 872 TRP A CD2   1 
ATOM   5581  N  NE1   . TRP E 3 576 ? 49.509  22.263 -117.090 1.00 37.46  ? 872 TRP A NE1   1 
ATOM   5582  C  CE2   . TRP E 3 576 ? 48.391  21.471 -117.071 1.00 37.34  ? 872 TRP A CE2   1 
ATOM   5583  C  CE3   . TRP E 3 576 ? 47.865  19.113 -116.955 1.00 37.47  ? 872 TRP A CE3   1 
ATOM   5584  C  CZ2   . TRP E 3 576 ? 47.035  21.820 -117.121 1.00 38.11  ? 872 TRP A CZ2   1 
ATOM   5585  C  CZ3   . TRP E 3 576 ? 46.518  19.458 -117.005 1.00 37.77  ? 872 TRP A CZ3   1 
ATOM   5586  C  CH2   . TRP E 3 576 ? 46.117  20.799 -117.088 1.00 37.97  ? 872 TRP A CH2   1 
ATOM   5587  N  N     . TYR E 3 577 ? 53.551  18.958 -114.799 1.00 41.04  ? 873 TYR A N     1 
ATOM   5588  C  CA    . TYR E 3 577 ? 54.085  19.367 -113.506 1.00 43.46  ? 873 TYR A CA    1 
ATOM   5589  C  C     . TYR E 3 577 ? 55.471  19.967 -113.705 1.00 44.79  ? 873 TYR A C     1 
ATOM   5590  O  O     . TYR E 3 577 ? 55.820  20.958 -113.068 1.00 45.02  ? 873 TYR A O     1 
ATOM   5591  C  CB    . TYR E 3 577 ? 54.188  18.169 -112.564 1.00 44.37  ? 873 TYR A CB    1 
ATOM   5592  C  CG    . TYR E 3 577 ? 54.730  18.515 -111.192 1.00 45.17  ? 873 TYR A CG    1 
ATOM   5593  C  CD1   . TYR E 3 577 ? 54.006  19.325 -110.316 1.00 44.94  ? 873 TYR A CD1   1 
ATOM   5594  C  CD2   . TYR E 3 577 ? 55.967  18.031 -110.769 1.00 44.87  ? 873 TYR A CD2   1 
ATOM   5595  C  CE1   . TYR E 3 577 ? 54.506  19.642 -109.051 1.00 45.25  ? 873 TYR A CE1   1 
ATOM   5596  C  CE2   . TYR E 3 577 ? 56.472  18.343 -109.512 1.00 44.77  ? 873 TYR A CE2   1 
ATOM   5597  C  CZ    . TYR E 3 577 ? 55.740  19.148 -108.657 1.00 45.26  ? 873 TYR A CZ    1 
ATOM   5598  O  OH    . TYR E 3 577 ? 56.243  19.460 -107.410 1.00 44.90  ? 873 TYR A OH    1 
ATOM   5599  N  N     . ASP E 3 578 ? 56.257  19.350 -114.588 1.00 46.12  ? 874 ASP A N     1 
ATOM   5600  C  CA    . ASP E 3 578 ? 57.610  19.822 -114.885 1.00 47.33  ? 874 ASP A CA    1 
ATOM   5601  C  C     . ASP E 3 578 ? 57.567  21.244 -115.442 1.00 47.98  ? 874 ASP A C     1 
ATOM   5602  O  O     . ASP E 3 578 ? 58.487  22.037 -115.228 1.00 47.75  ? 874 ASP A O     1 
ATOM   5603  C  CB    . ASP E 3 578 ? 58.278  18.917 -115.921 1.00 47.87  ? 874 ASP A CB    1 
ATOM   5604  C  CG    . ASP E 3 578 ? 59.373  18.063 -115.330 1.00 49.15  ? 874 ASP A CG    1 
ATOM   5605  O  OD1   . ASP E 3 578 ? 60.384  17.823 -116.036 1.00 49.44  ? 874 ASP A OD1   1 
ATOM   5606  O  OD2   . ASP E 3 578 ? 59.220  17.626 -114.169 1.00 49.61  ? 874 ASP A OD2   1 
ATOM   5607  N  N     . ALA E 3 579 ? 56.494  21.551 -116.166 1.00 48.53  ? 875 ALA A N     1 
ATOM   5608  C  CA    . ALA E 3 579 ? 56.329  22.865 -116.772 1.00 49.16  ? 875 ALA A CA    1 
ATOM   5609  C  C     . ALA E 3 579 ? 56.020  23.936 -115.733 1.00 49.90  ? 875 ALA A C     1 
ATOM   5610  O  O     . ALA E 3 579 ? 54.879  24.380 -115.611 1.00 50.25  ? 875 ALA A O     1 
ATOM   5611  C  CB    . ALA E 3 579 ? 55.226  22.813 -117.815 1.00 48.86  ? 875 ALA A CB    1 
ATOM   5612  N  N     . LYS E 3 580 ? 57.038  24.353 -114.988 1.00 50.60  ? 876 LYS A N     1 
ATOM   5613  C  CA    . LYS E 3 580 ? 56.857  25.377 -113.964 1.00 51.36  ? 876 LYS A CA    1 
ATOM   5614  C  C     . LYS E 3 580 ? 58.168  26.058 -113.566 1.00 51.77  ? 876 LYS A C     1 
ATOM   5615  O  O     . LYS E 3 580 ? 59.249  25.521 -113.891 1.00 51.77  ? 876 LYS A O     1 
ATOM   5616  C  CB    . LYS E 3 580 ? 56.197  24.766 -112.723 1.00 51.28  ? 876 LYS A CB    1 
ATOM   5617  C  CG    . LYS E 3 580 ? 56.948  23.584 -112.127 1.00 50.59  ? 876 LYS A CG    1 
ATOM   5618  C  CD    . LYS E 3 580 ? 56.203  23.015 -110.932 1.00 50.85  ? 876 LYS A CD    1 
ATOM   5619  C  CE    . LYS E 3 580 ? 56.858  21.749 -110.410 1.00 50.17  ? 876 LYS A CE    1 
ATOM   5620  N  NZ    . LYS E 3 580 ? 58.269  21.980 -110.012 1.00 50.62  ? 876 LYS A NZ    1 
ATOM   5621  O  OXT   . LYS E 3 580 ? 58.087  27.129 -112.923 1.00 52.38  ? 876 LYS A OXT   1 
ATOM   5622  N  N     . ALA F 3 1   ? 13.830  11.962 -48.989  1.00 49.91  ? 297 ALA B N     1 
ATOM   5623  C  CA    . ALA F 3 1   ? 14.071  12.659 -47.692  1.00 49.50  ? 297 ALA B CA    1 
ATOM   5624  C  C     . ALA F 3 1   ? 12.970  13.674 -47.390  1.00 49.27  ? 297 ALA B C     1 
ATOM   5625  O  O     . ALA F 3 1   ? 12.534  14.425 -48.270  1.00 49.67  ? 297 ALA B O     1 
ATOM   5626  C  CB    . ALA F 3 1   ? 15.430  13.356 -47.722  1.00 49.52  ? 297 ALA B CB    1 
ATOM   5627  N  N     . LYS F 3 2   ? 12.521  13.684 -46.141  1.00 48.74  ? 298 LYS B N     1 
ATOM   5628  C  CA    . LYS F 3 2   ? 11.485  14.610 -45.697  1.00 47.88  ? 298 LYS B CA    1 
ATOM   5629  C  C     . LYS F 3 2   ? 12.119  15.637 -44.766  1.00 47.19  ? 298 LYS B C     1 
ATOM   5630  O  O     . LYS F 3 2   ? 13.058  15.321 -44.029  1.00 46.94  ? 298 LYS B O     1 
ATOM   5631  C  CB    . LYS F 3 2   ? 10.379  13.855 -44.970  1.00 47.69  ? 298 LYS B CB    1 
ATOM   5632  N  N     . MET F 3 3   ? 11.608  16.864 -44.814  1.00 46.27  ? 299 MET B N     1 
ATOM   5633  C  CA    . MET F 3 3   ? 12.110  17.951 -43.979  1.00 45.32  ? 299 MET B CA    1 
ATOM   5634  C  C     . MET F 3 3   ? 11.246  18.093 -42.718  1.00 45.36  ? 299 MET B C     1 
ATOM   5635  O  O     . MET F 3 3   ? 10.079  17.702 -42.714  1.00 45.25  ? 299 MET B O     1 
ATOM   5636  C  CB    . MET F 3 3   ? 12.106  19.258 -44.778  1.00 43.80  ? 299 MET B CB    1 
ATOM   5637  C  CG    . MET F 3 3   ? 12.673  20.450 -44.025  1.00 42.96  ? 299 MET B CG    1 
ATOM   5638  S  SD    . MET F 3 3   ? 12.644  21.973 -44.999  1.00 41.10  ? 299 MET B SD    1 
ATOM   5639  C  CE    . MET F 3 3   ? 14.298  21.986 -45.713  1.00 40.58  ? 299 MET B CE    1 
ATOM   5640  N  N     . ALA F 3 4   ? 11.823  18.653 -41.656  1.00 45.48  ? 300 ALA B N     1 
ATOM   5641  C  CA    . ALA F 3 4   ? 11.113  18.828 -40.387  1.00 45.86  ? 300 ALA B CA    1 
ATOM   5642  C  C     . ALA F 3 4   ? 10.258  20.089 -40.302  1.00 45.87  ? 300 ALA B C     1 
ATOM   5643  O  O     . ALA F 3 4   ? 10.759  21.201 -40.456  1.00 45.15  ? 300 ALA B O     1 
ATOM   5644  C  CB    . ALA F 3 4   ? 12.109  18.814 -39.231  1.00 45.90  ? 300 ALA B CB    1 
ATOM   5645  N  N     . PHE F 3 5   ? 8.966   19.908 -40.036  1.00 46.34  ? 301 PHE B N     1 
ATOM   5646  C  CA    . PHE F 3 5   ? 8.053   21.036 -39.912  1.00 46.81  ? 301 PHE B CA    1 
ATOM   5647  C  C     . PHE F 3 5   ? 6.830   20.698 -39.060  1.00 47.19  ? 301 PHE B C     1 
ATOM   5648  O  O     . PHE F 3 5   ? 6.380   19.551 -39.004  1.00 47.07  ? 301 PHE B O     1 
ATOM   5649  C  CB    . PHE F 3 5   ? 7.596   21.513 -41.298  1.00 46.70  ? 301 PHE B CB    1 
ATOM   5650  C  CG    . PHE F 3 5   ? 6.606   20.599 -41.963  1.00 45.77  ? 301 PHE B CG    1 
ATOM   5651  C  CD1   . PHE F 3 5   ? 5.259   20.641 -41.620  1.00 45.48  ? 301 PHE B CD1   1 
ATOM   5652  C  CD2   . PHE F 3 5   ? 7.023   19.683 -42.921  1.00 45.91  ? 301 PHE B CD2   1 
ATOM   5653  C  CE1   . PHE F 3 5   ? 4.337   19.780 -42.220  1.00 45.05  ? 301 PHE B CE1   1 
ATOM   5654  C  CE2   . PHE F 3 5   ? 6.109   18.814 -43.530  1.00 45.63  ? 301 PHE B CE2   1 
ATOM   5655  C  CZ    . PHE F 3 5   ? 4.763   18.865 -43.176  1.00 45.20  ? 301 PHE B CZ    1 
ATOM   5656  N  N     . THR F 3 6   ? 6.294   21.717 -38.403  1.00 47.61  ? 302 THR B N     1 
ATOM   5657  C  CA    . THR F 3 6   ? 5.120   21.554 -37.562  1.00 48.08  ? 302 THR B CA    1 
ATOM   5658  C  C     . THR F 3 6   ? 3.875   21.721 -38.433  1.00 48.48  ? 302 THR B C     1 
ATOM   5659  O  O     . THR F 3 6   ? 3.793   22.652 -39.236  1.00 48.06  ? 302 THR B O     1 
ATOM   5660  C  CB    . THR F 3 6   ? 5.110   22.618 -36.448  1.00 48.02  ? 302 THR B CB    1 
ATOM   5661  O  OG1   . THR F 3 6   ? 6.400   22.666 -35.826  1.00 47.70  ? 302 THR B OG1   1 
ATOM   5662  C  CG2   . THR F 3 6   ? 4.066   22.290 -35.399  1.00 47.86  ? 302 THR B CG2   1 
ATOM   5663  N  N     . LEU F 3 7   ? 2.921   20.805 -38.293  1.00 48.93  ? 303 LEU B N     1 
ATOM   5664  C  CA    . LEU F 3 7   ? 1.677   20.876 -39.051  1.00 49.74  ? 303 LEU B CA    1 
ATOM   5665  C  C     . LEU F 3 7   ? 0.564   21.209 -38.051  1.00 50.25  ? 303 LEU B C     1 
ATOM   5666  O  O     . LEU F 3 7   ? -0.230  20.354 -37.662  1.00 49.84  ? 303 LEU B O     1 
ATOM   5667  C  CB    . LEU F 3 7   ? 1.409   19.542 -39.752  1.00 49.85  ? 303 LEU B CB    1 
ATOM   5668  C  CG    . LEU F 3 7   ? 0.323   19.548 -40.831  1.00 50.45  ? 303 LEU B CG    1 
ATOM   5669  C  CD1   . LEU F 3 7   ? 0.603   18.446 -41.831  1.00 50.84  ? 303 LEU B CD1   1 
ATOM   5670  C  CD2   . LEU F 3 7   ? -1.052  19.388 -40.204  1.00 50.82  ? 303 LEU B CD2   1 
ATOM   5671  N  N     . ALA F 3 8   ? 0.532   22.479 -37.656  1.00 50.56  ? 304 ALA B N     1 
ATOM   5672  C  CA    . ALA F 3 8   ? -0.401  23.020 -36.673  1.00 51.28  ? 304 ALA B CA    1 
ATOM   5673  C  C     . ALA F 3 8   ? -1.902  22.793 -36.832  1.00 51.68  ? 304 ALA B C     1 
ATOM   5674  O  O     . ALA F 3 8   ? -2.389  22.370 -37.878  1.00 51.63  ? 304 ALA B O     1 
ATOM   5675  C  CB    . ALA F 3 8   ? -0.139  24.514 -36.519  1.00 51.22  ? 304 ALA B CB    1 
ATOM   5676  N  N     . ASP F 3 9   ? -2.619  23.094 -35.750  1.00 52.54  ? 305 ASP B N     1 
ATOM   5677  C  CA    . ASP F 3 9   ? -4.074  22.986 -35.681  1.00 53.16  ? 305 ASP B CA    1 
ATOM   5678  C  C     . ASP F 3 9   ? -4.617  24.400 -35.496  1.00 53.06  ? 305 ASP B C     1 
ATOM   5679  O  O     . ASP F 3 9   ? -5.499  24.835 -36.231  1.00 53.33  ? 305 ASP B O     1 
ATOM   5680  C  CB    . ASP F 3 9   ? -4.493  22.102 -34.502  1.00 53.90  ? 305 ASP B CB    1 
ATOM   5681  C  CG    . ASP F 3 9   ? -4.356  20.624 -34.811  1.00 54.55  ? 305 ASP B CG    1 
ATOM   5682  O  OD1   . ASP F 3 9   ? -5.071  20.145 -35.716  1.00 55.24  ? 305 ASP B OD1   1 
ATOM   5683  O  OD2   . ASP F 3 9   ? -3.535  19.942 -34.158  1.00 55.45  ? 305 ASP B OD2   1 
ATOM   5684  N  N     . ARG F 3 10  ? -4.094  25.108 -34.499  1.00 53.04  ? 306 ARG B N     1 
ATOM   5685  C  CA    . ARG F 3 10  ? -4.495  26.491 -34.257  1.00 52.61  ? 306 ARG B CA    1 
ATOM   5686  C  C     . ARG F 3 10  ? -3.287  27.320 -34.662  1.00 51.87  ? 306 ARG B C     1 
ATOM   5687  O  O     . ARG F 3 10  ? -2.231  26.775 -34.986  1.00 51.70  ? 306 ARG B O     1 
ATOM   5688  C  CB    . ARG F 3 10  ? -4.809  26.756 -32.768  1.00 52.98  ? 306 ARG B CB    1 
ATOM   5689  C  CG    . ARG F 3 10  ? -3.581  26.885 -31.841  1.00 53.59  ? 306 ARG B CG    1 
ATOM   5690  C  CD    . ARG F 3 10  ? -3.702  28.062 -30.838  1.00 54.01  ? 306 ARG B CD    1 
ATOM   5691  N  NE    . ARG F 3 10  ? -2.539  28.157 -29.944  1.00 54.76  ? 306 ARG B NE    1 
ATOM   5692  C  CZ    . ARG F 3 10  ? -2.254  29.198 -29.156  1.00 55.04  ? 306 ARG B CZ    1 
ATOM   5693  N  NH1   . ARG F 3 10  ? -3.046  30.263 -29.136  1.00 55.42  ? 306 ARG B NH1   1 
ATOM   5694  N  NH2   . ARG F 3 10  ? -1.173  29.176 -28.383  1.00 54.33  ? 306 ARG B NH2   1 
ATOM   5695  N  N     . VAL F 3 11  ? -3.447  28.635 -34.658  1.00 50.90  ? 307 VAL B N     1 
ATOM   5696  C  CA    . VAL F 3 11  ? -2.347  29.523 -34.984  1.00 49.75  ? 307 VAL B CA    1 
ATOM   5697  C  C     . VAL F 3 11  ? -1.785  29.890 -33.622  1.00 49.30  ? 307 VAL B C     1 
ATOM   5698  O  O     . VAL F 3 11  ? -2.519  30.358 -32.756  1.00 49.54  ? 307 VAL B O     1 
ATOM   5699  C  CB    . VAL F 3 11  ? -2.843  30.805 -35.714  1.00 49.51  ? 307 VAL B CB    1 
ATOM   5700  C  CG1   . VAL F 3 11  ? -1.738  31.844 -35.761  1.00 49.02  ? 307 VAL B CG1   1 
ATOM   5701  C  CG2   . VAL F 3 11  ? -3.288  30.460 -37.125  1.00 49.05  ? 307 VAL B CG2   1 
ATOM   5702  N  N     . THR F 3 12  ? -0.500  29.647 -33.402  1.00 48.31  ? 308 THR B N     1 
ATOM   5703  C  CA    . THR F 3 12  ? 0.070   29.987 -32.112  1.00 47.61  ? 308 THR B CA    1 
ATOM   5704  C  C     . THR F 3 12  ? 0.998   31.169 -32.286  1.00 47.43  ? 308 THR B C     1 
ATOM   5705  O  O     . THR F 3 12  ? 1.495   31.424 -33.385  1.00 47.58  ? 308 THR B O     1 
ATOM   5706  C  CB    . THR F 3 12  ? 0.839   28.794 -31.474  1.00 47.20  ? 308 THR B CB    1 
ATOM   5707  O  OG1   . THR F 3 12  ? 2.044   28.542 -32.203  1.00 47.12  ? 308 THR B OG1   1 
ATOM   5708  C  CG2   . THR F 3 12  ? -0.023  27.543 -31.491  1.00 47.07  ? 308 THR B CG2   1 
ATOM   5709  N  N     . GLU F 3 13  ? 1.222   31.896 -31.200  1.00 47.07  ? 309 GLU B N     1 
ATOM   5710  C  CA    . GLU F 3 13  ? 2.077   33.069 -31.245  1.00 46.96  ? 309 GLU B CA    1 
ATOM   5711  C  C     . GLU F 3 13  ? 3.408   32.828 -31.956  1.00 46.40  ? 309 GLU B C     1 
ATOM   5712  O  O     . GLU F 3 13  ? 3.929   33.725 -32.618  1.00 45.49  ? 309 GLU B O     1 
ATOM   5713  C  CB    . GLU F 3 13  ? 2.330   33.574 -29.829  1.00 47.83  ? 309 GLU B CB    1 
ATOM   5714  C  CG    . GLU F 3 13  ? 3.289   34.742 -29.763  1.00 49.25  ? 309 GLU B CG    1 
ATOM   5715  C  CD    . GLU F 3 13  ? 3.389   35.319 -28.374  1.00 50.09  ? 309 GLU B CD    1 
ATOM   5716  O  OE1   . GLU F 3 13  ? 4.193   36.260 -28.181  1.00 50.75  ? 309 GLU B OE1   1 
ATOM   5717  O  OE2   . GLU F 3 13  ? 2.662   34.831 -27.480  1.00 50.26  ? 309 GLU B OE2   1 
ATOM   5718  N  N     . GLU F 3 14  ? 3.952   31.621 -31.814  1.00 45.87  ? 310 GLU B N     1 
ATOM   5719  C  CA    . GLU F 3 14  ? 5.226   31.274 -32.442  1.00 45.55  ? 310 GLU B CA    1 
ATOM   5720  C  C     . GLU F 3 14  ? 5.125   31.446 -33.959  1.00 44.77  ? 310 GLU B C     1 
ATOM   5721  O  O     . GLU F 3 14  ? 6.076   31.884 -34.606  1.00 44.57  ? 310 GLU B O     1 
ATOM   5722  C  CB    . GLU F 3 14  ? 5.609   29.828 -32.098  1.00 46.09  ? 310 GLU B CB    1 
ATOM   5723  C  CG    . GLU F 3 14  ? 4.720   28.779 -32.749  1.00 46.66  ? 310 GLU B CG    1 
ATOM   5724  C  CD    . GLU F 3 14  ? 4.931   27.386 -32.181  1.00 47.30  ? 310 GLU B CD    1 
ATOM   5725  O  OE1   . GLU F 3 14  ? 6.101   26.951 -32.086  1.00 48.15  ? 310 GLU B OE1   1 
ATOM   5726  O  OE2   . GLU F 3 14  ? 3.927   26.720 -31.841  1.00 47.04  ? 310 GLU B OE2   1 
ATOM   5727  N  N     . MET F 3 15  ? 3.965   31.095 -34.512  1.00 43.73  ? 311 MET B N     1 
ATOM   5728  C  CA    . MET F 3 15  ? 3.708   31.218 -35.943  1.00 42.64  ? 311 MET B CA    1 
ATOM   5729  C  C     . MET F 3 15  ? 3.430   32.673 -36.313  1.00 42.05  ? 311 MET B C     1 
ATOM   5730  O  O     . MET F 3 15  ? 2.679   32.941 -37.252  1.00 42.64  ? 311 MET B O     1 
ATOM   5731  C  CB    . MET F 3 15  ? 2.491   30.381 -36.345  1.00 43.09  ? 311 MET B CB    1 
ATOM   5732  C  CG    . MET F 3 15  ? 2.660   28.880 -36.245  1.00 42.97  ? 311 MET B CG    1 
ATOM   5733  S  SD    . MET F 3 15  ? 1.124   28.001 -36.665  1.00 44.74  ? 311 MET B SD    1 
ATOM   5734  C  CE    . MET F 3 15  ? 0.703   27.286 -35.065  1.00 44.48  ? 311 MET B CE    1 
ATOM   5735  N  N     . LEU F 3 16  ? 4.028   33.608 -35.580  1.00 40.63  ? 312 LEU B N     1 
ATOM   5736  C  CA    . LEU F 3 16  ? 3.817   35.031 -35.841  1.00 39.62  ? 312 LEU B CA    1 
ATOM   5737  C  C     . LEU F 3 16  ? 5.040   35.877 -35.491  1.00 39.27  ? 312 LEU B C     1 
ATOM   5738  O  O     . LEU F 3 16  ? 4.896   37.010 -35.028  1.00 39.82  ? 312 LEU B O     1 
ATOM   5739  C  CB    . LEU F 3 16  ? 2.618   35.540 -35.033  1.00 38.09  ? 312 LEU B CB    1 
ATOM   5740  C  CG    . LEU F 3 16  ? 1.283   34.816 -35.172  1.00 37.03  ? 312 LEU B CG    1 
ATOM   5741  C  CD1   . LEU F 3 16  ? 0.333   35.322 -34.110  1.00 37.37  ? 312 LEU B CD1   1 
ATOM   5742  C  CD2   . LEU F 3 16  ? 0.702   35.032 -36.547  1.00 37.58  ? 312 LEU B CD2   1 
ATOM   5743  N  N     . ALA F 3 17  ? 6.235   35.332 -35.713  1.00 38.70  ? 313 ALA B N     1 
ATOM   5744  C  CA    . ALA F 3 17  ? 7.485   36.034 -35.417  1.00 37.70  ? 313 ALA B CA    1 
ATOM   5745  C  C     . ALA F 3 17  ? 7.588   37.394 -36.115  1.00 36.99  ? 313 ALA B C     1 
ATOM   5746  O  O     . ALA F 3 17  ? 6.729   37.751 -36.921  1.00 37.03  ? 313 ALA B O     1 
ATOM   5747  C  CB    . ALA F 3 17  ? 8.664   35.164 -35.809  1.00 37.79  ? 313 ALA B CB    1 
ATOM   5748  N  N     . ASP F 3 18  ? 8.638   38.153 -35.801  1.00 35.75  ? 314 ASP B N     1 
ATOM   5749  C  CA    . ASP F 3 18  ? 8.821   39.464 -36.413  1.00 34.98  ? 314 ASP B CA    1 
ATOM   5750  C  C     . ASP F 3 18  ? 9.404   39.366 -37.817  1.00 33.95  ? 314 ASP B C     1 
ATOM   5751  O  O     . ASP F 3 18  ? 8.969   40.073 -38.726  1.00 32.36  ? 314 ASP B O     1 
ATOM   5752  C  CB    . ASP F 3 18  ? 9.710   40.369 -35.541  1.00 35.93  ? 314 ASP B CB    1 
ATOM   5753  C  CG    . ASP F 3 18  ? 11.074  39.763 -35.244  1.00 37.56  ? 314 ASP B CG    1 
ATOM   5754  O  OD1   . ASP F 3 18  ? 11.938  40.498 -34.702  1.00 38.23  ? 314 ASP B OD1   1 
ATOM   5755  O  OD2   . ASP F 3 18  ? 11.281  38.561 -35.532  1.00 38.60  ? 314 ASP B OD2   1 
ATOM   5756  N  N     . LYS F 3 19  ? 10.400  38.501 -37.991  1.00 32.90  ? 315 LYS B N     1 
ATOM   5757  C  CA    . LYS F 3 19  ? 11.005  38.311 -39.299  1.00 32.64  ? 315 LYS B CA    1 
ATOM   5758  C  C     . LYS F 3 19  ? 10.628  36.900 -39.713  1.00 32.34  ? 315 LYS B C     1 
ATOM   5759  O  O     . LYS F 3 19  ? 10.742  35.964 -38.918  1.00 32.45  ? 315 LYS B O     1 
ATOM   5760  C  CB    . LYS F 3 19  ? 12.528  38.441 -39.218  1.00 33.18  ? 315 LYS B CB    1 
ATOM   5761  C  CG    . LYS F 3 19  ? 13.208  38.817 -40.524  1.00 32.63  ? 315 LYS B CG    1 
ATOM   5762  C  CD    . LYS F 3 19  ? 12.734  37.982 -41.687  1.00 32.98  ? 315 LYS B CD    1 
ATOM   5763  C  CE    . LYS F 3 19  ? 13.318  38.496 -43.000  1.00 33.33  ? 315 LYS B CE    1 
ATOM   5764  N  NZ    . LYS F 3 19  ? 14.811  38.560 -42.961  1.00 31.39  ? 315 LYS B NZ    1 
ATOM   5765  N  N     . ALA F 3 20  ? 10.172  36.734 -40.946  1.00 31.87  ? 316 ALA B N     1 
ATOM   5766  C  CA    . ALA F 3 20  ? 9.783   35.408 -41.386  1.00 31.34  ? 316 ALA B CA    1 
ATOM   5767  C  C     . ALA F 3 20  ? 9.828   35.204 -42.888  1.00 31.15  ? 316 ALA B C     1 
ATOM   5768  O  O     . ALA F 3 20  ? 9.775   36.162 -43.665  1.00 31.30  ? 316 ALA B O     1 
ATOM   5769  C  CB    . ALA F 3 20  ? 8.375   35.099 -40.877  1.00 31.38  ? 316 ALA B CB    1 
ATOM   5770  N  N     . ALA F 3 21  ? 9.944   33.938 -43.281  1.00 29.88  ? 317 ALA B N     1 
ATOM   5771  C  CA    . ALA F 3 21  ? 9.906   33.554 -44.680  1.00 29.48  ? 317 ALA B CA    1 
ATOM   5772  C  C     . ALA F 3 21  ? 8.466   33.075 -44.736  1.00 29.52  ? 317 ALA B C     1 
ATOM   5773  O  O     . ALA F 3 21  ? 8.035   32.322 -43.877  1.00 28.11  ? 317 ALA B O     1 
ATOM   5774  C  CB    . ALA F 3 21  ? 10.865  32.406 -44.969  1.00 29.65  ? 317 ALA B CB    1 
ATOM   5775  N  N     . LEU F 3 22  ? 7.718   33.539 -45.729  1.00 29.80  ? 318 LEU B N     1 
ATOM   5776  C  CA    . LEU F 3 22  ? 6.316   33.182 -45.842  1.00 29.65  ? 318 LEU B CA    1 
ATOM   5777  C  C     . LEU F 3 22  ? 5.941   32.695 -47.233  1.00 29.77  ? 318 LEU B C     1 
ATOM   5778  O  O     . LEU F 3 22  ? 6.396   33.222 -48.248  1.00 30.29  ? 318 LEU B O     1 
ATOM   5779  C  CB    . LEU F 3 22  ? 5.462   34.403 -45.473  1.00 29.88  ? 318 LEU B CB    1 
ATOM   5780  C  CG    . LEU F 3 22  ? 3.936   34.334 -45.547  1.00 29.62  ? 318 LEU B CG    1 
ATOM   5781  C  CD1   . LEU F 3 22  ? 3.397   33.464 -44.418  1.00 28.33  ? 318 LEU B CD1   1 
ATOM   5782  C  CD2   . LEU F 3 22  ? 3.362   35.757 -45.463  1.00 29.13  ? 318 LEU B CD2   1 
ATOM   5783  N  N     . VAL F 3 23  ? 5.103   31.675 -47.271  1.00 29.41  ? 319 VAL B N     1 
ATOM   5784  C  CA    . VAL F 3 23  ? 4.641   31.144 -48.525  1.00 29.59  ? 319 VAL B CA    1 
ATOM   5785  C  C     . VAL F 3 23  ? 3.126   31.061 -48.417  1.00 29.88  ? 319 VAL B C     1 
ATOM   5786  O  O     . VAL F 3 23  ? 2.596   30.483 -47.480  1.00 29.27  ? 319 VAL B O     1 
ATOM   5787  C  CB    . VAL F 3 23  ? 5.233   29.736 -48.802  1.00 30.03  ? 319 VAL B CB    1 
ATOM   5788  C  CG1   . VAL F 3 23  ? 4.753   29.227 -50.151  1.00 28.12  ? 319 VAL B CG1   1 
ATOM   5789  C  CG2   . VAL F 3 23  ? 6.781   29.800 -48.778  1.00 29.01  ? 319 VAL B CG2   1 
ATOM   5790  N  N     . VAL F 3 24  ? 2.446   31.706 -49.356  1.00 31.09  ? 320 VAL B N     1 
ATOM   5791  C  CA    . VAL F 3 24  ? 0.991   31.700 -49.431  1.00 32.48  ? 320 VAL B CA    1 
ATOM   5792  C  C     . VAL F 3 24  ? 0.801   31.244 -50.858  1.00 33.91  ? 320 VAL B C     1 
ATOM   5793  O  O     . VAL F 3 24  ? 0.804   32.057 -51.776  1.00 34.54  ? 320 VAL B O     1 
ATOM   5794  C  CB    . VAL F 3 24  ? 0.390   33.107 -49.261  1.00 31.98  ? 320 VAL B CB    1 
ATOM   5795  C  CG1   . VAL F 3 24  ? -1.125  33.014 -49.262  1.00 31.69  ? 320 VAL B CG1   1 
ATOM   5796  C  CG2   . VAL F 3 24  ? 0.868   33.729 -47.959  1.00 31.47  ? 320 VAL B CG2   1 
ATOM   5797  N  N     . GLU F 3 25  ? 0.644   29.935 -51.029  1.00 35.55  ? 321 GLU B N     1 
ATOM   5798  C  CA    . GLU F 3 25  ? 0.537   29.308 -52.348  1.00 36.82  ? 321 GLU B CA    1 
ATOM   5799  C  C     . GLU F 3 25  ? -0.753  29.375 -53.146  1.00 37.39  ? 321 GLU B C     1 
ATOM   5800  O  O     . GLU F 3 25  ? -1.835  29.078 -52.643  1.00 37.70  ? 321 GLU B O     1 
ATOM   5801  C  CB    . GLU F 3 25  ? 0.950   27.839 -52.243  1.00 36.01  ? 321 GLU B CB    1 
ATOM   5802  C  CG    . GLU F 3 25  ? 1.238   27.208 -53.590  1.00 36.65  ? 321 GLU B CG    1 
ATOM   5803  C  CD    . GLU F 3 25  ? 2.714   27.195 -53.930  1.00 36.78  ? 321 GLU B CD    1 
ATOM   5804  O  OE1   . GLU F 3 25  ? 3.381   28.239 -53.766  1.00 36.77  ? 321 GLU B OE1   1 
ATOM   5805  O  OE2   . GLU F 3 25  ? 3.206   26.134 -54.368  1.00 37.02  ? 321 GLU B OE2   1 
ATOM   5806  N  N     . VAL F 3 26  ? -0.596  29.735 -54.420  1.00 38.45  ? 322 VAL B N     1 
ATOM   5807  C  CA    . VAL F 3 26  ? -1.688  29.836 -55.389  1.00 38.73  ? 322 VAL B CA    1 
ATOM   5808  C  C     . VAL F 3 26  ? -1.196  29.065 -56.617  1.00 39.12  ? 322 VAL B C     1 
ATOM   5809  O  O     . VAL F 3 26  ? -0.126  29.370 -57.164  1.00 38.74  ? 322 VAL B O     1 
ATOM   5810  C  CB    . VAL F 3 26  ? -1.967  31.307 -55.772  1.00 38.97  ? 322 VAL B CB    1 
ATOM   5811  C  CG1   . VAL F 3 26  ? -3.085  31.373 -56.791  1.00 39.63  ? 322 VAL B CG1   1 
ATOM   5812  C  CG2   . VAL F 3 26  ? -2.332  32.106 -54.528  1.00 38.75  ? 322 VAL B CG2   1 
ATOM   5813  N  N     . VAL F 3 27  ? -1.971  28.069 -57.046  1.00 39.61  ? 323 VAL B N     1 
ATOM   5814  C  CA    . VAL F 3 27  ? -1.582  27.223 -58.170  1.00 40.19  ? 323 VAL B CA    1 
ATOM   5815  C  C     . VAL F 3 27  ? -2.100  27.583 -59.569  1.00 39.98  ? 323 VAL B C     1 
ATOM   5816  O  O     . VAL F 3 27  ? -1.435  27.278 -60.554  1.00 39.39  ? 323 VAL B O     1 
ATOM   5817  C  CB    . VAL F 3 27  ? -1.942  25.754 -57.872  1.00 40.90  ? 323 VAL B CB    1 
ATOM   5818  C  CG1   . VAL F 3 27  ? -1.305  24.843 -58.901  1.00 40.89  ? 323 VAL B CG1   1 
ATOM   5819  C  CG2   . VAL F 3 27  ? -1.481  25.390 -56.471  1.00 41.33  ? 323 VAL B CG2   1 
ATOM   5820  N  N     . GLU F 3 28  ? -3.276  28.203 -59.677  1.00 40.33  ? 324 GLU B N     1 
ATOM   5821  C  CA    . GLU F 3 28  ? -3.781  28.592 -60.998  1.00 40.48  ? 324 GLU B CA    1 
ATOM   5822  C  C     . GLU F 3 28  ? -2.706  29.482 -61.606  1.00 40.28  ? 324 GLU B C     1 
ATOM   5823  O  O     . GLU F 3 28  ? -2.034  30.218 -60.881  1.00 40.36  ? 324 GLU B O     1 
ATOM   5824  C  CB    . GLU F 3 28  ? -5.068  29.417 -60.896  1.00 41.60  ? 324 GLU B CB    1 
ATOM   5825  C  CG    . GLU F 3 28  ? -6.158  28.847 -60.009  1.00 43.00  ? 324 GLU B CG    1 
ATOM   5826  C  CD    . GLU F 3 28  ? -6.586  27.465 -60.426  1.00 43.48  ? 324 GLU B CD    1 
ATOM   5827  O  OE1   . GLU F 3 28  ? -6.843  27.258 -61.632  1.00 45.14  ? 324 GLU B OE1   1 
ATOM   5828  O  OE2   . GLU F 3 28  ? -6.674  26.590 -59.544  1.00 44.22  ? 324 GLU B OE2   1 
ATOM   5829  N  N     . GLU F 3 29  ? -2.530  29.428 -62.921  1.00 40.28  ? 325 GLU B N     1 
ATOM   5830  C  CA    . GLU F 3 29  ? -1.523  30.272 -63.547  1.00 40.31  ? 325 GLU B CA    1 
ATOM   5831  C  C     . GLU F 3 29  ? -1.935  31.734 -63.328  1.00 39.41  ? 325 GLU B C     1 
ATOM   5832  O  O     . GLU F 3 29  ? -1.130  32.570 -62.925  1.00 38.74  ? 325 GLU B O     1 
ATOM   5833  C  CB    . GLU F 3 29  ? -1.401  29.961 -65.044  1.00 41.77  ? 325 GLU B CB    1 
ATOM   5834  C  CG    . GLU F 3 29  ? -0.079  30.441 -65.639  1.00 44.48  ? 325 GLU B CG    1 
ATOM   5835  C  CD    . GLU F 3 29  ? 0.599   29.396 -66.512  1.00 46.22  ? 325 GLU B CD    1 
ATOM   5836  O  OE1   . GLU F 3 29  ? 1.811   29.552 -66.791  1.00 46.80  ? 325 GLU B OE1   1 
ATOM   5837  O  OE2   . GLU F 3 29  ? -0.074  28.425 -66.925  1.00 47.15  ? 325 GLU B OE2   1 
ATOM   5838  N  N     . ASN F 3 30  ? -3.206  32.025 -63.579  1.00 38.56  ? 326 ASN B N     1 
ATOM   5839  C  CA    . ASN F 3 30  ? -3.742  33.369 -63.393  1.00 37.43  ? 326 ASN B CA    1 
ATOM   5840  C  C     . ASN F 3 30  ? -4.188  33.471 -61.937  1.00 36.86  ? 326 ASN B C     1 
ATOM   5841  O  O     . ASN F 3 30  ? -5.226  32.914 -61.556  1.00 37.11  ? 326 ASN B O     1 
ATOM   5842  C  CB    . ASN F 3 30  ? -4.928  33.573 -64.328  1.00 37.68  ? 326 ASN B CB    1 
ATOM   5843  C  CG    . ASN F 3 30  ? -5.499  34.962 -64.243  1.00 37.31  ? 326 ASN B CG    1 
ATOM   5844  O  OD1   . ASN F 3 30  ? -5.964  35.386 -63.189  1.00 37.69  ? 326 ASN B OD1   1 
ATOM   5845  N  ND2   . ASN F 3 30  ? -5.471  35.682 -65.357  1.00 37.85  ? 326 ASN B ND2   1 
ATOM   5846  N  N     . TYR F 3 31  ? -3.415  34.184 -61.121  1.00 35.50  ? 327 TYR B N     1 
ATOM   5847  C  CA    . TYR F 3 31  ? -3.734  34.295 -59.703  1.00 34.76  ? 327 TYR B CA    1 
ATOM   5848  C  C     . TYR F 3 31  ? -4.909  35.177 -59.266  1.00 35.10  ? 327 TYR B C     1 
ATOM   5849  O  O     . TYR F 3 31  ? -5.141  35.335 -58.067  1.00 35.01  ? 327 TYR B O     1 
ATOM   5850  C  CB    . TYR F 3 31  ? -2.480  34.681 -58.916  1.00 33.54  ? 327 TYR B CB    1 
ATOM   5851  C  CG    . TYR F 3 31  ? -1.768  35.930 -59.378  1.00 32.27  ? 327 TYR B CG    1 
ATOM   5852  C  CD1   . TYR F 3 31  ? -2.331  37.191 -59.194  1.00 31.36  ? 327 TYR B CD1   1 
ATOM   5853  C  CD2   . TYR F 3 31  ? -0.488  35.854 -59.936  1.00 31.71  ? 327 TYR B CD2   1 
ATOM   5854  C  CE1   . TYR F 3 31  ? -1.642  38.343 -59.546  1.00 30.56  ? 327 TYR B CE1   1 
ATOM   5855  C  CE2   . TYR F 3 31  ? 0.209   37.001 -60.285  1.00 30.38  ? 327 TYR B CE2   1 
ATOM   5856  C  CZ    . TYR F 3 31  ? -0.370  38.238 -60.085  1.00 30.06  ? 327 TYR B CZ    1 
ATOM   5857  O  OH    . TYR F 3 31  ? 0.335   39.366 -60.405  1.00 29.93  ? 327 TYR B OH    1 
ATOM   5858  N  N     . HIS F 3 32  ? -5.652  35.737 -60.215  1.00 35.36  ? 328 HIS B N     1 
ATOM   5859  C  CA    . HIS F 3 32  ? -6.812  36.566 -59.864  1.00 36.33  ? 328 HIS B CA    1 
ATOM   5860  C  C     . HIS F 3 32  ? -7.980  35.684 -59.447  1.00 36.60  ? 328 HIS B C     1 
ATOM   5861  O  O     . HIS F 3 32  ? -8.378  34.779 -60.186  1.00 36.66  ? 328 HIS B O     1 
ATOM   5862  C  CB    . HIS F 3 32  ? -7.253  37.439 -61.050  1.00 36.50  ? 328 HIS B CB    1 
ATOM   5863  C  CG    . HIS F 3 32  ? -6.487  38.717 -61.182  1.00 36.28  ? 328 HIS B CG    1 
ATOM   5864  N  ND1   . HIS F 3 32  ? -6.441  39.662 -60.181  1.00 35.67  ? 328 HIS B ND1   1 
ATOM   5865  C  CD2   . HIS F 3 32  ? -5.741  39.210 -62.199  1.00 36.61  ? 328 HIS B CD2   1 
ATOM   5866  C  CE1   . HIS F 3 32  ? -5.699  40.682 -60.572  1.00 36.02  ? 328 HIS B CE1   1 
ATOM   5867  N  NE2   . HIS F 3 32  ? -5.262  40.433 -61.794  1.00 36.98  ? 328 HIS B NE2   1 
ATOM   5868  N  N     . ALA F 3 33  ? -8.526  35.952 -58.265  1.00 36.69  ? 329 ALA B N     1 
ATOM   5869  C  CA    . ALA F 3 33  ? -9.655  35.187 -57.751  1.00 37.55  ? 329 ALA B CA    1 
ATOM   5870  C  C     . ALA F 3 33  ? -9.374  33.688 -57.809  1.00 38.10  ? 329 ALA B C     1 
ATOM   5871  O  O     . ALA F 3 33  ? -10.272 32.889 -58.073  1.00 37.67  ? 329 ALA B O     1 
ATOM   5872  C  CB    . ALA F 3 33  ? -10.917 35.513 -58.551  1.00 37.60  ? 329 ALA B CB    1 
ATOM   5873  N  N     . ALA F 3 34  ? -8.121  33.316 -57.569  1.00 38.90  ? 330 ALA B N     1 
ATOM   5874  C  CA    . ALA F 3 34  ? -7.722  31.911 -57.589  1.00 39.16  ? 330 ALA B CA    1 
ATOM   5875  C  C     . ALA F 3 34  ? -7.558  31.405 -56.163  1.00 39.43  ? 330 ALA B C     1 
ATOM   5876  O  O     . ALA F 3 34  ? -7.287  32.178 -55.251  1.00 39.27  ? 330 ALA B O     1 
ATOM   5877  C  CB    . ALA F 3 34  ? -6.419  31.751 -58.353  1.00 39.27  ? 330 ALA B CB    1 
ATOM   5878  N  N     . PRO F 3 35  ? -7.719  30.090 -55.954  1.00 40.05  ? 331 PRO B N     1 
ATOM   5879  C  CA    . PRO F 3 35  ? -7.591  29.471 -54.630  1.00 40.66  ? 331 PRO B CA    1 
ATOM   5880  C  C     . PRO F 3 35  ? -6.205  29.554 -53.994  1.00 41.39  ? 331 PRO B C     1 
ATOM   5881  O  O     . PRO F 3 35  ? -5.194  29.657 -54.689  1.00 42.27  ? 331 PRO B O     1 
ATOM   5882  C  CB    . PRO F 3 35  ? -7.990  28.017 -54.889  1.00 40.46  ? 331 PRO B CB    1 
ATOM   5883  C  CG    . PRO F 3 35  ? -8.903  28.110 -56.082  1.00 40.50  ? 331 PRO B CG    1 
ATOM   5884  C  CD    . PRO F 3 35  ? -8.196  29.110 -56.946  1.00 39.98  ? 331 PRO B CD    1 
ATOM   5885  N  N     . ILE F 3 36  ? -6.170  29.519 -52.666  1.00 41.69  ? 332 ILE B N     1 
ATOM   5886  C  CA    . ILE F 3 36  ? -4.915  29.514 -51.924  1.00 42.31  ? 332 ILE B CA    1 
ATOM   5887  C  C     . ILE F 3 36  ? -4.848  28.082 -51.379  1.00 42.45  ? 332 ILE B C     1 
ATOM   5888  O  O     . ILE F 3 36  ? -5.710  27.676 -50.596  1.00 42.16  ? 332 ILE B O     1 
ATOM   5889  C  CB    . ILE F 3 36  ? -4.925  30.534 -50.753  1.00 42.75  ? 332 ILE B CB    1 
ATOM   5890  C  CG1   . ILE F 3 36  ? -4.876  31.959 -51.305  1.00 42.71  ? 332 ILE B CG1   1 
ATOM   5891  C  CG2   . ILE F 3 36  ? -3.750  30.286 -49.828  1.00 42.36  ? 332 ILE B CG2   1 
ATOM   5892  C  CD1   . ILE F 3 36  ? -4.706  33.031 -50.239  1.00 43.74  ? 332 ILE B CD1   1 
ATOM   5893  N  N     . VAL F 3 37  ? -3.835  27.322 -51.792  1.00 42.27  ? 333 VAL B N     1 
ATOM   5894  C  CA    . VAL F 3 37  ? -3.719  25.920 -51.383  1.00 42.63  ? 333 VAL B CA    1 
ATOM   5895  C  C     . VAL F 3 37  ? -2.894  25.555 -50.153  1.00 42.63  ? 333 VAL B C     1 
ATOM   5896  O  O     . VAL F 3 37  ? -2.609  24.374 -49.934  1.00 43.25  ? 333 VAL B O     1 
ATOM   5897  C  CB    . VAL F 3 37  ? -3.213  25.050 -52.554  1.00 42.39  ? 333 VAL B CB    1 
ATOM   5898  C  CG1   . VAL F 3 37  ? -4.247  25.026 -53.657  1.00 42.91  ? 333 VAL B CG1   1 
ATOM   5899  C  CG2   . VAL F 3 37  ? -1.892  25.590 -53.078  1.00 43.38  ? 333 VAL B CG2   1 
ATOM   5900  N  N     . GLY F 3 38  ? -2.510  26.541 -49.349  1.00 42.10  ? 334 GLY B N     1 
ATOM   5901  C  CA    . GLY F 3 38  ? -1.740  26.235 -48.159  1.00 41.04  ? 334 GLY B CA    1 
ATOM   5902  C  C     . GLY F 3 38  ? -0.743  27.308 -47.791  1.00 40.31  ? 334 GLY B C     1 
ATOM   5903  O  O     . GLY F 3 38  ? -0.114  27.891 -48.661  1.00 40.70  ? 334 GLY B O     1 
ATOM   5904  N  N     . ILE F 3 39  ? -0.600  27.568 -46.497  1.00 39.81  ? 335 ILE B N     1 
ATOM   5905  C  CA    . ILE F 3 39  ? 0.333   28.578 -46.016  1.00 39.59  ? 335 ILE B CA    1 
ATOM   5906  C  C     . ILE F 3 39  ? 1.534   27.930 -45.321  1.00 39.41  ? 335 ILE B C     1 
ATOM   5907  O  O     . ILE F 3 39  ? 1.374   27.120 -44.406  1.00 39.56  ? 335 ILE B O     1 
ATOM   5908  C  CB    . ILE F 3 39  ? -0.351  29.551 -45.022  1.00 39.67  ? 335 ILE B CB    1 
ATOM   5909  C  CG1   . ILE F 3 39  ? -1.375  30.436 -45.752  1.00 40.10  ? 335 ILE B CG1   1 
ATOM   5910  C  CG2   . ILE F 3 39  ? 0.697   30.420 -44.333  1.00 40.05  ? 335 ILE B CG2   1 
ATOM   5911  C  CD1   . ILE F 3 39  ? -2.618  29.701 -46.247  1.00 39.64  ? 335 ILE B CD1   1 
ATOM   5912  N  N     . ALA F 3 40  ? 2.736   28.275 -45.769  1.00 38.67  ? 336 ALA B N     1 
ATOM   5913  C  CA    . ALA F 3 40  ? 3.944   27.740 -45.158  1.00 38.37  ? 336 ALA B CA    1 
ATOM   5914  C  C     . ALA F 3 40  ? 4.693   28.901 -44.502  1.00 38.43  ? 336 ALA B C     1 
ATOM   5915  O  O     . ALA F 3 40  ? 4.877   29.954 -45.108  1.00 37.70  ? 336 ALA B O     1 
ATOM   5916  C  CB    . ALA F 3 40  ? 4.823   27.064 -46.210  1.00 37.89  ? 336 ALA B CB    1 
ATOM   5917  N  N     . VAL F 3 41  ? 5.106   28.706 -43.254  1.00 38.26  ? 337 VAL B N     1 
ATOM   5918  C  CA    . VAL F 3 41  ? 5.831   29.726 -42.512  1.00 38.45  ? 337 VAL B CA    1 
ATOM   5919  C  C     . VAL F 3 41  ? 7.114   29.134 -41.947  1.00 38.76  ? 337 VAL B C     1 
ATOM   5920  O  O     . VAL F 3 41  ? 7.122   28.012 -41.449  1.00 38.63  ? 337 VAL B O     1 
ATOM   5921  C  CB    . VAL F 3 41  ? 4.993   30.265 -41.329  1.00 38.61  ? 337 VAL B CB    1 
ATOM   5922  C  CG1   . VAL F 3 41  ? 5.748   31.371 -40.617  1.00 37.48  ? 337 VAL B CG1   1 
ATOM   5923  C  CG2   . VAL F 3 41  ? 3.645   30.764 -41.828  1.00 38.92  ? 337 VAL B CG2   1 
ATOM   5924  N  N     . VAL F 3 42  ? 8.196   29.892 -42.029  1.00 38.81  ? 338 VAL B N     1 
ATOM   5925  C  CA    . VAL F 3 42  ? 9.472   29.441 -41.498  1.00 38.90  ? 338 VAL B CA    1 
ATOM   5926  C  C     . VAL F 3 42  ? 10.170  30.609 -40.816  1.00 39.16  ? 338 VAL B C     1 
ATOM   5927  O  O     . VAL F 3 42  ? 10.419  31.640 -41.433  1.00 38.91  ? 338 VAL B O     1 
ATOM   5928  C  CB    . VAL F 3 42  ? 10.392  28.874 -42.613  1.00 38.85  ? 338 VAL B CB    1 
ATOM   5929  C  CG1   . VAL F 3 42  ? 11.811  28.724 -42.094  1.00 38.56  ? 338 VAL B CG1   1 
ATOM   5930  C  CG2   . VAL F 3 42  ? 9.881   27.525 -43.074  1.00 38.24  ? 338 VAL B CG2   1 
ATOM   5931  N  N     . ASN F 3 43  ? 10.458  30.443 -39.530  1.00 39.72  ? 339 ASN B N     1 
ATOM   5932  C  CA    . ASN F 3 43  ? 11.145  31.458 -38.747  1.00 40.20  ? 339 ASN B CA    1 
ATOM   5933  C  C     . ASN F 3 43  ? 12.015  30.717 -37.739  1.00 40.64  ? 339 ASN B C     1 
ATOM   5934  O  O     . ASN F 3 43  ? 12.141  29.498 -37.811  1.00 40.01  ? 339 ASN B O     1 
ATOM   5935  C  CB    . ASN F 3 43  ? 10.139  32.371 -38.030  1.00 40.99  ? 339 ASN B CB    1 
ATOM   5936  C  CG    . ASN F 3 43  ? 9.399   31.665 -36.905  1.00 41.54  ? 339 ASN B CG    1 
ATOM   5937  O  OD1   . ASN F 3 43  ? 10.016  31.137 -35.980  1.00 40.97  ? 339 ASN B OD1   1 
ATOM   5938  N  ND2   . ASN F 3 43  ? 8.069   31.667 -36.972  1.00 41.31  ? 339 ASN B ND2   1 
ATOM   5939  N  N     . GLU F 3 44  ? 12.596  31.447 -36.793  1.00 41.33  ? 340 GLU B N     1 
ATOM   5940  C  CA    . GLU F 3 44  ? 13.478  30.850 -35.794  1.00 41.93  ? 340 GLU B CA    1 
ATOM   5941  C  C     . GLU F 3 44  ? 12.917  29.724 -34.925  1.00 41.90  ? 340 GLU B C     1 
ATOM   5942  O  O     . GLU F 3 44  ? 13.607  28.741 -34.654  1.00 41.86  ? 340 GLU B O     1 
ATOM   5943  C  CB    . GLU F 3 44  ? 14.030  31.945 -34.887  1.00 43.19  ? 340 GLU B CB    1 
ATOM   5944  C  CG    . GLU F 3 44  ? 12.977  32.862 -34.319  1.00 44.22  ? 340 GLU B CG    1 
ATOM   5945  C  CD    . GLU F 3 44  ? 13.580  33.914 -33.425  1.00 45.89  ? 340 GLU B CD    1 
ATOM   5946  O  OE1   . GLU F 3 44  ? 14.688  34.398 -33.754  1.00 46.53  ? 340 GLU B OE1   1 
ATOM   5947  O  OE2   . GLU F 3 44  ? 12.949  34.262 -32.399  1.00 46.51  ? 340 GLU B OE2   1 
ATOM   5948  N  N     . HIS F 3 45  ? 11.675  29.868 -34.484  1.00 41.61  ? 341 HIS B N     1 
ATOM   5949  C  CA    . HIS F 3 45  ? 11.047  28.873 -33.625  1.00 41.22  ? 341 HIS B CA    1 
ATOM   5950  C  C     . HIS F 3 45  ? 10.742  27.571 -34.375  1.00 41.11  ? 341 HIS B C     1 
ATOM   5951  O  O     . HIS F 3 45  ? 10.481  26.531 -33.768  1.00 40.96  ? 341 HIS B O     1 
ATOM   5952  C  CB    . HIS F 3 45  ? 9.780   29.483 -33.026  1.00 41.69  ? 341 HIS B CB    1 
ATOM   5953  C  CG    . HIS F 3 45  ? 9.966   30.897 -32.566  1.00 42.00  ? 341 HIS B CG    1 
ATOM   5954  N  ND1   . HIS F 3 45  ? 9.144   31.928 -32.972  1.00 42.02  ? 341 HIS B ND1   1 
ATOM   5955  C  CD2   . HIS F 3 45  ? 10.922  31.463 -31.790  1.00 42.15  ? 341 HIS B CD2   1 
ATOM   5956  C  CE1   . HIS F 3 45  ? 9.588   33.066 -32.470  1.00 42.21  ? 341 HIS B CE1   1 
ATOM   5957  N  NE2   . HIS F 3 45  ? 10.666  32.813 -31.750  1.00 42.40  ? 341 HIS B NE2   1 
ATOM   5958  N  N     . GLY F 3 46  ? 10.784  27.628 -35.699  1.00 40.49  ? 342 GLY B N     1 
ATOM   5959  C  CA    . GLY F 3 46  ? 10.521  26.438 -36.478  1.00 40.04  ? 342 GLY B CA    1 
ATOM   5960  C  C     . GLY F 3 46  ? 9.924   26.685 -37.847  1.00 39.63  ? 342 GLY B C     1 
ATOM   5961  O  O     . GLY F 3 46  ? 9.903   27.809 -38.350  1.00 39.40  ? 342 GLY B O     1 
ATOM   5962  N  N     . ARG F 3 47  ? 9.441   25.606 -38.448  1.00 39.21  ? 343 ARG B N     1 
ATOM   5963  C  CA    . ARG F 3 47  ? 8.832   25.647 -39.766  1.00 38.93  ? 343 ARG B CA    1 
ATOM   5964  C  C     . ARG F 3 47  ? 7.414   25.118 -39.600  1.00 38.98  ? 343 ARG B C     1 
ATOM   5965  O  O     . ARG F 3 47  ? 7.208   24.104 -38.938  1.00 39.44  ? 343 ARG B O     1 
ATOM   5966  C  CB    . ARG F 3 47  ? 9.637   24.760 -40.712  1.00 38.26  ? 343 ARG B CB    1 
ATOM   5967  C  CG    . ARG F 3 47  ? 11.128  25.022 -40.629  1.00 36.99  ? 343 ARG B CG    1 
ATOM   5968  C  CD    . ARG F 3 47  ? 11.899  24.085 -41.520  1.00 36.93  ? 343 ARG B CD    1 
ATOM   5969  N  NE    . ARG F 3 47  ? 13.342  24.263 -41.384  1.00 36.40  ? 343 ARG B NE    1 
ATOM   5970  C  CZ    . ARG F 3 47  ? 14.181  23.278 -41.081  1.00 36.47  ? 343 ARG B CZ    1 
ATOM   5971  N  NH1   . ARG F 3 47  ? 13.719  22.052 -40.881  1.00 37.25  ? 343 ARG B NH1   1 
ATOM   5972  N  NH2   . ARG F 3 47  ? 15.476  23.515 -40.981  1.00 35.99  ? 343 ARG B NH2   1 
ATOM   5973  N  N     . PHE F 3 48  ? 6.433   25.797 -40.184  1.00 39.29  ? 344 PHE B N     1 
ATOM   5974  C  CA    . PHE F 3 48  ? 5.049   25.356 -40.037  1.00 39.69  ? 344 PHE B CA    1 
ATOM   5975  C  C     . PHE F 3 48  ? 4.209   25.402 -41.307  1.00 40.62  ? 344 PHE B C     1 
ATOM   5976  O  O     . PHE F 3 48  ? 4.422   26.238 -42.188  1.00 40.83  ? 344 PHE B O     1 
ATOM   5977  C  CB    . PHE F 3 48  ? 4.328   26.184 -38.965  1.00 39.57  ? 344 PHE B CB    1 
ATOM   5978  C  CG    . PHE F 3 48  ? 5.202   26.605 -37.812  1.00 39.44  ? 344 PHE B CG    1 
ATOM   5979  C  CD1   . PHE F 3 48  ? 6.068   27.687 -37.934  1.00 39.17  ? 344 PHE B CD1   1 
ATOM   5980  C  CD2   . PHE F 3 48  ? 5.149   25.930 -36.599  1.00 39.42  ? 344 PHE B CD2   1 
ATOM   5981  C  CE1   . PHE F 3 48  ? 6.864   28.086 -36.865  1.00 39.16  ? 344 PHE B CE1   1 
ATOM   5982  C  CE2   . PHE F 3 48  ? 5.941   26.324 -35.528  1.00 39.04  ? 344 PHE B CE2   1 
ATOM   5983  C  CZ    . PHE F 3 48  ? 6.797   27.399 -35.659  1.00 39.26  ? 344 PHE B CZ    1 
ATOM   5984  N  N     . PHE F 3 49  ? 3.255   24.480 -41.387  1.00 41.24  ? 345 PHE B N     1 
ATOM   5985  C  CA    . PHE F 3 49  ? 2.320   24.401 -42.498  1.00 42.26  ? 345 PHE B CA    1 
ATOM   5986  C  C     . PHE F 3 49  ? 0.997   24.820 -41.888  1.00 43.29  ? 345 PHE B C     1 
ATOM   5987  O  O     . PHE F 3 49  ? 0.816   24.711 -40.673  1.00 43.36  ? 345 PHE B O     1 
ATOM   5988  C  CB    . PHE F 3 49  ? 2.175   22.969 -43.008  1.00 41.95  ? 345 PHE B CB    1 
ATOM   5989  C  CG    . PHE F 3 49  ? 1.031   22.785 -43.966  1.00 41.97  ? 345 PHE B CG    1 
ATOM   5990  C  CD1   . PHE F 3 49  ? 1.183   23.075 -45.318  1.00 42.23  ? 345 PHE B CD1   1 
ATOM   5991  C  CD2   . PHE F 3 49  ? -0.215  22.366 -43.507  1.00 41.71  ? 345 PHE B CD2   1 
ATOM   5992  C  CE1   . PHE F 3 49  ? 0.114   22.954 -46.198  1.00 42.29  ? 345 PHE B CE1   1 
ATOM   5993  C  CE2   . PHE F 3 49  ? -1.290  22.243 -44.380  1.00 41.61  ? 345 PHE B CE2   1 
ATOM   5994  C  CZ    . PHE F 3 49  ? -1.128  22.537 -45.727  1.00 42.10  ? 345 PHE B CZ    1 
ATOM   5995  N  N     . LEU F 3 50  ? 0.075   25.289 -42.724  1.00 44.50  ? 346 LEU B N     1 
ATOM   5996  C  CA    . LEU F 3 50  ? -1.239  25.712 -42.257  1.00 45.16  ? 346 LEU B CA    1 
ATOM   5997  C  C     . LEU F 3 50  ? -2.302  25.624 -43.335  1.00 45.63  ? 346 LEU B C     1 
ATOM   5998  O  O     . LEU F 3 50  ? -2.072  25.998 -44.484  1.00 45.11  ? 346 LEU B O     1 
ATOM   5999  C  CB    . LEU F 3 50  ? -1.194  27.152 -41.742  1.00 45.19  ? 346 LEU B CB    1 
ATOM   6000  C  CG    . LEU F 3 50  ? -0.447  27.420 -40.439  1.00 45.50  ? 346 LEU B CG    1 
ATOM   6001  C  CD1   . LEU F 3 50  ? -0.481  28.908 -40.115  1.00 45.15  ? 346 LEU B CD1   1 
ATOM   6002  C  CD2   . LEU F 3 50  ? -1.091  26.614 -39.327  1.00 46.47  ? 346 LEU B CD2   1 
ATOM   6003  N  N     . ARG F 3 51  ? -3.472  25.126 -42.955  1.00 46.75  ? 347 ARG B N     1 
ATOM   6004  C  CA    . ARG F 3 51  ? -4.586  25.042 -43.886  1.00 47.82  ? 347 ARG B CA    1 
ATOM   6005  C  C     . ARG F 3 51  ? -4.981  26.494 -44.124  1.00 48.05  ? 347 ARG B C     1 
ATOM   6006  O  O     . ARG F 3 51  ? -4.903  27.318 -43.209  1.00 48.40  ? 347 ARG B O     1 
ATOM   6007  C  CB    . ARG F 3 51  ? -5.767  24.290 -43.254  1.00 48.48  ? 347 ARG B CB    1 
ATOM   6008  C  CG    . ARG F 3 51  ? -5.963  22.847 -43.730  1.00 49.90  ? 347 ARG B CG    1 
ATOM   6009  C  CD    . ARG F 3 51  ? -5.270  21.830 -42.829  1.00 50.59  ? 347 ARG B CD    1 
ATOM   6010  N  NE    . ARG F 3 51  ? -5.679  21.976 -41.435  1.00 51.38  ? 347 ARG B NE    1 
ATOM   6011  C  CZ    . ARG F 3 51  ? -5.402  21.102 -40.469  1.00 52.10  ? 347 ARG B CZ    1 
ATOM   6012  N  NH1   . ARG F 3 51  ? -4.710  19.996 -40.735  1.00 52.24  ? 347 ARG B NH1   1 
ATOM   6013  N  NH2   . ARG F 3 51  ? -5.815  21.338 -39.228  1.00 51.95  ? 347 ARG B NH2   1 
ATOM   6014  N  N     . PRO F 3 52  ? -5.383  26.842 -45.352  1.00 48.32  ? 348 PRO B N     1 
ATOM   6015  C  CA    . PRO F 3 52  ? -5.767  28.240 -45.569  1.00 48.71  ? 348 PRO B CA    1 
ATOM   6016  C  C     . PRO F 3 52  ? -6.944  28.599 -44.658  1.00 48.93  ? 348 PRO B C     1 
ATOM   6017  O  O     . PRO F 3 52  ? -6.971  29.670 -44.053  1.00 48.99  ? 348 PRO B O     1 
ATOM   6018  C  CB    . PRO F 3 52  ? -6.149  28.267 -47.047  1.00 48.75  ? 348 PRO B CB    1 
ATOM   6019  C  CG    . PRO F 3 52  ? -5.279  27.192 -47.643  1.00 48.83  ? 348 PRO B CG    1 
ATOM   6020  C  CD    . PRO F 3 52  ? -5.388  26.089 -46.618  1.00 48.62  ? 348 PRO B CD    1 
ATOM   6021  N  N     . GLU F 3 53  ? -7.902  27.681 -44.557  1.00 49.37  ? 349 GLU B N     1 
ATOM   6022  C  CA    . GLU F 3 53  ? -9.096  27.869 -43.730  1.00 49.88  ? 349 GLU B CA    1 
ATOM   6023  C  C     . GLU F 3 53  ? -8.793  28.105 -42.250  1.00 49.66  ? 349 GLU B C     1 
ATOM   6024  O  O     . GLU F 3 53  ? -9.603  28.685 -41.526  1.00 49.35  ? 349 GLU B O     1 
ATOM   6025  C  CB    . GLU F 3 53  ? -10.023 26.660 -43.867  1.00 50.97  ? 349 GLU B CB    1 
ATOM   6026  C  CG    . GLU F 3 53  ? -10.405 26.345 -45.300  1.00 52.54  ? 349 GLU B CG    1 
ATOM   6027  C  CD    . GLU F 3 53  ? -11.293 25.121 -45.416  1.00 53.92  ? 349 GLU B CD    1 
ATOM   6028  O  OE1   . GLU F 3 53  ? -11.014 24.115 -44.723  1.00 54.49  ? 349 GLU B OE1   1 
ATOM   6029  O  OE2   . GLU F 3 53  ? -12.260 25.160 -46.210  1.00 55.02  ? 349 GLU B OE2   1 
ATOM   6030  N  N     . THR F 3 54  ? -7.631  27.654 -41.791  1.00 49.14  ? 350 THR B N     1 
ATOM   6031  C  CA    . THR F 3 54  ? -7.269  27.850 -40.393  1.00 48.56  ? 350 THR B CA    1 
ATOM   6032  C  C     . THR F 3 54  ? -6.584  29.203 -40.201  1.00 48.49  ? 350 THR B C     1 
ATOM   6033  O  O     . THR F 3 54  ? -7.010  30.018 -39.381  1.00 48.71  ? 350 THR B O     1 
ATOM   6034  C  CB    . THR F 3 54  ? -6.322  26.743 -39.898  1.00 48.10  ? 350 THR B CB    1 
ATOM   6035  O  OG1   . THR F 3 54  ? -6.951  25.470 -40.067  1.00 48.21  ? 350 THR B OG1   1 
ATOM   6036  C  CG2   . THR F 3 54  ? -5.992  26.942 -38.429  1.00 47.61  ? 350 THR B CG2   1 
ATOM   6037  N  N     . ALA F 3 55  ? -5.523  29.435 -40.968  1.00 47.94  ? 351 ALA B N     1 
ATOM   6038  C  CA    . ALA F 3 55  ? -4.767  30.678 -40.882  1.00 47.21  ? 351 ALA B CA    1 
ATOM   6039  C  C     . ALA F 3 55  ? -5.593  31.905 -41.288  1.00 46.82  ? 351 ALA B C     1 
ATOM   6040  O  O     . ALA F 3 55  ? -5.765  32.838 -40.506  1.00 46.19  ? 351 ALA B O     1 
ATOM   6041  C  CB    . ALA F 3 55  ? -3.520  30.574 -41.755  1.00 46.97  ? 351 ALA B CB    1 
ATOM   6042  N  N     . LEU F 3 56  ? -6.095  31.890 -42.518  1.00 46.63  ? 352 LEU B N     1 
ATOM   6043  C  CA    . LEU F 3 56  ? -6.884  32.992 -43.058  1.00 46.40  ? 352 LEU B CA    1 
ATOM   6044  C  C     . LEU F 3 56  ? -8.163  33.298 -42.289  1.00 46.09  ? 352 LEU B C     1 
ATOM   6045  O  O     . LEU F 3 56  ? -8.712  34.394 -42.405  1.00 45.94  ? 352 LEU B O     1 
ATOM   6046  C  CB    . LEU F 3 56  ? -7.219  32.721 -44.531  1.00 46.09  ? 352 LEU B CB    1 
ATOM   6047  C  CG    . LEU F 3 56  ? -6.155  33.095 -45.568  1.00 46.11  ? 352 LEU B CG    1 
ATOM   6048  C  CD1   . LEU F 3 56  ? -4.816  32.497 -45.196  1.00 46.26  ? 352 LEU B CD1   1 
ATOM   6049  C  CD2   . LEU F 3 56  ? -6.594  32.608 -46.938  1.00 46.18  ? 352 LEU B CD2   1 
ATOM   6050  N  N     . ALA F 3 57  ? -8.651  32.337 -41.515  1.00 45.80  ? 353 ALA B N     1 
ATOM   6051  C  CA    . ALA F 3 57  ? -9.868  32.565 -40.742  1.00 45.63  ? 353 ALA B CA    1 
ATOM   6052  C  C     . ALA F 3 57  ? -9.510  32.870 -39.290  1.00 45.14  ? 353 ALA B C     1 
ATOM   6053  O  O     . ALA F 3 57  ? -10.381 33.033 -38.441  1.00 44.34  ? 353 ALA B O     1 
ATOM   6054  C  CB    . ALA F 3 57  ? -10.780 31.344 -40.818  1.00 45.45  ? 353 ALA B CB    1 
ATOM   6055  N  N     . ASP F 3 58  ? -8.215  32.952 -39.013  1.00 45.02  ? 354 ASP B N     1 
ATOM   6056  C  CA    . ASP F 3 58  ? -7.756  33.227 -37.662  1.00 45.06  ? 354 ASP B CA    1 
ATOM   6057  C  C     . ASP F 3 58  ? -7.444  34.718 -37.515  1.00 45.01  ? 354 ASP B C     1 
ATOM   6058  O  O     . ASP F 3 58  ? -6.521  35.228 -38.148  1.00 45.37  ? 354 ASP B O     1 
ATOM   6059  C  CB    . ASP F 3 58  ? -6.514  32.379 -37.362  1.00 44.65  ? 354 ASP B CB    1 
ATOM   6060  C  CG    . ASP F 3 58  ? -6.142  32.377 -35.888  1.00 44.54  ? 354 ASP B CG    1 
ATOM   6061  O  OD1   . ASP F 3 58  ? -5.896  33.469 -35.335  1.00 44.10  ? 354 ASP B OD1   1 
ATOM   6062  O  OD2   . ASP F 3 58  ? -6.087  31.281 -35.286  1.00 44.09  ? 354 ASP B OD2   1 
ATOM   6063  N  N     . PRO F 3 59  ? -8.223  35.436 -36.682  1.00 44.98  ? 355 PRO B N     1 
ATOM   6064  C  CA    . PRO F 3 59  ? -8.038  36.876 -36.448  1.00 45.06  ? 355 PRO B CA    1 
ATOM   6065  C  C     . PRO F 3 59  ? -6.585  37.221 -36.127  1.00 45.17  ? 355 PRO B C     1 
ATOM   6066  O  O     . PRO F 3 59  ? -6.051  38.235 -36.585  1.00 45.59  ? 355 PRO B O     1 
ATOM   6067  C  CB    . PRO F 3 59  ? -8.960  37.150 -35.267  1.00 44.77  ? 355 PRO B CB    1 
ATOM   6068  C  CG    . PRO F 3 59  ? -10.065 36.172 -35.482  1.00 44.71  ? 355 PRO B CG    1 
ATOM   6069  C  CD    . PRO F 3 59  ? -9.317  34.915 -35.845  1.00 44.46  ? 355 PRO B CD    1 
ATOM   6070  N  N     . GLN F 3 60  ? -5.961  36.366 -35.326  1.00 44.71  ? 356 GLN B N     1 
ATOM   6071  C  CA    . GLN F 3 60  ? -4.575  36.543 -34.925  1.00 44.30  ? 356 GLN B CA    1 
ATOM   6072  C  C     . GLN F 3 60  ? -3.674  36.546 -36.168  1.00 43.74  ? 356 GLN B C     1 
ATOM   6073  O  O     . GLN F 3 60  ? -2.829  37.430 -36.347  1.00 43.09  ? 356 GLN B O     1 
ATOM   6074  C  CB    . GLN F 3 60  ? -4.146  35.382 -34.020  1.00 45.26  ? 356 GLN B CB    1 
ATOM   6075  C  CG    . GLN F 3 60  ? -5.195  34.882 -33.022  1.00 46.36  ? 356 GLN B CG    1 
ATOM   6076  C  CD    . GLN F 3 60  ? -5.106  35.568 -31.672  1.00 47.21  ? 356 GLN B CD    1 
ATOM   6077  O  OE1   . GLN F 3 60  ? -4.022  35.970 -31.239  1.00 47.38  ? 356 GLN B OE1   1 
ATOM   6078  N  NE2   . GLN F 3 60  ? -6.244  35.685 -30.986  1.00 47.04  ? 356 GLN B NE2   1 
ATOM   6079  N  N     . PHE F 3 61  ? -3.855  35.531 -37.010  1.00 42.65  ? 357 PHE B N     1 
ATOM   6080  C  CA    . PHE F 3 61  ? -3.063  35.373 -38.221  1.00 41.72  ? 357 PHE B CA    1 
ATOM   6081  C  C     . PHE F 3 61  ? -3.322  36.440 -39.276  1.00 40.78  ? 357 PHE B C     1 
ATOM   6082  O  O     . PHE F 3 61  ? -2.392  37.105 -39.730  1.00 40.77  ? 357 PHE B O     1 
ATOM   6083  C  CB    . PHE F 3 61  ? -3.313  34.004 -38.844  1.00 41.95  ? 357 PHE B CB    1 
ATOM   6084  C  CG    . PHE F 3 61  ? -2.287  33.619 -39.865  1.00 42.78  ? 357 PHE B CG    1 
ATOM   6085  C  CD1   . PHE F 3 61  ? -1.006  33.245 -39.468  1.00 42.48  ? 357 PHE B CD1   1 
ATOM   6086  C  CD2   . PHE F 3 61  ? -2.583  33.669 -41.222  1.00 42.58  ? 357 PHE B CD2   1 
ATOM   6087  C  CE1   . PHE F 3 61  ? -0.038  32.931 -40.406  1.00 42.92  ? 357 PHE B CE1   1 
ATOM   6088  C  CE2   . PHE F 3 61  ? -1.613  33.355 -42.171  1.00 43.28  ? 357 PHE B CE2   1 
ATOM   6089  C  CZ    . PHE F 3 61  ? -0.339  32.985 -41.760  1.00 42.79  ? 357 PHE B CZ    1 
ATOM   6090  N  N     . VAL F 3 62  ? -4.577  36.585 -39.692  1.00 39.37  ? 358 VAL B N     1 
ATOM   6091  C  CA    . VAL F 3 62  ? -4.903  37.587 -40.700  1.00 38.83  ? 358 VAL B CA    1 
ATOM   6092  C  C     . VAL F 3 62  ? -4.344  38.922 -40.238  1.00 38.40  ? 358 VAL B C     1 
ATOM   6093  O  O     . VAL F 3 62  ? -3.832  39.706 -41.038  1.00 39.14  ? 358 VAL B O     1 
ATOM   6094  C  CB    . VAL F 3 62  ? -6.429  37.708 -40.913  1.00 38.86  ? 358 VAL B CB    1 
ATOM   6095  C  CG1   . VAL F 3 62  ? -6.749  38.903 -41.807  1.00 38.44  ? 358 VAL B CG1   1 
ATOM   6096  C  CG2   . VAL F 3 62  ? -6.954  36.435 -41.550  1.00 38.12  ? 358 VAL B CG2   1 
ATOM   6097  N  N     . ALA F 3 63  ? -4.423  39.163 -38.933  1.00 37.42  ? 359 ALA B N     1 
ATOM   6098  C  CA    . ALA F 3 63  ? -3.913  40.397 -38.361  1.00 36.80  ? 359 ALA B CA    1 
ATOM   6099  C  C     . ALA F 3 63  ? -2.419  40.503 -38.641  1.00 36.25  ? 359 ALA B C     1 
ATOM   6100  O  O     . ALA F 3 63  ? -1.909  41.589 -38.927  1.00 35.91  ? 359 ALA B O     1 
ATOM   6101  C  CB    . ALA F 3 63  ? -4.166  40.424 -36.860  1.00 36.86  ? 359 ALA B CB    1 
ATOM   6102  N  N     . TRP F 3 64  ? -1.733  39.364 -38.570  1.00 35.10  ? 360 TRP B N     1 
ATOM   6103  C  CA    . TRP F 3 64  ? -0.293  39.297 -38.796  1.00 34.31  ? 360 TRP B CA    1 
ATOM   6104  C  C     . TRP F 3 64  ? 0.092   39.503 -40.273  1.00 33.82  ? 360 TRP B C     1 
ATOM   6105  O  O     . TRP F 3 64  ? 1.137   40.070 -40.583  1.00 33.33  ? 360 TRP B O     1 
ATOM   6106  C  CB    . TRP F 3 64  ? 0.228   37.947 -38.276  1.00 34.03  ? 360 TRP B CB    1 
ATOM   6107  C  CG    . TRP F 3 64  ? 1.629   37.656 -38.664  1.00 33.60  ? 360 TRP B CG    1 
ATOM   6108  C  CD1   . TRP F 3 64  ? 2.767   38.106 -38.057  1.00 34.01  ? 360 TRP B CD1   1 
ATOM   6109  C  CD2   . TRP F 3 64  ? 2.050   36.883 -39.790  1.00 33.86  ? 360 TRP B CD2   1 
ATOM   6110  N  NE1   . TRP F 3 64  ? 3.878   37.659 -38.742  1.00 32.76  ? 360 TRP B NE1   1 
ATOM   6111  C  CE2   . TRP F 3 64  ? 3.463   36.907 -39.811  1.00 33.38  ? 360 TRP B CE2   1 
ATOM   6112  C  CE3   . TRP F 3 64  ? 1.366   36.169 -40.789  1.00 33.52  ? 360 TRP B CE3   1 
ATOM   6113  C  CZ2   . TRP F 3 64  ? 4.203   36.251 -40.790  1.00 32.61  ? 360 TRP B CZ2   1 
ATOM   6114  C  CZ3   . TRP F 3 64  ? 2.106   35.515 -41.764  1.00 33.42  ? 360 TRP B CZ3   1 
ATOM   6115  C  CH2   . TRP F 3 64  ? 3.512   35.561 -41.756  1.00 33.68  ? 360 TRP B CH2   1 
ATOM   6116  N  N     . LEU F 3 65  ? -0.752  39.035 -41.181  1.00 35.03  ? 361 LEU B N     1 
ATOM   6117  C  CA    . LEU F 3 65  ? -0.507  39.201 -42.612  1.00 35.57  ? 361 LEU B CA    1 
ATOM   6118  C  C     . LEU F 3 65  ? -0.361  40.684 -42.941  1.00 36.29  ? 361 LEU B C     1 
ATOM   6119  O  O     . LEU F 3 65  ? 0.441   41.068 -43.793  1.00 35.32  ? 361 LEU B O     1 
ATOM   6120  C  CB    . LEU F 3 65  ? -1.668  38.621 -43.414  1.00 35.42  ? 361 LEU B CB    1 
ATOM   6121  C  CG    . LEU F 3 65  ? -1.786  37.096 -43.418  1.00 35.73  ? 361 LEU B CG    1 
ATOM   6122  C  CD1   . LEU F 3 65  ? -3.078  36.689 -44.071  1.00 35.69  ? 361 LEU B CD1   1 
ATOM   6123  C  CD2   . LEU F 3 65  ? -0.605  36.492 -44.153  1.00 35.62  ? 361 LEU B CD2   1 
ATOM   6124  N  N     . GLY F 3 66  ? -1.133  41.511 -42.239  1.00 37.58  ? 362 GLY B N     1 
ATOM   6125  C  CA    . GLY F 3 66  ? -1.105  42.951 -42.467  1.00 38.19  ? 362 GLY B CA    1 
ATOM   6126  C  C     . GLY F 3 66  ? -0.227  43.796 -41.554  1.00 39.00  ? 362 GLY B C     1 
ATOM   6127  O  O     . GLY F 3 66  ? -0.324  45.022 -41.587  1.00 39.06  ? 362 GLY B O     1 
ATOM   6128  N  N     . ASP F 3 67  ? 0.640   43.175 -40.754  1.00 39.31  ? 363 ASP B N     1 
ATOM   6129  C  CA    . ASP F 3 67  ? 1.501   43.944 -39.855  1.00 39.63  ? 363 ASP B CA    1 
ATOM   6130  C  C     . ASP F 3 67  ? 2.808   44.369 -40.528  1.00 39.63  ? 363 ASP B C     1 
ATOM   6131  O  O     . ASP F 3 67  ? 3.740   43.575 -40.656  1.00 39.92  ? 363 ASP B O     1 
ATOM   6132  C  CB    . ASP F 3 67  ? 1.825   43.129 -38.601  1.00 40.39  ? 363 ASP B CB    1 
ATOM   6133  C  CG    . ASP F 3 67  ? 2.163   44.005 -37.401  1.00 41.27  ? 363 ASP B CG    1 
ATOM   6134  O  OD1   . ASP F 3 67  ? 2.737   45.104 -37.598  1.00 41.40  ? 363 ASP B OD1   1 
ATOM   6135  O  OD2   . ASP F 3 67  ? 1.861   43.582 -36.255  1.00 42.01  ? 363 ASP B OD2   1 
ATOM   6136  N  N     . GLU F 3 68  ? 2.881   45.629 -40.937  1.00 39.45  ? 364 GLU B N     1 
ATOM   6137  C  CA    . GLU F 3 68  ? 4.069   46.151 -41.601  1.00 38.86  ? 364 GLU B CA    1 
ATOM   6138  C  C     . GLU F 3 68  ? 5.357   46.016 -40.805  1.00 37.75  ? 364 GLU B C     1 
ATOM   6139  O  O     . GLU F 3 68  ? 6.455   46.091 -41.376  1.00 36.93  ? 364 GLU B O     1 
ATOM   6140  C  CB    . GLU F 3 68  ? 3.867   47.619 -41.969  1.00 40.55  ? 364 GLU B CB    1 
ATOM   6141  C  CG    . GLU F 3 68  ? 2.869   47.833 -43.078  1.00 43.17  ? 364 GLU B CG    1 
ATOM   6142  C  CD    . GLU F 3 68  ? 2.617   49.296 -43.360  1.00 44.30  ? 364 GLU B CD    1 
ATOM   6143  O  OE1   . GLU F 3 68  ? 2.035   49.979 -42.488  1.00 44.98  ? 364 GLU B OE1   1 
ATOM   6144  O  OE2   . GLU F 3 68  ? 3.006   49.759 -44.455  1.00 45.39  ? 364 GLU B OE2   1 
ATOM   6145  N  N     . THR F 3 69  ? 5.239   45.829 -39.495  1.00 36.34  ? 365 THR B N     1 
ATOM   6146  C  CA    . THR F 3 69  ? 6.432   45.701 -38.667  1.00 35.15  ? 365 THR B CA    1 
ATOM   6147  C  C     . THR F 3 69  ? 6.994   44.291 -38.687  1.00 34.25  ? 365 THR B C     1 
ATOM   6148  O  O     . THR F 3 69  ? 8.165   44.092 -38.382  1.00 35.50  ? 365 THR B O     1 
ATOM   6149  C  CB    . THR F 3 69  ? 6.162   46.118 -37.217  1.00 34.37  ? 365 THR B CB    1 
ATOM   6150  O  OG1   . THR F 3 69  ? 5.131   45.295 -36.670  1.00 33.70  ? 365 THR B OG1   1 
ATOM   6151  C  CG2   . THR F 3 69  ? 5.742   47.580 -37.164  1.00 34.34  ? 365 THR B CG2   1 
ATOM   6152  N  N     . LYS F 3 70  ? 6.159   43.318 -39.037  1.00 33.90  ? 366 LYS B N     1 
ATOM   6153  C  CA    . LYS F 3 70  ? 6.594   41.918 -39.137  1.00 33.54  ? 366 LYS B CA    1 
ATOM   6154  C  C     . LYS F 3 70  ? 7.111   41.773 -40.564  1.00 32.79  ? 366 LYS B C     1 
ATOM   6155  O  O     . LYS F 3 70  ? 6.326   41.697 -41.504  1.00 33.06  ? 366 LYS B O     1 
ATOM   6156  C  CB    . LYS F 3 70  ? 5.423   40.948 -38.941  1.00 33.95  ? 366 LYS B CB    1 
ATOM   6157  C  CG    . LYS F 3 70  ? 4.578   41.179 -37.697  1.00 34.71  ? 366 LYS B CG    1 
ATOM   6158  C  CD    . LYS F 3 70  ? 5.419   41.294 -36.444  1.00 35.02  ? 366 LYS B CD    1 
ATOM   6159  C  CE    . LYS F 3 70  ? 4.549   41.529 -35.223  1.00 35.81  ? 366 LYS B CE    1 
ATOM   6160  N  NZ    . LYS F 3 70  ? 5.346   41.926 -34.033  1.00 33.84  ? 366 LYS B NZ    1 
ATOM   6161  N  N     . LYS F 3 71  ? 8.428   41.762 -40.725  1.00 32.23  ? 367 LYS B N     1 
ATOM   6162  C  CA    . LYS F 3 71  ? 9.039   41.656 -42.051  1.00 31.58  ? 367 LYS B CA    1 
ATOM   6163  C  C     . LYS F 3 71  ? 8.994   40.243 -42.621  1.00 32.12  ? 367 LYS B C     1 
ATOM   6164  O  O     . LYS F 3 71  ? 9.395   39.283 -41.957  1.00 31.99  ? 367 LYS B O     1 
ATOM   6165  C  CB    . LYS F 3 71  ? 10.484  42.120 -41.988  1.00 31.09  ? 367 LYS B CB    1 
ATOM   6166  C  CG    . LYS F 3 71  ? 10.664  43.497 -41.384  1.00 29.99  ? 367 LYS B CG    1 
ATOM   6167  C  CD    . LYS F 3 71  ? 9.757   44.518 -42.066  1.00 30.17  ? 367 LYS B CD    1 
ATOM   6168  C  CE    . LYS F 3 71  ? 9.925   45.885 -41.433  1.00 30.13  ? 367 LYS B CE    1 
ATOM   6169  N  NZ    . LYS F 3 71  ? 8.940   46.865 -41.956  1.00 29.06  ? 367 LYS B NZ    1 
ATOM   6170  N  N     . LYS F 3 72  ? 8.517   40.120 -43.855  1.00 31.83  ? 368 LYS B N     1 
ATOM   6171  C  CA    . LYS F 3 72  ? 8.428   38.817 -44.490  1.00 32.14  ? 368 LYS B CA    1 
ATOM   6172  C  C     . LYS F 3 72  ? 9.370   38.685 -45.674  1.00 32.46  ? 368 LYS B C     1 
ATOM   6173  O  O     . LYS F 3 72  ? 9.793   39.671 -46.268  1.00 32.78  ? 368 LYS B O     1 
ATOM   6174  C  CB    . LYS F 3 72  ? 7.001   38.536 -44.968  1.00 32.28  ? 368 LYS B CB    1 
ATOM   6175  C  CG    . LYS F 3 72  ? 5.962   38.427 -43.862  1.00 32.97  ? 368 LYS B CG    1 
ATOM   6176  C  CD    . LYS F 3 72  ? 5.265   39.748 -43.578  1.00 34.07  ? 368 LYS B CD    1 
ATOM   6177  C  CE    . LYS F 3 72  ? 4.140   39.519 -42.572  1.00 34.54  ? 368 LYS B CE    1 
ATOM   6178  N  NZ    . LYS F 3 72  ? 3.424   40.749 -42.184  1.00 35.10  ? 368 LYS B NZ    1 
ATOM   6179  N  N     . SER F 3 73  ? 9.696   37.441 -45.997  1.00 32.63  ? 369 SER B N     1 
ATOM   6180  C  CA    . SER F 3 73  ? 10.547  37.111 -47.128  1.00 32.01  ? 369 SER B CA    1 
ATOM   6181  C  C     . SER F 3 73  ? 9.661   36.205 -47.964  1.00 31.15  ? 369 SER B C     1 
ATOM   6182  O  O     . SER F 3 73  ? 9.039   35.291 -47.427  1.00 31.81  ? 369 SER B O     1 
ATOM   6183  C  CB    . SER F 3 73  ? 11.785  36.356 -46.654  1.00 32.39  ? 369 SER B CB    1 
ATOM   6184  O  OG    . SER F 3 73  ? 12.523  37.152 -45.740  1.00 33.70  ? 369 SER B OG    1 
ATOM   6185  N  N     . MET F 3 74  ? 9.572   36.465 -49.263  1.00 30.39  ? 370 MET B N     1 
ATOM   6186  C  CA    . MET F 3 74  ? 8.729   35.640 -50.126  1.00 29.65  ? 370 MET B CA    1 
ATOM   6187  C  C     . MET F 3 74  ? 9.286   35.525 -51.540  1.00 28.98  ? 370 MET B C     1 
ATOM   6188  O  O     . MET F 3 74  ? 10.301  36.133 -51.886  1.00 28.89  ? 370 MET B O     1 
ATOM   6189  C  CB    . MET F 3 74  ? 7.310   36.234 -50.230  1.00 30.75  ? 370 MET B CB    1 
ATOM   6190  C  CG    . MET F 3 74  ? 6.523   36.374 -48.928  1.00 30.64  ? 370 MET B CG    1 
ATOM   6191  S  SD    . MET F 3 74  ? 4.815   37.022 -49.225  1.00 31.90  ? 370 MET B SD    1 
ATOM   6192  C  CE    . MET F 3 74  ? 3.920   35.511 -49.265  1.00 29.51  ? 370 MET B CE    1 
ATOM   6193  N  N     . PHE F 3 75  ? 8.593   34.731 -52.345  1.00 28.72  ? 371 PHE B N     1 
ATOM   6194  C  CA    . PHE F 3 75  ? 8.915   34.528 -53.748  1.00 28.67  ? 371 PHE B CA    1 
ATOM   6195  C  C     . PHE F 3 75  ? 7.609   34.893 -54.431  1.00 29.31  ? 371 PHE B C     1 
ATOM   6196  O  O     . PHE F 3 75  ? 6.578   34.285 -54.150  1.00 29.70  ? 371 PHE B O     1 
ATOM   6197  C  CB    . PHE F 3 75  ? 9.257   33.056 -54.035  1.00 28.21  ? 371 PHE B CB    1 
ATOM   6198  C  CG    . PHE F 3 75  ? 9.765   32.821 -55.425  1.00 25.67  ? 371 PHE B CG    1 
ATOM   6199  C  CD1   . PHE F 3 75  ? 11.090  33.087 -55.747  1.00 24.39  ? 371 PHE B CD1   1 
ATOM   6200  C  CD2   . PHE F 3 75  ? 8.908   32.393 -56.427  1.00 24.85  ? 371 PHE B CD2   1 
ATOM   6201  C  CE1   . PHE F 3 75  ? 11.547  32.932 -57.042  1.00 23.29  ? 371 PHE B CE1   1 
ATOM   6202  C  CE2   . PHE F 3 75  ? 9.360   32.239 -57.733  1.00 23.82  ? 371 PHE B CE2   1 
ATOM   6203  C  CZ    . PHE F 3 75  ? 10.681  32.510 -58.037  1.00 23.56  ? 371 PHE B CZ    1 
ATOM   6204  N  N     . ASP F 3 76  ? 7.651   35.886 -55.321  1.00 30.18  ? 372 ASP B N     1 
ATOM   6205  C  CA    . ASP F 3 76  ? 6.459   36.367 -56.019  1.00 29.31  ? 372 ASP B CA    1 
ATOM   6206  C  C     . ASP F 3 76  ? 5.407   36.782 -54.989  1.00 28.72  ? 372 ASP B C     1 
ATOM   6207  O  O     . ASP F 3 76  ? 4.331   36.180 -54.878  1.00 27.92  ? 372 ASP B O     1 
ATOM   6208  C  CB    . ASP F 3 76  ? 5.882   35.305 -56.957  1.00 30.06  ? 372 ASP B CB    1 
ATOM   6209  C  CG    . ASP F 3 76  ? 4.779   35.865 -57.856  1.00 31.30  ? 372 ASP B CG    1 
ATOM   6210  O  OD1   . ASP F 3 76  ? 4.670   37.105 -57.947  1.00 32.09  ? 372 ASP B OD1   1 
ATOM   6211  O  OD2   . ASP F 3 76  ? 4.030   35.081 -58.486  1.00 32.35  ? 372 ASP B OD2   1 
ATOM   6212  N  N     . SER F 3 77  ? 5.736   37.820 -54.235  1.00 28.26  ? 373 SER B N     1 
ATOM   6213  C  CA    . SER F 3 77  ? 4.846   38.327 -53.202  1.00 28.71  ? 373 SER B CA    1 
ATOM   6214  C  C     . SER F 3 77  ? 3.596   38.937 -53.827  1.00 28.63  ? 373 SER B C     1 
ATOM   6215  O  O     . SER F 3 77  ? 2.547   39.008 -53.187  1.00 28.96  ? 373 SER B O     1 
ATOM   6216  C  CB    . SER F 3 77  ? 5.574   39.376 -52.358  1.00 27.73  ? 373 SER B CB    1 
ATOM   6217  O  OG    . SER F 3 77  ? 5.900   40.499 -53.150  1.00 26.34  ? 373 SER B OG    1 
ATOM   6218  N  N     . LYS F 3 78  ? 3.707   39.364 -55.085  1.00 29.99  ? 374 LYS B N     1 
ATOM   6219  C  CA    . LYS F 3 78  ? 2.579   39.976 -55.770  1.00 29.56  ? 374 LYS B CA    1 
ATOM   6220  C  C     . LYS F 3 78  ? 1.480   38.926 -55.906  1.00 30.60  ? 374 LYS B C     1 
ATOM   6221  O  O     . LYS F 3 78  ? 0.303   39.238 -55.739  1.00 29.77  ? 374 LYS B O     1 
ATOM   6222  C  CB    . LYS F 3 78  ? 3.015   40.538 -57.143  1.00 29.83  ? 374 LYS B CB    1 
ATOM   6223  C  CG    . LYS F 3 78  ? 1.932   41.370 -57.871  1.00 28.72  ? 374 LYS B CG    1 
ATOM   6224  C  CD    . LYS F 3 78  ? 2.510   42.386 -58.857  1.00 27.67  ? 374 LYS B CD    1 
ATOM   6225  C  CE    . LYS F 3 78  ? 3.336   41.753 -59.985  1.00 26.81  ? 374 LYS B CE    1 
ATOM   6226  N  NZ    . LYS F 3 78  ? 2.600   40.699 -60.750  1.00 27.92  ? 374 LYS B NZ    1 
ATOM   6227  N  N     . ARG F 3 79  ? 1.856   37.673 -56.169  1.00 30.52  ? 375 ARG B N     1 
ATOM   6228  C  CA    . ARG F 3 79  ? 0.846   36.612 -56.283  1.00 31.61  ? 375 ARG B CA    1 
ATOM   6229  C  C     . ARG F 3 79  ? 0.121   36.475 -54.942  1.00 32.02  ? 375 ARG B C     1 
ATOM   6230  O  O     . ARG F 3 79  ? -1.099  36.344 -54.895  1.00 32.05  ? 375 ARG B O     1 
ATOM   6231  C  CB    . ARG F 3 79  ? 1.494   35.262 -56.664  1.00 32.14  ? 375 ARG B CB    1 
ATOM   6232  C  CG    . ARG F 3 79  ? 0.534   34.059 -56.662  1.00 32.30  ? 375 ARG B CG    1 
ATOM   6233  C  CD    . ARG F 3 79  ? 1.201   32.780 -57.188  1.00 31.03  ? 375 ARG B CD    1 
ATOM   6234  N  NE    . ARG F 3 79  ? 1.399   32.803 -58.637  1.00 30.15  ? 375 ARG B NE    1 
ATOM   6235  C  CZ    . ARG F 3 79  ? 0.570   32.248 -59.513  1.00 29.50  ? 375 ARG B CZ    1 
ATOM   6236  N  NH1   . ARG F 3 79  ? -0.516  31.617 -59.089  1.00 30.28  ? 375 ARG B NH1   1 
ATOM   6237  N  NH2   . ARG F 3 79  ? 0.814   32.336 -60.811  1.00 29.45  ? 375 ARG B NH2   1 
ATOM   6238  N  N     . ALA F 3 80  ? 0.883   36.514 -53.853  1.00 32.57  ? 376 ALA B N     1 
ATOM   6239  C  CA    . ALA F 3 80  ? 0.318   36.393 -52.508  1.00 32.92  ? 376 ALA B CA    1 
ATOM   6240  C  C     . ALA F 3 80  ? -0.528  37.615 -52.144  1.00 32.96  ? 376 ALA B C     1 
ATOM   6241  O  O     . ALA F 3 80  ? -1.612  37.479 -51.588  1.00 33.78  ? 376 ALA B O     1 
ATOM   6242  C  CB    . ALA F 3 80  ? 1.446   36.207 -51.473  1.00 31.95  ? 376 ALA B CB    1 
ATOM   6243  N  N     . ALA F 3 81  ? -0.017  38.803 -52.443  1.00 32.66  ? 377 ALA B N     1 
ATOM   6244  C  CA    . ALA F 3 81  ? -0.737  40.043 -52.145  1.00 32.81  ? 377 ALA B CA    1 
ATOM   6245  C  C     . ALA F 3 81  ? -2.066  40.129 -52.886  1.00 32.44  ? 377 ALA B C     1 
ATOM   6246  O  O     . ALA F 3 81  ? -3.105  40.440 -52.286  1.00 32.42  ? 377 ALA B O     1 
ATOM   6247  C  CB    . ALA F 3 81  ? 0.124   41.244 -52.497  1.00 31.93  ? 377 ALA B CB    1 
ATOM   6248  N  N     . VAL F 3 82  ? -2.039  39.853 -54.188  1.00 32.60  ? 378 VAL B N     1 
ATOM   6249  C  CA    . VAL F 3 82  ? -3.259  39.908 -54.986  1.00 32.76  ? 378 VAL B CA    1 
ATOM   6250  C  C     . VAL F 3 82  ? -4.230  38.813 -54.569  1.00 32.21  ? 378 VAL B C     1 
ATOM   6251  O  O     . VAL F 3 82  ? -5.409  39.083 -54.339  1.00 31.71  ? 378 VAL B O     1 
ATOM   6252  C  CB    . VAL F 3 82  ? -2.945  39.801 -56.500  1.00 33.10  ? 378 VAL B CB    1 
ATOM   6253  C  CG1   . VAL F 3 82  ? -4.228  39.773 -57.310  1.00 32.87  ? 378 VAL B CG1   1 
ATOM   6254  C  CG2   . VAL F 3 82  ? -2.099  40.995 -56.931  1.00 33.34  ? 378 VAL B CG2   1 
ATOM   6255  N  N     . ALA F 3 83  ? -3.733  37.583 -54.435  1.00 32.18  ? 379 ALA B N     1 
ATOM   6256  C  CA    . ALA F 3 83  ? -4.586  36.465 -54.041  1.00 31.60  ? 379 ALA B CA    1 
ATOM   6257  C  C     . ALA F 3 83  ? -5.309  36.786 -52.739  1.00 31.88  ? 379 ALA B C     1 
ATOM   6258  O  O     . ALA F 3 83  ? -6.498  36.499 -52.589  1.00 31.17  ? 379 ALA B O     1 
ATOM   6259  C  CB    . ALA F 3 83  ? -3.753  35.193 -53.877  1.00 31.23  ? 379 ALA B CB    1 
ATOM   6260  N  N     . LEU F 3 84  ? -4.585  37.382 -51.795  1.00 33.17  ? 380 LEU B N     1 
ATOM   6261  C  CA    . LEU F 3 84  ? -5.175  37.736 -50.510  1.00 34.50  ? 380 LEU B CA    1 
ATOM   6262  C  C     . LEU F 3 84  ? -6.110  38.938 -50.638  1.00 35.48  ? 380 LEU B C     1 
ATOM   6263  O  O     . LEU F 3 84  ? -7.087  39.049 -49.894  1.00 37.15  ? 380 LEU B O     1 
ATOM   6264  C  CB    . LEU F 3 84  ? -4.081  38.023 -49.485  1.00 34.18  ? 380 LEU B CB    1 
ATOM   6265  C  CG    . LEU F 3 84  ? -3.309  36.774 -49.039  1.00 34.76  ? 380 LEU B CG    1 
ATOM   6266  C  CD1   . LEU F 3 84  ? -2.102  37.184 -48.189  1.00 34.88  ? 380 LEU B CD1   1 
ATOM   6267  C  CD2   . LEU F 3 84  ? -4.240  35.857 -48.260  1.00 33.04  ? 380 LEU B CD2   1 
ATOM   6268  N  N     . LYS F 3 85  ? -5.822  39.837 -51.574  1.00 36.55  ? 381 LYS B N     1 
ATOM   6269  C  CA    . LYS F 3 85  ? -6.696  40.991 -51.757  1.00 37.72  ? 381 LYS B CA    1 
ATOM   6270  C  C     . LYS F 3 85  ? -8.059  40.522 -52.245  1.00 38.02  ? 381 LYS B C     1 
ATOM   6271  O  O     . LYS F 3 85  ? -9.058  41.218 -52.082  1.00 38.60  ? 381 LYS B O     1 
ATOM   6272  C  CB    . LYS F 3 85  ? -6.085  41.995 -52.734  1.00 37.52  ? 381 LYS B CB    1 
ATOM   6273  C  CG    . LYS F 3 85  ? -5.093  42.934 -52.059  1.00 38.20  ? 381 LYS B CG    1 
ATOM   6274  C  CD    . LYS F 3 85  ? -4.369  43.822 -53.047  1.00 38.40  ? 381 LYS B CD    1 
ATOM   6275  C  CE    . LYS F 3 85  ? -3.507  44.846 -52.315  1.00 38.92  ? 381 LYS B CE    1 
ATOM   6276  N  NZ    . LYS F 3 85  ? -2.590  45.564 -53.243  1.00 38.95  ? 381 LYS B NZ    1 
ATOM   6277  N  N     . TRP F 3 86  ? -8.100  39.335 -52.840  1.00 38.60  ? 382 TRP B N     1 
ATOM   6278  C  CA    . TRP F 3 86  ? -9.363  38.776 -53.312  1.00 39.32  ? 382 TRP B CA    1 
ATOM   6279  C  C     . TRP F 3 86  ? -10.063 38.042 -52.174  1.00 40.07  ? 382 TRP B C     1 
ATOM   6280  O  O     . TRP F 3 86  ? -11.245 37.727 -52.267  1.00 41.04  ? 382 TRP B O     1 
ATOM   6281  C  CB    . TRP F 3 86  ? -9.141  37.804 -54.475  1.00 38.67  ? 382 TRP B CB    1 
ATOM   6282  C  CG    . TRP F 3 86  ? -8.802  38.468 -55.775  1.00 38.21  ? 382 TRP B CG    1 
ATOM   6283  C  CD1   . TRP F 3 86  ? -7.558  38.713 -56.272  1.00 37.95  ? 382 TRP B CD1   1 
ATOM   6284  C  CD2   . TRP F 3 86  ? -9.727  38.967 -56.747  1.00 38.10  ? 382 TRP B CD2   1 
ATOM   6285  N  NE1   . TRP F 3 86  ? -7.646  39.331 -57.492  1.00 37.68  ? 382 TRP B NE1   1 
ATOM   6286  C  CE2   . TRP F 3 86  ? -8.965  39.500 -57.810  1.00 37.60  ? 382 TRP B CE2   1 
ATOM   6287  C  CE3   . TRP F 3 86  ? -11.125 39.017 -56.821  1.00 37.18  ? 382 TRP B CE3   1 
ATOM   6288  C  CZ2   . TRP F 3 86  ? -9.554  40.078 -58.941  1.00 37.76  ? 382 TRP B CZ2   1 
ATOM   6289  C  CZ3   . TRP F 3 86  ? -11.712 39.590 -57.942  1.00 37.22  ? 382 TRP B CZ3   1 
ATOM   6290  C  CH2   . TRP F 3 86  ? -10.923 40.114 -58.991  1.00 37.16  ? 382 TRP B CH2   1 
ATOM   6291  N  N     . LYS F 3 87  ? -9.320  37.765 -51.106  1.00 40.50  ? 383 LYS B N     1 
ATOM   6292  C  CA    . LYS F 3 87  ? -9.854  37.073 -49.939  1.00 40.49  ? 383 LYS B CA    1 
ATOM   6293  C  C     . LYS F 3 87  ? -10.322 38.124 -48.939  1.00 40.59  ? 383 LYS B C     1 
ATOM   6294  O  O     . LYS F 3 87  ? -10.910 37.797 -47.904  1.00 40.73  ? 383 LYS B O     1 
ATOM   6295  C  CB    . LYS F 3 87  ? -8.759  36.230 -49.272  1.00 40.05  ? 383 LYS B CB    1 
ATOM   6296  C  CG    . LYS F 3 87  ? -8.170  35.120 -50.114  1.00 39.64  ? 383 LYS B CG    1 
ATOM   6297  C  CD    . LYS F 3 87  ? -9.147  33.974 -50.299  1.00 39.63  ? 383 LYS B CD    1 
ATOM   6298  C  CE    . LYS F 3 87  ? -8.493  32.805 -51.020  1.00 39.20  ? 383 LYS B CE    1 
ATOM   6299  N  NZ    . LYS F 3 87  ? -9.443  31.682 -51.261  1.00 39.21  ? 383 LYS B NZ    1 
ATOM   6300  N  N     . GLY F 3 88  ? -10.035 39.385 -49.252  1.00 40.20  ? 384 GLY B N     1 
ATOM   6301  C  CA    . GLY F 3 88  ? -10.387 40.482 -48.371  1.00 39.03  ? 384 GLY B CA    1 
ATOM   6302  C  C     . GLY F 3 88  ? -9.338  40.655 -47.289  1.00 38.35  ? 384 GLY B C     1 
ATOM   6303  O  O     . GLY F 3 88  ? -9.625  41.170 -46.215  1.00 38.41  ? 384 GLY B O     1 
ATOM   6304  N  N     . ILE F 3 89  ? -8.108  40.233 -47.578  1.00 38.03  ? 385 ILE B N     1 
ATOM   6305  C  CA    . ILE F 3 89  ? -7.008  40.320 -46.621  1.00 36.79  ? 385 ILE B CA    1 
ATOM   6306  C  C     . ILE F 3 89  ? -5.854  41.130 -47.208  1.00 36.78  ? 385 ILE B C     1 
ATOM   6307  O  O     . ILE F 3 89  ? -5.498  40.954 -48.372  1.00 36.23  ? 385 ILE B O     1 
ATOM   6308  C  CB    . ILE F 3 89  ? -6.498  38.901 -46.262  1.00 36.32  ? 385 ILE B CB    1 
ATOM   6309  C  CG1   . ILE F 3 89  ? -7.616  38.119 -45.572  1.00 35.84  ? 385 ILE B CG1   1 
ATOM   6310  C  CG2   . ILE F 3 89  ? -5.223  38.994 -45.416  1.00 35.39  ? 385 ILE B CG2   1 
ATOM   6311  C  CD1   . ILE F 3 89  ? -7.440  36.618 -45.604  1.00 34.92  ? 385 ILE B CD1   1 
ATOM   6312  N  N     . GLU F 3 90  ? -5.264  42.000 -46.395  1.00 36.99  ? 386 GLU B N     1 
ATOM   6313  C  CA    . GLU F 3 90  ? -4.160  42.846 -46.848  1.00 38.05  ? 386 GLU B CA    1 
ATOM   6314  C  C     . GLU F 3 90  ? -2.789  42.360 -46.383  1.00 37.80  ? 386 GLU B C     1 
ATOM   6315  O  O     . GLU F 3 90  ? -2.585  42.058 -45.205  1.00 37.48  ? 386 GLU B O     1 
ATOM   6316  C  CB    . GLU F 3 90  ? -4.364  44.283 -46.374  1.00 38.75  ? 386 GLU B CB    1 
ATOM   6317  C  CG    . GLU F 3 90  ? -3.565  45.288 -47.170  1.00 40.87  ? 386 GLU B CG    1 
ATOM   6318  C  CD    . GLU F 3 90  ? -3.722  46.707 -46.660  1.00 41.81  ? 386 GLU B CD    1 
ATOM   6319  O  OE1   . GLU F 3 90  ? -3.026  47.075 -45.685  1.00 42.64  ? 386 GLU B OE1   1 
ATOM   6320  O  OE2   . GLU F 3 90  ? -4.548  47.453 -47.233  1.00 42.97  ? 386 GLU B OE2   1 
ATOM   6321  N  N     . LEU F 3 91  ? -1.848  42.307 -47.320  1.00 37.41  ? 387 LEU B N     1 
ATOM   6322  C  CA    . LEU F 3 91  ? -0.494  41.847 -47.034  1.00 37.02  ? 387 LEU B CA    1 
ATOM   6323  C  C     . LEU F 3 91  ? 0.480   43.022 -47.011  1.00 36.79  ? 387 LEU B C     1 
ATOM   6324  O  O     . LEU F 3 91  ? 0.542   43.797 -47.961  1.00 38.11  ? 387 LEU B O     1 
ATOM   6325  C  CB    . LEU F 3 91  ? -0.068  40.837 -48.102  1.00 36.73  ? 387 LEU B CB    1 
ATOM   6326  C  CG    . LEU F 3 91  ? 1.273   40.124 -47.945  1.00 35.90  ? 387 LEU B CG    1 
ATOM   6327  C  CD1   . LEU F 3 91  ? 1.273   39.329 -46.663  1.00 35.44  ? 387 LEU B CD1   1 
ATOM   6328  C  CD2   . LEU F 3 91  ? 1.510   39.214 -49.150  1.00 35.95  ? 387 LEU B CD2   1 
ATOM   6329  N  N     . CYS F 3 92  ? 1.235   43.150 -45.926  1.00 35.89  ? 388 CYS B N     1 
ATOM   6330  C  CA    . CYS F 3 92  ? 2.200   44.232 -45.789  1.00 35.51  ? 388 CYS B CA    1 
ATOM   6331  C  C     . CYS F 3 92  ? 3.518   43.749 -45.162  1.00 34.00  ? 388 CYS B C     1 
ATOM   6332  O  O     . CYS F 3 92  ? 3.609   42.632 -44.665  1.00 32.64  ? 388 CYS B O     1 
ATOM   6333  C  CB    . CYS F 3 92  ? 1.610   45.341 -44.910  1.00 36.70  ? 388 CYS B CB    1 
ATOM   6334  S  SG    . CYS F 3 92  ? -0.082  45.889 -45.343  1.00 39.39  ? 388 CYS B SG    1 
ATOM   6335  N  N     . GLY F 3 93  ? 4.536   44.601 -45.202  1.00 33.01  ? 389 GLY B N     1 
ATOM   6336  C  CA    . GLY F 3 93  ? 5.807   44.264 -44.589  1.00 32.82  ? 389 GLY B CA    1 
ATOM   6337  C  C     . GLY F 3 93  ? 6.745   43.322 -45.320  1.00 32.39  ? 389 GLY B C     1 
ATOM   6338  O  O     . GLY F 3 93  ? 7.711   42.832 -44.725  1.00 32.98  ? 389 GLY B O     1 
ATOM   6339  N  N     . VAL F 3 94  ? 6.468   43.045 -46.589  1.00 31.48  ? 390 VAL B N     1 
ATOM   6340  C  CA    . VAL F 3 94  ? 7.345   42.180 -47.362  1.00 31.06  ? 390 VAL B CA    1 
ATOM   6341  C  C     . VAL F 3 94  ? 8.632   42.978 -47.554  1.00 30.32  ? 390 VAL B C     1 
ATOM   6342  O  O     . VAL F 3 94  ? 8.617   44.059 -48.143  1.00 29.74  ? 390 VAL B O     1 
ATOM   6343  C  CB    . VAL F 3 94  ? 6.712   41.826 -48.733  1.00 31.31  ? 390 VAL B CB    1 
ATOM   6344  C  CG1   . VAL F 3 94  ? 7.592   40.850 -49.484  1.00 31.07  ? 390 VAL B CG1   1 
ATOM   6345  C  CG2   . VAL F 3 94  ? 5.332   41.221 -48.519  1.00 31.08  ? 390 VAL B CG2   1 
ATOM   6346  N  N     . SER F 3 95  ? 9.741   42.456 -47.037  1.00 29.37  ? 391 SER B N     1 
ATOM   6347  C  CA    . SER F 3 95  ? 11.030  43.141 -47.140  1.00 29.66  ? 391 SER B CA    1 
ATOM   6348  C  C     . SER F 3 95  ? 12.026  42.485 -48.098  1.00 29.35  ? 391 SER B C     1 
ATOM   6349  O  O     . SER F 3 95  ? 13.158  42.955 -48.249  1.00 27.80  ? 391 SER B O     1 
ATOM   6350  C  CB    . SER F 3 95  ? 11.671  43.244 -45.759  1.00 29.49  ? 391 SER B CB    1 
ATOM   6351  O  OG    . SER F 3 95  ? 11.999  41.955 -45.257  1.00 30.43  ? 391 SER B OG    1 
ATOM   6352  N  N     . PHE F 3 96  ? 11.607  41.398 -48.738  1.00 29.71  ? 392 PHE B N     1 
ATOM   6353  C  CA    . PHE F 3 96  ? 12.472  40.679 -49.677  1.00 30.95  ? 392 PHE B CA    1 
ATOM   6354  C  C     . PHE F 3 96  ? 11.619  39.742 -50.531  1.00 31.44  ? 392 PHE B C     1 
ATOM   6355  O  O     . PHE F 3 96  ? 10.864  38.933 -49.997  1.00 32.59  ? 392 PHE B O     1 
ATOM   6356  C  CB    . PHE F 3 96  ? 13.526  39.849 -48.913  1.00 29.77  ? 392 PHE B CB    1 
ATOM   6357  C  CG    . PHE F 3 96  ? 14.585  39.234 -49.802  1.00 29.25  ? 392 PHE B CG    1 
ATOM   6358  C  CD1   . PHE F 3 96  ? 15.654  39.997 -50.269  1.00 29.70  ? 392 PHE B CD1   1 
ATOM   6359  C  CD2   . PHE F 3 96  ? 14.508  37.890 -50.182  1.00 29.63  ? 392 PHE B CD2   1 
ATOM   6360  C  CE1   . PHE F 3 96  ? 16.633  39.439 -51.099  1.00 28.93  ? 392 PHE B CE1   1 
ATOM   6361  C  CE2   . PHE F 3 96  ? 15.485  37.318 -51.017  1.00 29.19  ? 392 PHE B CE2   1 
ATOM   6362  C  CZ    . PHE F 3 96  ? 16.542  38.089 -51.471  1.00 28.55  ? 392 PHE B CZ    1 
ATOM   6363  N  N     . ASP F 3 97  ? 11.734  39.864 -51.850  1.00 32.19  ? 393 ASP B N     1 
ATOM   6364  C  CA    . ASP F 3 97  ? 10.987  39.011 -52.773  1.00 31.91  ? 393 ASP B CA    1 
ATOM   6365  C  C     . ASP F 3 97  ? 12.032  38.305 -53.628  1.00 31.88  ? 393 ASP B C     1 
ATOM   6366  O  O     . ASP F 3 97  ? 12.600  38.912 -54.527  1.00 31.23  ? 393 ASP B O     1 
ATOM   6367  C  CB    . ASP F 3 97  ? 10.075  39.845 -53.681  1.00 32.00  ? 393 ASP B CB    1 
ATOM   6368  C  CG    . ASP F 3 97  ? 9.072   38.987 -54.449  1.00 32.38  ? 393 ASP B CG    1 
ATOM   6369  O  OD1   . ASP F 3 97  ? 9.484   37.997 -55.093  1.00 32.36  ? 393 ASP B OD1   1 
ATOM   6370  O  OD2   . ASP F 3 97  ? 7.861   39.294 -54.405  1.00 32.06  ? 393 ASP B OD2   1 
ATOM   6371  N  N     . LEU F 3 98  ? 12.282  37.026 -53.332  1.00 31.48  ? 394 LEU B N     1 
ATOM   6372  C  CA    . LEU F 3 98  ? 13.268  36.222 -54.058  1.00 29.90  ? 394 LEU B CA    1 
ATOM   6373  C  C     . LEU F 3 98  ? 13.120  36.301 -55.575  1.00 29.06  ? 394 LEU B C     1 
ATOM   6374  O  O     . LEU F 3 98  ? 14.118  36.450 -56.288  1.00 28.47  ? 394 LEU B O     1 
ATOM   6375  C  CB    . LEU F 3 98  ? 13.183  34.754 -53.617  1.00 29.00  ? 394 LEU B CB    1 
ATOM   6376  C  CG    . LEU F 3 98  ? 14.420  33.900 -53.936  1.00 28.71  ? 394 LEU B CG    1 
ATOM   6377  C  CD1   . LEU F 3 98  ? 15.612  34.439 -53.184  1.00 27.64  ? 394 LEU B CD1   1 
ATOM   6378  C  CD2   . LEU F 3 98  ? 14.172  32.456 -53.552  1.00 26.67  ? 394 LEU B CD2   1 
ATOM   6379  N  N     . LEU F 3 99  ? 11.888  36.191 -56.066  1.00 28.73  ? 395 LEU B N     1 
ATOM   6380  C  CA    . LEU F 3 99  ? 11.634  36.267 -57.503  1.00 28.62  ? 395 LEU B CA    1 
ATOM   6381  C  C     . LEU F 3 99  ? 12.183  37.547 -58.099  1.00 28.54  ? 395 LEU B C     1 
ATOM   6382  O  O     . LEU F 3 99  ? 12.582  37.562 -59.262  1.00 28.91  ? 395 LEU B O     1 
ATOM   6383  C  CB    . LEU F 3 99  ? 10.140  36.182 -57.816  1.00 28.88  ? 395 LEU B CB    1 
ATOM   6384  C  CG    . LEU F 3 99  ? 9.715   36.608 -59.233  1.00 28.09  ? 395 LEU B CG    1 
ATOM   6385  C  CD1   . LEU F 3 99  ? 10.497  35.841 -60.292  1.00 27.90  ? 395 LEU B CD1   1 
ATOM   6386  C  CD2   . LEU F 3 99  ? 8.225   36.366 -59.398  1.00 29.19  ? 395 LEU B CD2   1 
ATOM   6387  N  N     . LEU F 3 100 ? 12.217  38.621 -57.312  1.00 28.42  ? 396 LEU B N     1 
ATOM   6388  C  CA    . LEU F 3 100 ? 12.738  39.882 -57.825  1.00 28.04  ? 396 LEU B CA    1 
ATOM   6389  C  C     . LEU F 3 100 ? 14.249  39.923 -57.681  1.00 28.13  ? 396 LEU B C     1 
ATOM   6390  O  O     . LEU F 3 100 ? 14.933  40.502 -58.516  1.00 27.51  ? 396 LEU B O     1 
ATOM   6391  C  CB    . LEU F 3 100 ? 12.107  41.081 -57.107  1.00 27.75  ? 396 LEU B CB    1 
ATOM   6392  C  CG    . LEU F 3 100 ? 10.719  41.518 -57.562  1.00 27.43  ? 396 LEU B CG    1 
ATOM   6393  C  CD1   . LEU F 3 100 ? 10.353  42.819 -56.830  1.00 27.75  ? 396 LEU B CD1   1 
ATOM   6394  C  CD2   . LEU F 3 100 ? 10.690  41.727 -59.072  1.00 26.79  ? 396 LEU B CD2   1 
ATOM   6395  N  N     . ALA F 3 101 ? 14.765  39.300 -56.624  1.00 28.13  ? 397 ALA B N     1 
ATOM   6396  C  CA    . ALA F 3 101 ? 16.209  39.248 -56.405  1.00 28.07  ? 397 ALA B CA    1 
ATOM   6397  C  C     . ALA F 3 101 ? 16.798  38.420 -57.546  1.00 27.67  ? 397 ALA B C     1 
ATOM   6398  O  O     . ALA F 3 101 ? 17.741  38.845 -58.207  1.00 28.44  ? 397 ALA B O     1 
ATOM   6399  C  CB    . ALA F 3 101 ? 16.524  38.590 -55.054  1.00 27.90  ? 397 ALA B CB    1 
ATOM   6400  N  N     . ALA F 3 102 ? 16.228  37.237 -57.772  1.00 27.03  ? 398 ALA B N     1 
ATOM   6401  C  CA    . ALA F 3 102 ? 16.675  36.363 -58.843  1.00 26.77  ? 398 ALA B CA    1 
ATOM   6402  C  C     . ALA F 3 102 ? 16.586  37.101 -60.185  1.00 26.10  ? 398 ALA B C     1 
ATOM   6403  O  O     . ALA F 3 102 ? 17.603  37.310 -60.870  1.00 27.00  ? 398 ALA B O     1 
ATOM   6404  C  CB    . ALA F 3 102 ? 15.822  35.107 -58.878  1.00 26.48  ? 398 ALA B CB    1 
ATOM   6405  N  N     . TYR F 3 103 ? 15.371  37.484 -60.564  1.00 25.55  ? 399 TYR B N     1 
ATOM   6406  C  CA    . TYR F 3 103 ? 15.162  38.228 -61.805  1.00 24.74  ? 399 TYR B CA    1 
ATOM   6407  C  C     . TYR F 3 103 ? 16.226  39.310 -61.983  1.00 23.60  ? 399 TYR B C     1 
ATOM   6408  O  O     . TYR F 3 103 ? 16.766  39.474 -63.070  1.00 22.34  ? 399 TYR B O     1 
ATOM   6409  C  CB    . TYR F 3 103 ? 13.802  38.908 -61.813  1.00 25.24  ? 399 TYR B CB    1 
ATOM   6410  C  CG    . TYR F 3 103 ? 13.611  39.864 -62.972  1.00 25.93  ? 399 TYR B CG    1 
ATOM   6411  C  CD1   . TYR F 3 103 ? 13.285  39.392 -64.237  1.00 26.20  ? 399 TYR B CD1   1 
ATOM   6412  C  CD2   . TYR F 3 103 ? 13.731  41.248 -62.795  1.00 26.55  ? 399 TYR B CD2   1 
ATOM   6413  C  CE1   . TYR F 3 103 ? 13.071  40.270 -65.305  1.00 27.39  ? 399 TYR B CE1   1 
ATOM   6414  C  CE2   . TYR F 3 103 ? 13.515  42.143 -63.866  1.00 25.57  ? 399 TYR B CE2   1 
ATOM   6415  C  CZ    . TYR F 3 103 ? 13.184  41.638 -65.111  1.00 26.50  ? 399 TYR B CZ    1 
ATOM   6416  O  OH    . TYR F 3 103 ? 12.934  42.479 -66.173  1.00 27.01  ? 399 TYR B OH    1 
ATOM   6417  N  N     . LEU F 3 104 ? 16.517  40.049 -60.917  1.00 23.74  ? 400 LEU B N     1 
ATOM   6418  C  CA    . LEU F 3 104 ? 17.507  41.110 -61.011  1.00 24.63  ? 400 LEU B CA    1 
ATOM   6419  C  C     . LEU F 3 104 ? 18.929  40.590 -61.222  1.00 25.46  ? 400 LEU B C     1 
ATOM   6420  O  O     . LEU F 3 104 ? 19.654  41.131 -62.050  1.00 26.68  ? 400 LEU B O     1 
ATOM   6421  C  CB    . LEU F 3 104 ? 17.444  42.027 -59.777  1.00 24.89  ? 400 LEU B CB    1 
ATOM   6422  C  CG    . LEU F 3 104 ? 16.313  43.073 -59.805  1.00 24.17  ? 400 LEU B CG    1 
ATOM   6423  C  CD1   . LEU F 3 104 ? 16.353  43.915 -58.546  1.00 24.09  ? 400 LEU B CD1   1 
ATOM   6424  C  CD2   . LEU F 3 104 ? 16.448  43.970 -61.031  1.00 22.84  ? 400 LEU B CD2   1 
ATOM   6425  N  N     . LEU F 3 105 ? 19.321  39.530 -60.508  1.00 26.36  ? 401 LEU B N     1 
ATOM   6426  C  CA    . LEU F 3 105 ? 20.666  38.984 -60.670  1.00 27.48  ? 401 LEU B CA    1 
ATOM   6427  C  C     . LEU F 3 105 ? 20.947  38.543 -62.107  1.00 28.02  ? 401 LEU B C     1 
ATOM   6428  O  O     . LEU F 3 105 ? 22.004  38.844 -62.662  1.00 29.21  ? 401 LEU B O     1 
ATOM   6429  C  CB    . LEU F 3 105 ? 20.897  37.798 -59.716  1.00 27.13  ? 401 LEU B CB    1 
ATOM   6430  C  CG    . LEU F 3 105 ? 21.022  38.141 -58.226  1.00 28.33  ? 401 LEU B CG    1 
ATOM   6431  C  CD1   . LEU F 3 105 ? 21.240  36.872 -57.392  1.00 27.19  ? 401 LEU B CD1   1 
ATOM   6432  C  CD2   . LEU F 3 105 ? 22.192  39.108 -58.046  1.00 28.83  ? 401 LEU B CD2   1 
ATOM   6433  N  N     . ASP F 3 106 ? 20.003  37.831 -62.711  1.00 28.82  ? 402 ASP B N     1 
ATOM   6434  C  CA    . ASP F 3 106 ? 20.178  37.343 -64.077  1.00 28.90  ? 402 ASP B CA    1 
ATOM   6435  C  C     . ASP F 3 106 ? 18.821  37.126 -64.687  1.00 28.51  ? 402 ASP B C     1 
ATOM   6436  O  O     . ASP F 3 106 ? 18.219  36.064 -64.499  1.00 28.85  ? 402 ASP B O     1 
ATOM   6437  C  CB    . ASP F 3 106 ? 20.925  36.005 -64.092  1.00 29.51  ? 402 ASP B CB    1 
ATOM   6438  C  CG    . ASP F 3 106 ? 21.285  35.550 -65.501  1.00 29.35  ? 402 ASP B CG    1 
ATOM   6439  O  OD1   . ASP F 3 106 ? 20.495  35.782 -66.436  1.00 27.50  ? 402 ASP B OD1   1 
ATOM   6440  O  OD2   . ASP F 3 106 ? 22.370  34.953 -65.668  1.00 30.47  ? 402 ASP B OD2   1 
ATOM   6441  N  N     . PRO F 3 107 ? 18.318  38.120 -65.442  1.00 28.14  ? 403 PRO B N     1 
ATOM   6442  C  CA    . PRO F 3 107 ? 17.000  37.979 -66.065  1.00 28.59  ? 403 PRO B CA    1 
ATOM   6443  C  C     . PRO F 3 107 ? 16.924  36.798 -67.028  1.00 28.64  ? 403 PRO B C     1 
ATOM   6444  O  O     . PRO F 3 107 ? 15.871  36.194 -67.202  1.00 27.30  ? 403 PRO B O     1 
ATOM   6445  C  CB    . PRO F 3 107 ? 16.790  39.335 -66.752  1.00 27.33  ? 403 PRO B CB    1 
ATOM   6446  C  CG    . PRO F 3 107 ? 18.187  39.821 -67.008  1.00 27.75  ? 403 PRO B CG    1 
ATOM   6447  C  CD    . PRO F 3 107 ? 18.911  39.435 -65.743  1.00 27.78  ? 403 PRO B CD    1 
ATOM   6448  N  N     . ALA F 3 108 ? 18.061  36.461 -67.627  1.00 30.21  ? 404 ALA B N     1 
ATOM   6449  C  CA    . ALA F 3 108 ? 18.144  35.369 -68.587  1.00 32.12  ? 404 ALA B CA    1 
ATOM   6450  C  C     . ALA F 3 108 ? 17.763  33.976 -68.068  1.00 32.91  ? 404 ALA B C     1 
ATOM   6451  O  O     . ALA F 3 108 ? 17.366  33.116 -68.857  1.00 33.63  ? 404 ALA B O     1 
ATOM   6452  C  CB    . ALA F 3 108 ? 19.549  35.329 -69.194  1.00 32.42  ? 404 ALA B CB    1 
ATOM   6453  N  N     . GLN F 3 109 ? 17.866  33.744 -66.762  1.00 33.83  ? 405 GLN B N     1 
ATOM   6454  C  CA    . GLN F 3 109 ? 17.522  32.428 -66.216  1.00 35.26  ? 405 GLN B CA    1 
ATOM   6455  C  C     . GLN F 3 109 ? 16.032  32.088 -66.296  1.00 36.11  ? 405 GLN B C     1 
ATOM   6456  O  O     . GLN F 3 109 ? 15.644  30.932 -66.132  1.00 36.00  ? 405 GLN B O     1 
ATOM   6457  C  CB    . GLN F 3 109 ? 17.981  32.316 -64.759  1.00 35.77  ? 405 GLN B CB    1 
ATOM   6458  C  CG    . GLN F 3 109 ? 19.479  32.112 -64.584  1.00 36.13  ? 405 GLN B CG    1 
ATOM   6459  C  CD    . GLN F 3 109 ? 19.945  30.743 -65.057  1.00 35.53  ? 405 GLN B CD    1 
ATOM   6460  O  OE1   . GLN F 3 109 ? 19.401  29.717 -64.647  1.00 35.86  ? 405 GLN B OE1   1 
ATOM   6461  N  NE2   . GLN F 3 109 ? 20.959  30.723 -65.919  1.00 35.50  ? 405 GLN B NE2   1 
ATOM   6462  N  N     . GLY F 3 110 ? 15.190  33.084 -66.548  1.00 36.57  ? 406 GLY B N     1 
ATOM   6463  C  CA    . GLY F 3 110 ? 13.767  32.806 -66.629  1.00 37.51  ? 406 GLY B CA    1 
ATOM   6464  C  C     . GLY F 3 110 ? 13.195  32.180 -65.361  1.00 37.93  ? 406 GLY B C     1 
ATOM   6465  O  O     . GLY F 3 110 ? 12.183  31.470 -65.412  1.00 37.96  ? 406 GLY B O     1 
ATOM   6466  N  N     . VAL F 3 111 ? 13.855  32.436 -64.231  1.00 37.73  ? 407 VAL B N     1 
ATOM   6467  C  CA    . VAL F 3 111 ? 13.441  31.928 -62.921  1.00 37.52  ? 407 VAL B CA    1 
ATOM   6468  C  C     . VAL F 3 111 ? 11.930  32.009 -62.770  1.00 38.20  ? 407 VAL B C     1 
ATOM   6469  O  O     . VAL F 3 111 ? 11.372  33.103 -62.729  1.00 38.38  ? 407 VAL B O     1 
ATOM   6470  C  CB    . VAL F 3 111 ? 14.098  32.758 -61.789  1.00 37.50  ? 407 VAL B CB    1 
ATOM   6471  C  CG1   . VAL F 3 111 ? 13.425  32.472 -60.454  1.00 36.63  ? 407 VAL B CG1   1 
ATOM   6472  C  CG2   . VAL F 3 111 ? 15.581  32.433 -61.713  1.00 35.77  ? 407 VAL B CG2   1 
ATOM   6473  N  N     . ASP F 3 112 ? 11.272  30.852 -62.693  1.00 38.54  ? 408 ASP B N     1 
ATOM   6474  C  CA    . ASP F 3 112 ? 9.821   30.800 -62.557  1.00 39.05  ? 408 ASP B CA    1 
ATOM   6475  C  C     . ASP F 3 112 ? 9.356   30.228 -61.221  1.00 39.24  ? 408 ASP B C     1 
ATOM   6476  O  O     . ASP F 3 112 ? 8.160   30.269 -60.905  1.00 39.62  ? 408 ASP B O     1 
ATOM   6477  C  CB    . ASP F 3 112 ? 9.217   29.993 -63.713  1.00 40.21  ? 408 ASP B CB    1 
ATOM   6478  C  CG    . ASP F 3 112 ? 9.809   28.603 -63.829  1.00 41.38  ? 408 ASP B CG    1 
ATOM   6479  O  OD1   . ASP F 3 112 ? 11.044  28.469 -63.689  1.00 41.73  ? 408 ASP B OD1   1 
ATOM   6480  O  OD2   . ASP F 3 112 ? 9.041   27.644 -64.080  1.00 42.62  ? 408 ASP B OD2   1 
ATOM   6481  N  N     . ASP F 3 113 ? 10.292  29.707 -60.431  1.00 38.69  ? 409 ASP B N     1 
ATOM   6482  C  CA    . ASP F 3 113 ? 9.956   29.142 -59.126  1.00 38.79  ? 409 ASP B CA    1 
ATOM   6483  C  C     . ASP F 3 113 ? 11.130  29.158 -58.154  1.00 37.72  ? 409 ASP B C     1 
ATOM   6484  O  O     . ASP F 3 113 ? 12.278  29.332 -58.557  1.00 38.03  ? 409 ASP B O     1 
ATOM   6485  C  CB    . ASP F 3 113 ? 9.405   27.715 -59.283  1.00 39.91  ? 409 ASP B CB    1 
ATOM   6486  C  CG    . ASP F 3 113 ? 10.436  26.723 -59.818  1.00 40.54  ? 409 ASP B CG    1 
ATOM   6487  O  OD1   . ASP F 3 113 ? 10.026  25.588 -60.143  1.00 41.55  ? 409 ASP B OD1   1 
ATOM   6488  O  OD2   . ASP F 3 113 ? 11.639  27.055 -59.907  1.00 40.81  ? 409 ASP B OD2   1 
ATOM   6489  N  N     . VAL F 3 114 ? 10.836  28.976 -56.872  1.00 37.28  ? 410 VAL B N     1 
ATOM   6490  C  CA    . VAL F 3 114 ? 11.863  28.986 -55.826  1.00 36.44  ? 410 VAL B CA    1 
ATOM   6491  C  C     . VAL F 3 114 ? 13.092  28.121 -56.119  1.00 35.77  ? 410 VAL B C     1 
ATOM   6492  O  O     . VAL F 3 114 ? 14.223  28.535 -55.840  1.00 35.05  ? 410 VAL B O     1 
ATOM   6493  C  CB    . VAL F 3 114 ? 11.265  28.569 -54.458  1.00 36.76  ? 410 VAL B CB    1 
ATOM   6494  C  CG1   . VAL F 3 114 ? 12.357  28.535 -53.395  1.00 35.68  ? 410 VAL B CG1   1 
ATOM   6495  C  CG2   . VAL F 3 114 ? 10.163  29.553 -54.055  1.00 36.38  ? 410 VAL B CG2   1 
ATOM   6496  N  N     . ALA F 3 115 ? 12.873  26.938 -56.690  1.00 35.11  ? 411 ALA B N     1 
ATOM   6497  C  CA    . ALA F 3 115 ? 13.968  26.018 -57.011  1.00 34.03  ? 411 ALA B CA    1 
ATOM   6498  C  C     . ALA F 3 115 ? 14.912  26.604 -58.056  1.00 33.78  ? 411 ALA B C     1 
ATOM   6499  O  O     . ALA F 3 115 ? 16.120  26.367 -58.025  1.00 33.05  ? 411 ALA B O     1 
ATOM   6500  C  CB    . ALA F 3 115 ? 13.402  24.691 -57.509  1.00 33.60  ? 411 ALA B CB    1 
ATOM   6501  N  N     . ALA F 3 116 ? 14.349  27.369 -58.987  1.00 33.37  ? 412 ALA B N     1 
ATOM   6502  C  CA    . ALA F 3 116 ? 15.127  27.994 -60.035  1.00 32.65  ? 412 ALA B CA    1 
ATOM   6503  C  C     . ALA F 3 116 ? 16.060  29.040 -59.433  1.00 31.79  ? 412 ALA B C     1 
ATOM   6504  O  O     . ALA F 3 116 ? 17.212  29.178 -59.849  1.00 31.54  ? 412 ALA B O     1 
ATOM   6505  C  CB    . ALA F 3 116 ? 14.188  28.643 -61.065  1.00 33.86  ? 412 ALA B CB    1 
ATOM   6506  N  N     . ALA F 3 117 ? 15.558  29.781 -58.454  1.00 31.34  ? 413 ALA B N     1 
ATOM   6507  C  CA    . ALA F 3 117 ? 16.360  30.815 -57.794  1.00 30.74  ? 413 ALA B CA    1 
ATOM   6508  C  C     . ALA F 3 117 ? 17.327  30.135 -56.838  1.00 30.11  ? 413 ALA B C     1 
ATOM   6509  O  O     . ALA F 3 117 ? 18.476  30.551 -56.683  1.00 30.56  ? 413 ALA B O     1 
ATOM   6510  C  CB    . ALA F 3 117 ? 15.456  31.772 -57.027  1.00 30.28  ? 413 ALA B CB    1 
ATOM   6511  N  N     . ALA F 3 118 ? 16.850  29.082 -56.197  1.00 30.01  ? 414 ALA B N     1 
ATOM   6512  C  CA    . ALA F 3 118 ? 17.670  28.331 -55.251  1.00 30.34  ? 414 ALA B CA    1 
ATOM   6513  C  C     . ALA F 3 118 ? 18.966  27.821 -55.893  1.00 29.86  ? 414 ALA B C     1 
ATOM   6514  O  O     . ALA F 3 118 ? 20.032  27.907 -55.285  1.00 30.09  ? 414 ALA B O     1 
ATOM   6515  C  CB    . ALA F 3 118 ? 16.867  27.166 -54.690  1.00 29.15  ? 414 ALA B CB    1 
ATOM   6516  N  N     . LYS F 3 119 ? 18.861  27.308 -57.119  1.00 29.64  ? 415 LYS B N     1 
ATOM   6517  C  CA    . LYS F 3 119 ? 20.005  26.760 -57.864  1.00 29.63  ? 415 LYS B CA    1 
ATOM   6518  C  C     . LYS F 3 119 ? 21.120  27.740 -58.155  1.00 29.17  ? 415 LYS B C     1 
ATOM   6519  O  O     . LYS F 3 119 ? 22.296  27.353 -58.242  1.00 27.25  ? 415 LYS B O     1 
ATOM   6520  C  CB    . LYS F 3 119 ? 19.558  26.184 -59.212  1.00 30.46  ? 415 LYS B CB    1 
ATOM   6521  C  CG    . LYS F 3 119 ? 18.769  24.910 -59.132  1.00 32.80  ? 415 LYS B CG    1 
ATOM   6522  C  CD    . LYS F 3 119 ? 19.004  24.081 -60.377  1.00 34.08  ? 415 LYS B CD    1 
ATOM   6523  C  CE    . LYS F 3 119 ? 20.411  23.513 -60.383  1.00 34.28  ? 415 LYS B CE    1 
ATOM   6524  N  NZ    . LYS F 3 119 ? 20.773  22.955 -61.722  1.00 34.57  ? 415 LYS B NZ    1 
ATOM   6525  N  N     . MET F 3 120 ? 20.739  28.999 -58.349  1.00 28.35  ? 416 MET B N     1 
ATOM   6526  C  CA    . MET F 3 120 ? 21.678  30.075 -58.659  1.00 28.40  ? 416 MET B CA    1 
ATOM   6527  C  C     . MET F 3 120 ? 22.724  30.294 -57.549  1.00 28.45  ? 416 MET B C     1 
ATOM   6528  O  O     . MET F 3 120 ? 23.803  30.840 -57.804  1.00 27.84  ? 416 MET B O     1 
ATOM   6529  C  CB    . MET F 3 120 ? 20.879  31.372 -58.942  1.00 29.19  ? 416 MET B CB    1 
ATOM   6530  C  CG    . MET F 3 120 ? 19.860  31.245 -60.108  1.00 29.15  ? 416 MET B CG    1 
ATOM   6531  S  SD    . MET F 3 120 ? 18.613  32.598 -60.256  1.00 30.78  ? 416 MET B SD    1 
ATOM   6532  C  CE    . MET F 3 120 ? 19.719  34.003 -60.445  1.00 30.46  ? 416 MET B CE    1 
ATOM   6533  N  N     . LYS F 3 121 ? 22.403  29.867 -56.326  1.00 28.94  ? 417 LYS B N     1 
ATOM   6534  C  CA    . LYS F 3 121 ? 23.309  29.997 -55.187  1.00 30.32  ? 417 LYS B CA    1 
ATOM   6535  C  C     . LYS F 3 121 ? 23.645  28.645 -54.534  1.00 31.42  ? 417 LYS B C     1 
ATOM   6536  O  O     . LYS F 3 121 ? 23.727  28.533 -53.308  1.00 31.78  ? 417 LYS B O     1 
ATOM   6537  C  CB    . LYS F 3 121 ? 22.703  30.936 -54.149  1.00 30.73  ? 417 LYS B CB    1 
ATOM   6538  C  CG    . LYS F 3 121 ? 22.630  32.377 -54.627  1.00 30.75  ? 417 LYS B CG    1 
ATOM   6539  C  CD    . LYS F 3 121 ? 24.034  32.927 -54.823  1.00 30.27  ? 417 LYS B CD    1 
ATOM   6540  C  CE    . LYS F 3 121 ? 24.015  34.406 -55.164  1.00 32.17  ? 417 LYS B CE    1 
ATOM   6541  N  NZ    . LYS F 3 121 ? 25.378  35.000 -55.096  1.00 30.64  ? 417 LYS B NZ    1 
ATOM   6542  N  N     . GLN F 3 122 ? 23.833  27.632 -55.375  1.00 33.23  ? 418 GLN B N     1 
ATOM   6543  C  CA    . GLN F 3 122 ? 24.167  26.263 -54.957  1.00 34.58  ? 418 GLN B CA    1 
ATOM   6544  C  C     . GLN F 3 122 ? 23.210  25.707 -53.904  1.00 34.98  ? 418 GLN B C     1 
ATOM   6545  O  O     . GLN F 3 122 ? 23.635  25.096 -52.918  1.00 34.47  ? 418 GLN B O     1 
ATOM   6546  C  CB    . GLN F 3 122 ? 25.599  26.181 -54.411  1.00 35.64  ? 418 GLN B CB    1 
ATOM   6547  C  CG    . GLN F 3 122 ? 26.661  26.998 -55.138  1.00 38.06  ? 418 GLN B CG    1 
ATOM   6548  C  CD    . GLN F 3 122 ? 26.550  26.966 -56.650  1.00 40.53  ? 418 GLN B CD    1 
ATOM   6549  O  OE1   . GLN F 3 122 ? 26.329  25.913 -57.261  1.00 42.07  ? 418 GLN B OE1   1 
ATOM   6550  N  NE2   . GLN F 3 122 ? 26.723  28.129 -57.270  1.00 41.39  ? 418 GLN B NE2   1 
ATOM   6551  N  N     . TYR F 3 123 ? 21.916  25.923 -54.110  1.00 35.02  ? 419 TYR B N     1 
ATOM   6552  C  CA    . TYR F 3 123 ? 20.923  25.422 -53.178  1.00 34.65  ? 419 TYR B CA    1 
ATOM   6553  C  C     . TYR F 3 123 ? 19.885  24.623 -53.938  1.00 35.62  ? 419 TYR B C     1 
ATOM   6554  O  O     . TYR F 3 123 ? 19.219  25.142 -54.839  1.00 35.46  ? 419 TYR B O     1 
ATOM   6555  C  CB    . TYR F 3 123 ? 20.243  26.572 -52.440  1.00 32.89  ? 419 TYR B CB    1 
ATOM   6556  C  CG    . TYR F 3 123 ? 19.346  26.119 -51.316  1.00 29.91  ? 419 TYR B CG    1 
ATOM   6557  C  CD1   . TYR F 3 123 ? 19.687  26.353 -49.988  1.00 28.73  ? 419 TYR B CD1   1 
ATOM   6558  C  CD2   . TYR F 3 123 ? 18.158  25.439 -51.579  1.00 29.18  ? 419 TYR B CD2   1 
ATOM   6559  C  CE1   . TYR F 3 123 ? 18.868  25.921 -48.950  1.00 28.72  ? 419 TYR B CE1   1 
ATOM   6560  C  CE2   . TYR F 3 123 ? 17.338  25.005 -50.549  1.00 28.32  ? 419 TYR B CE2   1 
ATOM   6561  C  CZ    . TYR F 3 123 ? 17.694  25.245 -49.243  1.00 27.82  ? 419 TYR B CZ    1 
ATOM   6562  O  OH    . TYR F 3 123 ? 16.881  24.796 -48.227  1.00 29.90  ? 419 TYR B OH    1 
ATOM   6563  N  N     . GLU F 3 124 ? 19.737  23.360 -53.560  1.00 36.84  ? 420 GLU B N     1 
ATOM   6564  C  CA    . GLU F 3 124 ? 18.788  22.489 -54.231  1.00 38.15  ? 420 GLU B CA    1 
ATOM   6565  C  C     . GLU F 3 124 ? 17.942  21.612 -53.314  1.00 38.04  ? 420 GLU B C     1 
ATOM   6566  O  O     . GLU F 3 124 ? 17.319  20.656 -53.783  1.00 38.12  ? 420 GLU B O     1 
ATOM   6567  C  CB    . GLU F 3 124 ? 19.540  21.626 -55.248  1.00 40.09  ? 420 GLU B CB    1 
ATOM   6568  C  CG    . GLU F 3 124 ? 20.154  22.452 -56.373  1.00 41.97  ? 420 GLU B CG    1 
ATOM   6569  C  CD    . GLU F 3 124 ? 20.902  21.618 -57.392  1.00 43.71  ? 420 GLU B CD    1 
ATOM   6570  O  OE1   . GLU F 3 124 ? 20.342  20.603 -57.859  1.00 44.51  ? 420 GLU B OE1   1 
ATOM   6571  O  OE2   . GLU F 3 124 ? 22.048  21.986 -57.735  1.00 44.31  ? 420 GLU B OE2   1 
ATOM   6572  N  N     . ALA F 3 125 ? 17.910  21.938 -52.019  1.00 38.36  ? 421 ALA B N     1 
ATOM   6573  C  CA    . ALA F 3 125 ? 17.111  21.181 -51.046  1.00 38.41  ? 421 ALA B CA    1 
ATOM   6574  C  C     . ALA F 3 125 ? 15.649  21.588 -51.155  1.00 38.44  ? 421 ALA B C     1 
ATOM   6575  O  O     . ALA F 3 125 ? 14.945  21.735 -50.155  1.00 38.71  ? 421 ALA B O     1 
ATOM   6576  C  CB    . ALA F 3 125 ? 17.610  21.426 -49.630  1.00 38.26  ? 421 ALA B CB    1 
ATOM   6577  N  N     . VAL F 3 126 ? 15.205  21.782 -52.390  1.00 38.80  ? 422 VAL B N     1 
ATOM   6578  C  CA    . VAL F 3 126 ? 13.831  22.159 -52.672  1.00 38.45  ? 422 VAL B CA    1 
ATOM   6579  C  C     . VAL F 3 126 ? 13.641  21.811 -54.133  1.00 39.09  ? 422 VAL B C     1 
ATOM   6580  O  O     . VAL F 3 126 ? 14.560  21.984 -54.937  1.00 38.64  ? 422 VAL B O     1 
ATOM   6581  C  CB    . VAL F 3 126 ? 13.596  23.679 -52.447  1.00 38.67  ? 422 VAL B CB    1 
ATOM   6582  C  CG1   . VAL F 3 126 ? 14.534  24.499 -53.326  1.00 37.64  ? 422 VAL B CG1   1 
ATOM   6583  C  CG2   . VAL F 3 126 ? 12.145  24.028 -52.737  1.00 38.33  ? 422 VAL B CG2   1 
ATOM   6584  N  N     . ARG F 3 127 ? 12.467  21.299 -54.480  1.00 39.34  ? 423 ARG B N     1 
ATOM   6585  C  CA    . ARG F 3 127 ? 12.215  20.925 -55.859  1.00 40.71  ? 423 ARG B CA    1 
ATOM   6586  C  C     . ARG F 3 127 ? 11.324  21.919 -56.615  1.00 41.43  ? 423 ARG B C     1 
ATOM   6587  O  O     . ARG F 3 127 ? 10.583  22.696 -56.009  1.00 40.55  ? 423 ARG B O     1 
ATOM   6588  C  CB    . ARG F 3 127 ? 11.607  19.522 -55.899  1.00 41.18  ? 423 ARG B CB    1 
ATOM   6589  C  CG    . ARG F 3 127 ? 10.269  19.386 -55.200  1.00 41.53  ? 423 ARG B CG    1 
ATOM   6590  C  CD    . ARG F 3 127 ? 9.926   17.907 -55.011  1.00 41.84  ? 423 ARG B CD    1 
ATOM   6591  N  NE    . ARG F 3 127 ? 10.310  17.110 -56.173  1.00 42.41  ? 423 ARG B NE    1 
ATOM   6592  C  CZ    . ARG F 3 127 ? 9.761   15.943 -56.502  1.00 42.66  ? 423 ARG B CZ    1 
ATOM   6593  N  NH1   . ARG F 3 127 ? 10.180  15.289 -57.578  1.00 43.30  ? 423 ARG B NH1   1 
ATOM   6594  N  NH2   . ARG F 3 127 ? 8.783   15.437 -55.765  1.00 43.30  ? 423 ARG B NH2   1 
ATOM   6595  N  N     . PRO F 3 128 ? 11.399  21.907 -57.958  1.00 42.15  ? 424 PRO B N     1 
ATOM   6596  C  CA    . PRO F 3 128 ? 10.609  22.793 -58.820  1.00 42.47  ? 424 PRO B CA    1 
ATOM   6597  C  C     . PRO F 3 128 ? 9.124   22.454 -58.739  1.00 42.83  ? 424 PRO B C     1 
ATOM   6598  O  O     . PRO F 3 128 ? 8.748   21.286 -58.637  1.00 42.90  ? 424 PRO B O     1 
ATOM   6599  C  CB    . PRO F 3 128 ? 11.191  22.525 -60.203  1.00 42.39  ? 424 PRO B CB    1 
ATOM   6600  C  CG    . PRO F 3 128 ? 11.548  21.074 -60.123  1.00 42.70  ? 424 PRO B CG    1 
ATOM   6601  C  CD    . PRO F 3 128 ? 12.225  20.997 -58.773  1.00 42.42  ? 424 PRO B CD    1 
ATOM   6602  N  N     . ASP F 3 129 ? 8.279   23.475 -58.793  1.00 43.06  ? 425 ASP B N     1 
ATOM   6603  C  CA    . ASP F 3 129 ? 6.842   23.262 -58.701  1.00 43.99  ? 425 ASP B CA    1 
ATOM   6604  C  C     . ASP F 3 129 ? 6.301   22.308 -59.764  1.00 44.41  ? 425 ASP B C     1 
ATOM   6605  O  O     . ASP F 3 129 ? 5.222   21.740 -59.597  1.00 44.54  ? 425 ASP B O     1 
ATOM   6606  C  CB    . ASP F 3 129 ? 6.097   24.601 -58.781  1.00 43.58  ? 425 ASP B CB    1 
ATOM   6607  C  CG    . ASP F 3 129 ? 6.326   25.467 -57.559  1.00 43.85  ? 425 ASP B CG    1 
ATOM   6608  O  OD1   . ASP F 3 129 ? 6.343   24.914 -56.443  1.00 43.24  ? 425 ASP B OD1   1 
ATOM   6609  O  OD2   . ASP F 3 129 ? 6.475   26.703 -57.706  1.00 44.84  ? 425 ASP B OD2   1 
ATOM   6610  N  N     . GLU F 3 130 ? 7.048   22.132 -60.850  1.00 45.00  ? 426 GLU B N     1 
ATOM   6611  C  CA    . GLU F 3 130 ? 6.617   21.247 -61.927  1.00 46.15  ? 426 GLU B CA    1 
ATOM   6612  C  C     . GLU F 3 130 ? 6.634   19.790 -61.489  1.00 46.15  ? 426 GLU B C     1 
ATOM   6613  O  O     . GLU F 3 130 ? 5.750   19.013 -61.848  1.00 46.19  ? 426 GLU B O     1 
ATOM   6614  C  CB    . GLU F 3 130 ? 7.520   21.400 -63.150  1.00 47.28  ? 426 GLU B CB    1 
ATOM   6615  C  CG    . GLU F 3 130 ? 7.047   20.577 -64.329  1.00 49.47  ? 426 GLU B CG    1 
ATOM   6616  C  CD    . GLU F 3 130 ? 8.013   20.599 -65.494  1.00 50.56  ? 426 GLU B CD    1 
ATOM   6617  O  OE1   . GLU F 3 130 ? 8.393   21.705 -65.946  1.00 51.45  ? 426 GLU B OE1   1 
ATOM   6618  O  OE2   . GLU F 3 130 ? 8.387   19.502 -65.962  1.00 51.34  ? 426 GLU B OE2   1 
ATOM   6619  N  N     . ALA F 3 131 ? 7.649   19.429 -60.711  1.00 46.31  ? 427 ALA B N     1 
ATOM   6620  C  CA    . ALA F 3 131 ? 7.807   18.066 -60.220  1.00 46.38  ? 427 ALA B CA    1 
ATOM   6621  C  C     . ALA F 3 131 ? 6.933   17.791 -59.001  1.00 46.73  ? 427 ALA B C     1 
ATOM   6622  O  O     . ALA F 3 131 ? 7.074   16.759 -58.346  1.00 46.84  ? 427 ALA B O     1 
ATOM   6623  C  CB    . ALA F 3 131 ? 9.262   17.818 -59.878  1.00 46.07  ? 427 ALA B CB    1 
ATOM   6624  N  N     . VAL F 3 132 ? 6.029   18.713 -58.695  1.00 46.85  ? 428 VAL B N     1 
ATOM   6625  C  CA    . VAL F 3 132 ? 5.158   18.543 -57.547  1.00 46.95  ? 428 VAL B CA    1 
ATOM   6626  C  C     . VAL F 3 132 ? 3.696   18.657 -57.948  1.00 47.22  ? 428 VAL B C     1 
ATOM   6627  O  O     . VAL F 3 132 ? 2.820   18.132 -57.266  1.00 47.74  ? 428 VAL B O     1 
ATOM   6628  C  CB    . VAL F 3 132 ? 5.472   19.600 -56.452  1.00 46.66  ? 428 VAL B CB    1 
ATOM   6629  C  CG1   . VAL F 3 132 ? 4.619   19.348 -55.214  1.00 46.46  ? 428 VAL B CG1   1 
ATOM   6630  C  CG2   . VAL F 3 132 ? 6.945   19.559 -56.101  1.00 46.05  ? 428 VAL B CG2   1 
ATOM   6631  N  N     . TYR F 3 133 ? 3.438   19.331 -59.063  1.00 47.76  ? 429 TYR B N     1 
ATOM   6632  C  CA    . TYR F 3 133 ? 2.071   19.526 -59.537  1.00 48.01  ? 429 TYR B CA    1 
ATOM   6633  C  C     . TYR F 3 133 ? 1.769   18.905 -60.901  1.00 49.28  ? 429 TYR B C     1 
ATOM   6634  O  O     . TYR F 3 133 ? 0.646   18.471 -61.148  1.00 48.97  ? 429 TYR B O     1 
ATOM   6635  C  CB    . TYR F 3 133 ? 1.754   21.020 -59.607  1.00 46.34  ? 429 TYR B CB    1 
ATOM   6636  C  CG    . TYR F 3 133 ? 1.857   21.743 -58.288  1.00 44.58  ? 429 TYR B CG    1 
ATOM   6637  C  CD1   . TYR F 3 133 ? 2.753   22.797 -58.120  1.00 43.94  ? 429 TYR B CD1   1 
ATOM   6638  C  CD2   . TYR F 3 133 ? 1.033   21.401 -57.218  1.00 43.51  ? 429 TYR B CD2   1 
ATOM   6639  C  CE1   . TYR F 3 133 ? 2.825   23.495 -56.923  1.00 43.06  ? 429 TYR B CE1   1 
ATOM   6640  C  CE2   . TYR F 3 133 ? 1.095   22.093 -56.019  1.00 43.46  ? 429 TYR B CE2   1 
ATOM   6641  C  CZ    . TYR F 3 133 ? 1.990   23.138 -55.879  1.00 43.05  ? 429 TYR B CZ    1 
ATOM   6642  O  OH    . TYR F 3 133 ? 2.033   23.843 -54.704  1.00 43.00  ? 429 TYR B OH    1 
ATOM   6643  N  N     . GLY F 3 134 ? 2.764   18.873 -61.783  1.00 50.72  ? 430 GLY B N     1 
ATOM   6644  C  CA    . GLY F 3 134 ? 2.548   18.331 -63.112  1.00 52.67  ? 430 GLY B CA    1 
ATOM   6645  C  C     . GLY F 3 134 ? 2.566   19.458 -64.131  1.00 54.16  ? 430 GLY B C     1 
ATOM   6646  O  O     . GLY F 3 134 ? 2.863   20.604 -63.784  1.00 54.19  ? 430 GLY B O     1 
ATOM   6647  N  N     . LYS F 3 135 ? 2.241   19.151 -65.384  1.00 55.49  ? 431 LYS B N     1 
ATOM   6648  C  CA    . LYS F 3 135 ? 2.251   20.163 -66.441  1.00 56.88  ? 431 LYS B CA    1 
ATOM   6649  C  C     . LYS F 3 135 ? 0.868   20.529 -66.966  1.00 57.62  ? 431 LYS B C     1 
ATOM   6650  O  O     . LYS F 3 135 ? -0.009  19.676 -67.067  1.00 57.91  ? 431 LYS B O     1 
ATOM   6651  C  CB    . LYS F 3 135 ? 3.110   19.693 -67.616  1.00 57.00  ? 431 LYS B CB    1 
ATOM   6652  C  CG    . LYS F 3 135 ? 4.586   19.505 -67.293  1.00 57.14  ? 431 LYS B CG    1 
ATOM   6653  C  CD    . LYS F 3 135 ? 5.386   19.214 -68.556  1.00 57.21  ? 431 LYS B CD    1 
ATOM   6654  C  CE    . LYS F 3 135 ? 6.868   19.114 -68.252  1.00 57.38  ? 431 LYS B CE    1 
ATOM   6655  N  NZ    . LYS F 3 135 ? 7.696   18.897 -69.467  1.00 57.85  ? 431 LYS B NZ    1 
ATOM   6656  N  N     . GLY F 3 136 ? 0.689   21.803 -67.306  1.00 58.27  ? 432 GLY B N     1 
ATOM   6657  C  CA    . GLY F 3 136 ? -0.580  22.275 -67.835  1.00 59.25  ? 432 GLY B CA    1 
ATOM   6658  C  C     . GLY F 3 136 ? -1.823  21.691 -67.187  1.00 59.87  ? 432 GLY B C     1 
ATOM   6659  O  O     . GLY F 3 136 ? -2.184  22.063 -66.070  1.00 60.20  ? 432 GLY B O     1 
ATOM   6660  N  N     . ALA F 3 137 ? -2.484  20.779 -67.893  1.00 60.39  ? 433 ALA B N     1 
ATOM   6661  C  CA    . ALA F 3 137 ? -3.698  20.150 -67.386  1.00 60.93  ? 433 ALA B CA    1 
ATOM   6662  C  C     . ALA F 3 137 ? -3.351  19.012 -66.441  1.00 61.25  ? 433 ALA B C     1 
ATOM   6663  O  O     . ALA F 3 137 ? -4.154  18.632 -65.585  1.00 61.09  ? 433 ALA B O     1 
ATOM   6664  C  CB    . ALA F 3 137 ? -4.546  19.629 -68.548  1.00 61.28  ? 433 ALA B CB    1 
ATOM   6665  N  N     . LYS F 3 138 ? -2.152  18.464 -66.606  1.00 61.60  ? 434 LYS B N     1 
ATOM   6666  C  CA    . LYS F 3 138 ? -1.689  17.371 -65.759  1.00 61.96  ? 434 LYS B CA    1 
ATOM   6667  C  C     . LYS F 3 138 ? -1.389  17.934 -64.371  1.00 62.13  ? 434 LYS B C     1 
ATOM   6668  O  O     . LYS F 3 138 ? -1.228  17.183 -63.403  1.00 62.47  ? 434 LYS B O     1 
ATOM   6669  C  CB    . LYS F 3 138 ? -0.421  16.732 -66.347  1.00 62.00  ? 434 LYS B CB    1 
ATOM   6670  C  CG    . LYS F 3 138 ? -0.537  16.302 -67.809  1.00 62.57  ? 434 LYS B CG    1 
ATOM   6671  C  CD    . LYS F 3 138 ? -0.546  17.504 -68.759  1.00 62.58  ? 434 LYS B CD    1 
ATOM   6672  C  CE    . LYS F 3 138 ? -0.830  17.102 -70.197  1.00 62.59  ? 434 LYS B CE    1 
ATOM   6673  N  NZ    . LYS F 3 138 ? -2.189  16.506 -70.342  1.00 62.75  ? 434 LYS B NZ    1 
ATOM   6674  N  N     . ARG F 3 139 ? -1.328  19.262 -64.285  1.00 61.79  ? 435 ARG B N     1 
ATOM   6675  C  CA    . ARG F 3 139 ? -1.037  19.954 -63.034  1.00 61.50  ? 435 ARG B CA    1 
ATOM   6676  C  C     . ARG F 3 139 ? -2.171  19.850 -62.012  1.00 61.24  ? 435 ARG B C     1 
ATOM   6677  O  O     . ARG F 3 139 ? -3.272  20.354 -62.232  1.00 61.29  ? 435 ARG B O     1 
ATOM   6678  C  CB    . ARG F 3 139 ? -0.716  21.427 -63.314  1.00 61.24  ? 435 ARG B CB    1 
ATOM   6679  C  CG    . ARG F 3 139 ? -0.317  22.214 -62.075  1.00 61.40  ? 435 ARG B CG    1 
ATOM   6680  C  CD    . ARG F 3 139 ? 0.411   23.503 -62.428  1.00 61.68  ? 435 ARG B CD    1 
ATOM   6681  N  NE    . ARG F 3 139 ? 0.823   24.249 -61.240  1.00 61.42  ? 435 ARG B NE    1 
ATOM   6682  C  CZ    . ARG F 3 139 ? 1.621   25.311 -61.265  1.00 61.50  ? 435 ARG B CZ    1 
ATOM   6683  N  NH1   . ARG F 3 139 ? 2.099   25.752 -62.419  1.00 61.54  ? 435 ARG B NH1   1 
ATOM   6684  N  NH2   . ARG F 3 139 ? 1.939   25.936 -60.138  1.00 61.66  ? 435 ARG B NH2   1 
ATOM   6685  N  N     . ALA F 3 140 ? -1.884  19.199 -60.888  1.00 60.94  ? 436 ALA B N     1 
ATOM   6686  C  CA    . ALA F 3 140 ? -2.867  19.015 -59.828  1.00 60.53  ? 436 ALA B CA    1 
ATOM   6687  C  C     . ALA F 3 140 ? -2.239  19.226 -58.456  1.00 60.29  ? 436 ALA B C     1 
ATOM   6688  O  O     . ALA F 3 140 ? -1.028  19.073 -58.284  1.00 60.36  ? 436 ALA B O     1 
ATOM   6689  C  CB    . ALA F 3 140 ? -3.466  17.620 -59.914  1.00 60.30  ? 436 ALA B CB    1 
ATOM   6690  N  N     . VAL F 3 141 ? -3.069  19.584 -57.481  1.00 59.84  ? 437 VAL B N     1 
ATOM   6691  C  CA    . VAL F 3 141 ? -2.594  19.809 -56.126  1.00 59.53  ? 437 VAL B CA    1 
ATOM   6692  C  C     . VAL F 3 141 ? -2.468  18.458 -55.438  1.00 59.54  ? 437 VAL B C     1 
ATOM   6693  O  O     . VAL F 3 141 ? -3.457  17.748 -55.259  1.00 59.71  ? 437 VAL B O     1 
ATOM   6694  C  CB    . VAL F 3 141 ? -3.570  20.694 -55.331  1.00 59.22  ? 437 VAL B CB    1 
ATOM   6695  C  CG1   . VAL F 3 141 ? -2.997  20.993 -53.955  1.00 59.23  ? 437 VAL B CG1   1 
ATOM   6696  C  CG2   . VAL F 3 141 ? -3.831  21.983 -56.089  1.00 59.14  ? 437 VAL B CG2   1 
ATOM   6697  N  N     . PRO F 3 142 ? -1.242  18.085 -55.040  1.00 59.46  ? 438 PRO B N     1 
ATOM   6698  C  CA    . PRO F 3 142 ? -0.990  16.806 -54.372  1.00 59.23  ? 438 PRO B CA    1 
ATOM   6699  C  C     . PRO F 3 142 ? -1.634  16.675 -52.990  1.00 59.14  ? 438 PRO B C     1 
ATOM   6700  O  O     . PRO F 3 142 ? -2.277  17.603 -52.491  1.00 58.76  ? 438 PRO B O     1 
ATOM   6701  C  CB    . PRO F 3 142 ? 0.534   16.755 -54.310  1.00 59.17  ? 438 PRO B CB    1 
ATOM   6702  C  CG    . PRO F 3 142 ? 0.894   18.189 -54.125  1.00 59.17  ? 438 PRO B CG    1 
ATOM   6703  C  CD    . PRO F 3 142 ? -0.002  18.878 -55.128  1.00 59.25  ? 438 PRO B CD    1 
ATOM   6704  N  N     . ASP F 3 143 ? -1.451  15.506 -52.385  1.00 58.82  ? 439 ASP B N     1 
ATOM   6705  C  CA    . ASP F 3 143 ? -1.993  15.221 -51.066  1.00 58.56  ? 439 ASP B CA    1 
ATOM   6706  C  C     . ASP F 3 143 ? -1.372  16.181 -50.067  1.00 57.97  ? 439 ASP B C     1 
ATOM   6707  O  O     . ASP F 3 143 ? -0.287  16.719 -50.303  1.00 58.01  ? 439 ASP B O     1 
ATOM   6708  C  CB    . ASP F 3 143 ? -1.666  13.782 -50.669  1.00 59.29  ? 439 ASP B CB    1 
ATOM   6709  C  CG    . ASP F 3 143 ? -2.022  12.789 -51.753  1.00 59.87  ? 439 ASP B CG    1 
ATOM   6710  O  OD1   . ASP F 3 143 ? -3.213  12.718 -52.122  1.00 60.15  ? 439 ASP B OD1   1 
ATOM   6711  O  OD2   . ASP F 3 143 ? -1.108  12.086 -52.241  1.00 60.79  ? 439 ASP B OD2   1 
ATOM   6712  N  N     . GLU F 3 144 ? -2.052  16.386 -48.946  1.00 57.07  ? 440 GLU B N     1 
ATOM   6713  C  CA    . GLU F 3 144 ? -1.553  17.295 -47.929  1.00 56.39  ? 440 GLU B CA    1 
ATOM   6714  C  C     . GLU F 3 144 ? -0.092  17.020 -47.580  1.00 56.18  ? 440 GLU B C     1 
ATOM   6715  O  O     . GLU F 3 144 ? 0.755   17.908 -47.695  1.00 56.32  ? 440 GLU B O     1 
ATOM   6716  C  CB    . GLU F 3 144 ? -2.414  17.206 -46.667  1.00 56.19  ? 440 GLU B CB    1 
ATOM   6717  C  CG    . GLU F 3 144 ? -2.165  18.327 -45.670  1.00 55.66  ? 440 GLU B CG    1 
ATOM   6718  C  CD    . GLU F 3 144 ? -3.108  18.273 -44.483  1.00 55.49  ? 440 GLU B CD    1 
ATOM   6719  O  OE1   . GLU F 3 144 ? -2.855  17.478 -43.553  1.00 55.08  ? 440 GLU B OE1   1 
ATOM   6720  O  OE2   . GLU F 3 144 ? -4.110  19.022 -44.486  1.00 55.32  ? 440 GLU B OE2   1 
ATOM   6721  N  N     . PRO F 3 145 ? 0.229   15.778 -47.171  1.00 55.67  ? 441 PRO B N     1 
ATOM   6722  C  CA    . PRO F 3 145 ? 1.605   15.421 -46.806  1.00 55.27  ? 441 PRO B CA    1 
ATOM   6723  C  C     . PRO F 3 145 ? 2.662   15.871 -47.812  1.00 54.30  ? 441 PRO B C     1 
ATOM   6724  O  O     . PRO F 3 145 ? 3.679   16.449 -47.436  1.00 54.51  ? 441 PRO B O     1 
ATOM   6725  C  CB    . PRO F 3 145 ? 1.543   13.897 -46.676  1.00 55.56  ? 441 PRO B CB    1 
ATOM   6726  C  CG    . PRO F 3 145 ? 0.131   13.655 -46.237  1.00 55.67  ? 441 PRO B CG    1 
ATOM   6727  C  CD    . PRO F 3 145 ? -0.637  14.584 -47.148  1.00 55.84  ? 441 PRO B CD    1 
ATOM   6728  N  N     . VAL F 3 146 ? 2.415   15.598 -49.088  1.00 53.65  ? 442 VAL B N     1 
ATOM   6729  C  CA    . VAL F 3 146 ? 3.341   15.961 -50.154  1.00 52.51  ? 442 VAL B CA    1 
ATOM   6730  C  C     . VAL F 3 146 ? 3.439   17.471 -50.318  1.00 51.89  ? 442 VAL B C     1 
ATOM   6731  O  O     . VAL F 3 146 ? 4.529   18.019 -50.475  1.00 51.52  ? 442 VAL B O     1 
ATOM   6732  C  CB    . VAL F 3 146 ? 2.886   15.371 -51.497  1.00 52.56  ? 442 VAL B CB    1 
ATOM   6733  C  CG1   . VAL F 3 146 ? 3.914   15.671 -52.565  1.00 52.77  ? 442 VAL B CG1   1 
ATOM   6734  C  CG2   . VAL F 3 146 ? 2.668   13.876 -51.358  1.00 52.55  ? 442 VAL B CG2   1 
ATOM   6735  N  N     . LEU F 3 147 ? 2.285   18.130 -50.287  1.00 51.17  ? 443 LEU B N     1 
ATOM   6736  C  CA    . LEU F 3 147 ? 2.202   19.580 -50.447  1.00 50.46  ? 443 LEU B CA    1 
ATOM   6737  C  C     . LEU F 3 147 ? 2.764   20.336 -49.257  1.00 50.07  ? 443 LEU B C     1 
ATOM   6738  O  O     . LEU F 3 147 ? 3.394   21.381 -49.414  1.00 50.90  ? 443 LEU B O     1 
ATOM   6739  C  CB    . LEU F 3 147 ? 0.745   19.996 -50.660  1.00 50.09  ? 443 LEU B CB    1 
ATOM   6740  C  CG    . LEU F 3 147 ? 0.421   21.487 -50.536  1.00 49.86  ? 443 LEU B CG    1 
ATOM   6741  C  CD1   . LEU F 3 147 ? 1.103   22.259 -51.644  1.00 49.60  ? 443 LEU B CD1   1 
ATOM   6742  C  CD2   . LEU F 3 147 ? -1.089  21.688 -50.597  1.00 49.87  ? 443 LEU B CD2   1 
ATOM   6743  N  N     . ALA F 3 148 ? 2.532   19.807 -48.064  1.00 49.41  ? 444 ALA B N     1 
ATOM   6744  C  CA    . ALA F 3 148 ? 3.000   20.449 -46.848  1.00 48.52  ? 444 ALA B CA    1 
ATOM   6745  C  C     . ALA F 3 148 ? 4.510   20.651 -46.824  1.00 47.80  ? 444 ALA B C     1 
ATOM   6746  O  O     . ALA F 3 148 ? 4.990   21.753 -46.571  1.00 47.79  ? 444 ALA B O     1 
ATOM   6747  C  CB    . ALA F 3 148 ? 2.560   19.637 -45.637  1.00 49.01  ? 444 ALA B CB    1 
ATOM   6748  N  N     . GLU F 3 149 ? 5.264   19.592 -47.089  1.00 46.83  ? 445 GLU B N     1 
ATOM   6749  C  CA    . GLU F 3 149 ? 6.715   19.704 -47.062  1.00 45.57  ? 445 GLU B CA    1 
ATOM   6750  C  C     . GLU F 3 149 ? 7.255   20.473 -48.260  1.00 44.14  ? 445 GLU B C     1 
ATOM   6751  O  O     . GLU F 3 149 ? 8.310   21.101 -48.175  1.00 44.57  ? 445 GLU B O     1 
ATOM   6752  C  CB    . GLU F 3 149 ? 7.363   18.320 -46.999  1.00 45.65  ? 445 GLU B CB    1 
ATOM   6753  C  CG    . GLU F 3 149 ? 7.408   17.591 -48.315  1.00 46.15  ? 445 GLU B CG    1 
ATOM   6754  C  CD    . GLU F 3 149 ? 8.308   16.384 -48.246  1.00 46.84  ? 445 GLU B CD    1 
ATOM   6755  O  OE1   . GLU F 3 149 ? 9.511   16.575 -47.963  1.00 46.44  ? 445 GLU B OE1   1 
ATOM   6756  O  OE2   . GLU F 3 149 ? 7.815   15.255 -48.469  1.00 46.59  ? 445 GLU B OE2   1 
ATOM   6757  N  N     . HIS F 3 150 ? 6.538   20.417 -49.376  1.00 42.76  ? 446 HIS B N     1 
ATOM   6758  C  CA    . HIS F 3 150 ? 6.960   21.135 -50.571  1.00 41.18  ? 446 HIS B CA    1 
ATOM   6759  C  C     . HIS F 3 150 ? 6.913   22.636 -50.297  1.00 39.90  ? 446 HIS B C     1 
ATOM   6760  O  O     . HIS F 3 150 ? 7.854   23.358 -50.626  1.00 39.60  ? 446 HIS B O     1 
ATOM   6761  C  CB    . HIS F 3 150 ? 6.061   20.783 -51.759  1.00 40.75  ? 446 HIS B CB    1 
ATOM   6762  C  CG    . HIS F 3 150 ? 6.313   21.616 -52.976  1.00 40.68  ? 446 HIS B CG    1 
ATOM   6763  N  ND1   . HIS F 3 150 ? 7.579   21.856 -53.467  1.00 40.15  ? 446 HIS B ND1   1 
ATOM   6764  C  CD2   . HIS F 3 150 ? 5.459   22.264 -53.805  1.00 39.84  ? 446 HIS B CD2   1 
ATOM   6765  C  CE1   . HIS F 3 150 ? 7.493   22.617 -54.544  1.00 40.40  ? 446 HIS B CE1   1 
ATOM   6766  N  NE2   . HIS F 3 150 ? 6.218   22.877 -54.771  1.00 39.24  ? 446 HIS B NE2   1 
ATOM   6767  N  N     . LEU F 3 151 ? 5.829   23.103 -49.680  1.00 38.58  ? 447 LEU B N     1 
ATOM   6768  C  CA    . LEU F 3 151 ? 5.706   24.527 -49.365  1.00 37.06  ? 447 LEU B CA    1 
ATOM   6769  C  C     . LEU F 3 151 ? 6.686   24.922 -48.257  1.00 36.22  ? 447 LEU B C     1 
ATOM   6770  O  O     . LEU F 3 151 ? 7.225   26.030 -48.262  1.00 36.21  ? 447 LEU B O     1 
ATOM   6771  C  CB    . LEU F 3 151 ? 4.266   24.870 -48.960  1.00 37.25  ? 447 LEU B CB    1 
ATOM   6772  C  CG    . LEU F 3 151 ? 3.179   24.561 -50.001  1.00 36.83  ? 447 LEU B CG    1 
ATOM   6773  C  CD1   . LEU F 3 151 ? 1.849   25.147 -49.548  1.00 37.32  ? 447 LEU B CD1   1 
ATOM   6774  C  CD2   . LEU F 3 151 ? 3.566   25.138 -51.354  1.00 36.24  ? 447 LEU B CD2   1 
ATOM   6775  N  N     . VAL F 3 152 ? 6.933   24.007 -47.319  1.00 35.14  ? 448 VAL B N     1 
ATOM   6776  C  CA    . VAL F 3 152 ? 7.865   24.265 -46.226  1.00 33.56  ? 448 VAL B CA    1 
ATOM   6777  C  C     . VAL F 3 152 ? 9.311   24.353 -46.738  1.00 33.11  ? 448 VAL B C     1 
ATOM   6778  O  O     . VAL F 3 152 ? 10.072  25.228 -46.316  1.00 32.86  ? 448 VAL B O     1 
ATOM   6779  C  CB    . VAL F 3 152 ? 7.753   23.164 -45.128  1.00 34.35  ? 448 VAL B CB    1 
ATOM   6780  C  CG1   . VAL F 3 152 ? 8.958   23.216 -44.185  1.00 32.86  ? 448 VAL B CG1   1 
ATOM   6781  C  CG2   . VAL F 3 152 ? 6.459   23.352 -44.341  1.00 33.20  ? 448 VAL B CG2   1 
ATOM   6782  N  N     . ARG F 3 153 ? 9.696   23.453 -47.642  1.00 32.68  ? 449 ARG B N     1 
ATOM   6783  C  CA    . ARG F 3 153 ? 11.059  23.482 -48.192  1.00 31.91  ? 449 ARG B CA    1 
ATOM   6784  C  C     . ARG F 3 153 ? 11.332  24.775 -48.966  1.00 31.47  ? 449 ARG B C     1 
ATOM   6785  O  O     . ARG F 3 153 ? 12.459  25.277 -48.981  1.00 32.36  ? 449 ARG B O     1 
ATOM   6786  C  CB    . ARG F 3 153 ? 11.300  22.270 -49.093  1.00 31.92  ? 449 ARG B CB    1 
ATOM   6787  C  CG    . ARG F 3 153 ? 11.686  21.011 -48.303  1.00 31.54  ? 449 ARG B CG    1 
ATOM   6788  C  CD    . ARG F 3 153 ? 12.068  19.851 -49.202  1.00 32.36  ? 449 ARG B CD    1 
ATOM   6789  N  NE    . ARG F 3 153 ? 12.675  18.757 -48.438  1.00 32.19  ? 449 ARG B NE    1 
ATOM   6790  C  CZ    . ARG F 3 153 ? 13.956  18.707 -48.073  1.00 32.65  ? 449 ARG B CZ    1 
ATOM   6791  N  NH1   . ARG F 3 153 ? 14.782  19.689 -48.403  1.00 31.66  ? 449 ARG B NH1   1 
ATOM   6792  N  NH2   . ARG F 3 153 ? 14.414  17.668 -47.376  1.00 31.38  ? 449 ARG B NH2   1 
ATOM   6793  N  N     . LYS F 3 154 ? 10.306  25.319 -49.609  1.00 30.22  ? 450 LYS B N     1 
ATOM   6794  C  CA    . LYS F 3 154 ? 10.480  26.564 -50.350  1.00 28.98  ? 450 LYS B CA    1 
ATOM   6795  C  C     . LYS F 3 154 ? 10.713  27.693 -49.347  1.00 28.10  ? 450 LYS B C     1 
ATOM   6796  O  O     . LYS F 3 154 ? 11.511  28.602 -49.586  1.00 28.50  ? 450 LYS B O     1 
ATOM   6797  C  CB    . LYS F 3 154 ? 9.255   26.834 -51.236  1.00 28.50  ? 450 LYS B CB    1 
ATOM   6798  C  CG    . LYS F 3 154 ? 8.980   25.715 -52.247  1.00 27.96  ? 450 LYS B CG    1 
ATOM   6799  C  CD    . LYS F 3 154 ? 8.344   26.194 -53.553  1.00 27.25  ? 450 LYS B CD    1 
ATOM   6800  C  CE    . LYS F 3 154 ? 6.948   26.763 -53.373  1.00 28.60  ? 450 LYS B CE    1 
ATOM   6801  N  NZ    . LYS F 3 154 ? 5.975   25.773 -52.854  1.00 29.87  ? 450 LYS B NZ    1 
ATOM   6802  N  N     . ALA F 3 155 ? 10.039  27.618 -48.205  1.00 28.01  ? 451 ALA B N     1 
ATOM   6803  C  CA    . ALA F 3 155 ? 10.199  28.617 -47.157  1.00 27.73  ? 451 ALA B CA    1 
ATOM   6804  C  C     . ALA F 3 155 ? 11.617  28.586 -46.594  1.00 27.43  ? 451 ALA B C     1 
ATOM   6805  O  O     . ALA F 3 155 ? 12.240  29.628 -46.409  1.00 25.83  ? 451 ALA B O     1 
ATOM   6806  C  CB    . ALA F 3 155 ? 9.190   28.377 -46.044  1.00 27.32  ? 451 ALA B CB    1 
ATOM   6807  N  N     . ALA F 3 156 ? 12.127  27.382 -46.325  1.00 28.13  ? 452 ALA B N     1 
ATOM   6808  C  CA    . ALA F 3 156 ? 13.472  27.235 -45.794  1.00 27.98  ? 452 ALA B CA    1 
ATOM   6809  C  C     . ALA F 3 156 ? 14.497  27.829 -46.761  1.00 27.78  ? 452 ALA B C     1 
ATOM   6810  O  O     . ALA F 3 156 ? 15.445  28.508 -46.334  1.00 28.93  ? 452 ALA B O     1 
ATOM   6811  C  CB    . ALA F 3 156 ? 13.786  25.738 -45.521  1.00 28.09  ? 452 ALA B CB    1 
ATOM   6812  N  N     . ALA F 3 157 ? 14.320  27.576 -48.056  1.00 27.83  ? 453 ALA B N     1 
ATOM   6813  C  CA    . ALA F 3 157 ? 15.235  28.119 -49.070  1.00 27.44  ? 453 ALA B CA    1 
ATOM   6814  C  C     . ALA F 3 157 ? 15.216  29.655 -49.034  1.00 27.51  ? 453 ALA B C     1 
ATOM   6815  O  O     . ALA F 3 157 ? 16.270  30.297 -48.971  1.00 26.16  ? 453 ALA B O     1 
ATOM   6816  C  CB    . ALA F 3 157 ? 14.841  27.630 -50.454  1.00 26.81  ? 453 ALA B CB    1 
ATOM   6817  N  N     . ILE F 3 158 ? 14.012  30.227 -49.065  1.00 27.23  ? 454 ILE B N     1 
ATOM   6818  C  CA    . ILE F 3 158 ? 13.830  31.681 -49.031  1.00 28.72  ? 454 ILE B CA    1 
ATOM   6819  C  C     . ILE F 3 158 ? 14.506  32.270 -47.796  1.00 30.25  ? 454 ILE B C     1 
ATOM   6820  O  O     . ILE F 3 158 ? 15.146  33.318 -47.861  1.00 30.46  ? 454 ILE B O     1 
ATOM   6821  C  CB    . ILE F 3 158 ? 12.318  32.049 -49.021  1.00 28.35  ? 454 ILE B CB    1 
ATOM   6822  C  CG1   . ILE F 3 158 ? 11.648  31.530 -50.301  1.00 27.80  ? 454 ILE B CG1   1 
ATOM   6823  C  CG2   . ILE F 3 158 ? 12.148  33.571 -48.897  1.00 28.74  ? 454 ILE B CG2   1 
ATOM   6824  C  CD1   . ILE F 3 158 ? 10.151  31.741 -50.359  1.00 29.02  ? 454 ILE B CD1   1 
ATOM   6825  N  N     . TRP F 3 159 ? 14.390  31.564 -46.675  1.00 32.80  ? 455 TRP B N     1 
ATOM   6826  C  CA    . TRP F 3 159 ? 14.983  32.000 -45.419  1.00 34.05  ? 455 TRP B CA    1 
ATOM   6827  C  C     . TRP F 3 159 ? 16.507  31.953 -45.510  1.00 34.60  ? 455 TRP B C     1 
ATOM   6828  O  O     . TRP F 3 159 ? 17.202  32.868 -45.062  1.00 34.37  ? 455 TRP B O     1 
ATOM   6829  C  CB    . TRP F 3 159 ? 14.482  31.097 -44.287  1.00 36.58  ? 455 TRP B CB    1 
ATOM   6830  C  CG    . TRP F 3 159 ? 14.966  31.474 -42.928  1.00 38.63  ? 455 TRP B CG    1 
ATOM   6831  C  CD1   . TRP F 3 159 ? 16.087  31.017 -42.297  1.00 40.27  ? 455 TRP B CD1   1 
ATOM   6832  C  CD2   . TRP F 3 159 ? 14.335  32.379 -42.020  1.00 40.16  ? 455 TRP B CD2   1 
ATOM   6833  N  NE1   . TRP F 3 159 ? 16.190  31.578 -41.047  1.00 40.71  ? 455 TRP B NE1   1 
ATOM   6834  C  CE2   . TRP F 3 159 ? 15.128  32.420 -40.852  1.00 40.71  ? 455 TRP B CE2   1 
ATOM   6835  C  CE3   . TRP F 3 159 ? 13.175  33.162 -42.080  1.00 40.37  ? 455 TRP B CE3   1 
ATOM   6836  C  CZ2   . TRP F 3 159 ? 14.796  33.213 -39.749  1.00 40.72  ? 455 TRP B CZ2   1 
ATOM   6837  C  CZ3   . TRP F 3 159 ? 12.846  33.950 -40.983  1.00 40.87  ? 455 TRP B CZ3   1 
ATOM   6838  C  CH2   . TRP F 3 159 ? 13.658  33.968 -39.832  1.00 41.12  ? 455 TRP B CH2   1 
ATOM   6839  N  N     . GLU F 3 160 ? 17.023  30.886 -46.105  1.00 35.32  ? 456 GLU B N     1 
ATOM   6840  C  CA    . GLU F 3 160 ? 18.469  30.708 -46.260  1.00 35.73  ? 456 GLU B CA    1 
ATOM   6841  C  C     . GLU F 3 160 ? 19.074  31.540 -47.393  1.00 35.93  ? 456 GLU B C     1 
ATOM   6842  O  O     . GLU F 3 160 ? 20.189  32.062 -47.269  1.00 36.69  ? 456 GLU B O     1 
ATOM   6843  C  CB    . GLU F 3 160 ? 18.780  29.225 -46.506  1.00 36.31  ? 456 GLU B CB    1 
ATOM   6844  C  CG    . GLU F 3 160 ? 19.240  28.437 -45.275  1.00 36.97  ? 456 GLU B CG    1 
ATOM   6845  C  CD    . GLU F 3 160 ? 18.237  28.420 -44.136  1.00 37.16  ? 456 GLU B CD    1 
ATOM   6846  O  OE1   . GLU F 3 160 ? 17.089  27.940 -44.330  1.00 38.40  ? 456 GLU B OE1   1 
ATOM   6847  O  OE2   . GLU F 3 160 ? 18.606  28.882 -43.035  1.00 36.28  ? 456 GLU B OE2   1 
ATOM   6848  N  N     . LEU F 3 161 ? 18.339  31.666 -48.490  1.00 35.67  ? 457 LEU B N     1 
ATOM   6849  C  CA    . LEU F 3 161 ? 18.812  32.398 -49.666  1.00 36.46  ? 457 LEU B CA    1 
ATOM   6850  C  C     . LEU F 3 161 ? 18.683  33.919 -49.669  1.00 37.23  ? 457 LEU B C     1 
ATOM   6851  O  O     . LEU F 3 161 ? 19.355  34.584 -50.452  1.00 37.63  ? 457 LEU B O     1 
ATOM   6852  C  CB    . LEU F 3 161 ? 18.131  31.851 -50.915  1.00 35.11  ? 457 LEU B CB    1 
ATOM   6853  C  CG    . LEU F 3 161 ? 18.674  30.519 -51.420  1.00 34.99  ? 457 LEU B CG    1 
ATOM   6854  C  CD1   . LEU F 3 161 ? 17.726  29.921 -52.426  1.00 33.58  ? 457 LEU B CD1   1 
ATOM   6855  C  CD2   . LEU F 3 161 ? 20.046  30.741 -52.042  1.00 34.64  ? 457 LEU B CD2   1 
ATOM   6856  N  N     . GLU F 3 162 ? 17.833  34.485 -48.819  1.00 37.72  ? 458 GLU B N     1 
ATOM   6857  C  CA    . GLU F 3 162 ? 17.715  35.942 -48.821  1.00 38.43  ? 458 GLU B CA    1 
ATOM   6858  C  C     . GLU F 3 162 ? 19.075  36.599 -48.604  1.00 38.20  ? 458 GLU B C     1 
ATOM   6859  O  O     . GLU F 3 162 ? 19.370  37.635 -49.194  1.00 38.06  ? 458 GLU B O     1 
ATOM   6860  C  CB    . GLU F 3 162 ? 16.749  36.446 -47.742  1.00 38.01  ? 458 GLU B CB    1 
ATOM   6861  C  CG    . GLU F 3 162 ? 16.815  37.964 -47.601  1.00 39.68  ? 458 GLU B CG    1 
ATOM   6862  C  CD    . GLU F 3 162 ? 15.757  38.554 -46.687  1.00 40.75  ? 458 GLU B CD    1 
ATOM   6863  O  OE1   . GLU F 3 162 ? 15.691  39.798 -46.614  1.00 41.80  ? 458 GLU B OE1   1 
ATOM   6864  O  OE2   . GLU F 3 162 ? 14.999  37.796 -46.040  1.00 41.32  ? 458 GLU B OE2   1 
ATOM   6865  N  N     . ARG F 3 163 ? 19.906  35.991 -47.763  1.00 37.96  ? 459 ARG B N     1 
ATOM   6866  C  CA    . ARG F 3 163 ? 21.219  36.552 -47.470  1.00 37.23  ? 459 ARG B CA    1 
ATOM   6867  C  C     . ARG F 3 163 ? 22.252  36.532 -48.603  1.00 36.43  ? 459 ARG B C     1 
ATOM   6868  O  O     . ARG F 3 163 ? 22.912  37.542 -48.844  1.00 36.41  ? 459 ARG B O     1 
ATOM   6869  C  CB    . ARG F 3 163 ? 21.811  35.878 -46.234  1.00 38.45  ? 459 ARG B CB    1 
ATOM   6870  C  CG    . ARG F 3 163 ? 22.481  36.858 -45.301  1.00 39.82  ? 459 ARG B CG    1 
ATOM   6871  C  CD    . ARG F 3 163 ? 21.454  37.875 -44.793  1.00 42.49  ? 459 ARG B CD    1 
ATOM   6872  N  NE    . ARG F 3 163 ? 21.788  39.243 -45.175  1.00 43.14  ? 459 ARG B NE    1 
ATOM   6873  C  CZ    . ARG F 3 163 ? 20.980  40.283 -45.011  1.00 43.69  ? 459 ARG B CZ    1 
ATOM   6874  N  NH1   . ARG F 3 163 ? 19.776  40.118 -44.475  1.00 43.72  ? 459 ARG B NH1   1 
ATOM   6875  N  NH2   . ARG F 3 163 ? 21.385  41.494 -45.375  1.00 44.03  ? 459 ARG B NH2   1 
ATOM   6876  N  N     . PRO F 3 164 ? 22.432  35.386 -49.291  1.00 35.51  ? 460 PRO B N     1 
ATOM   6877  C  CA    . PRO F 3 164 ? 23.418  35.350 -50.381  1.00 35.13  ? 460 PRO B CA    1 
ATOM   6878  C  C     . PRO F 3 164 ? 22.989  36.181 -51.595  1.00 34.16  ? 460 PRO B C     1 
ATOM   6879  O  O     . PRO F 3 164 ? 23.813  36.558 -52.426  1.00 34.21  ? 460 PRO B O     1 
ATOM   6880  C  CB    . PRO F 3 164 ? 23.542  33.855 -50.696  1.00 35.22  ? 460 PRO B CB    1 
ATOM   6881  C  CG    . PRO F 3 164 ? 22.187  33.329 -50.370  1.00 35.30  ? 460 PRO B CG    1 
ATOM   6882  C  CD    . PRO F 3 164 ? 21.852  34.050 -49.069  1.00 35.81  ? 460 PRO B CD    1 
ATOM   6883  N  N     . PHE F 3 165 ? 21.694  36.461 -51.701  1.00 33.22  ? 461 PHE B N     1 
ATOM   6884  C  CA    . PHE F 3 165 ? 21.217  37.283 -52.806  1.00 31.60  ? 461 PHE B CA    1 
ATOM   6885  C  C     . PHE F 3 165 ? 21.516  38.758 -52.532  1.00 31.05  ? 461 PHE B C     1 
ATOM   6886  O  O     . PHE F 3 165 ? 21.918  39.480 -53.439  1.00 31.90  ? 461 PHE B O     1 
ATOM   6887  C  CB    . PHE F 3 165 ? 19.723  37.075 -53.037  1.00 30.22  ? 461 PHE B CB    1 
ATOM   6888  C  CG    . PHE F 3 165 ? 19.412  35.926 -53.956  1.00 29.50  ? 461 PHE B CG    1 
ATOM   6889  C  CD1   . PHE F 3 165 ? 19.708  34.614 -53.582  1.00 29.07  ? 461 PHE B CD1   1 
ATOM   6890  C  CD2   . PHE F 3 165 ? 18.866  36.159 -55.209  1.00 28.41  ? 461 PHE B CD2   1 
ATOM   6891  C  CE1   . PHE F 3 165 ? 19.465  33.564 -54.445  1.00 28.36  ? 461 PHE B CE1   1 
ATOM   6892  C  CE2   . PHE F 3 165 ? 18.618  35.118 -56.084  1.00 29.26  ? 461 PHE B CE2   1 
ATOM   6893  C  CZ    . PHE F 3 165 ? 18.920  33.808 -55.702  1.00 29.26  ? 461 PHE B CZ    1 
ATOM   6894  N  N     . LEU F 3 166 ? 21.335  39.203 -51.289  1.00 30.52  ? 462 LEU B N     1 
ATOM   6895  C  CA    . LEU F 3 166 ? 21.610  40.597 -50.947  1.00 29.88  ? 462 LEU B CA    1 
ATOM   6896  C  C     . LEU F 3 166 ? 23.110  40.844 -51.003  1.00 30.90  ? 462 LEU B C     1 
ATOM   6897  O  O     . LEU F 3 166 ? 23.557  41.932 -51.359  1.00 30.45  ? 462 LEU B O     1 
ATOM   6898  C  CB    . LEU F 3 166 ? 21.073  40.941 -49.548  1.00 29.42  ? 462 LEU B CB    1 
ATOM   6899  C  CG    . LEU F 3 166 ? 19.548  40.978 -49.356  1.00 29.11  ? 462 LEU B CG    1 
ATOM   6900  C  CD1   . LEU F 3 166 ? 19.224  41.361 -47.916  1.00 28.49  ? 462 LEU B CD1   1 
ATOM   6901  C  CD2   . LEU F 3 166 ? 18.921  41.986 -50.319  1.00 29.20  ? 462 LEU B CD2   1 
ATOM   6902  N  N     . ASP F 3 167 ? 23.891  39.825 -50.650  1.00 31.54  ? 463 ASP B N     1 
ATOM   6903  C  CA    . ASP F 3 167 ? 25.339  39.945 -50.680  1.00 32.29  ? 463 ASP B CA    1 
ATOM   6904  C  C     . ASP F 3 167 ? 25.789  40.261 -52.106  1.00 32.36  ? 463 ASP B C     1 
ATOM   6905  O  O     . ASP F 3 167 ? 26.577  41.187 -52.317  1.00 32.21  ? 463 ASP B O     1 
ATOM   6906  C  CB    . ASP F 3 167 ? 25.999  38.646 -50.187  1.00 33.32  ? 463 ASP B CB    1 
ATOM   6907  C  CG    . ASP F 3 167 ? 25.642  38.325 -48.746  1.00 35.76  ? 463 ASP B CG    1 
ATOM   6908  O  OD1   . ASP F 3 167 ? 26.099  37.281 -48.219  1.00 36.26  ? 463 ASP B OD1   1 
ATOM   6909  O  OD2   . ASP F 3 167 ? 24.897  39.126 -48.131  1.00 37.68  ? 463 ASP B OD2   1 
ATOM   6910  N  N     . GLU F 3 168 ? 25.279  39.508 -53.082  1.00 31.75  ? 464 GLU B N     1 
ATOM   6911  C  CA    . GLU F 3 168 ? 25.652  39.728 -54.473  1.00 32.69  ? 464 GLU B CA    1 
ATOM   6912  C  C     . GLU F 3 168 ? 24.978  40.972 -55.066  1.00 33.37  ? 464 GLU B C     1 
ATOM   6913  O  O     . GLU F 3 168 ? 25.628  41.776 -55.731  1.00 32.47  ? 464 GLU B O     1 
ATOM   6914  C  CB    . GLU F 3 168 ? 25.303  38.513 -55.335  1.00 33.69  ? 464 GLU B CB    1 
ATOM   6915  C  CG    . GLU F 3 168 ? 26.173  38.442 -56.575  1.00 34.86  ? 464 GLU B CG    1 
ATOM   6916  C  CD    . GLU F 3 168 ? 25.770  37.362 -57.534  1.00 36.03  ? 464 GLU B CD    1 
ATOM   6917  O  OE1   . GLU F 3 168 ? 25.526  36.221 -57.088  1.00 38.34  ? 464 GLU B OE1   1 
ATOM   6918  O  OE2   . GLU F 3 168 ? 25.719  37.651 -58.747  1.00 37.33  ? 464 GLU B OE2   1 
ATOM   6919  N  N     . LEU F 3 169 ? 23.678  41.129 -54.820  1.00 33.57  ? 465 LEU B N     1 
ATOM   6920  C  CA    . LEU F 3 169 ? 22.962  42.290 -55.336  1.00 34.41  ? 465 LEU B CA    1 
ATOM   6921  C  C     . LEU F 3 169 ? 23.752  43.550 -54.999  1.00 34.78  ? 465 LEU B C     1 
ATOM   6922  O  O     . LEU F 3 169 ? 23.959  44.406 -55.859  1.00 34.74  ? 465 LEU B O     1 
ATOM   6923  C  CB    . LEU F 3 169 ? 21.549  42.367 -54.737  1.00 33.94  ? 465 LEU B CB    1 
ATOM   6924  C  CG    . LEU F 3 169 ? 20.554  41.310 -55.228  1.00 33.71  ? 465 LEU B CG    1 
ATOM   6925  C  CD1   . LEU F 3 169 ? 19.208  41.475 -54.531  1.00 34.40  ? 465 LEU B CD1   1 
ATOM   6926  C  CD2   . LEU F 3 169 ? 20.380  41.453 -56.718  1.00 34.47  ? 465 LEU B CD2   1 
ATOM   6927  N  N     . ARG F 3 170 ? 24.201  43.653 -53.752  1.00 35.30  ? 466 ARG B N     1 
ATOM   6928  C  CA    . ARG F 3 170 ? 24.981  44.803 -53.330  1.00 36.18  ? 466 ARG B CA    1 
ATOM   6929  C  C     . ARG F 3 170 ? 26.317  44.832 -54.065  1.00 36.41  ? 466 ARG B C     1 
ATOM   6930  O  O     . ARG F 3 170 ? 26.745  45.884 -54.538  1.00 36.66  ? 466 ARG B O     1 
ATOM   6931  C  CB    . ARG F 3 170 ? 25.234  44.769 -51.820  1.00 37.49  ? 466 ARG B CB    1 
ATOM   6932  C  CG    . ARG F 3 170 ? 26.029  45.975 -51.337  1.00 39.59  ? 466 ARG B CG    1 
ATOM   6933  C  CD    . ARG F 3 170 ? 26.306  45.942 -49.850  1.00 41.59  ? 466 ARG B CD    1 
ATOM   6934  N  NE    . ARG F 3 170 ? 27.160  47.059 -49.442  1.00 43.38  ? 466 ARG B NE    1 
ATOM   6935  C  CZ    . ARG F 3 170 ? 26.796  48.336 -49.471  1.00 43.60  ? 466 ARG B CZ    1 
ATOM   6936  N  NH1   . ARG F 3 170 ? 25.582  48.677 -49.886  1.00 44.37  ? 466 ARG B NH1   1 
ATOM   6937  N  NH2   . ARG F 3 170 ? 27.651  49.273 -49.083  1.00 44.50  ? 466 ARG B NH2   1 
ATOM   6938  N  N     . ARG F 3 171 ? 26.987  43.686 -54.151  1.00 36.64  ? 467 ARG B N     1 
ATOM   6939  C  CA    . ARG F 3 171 ? 28.268  43.633 -54.851  1.00 36.88  ? 467 ARG B CA    1 
ATOM   6940  C  C     . ARG F 3 171 ? 28.092  44.258 -56.234  1.00 36.42  ? 467 ARG B C     1 
ATOM   6941  O  O     . ARG F 3 171 ? 28.946  45.023 -56.682  1.00 36.58  ? 467 ARG B O     1 
ATOM   6942  C  CB    . ARG F 3 171 ? 28.772  42.185 -54.969  1.00 37.36  ? 467 ARG B CB    1 
ATOM   6943  C  CG    . ARG F 3 171 ? 29.444  41.669 -53.703  1.00 38.41  ? 467 ARG B CG    1 
ATOM   6944  C  CD    . ARG F 3 171 ? 30.310  40.425 -53.957  1.00 39.14  ? 467 ARG B CD    1 
ATOM   6945  N  NE    . ARG F 3 171 ? 29.603  39.171 -53.699  1.00 39.63  ? 467 ARG B NE    1 
ATOM   6946  C  CZ    . ARG F 3 171 ? 29.249  38.743 -52.489  1.00 39.37  ? 467 ARG B CZ    1 
ATOM   6947  N  NH1   . ARG F 3 171 ? 29.532  39.464 -51.412  1.00 39.22  ? 467 ARG B NH1   1 
ATOM   6948  N  NH2   . ARG F 3 171 ? 28.614  37.586 -52.354  1.00 39.53  ? 467 ARG B NH2   1 
ATOM   6949  N  N     . ASN F 3 172 ? 26.969  43.951 -56.887  1.00 35.77  ? 468 ASN B N     1 
ATOM   6950  C  CA    . ASN F 3 172 ? 26.651  44.495 -58.210  1.00 35.20  ? 468 ASN B CA    1 
ATOM   6951  C  C     . ASN F 3 172 ? 26.169  45.939 -58.073  1.00 35.40  ? 468 ASN B C     1 
ATOM   6952  O  O     . ASN F 3 172 ? 26.036  46.660 -59.059  1.00 35.25  ? 468 ASN B O     1 
ATOM   6953  C  CB    . ASN F 3 172 ? 25.536  43.681 -58.879  1.00 34.96  ? 468 ASN B CB    1 
ATOM   6954  C  CG    . ASN F 3 172 ? 25.976  42.290 -59.277  1.00 34.65  ? 468 ASN B CG    1 
ATOM   6955  O  OD1   . ASN F 3 172 ? 27.046  41.824 -58.884  1.00 35.75  ? 468 ASN B OD1   1 
ATOM   6956  N  ND2   . ASN F 3 172 ? 25.143  41.611 -60.059  1.00 34.48  ? 468 ASN B ND2   1 
ATOM   6957  N  N     . GLU F 3 173 ? 25.906  46.352 -56.840  1.00 35.23  ? 469 GLU B N     1 
ATOM   6958  C  CA    . GLU F 3 173 ? 25.412  47.691 -56.559  1.00 35.03  ? 469 GLU B CA    1 
ATOM   6959  C  C     . GLU F 3 173 ? 23.971  47.765 -57.054  1.00 34.13  ? 469 GLU B C     1 
ATOM   6960  O  O     . GLU F 3 173 ? 23.546  48.756 -57.649  1.00 33.29  ? 469 GLU B O     1 
ATOM   6961  C  CB    . GLU F 3 173 ? 26.269  48.741 -57.264  1.00 36.59  ? 469 GLU B CB    1 
ATOM   6962  C  CG    . GLU F 3 173 ? 27.764  48.536 -57.098  1.00 38.21  ? 469 GLU B CG    1 
ATOM   6963  C  CD    . GLU F 3 173 ? 28.484  49.802 -56.698  1.00 38.85  ? 469 GLU B CD    1 
ATOM   6964  O  OE1   . GLU F 3 173 ? 28.328  50.228 -55.541  1.00 40.30  ? 469 GLU B OE1   1 
ATOM   6965  O  OE2   . GLU F 3 173 ? 29.201  50.382 -57.540  1.00 40.56  ? 469 GLU B OE2   1 
ATOM   6966  N  N     . GLN F 3 174 ? 23.233  46.689 -56.808  1.00 33.14  ? 470 GLN B N     1 
ATOM   6967  C  CA    . GLN F 3 174 ? 21.836  46.584 -57.200  1.00 32.81  ? 470 GLN B CA    1 
ATOM   6968  C  C     . GLN F 3 174 ? 20.942  46.464 -55.970  1.00 32.98  ? 470 GLN B C     1 
ATOM   6969  O  O     . GLN F 3 174 ? 19.733  46.286 -56.089  1.00 32.63  ? 470 GLN B O     1 
ATOM   6970  C  CB    . GLN F 3 174 ? 21.623  45.351 -58.078  1.00 32.44  ? 470 GLN B CB    1 
ATOM   6971  C  CG    . GLN F 3 174 ? 22.439  45.316 -59.371  1.00 30.78  ? 470 GLN B CG    1 
ATOM   6972  C  CD    . GLN F 3 174 ? 22.204  44.036 -60.151  1.00 30.99  ? 470 GLN B CD    1 
ATOM   6973  O  OE1   . GLN F 3 174 ? 22.545  42.934 -59.686  1.00 30.58  ? 470 GLN B OE1   1 
ATOM   6974  N  NE2   . GLN F 3 174 ? 21.621  44.166 -61.340  1.00 28.31  ? 470 GLN B NE2   1 
ATOM   6975  N  N     . ASP F 3 175 ? 21.533  46.551 -54.785  1.00 34.32  ? 471 ASP B N     1 
ATOM   6976  C  CA    . ASP F 3 175 ? 20.752  46.413 -53.564  1.00 35.68  ? 471 ASP B CA    1 
ATOM   6977  C  C     . ASP F 3 175 ? 19.657  47.466 -53.428  1.00 35.91  ? 471 ASP B C     1 
ATOM   6978  O  O     . ASP F 3 175 ? 18.604  47.197 -52.859  1.00 37.14  ? 471 ASP B O     1 
ATOM   6979  C  CB    . ASP F 3 175 ? 21.676  46.397 -52.337  1.00 36.18  ? 471 ASP B CB    1 
ATOM   6980  C  CG    . ASP F 3 175 ? 22.477  47.666 -52.181  1.00 36.97  ? 471 ASP B CG    1 
ATOM   6981  O  OD1   . ASP F 3 175 ? 23.202  48.063 -53.125  1.00 38.60  ? 471 ASP B OD1   1 
ATOM   6982  O  OD2   . ASP F 3 175 ? 22.397  48.263 -51.093  1.00 37.92  ? 471 ASP B OD2   1 
ATOM   6983  N  N     . ARG F 3 176 ? 19.890  48.659 -53.960  1.00 36.52  ? 472 ARG B N     1 
ATOM   6984  C  CA    . ARG F 3 176 ? 18.878  49.711 -53.903  1.00 36.67  ? 472 ARG B CA    1 
ATOM   6985  C  C     . ARG F 3 176 ? 17.786  49.455 -54.951  1.00 35.83  ? 472 ARG B C     1 
ATOM   6986  O  O     . ARG F 3 176 ? 16.625  49.802 -54.736  1.00 36.00  ? 472 ARG B O     1 
ATOM   6987  C  CB    . ARG F 3 176 ? 19.511  51.080 -54.164  1.00 38.12  ? 472 ARG B CB    1 
ATOM   6988  C  CG    . ARG F 3 176 ? 20.695  51.432 -53.279  1.00 39.74  ? 472 ARG B CG    1 
ATOM   6989  C  CD    . ARG F 3 176 ? 20.257  51.905 -51.915  1.00 41.72  ? 472 ARG B CD    1 
ATOM   6990  N  NE    . ARG F 3 176 ? 19.427  53.106 -51.986  1.00 43.72  ? 472 ARG B NE    1 
ATOM   6991  C  CZ    . ARG F 3 176 ? 19.843  54.280 -52.446  1.00 43.75  ? 472 ARG B CZ    1 
ATOM   6992  N  NH1   . ARG F 3 176 ? 21.087  54.423 -52.881  1.00 44.40  ? 472 ARG B NH1   1 
ATOM   6993  N  NH2   . ARG F 3 176 ? 19.012  55.313 -52.471  1.00 44.64  ? 472 ARG B NH2   1 
ATOM   6994  N  N     . LEU F 3 177 ? 18.156  48.850 -56.081  1.00 34.91  ? 473 LEU B N     1 
ATOM   6995  C  CA    . LEU F 3 177 ? 17.194  48.565 -57.152  1.00 33.73  ? 473 LEU B CA    1 
ATOM   6996  C  C     . LEU F 3 177 ? 16.113  47.599 -56.677  1.00 33.74  ? 473 LEU B C     1 
ATOM   6997  O  O     . LEU F 3 177 ? 14.987  47.620 -57.175  1.00 33.86  ? 473 LEU B O     1 
ATOM   6998  C  CB    . LEU F 3 177 ? 17.900  47.978 -58.392  1.00 32.43  ? 473 LEU B CB    1 
ATOM   6999  C  CG    . LEU F 3 177 ? 17.050  47.573 -59.619  1.00 31.95  ? 473 LEU B CG    1 
ATOM   7000  C  CD1   . LEU F 3 177 ? 16.313  48.773 -60.183  1.00 30.99  ? 473 LEU B CD1   1 
ATOM   7001  C  CD2   . LEU F 3 177 ? 17.934  46.991 -60.708  1.00 31.18  ? 473 LEU B CD2   1 
ATOM   7002  N  N     . LEU F 3 178 ? 16.453  46.747 -55.718  1.00 32.74  ? 474 LEU B N     1 
ATOM   7003  C  CA    . LEU F 3 178 ? 15.476  45.797 -55.202  1.00 32.92  ? 474 LEU B CA    1 
ATOM   7004  C  C     . LEU F 3 178 ? 14.638  46.347 -54.055  1.00 32.61  ? 474 LEU B C     1 
ATOM   7005  O  O     . LEU F 3 178 ? 13.421  46.213 -54.046  1.00 33.22  ? 474 LEU B O     1 
ATOM   7006  C  CB    . LEU F 3 178 ? 16.167  44.522 -54.712  1.00 32.22  ? 474 LEU B CB    1 
ATOM   7007  C  CG    . LEU F 3 178 ? 15.212  43.474 -54.133  1.00 31.78  ? 474 LEU B CG    1 
ATOM   7008  C  CD1   . LEU F 3 178 ? 14.567  42.698 -55.276  1.00 31.17  ? 474 LEU B CD1   1 
ATOM   7009  C  CD2   . LEU F 3 178 ? 15.975  42.524 -53.212  1.00 31.51  ? 474 LEU B CD2   1 
ATOM   7010  N  N     . VAL F 3 179 ? 15.300  46.954 -53.079  1.00 32.41  ? 475 VAL B N     1 
ATOM   7011  C  CA    . VAL F 3 179 ? 14.614  47.478 -51.907  1.00 32.14  ? 475 VAL B CA    1 
ATOM   7012  C  C     . VAL F 3 179 ? 13.851  48.780 -52.156  1.00 32.17  ? 475 VAL B C     1 
ATOM   7013  O  O     . VAL F 3 179 ? 12.790  49.000 -51.583  1.00 32.11  ? 475 VAL B O     1 
ATOM   7014  C  CB    . VAL F 3 179 ? 15.620  47.658 -50.751  1.00 31.58  ? 475 VAL B CB    1 
ATOM   7015  C  CG1   . VAL F 3 179 ? 14.973  48.371 -49.577  1.00 32.34  ? 475 VAL B CG1   1 
ATOM   7016  C  CG2   . VAL F 3 179 ? 16.132  46.281 -50.311  1.00 32.47  ? 475 VAL B CG2   1 
ATOM   7017  N  N     . GLU F 3 180 ? 14.376  49.626 -53.026  1.00 32.34  ? 476 GLU B N     1 
ATOM   7018  C  CA    . GLU F 3 180 ? 13.723  50.892 -53.310  1.00 33.59  ? 476 GLU B CA    1 
ATOM   7019  C  C     . GLU F 3 180 ? 12.841  50.936 -54.557  1.00 33.97  ? 476 GLU B C     1 
ATOM   7020  O  O     . GLU F 3 180 ? 11.792  51.582 -54.544  1.00 35.25  ? 476 GLU B O     1 
ATOM   7021  C  CB    . GLU F 3 180 ? 14.777  51.998 -53.376  1.00 33.29  ? 476 GLU B CB    1 
ATOM   7022  C  CG    . GLU F 3 180 ? 15.688  51.972 -52.181  1.00 34.14  ? 476 GLU B CG    1 
ATOM   7023  C  CD    . GLU F 3 180 ? 16.222  53.327 -51.812  1.00 34.37  ? 476 GLU B CD    1 
ATOM   7024  O  OE1   . GLU F 3 180 ? 16.973  53.401 -50.826  1.00 35.77  ? 476 GLU B OE1   1 
ATOM   7025  O  OE2   . GLU F 3 180 ? 15.891  54.314 -52.497  1.00 35.77  ? 476 GLU B OE2   1 
ATOM   7026  N  N     . LEU F 3 181 ? 13.230  50.248 -55.629  1.00 33.94  ? 477 LEU B N     1 
ATOM   7027  C  CA    . LEU F 3 181 ? 12.428  50.305 -56.850  1.00 32.90  ? 477 LEU B CA    1 
ATOM   7028  C  C     . LEU F 3 181 ? 11.540  49.105 -57.151  1.00 32.74  ? 477 LEU B C     1 
ATOM   7029  O  O     . LEU F 3 181 ? 10.312  49.193 -57.035  1.00 32.90  ? 477 LEU B O     1 
ATOM   7030  C  CB    . LEU F 3 181 ? 13.327  50.575 -58.050  1.00 33.45  ? 477 LEU B CB    1 
ATOM   7031  C  CG    . LEU F 3 181 ? 12.643  50.782 -59.404  1.00 33.96  ? 477 LEU B CG    1 
ATOM   7032  C  CD1   . LEU F 3 181 ? 11.764  52.023 -59.369  1.00 34.06  ? 477 LEU B CD1   1 
ATOM   7033  C  CD2   . LEU F 3 181 ? 13.711  50.915 -60.486  1.00 35.00  ? 477 LEU B CD2   1 
ATOM   7034  N  N     . GLU F 3 182 ? 12.139  47.981 -57.534  1.00 31.45  ? 478 GLU B N     1 
ATOM   7035  C  CA    . GLU F 3 182 ? 11.341  46.812 -57.877  1.00 30.55  ? 478 GLU B CA    1 
ATOM   7036  C  C     . GLU F 3 182 ? 10.363  46.329 -56.804  1.00 30.13  ? 478 GLU B C     1 
ATOM   7037  O  O     . GLU F 3 182 ? 9.215   46.014 -57.123  1.00 30.09  ? 478 GLU B O     1 
ATOM   7038  C  CB    . GLU F 3 182 ? 12.249  45.657 -58.323  1.00 31.48  ? 478 GLU B CB    1 
ATOM   7039  C  CG    . GLU F 3 182 ? 13.103  45.960 -59.566  1.00 31.41  ? 478 GLU B CG    1 
ATOM   7040  C  CD    . GLU F 3 182 ? 12.294  46.123 -60.858  1.00 31.40  ? 478 GLU B CD    1 
ATOM   7041  O  OE1   . GLU F 3 182 ? 11.046  46.146 -60.818  1.00 30.43  ? 478 GLU B OE1   1 
ATOM   7042  O  OE2   . GLU F 3 182 ? 12.922  46.227 -61.928  1.00 31.74  ? 478 GLU B OE2   1 
ATOM   7043  N  N     . GLN F 3 183 ? 10.785  46.267 -55.541  1.00 29.76  ? 479 GLN B N     1 
ATOM   7044  C  CA    . GLN F 3 183 ? 9.873   45.786 -54.505  1.00 28.53  ? 479 GLN B CA    1 
ATOM   7045  C  C     . GLN F 3 183 ? 8.715   46.762 -54.287  1.00 28.43  ? 479 GLN B C     1 
ATOM   7046  O  O     . GLN F 3 183 ? 7.557   46.356 -54.231  1.00 28.10  ? 479 GLN B O     1 
ATOM   7047  C  CB    . GLN F 3 183 ? 10.645  45.457 -53.203  1.00 28.93  ? 479 GLN B CB    1 
ATOM   7048  C  CG    . GLN F 3 183 ? 11.470  44.170 -53.369  1.00 28.93  ? 479 GLN B CG    1 
ATOM   7049  C  CD    . GLN F 3 183 ? 12.176  43.629 -52.114  1.00 30.43  ? 479 GLN B CD    1 
ATOM   7050  O  OE1   . GLN F 3 183 ? 12.793  42.564 -52.179  1.00 28.75  ? 479 GLN B OE1   1 
ATOM   7051  N  NE2   . GLN F 3 183 ? 12.097  44.349 -50.989  1.00 28.58  ? 479 GLN B NE2   1 
ATOM   7052  N  N     . PRO F 3 184 ? 9.006   48.061 -54.153  1.00 27.79  ? 480 PRO B N     1 
ATOM   7053  C  CA    . PRO F 3 184 ? 7.886   48.987 -53.966  1.00 27.08  ? 480 PRO B CA    1 
ATOM   7054  C  C     . PRO F 3 184 ? 6.994   48.960 -55.214  1.00 25.44  ? 480 PRO B C     1 
ATOM   7055  O  O     . PRO F 3 184 ? 5.760   49.011 -55.110  1.00 25.22  ? 480 PRO B O     1 
ATOM   7056  C  CB    . PRO F 3 184 ? 8.586   50.332 -53.783  1.00 27.25  ? 480 PRO B CB    1 
ATOM   7057  C  CG    . PRO F 3 184 ? 9.838   49.949 -53.075  1.00 27.62  ? 480 PRO B CG    1 
ATOM   7058  C  CD    . PRO F 3 184 ? 10.289  48.721 -53.837  1.00 28.28  ? 480 PRO B CD    1 
ATOM   7059  N  N     . LEU F 3 185 ? 7.616   48.893 -56.394  1.00 23.37  ? 481 LEU B N     1 
ATOM   7060  C  CA    . LEU F 3 185 ? 6.860   48.844 -57.638  1.00 22.53  ? 481 LEU B CA    1 
ATOM   7061  C  C     . LEU F 3 185 ? 5.969   47.620 -57.643  1.00 22.02  ? 481 LEU B C     1 
ATOM   7062  O  O     . LEU F 3 185 ? 4.897   47.643 -58.227  1.00 21.93  ? 481 LEU B O     1 
ATOM   7063  C  CB    . LEU F 3 185 ? 7.772   48.806 -58.865  1.00 21.93  ? 481 LEU B CB    1 
ATOM   7064  C  CG    . LEU F 3 185 ? 7.046   48.618 -60.201  1.00 21.70  ? 481 LEU B CG    1 
ATOM   7065  C  CD1   . LEU F 3 185 ? 6.181   49.865 -60.518  1.00 22.95  ? 481 LEU B CD1   1 
ATOM   7066  C  CD2   . LEU F 3 185 ? 8.049   48.425 -61.319  1.00 21.85  ? 481 LEU B CD2   1 
ATOM   7067  N  N     . SER F 3 186 ? 6.414   46.549 -56.984  1.00 21.73  ? 482 SER B N     1 
ATOM   7068  C  CA    . SER F 3 186 ? 5.613   45.334 -56.904  1.00 22.00  ? 482 SER B CA    1 
ATOM   7069  C  C     . SER F 3 186 ? 4.270   45.655 -56.217  1.00 22.60  ? 482 SER B C     1 
ATOM   7070  O  O     . SER F 3 186 ? 3.204   45.347 -56.745  1.00 21.65  ? 482 SER B O     1 
ATOM   7071  C  CB    . SER F 3 186 ? 6.370   44.271 -56.089  1.00 22.57  ? 482 SER B CB    1 
ATOM   7072  O  OG    . SER F 3 186 ? 5.764   43.009 -56.224  1.00 21.32  ? 482 SER B OG    1 
ATOM   7073  N  N     . SER F 3 187 ? 4.332   46.265 -55.034  1.00 23.52  ? 483 SER B N     1 
ATOM   7074  C  CA    . SER F 3 187 ? 3.116   46.614 -54.290  1.00 25.43  ? 483 SER B CA    1 
ATOM   7075  C  C     . SER F 3 187 ? 2.236   47.505 -55.167  1.00 25.54  ? 483 SER B C     1 
ATOM   7076  O  O     . SER F 3 187 ? 1.003   47.372 -55.179  1.00 25.76  ? 483 SER B O     1 
ATOM   7077  C  CB    . SER F 3 187 ? 3.463   47.366 -53.000  1.00 26.49  ? 483 SER B CB    1 
ATOM   7078  O  OG    . SER F 3 187 ? 4.360   46.619 -52.196  1.00 28.44  ? 483 SER B OG    1 
ATOM   7079  N  N     . ILE F 3 188 ? 2.879   48.397 -55.910  1.00 23.99  ? 484 ILE B N     1 
ATOM   7080  C  CA    . ILE F 3 188 ? 2.152   49.287 -56.800  1.00 25.31  ? 484 ILE B CA    1 
ATOM   7081  C  C     . ILE F 3 188 ? 1.500   48.495 -57.938  1.00 26.19  ? 484 ILE B C     1 
ATOM   7082  O  O     . ILE F 3 188 ? 0.346   48.751 -58.286  1.00 25.88  ? 484 ILE B O     1 
ATOM   7083  C  CB    . ILE F 3 188 ? 3.065   50.379 -57.378  1.00 23.50  ? 484 ILE B CB    1 
ATOM   7084  C  CG1   . ILE F 3 188 ? 3.476   51.348 -56.262  1.00 24.59  ? 484 ILE B CG1   1 
ATOM   7085  C  CG2   . ILE F 3 188 ? 2.349   51.130 -58.471  1.00 24.73  ? 484 ILE B CG2   1 
ATOM   7086  C  CD1   . ILE F 3 188 ? 4.336   52.496 -56.725  1.00 23.91  ? 484 ILE B CD1   1 
ATOM   7087  N  N     . LEU F 3 189 ? 2.218   47.520 -58.495  1.00 26.04  ? 485 LEU B N     1 
ATOM   7088  C  CA    . LEU F 3 189 ? 1.663   46.722 -59.584  1.00 26.13  ? 485 LEU B CA    1 
ATOM   7089  C  C     . LEU F 3 189 ? 0.494   45.891 -59.070  1.00 26.55  ? 485 LEU B C     1 
ATOM   7090  O  O     . LEU F 3 189 ? -0.441  45.597 -59.812  1.00 27.29  ? 485 LEU B O     1 
ATOM   7091  C  CB    . LEU F 3 189 ? 2.739   45.808 -60.181  1.00 26.19  ? 485 LEU B CB    1 
ATOM   7092  C  CG    . LEU F 3 189 ? 3.928   46.429 -60.937  1.00 26.54  ? 485 LEU B CG    1 
ATOM   7093  C  CD1   . LEU F 3 189 ? 5.074   45.428 -61.041  1.00 25.61  ? 485 LEU B CD1   1 
ATOM   7094  C  CD2   . LEU F 3 189 ? 3.479   46.867 -62.331  1.00 25.40  ? 485 LEU B CD2   1 
ATOM   7095  N  N     . ALA F 3 190 ? 0.553   45.508 -57.796  1.00 27.60  ? 486 ALA B N     1 
ATOM   7096  C  CA    . ALA F 3 190 ? -0.495  44.697 -57.188  1.00 27.94  ? 486 ALA B CA    1 
ATOM   7097  C  C     . ALA F 3 190 ? -1.758  45.514 -56.969  1.00 27.97  ? 486 ALA B C     1 
ATOM   7098  O  O     . ALA F 3 190 ? -2.868  44.987 -57.054  1.00 27.33  ? 486 ALA B O     1 
ATOM   7099  C  CB    . ALA F 3 190 ? -0.023  44.122 -55.874  1.00 27.36  ? 486 ALA B CB    1 
ATOM   7100  N  N     . GLU F 3 191 ? -1.589  46.796 -56.667  1.00 28.59  ? 487 GLU B N     1 
ATOM   7101  C  CA    . GLU F 3 191 ? -2.737  47.670 -56.471  1.00 29.54  ? 487 GLU B CA    1 
ATOM   7102  C  C     . GLU F 3 191 ? -3.435  47.862 -57.814  1.00 30.00  ? 487 GLU B C     1 
ATOM   7103  O  O     . GLU F 3 191 ? -4.662  47.784 -57.898  1.00 30.81  ? 487 GLU B O     1 
ATOM   7104  C  CB    . GLU F 3 191 ? -2.298  49.021 -55.881  1.00 30.21  ? 487 GLU B CB    1 
ATOM   7105  C  CG    . GLU F 3 191 ? -1.598  48.886 -54.534  1.00 32.18  ? 487 GLU B CG    1 
ATOM   7106  C  CD    . GLU F 3 191 ? -1.478  50.197 -53.759  1.00 34.79  ? 487 GLU B CD    1 
ATOM   7107  O  OE1   . GLU F 3 191 ? -1.073  51.232 -54.350  1.00 35.68  ? 487 GLU B OE1   1 
ATOM   7108  O  OE2   . GLU F 3 191 ? -1.784  50.182 -52.544  1.00 35.77  ? 487 GLU B OE2   1 
ATOM   7109  N  N     . MET F 3 192 ? -2.655  48.078 -58.871  1.00 30.52  ? 488 MET B N     1 
ATOM   7110  C  CA    . MET F 3 192 ? -3.219  48.273 -60.211  1.00 31.21  ? 488 MET B CA    1 
ATOM   7111  C  C     . MET F 3 192 ? -3.926  47.035 -60.757  1.00 32.24  ? 488 MET B C     1 
ATOM   7112  O  O     . MET F 3 192 ? -5.047  47.123 -61.270  1.00 31.88  ? 488 MET B O     1 
ATOM   7113  C  CB    . MET F 3 192 ? -2.132  48.678 -61.187  1.00 31.18  ? 488 MET B CB    1 
ATOM   7114  C  CG    . MET F 3 192 ? -1.464  49.983 -60.840  1.00 31.69  ? 488 MET B CG    1 
ATOM   7115  S  SD    . MET F 3 192 ? 0.006   50.205 -61.828  1.00 31.46  ? 488 MET B SD    1 
ATOM   7116  C  CE    . MET F 3 192 ? -0.671  50.422 -63.439  1.00 31.43  ? 488 MET B CE    1 
ATOM   7117  N  N     . GLU F 3 193 ? -3.269  45.881 -60.653  1.00 32.75  ? 489 GLU B N     1 
ATOM   7118  C  CA    . GLU F 3 193 ? -3.856  44.639 -61.145  1.00 32.56  ? 489 GLU B CA    1 
ATOM   7119  C  C     . GLU F 3 193 ? -5.156  44.349 -60.421  1.00 33.26  ? 489 GLU B C     1 
ATOM   7120  O  O     . GLU F 3 193 ? -6.070  43.766 -60.998  1.00 34.19  ? 489 GLU B O     1 
ATOM   7121  C  CB    . GLU F 3 193 ? -2.901  43.459 -60.936  1.00 31.91  ? 489 GLU B CB    1 
ATOM   7122  C  CG    . GLU F 3 193 ? -1.592  43.524 -61.718  1.00 31.33  ? 489 GLU B CG    1 
ATOM   7123  C  CD    . GLU F 3 193 ? -0.690  42.340 -61.390  1.00 32.13  ? 489 GLU B CD    1 
ATOM   7124  O  OE1   . GLU F 3 193 ? 0.489   42.322 -61.816  1.00 31.47  ? 489 GLU B OE1   1 
ATOM   7125  O  OE2   . GLU F 3 193 ? -1.182  41.426 -60.700  1.00 30.96  ? 489 GLU B OE2   1 
ATOM   7126  N  N     . PHE F 3 194 ? -5.237  44.732 -59.150  1.00 34.22  ? 490 PHE B N     1 
ATOM   7127  C  CA    . PHE F 3 194 ? -6.453  44.487 -58.373  1.00 35.68  ? 490 PHE B CA    1 
ATOM   7128  C  C     . PHE F 3 194 ? -7.562  45.440 -58.812  1.00 36.45  ? 490 PHE B C     1 
ATOM   7129  O  O     . PHE F 3 194 ? -8.661  45.006 -59.153  1.00 37.23  ? 490 PHE B O     1 
ATOM   7130  C  CB    . PHE F 3 194 ? -6.176  44.640 -56.865  1.00 35.44  ? 490 PHE B CB    1 
ATOM   7131  C  CG    . PHE F 3 194 ? -7.361  44.303 -55.981  1.00 35.77  ? 490 PHE B CG    1 
ATOM   7132  C  CD1   . PHE F 3 194 ? -8.186  43.214 -56.272  1.00 36.21  ? 490 PHE B CD1   1 
ATOM   7133  C  CD2   . PHE F 3 194 ? -7.624  45.045 -54.833  1.00 35.74  ? 490 PHE B CD2   1 
ATOM   7134  C  CE1   . PHE F 3 194 ? -9.251  42.873 -55.429  1.00 36.20  ? 490 PHE B CE1   1 
ATOM   7135  C  CE2   . PHE F 3 194 ? -8.684  44.711 -53.982  1.00 35.46  ? 490 PHE B CE2   1 
ATOM   7136  C  CZ    . PHE F 3 194 ? -9.497  43.626 -54.279  1.00 36.06  ? 490 PHE B CZ    1 
ATOM   7137  N  N     . ALA F 3 195 ? -7.266  46.735 -58.810  1.00 37.58  ? 491 ALA B N     1 
ATOM   7138  C  CA    . ALA F 3 195 ? -8.244  47.744 -59.217  1.00 38.11  ? 491 ALA B CA    1 
ATOM   7139  C  C     . ALA F 3 195 ? -8.955  47.301 -60.483  1.00 38.53  ? 491 ALA B C     1 
ATOM   7140  O  O     . ALA F 3 195 ? -10.187 47.212 -60.521  1.00 38.42  ? 491 ALA B O     1 
ATOM   7141  C  CB    . ALA F 3 195 ? -7.556  49.069 -59.457  1.00 37.64  ? 491 ALA B CB    1 
ATOM   7142  N  N     . GLY F 3 196 ? -8.161  47.027 -61.515  1.00 38.83  ? 492 GLY B N     1 
ATOM   7143  C  CA    . GLY F 3 196 ? -8.703  46.595 -62.785  1.00 39.27  ? 492 GLY B CA    1 
ATOM   7144  C  C     . GLY F 3 196 ? -9.198  47.745 -63.638  1.00 40.00  ? 492 GLY B C     1 
ATOM   7145  O  O     . GLY F 3 196 ? -9.116  48.917 -63.258  1.00 39.71  ? 492 GLY B O     1 
ATOM   7146  N  N     . VAL F 3 197 ? -9.704  47.402 -64.813  1.00 40.69  ? 493 VAL B N     1 
ATOM   7147  C  CA    . VAL F 3 197 ? -10.230 48.392 -65.741  1.00 41.33  ? 493 VAL B CA    1 
ATOM   7148  C  C     . VAL F 3 197 ? -11.647 47.988 -66.114  1.00 41.80  ? 493 VAL B C     1 
ATOM   7149  O  O     . VAL F 3 197 ? -11.879 46.888 -66.624  1.00 41.98  ? 493 VAL B O     1 
ATOM   7150  C  CB    . VAL F 3 197 ? -9.360  48.480 -67.019  1.00 41.39  ? 493 VAL B CB    1 
ATOM   7151  C  CG1   . VAL F 3 197 ? -10.016 49.397 -68.055  1.00 41.65  ? 493 VAL B CG1   1 
ATOM   7152  C  CG2   . VAL F 3 197 ? -7.983  49.009 -66.659  1.00 40.89  ? 493 VAL B CG2   1 
ATOM   7153  N  N     . LYS F 3 198 ? -12.599 48.871 -65.829  1.00 42.98  ? 494 LYS B N     1 
ATOM   7154  C  CA    . LYS F 3 198 ? -13.992 48.610 -66.158  1.00 43.67  ? 494 LYS B CA    1 
ATOM   7155  C  C     . LYS F 3 198 ? -14.118 48.720 -67.667  1.00 44.53  ? 494 LYS B C     1 
ATOM   7156  O  O     . LYS F 3 198 ? -13.620 49.667 -68.275  1.00 44.53  ? 494 LYS B O     1 
ATOM   7157  C  CB    . LYS F 3 198 ? -14.911 49.634 -65.492  1.00 43.55  ? 494 LYS B CB    1 
ATOM   7158  C  CG    . LYS F 3 198 ? -16.370 49.446 -65.830  1.00 43.30  ? 494 LYS B CG    1 
ATOM   7159  C  CD    . LYS F 3 198 ? -17.246 50.473 -65.150  1.00 43.50  ? 494 LYS B CD    1 
ATOM   7160  C  CE    . LYS F 3 198 ? -18.709 50.242 -65.507  1.00 43.36  ? 494 LYS B CE    1 
ATOM   7161  N  NZ    . LYS F 3 198 ? -19.598 51.332 -65.010  1.00 44.35  ? 494 LYS B NZ    1 
ATOM   7162  N  N     . VAL F 3 199 ? -14.772 47.741 -68.273  1.00 45.69  ? 495 VAL B N     1 
ATOM   7163  C  CA    . VAL F 3 199 ? -14.949 47.739 -69.715  1.00 46.83  ? 495 VAL B CA    1 
ATOM   7164  C  C     . VAL F 3 199 ? -16.426 47.955 -70.001  1.00 47.65  ? 495 VAL B C     1 
ATOM   7165  O  O     . VAL F 3 199 ? -17.230 48.047 -69.081  1.00 47.48  ? 495 VAL B O     1 
ATOM   7166  C  CB    . VAL F 3 199 ? -14.494 46.392 -70.322  1.00 46.79  ? 495 VAL B CB    1 
ATOM   7167  C  CG1   . VAL F 3 199 ? -14.411 46.492 -71.833  1.00 46.67  ? 495 VAL B CG1   1 
ATOM   7168  C  CG2   . VAL F 3 199 ? -13.144 45.999 -69.746  1.00 46.85  ? 495 VAL B CG2   1 
ATOM   7169  N  N     . ASP F 3 200 ? -16.770 48.048 -71.280  1.00 49.16  ? 496 ASP B N     1 
ATOM   7170  C  CA    . ASP F 3 200 ? -18.148 48.230 -71.708  1.00 50.03  ? 496 ASP B CA    1 
ATOM   7171  C  C     . ASP F 3 200 ? -18.428 47.086 -72.676  1.00 50.78  ? 496 ASP B C     1 
ATOM   7172  O  O     . ASP F 3 200 ? -18.232 47.215 -73.885  1.00 50.83  ? 496 ASP B O     1 
ATOM   7173  C  CB    . ASP F 3 200 ? -18.307 49.572 -72.421  1.00 50.61  ? 496 ASP B CB    1 
ATOM   7174  C  CG    . ASP F 3 200 ? -19.752 49.990 -72.550  1.00 50.45  ? 496 ASP B CG    1 
ATOM   7175  O  OD1   . ASP F 3 200 ? -20.561 49.187 -73.050  1.00 50.89  ? 496 ASP B OD1   1 
ATOM   7176  O  OD2   . ASP F 3 200 ? -20.077 51.128 -72.154  1.00 51.50  ? 496 ASP B OD2   1 
ATOM   7177  N  N     . THR F 3 201 ? -18.869 45.958 -72.134  1.00 51.64  ? 497 THR B N     1 
ATOM   7178  C  CA    . THR F 3 201 ? -19.149 44.784 -72.948  1.00 52.21  ? 497 THR B CA    1 
ATOM   7179  C  C     . THR F 3 201 ? -20.130 45.060 -74.081  1.00 52.46  ? 497 THR B C     1 
ATOM   7180  O  O     . THR F 3 201 ? -19.851 44.741 -75.236  1.00 52.11  ? 497 THR B O     1 
ATOM   7181  C  CB    . THR F 3 201 ? -19.686 43.631 -72.082  1.00 52.26  ? 497 THR B CB    1 
ATOM   7182  O  OG1   . THR F 3 201 ? -20.915 44.025 -71.462  1.00 52.72  ? 497 THR B OG1   1 
ATOM   7183  C  CG2   . THR F 3 201 ? -18.675 43.274 -71.007  1.00 52.34  ? 497 THR B CG2   1 
ATOM   7184  N  N     . LYS F 3 202 ? -21.272 45.657 -73.749  1.00 53.37  ? 498 LYS B N     1 
ATOM   7185  C  CA    . LYS F 3 202 ? -22.295 45.970 -74.745  1.00 53.90  ? 498 LYS B CA    1 
ATOM   7186  C  C     . LYS F 3 202 ? -21.708 46.648 -75.978  1.00 54.37  ? 498 LYS B C     1 
ATOM   7187  O  O     . LYS F 3 202 ? -22.125 46.370 -77.100  1.00 54.56  ? 498 LYS B O     1 
ATOM   7188  C  CB    . LYS F 3 202 ? -23.379 46.857 -74.130  1.00 54.11  ? 498 LYS B CB    1 
ATOM   7189  C  CG    . LYS F 3 202 ? -24.100 46.218 -72.952  1.00 54.83  ? 498 LYS B CG    1 
ATOM   7190  C  CD    . LYS F 3 202 ? -25.201 47.121 -72.405  1.00 55.13  ? 498 LYS B CD    1 
ATOM   7191  C  CE    . LYS F 3 202 ? -25.907 46.470 -71.221  1.00 55.14  ? 498 LYS B CE    1 
ATOM   7192  N  NZ    . LYS F 3 202 ? -26.973 47.340 -70.643  1.00 55.05  ? 498 LYS B NZ    1 
ATOM   7193  N  N     . ARG F 3 203 ? -20.741 47.535 -75.768  1.00 54.72  ? 499 ARG B N     1 
ATOM   7194  C  CA    . ARG F 3 203 ? -20.100 48.234 -76.875  1.00 55.66  ? 499 ARG B CA    1 
ATOM   7195  C  C     . ARG F 3 203 ? -19.198 47.292 -77.670  1.00 56.14  ? 499 ARG B C     1 
ATOM   7196  O  O     . ARG F 3 203 ? -19.050 47.439 -78.885  1.00 55.80  ? 499 ARG B O     1 
ATOM   7197  C  CB    . ARG F 3 203 ? -19.271 49.407 -76.353  1.00 55.79  ? 499 ARG B CB    1 
ATOM   7198  C  CG    . ARG F 3 203 ? -18.427 50.081 -77.423  1.00 56.39  ? 499 ARG B CG    1 
ATOM   7199  C  CD    . ARG F 3 203 ? -17.594 51.218 -76.851  1.00 56.71  ? 499 ARG B CD    1 
ATOM   7200  N  NE    . ARG F 3 203 ? -18.121 52.536 -77.197  1.00 57.21  ? 499 ARG B NE    1 
ATOM   7201  C  CZ    . ARG F 3 203 ? -19.335 52.974 -76.877  1.00 57.31  ? 499 ARG B CZ    1 
ATOM   7202  N  NH1   . ARG F 3 203 ? -20.168 52.200 -76.195  1.00 57.35  ? 499 ARG B NH1   1 
ATOM   7203  N  NH2   . ARG F 3 203 ? -19.716 54.191 -77.240  1.00 57.18  ? 499 ARG B NH2   1 
ATOM   7204  N  N     . LEU F 3 204 ? -18.595 46.329 -76.974  1.00 56.68  ? 500 LEU B N     1 
ATOM   7205  C  CA    . LEU F 3 204 ? -17.708 45.358 -77.606  1.00 57.22  ? 500 LEU B CA    1 
ATOM   7206  C  C     . LEU F 3 204 ? -18.486 44.376 -78.469  1.00 57.59  ? 500 LEU B C     1 
ATOM   7207  O  O     . LEU F 3 204 ? -18.006 43.951 -79.518  1.00 57.54  ? 500 LEU B O     1 
ATOM   7208  C  CB    . LEU F 3 204 ? -16.913 44.591 -76.546  1.00 57.21  ? 500 LEU B CB    1 
ATOM   7209  C  CG    . LEU F 3 204 ? -15.831 45.363 -75.786  1.00 57.07  ? 500 LEU B CG    1 
ATOM   7210  C  CD1   . LEU F 3 204 ? -15.280 44.484 -74.677  1.00 57.20  ? 500 LEU B CD1   1 
ATOM   7211  C  CD2   . LEU F 3 204 ? -14.715 45.782 -76.737  1.00 57.04  ? 500 LEU B CD2   1 
ATOM   7212  N  N     . GLU F 3 205 ? -19.684 44.015 -78.018  1.00 58.34  ? 501 GLU B N     1 
ATOM   7213  C  CA    . GLU F 3 205 ? -20.543 43.090 -78.754  1.00 59.10  ? 501 GLU B CA    1 
ATOM   7214  C  C     . GLU F 3 205 ? -21.042 43.798 -80.007  1.00 59.82  ? 501 GLU B C     1 
ATOM   7215  O  O     . GLU F 3 205 ? -21.199 43.189 -81.066  1.00 60.30  ? 501 GLU B O     1 
ATOM   7216  C  CB    . GLU F 3 205 ? -21.734 42.675 -77.894  1.00 58.80  ? 501 GLU B CB    1 
ATOM   7217  C  CG    . GLU F 3 205 ? -21.351 42.289 -76.483  1.00 58.85  ? 501 GLU B CG    1 
ATOM   7218  C  CD    . GLU F 3 205 ? -22.501 41.682 -75.716  1.00 58.76  ? 501 GLU B CD    1 
ATOM   7219  O  OE1   . GLU F 3 205 ? -23.618 42.239 -75.782  1.00 58.78  ? 501 GLU B OE1   1 
ATOM   7220  O  OE2   . GLU F 3 205 ? -22.283 40.653 -75.042  1.00 59.13  ? 501 GLU B OE2   1 
ATOM   7221  N  N     . GLN F 3 206 ? -21.298 45.093 -79.863  1.00 60.44  ? 502 GLN B N     1 
ATOM   7222  C  CA    . GLN F 3 206 ? -21.754 45.930 -80.963  1.00 60.92  ? 502 GLN B CA    1 
ATOM   7223  C  C     . GLN F 3 206 ? -20.749 45.779 -82.096  1.00 61.37  ? 502 GLN B C     1 
ATOM   7224  O  O     . GLN F 3 206 ? -21.045 45.194 -83.141  1.00 61.23  ? 502 GLN B O     1 
ATOM   7225  C  CB    . GLN F 3 206 ? -21.795 47.385 -80.505  1.00 61.24  ? 502 GLN B CB    1 
ATOM   7226  C  CG    . GLN F 3 206 ? -21.989 48.402 -81.603  1.00 61.42  ? 502 GLN B CG    1 
ATOM   7227  C  CD    . GLN F 3 206 ? -21.419 49.753 -81.223  1.00 61.69  ? 502 GLN B CD    1 
ATOM   7228  O  OE1   . GLN F 3 206 ? -20.201 49.923 -81.148  1.00 61.67  ? 502 GLN B OE1   1 
ATOM   7229  N  NE2   . GLN F 3 206 ? -22.296 50.719 -80.969  1.00 61.98  ? 502 GLN B NE2   1 
ATOM   7230  N  N     . MET F 3 207 ? -19.549 46.304 -81.871  1.00 61.76  ? 503 MET B N     1 
ATOM   7231  C  CA    . MET F 3 207 ? -18.487 46.229 -82.859  1.00 62.00  ? 503 MET B CA    1 
ATOM   7232  C  C     . MET F 3 207 ? -18.274 44.768 -83.243  1.00 62.27  ? 503 MET B C     1 
ATOM   7233  O  O     . MET F 3 207 ? -17.815 44.462 -84.345  1.00 62.14  ? 503 MET B O     1 
ATOM   7234  C  CB    . MET F 3 207 ? -17.194 46.819 -82.285  1.00 62.09  ? 503 MET B CB    1 
ATOM   7235  C  CG    . MET F 3 207 ? -17.358 48.213 -81.685  1.00 62.81  ? 503 MET B CG    1 
ATOM   7236  S  SD    . MET F 3 207 ? -15.794 48.974 -81.171  1.00 63.63  ? 503 MET B SD    1 
ATOM   7237  C  CE    . MET F 3 207 ? -15.436 48.035 -79.697  1.00 63.56  ? 503 MET B CE    1 
ATOM   7238  N  N     . GLY F 3 208 ? -18.622 43.871 -82.326  1.00 62.48  ? 504 GLY B N     1 
ATOM   7239  C  CA    . GLY F 3 208 ? -18.459 42.452 -82.571  1.00 62.99  ? 504 GLY B CA    1 
ATOM   7240  C  C     . GLY F 3 208 ? -19.272 41.931 -83.742  1.00 63.53  ? 504 GLY B C     1 
ATOM   7241  O  O     . GLY F 3 208 ? -18.707 41.454 -84.730  1.00 63.49  ? 504 GLY B O     1 
ATOM   7242  N  N     . LYS F 3 209 ? -20.598 42.017 -83.634  1.00 63.77  ? 505 LYS B N     1 
ATOM   7243  C  CA    . LYS F 3 209 ? -21.486 41.542 -84.692  1.00 64.01  ? 505 LYS B CA    1 
ATOM   7244  C  C     . LYS F 3 209 ? -21.255 42.273 -86.010  1.00 64.38  ? 505 LYS B C     1 
ATOM   7245  O  O     . LYS F 3 209 ? -21.535 41.738 -87.084  1.00 64.39  ? 505 LYS B O     1 
ATOM   7246  C  CB    . LYS F 3 209 ? -22.952 41.689 -84.270  1.00 63.82  ? 505 LYS B CB    1 
ATOM   7247  C  CG    . LYS F 3 209 ? -23.360 40.788 -83.109  1.00 63.72  ? 505 LYS B CG    1 
ATOM   7248  C  CD    . LYS F 3 209 ? -24.873 40.752 -82.943  1.00 63.50  ? 505 LYS B CD    1 
ATOM   7249  C  CE    . LYS F 3 209 ? -25.300 39.843 -81.798  1.00 63.04  ? 505 LYS B CE    1 
ATOM   7250  N  NZ    . LYS F 3 209 ? -24.866 40.362 -80.470  1.00 63.04  ? 505 LYS B NZ    1 
ATOM   7251  N  N     . GLU F 3 210 ? -20.749 43.498 -85.926  1.00 64.57  ? 506 GLU B N     1 
ATOM   7252  C  CA    . GLU F 3 210 ? -20.472 44.280 -87.122  1.00 65.12  ? 506 GLU B CA    1 
ATOM   7253  C  C     . GLU F 3 210 ? -19.276 43.683 -87.861  1.00 65.23  ? 506 GLU B C     1 
ATOM   7254  O  O     . GLU F 3 210 ? -19.316 43.494 -89.078  1.00 65.37  ? 506 GLU B O     1 
ATOM   7255  C  CB    . GLU F 3 210 ? -20.199 45.740 -86.746  1.00 65.34  ? 506 GLU B CB    1 
ATOM   7256  C  CG    . GLU F 3 210 ? -21.414 46.448 -86.159  1.00 65.71  ? 506 GLU B CG    1 
ATOM   7257  C  CD    . GLU F 3 210 ? -21.118 47.866 -85.708  1.00 66.02  ? 506 GLU B CD    1 
ATOM   7258  O  OE1   . GLU F 3 210 ? -22.041 48.526 -85.181  1.00 66.18  ? 506 GLU B OE1   1 
ATOM   7259  O  OE2   . GLU F 3 210 ? -19.967 48.320 -85.878  1.00 66.35  ? 506 GLU B OE2   1 
ATOM   7260  N  N     . LEU F 3 211 ? -18.214 43.378 -87.122  1.00 65.44  ? 507 LEU B N     1 
ATOM   7261  C  CA    . LEU F 3 211 ? -17.021 42.789 -87.722  1.00 65.59  ? 507 LEU B CA    1 
ATOM   7262  C  C     . LEU F 3 211 ? -17.292 41.336 -88.111  1.00 65.91  ? 507 LEU B C     1 
ATOM   7263  O  O     . LEU F 3 211 ? -16.488 40.709 -88.801  1.00 66.00  ? 507 LEU B O     1 
ATOM   7264  C  CB    . LEU F 3 211 ? -15.843 42.847 -86.744  1.00 65.11  ? 507 LEU B CB    1 
ATOM   7265  C  CG    . LEU F 3 211 ? -15.283 44.226 -86.382  1.00 64.97  ? 507 LEU B CG    1 
ATOM   7266  C  CD1   . LEU F 3 211 ? -14.170 44.073 -85.366  1.00 64.71  ? 507 LEU B CD1   1 
ATOM   7267  C  CD2   . LEU F 3 211 ? -14.766 44.921 -87.630  1.00 64.80  ? 507 LEU B CD2   1 
ATOM   7268  N  N     . ALA F 3 212 ? -18.434 40.813 -87.669  1.00 66.24  ? 508 ALA B N     1 
ATOM   7269  C  CA    . ALA F 3 212 ? -18.819 39.433 -87.952  1.00 66.53  ? 508 ALA B CA    1 
ATOM   7270  C  C     . ALA F 3 212 ? -19.452 39.274 -89.333  1.00 66.87  ? 508 ALA B C     1 
ATOM   7271  O  O     . ALA F 3 212 ? -18.933 38.550 -90.185  1.00 66.73  ? 508 ALA B O     1 
ATOM   7272  C  CB    . ALA F 3 212 ? -19.783 38.937 -86.880  1.00 66.35  ? 508 ALA B CB    1 
ATOM   7273  N  N     . GLU F 3 213 ? -20.577 39.955 -89.539  1.00 67.40  ? 509 GLU B N     1 
ATOM   7274  C  CA    . GLU F 3 213 ? -21.313 39.911 -90.801  1.00 67.69  ? 509 GLU B CA    1 
ATOM   7275  C  C     . GLU F 3 213 ? -20.496 40.470 -91.960  1.00 67.78  ? 509 GLU B C     1 
ATOM   7276  O  O     . GLU F 3 213 ? -20.921 40.406 -93.116  1.00 68.03  ? 509 GLU B O     1 
ATOM   7277  C  CB    . GLU F 3 213 ? -22.609 40.713 -90.676  1.00 67.85  ? 509 GLU B CB    1 
ATOM   7278  C  CG    . GLU F 3 213 ? -22.375 42.179 -90.341  1.00 68.55  ? 509 GLU B CG    1 
ATOM   7279  C  CD    . GLU F 3 213 ? -23.645 43.006 -90.376  1.00 68.82  ? 509 GLU B CD    1 
ATOM   7280  O  OE1   . GLU F 3 213 ? -23.589 44.194 -89.986  1.00 68.64  ? 509 GLU B OE1   1 
ATOM   7281  O  OE2   . GLU F 3 213 ? -24.694 42.471 -90.798  1.00 69.10  ? 509 GLU B OE2   1 
ATOM   7282  N  N     . GLN F 3 214 ? -19.328 41.021 -91.643  1.00 67.67  ? 510 GLN B N     1 
ATOM   7283  C  CA    . GLN F 3 214 ? -18.451 41.599 -92.652  1.00 67.53  ? 510 GLN B CA    1 
ATOM   7284  C  C     . GLN F 3 214 ? -17.344 40.624 -93.049  1.00 67.82  ? 510 GLN B C     1 
ATOM   7285  O  O     . GLN F 3 214 ? -17.075 40.431 -94.236  1.00 67.79  ? 510 GLN B O     1 
ATOM   7286  C  CB    . GLN F 3 214 ? -17.831 42.894 -92.124  1.00 67.05  ? 510 GLN B CB    1 
ATOM   7287  C  CG    . GLN F 3 214 ? -17.111 43.717 -93.179  1.00 66.69  ? 510 GLN B CG    1 
ATOM   7288  C  CD    . GLN F 3 214 ? -16.554 45.014 -92.625  1.00 66.30  ? 510 GLN B CD    1 
ATOM   7289  O  OE1   . GLN F 3 214 ? -17.014 45.509 -91.597  1.00 65.96  ? 510 GLN B OE1   1 
ATOM   7290  N  NE2   . GLN F 3 214 ? -15.570 45.582 -93.317  1.00 66.11  ? 510 GLN B NE2   1 
ATOM   7291  N  N     . LEU F 3 215 ? -16.704 40.012 -92.054  1.00 68.04  ? 511 LEU B N     1 
ATOM   7292  C  CA    . LEU F 3 215 ? -15.625 39.057 -92.302  1.00 68.34  ? 511 LEU B CA    1 
ATOM   7293  C  C     . LEU F 3 215 ? -16.047 37.882 -93.191  1.00 68.84  ? 511 LEU B C     1 
ATOM   7294  O  O     . LEU F 3 215 ? -15.200 37.133 -93.689  1.00 68.72  ? 511 LEU B O     1 
ATOM   7295  C  CB    . LEU F 3 215 ? -15.067 38.534 -90.973  1.00 68.08  ? 511 LEU B CB    1 
ATOM   7296  C  CG    . LEU F 3 215 ? -13.961 39.378 -90.328  1.00 67.76  ? 511 LEU B CG    1 
ATOM   7297  C  CD1   . LEU F 3 215 ? -13.707 38.920 -88.901  1.00 67.56  ? 511 LEU B CD1   1 
ATOM   7298  C  CD2   . LEU F 3 215 ? -12.696 39.262 -91.166  1.00 67.57  ? 511 LEU B CD2   1 
ATOM   7299  N  N     . GLY F 3 216 ? -17.354 37.721 -93.381  1.00 69.11  ? 512 GLY B N     1 
ATOM   7300  C  CA    . GLY F 3 216 ? -17.850 36.652 -94.228  1.00 69.70  ? 512 GLY B CA    1 
ATOM   7301  C  C     . GLY F 3 216 ? -18.036 37.184 -95.637  1.00 70.06  ? 512 GLY B C     1 
ATOM   7302  O  O     . GLY F 3 216 ? -17.930 36.451 -96.619  1.00 69.84  ? 512 GLY B O     1 
ATOM   7303  N  N     . THR F 3 217 ? -18.311 38.481 -95.723  1.00 70.55  ? 513 THR B N     1 
ATOM   7304  C  CA    . THR F 3 217 ? -18.513 39.153 -96.997  1.00 71.17  ? 513 THR B CA    1 
ATOM   7305  C  C     . THR F 3 217 ? -17.168 39.401 -97.674  1.00 71.85  ? 513 THR B C     1 
ATOM   7306  O  O     . THR F 3 217 ? -17.066 39.388 -98.903  1.00 71.89  ? 513 THR B O     1 
ATOM   7307  C  CB    . THR F 3 217 ? -19.223 40.505 -96.793  1.00 70.98  ? 513 THR B CB    1 
ATOM   7308  O  OG1   . THR F 3 217 ? -20.453 40.297 -96.085  1.00 71.04  ? 513 THR B OG1   1 
ATOM   7309  C  CG2   . THR F 3 217 ? -19.516 41.163 -98.135  1.00 70.76  ? 513 THR B CG2   1 
ATOM   7310  N  N     . VAL F 3 218 ? -16.139 39.628 -96.863  1.00 72.57  ? 514 VAL B N     1 
ATOM   7311  C  CA    . VAL F 3 218 ? -14.797 39.880 -97.375  1.00 73.29  ? 514 VAL B CA    1 
ATOM   7312  C  C     . VAL F 3 218 ? -14.131 38.575 -97.802  1.00 73.97  ? 514 VAL B C     1 
ATOM   7313  O  O     . VAL F 3 218 ? -13.333 38.552 -98.738  1.00 73.99  ? 514 VAL B O     1 
ATOM   7314  C  CB    . VAL F 3 218 ? -13.912 40.562 -96.307  1.00 73.27  ? 514 VAL B CB    1 
ATOM   7315  C  CG1   . VAL F 3 218 ? -12.541 40.895 -96.893  1.00 73.02  ? 514 VAL B CG1   1 
ATOM   7316  C  CG2   . VAL F 3 218 ? -14.600 41.818 -95.791  1.00 73.28  ? 514 VAL B CG2   1 
ATOM   7317  N  N     . GLU F 3 219 ? -14.463 37.491 -97.109  1.00 74.79  ? 515 GLU B N     1 
ATOM   7318  C  CA    . GLU F 3 219 ? -13.895 36.187 -97.426  1.00 75.72  ? 515 GLU B CA    1 
ATOM   7319  C  C     . GLU F 3 219 ? -14.507 35.686 -98.731  1.00 76.21  ? 515 GLU B C     1 
ATOM   7320  O  O     . GLU F 3 219 ? -14.115 34.644 -99.258  1.00 76.27  ? 515 GLU B O     1 
ATOM   7321  C  CB    . GLU F 3 219 ? -14.178 35.197 -96.290  1.00 75.94  ? 515 GLU B CB    1 
ATOM   7322  C  CG    . GLU F 3 219 ? -13.278 33.965 -96.301  1.00 76.41  ? 515 GLU B CG    1 
ATOM   7323  C  CD    . GLU F 3 219 ? -13.458 33.088 -95.072  1.00 76.56  ? 515 GLU B CD    1 
ATOM   7324  O  OE1   . GLU F 3 219 ? -12.731 32.079 -94.949  1.00 76.51  ? 515 GLU B OE1   1 
ATOM   7325  O  OE2   . GLU F 3 219 ? -14.324 33.406 -94.228  1.00 76.88  ? 515 GLU B OE2   1 
ATOM   7326  N  N     . GLN F 3 220 ? -15.471 36.444 -99.246  1.00 76.66  ? 516 GLN B N     1 
ATOM   7327  C  CA    . GLN F 3 220 ? -16.144 36.105 -100.494 1.00 77.07  ? 516 GLN B CA    1 
ATOM   7328  C  C     . GLN F 3 220 ? -15.368 36.685 -101.662 1.00 77.56  ? 516 GLN B C     1 
ATOM   7329  O  O     . GLN F 3 220 ? -15.180 36.026 -102.685 1.00 77.68  ? 516 GLN B O     1 
ATOM   7330  C  CB    . GLN F 3 220 ? -17.566 36.665 -100.499 1.00 76.81  ? 516 GLN B CB    1 
ATOM   7331  C  CG    . GLN F 3 220 ? -18.458 36.051 -99.447  1.00 76.84  ? 516 GLN B CG    1 
ATOM   7332  C  CD    . GLN F 3 220 ? -18.487 34.539 -99.538  1.00 76.80  ? 516 GLN B CD    1 
ATOM   7333  O  OE1   . GLN F 3 220 ? -18.819 33.976 -100.582 1.00 76.61  ? 516 GLN B OE1   1 
ATOM   7334  N  NE2   . GLN F 3 220 ? -18.136 33.872 -98.444  1.00 76.79  ? 516 GLN B NE2   1 
ATOM   7335  N  N     . ARG F 3 221 ? -14.924 37.928 -101.500 1.00 78.10  ? 517 ARG B N     1 
ATOM   7336  C  CA    . ARG F 3 221 ? -14.155 38.614 -102.528 1.00 78.72  ? 517 ARG B CA    1 
ATOM   7337  C  C     . ARG F 3 221 ? -12.724 38.070 -102.559 1.00 79.33  ? 517 ARG B C     1 
ATOM   7338  O  O     . ARG F 3 221 ? -11.926 38.438 -103.422 1.00 79.53  ? 517 ARG B O     1 
ATOM   7339  C  CB    . ARG F 3 221 ? -14.143 40.120 -102.252 1.00 78.52  ? 517 ARG B CB    1 
ATOM   7340  C  CG    . ARG F 3 221 ? -13.370 40.938 -103.271 1.00 78.53  ? 517 ARG B CG    1 
ATOM   7341  C  CD    . ARG F 3 221 ? -14.008 40.907 -104.648 1.00 78.29  ? 517 ARG B CD    1 
ATOM   7342  N  NE    . ARG F 3 221 ? -13.103 41.437 -105.665 1.00 78.11  ? 517 ARG B NE    1 
ATOM   7343  C  CZ    . ARG F 3 221 ? -13.451 41.678 -106.924 1.00 77.87  ? 517 ARG B CZ    1 
ATOM   7344  N  NH1   . ARG F 3 221 ? -14.692 41.442 -107.327 1.00 77.81  ? 517 ARG B NH1   1 
ATOM   7345  N  NH2   . ARG F 3 221 ? -12.556 42.143 -107.784 1.00 77.82  ? 517 ARG B NH2   1 
ATOM   7346  N  N     . ILE F 3 222 ? -12.408 37.193 -101.609 1.00 79.89  ? 518 ILE B N     1 
ATOM   7347  C  CA    . ILE F 3 222 ? -11.084 36.583 -101.526 1.00 80.35  ? 518 ILE B CA    1 
ATOM   7348  C  C     . ILE F 3 222 ? -11.060 35.259 -102.284 1.00 80.76  ? 518 ILE B C     1 
ATOM   7349  O  O     . ILE F 3 222 ? -10.133 34.990 -103.048 1.00 80.77  ? 518 ILE B O     1 
ATOM   7350  C  CB    . ILE F 3 222 ? -10.680 36.297 -100.062 1.00 80.30  ? 518 ILE B CB    1 
ATOM   7351  C  CG1   . ILE F 3 222 ? -10.525 37.607 -99.292  1.00 80.29  ? 518 ILE B CG1   1 
ATOM   7352  C  CG2   . ILE F 3 222 ? -9.377  35.507 -100.025 1.00 80.17  ? 518 ILE B CG2   1 
ATOM   7353  C  CD1   . ILE F 3 222 ? -10.217 37.405 -97.826  1.00 80.32  ? 518 ILE B CD1   1 
ATOM   7354  N  N     . TYR F 3 223 ? -12.086 34.439 -102.065 1.00 81.29  ? 519 TYR B N     1 
ATOM   7355  C  CA    . TYR F 3 223 ? -12.183 33.135 -102.713 1.00 81.83  ? 519 TYR B CA    1 
ATOM   7356  C  C     . TYR F 3 223 ? -12.573 33.194 -104.187 1.00 81.98  ? 519 TYR B C     1 
ATOM   7357  O  O     . TYR F 3 223 ? -12.203 32.315 -104.967 1.00 81.92  ? 519 TYR B O     1 
ATOM   7358  C  CB    . TYR F 3 223 ? -13.170 32.238 -101.959 1.00 82.18  ? 519 TYR B CB    1 
ATOM   7359  C  CG    . TYR F 3 223 ? -12.728 31.875 -100.559 1.00 82.65  ? 519 TYR B CG    1 
ATOM   7360  C  CD1   . TYR F 3 223 ? -11.385 31.625 -100.272 1.00 82.64  ? 519 TYR B CD1   1 
ATOM   7361  C  CD2   . TYR F 3 223 ? -13.656 31.742 -99.526  1.00 82.92  ? 519 TYR B CD2   1 
ATOM   7362  C  CE1   . TYR F 3 223 ? -10.978 31.253 -98.996  1.00 82.75  ? 519 TYR B CE1   1 
ATOM   7363  C  CE2   . TYR F 3 223 ? -13.259 31.368 -98.244  1.00 83.03  ? 519 TYR B CE2   1 
ATOM   7364  C  CZ    . TYR F 3 223 ? -11.919 31.124 -97.986  1.00 83.02  ? 519 TYR B CZ    1 
ATOM   7365  O  OH    . TYR F 3 223 ? -11.523 30.743 -96.722  1.00 83.20  ? 519 TYR B OH    1 
ATOM   7366  N  N     . GLU F 3 224 ? -13.324 34.219 -104.572 1.00 82.15  ? 520 GLU B N     1 
ATOM   7367  C  CA    . GLU F 3 224 ? -13.726 34.352 -105.964 1.00 82.39  ? 520 GLU B CA    1 
ATOM   7368  C  C     . GLU F 3 224 ? -12.526 34.790 -106.805 1.00 82.56  ? 520 GLU B C     1 
ATOM   7369  O  O     . GLU F 3 224 ? -12.265 34.219 -107.865 1.00 82.55  ? 520 GLU B O     1 
ATOM   7370  C  CB    . GLU F 3 224 ? -14.870 35.364 -106.100 1.00 82.31  ? 520 GLU B CB    1 
ATOM   7371  C  CG    . GLU F 3 224 ? -14.544 36.759 -105.601 1.00 82.35  ? 520 GLU B CG    1 
ATOM   7372  C  CD    . GLU F 3 224 ? -15.672 37.738 -105.852 1.00 82.40  ? 520 GLU B CD    1 
ATOM   7373  O  OE1   . GLU F 3 224 ? -16.801 37.484 -105.380 1.00 82.36  ? 520 GLU B OE1   1 
ATOM   7374  O  OE2   . GLU F 3 224 ? -15.429 38.761 -106.524 1.00 82.35  ? 520 GLU B OE2   1 
ATOM   7375  N  N     . LEU F 3 225 ? -11.794 35.792 -106.317 1.00 82.69  ? 521 LEU B N     1 
ATOM   7376  C  CA    . LEU F 3 225 ? -10.615 36.310 -107.010 1.00 82.84  ? 521 LEU B CA    1 
ATOM   7377  C  C     . LEU F 3 225 ? -9.471  35.298 -107.038 1.00 83.13  ? 521 LEU B C     1 
ATOM   7378  O  O     . LEU F 3 225 ? -8.428  35.543 -107.646 1.00 83.15  ? 521 LEU B O     1 
ATOM   7379  C  CB    . LEU F 3 225 ? -10.124 37.599 -106.342 1.00 82.68  ? 521 LEU B CB    1 
ATOM   7380  C  CG    . LEU F 3 225 ? -10.959 38.876 -106.480 1.00 82.58  ? 521 LEU B CG    1 
ATOM   7381  C  CD1   . LEU F 3 225 ? -10.342 39.972 -105.625 1.00 82.36  ? 521 LEU B CD1   1 
ATOM   7382  C  CD2   . LEU F 3 225 ? -11.019 39.310 -107.939 1.00 82.54  ? 521 LEU B CD2   1 
ATOM   7383  N  N     . ALA F 3 226 ? -9.668  34.165 -106.373 1.00 83.38  ? 522 ALA B N     1 
ATOM   7384  C  CA    . ALA F 3 226 ? -8.652  33.121 -106.324 1.00 83.71  ? 522 ALA B CA    1 
ATOM   7385  C  C     . ALA F 3 226 ? -9.184  31.832 -106.944 1.00 83.87  ? 522 ALA B C     1 
ATOM   7386  O  O     . ALA F 3 226 ? -8.417  31.008 -107.448 1.00 83.78  ? 522 ALA B O     1 
ATOM   7387  C  CB    . ALA F 3 226 ? -8.228  32.876 -104.883 1.00 83.64  ? 522 ALA B CB    1 
ATOM   7388  N  N     . GLY F 3 227 ? -10.504 31.666 -106.899 1.00 84.09  ? 523 GLY B N     1 
ATOM   7389  C  CA    . GLY F 3 227 ? -11.127 30.484 -107.468 1.00 84.42  ? 523 GLY B CA    1 
ATOM   7390  C  C     . GLY F 3 227 ? -11.499 29.420 -106.452 1.00 84.58  ? 523 GLY B C     1 
ATOM   7391  O  O     . GLY F 3 227 ? -12.597 28.864 -106.499 1.00 84.63  ? 523 GLY B O     1 
ATOM   7392  N  N     . GLN F 3 228 ? -10.584 29.136 -105.532 1.00 84.80  ? 524 GLN B N     1 
ATOM   7393  C  CA    . GLN F 3 228 ? -10.815 28.125 -104.507 1.00 85.06  ? 524 GLN B CA    1 
ATOM   7394  C  C     . GLN F 3 228 ? -11.302 28.754 -103.208 1.00 85.11  ? 524 GLN B C     1 
ATOM   7395  O  O     . GLN F 3 228 ? -11.385 29.976 -103.089 1.00 85.01  ? 524 GLN B O     1 
ATOM   7396  C  CB    . GLN F 3 228 ? -9.525  27.343 -104.241 1.00 85.21  ? 524 GLN B CB    1 
ATOM   7397  C  CG    . GLN F 3 228 ? -8.850  26.817 -105.499 1.00 85.32  ? 524 GLN B CG    1 
ATOM   7398  C  CD    . GLN F 3 228 ? -7.512  26.161 -105.214 1.00 85.34  ? 524 GLN B CD    1 
ATOM   7399  O  OE1   . GLN F 3 228 ? -6.673  26.719 -104.505 1.00 85.52  ? 524 GLN B OE1   1 
ATOM   7400  N  NE2   . GLN F 3 228 ? -7.301  24.978 -105.777 1.00 85.23  ? 524 GLN B NE2   1 
ATOM   7401  N  N     . GLU F 3 229 ? -11.618 27.902 -102.238 1.00 85.25  ? 525 GLU B N     1 
ATOM   7402  C  CA    . GLU F 3 229 ? -12.098 28.342 -100.932 1.00 85.36  ? 525 GLU B CA    1 
ATOM   7403  C  C     . GLU F 3 229 ? -11.022 28.019 -99.896  1.00 85.31  ? 525 GLU B C     1 
ATOM   7404  O  O     . GLU F 3 229 ? -11.302 27.919 -98.699  1.00 85.30  ? 525 GLU B O     1 
ATOM   7405  C  CB    . GLU F 3 229 ? -13.398 27.608 -100.585 1.00 85.35  ? 525 GLU B CB    1 
ATOM   7406  C  CG    . GLU F 3 229 ? -14.170 28.190 -99.414  1.00 85.56  ? 525 GLU B CG    1 
ATOM   7407  C  CD    . GLU F 3 229 ? -15.416 27.385 -99.088  1.00 85.70  ? 525 GLU B CD    1 
ATOM   7408  O  OE1   . GLU F 3 229 ? -16.239 27.856 -98.274  1.00 85.91  ? 525 GLU B OE1   1 
ATOM   7409  O  OE2   . GLU F 3 229 ? -15.569 26.277 -99.642  1.00 85.52  ? 525 GLU B OE2   1 
ATOM   7410  N  N     . PHE F 3 230 ? -9.791  27.859 -100.380 1.00 85.23  ? 526 PHE B N     1 
ATOM   7411  C  CA    . PHE F 3 230 ? -8.638  27.529 -99.542  1.00 85.18  ? 526 PHE B CA    1 
ATOM   7412  C  C     . PHE F 3 230 ? -8.603  28.272 -98.214  1.00 84.89  ? 526 PHE B C     1 
ATOM   7413  O  O     . PHE F 3 230 ? -9.333  29.241 -98.008  1.00 84.88  ? 526 PHE B O     1 
ATOM   7414  C  CB    . PHE F 3 230 ? -7.334  27.805 -100.299 1.00 85.43  ? 526 PHE B CB    1 
ATOM   7415  C  CG    . PHE F 3 230 ? -7.166  29.239 -100.720 1.00 85.58  ? 526 PHE B CG    1 
ATOM   7416  C  CD1   . PHE F 3 230 ? -7.885  29.752 -101.793 1.00 85.61  ? 526 PHE B CD1   1 
ATOM   7417  C  CD2   . PHE F 3 230 ? -6.293  30.079 -100.036 1.00 85.75  ? 526 PHE B CD2   1 
ATOM   7418  C  CE1   . PHE F 3 230 ? -7.737  31.083 -102.179 1.00 85.64  ? 526 PHE B CE1   1 
ATOM   7419  C  CE2   . PHE F 3 230 ? -6.140  31.411 -100.415 1.00 85.70  ? 526 PHE B CE2   1 
ATOM   7420  C  CZ    . PHE F 3 230 ? -6.863  31.913 -101.488 1.00 85.64  ? 526 PHE B CZ    1 
ATOM   7421  N  N     . ASN F 3 231 ? -7.740  27.812 -97.314  1.00 84.41  ? 527 ASN B N     1 
ATOM   7422  C  CA    . ASN F 3 231 ? -7.607  28.432 -96.005  1.00 84.01  ? 527 ASN B CA    1 
ATOM   7423  C  C     . ASN F 3 231 ? -6.693  29.651 -96.062  1.00 83.72  ? 527 ASN B C     1 
ATOM   7424  O  O     . ASN F 3 231 ? -5.480  29.522 -96.221  1.00 83.76  ? 527 ASN B O     1 
ATOM   7425  C  CB    . ASN F 3 231 ? -7.071  27.415 -94.993  1.00 83.91  ? 527 ASN B CB    1 
ATOM   7426  C  CG    . ASN F 3 231 ? -6.793  28.032 -93.638  1.00 83.94  ? 527 ASN B CG    1 
ATOM   7427  O  OD1   . ASN F 3 231 ? -7.593  28.811 -93.123  1.00 84.03  ? 527 ASN B OD1   1 
ATOM   7428  N  ND2   . ASN F 3 231 ? -5.660  27.677 -93.047  1.00 83.95  ? 527 ASN B ND2   1 
ATOM   7429  N  N     . ILE F 3 232 ? -7.286  30.835 -95.946  1.00 83.48  ? 528 ILE B N     1 
ATOM   7430  C  CA    . ILE F 3 232 ? -6.526  32.078 -95.977  1.00 83.26  ? 528 ILE B CA    1 
ATOM   7431  C  C     . ILE F 3 232 ? -5.943  32.348 -94.597  1.00 83.13  ? 528 ILE B C     1 
ATOM   7432  O  O     . ILE F 3 232 ? -5.119  33.246 -94.422  1.00 83.10  ? 528 ILE B O     1 
ATOM   7433  C  CB    . ILE F 3 232 ? -7.407  33.286 -96.394  1.00 83.17  ? 528 ILE B CB    1 
ATOM   7434  C  CG1   . ILE F 3 232 ? -8.502  33.544 -95.352  1.00 83.20  ? 528 ILE B CG1   1 
ATOM   7435  C  CG2   . ILE F 3 232 ? -8.004  33.039 -97.770  1.00 83.24  ? 528 ILE B CG2   1 
ATOM   7436  C  CD1   . ILE F 3 232 ? -9.563  32.461 -95.244  1.00 83.15  ? 528 ILE B CD1   1 
ATOM   7437  N  N     . ASN F 3 233 ? -6.382  31.565 -93.617  1.00 83.07  ? 529 ASN B N     1 
ATOM   7438  C  CA    . ASN F 3 233 ? -5.901  31.709 -92.251  1.00 82.97  ? 529 ASN B CA    1 
ATOM   7439  C  C     . ASN F 3 233 ? -4.569  30.981 -92.093  1.00 82.89  ? 529 ASN B C     1 
ATOM   7440  O  O     . ASN F 3 233 ? -4.122  30.723 -90.977  1.00 82.98  ? 529 ASN B O     1 
ATOM   7441  C  CB    . ASN F 3 233 ? -6.922  31.141 -91.260  1.00 83.00  ? 529 ASN B CB    1 
ATOM   7442  C  CG    . ASN F 3 233 ? -8.267  31.839 -91.340  1.00 82.94  ? 529 ASN B CG    1 
ATOM   7443  O  OD1   . ASN F 3 233 ? -8.362  33.054 -91.166  1.00 82.90  ? 529 ASN B OD1   1 
ATOM   7444  N  ND2   . ASN F 3 233 ? -9.317  31.070 -91.603  1.00 82.91  ? 529 ASN B ND2   1 
ATOM   7445  N  N     . SER F 3 234 ? -3.943  30.645 -93.216  1.00 82.72  ? 530 SER B N     1 
ATOM   7446  C  CA    . SER F 3 234 ? -2.658  29.958 -93.195  1.00 82.53  ? 530 SER B CA    1 
ATOM   7447  C  C     . SER F 3 234 ? -1.668  30.641 -94.133  1.00 82.44  ? 530 SER B C     1 
ATOM   7448  O  O     . SER F 3 234 ? -1.856  30.648 -95.349  1.00 82.51  ? 530 SER B O     1 
ATOM   7449  C  CB    . SER F 3 234 ? -2.822  28.491 -93.607  1.00 82.49  ? 530 SER B CB    1 
ATOM   7450  O  OG    . SER F 3 234 ? -3.249  28.374 -94.951  1.00 82.38  ? 530 SER B OG    1 
ATOM   7451  N  N     . PRO F 3 235 ? -0.605  31.241 -93.573  1.00 82.27  ? 531 PRO B N     1 
ATOM   7452  C  CA    . PRO F 3 235 ? 0.426   31.931 -94.355  1.00 82.04  ? 531 PRO B CA    1 
ATOM   7453  C  C     . PRO F 3 235 ? 1.259   30.982 -95.225  1.00 81.88  ? 531 PRO B C     1 
ATOM   7454  O  O     . PRO F 3 235 ? 2.464   31.183 -95.399  1.00 82.01  ? 531 PRO B O     1 
ATOM   7455  C  CB    . PRO F 3 235 ? 1.269   32.613 -93.280  1.00 82.09  ? 531 PRO B CB    1 
ATOM   7456  C  CG    . PRO F 3 235 ? 0.274   32.879 -92.193  1.00 82.14  ? 531 PRO B CG    1 
ATOM   7457  C  CD    . PRO F 3 235 ? -0.478  31.575 -92.143  1.00 82.23  ? 531 PRO B CD    1 
ATOM   7458  N  N     . LYS F 3 236 ? 0.612   29.949 -95.763  1.00 81.52  ? 532 LYS B N     1 
ATOM   7459  C  CA    . LYS F 3 236 ? 1.283   28.969 -96.616  1.00 81.07  ? 532 LYS B CA    1 
ATOM   7460  C  C     . LYS F 3 236 ? 0.437   28.614 -97.836  1.00 80.62  ? 532 LYS B C     1 
ATOM   7461  O  O     . LYS F 3 236 ? 0.945   28.545 -98.957  1.00 80.81  ? 532 LYS B O     1 
ATOM   7462  C  CB    . LYS F 3 236 ? 1.573   27.681 -95.838  1.00 81.23  ? 532 LYS B CB    1 
ATOM   7463  C  CG    . LYS F 3 236 ? 2.350   26.646 -96.650  1.00 81.18  ? 532 LYS B CG    1 
ATOM   7464  C  CD    . LYS F 3 236 ? 2.158   25.237 -96.114  1.00 81.22  ? 532 LYS B CD    1 
ATOM   7465  C  CE    . LYS F 3 236 ? 0.738   24.743 -96.358  1.00 81.30  ? 532 LYS B CE    1 
ATOM   7466  N  NZ    . LYS F 3 236 ? 0.399   24.704 -97.811  1.00 80.97  ? 532 LYS B NZ    1 
ATOM   7467  N  N     . GLN F 3 237 ? -0.851  28.381 -97.601  1.00 79.99  ? 533 GLN B N     1 
ATOM   7468  C  CA    . GLN F 3 237 ? -1.789  28.012 -98.658  1.00 79.18  ? 533 GLN B CA    1 
ATOM   7469  C  C     . GLN F 3 237 ? -2.044  29.101 -99.685  1.00 78.74  ? 533 GLN B C     1 
ATOM   7470  O  O     . GLN F 3 237 ? -1.901  28.868 -100.885 1.00 78.70  ? 533 GLN B O     1 
ATOM   7471  C  CB    . GLN F 3 237 ? -3.119  27.586 -98.048  1.00 78.99  ? 533 GLN B CB    1 
ATOM   7472  C  CG    . GLN F 3 237 ? -3.035  26.322 -97.234  1.00 78.64  ? 533 GLN B CG    1 
ATOM   7473  C  CD    . GLN F 3 237 ? -4.367  25.946 -96.647  1.00 78.63  ? 533 GLN B CD    1 
ATOM   7474  O  OE1   . GLN F 3 237 ? -5.367  25.857 -97.361  1.00 78.65  ? 533 GLN B OE1   1 
ATOM   7475  N  NE2   . GLN F 3 237 ? -4.395  25.722 -95.340  1.00 78.77  ? 533 GLN B NE2   1 
ATOM   7476  N  N     . LEU F 3 238 ? -2.437  30.285 -99.223  1.00 78.18  ? 534 LEU B N     1 
ATOM   7477  C  CA    . LEU F 3 238 ? -2.706  31.387 -100.138 1.00 77.76  ? 534 LEU B CA    1 
ATOM   7478  C  C     . LEU F 3 238 ? -1.444  31.748 -100.924 1.00 77.33  ? 534 LEU B C     1 
ATOM   7479  O  O     . LEU F 3 238 ? -1.493  32.525 -101.879 1.00 77.51  ? 534 LEU B O     1 
ATOM   7480  C  CB    . LEU F 3 238 ? -3.242  32.606 -99.371  1.00 77.87  ? 534 LEU B CB    1 
ATOM   7481  C  CG    . LEU F 3 238 ? -2.405  33.327 -98.310  1.00 77.96  ? 534 LEU B CG    1 
ATOM   7482  C  CD1   . LEU F 3 238 ? -1.245  34.073 -98.957  1.00 77.91  ? 534 LEU B CD1   1 
ATOM   7483  C  CD2   . LEU F 3 238 ? -3.297  34.309 -97.569  1.00 77.99  ? 534 LEU B CD2   1 
ATOM   7484  N  N     . GLY F 3 239 ? -0.316  31.172 -100.514 1.00 76.61  ? 535 GLY B N     1 
ATOM   7485  C  CA    . GLY F 3 239 ? 0.942   31.423 -101.196 1.00 75.62  ? 535 GLY B CA    1 
ATOM   7486  C  C     . GLY F 3 239 ? 0.978   30.660 -102.505 1.00 74.91  ? 535 GLY B C     1 
ATOM   7487  O  O     . GLY F 3 239 ? 1.644   31.065 -103.456 1.00 74.66  ? 535 GLY B O     1 
ATOM   7488  N  N     . VAL F 3 240 ? 0.257   29.543 -102.546 1.00 74.23  ? 536 VAL B N     1 
ATOM   7489  C  CA    . VAL F 3 240 ? 0.179   28.718 -103.745 1.00 73.65  ? 536 VAL B CA    1 
ATOM   7490  C  C     . VAL F 3 240 ? -0.903  29.314 -104.648 1.00 73.23  ? 536 VAL B C     1 
ATOM   7491  O  O     . VAL F 3 240 ? -0.951  29.043 -105.849 1.00 73.27  ? 536 VAL B O     1 
ATOM   7492  C  CB    . VAL F 3 240 ? -0.178  27.246 -103.396 1.00 73.63  ? 536 VAL B CB    1 
ATOM   7493  C  CG1   . VAL F 3 240 ? -0.223  26.396 -104.661 1.00 73.50  ? 536 VAL B CG1   1 
ATOM   7494  C  CG2   . VAL F 3 240 ? 0.841   26.682 -102.422 1.00 73.39  ? 536 VAL B CG2   1 
ATOM   7495  N  N     . ILE F 3 241 ? -1.773  30.125 -104.052 1.00 72.67  ? 537 ILE B N     1 
ATOM   7496  C  CA    . ILE F 3 241 ? -2.847  30.785 -104.786 1.00 72.07  ? 537 ILE B CA    1 
ATOM   7497  C  C     . ILE F 3 241 ? -2.352  32.158 -105.230 1.00 71.84  ? 537 ILE B C     1 
ATOM   7498  O  O     . ILE F 3 241 ? -2.911  32.767 -106.142 1.00 71.53  ? 537 ILE B O     1 
ATOM   7499  C  CB    . ILE F 3 241 ? -4.118  30.969 -103.905 1.00 72.13  ? 537 ILE B CB    1 
ATOM   7500  C  CG1   . ILE F 3 241 ? -4.835  29.630 -103.706 1.00 72.01  ? 537 ILE B CG1   1 
ATOM   7501  C  CG2   . ILE F 3 241 ? -5.069  31.956 -104.558 1.00 71.86  ? 537 ILE B CG2   1 
ATOM   7502  C  CD1   . ILE F 3 241 ? -4.082  28.634 -102.857 1.00 72.18  ? 537 ILE B CD1   1 
ATOM   7503  N  N     . LEU F 3 242 ? -1.290  32.635 -104.583 1.00 71.64  ? 538 LEU B N     1 
ATOM   7504  C  CA    . LEU F 3 242 ? -0.715  33.941 -104.898 1.00 71.47  ? 538 LEU B CA    1 
ATOM   7505  C  C     . LEU F 3 242 ? 0.572   33.811 -105.711 1.00 71.57  ? 538 LEU B C     1 
ATOM   7506  O  O     . LEU F 3 242 ? 0.647   34.273 -106.852 1.00 71.38  ? 538 LEU B O     1 
ATOM   7507  C  CB    . LEU F 3 242 ? -0.429  34.714 -103.605 1.00 71.24  ? 538 LEU B CB    1 
ATOM   7508  C  CG    . LEU F 3 242 ? -0.131  36.217 -103.701 1.00 71.09  ? 538 LEU B CG    1 
ATOM   7509  C  CD1   . LEU F 3 242 ? -0.096  36.803 -102.301 1.00 70.86  ? 538 LEU B CD1   1 
ATOM   7510  C  CD2   . LEU F 3 242 ? 1.186   36.468 -104.421 1.00 70.99  ? 538 LEU B CD2   1 
ATOM   7511  N  N     . PHE F 3 243 ? 1.581   33.187 -105.110 1.00 71.68  ? 539 PHE B N     1 
ATOM   7512  C  CA    . PHE F 3 243 ? 2.873   32.995 -105.763 1.00 71.79  ? 539 PHE B CA    1 
ATOM   7513  C  C     . PHE F 3 243 ? 2.898   31.688 -106.550 1.00 71.98  ? 539 PHE B C     1 
ATOM   7514  O  O     . PHE F 3 243 ? 3.831   30.898 -106.415 1.00 72.15  ? 539 PHE B O     1 
ATOM   7515  C  CB    . PHE F 3 243 ? 3.994   32.972 -104.719 1.00 71.65  ? 539 PHE B CB    1 
ATOM   7516  C  CG    . PHE F 3 243 ? 4.039   34.193 -103.839 1.00 71.65  ? 539 PHE B CG    1 
ATOM   7517  C  CD1   . PHE F 3 243 ? 4.421   35.428 -104.352 1.00 71.82  ? 539 PHE B CD1   1 
ATOM   7518  C  CD2   . PHE F 3 243 ? 3.704   34.104 -102.491 1.00 71.42  ? 539 PHE B CD2   1 
ATOM   7519  C  CE1   . PHE F 3 243 ? 4.471   36.560 -103.535 1.00 71.75  ? 539 PHE B CE1   1 
ATOM   7520  C  CE2   . PHE F 3 243 ? 3.750   35.223 -101.669 1.00 71.37  ? 539 PHE B CE2   1 
ATOM   7521  C  CZ    . PHE F 3 243 ? 4.135   36.455 -102.192 1.00 71.66  ? 539 PHE B CZ    1 
ATOM   7522  N  N     . GLU F 3 244 ? 1.870   31.458 -107.364 1.00 72.31  ? 540 GLU B N     1 
ATOM   7523  C  CA    . GLU F 3 244 ? 1.789   30.241 -108.167 1.00 72.47  ? 540 GLU B CA    1 
ATOM   7524  C  C     . GLU F 3 244 ? 0.572   30.268 -109.094 1.00 72.55  ? 540 GLU B C     1 
ATOM   7525  O  O     . GLU F 3 244 ? 0.719   30.254 -110.315 1.00 72.50  ? 540 GLU B O     1 
ATOM   7526  C  CB    . GLU F 3 244 ? 1.733   29.009 -107.253 1.00 72.56  ? 540 GLU B CB    1 
ATOM   7527  C  CG    . GLU F 3 244 ? 2.284   27.733 -107.882 1.00 72.69  ? 540 GLU B CG    1 
ATOM   7528  C  CD    . GLU F 3 244 ? 2.324   26.567 -106.905 1.00 72.88  ? 540 GLU B CD    1 
ATOM   7529  O  OE1   . GLU F 3 244 ? 2.872   26.742 -105.796 1.00 72.43  ? 540 GLU B OE1   1 
ATOM   7530  O  OE2   . GLU F 3 244 ? 1.813   25.476 -107.247 1.00 72.80  ? 540 GLU B OE2   1 
ATOM   7531  N  N     . LYS F 3 245 ? -0.628  30.309 -108.518 1.00 72.77  ? 541 LYS B N     1 
ATOM   7532  C  CA    . LYS F 3 245 ? -1.848  30.348 -109.323 1.00 73.02  ? 541 LYS B CA    1 
ATOM   7533  C  C     . LYS F 3 245 ? -2.037  31.703 -109.999 1.00 73.21  ? 541 LYS B C     1 
ATOM   7534  O  O     . LYS F 3 245 ? -2.292  31.773 -111.199 1.00 73.23  ? 541 LYS B O     1 
ATOM   7535  C  CB    . LYS F 3 245 ? -3.080  30.042 -108.469 1.00 72.95  ? 541 LYS B CB    1 
ATOM   7536  C  CG    . LYS F 3 245 ? -4.393  30.308 -109.200 1.00 72.85  ? 541 LYS B CG    1 
ATOM   7537  C  CD    . LYS F 3 245 ? -5.600  29.996 -108.341 1.00 72.76  ? 541 LYS B CD    1 
ATOM   7538  C  CE    . LYS F 3 245 ? -5.665  28.522 -107.994 1.00 72.82  ? 541 LYS B CE    1 
ATOM   7539  N  NZ    . LYS F 3 245 ? -6.883  28.215 -107.202 1.00 72.87  ? 541 LYS B NZ    1 
ATOM   7540  N  N     . LEU F 3 246 ? -1.925  32.777 -109.223 1.00 73.60  ? 542 LEU B N     1 
ATOM   7541  C  CA    . LEU F 3 246 ? -2.080  34.122 -109.767 1.00 74.25  ? 542 LEU B CA    1 
ATOM   7542  C  C     . LEU F 3 246 ? -0.865  34.522 -110.598 1.00 74.56  ? 542 LEU B C     1 
ATOM   7543  O  O     . LEU F 3 246 ? -0.868  35.569 -111.249 1.00 74.57  ? 542 LEU B O     1 
ATOM   7544  C  CB    . LEU F 3 246 ? -2.273  35.145 -108.639 1.00 74.29  ? 542 LEU B CB    1 
ATOM   7545  C  CG    . LEU F 3 246 ? -3.578  35.130 -107.839 1.00 74.45  ? 542 LEU B CG    1 
ATOM   7546  C  CD1   . LEU F 3 246 ? -3.549  36.244 -106.801 1.00 74.41  ? 542 LEU B CD1   1 
ATOM   7547  C  CD2   . LEU F 3 246 ? -4.760  35.312 -108.777 1.00 74.53  ? 542 LEU B CD2   1 
ATOM   7548  N  N     . GLN F 3 247 ? 0.171   33.686 -110.571 1.00 75.05  ? 543 GLN B N     1 
ATOM   7549  C  CA    . GLN F 3 247 ? 1.401   33.959 -111.312 1.00 75.51  ? 543 GLN B CA    1 
ATOM   7550  C  C     . GLN F 3 247 ? 1.966   35.303 -110.838 1.00 75.84  ? 543 GLN B C     1 
ATOM   7551  O  O     . GLN F 3 247 ? 2.695   35.973 -111.572 1.00 75.79  ? 543 GLN B O     1 
ATOM   7552  C  CB    . GLN F 3 247 ? 1.115   34.044 -112.816 1.00 75.55  ? 543 GLN B CB    1 
ATOM   7553  C  CG    . GLN F 3 247 ? 0.242   32.932 -113.394 1.00 75.74  ? 543 GLN B CG    1 
ATOM   7554  C  CD    . GLN F 3 247 ? 0.889   31.560 -113.334 1.00 75.89  ? 543 GLN B CD    1 
ATOM   7555  O  OE1   . GLN F 3 247 ? 2.084   31.409 -113.594 1.00 75.95  ? 543 GLN B OE1   1 
ATOM   7556  N  NE2   . GLN F 3 247 ? 0.096   30.547 -113.008 1.00 75.87  ? 543 GLN B NE2   1 
ATOM   7557  N  N     . LEU F 3 248 ? 1.625   35.682 -109.606 1.00 76.14  ? 544 LEU B N     1 
ATOM   7558  C  CA    . LEU F 3 248 ? 2.055   36.953 -109.031 1.00 76.31  ? 544 LEU B CA    1 
ATOM   7559  C  C     . LEU F 3 248 ? 3.481   36.944 -108.484 1.00 76.75  ? 544 LEU B C     1 
ATOM   7560  O  O     . LEU F 3 248 ? 3.955   35.936 -107.962 1.00 76.68  ? 544 LEU B O     1 
ATOM   7561  C  CB    . LEU F 3 248 ? 1.073   37.375 -107.935 1.00 76.14  ? 544 LEU B CB    1 
ATOM   7562  C  CG    . LEU F 3 248 ? 0.621   38.839 -107.934 1.00 76.15  ? 544 LEU B CG    1 
ATOM   7563  C  CD1   . LEU F 3 248 ? 0.143   39.246 -109.321 1.00 75.93  ? 544 LEU B CD1   1 
ATOM   7564  C  CD2   . LEU F 3 248 ? -0.491  39.021 -106.914 1.00 76.14  ? 544 LEU B CD2   1 
ATOM   7565  N  N     . PRO F 3 249 ? 4.180   38.086 -108.597 1.00 77.31  ? 545 PRO B N     1 
ATOM   7566  C  CA    . PRO F 3 249 ? 5.560   38.320 -108.155 1.00 77.83  ? 545 PRO B CA    1 
ATOM   7567  C  C     . PRO F 3 249 ? 5.927   37.944 -106.716 1.00 78.34  ? 545 PRO B C     1 
ATOM   7568  O  O     . PRO F 3 249 ? 5.215   38.267 -105.764 1.00 78.24  ? 545 PRO B O     1 
ATOM   7569  C  CB    . PRO F 3 249 ? 5.753   39.812 -108.419 1.00 77.81  ? 545 PRO B CB    1 
ATOM   7570  C  CG    . PRO F 3 249 ? 4.906   40.040 -109.624 1.00 77.72  ? 545 PRO B CG    1 
ATOM   7571  C  CD    . PRO F 3 249 ? 3.648   39.291 -109.261 1.00 77.48  ? 545 PRO B CD    1 
ATOM   7572  N  N     . VAL F 3 250 ? 7.063   37.265 -106.580 1.00 78.90  ? 546 VAL B N     1 
ATOM   7573  C  CA    . VAL F 3 250 ? 7.587   36.848 -105.285 1.00 79.53  ? 546 VAL B CA    1 
ATOM   7574  C  C     . VAL F 3 250 ? 8.730   37.805 -104.945 1.00 79.90  ? 546 VAL B C     1 
ATOM   7575  O  O     . VAL F 3 250 ? 9.820   37.694 -105.508 1.00 80.12  ? 546 VAL B O     1 
ATOM   7576  C  CB    . VAL F 3 250 ? 8.151   35.409 -105.347 1.00 79.45  ? 546 VAL B CB    1 
ATOM   7577  C  CG1   . VAL F 3 250 ? 8.599   34.964 -103.962 1.00 79.54  ? 546 VAL B CG1   1 
ATOM   7578  C  CG2   . VAL F 3 250 ? 7.106   34.460 -105.908 1.00 79.45  ? 546 VAL B CG2   1 
ATOM   7579  N  N     . LEU F 3 251 ? 8.485   38.739 -104.030 1.00 80.32  ? 547 LEU B N     1 
ATOM   7580  C  CA    . LEU F 3 251 ? 9.505   39.718 -103.654 1.00 80.66  ? 547 LEU B CA    1 
ATOM   7581  C  C     . LEU F 3 251 ? 10.311  39.345 -102.418 1.00 80.95  ? 547 LEU B C     1 
ATOM   7582  O  O     . LEU F 3 251 ? 11.218  40.077 -102.022 1.00 81.10  ? 547 LEU B O     1 
ATOM   7583  C  CB    . LEU F 3 251 ? 8.866   41.091 -103.433 1.00 80.52  ? 547 LEU B CB    1 
ATOM   7584  C  CG    . LEU F 3 251 ? 8.056   41.666 -104.595 1.00 80.53  ? 547 LEU B CG    1 
ATOM   7585  C  CD1   . LEU F 3 251 ? 7.641   43.087 -104.259 1.00 80.54  ? 547 LEU B CD1   1 
ATOM   7586  C  CD2   . LEU F 3 251 ? 8.882   41.639 -105.869 1.00 80.39  ? 547 LEU B CD2   1 
ATOM   7587  N  N     . LYS F 3 252 ? 9.984   38.212 -101.808 1.00 81.37  ? 548 LYS B N     1 
ATOM   7588  C  CA    . LYS F 3 252 ? 10.695  37.764 -100.617 1.00 81.71  ? 548 LYS B CA    1 
ATOM   7589  C  C     . LYS F 3 252 ? 10.162  36.414 -100.165 1.00 81.92  ? 548 LYS B C     1 
ATOM   7590  O  O     . LYS F 3 252 ? 8.993   36.091 -100.384 1.00 82.04  ? 548 LYS B O     1 
ATOM   7591  C  CB    . LYS F 3 252 ? 10.539  38.792 -99.490  1.00 81.72  ? 548 LYS B CB    1 
ATOM   7592  C  CG    . LYS F 3 252 ? 11.397  38.518 -98.259  1.00 81.74  ? 548 LYS B CG    1 
ATOM   7593  C  CD    . LYS F 3 252 ? 11.369  39.702 -97.299  1.00 81.76  ? 548 LYS B CD    1 
ATOM   7594  C  CE    . LYS F 3 252 ? 12.281  39.482 -96.101  1.00 81.74  ? 548 LYS B CE    1 
ATOM   7595  N  NZ    . LYS F 3 252 ? 11.847  38.330 -95.262  1.00 81.85  ? 548 LYS B NZ    1 
ATOM   7596  N  N     . LYS F 3 253 ? 11.026  35.624 -99.540  1.00 82.22  ? 549 LYS B N     1 
ATOM   7597  C  CA    . LYS F 3 253 ? 10.636  34.308 -99.058  1.00 82.62  ? 549 LYS B CA    1 
ATOM   7598  C  C     . LYS F 3 253 ? 11.178  34.078 -97.652  1.00 82.89  ? 549 LYS B C     1 
ATOM   7599  O  O     . LYS F 3 253 ? 11.985  34.861 -97.150  1.00 82.84  ? 549 LYS B O     1 
ATOM   7600  C  CB    . LYS F 3 253 ? 11.157  33.225 -100.009 1.00 82.65  ? 549 LYS B CB    1 
ATOM   7601  C  CG    . LYS F 3 253 ? 10.715  33.415 -101.459 1.00 82.86  ? 549 LYS B CG    1 
ATOM   7602  C  CD    . LYS F 3 253 ? 11.173  32.270 -102.355 1.00 82.73  ? 549 LYS B CD    1 
ATOM   7603  C  CE    . LYS F 3 253 ? 10.476  30.966 -101.997 1.00 82.65  ? 549 LYS B CE    1 
ATOM   7604  N  NZ    . LYS F 3 253 ? 10.902  29.847 -102.883 1.00 82.70  ? 549 LYS B NZ    1 
ATOM   7605  N  N     . THR F 3 254 ? 10.719  33.006 -97.016  1.00 83.23  ? 550 THR B N     1 
ATOM   7606  C  CA    . THR F 3 254 ? 11.161  32.669 -95.670  1.00 83.67  ? 550 THR B CA    1 
ATOM   7607  C  C     . THR F 3 254 ? 11.909  31.338 -95.672  1.00 83.99  ? 550 THR B C     1 
ATOM   7608  O  O     . THR F 3 254 ? 12.418  30.907 -96.707  1.00 84.14  ? 550 THR B O     1 
ATOM   7609  C  CB    . THR F 3 254 ? 9.963   32.592 -94.690  1.00 83.80  ? 550 THR B CB    1 
ATOM   7610  O  OG1   . THR F 3 254 ? 8.962   31.709 -95.215  1.00 83.88  ? 550 THR B OG1   1 
ATOM   7611  C  CG2   . THR F 3 254 ? 9.358   33.976 -94.479  1.00 83.70  ? 550 THR B CG2   1 
ATOM   7612  N  N     . LYS F 3 255 ? 11.976  30.691 -94.514  1.00 84.29  ? 551 LYS B N     1 
ATOM   7613  C  CA    . LYS F 3 255 ? 12.671  29.416 -94.397  1.00 84.64  ? 551 LYS B CA    1 
ATOM   7614  C  C     . LYS F 3 255 ? 11.789  28.226 -94.785  1.00 84.75  ? 551 LYS B C     1 
ATOM   7615  O  O     . LYS F 3 255 ? 12.297  27.182 -95.202  1.00 84.88  ? 551 LYS B O     1 
ATOM   7616  C  CB    . LYS F 3 255 ? 13.189  29.238 -92.967  1.00 85.01  ? 551 LYS B CB    1 
ATOM   7617  C  CG    . LYS F 3 255 ? 14.130  30.349 -92.510  1.00 85.48  ? 551 LYS B CG    1 
ATOM   7618  C  CD    . LYS F 3 255 ? 14.583  30.151 -91.068  1.00 85.72  ? 551 LYS B CD    1 
ATOM   7619  C  CE    . LYS F 3 255 ? 15.478  31.296 -90.608  1.00 86.03  ? 551 LYS B CE    1 
ATOM   7620  N  NZ    . LYS F 3 255 ? 16.698  31.423 -91.456  1.00 85.94  ? 551 LYS B NZ    1 
ATOM   7621  N  N     . THR F 3 256 ? 10.473  28.387 -94.657  1.00 84.62  ? 552 THR B N     1 
ATOM   7622  C  CA    . THR F 3 256 ? 9.535   27.315 -94.990  1.00 84.43  ? 552 THR B CA    1 
ATOM   7623  C  C     . THR F 3 256 ? 8.693   27.609 -96.232  1.00 84.26  ? 552 THR B C     1 
ATOM   7624  O  O     . THR F 3 256 ? 8.303   26.690 -96.955  1.00 84.32  ? 552 THR B O     1 
ATOM   7625  C  CB    . THR F 3 256 ? 8.581   27.026 -93.813  1.00 84.50  ? 552 THR B CB    1 
ATOM   7626  O  OG1   . THR F 3 256 ? 9.344   26.620 -92.670  1.00 84.47  ? 552 THR B OG1   1 
ATOM   7627  C  CG2   . THR F 3 256 ? 7.599   25.917 -94.178  1.00 84.47  ? 552 THR B CG2   1 
ATOM   7628  N  N     . GLY F 3 257 ? 8.412   28.886 -96.476  1.00 83.91  ? 553 GLY B N     1 
ATOM   7629  C  CA    . GLY F 3 257 ? 7.618   29.254 -97.635  1.00 83.51  ? 553 GLY B CA    1 
ATOM   7630  C  C     . GLY F 3 257 ? 7.872   30.678 -98.093  1.00 83.25  ? 553 GLY B C     1 
ATOM   7631  O  O     . GLY F 3 257 ? 8.891   31.274 -97.749  1.00 83.19  ? 553 GLY B O     1 
ATOM   7632  N  N     . TYR F 3 258 ? 6.945   31.226 -98.874  1.00 82.92  ? 554 TYR B N     1 
ATOM   7633  C  CA    . TYR F 3 258 ? 7.080   32.589 -99.372  1.00 82.54  ? 554 TYR B CA    1 
ATOM   7634  C  C     . TYR F 3 258 ? 6.828   33.593 -98.256  1.00 81.84  ? 554 TYR B C     1 
ATOM   7635  O  O     . TYR F 3 258 ? 6.520   33.216 -97.125  1.00 81.88  ? 554 TYR B O     1 
ATOM   7636  C  CB    . TYR F 3 258 ? 6.089   32.849 -100.508 1.00 83.21  ? 554 TYR B CB    1 
ATOM   7637  C  CG    . TYR F 3 258 ? 6.207   31.899 -101.681 1.00 83.98  ? 554 TYR B CG    1 
ATOM   7638  C  CD1   . TYR F 3 258 ? 5.752   30.583 -101.590 1.00 84.13  ? 554 TYR B CD1   1 
ATOM   7639  C  CD2   . TYR F 3 258 ? 6.762   32.323 -102.890 1.00 84.22  ? 554 TYR B CD2   1 
ATOM   7640  C  CE1   . TYR F 3 258 ? 5.842   29.711 -102.679 1.00 84.49  ? 554 TYR B CE1   1 
ATOM   7641  C  CE2   . TYR F 3 258 ? 6.859   31.461 -103.983 1.00 84.49  ? 554 TYR B CE2   1 
ATOM   7642  C  CZ    . TYR F 3 258 ? 6.395   30.159 -103.872 1.00 84.59  ? 554 TYR B CZ    1 
ATOM   7643  O  OH    . TYR F 3 258 ? 6.475   29.314 -104.957 1.00 84.73  ? 554 TYR B OH    1 
ATOM   7644  N  N     . SER F 3 259 ? 6.954   34.874 -98.581  1.00 80.94  ? 555 SER B N     1 
ATOM   7645  C  CA    . SER F 3 259 ? 6.734   35.930 -97.602  1.00 80.00  ? 555 SER B CA    1 
ATOM   7646  C  C     . SER F 3 259 ? 5.357   36.568 -97.772  1.00 79.26  ? 555 SER B C     1 
ATOM   7647  O  O     . SER F 3 259 ? 5.232   37.650 -98.350  1.00 79.38  ? 555 SER B O     1 
ATOM   7648  C  CB    . SER F 3 259 ? 7.822   37.003 -97.730  1.00 79.97  ? 555 SER B CB    1 
ATOM   7649  O  OG    . SER F 3 259 ? 7.601   38.072 -96.826  1.00 79.93  ? 555 SER B OG    1 
ATOM   7650  N  N     . THR F 3 260 ? 4.325   35.895 -97.269  1.00 78.22  ? 556 THR B N     1 
ATOM   7651  C  CA    . THR F 3 260 ? 2.968   36.418 -97.365  1.00 77.36  ? 556 THR B CA    1 
ATOM   7652  C  C     . THR F 3 260 ? 2.748   37.471 -96.274  1.00 76.76  ? 556 THR B C     1 
ATOM   7653  O  O     . THR F 3 260 ? 1.681   37.548 -95.662  1.00 76.59  ? 556 THR B O     1 
ATOM   7654  C  CB    . THR F 3 260 ? 1.909   35.280 -97.243  1.00 77.33  ? 556 THR B CB    1 
ATOM   7655  O  OG1   . THR F 3 260 ? 0.593   35.830 -97.363  1.00 77.44  ? 556 THR B OG1   1 
ATOM   7656  C  CG2   . THR F 3 260 ? 2.024   34.567 -95.916  1.00 77.30  ? 556 THR B CG2   1 
ATOM   7657  N  N     . SER F 3 261 ? 3.780   38.279 -96.043  1.00 76.07  ? 557 SER B N     1 
ATOM   7658  C  CA    . SER F 3 261 ? 3.737   39.342 -95.044  1.00 75.44  ? 557 SER B CA    1 
ATOM   7659  C  C     . SER F 3 261 ? 3.086   40.575 -95.653  1.00 74.93  ? 557 SER B C     1 
ATOM   7660  O  O     . SER F 3 261 ? 3.231   40.834 -96.846  1.00 75.08  ? 557 SER B O     1 
ATOM   7661  C  CB    . SER F 3 261 ? 5.155   39.697 -94.586  1.00 75.52  ? 557 SER B CB    1 
ATOM   7662  O  OG    . SER F 3 261 ? 5.829   38.567 -94.061  1.00 76.00  ? 557 SER B OG    1 
ATOM   7663  N  N     . ALA F 3 262 ? 2.373   41.339 -94.834  1.00 74.32  ? 558 ALA B N     1 
ATOM   7664  C  CA    . ALA F 3 262 ? 1.706   42.545 -95.312  1.00 73.50  ? 558 ALA B CA    1 
ATOM   7665  C  C     . ALA F 3 262 ? 2.715   43.544 -95.876  1.00 72.99  ? 558 ALA B C     1 
ATOM   7666  O  O     . ALA F 3 262 ? 2.425   44.243 -96.848  1.00 72.89  ? 558 ALA B O     1 
ATOM   7667  C  CB    . ALA F 3 262 ? 0.910   43.183 -94.183  1.00 73.66  ? 558 ALA B CB    1 
ATOM   7668  N  N     . ASP F 3 263 ? 3.897   43.610 -95.269  1.00 72.33  ? 559 ASP B N     1 
ATOM   7669  C  CA    . ASP F 3 263 ? 4.930   44.530 -95.739  1.00 71.98  ? 559 ASP B CA    1 
ATOM   7670  C  C     . ASP F 3 263 ? 5.210   44.187 -97.195  1.00 71.56  ? 559 ASP B C     1 
ATOM   7671  O  O     . ASP F 3 263 ? 5.642   45.031 -97.980  1.00 71.37  ? 559 ASP B O     1 
ATOM   7672  C  CB    . ASP F 3 263 ? 6.209   44.375 -94.906  1.00 72.14  ? 559 ASP B CB    1 
ATOM   7673  C  CG    . ASP F 3 263 ? 7.207   43.413 -95.529  1.00 72.35  ? 559 ASP B CG    1 
ATOM   7674  O  OD1   . ASP F 3 263 ? 7.814   43.769 -96.563  1.00 72.26  ? 559 ASP B OD1   1 
ATOM   7675  O  OD2   . ASP F 3 263 ? 7.387   42.302 -94.986  1.00 72.60  ? 559 ASP B OD2   1 
ATOM   7676  N  N     . VAL F 3 264 ? 4.951   42.929 -97.535  1.00 71.07  ? 560 VAL B N     1 
ATOM   7677  C  CA    . VAL F 3 264 ? 5.144   42.417 -98.883  1.00 70.54  ? 560 VAL B CA    1 
ATOM   7678  C  C     . VAL F 3 264 ? 3.838   42.495 -99.671  1.00 70.01  ? 560 VAL B C     1 
ATOM   7679  O  O     . VAL F 3 264 ? 3.854   42.736 -100.877 1.00 69.91  ? 560 VAL B O     1 
ATOM   7680  C  CB    . VAL F 3 264 ? 5.625   40.938 -98.850  1.00 70.76  ? 560 VAL B CB    1 
ATOM   7681  C  CG1   . VAL F 3 264 ? 5.626   40.350 -100.253 1.00 70.82  ? 560 VAL B CG1   1 
ATOM   7682  C  CG2   . VAL F 3 264 ? 7.022   40.860 -98.248  1.00 70.74  ? 560 VAL B CG2   1 
ATOM   7683  N  N     . LEU F 3 265 ? 2.713   42.302 -98.984  1.00 69.36  ? 561 LEU B N     1 
ATOM   7684  C  CA    . LEU F 3 265 ? 1.401   42.331 -99.629  1.00 68.95  ? 561 LEU B CA    1 
ATOM   7685  C  C     . LEU F 3 265 ? 0.870   43.721 -99.942  1.00 68.96  ? 561 LEU B C     1 
ATOM   7686  O  O     . LEU F 3 265 ? -0.218  43.862 -100.488 1.00 68.76  ? 561 LEU B O     1 
ATOM   7687  C  CB    . LEU F 3 265 ? 0.372   41.572 -98.786  1.00 68.62  ? 561 LEU B CB    1 
ATOM   7688  C  CG    . LEU F 3 265 ? 0.241   40.072 -99.069  1.00 68.11  ? 561 LEU B CG    1 
ATOM   7689  C  CD1   . LEU F 3 265 ? 1.601   39.406 -98.986  1.00 67.91  ? 561 LEU B CD1   1 
ATOM   7690  C  CD2   . LEU F 3 265 ? -0.730  39.450 -98.082  1.00 67.91  ? 561 LEU B CD2   1 
ATOM   7691  N  N     . GLU F 3 266 ? 1.622   44.753 -99.587  1.00 68.98  ? 562 GLU B N     1 
ATOM   7692  C  CA    . GLU F 3 266 ? 1.189   46.105 -99.891  1.00 69.08  ? 562 GLU B CA    1 
ATOM   7693  C  C     . GLU F 3 266 ? 1.991   46.588 -101.094 1.00 69.12  ? 562 GLU B C     1 
ATOM   7694  O  O     . GLU F 3 266 ? 1.548   47.452 -101.852 1.00 68.65  ? 562 GLU B O     1 
ATOM   7695  C  CB    . GLU F 3 266 ? 1.391   47.013 -98.681  1.00 69.44  ? 562 GLU B CB    1 
ATOM   7696  C  CG    . GLU F 3 266 ? 0.508   46.611 -97.511  1.00 70.19  ? 562 GLU B CG    1 
ATOM   7697  C  CD    . GLU F 3 266 ? 0.327   47.718 -96.495  1.00 70.55  ? 562 GLU B CD    1 
ATOM   7698  O  OE1   . GLU F 3 266 ? -0.404  47.495 -95.506  1.00 70.94  ? 562 GLU B OE1   1 
ATOM   7699  O  OE2   . GLU F 3 266 ? 0.908   48.807 -96.684  1.00 70.86  ? 562 GLU B OE2   1 
ATOM   7700  N  N     . LYS F 3 267 ? 3.171   46.000 -101.263 1.00 69.14  ? 563 LYS B N     1 
ATOM   7701  C  CA    . LYS F 3 267 ? 4.051   46.316 -102.381 1.00 69.31  ? 563 LYS B CA    1 
ATOM   7702  C  C     . LYS F 3 267 ? 3.702   45.318 -103.478 1.00 69.45  ? 563 LYS B C     1 
ATOM   7703  O  O     . LYS F 3 267 ? 4.055   45.495 -104.647 1.00 69.65  ? 563 LYS B O     1 
ATOM   7704  C  CB    . LYS F 3 267 ? 5.513   46.149 -101.966 1.00 69.01  ? 563 LYS B CB    1 
ATOM   7705  C  CG    . LYS F 3 267 ? 5.914   46.993 -100.768 1.00 69.16  ? 563 LYS B CG    1 
ATOM   7706  C  CD    . LYS F 3 267 ? 7.331   46.675 -100.323 1.00 69.53  ? 563 LYS B CD    1 
ATOM   7707  C  CE    . LYS F 3 267 ? 7.800   47.626 -99.236  1.00 69.40  ? 563 LYS B CE    1 
ATOM   7708  N  NZ    . LYS F 3 267 ? 9.217   47.369 -98.866  1.00 69.59  ? 563 LYS B NZ    1 
ATOM   7709  N  N     . LEU F 3 268 ? 2.999   44.265 -103.075 1.00 69.51  ? 564 LEU B N     1 
ATOM   7710  C  CA    . LEU F 3 268 ? 2.564   43.211 -103.981 1.00 69.69  ? 564 LEU B CA    1 
ATOM   7711  C  C     . LEU F 3 268 ? 1.199   43.601 -104.542 1.00 69.76  ? 564 LEU B C     1 
ATOM   7712  O  O     . LEU F 3 268 ? 0.830   43.204 -105.645 1.00 69.91  ? 564 LEU B O     1 
ATOM   7713  C  CB    . LEU F 3 268 ? 2.475   41.886 -103.211 1.00 69.67  ? 564 LEU B CB    1 
ATOM   7714  C  CG    . LEU F 3 268 ? 2.067   40.572 -103.885 1.00 69.81  ? 564 LEU B CG    1 
ATOM   7715  C  CD1   . LEU F 3 268 ? 0.592   40.611 -104.239 1.00 69.83  ? 564 LEU B CD1   1 
ATOM   7716  C  CD2   . LEU F 3 268 ? 2.928   40.329 -105.116 1.00 69.97  ? 564 LEU B CD2   1 
ATOM   7717  N  N     . ALA F 3 269 ? 0.464   44.397 -103.772 1.00 69.96  ? 565 ALA B N     1 
ATOM   7718  C  CA    . ALA F 3 269 ? -0.869  44.859 -104.148 1.00 70.02  ? 565 ALA B CA    1 
ATOM   7719  C  C     . ALA F 3 269 ? -0.955  45.600 -105.483 1.00 70.12  ? 565 ALA B C     1 
ATOM   7720  O  O     . ALA F 3 269 ? -1.963  45.502 -106.185 1.00 70.17  ? 565 ALA B O     1 
ATOM   7721  C  CB    . ALA F 3 269 ? -1.437  45.735 -103.041 1.00 69.99  ? 565 ALA B CB    1 
ATOM   7722  N  N     . PRO F 3 270 ? 0.087   46.370 -105.844 1.00 70.09  ? 566 PRO B N     1 
ATOM   7723  C  CA    . PRO F 3 270 ? 0.046   47.100 -107.118 1.00 69.95  ? 566 PRO B CA    1 
ATOM   7724  C  C     . PRO F 3 270 ? -0.010  46.218 -108.368 1.00 69.70  ? 566 PRO B C     1 
ATOM   7725  O  O     . PRO F 3 270 ? 0.090   46.722 -109.486 1.00 69.89  ? 566 PRO B O     1 
ATOM   7726  C  CB    . PRO F 3 270 ? 1.317   47.949 -107.068 1.00 69.85  ? 566 PRO B CB    1 
ATOM   7727  C  CG    . PRO F 3 270 ? 1.468   48.223 -105.606 1.00 69.99  ? 566 PRO B CG    1 
ATOM   7728  C  CD    . PRO F 3 270 ? 1.194   46.862 -105.004 1.00 69.99  ? 566 PRO B CD    1 
ATOM   7729  N  N     . TYR F 3 271 ? -0.169  44.910 -108.181 1.00 69.43  ? 567 TYR B N     1 
ATOM   7730  C  CA    . TYR F 3 271 ? -0.235  43.983 -109.311 1.00 69.12  ? 567 TYR B CA    1 
ATOM   7731  C  C     . TYR F 3 271 ? -1.621  43.362 -109.448 1.00 68.84  ? 567 TYR B C     1 
ATOM   7732  O  O     . TYR F 3 271 ? -2.080  43.078 -110.555 1.00 68.65  ? 567 TYR B O     1 
ATOM   7733  C  CB    . TYR F 3 271 ? 0.795   42.854 -109.156 1.00 69.18  ? 567 TYR B CB    1 
ATOM   7734  C  CG    . TYR F 3 271 ? 2.238   43.306 -109.064 1.00 69.25  ? 567 TYR B CG    1 
ATOM   7735  C  CD1   . TYR F 3 271 ? 2.704   44.007 -107.948 1.00 69.41  ? 567 TYR B CD1   1 
ATOM   7736  C  CD2   . TYR F 3 271 ? 3.145   43.010 -110.080 1.00 69.17  ? 567 TYR B CD2   1 
ATOM   7737  C  CE1   . TYR F 3 271 ? 4.039   44.397 -107.847 1.00 69.23  ? 567 TYR B CE1   1 
ATOM   7738  C  CE2   . TYR F 3 271 ? 4.481   43.396 -109.988 1.00 69.32  ? 567 TYR B CE2   1 
ATOM   7739  C  CZ    . TYR F 3 271 ? 4.920   44.087 -108.869 1.00 69.32  ? 567 TYR B CZ    1 
ATOM   7740  O  OH    . TYR F 3 271 ? 6.241   44.460 -108.770 1.00 69.30  ? 567 TYR B OH    1 
ATOM   7741  N  N     . HIS F 3 272 ? -2.282  43.148 -108.316 1.00 68.60  ? 568 HIS B N     1 
ATOM   7742  C  CA    . HIS F 3 272 ? -3.606  42.547 -108.312 1.00 68.24  ? 568 HIS B CA    1 
ATOM   7743  C  C     . HIS F 3 272 ? -4.530  43.326 -107.378 1.00 68.09  ? 568 HIS B C     1 
ATOM   7744  O  O     . HIS F 3 272 ? -4.128  44.331 -106.791 1.00 68.24  ? 568 HIS B O     1 
ATOM   7745  C  CB    . HIS F 3 272 ? -3.498  41.091 -107.860 1.00 68.35  ? 568 HIS B CB    1 
ATOM   7746  C  CG    . HIS F 3 272 ? -4.582  40.209 -108.389 1.00 68.47  ? 568 HIS B CG    1 
ATOM   7747  N  ND1   . HIS F 3 272 ? -5.916  40.412 -108.104 1.00 68.61  ? 568 HIS B ND1   1 
ATOM   7748  C  CD2   . HIS F 3 272 ? -4.530  39.115 -109.184 1.00 68.66  ? 568 HIS B CD2   1 
ATOM   7749  C  CE1   . HIS F 3 272 ? -6.637  39.479 -108.699 1.00 68.88  ? 568 HIS B CE1   1 
ATOM   7750  N  NE2   . HIS F 3 272 ? -5.820  38.679 -109.362 1.00 69.04  ? 568 HIS B NE2   1 
ATOM   7751  N  N     . GLU F 3 273 ? -5.770  42.865 -107.247 1.00 67.79  ? 569 GLU B N     1 
ATOM   7752  C  CA    . GLU F 3 273 ? -6.742  43.531 -106.386 1.00 67.34  ? 569 GLU B CA    1 
ATOM   7753  C  C     . GLU F 3 273 ? -7.094  42.645 -105.195 1.00 66.85  ? 569 GLU B C     1 
ATOM   7754  O  O     . GLU F 3 273 ? -7.481  43.138 -104.139 1.00 66.69  ? 569 GLU B O     1 
ATOM   7755  C  CB    . GLU F 3 273 ? -8.006  43.871 -107.189 1.00 67.51  ? 569 GLU B CB    1 
ATOM   7756  C  CG    . GLU F 3 273 ? -9.009  44.764 -106.464 1.00 68.00  ? 569 GLU B CG    1 
ATOM   7757  C  CD    . GLU F 3 273 ? -10.221 45.113 -107.325 1.00 68.17  ? 569 GLU B CD    1 
ATOM   7758  O  OE1   . GLU F 3 273 ? -10.949 44.185 -107.733 1.00 68.32  ? 569 GLU B OE1   1 
ATOM   7759  O  OE2   . GLU F 3 273 ? -10.446 46.313 -107.595 1.00 68.31  ? 569 GLU B OE2   1 
ATOM   7760  N  N     . ILE F 3 274 ? -6.951  41.333 -105.370 1.00 66.45  ? 570 ILE B N     1 
ATOM   7761  C  CA    . ILE F 3 274 ? -7.252  40.377 -104.306 1.00 66.00  ? 570 ILE B CA    1 
ATOM   7762  C  C     . ILE F 3 274 ? -6.368  40.661 -103.097 1.00 65.87  ? 570 ILE B C     1 
ATOM   7763  O  O     . ILE F 3 274 ? -6.659  40.234 -101.980 1.00 65.45  ? 570 ILE B O     1 
ATOM   7764  C  CB    . ILE F 3 274 ? -7.002  38.920 -104.762 1.00 65.62  ? 570 ILE B CB    1 
ATOM   7765  C  CG1   . ILE F 3 274 ? -7.546  37.949 -103.713 1.00 65.32  ? 570 ILE B CG1   1 
ATOM   7766  C  CG2   . ILE F 3 274 ? -5.507  38.684 -104.969 1.00 65.35  ? 570 ILE B CG2   1 
ATOM   7767  C  CD1   . ILE F 3 274 ? -7.361  36.490 -104.066 1.00 64.81  ? 570 ILE B CD1   1 
ATOM   7768  N  N     . VAL F 3 275 ? -5.282  41.383 -103.339 1.00 65.90  ? 571 VAL B N     1 
ATOM   7769  C  CA    . VAL F 3 275 ? -4.349  41.733 -102.281 1.00 65.88  ? 571 VAL B CA    1 
ATOM   7770  C  C     . VAL F 3 275 ? -5.076  42.540 -101.210 1.00 65.90  ? 571 VAL B C     1 
ATOM   7771  O  O     . VAL F 3 275 ? -4.811  42.389 -100.016 1.00 65.92  ? 571 VAL B O     1 
ATOM   7772  C  CB    . VAL F 3 275 ? -3.182  42.575 -102.827 1.00 66.05  ? 571 VAL B CB    1 
ATOM   7773  C  CG1   . VAL F 3 275 ? -2.119  42.704 -101.772 1.00 65.93  ? 571 VAL B CG1   1 
ATOM   7774  C  CG2   . VAL F 3 275 ? -2.613  41.939 -104.086 1.00 66.04  ? 571 VAL B CG2   1 
ATOM   7775  N  N     . GLU F 3 276 ? -5.994  43.395 -101.651 1.00 65.90  ? 572 GLU B N     1 
ATOM   7776  C  CA    . GLU F 3 276 ? -6.778  44.234 -100.748 1.00 65.68  ? 572 GLU B CA    1 
ATOM   7777  C  C     . GLU F 3 276 ? -7.785  43.405 -99.947  1.00 65.18  ? 572 GLU B C     1 
ATOM   7778  O  O     . GLU F 3 276 ? -8.211  43.808 -98.866  1.00 65.07  ? 572 GLU B O     1 
ATOM   7779  C  CB    . GLU F 3 276 ? -7.515  45.314 -101.549 1.00 66.09  ? 572 GLU B CB    1 
ATOM   7780  C  CG    . GLU F 3 276 ? -6.600  46.352 -102.182 1.00 66.43  ? 572 GLU B CG    1 
ATOM   7781  C  CD    . GLU F 3 276 ? -7.323  47.253 -103.174 1.00 66.75  ? 572 GLU B CD    1 
ATOM   7782  O  OE1   . GLU F 3 276 ? -8.419  47.753 -102.840 1.00 66.75  ? 572 GLU B OE1   1 
ATOM   7783  O  OE2   . GLU F 3 276 ? -6.787  47.467 -104.286 1.00 66.78  ? 572 GLU B OE2   1 
ATOM   7784  N  N     . ASN F 3 277 ? -8.164  42.249 -100.482 1.00 64.49  ? 573 ASN B N     1 
ATOM   7785  C  CA    . ASN F 3 277 ? -9.116  41.378 -99.802  1.00 63.78  ? 573 ASN B CA    1 
ATOM   7786  C  C     . ASN F 3 277 ? -8.415  40.457 -98.813  1.00 62.91  ? 573 ASN B C     1 
ATOM   7787  O  O     . ASN F 3 277 ? -9.047  39.895 -97.918  1.00 62.84  ? 573 ASN B O     1 
ATOM   7788  C  CB    . ASN F 3 277 ? -9.887  40.544 -100.820 1.00 64.15  ? 573 ASN B CB    1 
ATOM   7789  C  CG    . ASN F 3 277 ? -10.738 41.393 -101.727 1.00 64.64  ? 573 ASN B CG    1 
ATOM   7790  O  OD1   . ASN F 3 277 ? -10.563 41.390 -102.948 1.00 65.27  ? 573 ASN B OD1   1 
ATOM   7791  N  ND2   . ASN F 3 277 ? -11.669 42.135 -101.136 1.00 64.45  ? 573 ASN B ND2   1 
ATOM   7792  N  N     . ILE F 3 278 ? -7.107  40.302 -98.984  1.00 61.71  ? 574 ILE B N     1 
ATOM   7793  C  CA    . ILE F 3 278 ? -6.326  39.456 -98.096  1.00 60.45  ? 574 ILE B CA    1 
ATOM   7794  C  C     . ILE F 3 278 ? -5.968  40.259 -96.857  1.00 59.53  ? 574 ILE B C     1 
ATOM   7795  O  O     . ILE F 3 278 ? -6.152  39.799 -95.731  1.00 59.11  ? 574 ILE B O     1 
ATOM   7796  C  CB    . ILE F 3 278 ? -5.036  38.965 -98.780  1.00 60.51  ? 574 ILE B CB    1 
ATOM   7797  C  CG1   . ILE F 3 278 ? -5.397  38.163 -100.032 1.00 60.38  ? 574 ILE B CG1   1 
ATOM   7798  C  CG2   . ILE F 3 278 ? -4.215  38.120 -97.812  1.00 60.36  ? 574 ILE B CG2   1 
ATOM   7799  C  CD1   . ILE F 3 278 ? -6.343  37.003 -99.769  1.00 60.28  ? 574 ILE B CD1   1 
ATOM   7800  N  N     . LEU F 3 279 ? -5.461  41.468 -97.068  1.00 58.61  ? 575 LEU B N     1 
ATOM   7801  C  CA    . LEU F 3 279 ? -5.102  42.322 -95.952  1.00 57.93  ? 575 LEU B CA    1 
ATOM   7802  C  C     . LEU F 3 279 ? -6.371  42.746 -95.210  1.00 57.45  ? 575 LEU B C     1 
ATOM   7803  O  O     . LEU F 3 279 ? -6.348  42.959 -93.999  1.00 57.21  ? 575 LEU B O     1 
ATOM   7804  C  CB    . LEU F 3 279 ? -4.335  43.549 -96.451  1.00 58.11  ? 575 LEU B CB    1 
ATOM   7805  C  CG    . LEU F 3 279 ? -2.991  43.263 -97.134  1.00 58.40  ? 575 LEU B CG    1 
ATOM   7806  C  CD1   . LEU F 3 279 ? -2.360  44.564 -97.607  1.00 58.36  ? 575 LEU B CD1   1 
ATOM   7807  C  CD2   . LEU F 3 279 ? -2.063  42.541 -96.165  1.00 58.42  ? 575 LEU B CD2   1 
ATOM   7808  N  N     . HIS F 3 280 ? -7.479  42.847 -95.941  1.00 56.71  ? 576 HIS B N     1 
ATOM   7809  C  CA    . HIS F 3 280 ? -8.753  43.245 -95.351  1.00 55.84  ? 576 HIS B CA    1 
ATOM   7810  C  C     . HIS F 3 280 ? -9.233  42.163 -94.402  1.00 55.04  ? 576 HIS B C     1 
ATOM   7811  O  O     . HIS F 3 280 ? -9.818  42.452 -93.358  1.00 54.66  ? 576 HIS B O     1 
ATOM   7812  C  CB    . HIS F 3 280 ? -9.815  43.455 -96.437  1.00 56.24  ? 576 HIS B CB    1 
ATOM   7813  C  CG    . HIS F 3 280 ? -11.021 44.212 -95.967  1.00 56.59  ? 576 HIS B CG    1 
ATOM   7814  N  ND1   . HIS F 3 280 ? -12.254 44.106 -96.577  1.00 56.77  ? 576 HIS B ND1   1 
ATOM   7815  C  CD2   . HIS F 3 280 ? -11.175 45.114 -94.967  1.00 56.77  ? 576 HIS B CD2   1 
ATOM   7816  C  CE1   . HIS F 3 280 ? -13.113 44.909 -95.974  1.00 56.91  ? 576 HIS B CE1   1 
ATOM   7817  N  NE2   . HIS F 3 280 ? -12.484 45.532 -94.994  1.00 56.84  ? 576 HIS B NE2   1 
ATOM   7818  N  N     . TYR F 3 281 ? -8.982  40.912 -94.777  1.00 54.13  ? 577 TYR B N     1 
ATOM   7819  C  CA    . TYR F 3 281 ? -9.398  39.781 -93.962  1.00 53.25  ? 577 TYR B CA    1 
ATOM   7820  C  C     . TYR F 3 281 ? -8.592  39.678 -92.674  1.00 52.62  ? 577 TYR B C     1 
ATOM   7821  O  O     . TYR F 3 281 ? -9.143  39.400 -91.609  1.00 51.89  ? 577 TYR B O     1 
ATOM   7822  C  CB    . TYR F 3 281 ? -9.259  38.478 -94.742  1.00 52.91  ? 577 TYR B CB    1 
ATOM   7823  C  CG    . TYR F 3 281 ? -10.089 37.363 -94.156  1.00 53.08  ? 577 TYR B CG    1 
ATOM   7824  C  CD1   . TYR F 3 281 ? -11.484 37.427 -94.177  1.00 52.98  ? 577 TYR B CD1   1 
ATOM   7825  C  CD2   . TYR F 3 281 ? -9.488  36.256 -93.560  1.00 52.73  ? 577 TYR B CD2   1 
ATOM   7826  C  CE1   . TYR F 3 281 ? -12.261 36.414 -93.620  1.00 53.17  ? 577 TYR B CE1   1 
ATOM   7827  C  CE2   . TYR F 3 281 ? -10.256 35.238 -92.998  1.00 53.25  ? 577 TYR B CE2   1 
ATOM   7828  C  CZ    . TYR F 3 281 ? -11.641 35.323 -93.033  1.00 53.26  ? 577 TYR B CZ    1 
ATOM   7829  O  OH    . TYR F 3 281 ? -12.405 34.314 -92.493  1.00 53.73  ? 577 TYR B OH    1 
ATOM   7830  N  N     . ARG F 3 282 ? -7.286  39.899 -92.785  1.00 52.23  ? 578 ARG B N     1 
ATOM   7831  C  CA    . ARG F 3 282 ? -6.386  39.833 -91.640  1.00 52.00  ? 578 ARG B CA    1 
ATOM   7832  C  C     . ARG F 3 282 ? -6.592  41.006 -90.689  1.00 52.19  ? 578 ARG B C     1 
ATOM   7833  O  O     . ARG F 3 282 ? -6.352  40.887 -89.487  1.00 51.98  ? 578 ARG B O     1 
ATOM   7834  C  CB    . ARG F 3 282 ? -4.929  39.818 -92.114  1.00 51.64  ? 578 ARG B CB    1 
ATOM   7835  C  CG    . ARG F 3 282 ? -4.490  38.533 -92.807  1.00 50.38  ? 578 ARG B CG    1 
ATOM   7836  C  CD    . ARG F 3 282 ? -3.055  38.660 -93.305  1.00 49.41  ? 578 ARG B CD    1 
ATOM   7837  N  NE    . ARG F 3 282 ? -2.534  37.406 -93.846  1.00 47.92  ? 578 ARG B NE    1 
ATOM   7838  C  CZ    . ARG F 3 282 ? -1.360  37.294 -94.462  1.00 47.41  ? 578 ARG B CZ    1 
ATOM   7839  N  NH1   . ARG F 3 282 ? -0.584  38.362 -94.617  1.00 46.72  ? 578 ARG B NH1   1 
ATOM   7840  N  NH2   . ARG F 3 282 ? -0.963  36.115 -94.923  1.00 46.34  ? 578 ARG B NH2   1 
ATOM   7841  N  N     . GLN F 3 283 ? -7.029  42.138 -91.239  1.00 52.58  ? 579 GLN B N     1 
ATOM   7842  C  CA    . GLN F 3 283 ? -7.276  43.349 -90.456  1.00 52.73  ? 579 GLN B CA    1 
ATOM   7843  C  C     . GLN F 3 283 ? -8.521  43.171 -89.609  1.00 52.53  ? 579 GLN B C     1 
ATOM   7844  O  O     . GLN F 3 283 ? -8.503  43.387 -88.399  1.00 52.50  ? 579 GLN B O     1 
ATOM   7845  C  CB    . GLN F 3 283 ? -7.488  44.549 -91.378  1.00 53.54  ? 579 GLN B CB    1 
ATOM   7846  C  CG    . GLN F 3 283 ? -7.789  45.845 -90.636  1.00 54.54  ? 579 GLN B CG    1 
ATOM   7847  C  CD    . GLN F 3 283 ? -8.806  46.709 -91.355  1.00 54.79  ? 579 GLN B CD    1 
ATOM   7848  O  OE1   . GLN F 3 283 ? -8.658  47.002 -92.540  1.00 55.43  ? 579 GLN B OE1   1 
ATOM   7849  N  NE2   . GLN F 3 283 ? -9.848  47.122 -90.638  1.00 55.24  ? 579 GLN B NE2   1 
ATOM   7850  N  N     . LEU F 3 284 ? -9.608  42.789 -90.268  1.00 52.37  ? 580 LEU B N     1 
ATOM   7851  C  CA    . LEU F 3 284 ? -10.888 42.569 -89.606  1.00 51.97  ? 580 LEU B CA    1 
ATOM   7852  C  C     . LEU F 3 284 ? -10.806 41.350 -88.702  1.00 51.72  ? 580 LEU B C     1 
ATOM   7853  O  O     . LEU F 3 284 ? -11.276 41.368 -87.567  1.00 52.15  ? 580 LEU B O     1 
ATOM   7854  C  CB    . LEU F 3 284 ? -11.979 42.343 -90.653  1.00 51.82  ? 580 LEU B CB    1 
ATOM   7855  C  CG    . LEU F 3 284 ? -12.290 43.497 -91.603  1.00 51.51  ? 580 LEU B CG    1 
ATOM   7856  C  CD1   . LEU F 3 284 ? -13.054 42.976 -92.805  1.00 51.72  ? 580 LEU B CD1   1 
ATOM   7857  C  CD2   . LEU F 3 284 ? -13.088 44.562 -90.861  1.00 51.42  ? 580 LEU B CD2   1 
ATOM   7858  N  N     . GLY F 3 285 ? -10.202 40.288 -89.218  1.00 51.49  ? 581 GLY B N     1 
ATOM   7859  C  CA    . GLY F 3 285 ? -10.076 39.062 -88.456  1.00 50.69  ? 581 GLY B CA    1 
ATOM   7860  C  C     . GLY F 3 285 ? -9.262  39.187 -87.184  1.00 49.93  ? 581 GLY B C     1 
ATOM   7861  O  O     . GLY F 3 285 ? -9.475  38.431 -86.236  1.00 49.98  ? 581 GLY B O     1 
ATOM   7862  N  N     . LYS F 3 286 ? -8.330  40.132 -87.144  1.00 49.12  ? 582 LYS B N     1 
ATOM   7863  C  CA    . LYS F 3 286 ? -7.510  40.287 -85.952  1.00 48.28  ? 582 LYS B CA    1 
ATOM   7864  C  C     . LYS F 3 286 ? -8.249  41.075 -84.887  1.00 47.64  ? 582 LYS B C     1 
ATOM   7865  O  O     . LYS F 3 286 ? -7.975  40.926 -83.700  1.00 47.92  ? 582 LYS B O     1 
ATOM   7866  C  CB    . LYS F 3 286 ? -6.186  40.975 -86.284  1.00 48.67  ? 582 LYS B CB    1 
ATOM   7867  C  CG    . LYS F 3 286 ? -5.123  40.757 -85.223  1.00 48.20  ? 582 LYS B CG    1 
ATOM   7868  C  CD    . LYS F 3 286 ? -3.807  41.390 -85.622  1.00 48.73  ? 582 LYS B CD    1 
ATOM   7869  C  CE    . LYS F 3 286 ? -2.697  41.016 -84.649  1.00 48.81  ? 582 LYS B CE    1 
ATOM   7870  N  NZ    . LYS F 3 286 ? -2.470  39.549 -84.594  1.00 48.21  ? 582 LYS B NZ    1 
ATOM   7871  N  N     . LEU F 3 287 ? -9.191  41.911 -85.308  1.00 46.51  ? 583 LEU B N     1 
ATOM   7872  C  CA    . LEU F 3 287 ? -9.965  42.701 -84.363  1.00 45.88  ? 583 LEU B CA    1 
ATOM   7873  C  C     . LEU F 3 287 ? -10.959 41.841 -83.602  1.00 46.15  ? 583 LEU B C     1 
ATOM   7874  O  O     . LEU F 3 287 ? -11.132 41.993 -82.394  1.00 45.96  ? 583 LEU B O     1 
ATOM   7875  C  CB    . LEU F 3 287 ? -10.708 43.825 -85.089  1.00 44.63  ? 583 LEU B CB    1 
ATOM   7876  C  CG    . LEU F 3 287 ? -9.911  45.116 -85.268  1.00 43.55  ? 583 LEU B CG    1 
ATOM   7877  C  CD1   . LEU F 3 287 ? -8.562  44.823 -85.912  1.00 42.97  ? 583 LEU B CD1   1 
ATOM   7878  C  CD2   . LEU F 3 287 ? -10.715 46.089 -86.101  1.00 43.26  ? 583 LEU B CD2   1 
ATOM   7879  N  N     . GLN F 3 288 ? -11.614 40.935 -84.313  1.00 46.36  ? 584 GLN B N     1 
ATOM   7880  C  CA    . GLN F 3 288 ? -12.589 40.066 -83.685  1.00 47.26  ? 584 GLN B CA    1 
ATOM   7881  C  C     . GLN F 3 288 ? -11.871 39.079 -82.767  1.00 47.28  ? 584 GLN B C     1 
ATOM   7882  O  O     . GLN F 3 288 ? -11.498 39.417 -81.639  1.00 47.28  ? 584 GLN B O     1 
ATOM   7883  C  CB    . GLN F 3 288 ? -13.382 39.309 -84.756  1.00 47.95  ? 584 GLN B CB    1 
ATOM   7884  C  CG    . GLN F 3 288 ? -14.647 38.666 -84.232  1.00 48.63  ? 584 GLN B CG    1 
ATOM   7885  C  CD    . GLN F 3 288 ? -15.680 39.692 -83.826  1.00 49.46  ? 584 GLN B CD    1 
ATOM   7886  O  OE1   . GLN F 3 288 ? -15.363 40.676 -83.151  1.00 49.78  ? 584 GLN B OE1   1 
ATOM   7887  N  NE2   . GLN F 3 288 ? -16.929 39.469 -84.230  1.00 49.42  ? 584 GLN B NE2   1 
ATOM   7888  N  N     . SER F 3 289 ? -11.678 37.865 -83.274  1.00 47.17  ? 585 SER B N     1 
ATOM   7889  C  CA    . SER F 3 289 ? -11.012 36.787 -82.552  1.00 47.29  ? 585 SER B CA    1 
ATOM   7890  C  C     . SER F 3 289 ? -10.107 37.243 -81.406  1.00 47.06  ? 585 SER B C     1 
ATOM   7891  O  O     . SER F 3 289 ? -10.324 36.862 -80.256  1.00 47.06  ? 585 SER B O     1 
ATOM   7892  C  CB    . SER F 3 289 ? -10.188 35.953 -83.528  1.00 47.07  ? 585 SER B CB    1 
ATOM   7893  O  OG    . SER F 3 289 ? -9.093  36.705 -84.020  1.00 47.42  ? 585 SER B OG    1 
ATOM   7894  N  N     . THR F 3 290 ? -9.107  38.061 -81.721  1.00 46.60  ? 586 THR B N     1 
ATOM   7895  C  CA    . THR F 3 290 ? -8.160  38.543 -80.720  1.00 46.87  ? 586 THR B CA    1 
ATOM   7896  C  C     . THR F 3 290 ? -8.673  39.545 -79.683  1.00 47.08  ? 586 THR B C     1 
ATOM   7897  O  O     . THR F 3 290 ? -8.924  39.176 -78.534  1.00 47.25  ? 586 THR B O     1 
ATOM   7898  C  CB    . THR F 3 290 ? -6.899  39.150 -81.387  1.00 46.98  ? 586 THR B CB    1 
ATOM   7899  O  OG1   . THR F 3 290 ? -6.164  38.114 -82.046  1.00 47.33  ? 586 THR B OG1   1 
ATOM   7900  C  CG2   . THR F 3 290 ? -5.996  39.808 -80.345  1.00 46.57  ? 586 THR B CG2   1 
ATOM   7901  N  N     . TYR F 3 291 ? -8.821  40.807 -80.074  1.00 46.54  ? 587 TYR B N     1 
ATOM   7902  C  CA    . TYR F 3 291 ? -9.256  41.821 -79.120  1.00 46.20  ? 587 TYR B CA    1 
ATOM   7903  C  C     . TYR F 3 291 ? -10.725 41.803 -78.698  1.00 45.97  ? 587 TYR B C     1 
ATOM   7904  O  O     . TYR F 3 291 ? -11.014 41.895 -77.516  1.00 46.58  ? 587 TYR B O     1 
ATOM   7905  C  CB    . TYR F 3 291 ? -8.873  43.216 -79.621  1.00 45.19  ? 587 TYR B CB    1 
ATOM   7906  C  CG    . TYR F 3 291 ? -7.382  43.396 -79.823  1.00 44.58  ? 587 TYR B CG    1 
ATOM   7907  C  CD1   . TYR F 3 291 ? -6.782  43.084 -81.045  1.00 43.89  ? 587 TYR B CD1   1 
ATOM   7908  C  CD2   . TYR F 3 291 ? -6.568  43.869 -78.790  1.00 43.81  ? 587 TYR B CD2   1 
ATOM   7909  C  CE1   . TYR F 3 291 ? -5.406  43.241 -81.238  1.00 43.67  ? 587 TYR B CE1   1 
ATOM   7910  C  CE2   . TYR F 3 291 ? -5.188  44.030 -78.971  1.00 43.33  ? 587 TYR B CE2   1 
ATOM   7911  C  CZ    . TYR F 3 291 ? -4.616  43.712 -80.198  1.00 43.33  ? 587 TYR B CZ    1 
ATOM   7912  O  OH    . TYR F 3 291 ? -3.261  43.852 -80.393  1.00 41.17  ? 587 TYR B OH    1 
ATOM   7913  N  N     . ILE F 3 292 ? -11.655 41.686 -79.637  1.00 46.13  ? 588 ILE B N     1 
ATOM   7914  C  CA    . ILE F 3 292 ? -13.073 41.663 -79.266  1.00 45.81  ? 588 ILE B CA    1 
ATOM   7915  C  C     . ILE F 3 292 ? -13.444 40.386 -78.519  1.00 45.83  ? 588 ILE B C     1 
ATOM   7916  O  O     . ILE F 3 292 ? -13.732 40.416 -77.322  1.00 45.07  ? 588 ILE B O     1 
ATOM   7917  C  CB    . ILE F 3 292 ? -13.996 41.781 -80.504  1.00 45.42  ? 588 ILE B CB    1 
ATOM   7918  C  CG1   . ILE F 3 292 ? -13.959 43.205 -81.047  1.00 45.18  ? 588 ILE B CG1   1 
ATOM   7919  C  CG2   . ILE F 3 292 ? -15.434 41.423 -80.124  1.00 45.07  ? 588 ILE B CG2   1 
ATOM   7920  C  CD1   . ILE F 3 292 ? -14.583 44.216 -80.106  1.00 45.43  ? 588 ILE B CD1   1 
ATOM   7921  N  N     . GLU F 3 293 ? -13.433 39.271 -79.244  1.00 46.28  ? 589 GLU B N     1 
ATOM   7922  C  CA    . GLU F 3 293 ? -13.775 37.966 -78.693  1.00 46.81  ? 589 GLU B CA    1 
ATOM   7923  C  C     . GLU F 3 293 ? -12.943 37.609 -77.470  1.00 46.75  ? 589 GLU B C     1 
ATOM   7924  O  O     . GLU F 3 293 ? -13.445 36.997 -76.527  1.00 46.99  ? 589 GLU B O     1 
ATOM   7925  C  CB    . GLU F 3 293 ? -13.606 36.891 -79.768  1.00 47.69  ? 589 GLU B CB    1 
ATOM   7926  C  CG    . GLU F 3 293 ? -14.303 37.236 -81.077  1.00 49.18  ? 589 GLU B CG    1 
ATOM   7927  C  CD    . GLU F 3 293 ? -15.032 36.050 -81.693  1.00 50.37  ? 589 GLU B CD    1 
ATOM   7928  O  OE1   . GLU F 3 293 ? -14.376 35.026 -81.980  1.00 51.04  ? 589 GLU B OE1   1 
ATOM   7929  O  OE2   . GLU F 3 293 ? -16.265 36.145 -81.891  1.00 50.73  ? 589 GLU B OE2   1 
ATOM   7930  N  N     . GLY F 3 294 ? -11.673 37.997 -77.488  1.00 46.47  ? 590 GLY B N     1 
ATOM   7931  C  CA    . GLY F 3 294 ? -10.798 37.712 -76.369  1.00 46.02  ? 590 GLY B CA    1 
ATOM   7932  C  C     . GLY F 3 294 ? -11.172 38.498 -75.128  1.00 45.96  ? 590 GLY B C     1 
ATOM   7933  O  O     . GLY F 3 294 ? -11.335 37.920 -74.048  1.00 45.74  ? 590 GLY B O     1 
ATOM   7934  N  N     . LEU F 3 295 ? -11.307 39.815 -75.280  1.00 45.34  ? 591 LEU B N     1 
ATOM   7935  C  CA    . LEU F 3 295 ? -11.657 40.688 -74.166  1.00 44.61  ? 591 LEU B CA    1 
ATOM   7936  C  C     . LEU F 3 295 ? -12.994 40.321 -73.538  1.00 44.52  ? 591 LEU B C     1 
ATOM   7937  O  O     . LEU F 3 295 ? -13.164 40.425 -72.326  1.00 44.23  ? 591 LEU B O     1 
ATOM   7938  C  CB    . LEU F 3 295 ? -11.681 42.152 -74.619  1.00 44.56  ? 591 LEU B CB    1 
ATOM   7939  C  CG    . LEU F 3 295 ? -10.328 42.858 -74.779  1.00 44.46  ? 591 LEU B CG    1 
ATOM   7940  C  CD1   . LEU F 3 295 ? -10.538 44.266 -75.319  1.00 44.30  ? 591 LEU B CD1   1 
ATOM   7941  C  CD2   . LEU F 3 295 ? -9.613  42.905 -73.435  1.00 44.02  ? 591 LEU B CD2   1 
ATOM   7942  N  N     . LEU F 3 296 ? -13.941 39.887 -74.359  1.00 44.70  ? 592 LEU B N     1 
ATOM   7943  C  CA    . LEU F 3 296 ? -15.253 39.503 -73.861  1.00 45.00  ? 592 LEU B CA    1 
ATOM   7944  C  C     . LEU F 3 296 ? -15.171 38.249 -72.999  1.00 45.49  ? 592 LEU B C     1 
ATOM   7945  O  O     . LEU F 3 296 ? -15.973 38.063 -72.082  1.00 45.57  ? 592 LEU B O     1 
ATOM   7946  C  CB    . LEU F 3 296 ? -16.215 39.268 -75.029  1.00 45.32  ? 592 LEU B CB    1 
ATOM   7947  C  CG    . LEU F 3 296 ? -16.842 40.522 -75.654  1.00 45.23  ? 592 LEU B CG    1 
ATOM   7948  C  CD1   . LEU F 3 296 ? -17.483 40.171 -76.983  1.00 44.84  ? 592 LEU B CD1   1 
ATOM   7949  C  CD2   . LEU F 3 296 ? -17.871 41.113 -74.700  1.00 44.99  ? 592 LEU B CD2   1 
ATOM   7950  N  N     . LYS F 3 297 ? -14.194 37.395 -73.284  1.00 45.49  ? 593 LYS B N     1 
ATOM   7951  C  CA    . LYS F 3 297 ? -14.035 36.161 -72.523  1.00 45.77  ? 593 LYS B CA    1 
ATOM   7952  C  C     . LYS F 3 297 ? -13.294 36.331 -71.202  1.00 45.74  ? 593 LYS B C     1 
ATOM   7953  O  O     . LYS F 3 297 ? -13.545 35.584 -70.260  1.00 46.39  ? 593 LYS B O     1 
ATOM   7954  C  CB    . LYS F 3 297 ? -13.323 35.097 -73.364  1.00 45.75  ? 593 LYS B CB    1 
ATOM   7955  C  CG    . LYS F 3 297 ? -14.110 34.639 -74.586  1.00 46.39  ? 593 LYS B CG    1 
ATOM   7956  C  CD    . LYS F 3 297 ? -13.913 33.155 -74.869  1.00 46.08  ? 593 LYS B CD    1 
ATOM   7957  C  CE    . LYS F 3 297 ? -12.477 32.825 -75.228  1.00 46.70  ? 593 LYS B CE    1 
ATOM   7958  N  NZ    . LYS F 3 297 ? -12.297 31.366 -75.474  1.00 46.21  ? 593 LYS B NZ    1 
ATOM   7959  N  N     . VAL F 3 298 ? -12.399 37.315 -71.126  1.00 45.68  ? 594 VAL B N     1 
ATOM   7960  C  CA    . VAL F 3 298 ? -11.611 37.536 -69.916  1.00 45.46  ? 594 VAL B CA    1 
ATOM   7961  C  C     . VAL F 3 298 ? -12.148 38.616 -68.963  1.00 46.06  ? 594 VAL B C     1 
ATOM   7962  O  O     . VAL F 3 298 ? -11.486 38.955 -67.978  1.00 45.55  ? 594 VAL B O     1 
ATOM   7963  C  CB    . VAL F 3 298 ? -10.128 37.862 -70.283  1.00 45.61  ? 594 VAL B CB    1 
ATOM   7964  C  CG1   . VAL F 3 298 ? -10.001 39.299 -70.757  1.00 44.09  ? 594 VAL B CG1   1 
ATOM   7965  C  CG2   . VAL F 3 298 ? -9.217  37.595 -69.098  1.00 44.90  ? 594 VAL B CG2   1 
ATOM   7966  N  N     . VAL F 3 299 ? -13.338 39.151 -69.244  1.00 46.31  ? 595 VAL B N     1 
ATOM   7967  C  CA    . VAL F 3 299 ? -13.930 40.173 -68.376  1.00 46.67  ? 595 VAL B CA    1 
ATOM   7968  C  C     . VAL F 3 299 ? -14.749 39.496 -67.285  1.00 46.90  ? 595 VAL B C     1 
ATOM   7969  O  O     . VAL F 3 299 ? -15.256 38.386 -67.475  1.00 46.82  ? 595 VAL B O     1 
ATOM   7970  C  CB    . VAL F 3 299 ? -14.890 41.137 -69.139  1.00 46.91  ? 595 VAL B CB    1 
ATOM   7971  C  CG1   . VAL F 3 299 ? -14.153 41.872 -70.219  1.00 46.61  ? 595 VAL B CG1   1 
ATOM   7972  C  CG2   . VAL F 3 299 ? -16.057 40.362 -69.722  1.00 46.78  ? 595 VAL B CG2   1 
ATOM   7973  N  N     . ARG F 3 300 ? -14.892 40.169 -66.150  1.00 46.73  ? 596 ARG B N     1 
ATOM   7974  C  CA    . ARG F 3 300 ? -15.664 39.612 -65.049  1.00 47.10  ? 596 ARG B CA    1 
ATOM   7975  C  C     . ARG F 3 300 ? -17.125 40.084 -65.075  1.00 47.19  ? 596 ARG B C     1 
ATOM   7976  O  O     . ARG F 3 300 ? -17.408 41.266 -64.888  1.00 47.41  ? 596 ARG B O     1 
ATOM   7977  C  CB    . ARG F 3 300 ? -14.997 39.979 -63.727  1.00 46.51  ? 596 ARG B CB    1 
ATOM   7978  C  CG    . ARG F 3 300 ? -13.533 39.588 -63.689  1.00 46.99  ? 596 ARG B CG    1 
ATOM   7979  C  CD    . ARG F 3 300 ? -12.977 39.641 -62.285  1.00 47.66  ? 596 ARG B CD    1 
ATOM   7980  N  NE    . ARG F 3 300 ? -13.496 38.559 -61.458  1.00 48.63  ? 596 ARG B NE    1 
ATOM   7981  C  CZ    . ARG F 3 300 ? -13.180 37.278 -61.619  1.00 49.17  ? 596 ARG B CZ    1 
ATOM   7982  N  NH1   . ARG F 3 300 ? -12.339 36.912 -62.579  1.00 50.12  ? 596 ARG B NH1   1 
ATOM   7983  N  NH2   . ARG F 3 300 ? -13.705 36.360 -60.821  1.00 49.31  ? 596 ARG B NH2   1 
ATOM   7984  N  N     . PRO F 3 301 ? -18.068 39.155 -65.317  1.00 47.44  ? 597 PRO B N     1 
ATOM   7985  C  CA    . PRO F 3 301 ? -19.511 39.419 -65.381  1.00 47.63  ? 597 PRO B CA    1 
ATOM   7986  C  C     . PRO F 3 301 ? -20.122 39.735 -64.020  1.00 48.44  ? 597 PRO B C     1 
ATOM   7987  O  O     . PRO F 3 301 ? -21.298 39.453 -63.764  1.00 48.48  ? 597 PRO B O     1 
ATOM   7988  C  CB    . PRO F 3 301 ? -20.062 38.129 -65.963  1.00 47.56  ? 597 PRO B CB    1 
ATOM   7989  C  CG    . PRO F 3 301 ? -19.165 37.105 -65.365  1.00 47.48  ? 597 PRO B CG    1 
ATOM   7990  C  CD    . PRO F 3 301 ? -17.798 37.729 -65.571  1.00 47.29  ? 597 PRO B CD    1 
ATOM   7991  N  N     . ASP F 3 302 ? -19.311 40.323 -63.150  1.00 48.73  ? 598 ASP B N     1 
ATOM   7992  C  CA    . ASP F 3 302 ? -19.744 40.677 -61.807  1.00 49.01  ? 598 ASP B CA    1 
ATOM   7993  C  C     . ASP F 3 302 ? -19.432 42.140 -61.571  1.00 48.62  ? 598 ASP B C     1 
ATOM   7994  O  O     . ASP F 3 302 ? -19.789 42.698 -60.537  1.00 49.45  ? 598 ASP B O     1 
ATOM   7995  C  CB    . ASP F 3 302 ? -18.995 39.823 -60.782  1.00 49.52  ? 598 ASP B CB    1 
ATOM   7996  C  CG    . ASP F 3 302 ? -17.487 39.978 -60.891  1.00 50.13  ? 598 ASP B CG    1 
ATOM   7997  O  OD1   . ASP F 3 302 ? -16.937 40.935 -60.306  1.00 50.84  ? 598 ASP B OD1   1 
ATOM   7998  O  OD2   . ASP F 3 302 ? -16.851 39.150 -61.578  1.00 50.62  ? 598 ASP B OD2   1 
ATOM   7999  N  N     . THR F 3 303 ? -18.757 42.752 -62.537  1.00 48.06  ? 599 THR B N     1 
ATOM   8000  C  CA    . THR F 3 303 ? -18.369 44.155 -62.447  1.00 47.04  ? 599 THR B CA    1 
ATOM   8001  C  C     . THR F 3 303 ? -17.978 44.688 -63.823  1.00 46.52  ? 599 THR B C     1 
ATOM   8002  O  O     . THR F 3 303 ? -17.719 45.882 -63.986  1.00 46.43  ? 599 THR B O     1 
ATOM   8003  C  CB    . THR F 3 303 ? -17.156 44.333 -61.513  1.00 47.27  ? 599 THR B CB    1 
ATOM   8004  O  OG1   . THR F 3 303 ? -16.124 43.418 -61.902  1.00 47.48  ? 599 THR B OG1   1 
ATOM   8005  C  CG2   . THR F 3 303 ? -17.535 44.080 -60.066  1.00 46.99  ? 599 THR B CG2   1 
ATOM   8006  N  N     . LYS F 3 304 ? -17.934 43.796 -64.809  1.00 45.64  ? 600 LYS B N     1 
ATOM   8007  C  CA    . LYS F 3 304 ? -17.551 44.171 -66.165  1.00 44.97  ? 600 LYS B CA    1 
ATOM   8008  C  C     . LYS F 3 304 ? -16.096 44.643 -66.214  1.00 43.97  ? 600 LYS B C     1 
ATOM   8009  O  O     . LYS F 3 304 ? -15.700 45.370 -67.125  1.00 43.60  ? 600 LYS B O     1 
ATOM   8010  C  CB    . LYS F 3 304 ? -18.460 45.282 -66.699  1.00 45.72  ? 600 LYS B CB    1 
ATOM   8011  C  CG    . LYS F 3 304 ? -19.913 44.876 -66.901  1.00 47.03  ? 600 LYS B CG    1 
ATOM   8012  C  CD    . LYS F 3 304 ? -20.694 45.969 -67.617  1.00 47.92  ? 600 LYS B CD    1 
ATOM   8013  C  CE    . LYS F 3 304 ? -20.112 46.245 -68.999  1.00 48.84  ? 600 LYS B CE    1 
ATOM   8014  N  NZ    . LYS F 3 304 ? -20.796 47.377 -69.686  1.00 49.80  ? 600 LYS B NZ    1 
ATOM   8015  N  N     . LYS F 3 305 ? -15.295 44.223 -65.241  1.00 42.87  ? 601 LYS B N     1 
ATOM   8016  C  CA    . LYS F 3 305 ? -13.898 44.632 -65.219  1.00 41.79  ? 601 LYS B CA    1 
ATOM   8017  C  C     . LYS F 3 305 ? -12.930 43.555 -65.692  1.00 41.62  ? 601 LYS B C     1 
ATOM   8018  O  O     . LYS F 3 305 ? -13.172 42.361 -65.518  1.00 42.19  ? 601 LYS B O     1 
ATOM   8019  C  CB    . LYS F 3 305 ? -13.500 45.109 -63.816  1.00 40.69  ? 601 LYS B CB    1 
ATOM   8020  C  CG    . LYS F 3 305 ? -14.075 46.473 -63.439  1.00 39.85  ? 601 LYS B CG    1 
ATOM   8021  C  CD    . LYS F 3 305 ? -13.418 47.091 -62.199  1.00 38.33  ? 601 LYS B CD    1 
ATOM   8022  C  CE    . LYS F 3 305 ? -13.879 46.438 -60.906  1.00 37.45  ? 601 LYS B CE    1 
ATOM   8023  N  NZ    . LYS F 3 305 ? -13.338 47.134 -59.694  1.00 36.54  ? 601 LYS B NZ    1 
ATOM   8024  N  N     . VAL F 3 306 ? -11.843 43.997 -66.317  1.00 41.41  ? 602 VAL B N     1 
ATOM   8025  C  CA    . VAL F 3 306 ? -10.799 43.099 -66.797  1.00 40.78  ? 602 VAL B CA    1 
ATOM   8026  C  C     . VAL F 3 306 ? -9.586  43.257 -65.877  1.00 40.09  ? 602 VAL B C     1 
ATOM   8027  O  O     . VAL F 3 306 ? -9.158  44.374 -65.585  1.00 39.60  ? 602 VAL B O     1 
ATOM   8028  C  CB    . VAL F 3 306 ? -10.357 43.439 -68.242  1.00 41.29  ? 602 VAL B CB    1 
ATOM   8029  C  CG1   . VAL F 3 306 ? -11.444 43.070 -69.224  1.00 41.54  ? 602 VAL B CG1   1 
ATOM   8030  C  CG2   . VAL F 3 306 ? -10.024 44.917 -68.354  1.00 41.50  ? 602 VAL B CG2   1 
ATOM   8031  N  N     . HIS F 3 307 ? -9.049  42.138 -65.403  1.00 39.16  ? 603 HIS B N     1 
ATOM   8032  C  CA    . HIS F 3 307 ? -7.886  42.179 -64.531  1.00 38.61  ? 603 HIS B CA    1 
ATOM   8033  C  C     . HIS F 3 307 ? -6.683  41.514 -65.205  1.00 38.10  ? 603 HIS B C     1 
ATOM   8034  O  O     . HIS F 3 307 ? -6.605  40.287 -65.305  1.00 37.84  ? 603 HIS B O     1 
ATOM   8035  C  CB    . HIS F 3 307 ? -8.197  41.495 -63.195  1.00 39.17  ? 603 HIS B CB    1 
ATOM   8036  C  CG    . HIS F 3 307 ? -9.280  42.171 -62.404  1.00 39.34  ? 603 HIS B CG    1 
ATOM   8037  N  ND1   . HIS F 3 307 ? -10.614 41.845 -62.534  1.00 40.08  ? 603 HIS B ND1   1 
ATOM   8038  C  CD2   . HIS F 3 307 ? -9.224  43.157 -61.478  1.00 39.22  ? 603 HIS B CD2   1 
ATOM   8039  C  CE1   . HIS F 3 307 ? -11.332 42.597 -61.718  1.00 39.20  ? 603 HIS B CE1   1 
ATOM   8040  N  NE2   . HIS F 3 307 ? -10.514 43.401 -61.067  1.00 39.14  ? 603 HIS B NE2   1 
ATOM   8041  N  N     . THR F 3 308 ? -5.748  42.337 -65.671  1.00 36.95  ? 604 THR B N     1 
ATOM   8042  C  CA    . THR F 3 308 ? -4.545  41.844 -66.339  1.00 35.57  ? 604 THR B CA    1 
ATOM   8043  C  C     . THR F 3 308 ? -3.467  41.489 -65.314  1.00 34.87  ? 604 THR B C     1 
ATOM   8044  O  O     . THR F 3 308 ? -3.720  41.462 -64.115  1.00 35.14  ? 604 THR B O     1 
ATOM   8045  C  CB    . THR F 3 308 ? -3.973  42.918 -67.290  1.00 35.01  ? 604 THR B CB    1 
ATOM   8046  O  OG1   . THR F 3 308 ? -2.882  42.373 -68.041  1.00 34.86  ? 604 THR B OG1   1 
ATOM   8047  C  CG2   . THR F 3 308 ? -3.470  44.121 -66.495  1.00 34.43  ? 604 THR B CG2   1 
ATOM   8048  N  N     . ILE F 3 309 ? -2.264  41.208 -65.804  1.00 34.48  ? 605 ILE B N     1 
ATOM   8049  C  CA    . ILE F 3 309 ? -1.129  40.909 -64.945  1.00 32.59  ? 605 ILE B CA    1 
ATOM   8050  C  C     . ILE F 3 309 ? 0.118   41.472 -65.622  1.00 32.37  ? 605 ILE B C     1 
ATOM   8051  O  O     . ILE F 3 309 ? 0.354   41.234 -66.806  1.00 31.39  ? 605 ILE B O     1 
ATOM   8052  C  CB    . ILE F 3 309 ? -0.957  39.383 -64.700  1.00 32.91  ? 605 ILE B CB    1 
ATOM   8053  C  CG1   . ILE F 3 309 ? -2.081  38.865 -63.797  1.00 32.34  ? 605 ILE B CG1   1 
ATOM   8054  C  CG2   . ILE F 3 309 ? 0.384   39.108 -64.038  1.00 31.61  ? 605 ILE B CG2   1 
ATOM   8055  C  CD1   . ILE F 3 309 ? -1.877  37.431 -63.330  1.00 31.72  ? 605 ILE B CD1   1 
ATOM   8056  N  N     . PHE F 3 310 ? 0.890   42.257 -64.878  1.00 31.74  ? 606 PHE B N     1 
ATOM   8057  C  CA    . PHE F 3 310 ? 2.115   42.831 -65.409  1.00 31.91  ? 606 PHE B CA    1 
ATOM   8058  C  C     . PHE F 3 310 ? 3.300   42.047 -64.897  1.00 31.87  ? 606 PHE B C     1 
ATOM   8059  O  O     . PHE F 3 310 ? 3.652   42.133 -63.722  1.00 31.77  ? 606 PHE B O     1 
ATOM   8060  C  CB    . PHE F 3 310 ? 2.255   44.291 -64.997  1.00 33.00  ? 606 PHE B CB    1 
ATOM   8061  C  CG    . PHE F 3 310 ? 1.171   45.162 -65.536  1.00 32.46  ? 606 PHE B CG    1 
ATOM   8062  C  CD1   . PHE F 3 310 ? -0.022  45.317 -64.840  1.00 33.29  ? 606 PHE B CD1   1 
ATOM   8063  C  CD2   . PHE F 3 310 ? 1.324   45.794 -66.759  1.00 32.65  ? 606 PHE B CD2   1 
ATOM   8064  C  CE1   . PHE F 3 310 ? -1.054  46.093 -65.358  1.00 32.95  ? 606 PHE B CE1   1 
ATOM   8065  C  CE2   . PHE F 3 310 ? 0.293   46.579 -67.295  1.00 32.96  ? 606 PHE B CE2   1 
ATOM   8066  C  CZ    . PHE F 3 310 ? -0.897  46.727 -66.590  1.00 32.71  ? 606 PHE B CZ    1 
ATOM   8067  N  N     . ASN F 3 311 ? 3.921   41.295 -65.794  1.00 30.99  ? 607 ASN B N     1 
ATOM   8068  C  CA    . ASN F 3 311 ? 5.059   40.472 -65.435  1.00 30.43  ? 607 ASN B CA    1 
ATOM   8069  C  C     . ASN F 3 311 ? 6.317   41.302 -65.244  1.00 29.14  ? 607 ASN B C     1 
ATOM   8070  O  O     . ASN F 3 311 ? 6.949   41.735 -66.208  1.00 27.81  ? 607 ASN B O     1 
ATOM   8071  C  CB    . ASN F 3 311 ? 5.241   39.402 -66.504  1.00 32.23  ? 607 ASN B CB    1 
ATOM   8072  C  CG    . ASN F 3 311 ? 3.922   38.733 -66.864  1.00 33.71  ? 607 ASN B CG    1 
ATOM   8073  O  OD1   . ASN F 3 311 ? 3.135   39.259 -67.666  1.00 35.73  ? 607 ASN B OD1   1 
ATOM   8074  N  ND2   . ASN F 3 311 ? 3.654   37.589 -66.245  1.00 34.76  ? 607 ASN B ND2   1 
ATOM   8075  N  N     . GLN F 3 312 ? 6.659   41.507 -63.977  1.00 27.53  ? 608 GLN B N     1 
ATOM   8076  C  CA    . GLN F 3 312 ? 7.816   42.287 -63.576  1.00 26.83  ? 608 GLN B CA    1 
ATOM   8077  C  C     . GLN F 3 312 ? 9.091   41.428 -63.545  1.00 27.32  ? 608 GLN B C     1 
ATOM   8078  O  O     . GLN F 3 312 ? 10.192  41.950 -63.414  1.00 25.75  ? 608 GLN B O     1 
ATOM   8079  C  CB    . GLN F 3 312 ? 7.544   42.888 -62.196  1.00 25.78  ? 608 GLN B CB    1 
ATOM   8080  C  CG    . GLN F 3 312 ? 8.635   43.771 -61.637  1.00 24.69  ? 608 GLN B CG    1 
ATOM   8081  C  CD    . GLN F 3 312 ? 8.322   44.237 -60.240  1.00 23.95  ? 608 GLN B CD    1 
ATOM   8082  O  OE1   . GLN F 3 312 ? 7.575   43.595 -59.517  1.00 24.39  ? 608 GLN B OE1   1 
ATOM   8083  N  NE2   . GLN F 3 312 ? 8.909   45.352 -59.842  1.00 26.39  ? 608 GLN B NE2   1 
ATOM   8084  N  N     . ALA F 3 313 ? 8.943   40.113 -63.673  1.00 27.91  ? 609 ALA B N     1 
ATOM   8085  C  CA    . ALA F 3 313 ? 10.121  39.242 -63.657  1.00 28.77  ? 609 ALA B CA    1 
ATOM   8086  C  C     . ALA F 3 313 ? 10.215  38.412 -64.932  1.00 29.21  ? 609 ALA B C     1 
ATOM   8087  O  O     . ALA F 3 313 ? 10.278  37.177 -64.864  1.00 30.27  ? 609 ALA B O     1 
ATOM   8088  C  CB    . ALA F 3 313 ? 10.074  38.323 -62.442  1.00 28.36  ? 609 ALA B CB    1 
ATOM   8089  N  N     . LEU F 3 314 ? 10.244  39.070 -66.090  1.00 28.06  ? 610 LEU B N     1 
ATOM   8090  C  CA    . LEU F 3 314 ? 10.288  38.320 -67.344  1.00 27.66  ? 610 LEU B CA    1 
ATOM   8091  C  C     . LEU F 3 314 ? 11.121  38.900 -68.479  1.00 27.80  ? 610 LEU B C     1 
ATOM   8092  O  O     . LEU F 3 314 ? 11.941  38.181 -69.068  1.00 27.58  ? 610 LEU B O     1 
ATOM   8093  C  CB    . LEU F 3 314 ? 8.859   38.080 -67.839  1.00 27.55  ? 610 LEU B CB    1 
ATOM   8094  C  CG    . LEU F 3 314 ? 8.544   37.123 -69.004  1.00 28.35  ? 610 LEU B CG    1 
ATOM   8095  C  CD1   . LEU F 3 314 ? 7.099   36.683 -68.861  1.00 27.79  ? 610 LEU B CD1   1 
ATOM   8096  C  CD2   . LEU F 3 314 ? 8.767   37.775 -70.358  1.00 27.51  ? 610 LEU B CD2   1 
ATOM   8097  N  N     . THR F 3 315 ? 10.936  40.185 -68.793  1.00 25.58  ? 611 THR B N     1 
ATOM   8098  C  CA    . THR F 3 315 ? 11.672  40.755 -69.905  1.00 24.57  ? 611 THR B CA    1 
ATOM   8099  C  C     . THR F 3 315 ? 13.141  40.830 -69.591  1.00 24.62  ? 611 THR B C     1 
ATOM   8100  O  O     . THR F 3 315 ? 13.540  41.043 -68.452  1.00 24.37  ? 611 THR B O     1 
ATOM   8101  C  CB    . THR F 3 315 ? 11.173  42.193 -70.320  1.00 22.72  ? 611 THR B CB    1 
ATOM   8102  O  OG1   . THR F 3 315 ? 11.639  43.160 -69.369  1.00 20.61  ? 611 THR B OG1   1 
ATOM   8103  C  CG2   . THR F 3 315 ? 9.654   42.236 -70.395  1.00 23.81  ? 611 THR B CG2   1 
ATOM   8104  N  N     . GLN F 3 316 ? 13.943  40.679 -70.636  1.00 25.19  ? 612 GLN B N     1 
ATOM   8105  C  CA    . GLN F 3 316 ? 15.392  40.694 -70.514  1.00 26.09  ? 612 GLN B CA    1 
ATOM   8106  C  C     . GLN F 3 316 ? 15.974  42.092 -70.431  1.00 26.49  ? 612 GLN B C     1 
ATOM   8107  O  O     . GLN F 3 316 ? 17.177  42.250 -70.208  1.00 26.97  ? 612 GLN B O     1 
ATOM   8108  C  CB    . GLN F 3 316 ? 16.015  39.974 -71.719  1.00 26.68  ? 612 GLN B CB    1 
ATOM   8109  C  CG    . GLN F 3 316 ? 15.571  38.522 -71.882  1.00 27.13  ? 612 GLN B CG    1 
ATOM   8110  C  CD    . GLN F 3 316 ? 16.019  37.648 -70.713  1.00 27.51  ? 612 GLN B CD    1 
ATOM   8111  O  OE1   . GLN F 3 316 ? 17.205  37.595 -70.383  1.00 27.45  ? 612 GLN B OE1   1 
ATOM   8112  N  NE2   . GLN F 3 316 ? 15.071  36.960 -70.086  1.00 25.57  ? 612 GLN B NE2   1 
ATOM   8113  N  N     . THR F 3 317 ? 15.132  43.101 -70.624  1.00 26.27  ? 613 THR B N     1 
ATOM   8114  C  CA    . THR F 3 317 ? 15.581  44.486 -70.600  1.00 25.69  ? 613 THR B CA    1 
ATOM   8115  C  C     . THR F 3 317 ? 15.202  45.261 -69.345  1.00 26.51  ? 613 THR B C     1 
ATOM   8116  O  O     . THR F 3 317 ? 15.826  46.297 -69.031  1.00 26.21  ? 613 THR B O     1 
ATOM   8117  C  CB    . THR F 3 317 ? 15.017  45.253 -71.793  1.00 25.08  ? 613 THR B CB    1 
ATOM   8118  O  OG1   . THR F 3 317 ? 13.581  45.212 -71.749  1.00 25.13  ? 613 THR B OG1   1 
ATOM   8119  C  CG2   . THR F 3 317 ? 15.504  44.640 -73.090  1.00 24.66  ? 613 THR B CG2   1 
ATOM   8120  N  N     . GLY F 3 318 ? 14.177  44.782 -68.646  1.00 25.61  ? 614 GLY B N     1 
ATOM   8121  C  CA    . GLY F 3 318 ? 13.733  45.453 -67.436  1.00 25.89  ? 614 GLY B CA    1 
ATOM   8122  C  C     . GLY F 3 318 ? 12.375  46.077 -67.660  1.00 26.55  ? 614 GLY B C     1 
ATOM   8123  O  O     . GLY F 3 318 ? 11.912  46.906 -66.877  1.00 26.63  ? 614 GLY B O     1 
ATOM   8124  N  N     . ARG F 3 319 ? 11.744  45.665 -68.750  1.00 26.50  ? 615 ARG B N     1 
ATOM   8125  C  CA    . ARG F 3 319 ? 10.418  46.123 -69.120  1.00 27.25  ? 615 ARG B CA    1 
ATOM   8126  C  C     . ARG F 3 319 ? 9.409   45.195 -68.449  1.00 27.53  ? 615 ARG B C     1 
ATOM   8127  O  O     . ARG F 3 319 ? 9.771   44.176 -67.845  1.00 27.14  ? 615 ARG B O     1 
ATOM   8128  C  CB    . ARG F 3 319 ? 10.226  46.017 -70.640  1.00 28.10  ? 615 ARG B CB    1 
ATOM   8129  C  CG    . ARG F 3 319 ? 10.454  47.283 -71.465  1.00 27.65  ? 615 ARG B CG    1 
ATOM   8130  C  CD    . ARG F 3 319 ? 9.813   47.129 -72.856  1.00 27.20  ? 615 ARG B CD    1 
ATOM   8131  N  NE    . ARG F 3 319 ? 9.820   48.365 -73.643  1.00 27.05  ? 615 ARG B NE    1 
ATOM   8132  C  CZ    . ARG F 3 319 ? 9.265   48.499 -74.851  1.00 26.60  ? 615 ARG B CZ    1 
ATOM   8133  N  NH1   . ARG F 3 319 ? 8.647   47.480 -75.427  1.00 26.07  ? 615 ARG B NH1   1 
ATOM   8134  N  NH2   . ARG F 3 319 ? 9.345   49.654 -75.503  1.00 26.64  ? 615 ARG B NH2   1 
ATOM   8135  N  N     . LEU F 3 320 ? 8.134   45.546 -68.553  1.00 27.87  ? 616 LEU B N     1 
ATOM   8136  C  CA    . LEU F 3 320 ? 7.078   44.698 -68.017  1.00 27.25  ? 616 LEU B CA    1 
ATOM   8137  C  C     . LEU F 3 320 ? 6.429   44.070 -69.233  1.00 26.76  ? 616 LEU B C     1 
ATOM   8138  O  O     . LEU F 3 320 ? 6.745   44.431 -70.362  1.00 28.39  ? 616 LEU B O     1 
ATOM   8139  C  CB    . LEU F 3 320 ? 6.007   45.528 -67.312  1.00 27.96  ? 616 LEU B CB    1 
ATOM   8140  C  CG    . LEU F 3 320 ? 6.311   46.181 -65.980  1.00 28.49  ? 616 LEU B CG    1 
ATOM   8141  C  CD1   . LEU F 3 320 ? 5.076   46.937 -65.530  1.00 27.95  ? 616 LEU B CD1   1 
ATOM   8142  C  CD2   . LEU F 3 320 ? 6.714   45.099 -64.956  1.00 27.85  ? 616 LEU B CD2   1 
ATOM   8143  N  N     . SER F 3 321 ? 5.518   43.135 -68.993  1.00 25.46  ? 617 SER B N     1 
ATOM   8144  C  CA    . SER F 3 321 ? 4.741   42.510 -70.051  1.00 24.53  ? 617 SER B CA    1 
ATOM   8145  C  C     . SER F 3 321 ? 3.345   42.438 -69.431  1.00 24.56  ? 617 SER B C     1 
ATOM   8146  O  O     . SER F 3 321 ? 3.200   42.393 -68.200  1.00 23.58  ? 617 SER B O     1 
ATOM   8147  C  CB    . SER F 3 321 ? 5.271   41.113 -70.430  1.00 22.66  ? 617 SER B CB    1 
ATOM   8148  O  OG    . SER F 3 321 ? 5.242   40.190 -69.361  1.00 24.03  ? 617 SER B OG    1 
ATOM   8149  N  N     . SER F 3 322 ? 2.324   42.470 -70.276  1.00 24.96  ? 618 SER B N     1 
ATOM   8150  C  CA    . SER F 3 322 ? 0.947   42.441 -69.799  1.00 26.08  ? 618 SER B CA    1 
ATOM   8151  C  C     . SER F 3 322 ? 0.265   41.166 -70.284  1.00 26.56  ? 618 SER B C     1 
ATOM   8152  O  O     . SER F 3 322 ? 0.285   40.882 -71.467  1.00 27.83  ? 618 SER B O     1 
ATOM   8153  C  CB    . SER F 3 322 ? 0.198   43.690 -70.328  1.00 24.77  ? 618 SER B CB    1 
ATOM   8154  O  OG    . SER F 3 322 ? -1.062  43.852 -69.704  1.00 25.75  ? 618 SER B OG    1 
ATOM   8155  N  N     . THR F 3 323 ? -0.346  40.413 -69.383  1.00 28.33  ? 619 THR B N     1 
ATOM   8156  C  CA    . THR F 3 323 ? -0.983  39.180 -69.794  1.00 29.87  ? 619 THR B CA    1 
ATOM   8157  C  C     . THR F 3 323 ? -2.410  38.982 -69.304  1.00 30.64  ? 619 THR B C     1 
ATOM   8158  O  O     . THR F 3 323 ? -2.834  39.583 -68.319  1.00 30.11  ? 619 THR B O     1 
ATOM   8159  C  CB    . THR F 3 323 ? -0.125  37.971 -69.362  1.00 29.86  ? 619 THR B CB    1 
ATOM   8160  O  OG1   . THR F 3 323 ? 0.497   38.255 -68.101  1.00 30.85  ? 619 THR B OG1   1 
ATOM   8161  C  CG2   . THR F 3 323 ? 0.951   37.691 -70.394  1.00 30.32  ? 619 THR B CG2   1 
ATOM   8162  N  N     . GLU F 3 324 ? -3.110  38.102 -70.021  1.00 31.80  ? 620 GLU B N     1 
ATOM   8163  C  CA    . GLU F 3 324 ? -4.500  37.694 -69.802  1.00 33.80  ? 620 GLU B CA    1 
ATOM   8164  C  C     . GLU F 3 324 ? -5.383  38.594 -68.956  1.00 34.18  ? 620 GLU B C     1 
ATOM   8165  O  O     . GLU F 3 324 ? -5.538  38.360 -67.760  1.00 34.76  ? 620 GLU B O     1 
ATOM   8166  C  CB    . GLU F 3 324 ? -4.566  36.268 -69.225  1.00 34.48  ? 620 GLU B CB    1 
ATOM   8167  C  CG    . GLU F 3 324 ? -6.008  35.778 -69.016  1.00 35.24  ? 620 GLU B CG    1 
ATOM   8168  C  CD    . GLU F 3 324 ? -6.095  34.298 -68.701  1.00 35.46  ? 620 GLU B CD    1 
ATOM   8169  O  OE1   . GLU F 3 324 ? -5.718  33.487 -69.573  1.00 35.40  ? 620 GLU B OE1   1 
ATOM   8170  O  OE2   . GLU F 3 324 ? -6.537  33.950 -67.583  1.00 35.43  ? 620 GLU B OE2   1 
ATOM   8171  N  N     . PRO F 3 325 ? -5.973  39.636 -69.567  1.00 34.77  ? 621 PRO B N     1 
ATOM   8172  C  CA    . PRO F 3 325 ? -5.766  39.893 -70.998  1.00 34.97  ? 621 PRO B CA    1 
ATOM   8173  C  C     . PRO F 3 325 ? -4.573  40.813 -71.165  1.00 34.75  ? 621 PRO B C     1 
ATOM   8174  O  O     . PRO F 3 325 ? -4.146  41.456 -70.222  1.00 35.17  ? 621 PRO B O     1 
ATOM   8175  C  CB    . PRO F 3 325 ? -7.059  40.571 -71.409  1.00 35.47  ? 621 PRO B CB    1 
ATOM   8176  C  CG    . PRO F 3 325 ? -7.343  41.431 -70.204  1.00 34.83  ? 621 PRO B CG    1 
ATOM   8177  C  CD    . PRO F 3 325 ? -7.068  40.475 -69.042  1.00 34.50  ? 621 PRO B CD    1 
ATOM   8178  N  N     . ASN F 3 326 ? -4.023  40.878 -72.362  1.00 35.17  ? 622 ASN B N     1 
ATOM   8179  C  CA    . ASN F 3 326 ? -2.897  41.763 -72.574  1.00 34.17  ? 622 ASN B CA    1 
ATOM   8180  C  C     . ASN F 3 326 ? -3.464  43.144 -72.895  1.00 34.63  ? 622 ASN B C     1 
ATOM   8181  O  O     . ASN F 3 326 ? -4.071  43.344 -73.946  1.00 34.32  ? 622 ASN B O     1 
ATOM   8182  C  CB    . ASN F 3 326 ? -2.037  41.274 -73.729  1.00 33.65  ? 622 ASN B CB    1 
ATOM   8183  C  CG    . ASN F 3 326 ? -0.824  42.158 -73.948  1.00 32.85  ? 622 ASN B CG    1 
ATOM   8184  O  OD1   . ASN F 3 326 ? -0.655  43.169 -73.265  1.00 33.10  ? 622 ASN B OD1   1 
ATOM   8185  N  ND2   . ASN F 3 326 ? 0.021   41.786 -74.891  1.00 31.67  ? 622 ASN B ND2   1 
ATOM   8186  N  N     . LEU F 3 327 ? -3.277  44.091 -71.985  1.00 34.58  ? 623 LEU B N     1 
ATOM   8187  C  CA    . LEU F 3 327 ? -3.795  45.438 -72.198  1.00 35.10  ? 623 LEU B CA    1 
ATOM   8188  C  C     . LEU F 3 327 ? -2.725  46.415 -72.673  1.00 34.91  ? 623 LEU B C     1 
ATOM   8189  O  O     . LEU F 3 327 ? -2.933  47.623 -72.639  1.00 35.69  ? 623 LEU B O     1 
ATOM   8190  C  CB    . LEU F 3 327 ? -4.458  45.952 -70.911  1.00 35.28  ? 623 LEU B CB    1 
ATOM   8191  C  CG    . LEU F 3 327 ? -5.644  45.123 -70.390  1.00 35.43  ? 623 LEU B CG    1 
ATOM   8192  C  CD1   . LEU F 3 327 ? -6.057  45.569 -68.990  1.00 35.29  ? 623 LEU B CD1   1 
ATOM   8193  C  CD2   . LEU F 3 327 ? -6.806  45.249 -71.356  1.00 35.93  ? 623 LEU B CD2   1 
ATOM   8194  N  N     . GLN F 3 328 ? -1.586  45.892 -73.128  1.00 34.93  ? 624 GLN B N     1 
ATOM   8195  C  CA    . GLN F 3 328 ? -0.494  46.737 -73.608  1.00 34.09  ? 624 GLN B CA    1 
ATOM   8196  C  C     . GLN F 3 328 ? -0.310  46.779 -75.123  1.00 33.80  ? 624 GLN B C     1 
ATOM   8197  O  O     . GLN F 3 328 ? 0.646   47.392 -75.611  1.00 32.68  ? 624 GLN B O     1 
ATOM   8198  C  CB    . GLN F 3 328 ? 0.830   46.309 -72.985  1.00 34.59  ? 624 GLN B CB    1 
ATOM   8199  C  CG    . GLN F 3 328 ? 0.962   46.622 -71.517  1.00 35.22  ? 624 GLN B CG    1 
ATOM   8200  C  CD    . GLN F 3 328 ? 2.297   46.183 -70.983  1.00 35.67  ? 624 GLN B CD    1 
ATOM   8201  O  OE1   . GLN F 3 328 ? 2.705   45.037 -71.184  1.00 35.96  ? 624 GLN B OE1   1 
ATOM   8202  N  NE2   . GLN F 3 328 ? 2.990   47.085 -70.289  1.00 36.26  ? 624 GLN B NE2   1 
ATOM   8203  N  N     . ASN F 3 329 ? -1.173  46.106 -75.874  1.00 33.24  ? 625 ASN B N     1 
ATOM   8204  C  CA    . ASN F 3 329 ? -1.034  46.167 -77.324  1.00 34.42  ? 625 ASN B CA    1 
ATOM   8205  C  C     . ASN F 3 329 ? -2.375  46.325 -78.045  1.00 35.26  ? 625 ASN B C     1 
ATOM   8206  O  O     . ASN F 3 329 ? -2.571  45.802 -79.140  1.00 35.67  ? 625 ASN B O     1 
ATOM   8207  C  CB    . ASN F 3 329 ? -0.258  44.945 -77.840  1.00 33.90  ? 625 ASN B CB    1 
ATOM   8208  C  CG    . ASN F 3 329 ? -1.070  43.679 -77.814  1.00 33.02  ? 625 ASN B CG    1 
ATOM   8209  O  OD1   . ASN F 3 329 ? -2.085  43.592 -77.131  1.00 31.68  ? 625 ASN B OD1   1 
ATOM   8210  N  ND2   . ASN F 3 329 ? -0.615  42.677 -78.553  1.00 32.33  ? 625 ASN B ND2   1 
ATOM   8211  N  N     . ILE F 3 330 ? -3.292  47.055 -77.411  1.00 35.61  ? 626 ILE B N     1 
ATOM   8212  C  CA    . ILE F 3 330 ? -4.616  47.319 -77.971  1.00 36.53  ? 626 ILE B CA    1 
ATOM   8213  C  C     . ILE F 3 330 ? -4.424  48.250 -79.167  1.00 36.96  ? 626 ILE B C     1 
ATOM   8214  O  O     . ILE F 3 330 ? -3.626  49.184 -79.105  1.00 36.93  ? 626 ILE B O     1 
ATOM   8215  C  CB    . ILE F 3 330 ? -5.536  47.991 -76.917  1.00 36.18  ? 626 ILE B CB    1 
ATOM   8216  C  CG1   . ILE F 3 330 ? -5.597  47.113 -75.668  1.00 36.52  ? 626 ILE B CG1   1 
ATOM   8217  C  CG2   . ILE F 3 330 ? -6.935  48.207 -77.480  1.00 36.16  ? 626 ILE B CG2   1 
ATOM   8218  C  CD1   . ILE F 3 330 ? -6.087  45.691 -75.928  1.00 36.87  ? 626 ILE B CD1   1 
ATOM   8219  N  N     . PRO F 3 331 ? -5.166  47.995 -80.277  1.00 37.44  ? 627 PRO B N     1 
ATOM   8220  C  CA    . PRO F 3 331 ? -5.007  48.830 -81.471  1.00 38.40  ? 627 PRO B CA    1 
ATOM   8221  C  C     . PRO F 3 331 ? -5.034  50.320 -81.207  1.00 39.14  ? 627 PRO B C     1 
ATOM   8222  O  O     . PRO F 3 331 ? -5.652  50.789 -80.255  1.00 39.05  ? 627 PRO B O     1 
ATOM   8223  C  CB    . PRO F 3 331 ? -6.109  48.335 -82.365  1.00 37.97  ? 627 PRO B CB    1 
ATOM   8224  C  CG    . PRO F 3 331 ? -5.749  46.911 -82.363  1.00 38.19  ? 627 PRO B CG    1 
ATOM   8225  C  CD    . PRO F 3 331 ? -5.193  46.674 -80.977  1.00 37.68  ? 627 PRO B CD    1 
ATOM   8226  N  N     . ILE F 3 332 ? -4.335  51.056 -82.058  1.00 40.70  ? 628 ILE B N     1 
ATOM   8227  C  CA    . ILE F 3 332 ? -4.233  52.498 -81.960  1.00 42.07  ? 628 ILE B CA    1 
ATOM   8228  C  C     . ILE F 3 332 ? -4.068  53.047 -83.373  1.00 43.53  ? 628 ILE B C     1 
ATOM   8229  O  O     . ILE F 3 332 ? -4.813  53.922 -83.814  1.00 43.57  ? 628 ILE B O     1 
ATOM   8230  C  CB    . ILE F 3 332 ? -3.085  52.940 -81.043  1.00 41.84  ? 628 ILE B CB    1 
ATOM   8231  C  CG1   . ILE F 3 332 ? -3.047  54.468 -80.927  1.00 41.55  ? 628 ILE B CG1   1 
ATOM   8232  C  CG2   . ILE F 3 332 ? -1.760  52.410 -81.550  1.00 41.88  ? 628 ILE B CG2   1 
ATOM   8233  C  CD1   . ILE F 3 332 ? -4.177  55.042 -80.102  1.00 40.96  ? 628 ILE B CD1   1 
ATOM   8234  N  N     . ARG F 3 333 ? -3.085  52.461 -84.083  1.00 45.23  ? 629 ARG B N     1 
ATOM   8235  C  CA    . ARG F 3 333 ? -2.728  52.850 -85.448  1.00 47.05  ? 629 ARG B CA    1 
ATOM   8236  C  C     . ARG F 3 333 ? -3.904  53.062 -86.412  1.00 47.58  ? 629 ARG B C     1 
ATOM   8237  O  O     . ARG F 3 333 ? -3.985  54.089 -87.087  1.00 47.91  ? 629 ARG B O     1 
ATOM   8238  C  CB    . ARG F 3 333 ? -1.751  51.818 -86.040  1.00 48.32  ? 629 ARG B CB    1 
ATOM   8239  C  CG    . ARG F 3 333 ? -1.031  52.251 -87.318  1.00 49.53  ? 629 ARG B CG    1 
ATOM   8240  C  CD    . ARG F 3 333 ? -0.017  51.217 -87.795  1.00 50.65  ? 629 ARG B CD    1 
ATOM   8241  N  NE    . ARG F 3 333 ? -0.676  50.124 -88.511  1.00 51.09  ? 629 ARG B NE    1 
ATOM   8242  C  CZ    . ARG F 3 333 ? -1.186  50.230 -89.736  1.00 51.57  ? 629 ARG B CZ    1 
ATOM   8243  N  NH1   . ARG F 3 333 ? -1.112  51.381 -90.393  1.00 51.78  ? 629 ARG B NH1   1 
ATOM   8244  N  NH2   . ARG F 3 333 ? -1.782  49.187 -90.305  1.00 51.83  ? 629 ARG B NH2   1 
ATOM   8245  N  N     . LEU F 3 334 ? -4.805  52.091 -86.485  1.00 48.22  ? 630 LEU B N     1 
ATOM   8246  C  CA    . LEU F 3 334 ? -5.962  52.188 -87.372  1.00 48.85  ? 630 LEU B CA    1 
ATOM   8247  C  C     . LEU F 3 334 ? -7.201  52.592 -86.585  1.00 48.95  ? 630 LEU B C     1 
ATOM   8248  O  O     . LEU F 3 334 ? -7.648  51.858 -85.703  1.00 48.61  ? 630 LEU B O     1 
ATOM   8249  C  CB    . LEU F 3 334 ? -6.216  50.843 -88.057  1.00 49.50  ? 630 LEU B CB    1 
ATOM   8250  C  CG    . LEU F 3 334 ? -5.020  50.206 -88.766  1.00 50.01  ? 630 LEU B CG    1 
ATOM   8251  C  CD1   . LEU F 3 334 ? -5.440  48.873 -89.391  1.00 50.57  ? 630 LEU B CD1   1 
ATOM   8252  C  CD2   . LEU F 3 334 ? -4.497  51.156 -89.833  1.00 50.53  ? 630 LEU B CD2   1 
ATOM   8253  N  N     . GLU F 3 335 ? -7.760  53.754 -86.912  1.00 49.06  ? 631 GLU B N     1 
ATOM   8254  C  CA    . GLU F 3 335 ? -8.946  54.251 -86.223  1.00 49.30  ? 631 GLU B CA    1 
ATOM   8255  C  C     . GLU F 3 335 ? -10.093 53.256 -86.271  1.00 49.56  ? 631 GLU B C     1 
ATOM   8256  O  O     . GLU F 3 335 ? -11.100 53.420 -85.582  1.00 50.03  ? 631 GLU B O     1 
ATOM   8257  C  CB    . GLU F 3 335 ? -9.379  55.596 -86.816  1.00 49.29  ? 631 GLU B CB    1 
ATOM   8258  C  CG    . GLU F 3 335 ? -8.852  56.790 -86.032  1.00 49.54  ? 631 GLU B CG    1 
ATOM   8259  C  CD    . GLU F 3 335 ? -9.619  57.019 -84.741  1.00 49.24  ? 631 GLU B CD    1 
ATOM   8260  O  OE1   . GLU F 3 335 ? -9.100  57.717 -83.843  1.00 49.75  ? 631 GLU B OE1   1 
ATOM   8261  O  OE2   . GLU F 3 335 ? -10.753 56.512 -84.631  1.00 49.15  ? 631 GLU B OE2   1 
ATOM   8262  N  N     . GLU F 3 336 ? -9.937  52.219 -87.081  1.00 49.75  ? 632 GLU B N     1 
ATOM   8263  C  CA    . GLU F 3 336 ? -10.959 51.189 -87.190  1.00 50.09  ? 632 GLU B CA    1 
ATOM   8264  C  C     . GLU F 3 336 ? -10.816 50.278 -85.965  1.00 50.08  ? 632 GLU B C     1 
ATOM   8265  O  O     . GLU F 3 336 ? -11.782 50.021 -85.237  1.00 49.79  ? 632 GLU B O     1 
ATOM   8266  C  CB    . GLU F 3 336 ? -10.755 50.372 -88.468  1.00 51.02  ? 632 GLU B CB    1 
ATOM   8267  C  CG    . GLU F 3 336 ? -10.609 51.184 -89.757  1.00 51.97  ? 632 GLU B CG    1 
ATOM   8268  C  CD    . GLU F 3 336 ? -9.229  51.812 -89.926  1.00 52.67  ? 632 GLU B CD    1 
ATOM   8269  O  OE1   . GLU F 3 336 ? -8.946  52.845 -89.282  1.00 53.00  ? 632 GLU B OE1   1 
ATOM   8270  O  OE2   . GLU F 3 336 ? -8.425  51.264 -90.708  1.00 53.16  ? 632 GLU B OE2   1 
ATOM   8271  N  N     . GLY F 3 337 ? -9.594  49.800 -85.745  1.00 49.66  ? 633 GLY B N     1 
ATOM   8272  C  CA    . GLY F 3 337 ? -9.325  48.936 -84.613  1.00 48.91  ? 633 GLY B CA    1 
ATOM   8273  C  C     . GLY F 3 337 ? -9.100  49.762 -83.365  1.00 48.72  ? 633 GLY B C     1 
ATOM   8274  O  O     . GLY F 3 337 ? -9.253  49.274 -82.246  1.00 48.11  ? 633 GLY B O     1 
ATOM   8275  N  N     . ARG F 3 338 ? -8.737  51.026 -83.559  1.00 48.86  ? 634 ARG B N     1 
ATOM   8276  C  CA    . ARG F 3 338 ? -8.501  51.920 -82.440  1.00 48.77  ? 634 ARG B CA    1 
ATOM   8277  C  C     . ARG F 3 338 ? -9.815  52.162 -81.703  1.00 49.20  ? 634 ARG B C     1 
ATOM   8278  O  O     . ARG F 3 338 ? -9.821  52.468 -80.509  1.00 49.08  ? 634 ARG B O     1 
ATOM   8279  C  CB    . ARG F 3 338 ? -7.928  53.244 -82.934  1.00 48.58  ? 634 ARG B CB    1 
ATOM   8280  C  CG    . ARG F 3 338 ? -7.662  54.241 -81.832  1.00 48.56  ? 634 ARG B CG    1 
ATOM   8281  C  CD    . ARG F 3 338 ? -7.104  55.533 -82.386  1.00 48.49  ? 634 ARG B CD    1 
ATOM   8282  N  NE    . ARG F 3 338 ? -6.671  56.424 -81.317  1.00 48.82  ? 634 ARG B NE    1 
ATOM   8283  C  CZ    . ARG F 3 338 ? -6.014  57.562 -81.515  1.00 49.05  ? 634 ARG B CZ    1 
ATOM   8284  N  NH1   . ARG F 3 338 ? -5.717  57.947 -82.748  1.00 49.34  ? 634 ARG B NH1   1 
ATOM   8285  N  NH2   . ARG F 3 338 ? -5.653  58.314 -80.483  1.00 48.48  ? 634 ARG B NH2   1 
ATOM   8286  N  N     . LYS F 3 339 ? -10.928 52.006 -82.417  1.00 49.57  ? 635 LYS B N     1 
ATOM   8287  C  CA    . LYS F 3 339 ? -12.248 52.204 -81.828  1.00 50.12  ? 635 LYS B CA    1 
ATOM   8288  C  C     . LYS F 3 339 ? -12.519 51.266 -80.654  1.00 50.18  ? 635 LYS B C     1 
ATOM   8289  O  O     . LYS F 3 339 ? -13.502 51.438 -79.930  1.00 50.12  ? 635 LYS B O     1 
ATOM   8290  C  CB    . LYS F 3 339 ? -13.338 52.025 -82.887  1.00 50.68  ? 635 LYS B CB    1 
ATOM   8291  C  CG    . LYS F 3 339 ? -13.730 53.309 -83.609  1.00 51.48  ? 635 LYS B CG    1 
ATOM   8292  C  CD    . LYS F 3 339 ? -14.692 53.032 -84.768  1.00 52.62  ? 635 LYS B CD    1 
ATOM   8293  C  CE    . LYS F 3 339 ? -15.992 52.360 -84.317  1.00 53.36  ? 635 LYS B CE    1 
ATOM   8294  N  NZ    . LYS F 3 339 ? -16.870 53.260 -83.514  1.00 54.17  ? 635 LYS B NZ    1 
ATOM   8295  N  N     . ILE F 3 340 ? -11.655 50.270 -80.469  1.00 49.88  ? 636 ILE B N     1 
ATOM   8296  C  CA    . ILE F 3 340 ? -11.820 49.333 -79.364  1.00 49.77  ? 636 ILE B CA    1 
ATOM   8297  C  C     . ILE F 3 340 ? -11.628 50.054 -78.031  1.00 49.25  ? 636 ILE B C     1 
ATOM   8298  O  O     . ILE F 3 340 ? -12.313 49.760 -77.052  1.00 49.27  ? 636 ILE B O     1 
ATOM   8299  C  CB    . ILE F 3 340 ? -10.794 48.168 -79.444  1.00 50.38  ? 636 ILE B CB    1 
ATOM   8300  C  CG1   . ILE F 3 340 ? -11.128 47.254 -80.621  1.00 50.71  ? 636 ILE B CG1   1 
ATOM   8301  C  CG2   . ILE F 3 340 ? -10.815 47.359 -78.153  1.00 50.60  ? 636 ILE B CG2   1 
ATOM   8302  C  CD1   . ILE F 3 340 ? -12.439 46.541 -80.470  1.00 51.64  ? 636 ILE B CD1   1 
ATOM   8303  N  N     . ARG F 3 341 ? -10.699 51.005 -78.005  1.00 48.70  ? 637 ARG B N     1 
ATOM   8304  C  CA    . ARG F 3 341 ? -10.395 51.754 -76.793  1.00 48.24  ? 637 ARG B CA    1 
ATOM   8305  C  C     . ARG F 3 341 ? -11.572 52.510 -76.189  1.00 47.97  ? 637 ARG B C     1 
ATOM   8306  O  O     . ARG F 3 341 ? -11.384 53.333 -75.289  1.00 47.69  ? 637 ARG B O     1 
ATOM   8307  C  CB    . ARG F 3 341 ? -9.251  52.744 -77.047  1.00 48.76  ? 637 ARG B CB    1 
ATOM   8308  C  CG    . ARG F 3 341 ? -7.928  52.107 -77.436  1.00 49.53  ? 637 ARG B CG    1 
ATOM   8309  C  CD    . ARG F 3 341 ? -6.770  53.052 -77.146  1.00 50.47  ? 637 ARG B CD    1 
ATOM   8310  N  NE    . ARG F 3 341 ? -5.483  52.454 -77.484  1.00 51.92  ? 637 ARG B NE    1 
ATOM   8311  C  CZ    . ARG F 3 341 ? -4.314  52.880 -77.018  1.00 52.02  ? 637 ARG B CZ    1 
ATOM   8312  N  NH1   . ARG F 3 341 ? -4.261  53.911 -76.186  1.00 52.51  ? 637 ARG B NH1   1 
ATOM   8313  N  NH2   . ARG F 3 341 ? -3.197  52.274 -77.387  1.00 52.56  ? 637 ARG B NH2   1 
ATOM   8314  N  N     . GLN F 3 342 ? -12.779 52.240 -76.673  1.00 47.15  ? 638 GLN B N     1 
ATOM   8315  C  CA    . GLN F 3 342 ? -13.960 52.914 -76.154  1.00 46.39  ? 638 GLN B CA    1 
ATOM   8316  C  C     . GLN F 3 342 ? -14.671 52.101 -75.087  1.00 45.95  ? 638 GLN B C     1 
ATOM   8317  O  O     . GLN F 3 342 ? -15.366 52.659 -74.239  1.00 45.86  ? 638 GLN B O     1 
ATOM   8318  C  CB    . GLN F 3 342 ? -14.924 53.234 -77.294  1.00 46.98  ? 638 GLN B CB    1 
ATOM   8319  C  CG    . GLN F 3 342 ? -14.376 54.267 -78.249  1.00 47.33  ? 638 GLN B CG    1 
ATOM   8320  C  CD    . GLN F 3 342 ? -15.291 54.535 -79.412  1.00 47.80  ? 638 GLN B CD    1 
ATOM   8321  O  OE1   . GLN F 3 342 ? -15.601 53.633 -80.195  1.00 47.97  ? 638 GLN B OE1   1 
ATOM   8322  N  NE2   . GLN F 3 342 ? -15.730 55.782 -79.540  1.00 47.95  ? 638 GLN B NE2   1 
ATOM   8323  N  N     . ALA F 3 343 ? -14.497 50.784 -75.130  1.00 45.36  ? 639 ALA B N     1 
ATOM   8324  C  CA    . ALA F 3 343 ? -15.127 49.905 -74.155  1.00 45.10  ? 639 ALA B CA    1 
ATOM   8325  C  C     . ALA F 3 343 ? -14.479 50.097 -72.789  1.00 45.13  ? 639 ALA B C     1 
ATOM   8326  O  O     . ALA F 3 343 ? -15.073 49.787 -71.757  1.00 45.51  ? 639 ALA B O     1 
ATOM   8327  C  CB    . ALA F 3 343 ? -15.000 48.453 -74.598  1.00 44.76  ? 639 ALA B CB    1 
ATOM   8328  N  N     . PHE F 3 344 ? -13.259 50.617 -72.786  1.00 44.94  ? 640 PHE B N     1 
ATOM   8329  C  CA    . PHE F 3 344 ? -12.542 50.845 -71.541  1.00 44.72  ? 640 PHE B CA    1 
ATOM   8330  C  C     . PHE F 3 344 ? -12.994 52.173 -70.956  1.00 44.46  ? 640 PHE B C     1 
ATOM   8331  O  O     . PHE F 3 344 ? -12.520 53.243 -71.343  1.00 44.33  ? 640 PHE B O     1 
ATOM   8332  C  CB    . PHE F 3 344 ? -11.035 50.838 -71.794  1.00 44.44  ? 640 PHE B CB    1 
ATOM   8333  C  CG    . PHE F 3 344 ? -10.507 49.501 -72.240  1.00 45.11  ? 640 PHE B CG    1 
ATOM   8334  C  CD1   . PHE F 3 344 ? -10.488 48.420 -71.364  1.00 44.74  ? 640 PHE B CD1   1 
ATOM   8335  C  CD2   . PHE F 3 344 ? -10.036 49.317 -73.536  1.00 45.19  ? 640 PHE B CD2   1 
ATOM   8336  C  CE1   . PHE F 3 344 ? -10.007 47.177 -71.771  1.00 44.66  ? 640 PHE B CE1   1 
ATOM   8337  C  CE2   . PHE F 3 344 ? -9.554  48.076 -73.952  1.00 45.26  ? 640 PHE B CE2   1 
ATOM   8338  C  CZ    . PHE F 3 344 ? -9.540  47.005 -73.064  1.00 44.78  ? 640 PHE B CZ    1 
ATOM   8339  N  N     . VAL F 3 345 ? -13.926 52.084 -70.016  1.00 44.05  ? 641 VAL B N     1 
ATOM   8340  C  CA    . VAL F 3 345 ? -14.487 53.259 -69.373  1.00 43.32  ? 641 VAL B CA    1 
ATOM   8341  C  C     . VAL F 3 345 ? -14.137 53.314 -67.893  1.00 42.74  ? 641 VAL B C     1 
ATOM   8342  O  O     . VAL F 3 345 ? -13.783 52.296 -67.291  1.00 42.91  ? 641 VAL B O     1 
ATOM   8343  C  CB    . VAL F 3 345 ? -16.020 53.254 -69.513  1.00 43.31  ? 641 VAL B CB    1 
ATOM   8344  C  CG1   . VAL F 3 345 ? -16.403 53.265 -70.979  1.00 43.24  ? 641 VAL B CG1   1 
ATOM   8345  C  CG2   . VAL F 3 345 ? -16.595 52.023 -68.839  1.00 43.51  ? 641 VAL B CG2   1 
ATOM   8346  N  N     . PRO F 3 346 ? -14.219 54.510 -67.288  1.00 42.08  ? 642 PRO B N     1 
ATOM   8347  C  CA    . PRO F 3 346 ? -13.913 54.685 -65.865  1.00 41.71  ? 642 PRO B CA    1 
ATOM   8348  C  C     . PRO F 3 346 ? -14.794 53.761 -65.028  1.00 41.63  ? 642 PRO B C     1 
ATOM   8349  O  O     . PRO F 3 346 ? -15.916 53.441 -65.430  1.00 41.62  ? 642 PRO B O     1 
ATOM   8350  C  CB    . PRO F 3 346 ? -14.221 56.163 -65.629  1.00 41.94  ? 642 PRO B CB    1 
ATOM   8351  C  CG    . PRO F 3 346 ? -13.867 56.781 -66.951  1.00 41.77  ? 642 PRO B CG    1 
ATOM   8352  C  CD    . PRO F 3 346 ? -14.486 55.810 -67.932  1.00 41.50  ? 642 PRO B CD    1 
ATOM   8353  N  N     . SER F 3 347 ? -14.296 53.335 -63.870  1.00 41.16  ? 643 SER B N     1 
ATOM   8354  C  CA    . SER F 3 347 ? -15.058 52.420 -63.025  1.00 41.63  ? 643 SER B CA    1 
ATOM   8355  C  C     . SER F 3 347 ? -16.205 53.045 -62.228  1.00 41.96  ? 643 SER B C     1 
ATOM   8356  O  O     . SER F 3 347 ? -16.761 52.411 -61.338  1.00 42.47  ? 643 SER B O     1 
ATOM   8357  C  CB    . SER F 3 347 ? -14.121 51.659 -62.079  1.00 40.66  ? 643 SER B CB    1 
ATOM   8358  O  OG    . SER F 3 347 ? -13.460 52.532 -61.188  1.00 40.08  ? 643 SER B OG    1 
ATOM   8359  N  N     . GLU F 3 348 ? -16.555 54.288 -62.542  1.00 42.74  ? 644 GLU B N     1 
ATOM   8360  C  CA    . GLU F 3 348 ? -17.664 54.960 -61.872  1.00 42.69  ? 644 GLU B CA    1 
ATOM   8361  C  C     . GLU F 3 348 ? -17.896 56.388 -62.343  1.00 42.55  ? 644 GLU B C     1 
ATOM   8362  O  O     . GLU F 3 348 ? -16.996 57.049 -62.862  1.00 41.61  ? 644 GLU B O     1 
ATOM   8363  C  CB    . GLU F 3 348 ? -17.499 54.919 -60.348  1.00 43.85  ? 644 GLU B CB    1 
ATOM   8364  C  CG    . GLU F 3 348 ? -16.101 55.175 -59.831  1.00 45.38  ? 644 GLU B CG    1 
ATOM   8365  C  CD    . GLU F 3 348 ? -15.952 54.722 -58.395  1.00 46.19  ? 644 GLU B CD    1 
ATOM   8366  O  OE1   . GLU F 3 348 ? -16.534 55.378 -57.501  1.00 47.44  ? 644 GLU B OE1   1 
ATOM   8367  O  OE2   . GLU F 3 348 ? -15.270 53.700 -58.157  1.00 47.11  ? 644 GLU B OE2   1 
ATOM   8368  N  N     . SER F 3 349 ? -19.132 56.839 -62.153  1.00 42.57  ? 645 SER B N     1 
ATOM   8369  C  CA    . SER F 3 349 ? -19.591 58.164 -62.555  1.00 42.15  ? 645 SER B CA    1 
ATOM   8370  C  C     . SER F 3 349 ? -18.746 59.363 -62.130  1.00 42.09  ? 645 SER B C     1 
ATOM   8371  O  O     . SER F 3 349 ? -18.201 59.407 -61.023  1.00 42.10  ? 645 SER B O     1 
ATOM   8372  C  CB    . SER F 3 349 ? -21.025 58.363 -62.057  1.00 42.19  ? 645 SER B CB    1 
ATOM   8373  O  OG    . SER F 3 349 ? -21.099 58.201 -60.651  1.00 42.30  ? 645 SER B OG    1 
ATOM   8374  N  N     . ASP F 3 350 ? -18.672 60.347 -63.026  1.00 42.12  ? 646 ASP B N     1 
ATOM   8375  C  CA    . ASP F 3 350 ? -17.932 61.588 -62.801  1.00 41.69  ? 646 ASP B CA    1 
ATOM   8376  C  C     . ASP F 3 350 ? -16.428 61.377 -62.754  1.00 41.18  ? 646 ASP B C     1 
ATOM   8377  O  O     . ASP F 3 350 ? -15.675 62.264 -62.342  1.00 40.78  ? 646 ASP B O     1 
ATOM   8378  C  CB    . ASP F 3 350 ? -18.399 62.265 -61.509  1.00 41.97  ? 646 ASP B CB    1 
ATOM   8379  C  CG    . ASP F 3 350 ? -19.889 62.561 -61.514  1.00 43.06  ? 646 ASP B CG    1 
ATOM   8380  O  OD1   . ASP F 3 350 ? -20.361 63.264 -62.440  1.00 42.35  ? 646 ASP B OD1   1 
ATOM   8381  O  OD2   . ASP F 3 350 ? -20.585 62.085 -60.589  1.00 43.55  ? 646 ASP B OD2   1 
ATOM   8382  N  N     . TRP F 3 351 ? -15.996 60.194 -63.172  1.00 40.36  ? 647 TRP B N     1 
ATOM   8383  C  CA    . TRP F 3 351 ? -14.577 59.880 -63.203  1.00 39.60  ? 647 TRP B CA    1 
ATOM   8384  C  C     . TRP F 3 351 ? -14.100 59.926 -64.637  1.00 38.47  ? 647 TRP B C     1 
ATOM   8385  O  O     . TRP F 3 351 ? -14.857 59.635 -65.553  1.00 38.80  ? 647 TRP B O     1 
ATOM   8386  C  CB    . TRP F 3 351 ? -14.325 58.496 -62.615  1.00 39.85  ? 647 TRP B CB    1 
ATOM   8387  C  CG    . TRP F 3 351 ? -14.396 58.468 -61.134  1.00 40.62  ? 647 TRP B CG    1 
ATOM   8388  C  CD1   . TRP F 3 351 ? -15.404 58.953 -60.350  1.00 40.58  ? 647 TRP B CD1   1 
ATOM   8389  C  CD2   . TRP F 3 351 ? -13.441 57.879 -60.244  1.00 40.78  ? 647 TRP B CD2   1 
ATOM   8390  N  NE1   . TRP F 3 351 ? -15.138 58.696 -59.026  1.00 41.17  ? 647 TRP B NE1   1 
ATOM   8391  C  CE2   . TRP F 3 351 ? -13.940 58.035 -58.934  1.00 40.85  ? 647 TRP B CE2   1 
ATOM   8392  C  CE3   . TRP F 3 351 ? -12.214 57.228 -60.428  1.00 41.12  ? 647 TRP B CE3   1 
ATOM   8393  C  CZ2   . TRP F 3 351 ? -13.254 57.565 -57.810  1.00 41.09  ? 647 TRP B CZ2   1 
ATOM   8394  C  CZ3   . TRP F 3 351 ? -11.530 56.758 -59.308  1.00 41.28  ? 647 TRP B CZ3   1 
ATOM   8395  C  CH2   . TRP F 3 351 ? -12.056 56.929 -58.016  1.00 41.07  ? 647 TRP B CH2   1 
ATOM   8396  N  N     . LEU F 3 352 ? -12.838 60.290 -64.828  1.00 38.07  ? 648 LEU B N     1 
ATOM   8397  C  CA    . LEU F 3 352 ? -12.268 60.377 -66.165  1.00 37.09  ? 648 LEU B CA    1 
ATOM   8398  C  C     . LEU F 3 352 ? -11.007 59.539 -66.299  1.00 36.82  ? 648 LEU B C     1 
ATOM   8399  O  O     . LEU F 3 352 ? -10.425 59.099 -65.304  1.00 36.63  ? 648 LEU B O     1 
ATOM   8400  C  CB    . LEU F 3 352 ? -11.942 61.836 -66.505  1.00 37.32  ? 648 LEU B CB    1 
ATOM   8401  C  CG    . LEU F 3 352 ? -13.128 62.805 -66.577  1.00 36.75  ? 648 LEU B CG    1 
ATOM   8402  C  CD1   . LEU F 3 352 ? -12.631 64.187 -66.959  1.00 37.08  ? 648 LEU B CD1   1 
ATOM   8403  C  CD2   . LEU F 3 352 ? -14.141 62.302 -67.593  1.00 37.15  ? 648 LEU B CD2   1 
ATOM   8404  N  N     . ILE F 3 353 ? -10.598 59.314 -67.542  1.00 35.86  ? 649 ILE B N     1 
ATOM   8405  C  CA    . ILE F 3 353 ? -9.397  58.553 -67.820  1.00 35.23  ? 649 ILE B CA    1 
ATOM   8406  C  C     . ILE F 3 353 ? -8.335  59.556 -68.229  1.00 34.09  ? 649 ILE B C     1 
ATOM   8407  O  O     . ILE F 3 353 ? -8.608  60.462 -69.022  1.00 34.28  ? 649 ILE B O     1 
ATOM   8408  C  CB    . ILE F 3 353 ? -9.616  57.542 -68.958  1.00 35.23  ? 649 ILE B CB    1 
ATOM   8409  C  CG1   . ILE F 3 353 ? -10.769 56.603 -68.604  1.00 36.02  ? 649 ILE B CG1   1 
ATOM   8410  C  CG2   . ILE F 3 353 ? -8.340  56.754 -69.201  1.00 36.11  ? 649 ILE B CG2   1 
ATOM   8411  C  CD1   . ILE F 3 353 ? -10.559 55.810 -67.337  1.00 36.02  ? 649 ILE B CD1   1 
ATOM   8412  N  N     . PHE F 3 354 ? -7.129  59.385 -67.685  1.00 32.64  ? 650 PHE B N     1 
ATOM   8413  C  CA    . PHE F 3 354 ? -5.998  60.273 -67.940  1.00 30.80  ? 650 PHE B CA    1 
ATOM   8414  C  C     . PHE F 3 354 ? -4.789  59.479 -68.427  1.00 31.14  ? 650 PHE B C     1 
ATOM   8415  O  O     . PHE F 3 354 ? -4.464  58.432 -67.864  1.00 30.91  ? 650 PHE B O     1 
ATOM   8416  C  CB    . PHE F 3 354 ? -5.627  60.997 -66.645  1.00 29.81  ? 650 PHE B CB    1 
ATOM   8417  C  CG    . PHE F 3 354 ? -4.521  61.998 -66.792  1.00 27.89  ? 650 PHE B CG    1 
ATOM   8418  C  CD1   . PHE F 3 354 ? -4.809  63.331 -67.075  1.00 28.75  ? 650 PHE B CD1   1 
ATOM   8419  C  CD2   . PHE F 3 354 ? -3.192  61.623 -66.612  1.00 27.20  ? 650 PHE B CD2   1 
ATOM   8420  C  CE1   . PHE F 3 354 ? -3.791  64.274 -67.170  1.00 28.16  ? 650 PHE B CE1   1 
ATOM   8421  C  CE2   . PHE F 3 354 ? -2.167  62.555 -66.702  1.00 25.83  ? 650 PHE B CE2   1 
ATOM   8422  C  CZ    . PHE F 3 354 ? -2.463  63.886 -66.982  1.00 27.62  ? 650 PHE B CZ    1 
ATOM   8423  N  N     . ALA F 3 355 ? -4.122  59.997 -69.456  1.00 30.82  ? 651 ALA B N     1 
ATOM   8424  C  CA    . ALA F 3 355 ? -2.941  59.356 -70.032  1.00 30.90  ? 651 ALA B CA    1 
ATOM   8425  C  C     . ALA F 3 355 ? -1.758  60.305 -70.177  1.00 30.66  ? 651 ALA B C     1 
ATOM   8426  O  O     . ALA F 3 355 ? -1.914  61.448 -70.598  1.00 29.89  ? 651 ALA B O     1 
ATOM   8427  C  CB    . ALA F 3 355 ? -3.278  58.785 -71.384  1.00 31.46  ? 651 ALA B CB    1 
ATOM   8428  N  N     . ALA F 3 356 ? -0.570  59.810 -69.848  1.00 30.08  ? 652 ALA B N     1 
ATOM   8429  C  CA    . ALA F 3 356 ? 0.654   60.589 -69.965  1.00 30.93  ? 652 ALA B CA    1 
ATOM   8430  C  C     . ALA F 3 356 ? 1.621   59.763 -70.790  1.00 31.94  ? 652 ALA B C     1 
ATOM   8431  O  O     . ALA F 3 356 ? 1.670   58.527 -70.666  1.00 32.87  ? 652 ALA B O     1 
ATOM   8432  C  CB    . ALA F 3 356 ? 1.230   60.880 -68.608  1.00 30.72  ? 652 ALA B CB    1 
ATOM   8433  N  N     . ASP F 3 357 ? 2.409   60.436 -71.614  1.00 31.78  ? 653 ASP B N     1 
ATOM   8434  C  CA    . ASP F 3 357 ? 3.323   59.746 -72.506  1.00 32.00  ? 653 ASP B CA    1 
ATOM   8435  C  C     . ASP F 3 357 ? 4.666   60.452 -72.558  1.00 31.75  ? 653 ASP B C     1 
ATOM   8436  O  O     . ASP F 3 357 ? 4.714   61.665 -72.727  1.00 31.85  ? 653 ASP B O     1 
ATOM   8437  C  CB    . ASP F 3 357 ? 2.705   59.745 -73.913  1.00 33.67  ? 653 ASP B CB    1 
ATOM   8438  C  CG    . ASP F 3 357 ? 3.023   58.494 -74.717  1.00 34.54  ? 653 ASP B CG    1 
ATOM   8439  O  OD1   . ASP F 3 357 ? 2.094   57.673 -74.921  1.00 36.51  ? 653 ASP B OD1   1 
ATOM   8440  O  OD2   . ASP F 3 357 ? 4.181   58.338 -75.164  1.00 33.19  ? 653 ASP B OD2   1 
ATOM   8441  N  N     . TYR F 3 358 ? 5.758   59.709 -72.393  1.00 30.76  ? 654 TYR B N     1 
ATOM   8442  C  CA    . TYR F 3 358 ? 7.075   60.324 -72.513  1.00 30.00  ? 654 TYR B CA    1 
ATOM   8443  C  C     . TYR F 3 358 ? 7.280   60.425 -74.018  1.00 30.61  ? 654 TYR B C     1 
ATOM   8444  O  O     . TYR F 3 358 ? 7.012   59.461 -74.749  1.00 30.52  ? 654 TYR B O     1 
ATOM   8445  C  CB    . TYR F 3 358 ? 8.175   59.440 -71.921  1.00 30.17  ? 654 TYR B CB    1 
ATOM   8446  C  CG    . TYR F 3 358 ? 8.275   59.459 -70.413  1.00 28.82  ? 654 TYR B CG    1 
ATOM   8447  C  CD1   . TYR F 3 358 ? 7.961   58.332 -69.670  1.00 28.37  ? 654 TYR B CD1   1 
ATOM   8448  C  CD2   . TYR F 3 358 ? 8.690   60.607 -69.732  1.00 28.93  ? 654 TYR B CD2   1 
ATOM   8449  C  CE1   . TYR F 3 358 ? 8.054   58.333 -68.285  1.00 27.94  ? 654 TYR B CE1   1 
ATOM   8450  C  CE2   . TYR F 3 358 ? 8.785   60.625 -68.336  1.00 27.88  ? 654 TYR B CE2   1 
ATOM   8451  C  CZ    . TYR F 3 358 ? 8.465   59.476 -67.620  1.00 27.46  ? 654 TYR B CZ    1 
ATOM   8452  O  OH    . TYR F 3 358 ? 8.544   59.450 -66.247  1.00 25.17  ? 654 TYR B OH    1 
ATOM   8453  N  N     . SER F 3 359 ? 7.737   61.571 -74.504  1.00 30.72  ? 655 SER B N     1 
ATOM   8454  C  CA    . SER F 3 359 ? 7.929   61.693 -75.947  1.00 31.63  ? 655 SER B CA    1 
ATOM   8455  C  C     . SER F 3 359 ? 9.378   61.419 -76.341  1.00 31.10  ? 655 SER B C     1 
ATOM   8456  O  O     . SER F 3 359 ? 10.307  61.840 -75.644  1.00 31.94  ? 655 SER B O     1 
ATOM   8457  C  CB    . SER F 3 359 ? 7.502   63.097 -76.432  1.00 32.18  ? 655 SER B CB    1 
ATOM   8458  O  OG    . SER F 3 359 ? 8.593   63.849 -76.945  1.00 32.16  ? 655 SER B OG    1 
ATOM   8459  N  N     . GLN F 3 360 ? 9.564   60.715 -77.457  1.00 30.74  ? 656 GLN B N     1 
ATOM   8460  C  CA    . GLN F 3 360 ? 10.901  60.409 -77.954  1.00 29.58  ? 656 GLN B CA    1 
ATOM   8461  C  C     . GLN F 3 360 ? 11.730  59.867 -76.788  1.00 28.61  ? 656 GLN B C     1 
ATOM   8462  O  O     . GLN F 3 360 ? 12.929  60.132 -76.668  1.00 28.64  ? 656 GLN B O     1 
ATOM   8463  C  CB    . GLN F 3 360 ? 11.523  61.695 -78.498  1.00 29.59  ? 656 GLN B CB    1 
ATOM   8464  C  CG    . GLN F 3 360 ? 10.586  62.474 -79.429  1.00 28.91  ? 656 GLN B CG    1 
ATOM   8465  C  CD    . GLN F 3 360 ? 11.222  63.738 -79.981  1.00 29.42  ? 656 GLN B CD    1 
ATOM   8466  O  OE1   . GLN F 3 360 ? 12.203  63.684 -80.728  1.00 28.11  ? 656 GLN B OE1   1 
ATOM   8467  N  NE2   . GLN F 3 360 ? 10.667  64.889 -79.607  1.00 28.81  ? 656 GLN B NE2   1 
ATOM   8468  N  N     . ILE F 3 361 ? 11.073  59.108 -75.923  1.00 27.43  ? 657 ILE B N     1 
ATOM   8469  C  CA    . ILE F 3 361 ? 11.726  58.590 -74.732  1.00 27.07  ? 657 ILE B CA    1 
ATOM   8470  C  C     . ILE F 3 361 ? 13.111  57.957 -74.894  1.00 26.13  ? 657 ILE B C     1 
ATOM   8471  O  O     . ILE F 3 361 ? 14.042  58.354 -74.198  1.00 25.79  ? 657 ILE B O     1 
ATOM   8472  C  CB    . ILE F 3 361 ? 10.816  57.620 -73.976  1.00 26.38  ? 657 ILE B CB    1 
ATOM   8473  C  CG1   . ILE F 3 361 ? 11.485  57.235 -72.662  1.00 26.38  ? 657 ILE B CG1   1 
ATOM   8474  C  CG2   . ILE F 3 361 ? 10.504  56.429 -74.823  1.00 26.81  ? 657 ILE B CG2   1 
ATOM   8475  C  CD1   . ILE F 3 361 ? 11.935  58.441 -71.839  1.00 25.67  ? 657 ILE B CD1   1 
ATOM   8476  N  N     . GLU F 3 362 ? 13.274  57.005 -75.806  1.00 26.91  ? 658 GLU B N     1 
ATOM   8477  C  CA    . GLU F 3 362 ? 14.593  56.392 -75.954  1.00 27.03  ? 658 GLU B CA    1 
ATOM   8478  C  C     . GLU F 3 362 ? 15.591  57.226 -76.746  1.00 26.64  ? 658 GLU B C     1 
ATOM   8479  O  O     . GLU F 3 362 ? 16.793  56.935 -76.743  1.00 27.58  ? 658 GLU B O     1 
ATOM   8480  C  CB    . GLU F 3 362 ? 14.463  54.958 -76.493  1.00 27.41  ? 658 GLU B CB    1 
ATOM   8481  C  CG    . GLU F 3 362 ? 13.675  54.088 -75.499  1.00 28.48  ? 658 GLU B CG    1 
ATOM   8482  C  CD    . GLU F 3 362 ? 13.645  52.592 -75.823  1.00 29.89  ? 658 GLU B CD    1 
ATOM   8483  O  OE1   . GLU F 3 362 ? 12.767  51.907 -75.257  1.00 30.41  ? 658 GLU B OE1   1 
ATOM   8484  O  OE2   . GLU F 3 362 ? 14.484  52.099 -76.613  1.00 29.97  ? 658 GLU B OE2   1 
ATOM   8485  N  N     . LEU F 3 363 ? 15.121  58.288 -77.395  1.00 25.68  ? 659 LEU B N     1 
ATOM   8486  C  CA    . LEU F 3 363 ? 16.044  59.160 -78.116  1.00 25.21  ? 659 LEU B CA    1 
ATOM   8487  C  C     . LEU F 3 363 ? 16.682  60.113 -77.096  1.00 23.96  ? 659 LEU B C     1 
ATOM   8488  O  O     . LEU F 3 363 ? 17.871  60.424 -77.183  1.00 24.36  ? 659 LEU B O     1 
ATOM   8489  C  CB    . LEU F 3 363 ? 15.328  59.953 -79.223  1.00 24.32  ? 659 LEU B CB    1 
ATOM   8490  C  CG    . LEU F 3 363 ? 14.841  59.226 -80.478  1.00 24.33  ? 659 LEU B CG    1 
ATOM   8491  C  CD1   . LEU F 3 363 ? 14.545  60.272 -81.546  1.00 23.18  ? 659 LEU B CD1   1 
ATOM   8492  C  CD2   . LEU F 3 363 ? 15.899  58.257 -80.982  1.00 23.94  ? 659 LEU B CD2   1 
ATOM   8493  N  N     . ARG F 3 364 ? 15.893  60.565 -76.124  1.00 23.73  ? 660 ARG B N     1 
ATOM   8494  C  CA    . ARG F 3 364 ? 16.398  61.450 -75.055  1.00 23.12  ? 660 ARG B CA    1 
ATOM   8495  C  C     . ARG F 3 364 ? 17.388  60.640 -74.193  1.00 23.93  ? 660 ARG B C     1 
ATOM   8496  O  O     . ARG F 3 364 ? 18.480  61.109 -73.835  1.00 23.39  ? 660 ARG B O     1 
ATOM   8497  C  CB    . ARG F 3 364 ? 15.242  61.929 -74.168  1.00 22.52  ? 660 ARG B CB    1 
ATOM   8498  C  CG    . ARG F 3 364 ? 14.297  62.903 -74.863  1.00 22.54  ? 660 ARG B CG    1 
ATOM   8499  C  CD    . ARG F 3 364 ? 13.057  63.182 -74.019  1.00 22.81  ? 660 ARG B CD    1 
ATOM   8500  N  NE    . ARG F 3 364 ? 12.075  63.948 -74.788  1.00 24.32  ? 660 ARG B NE    1 
ATOM   8501  C  CZ    . ARG F 3 364 ? 12.166  65.249 -75.054  1.00 23.73  ? 660 ARG B CZ    1 
ATOM   8502  N  NH1   . ARG F 3 364 ? 13.187  65.954 -74.603  1.00 24.71  ? 660 ARG B NH1   1 
ATOM   8503  N  NH2   . ARG F 3 364 ? 11.245  65.839 -75.810  1.00 23.29  ? 660 ARG B NH2   1 
ATOM   8504  N  N     . VAL F 3 365 ? 16.988  59.424 -73.847  1.00 22.97  ? 661 VAL B N     1 
ATOM   8505  C  CA    . VAL F 3 365 ? 17.877  58.568 -73.056  1.00 23.50  ? 661 VAL B CA    1 
ATOM   8506  C  C     . VAL F 3 365 ? 19.154  58.360 -73.868  1.00 23.01  ? 661 VAL B C     1 
ATOM   8507  O  O     . VAL F 3 365 ? 20.251  58.545 -73.352  1.00 25.34  ? 661 VAL B O     1 
ATOM   8508  C  CB    . VAL F 3 365 ? 17.202  57.225 -72.719  1.00 23.53  ? 661 VAL B CB    1 
ATOM   8509  C  CG1   . VAL F 3 365 ? 18.221  56.231 -72.104  1.00 23.87  ? 661 VAL B CG1   1 
ATOM   8510  C  CG2   . VAL F 3 365 ? 16.084  57.474 -71.692  1.00 23.54  ? 661 VAL B CG2   1 
ATOM   8511  N  N     . LEU F 3 366 ? 19.027  58.033 -75.150  1.00 23.62  ? 662 LEU B N     1 
ATOM   8512  C  CA    . LEU F 3 366 ? 20.224  57.820 -75.960  1.00 23.06  ? 662 LEU B CA    1 
ATOM   8513  C  C     . LEU F 3 366 ? 21.133  59.034 -76.000  1.00 23.02  ? 662 LEU B C     1 
ATOM   8514  O  O     . LEU F 3 366 ? 22.346  58.895 -75.892  1.00 23.56  ? 662 LEU B O     1 
ATOM   8515  C  CB    . LEU F 3 366 ? 19.862  57.405 -77.381  1.00 23.30  ? 662 LEU B CB    1 
ATOM   8516  C  CG    . LEU F 3 366 ? 21.063  57.195 -78.312  1.00 23.39  ? 662 LEU B CG    1 
ATOM   8517  C  CD1   . LEU F 3 366 ? 22.005  56.113 -77.766  1.00 23.36  ? 662 LEU B CD1   1 
ATOM   8518  C  CD2   . LEU F 3 366 ? 20.552  56.821 -79.674  1.00 24.51  ? 662 LEU B CD2   1 
ATOM   8519  N  N     . ALA F 3 367 ? 20.553  60.229 -76.158  1.00 22.51  ? 663 ALA B N     1 
ATOM   8520  C  CA    . ALA F 3 367 ? 21.333  61.467 -76.209  1.00 20.95  ? 663 ALA B CA    1 
ATOM   8521  C  C     . ALA F 3 367 ? 22.105  61.623 -74.925  1.00 19.74  ? 663 ALA B C     1 
ATOM   8522  O  O     . ALA F 3 367 ? 23.275  62.045 -74.909  1.00 19.75  ? 663 ALA B O     1 
ATOM   8523  C  CB    . ALA F 3 367 ? 20.390  62.699 -76.425  1.00 20.67  ? 663 ALA B CB    1 
ATOM   8524  N  N     . HIS F 3 368 ? 21.432  61.310 -73.832  1.00 19.62  ? 664 HIS B N     1 
ATOM   8525  C  CA    . HIS F 3 368 ? 22.056  61.363 -72.541  1.00 20.17  ? 664 HIS B CA    1 
ATOM   8526  C  C     . HIS F 3 368 ? 23.137  60.266 -72.478  1.00 21.28  ? 664 HIS B C     1 
ATOM   8527  O  O     . HIS F 3 368 ? 24.301  60.544 -72.211  1.00 20.94  ? 664 HIS B O     1 
ATOM   8528  C  CB    . HIS F 3 368 ? 21.020  61.120 -71.436  1.00 19.14  ? 664 HIS B CB    1 
ATOM   8529  C  CG    . HIS F 3 368 ? 21.626  60.854 -70.094  1.00 18.64  ? 664 HIS B CG    1 
ATOM   8530  N  ND1   . HIS F 3 368 ? 21.843  61.844 -69.162  1.00 18.47  ? 664 HIS B ND1   1 
ATOM   8531  C  CD2   . HIS F 3 368 ? 22.173  59.723 -69.577  1.00 17.27  ? 664 HIS B CD2   1 
ATOM   8532  C  CE1   . HIS F 3 368 ? 22.503  61.336 -68.130  1.00 20.06  ? 664 HIS B CE1   1 
ATOM   8533  N  NE2   . HIS F 3 368 ? 22.717  60.054 -68.362  1.00 16.64  ? 664 HIS B NE2   1 
ATOM   8534  N  N     . ILE F 3 369 ? 22.747  59.026 -72.758  1.00 22.93  ? 665 ILE B N     1 
ATOM   8535  C  CA    . ILE F 3 369 ? 23.696  57.901 -72.659  1.00 24.09  ? 665 ILE B CA    1 
ATOM   8536  C  C     . ILE F 3 369 ? 24.902  57.971 -73.598  1.00 25.03  ? 665 ILE B C     1 
ATOM   8537  O  O     . ILE F 3 369 ? 26.017  57.657 -73.193  1.00 26.79  ? 665 ILE B O     1 
ATOM   8538  C  CB    . ILE F 3 369 ? 22.963  56.546 -72.838  1.00 24.10  ? 665 ILE B CB    1 
ATOM   8539  C  CG1   . ILE F 3 369 ? 22.229  56.193 -71.541  1.00 23.46  ? 665 ILE B CG1   1 
ATOM   8540  C  CG2   . ILE F 3 369 ? 23.965  55.436 -73.174  1.00 24.59  ? 665 ILE B CG2   1 
ATOM   8541  C  CD1   . ILE F 3 369 ? 21.367  54.997 -71.654  1.00 23.35  ? 665 ILE B CD1   1 
ATOM   8542  N  N     . ALA F 3 370 ? 24.679  58.385 -74.840  1.00 25.91  ? 666 ALA B N     1 
ATOM   8543  C  CA    . ALA F 3 370 ? 25.746  58.509 -75.825  1.00 27.68  ? 666 ALA B CA    1 
ATOM   8544  C  C     . ALA F 3 370 ? 26.413  59.884 -75.784  1.00 29.19  ? 666 ALA B C     1 
ATOM   8545  O  O     . ALA F 3 370 ? 27.457  60.089 -76.398  1.00 29.85  ? 666 ALA B O     1 
ATOM   8546  C  CB    . ALA F 3 370 ? 25.187  58.252 -77.243  1.00 27.01  ? 666 ALA B CB    1 
ATOM   8547  N  N     . GLU F 3 371 ? 25.816  60.821 -75.057  1.00 30.87  ? 667 GLU B N     1 
ATOM   8548  C  CA    . GLU F 3 371 ? 26.354  62.176 -74.983  1.00 32.76  ? 667 GLU B CA    1 
ATOM   8549  C  C     . GLU F 3 371 ? 26.592  62.716 -76.397  1.00 33.19  ? 667 GLU B C     1 
ATOM   8550  O  O     . GLU F 3 371 ? 27.628  63.324 -76.676  1.00 33.21  ? 667 GLU B O     1 
ATOM   8551  C  CB    . GLU F 3 371 ? 27.652  62.204 -74.173  1.00 33.64  ? 667 GLU B CB    1 
ATOM   8552  C  CG    . GLU F 3 371 ? 27.458  61.892 -72.682  1.00 35.54  ? 667 GLU B CG    1 
ATOM   8553  C  CD    . GLU F 3 371 ? 28.599  62.410 -71.793  1.00 37.22  ? 667 GLU B CD    1 
ATOM   8554  O  OE1   . GLU F 3 371 ? 29.683  61.787 -71.737  1.00 38.58  ? 667 GLU B OE1   1 
ATOM   8555  O  OE2   . GLU F 3 371 ? 28.408  63.457 -71.145  1.00 38.73  ? 667 GLU B OE2   1 
ATOM   8556  N  N     . ASP F 3 372 ? 25.625  62.466 -77.284  1.00 33.28  ? 668 ASP B N     1 
ATOM   8557  C  CA    . ASP F 3 372 ? 25.684  62.929 -78.669  1.00 34.13  ? 668 ASP B CA    1 
ATOM   8558  C  C     . ASP F 3 372 ? 25.302  64.412 -78.651  1.00 35.44  ? 668 ASP B C     1 
ATOM   8559  O  O     . ASP F 3 372 ? 24.116  64.752 -78.636  1.00 34.51  ? 668 ASP B O     1 
ATOM   8560  C  CB    . ASP F 3 372 ? 24.698  62.135 -79.543  1.00 33.37  ? 668 ASP B CB    1 
ATOM   8561  C  CG    . ASP F 3 372 ? 24.807  62.485 -81.028  1.00 34.29  ? 668 ASP B CG    1 
ATOM   8562  O  OD1   . ASP F 3 372 ? 24.163  63.468 -81.466  1.00 32.88  ? 668 ASP B OD1   1 
ATOM   8563  O  OD2   . ASP F 3 372 ? 25.554  61.786 -81.759  1.00 32.79  ? 668 ASP B OD2   1 
ATOM   8564  N  N     . ASP F 3 373 ? 26.320  65.274 -78.638  1.00 36.54  ? 669 ASP B N     1 
ATOM   8565  C  CA    . ASP F 3 373 ? 26.141  66.721 -78.595  1.00 38.05  ? 669 ASP B CA    1 
ATOM   8566  C  C     . ASP F 3 373 ? 25.109  67.262 -79.573  1.00 37.97  ? 669 ASP B C     1 
ATOM   8567  O  O     . ASP F 3 373 ? 24.310  68.132 -79.227  1.00 37.73  ? 669 ASP B O     1 
ATOM   8568  C  CB    . ASP F 3 373 ? 27.474  67.431 -78.839  1.00 39.10  ? 669 ASP B CB    1 
ATOM   8569  C  CG    . ASP F 3 373 ? 28.383  67.390 -77.631  1.00 40.97  ? 669 ASP B CG    1 
ATOM   8570  O  OD1   . ASP F 3 373 ? 27.859  67.455 -76.492  1.00 42.89  ? 669 ASP B OD1   1 
ATOM   8571  O  OD2   . ASP F 3 373 ? 29.618  67.315 -77.814  1.00 41.17  ? 669 ASP B OD2   1 
ATOM   8572  N  N     . ASN F 3 374 ? 25.143  66.753 -80.798  1.00 38.25  ? 670 ASN B N     1 
ATOM   8573  C  CA    . ASN F 3 374 ? 24.214  67.173 -81.830  1.00 37.81  ? 670 ASN B CA    1 
ATOM   8574  C  C     . ASN F 3 374 ? 22.784  66.801 -81.443  1.00 37.45  ? 670 ASN B C     1 
ATOM   8575  O  O     . ASN F 3 374 ? 21.856  67.612 -81.564  1.00 37.44  ? 670 ASN B O     1 
ATOM   8576  C  CB    . ASN F 3 374 ? 24.591  66.498 -83.146  1.00 39.03  ? 670 ASN B CB    1 
ATOM   8577  C  CG    . ASN F 3 374 ? 23.679  66.889 -84.284  1.00 39.54  ? 670 ASN B CG    1 
ATOM   8578  O  OD1   . ASN F 3 374 ? 22.478  66.640 -84.240  1.00 40.98  ? 670 ASN B OD1   1 
ATOM   8579  N  ND2   . ASN F 3 374 ? 24.247  67.497 -85.317  1.00 39.73  ? 670 ASN B ND2   1 
ATOM   8580  N  N     . LEU F 3 375 ? 22.614  65.571 -80.970  1.00 36.07  ? 671 LEU B N     1 
ATOM   8581  C  CA    . LEU F 3 375 ? 21.302  65.076 -80.577  1.00 35.26  ? 671 LEU B CA    1 
ATOM   8582  C  C     . LEU F 3 375 ? 20.859  65.699 -79.253  1.00 34.88  ? 671 LEU B C     1 
ATOM   8583  O  O     . LEU F 3 375 ? 19.666  65.878 -79.018  1.00 35.07  ? 671 LEU B O     1 
ATOM   8584  C  CB    . LEU F 3 375 ? 21.324  63.545 -80.454  1.00 33.96  ? 671 LEU B CB    1 
ATOM   8585  C  CG    . LEU F 3 375 ? 19.979  62.857 -80.200  1.00 33.04  ? 671 LEU B CG    1 
ATOM   8586  C  CD1   . LEU F 3 375 ? 18.995  63.229 -81.299  1.00 33.25  ? 671 LEU B CD1   1 
ATOM   8587  C  CD2   . LEU F 3 375 ? 20.178  61.346 -80.147  1.00 33.92  ? 671 LEU B CD2   1 
ATOM   8588  N  N     . MET F 3 376 ? 21.815  66.038 -78.394  1.00 34.81  ? 672 MET B N     1 
ATOM   8589  C  CA    . MET F 3 376 ? 21.468  66.645 -77.125  1.00 35.14  ? 672 MET B CA    1 
ATOM   8590  C  C     . MET F 3 376 ? 20.847  68.014 -77.411  1.00 35.69  ? 672 MET B C     1 
ATOM   8591  O  O     . MET F 3 376 ? 20.128  68.564 -76.580  1.00 36.18  ? 672 MET B O     1 
ATOM   8592  C  CB    . MET F 3 376 ? 22.701  66.781 -76.222  1.00 35.48  ? 672 MET B CB    1 
ATOM   8593  C  CG    . MET F 3 376 ? 23.371  65.440 -75.868  1.00 35.69  ? 672 MET B CG    1 
ATOM   8594  S  SD    . MET F 3 376 ? 24.153  65.438 -74.250  1.00 37.17  ? 672 MET B SD    1 
ATOM   8595  C  CE    . MET F 3 376 ? 25.658  66.395 -74.569  1.00 35.28  ? 672 MET B CE    1 
ATOM   8596  N  N     . GLU F 3 377 ? 21.114  68.552 -78.599  1.00 36.15  ? 673 GLU B N     1 
ATOM   8597  C  CA    . GLU F 3 377 ? 20.555  69.852 -78.986  1.00 36.39  ? 673 GLU B CA    1 
ATOM   8598  C  C     . GLU F 3 377 ? 19.137  69.669 -79.493  1.00 35.75  ? 673 GLU B C     1 
ATOM   8599  O  O     . GLU F 3 377 ? 18.238  70.425 -79.129  1.00 35.64  ? 673 GLU B O     1 
ATOM   8600  C  CB    . GLU F 3 377 ? 21.409  70.522 -80.062  1.00 36.47  ? 673 GLU B CB    1 
ATOM   8601  C  CG    . GLU F 3 377 ? 22.486  71.447 -79.516  1.00 38.28  ? 673 GLU B CG    1 
ATOM   8602  C  CD    . GLU F 3 377 ? 21.935  72.765 -78.980  1.00 38.44  ? 673 GLU B CD    1 
ATOM   8603  O  OE1   . GLU F 3 377 ? 21.467  73.597 -79.784  1.00 38.55  ? 673 GLU B OE1   1 
ATOM   8604  O  OE2   . GLU F 3 377 ? 21.971  72.970 -77.751  1.00 38.91  ? 673 GLU B OE2   1 
ATOM   8605  N  N     . ALA F 3 378 ? 18.937  68.655 -80.328  1.00 35.35  ? 674 ALA B N     1 
ATOM   8606  C  CA    . ALA F 3 378 ? 17.617  68.383 -80.866  1.00 35.20  ? 674 ALA B CA    1 
ATOM   8607  C  C     . ALA F 3 378 ? 16.587  68.322 -79.730  1.00 35.09  ? 674 ALA B C     1 
ATOM   8608  O  O     . ALA F 3 378 ? 15.417  68.669 -79.914  1.00 34.36  ? 674 ALA B O     1 
ATOM   8609  C  CB    . ALA F 3 378 ? 17.627  67.082 -81.646  1.00 34.25  ? 674 ALA B CB    1 
ATOM   8610  N  N     . PHE F 3 379 ? 17.018  67.900 -78.548  1.00 35.01  ? 675 PHE B N     1 
ATOM   8611  C  CA    . PHE F 3 379 ? 16.086  67.828 -77.430  1.00 35.49  ? 675 PHE B CA    1 
ATOM   8612  C  C     . PHE F 3 379 ? 16.106  69.047 -76.527  1.00 35.95  ? 675 PHE B C     1 
ATOM   8613  O  O     . PHE F 3 379 ? 15.156  69.284 -75.794  1.00 36.50  ? 675 PHE B O     1 
ATOM   8614  C  CB    . PHE F 3 379 ? 16.310  66.550 -76.626  1.00 35.25  ? 675 PHE B CB    1 
ATOM   8615  C  CG    . PHE F 3 379 ? 15.981  65.309 -77.390  1.00 34.09  ? 675 PHE B CG    1 
ATOM   8616  C  CD1   . PHE F 3 379 ? 16.991  64.519 -77.935  1.00 34.88  ? 675 PHE B CD1   1 
ATOM   8617  C  CD2   . PHE F 3 379 ? 14.662  64.946 -77.601  1.00 34.20  ? 675 PHE B CD2   1 
ATOM   8618  C  CE1   . PHE F 3 379 ? 16.687  63.381 -78.683  1.00 34.22  ? 675 PHE B CE1   1 
ATOM   8619  C  CE2   . PHE F 3 379 ? 14.348  63.808 -78.350  1.00 35.18  ? 675 PHE B CE2   1 
ATOM   8620  C  CZ    . PHE F 3 379 ? 15.366  63.027 -78.891  1.00 33.93  ? 675 PHE B CZ    1 
ATOM   8621  N  N     . ARG F 3 380 ? 17.180  69.825 -76.567  1.00 36.88  ? 676 ARG B N     1 
ATOM   8622  C  CA    . ARG F 3 380 ? 17.224  71.035 -75.766  1.00 38.02  ? 676 ARG B CA    1 
ATOM   8623  C  C     . ARG F 3 380 ? 16.330  72.056 -76.485  1.00 38.60  ? 676 ARG B C     1 
ATOM   8624  O  O     . ARG F 3 380 ? 15.542  72.773 -75.854  1.00 38.17  ? 676 ARG B O     1 
ATOM   8625  C  CB    . ARG F 3 380 ? 18.660  71.540 -75.641  1.00 38.69  ? 676 ARG B CB    1 
ATOM   8626  C  CG    . ARG F 3 380 ? 19.433  70.775 -74.581  1.00 40.05  ? 676 ARG B CG    1 
ATOM   8627  C  CD    . ARG F 3 380 ? 20.925  70.998 -74.644  1.00 40.94  ? 676 ARG B CD    1 
ATOM   8628  N  NE    . ARG F 3 380 ? 21.584  70.255 -73.575  1.00 41.79  ? 676 ARG B NE    1 
ATOM   8629  C  CZ    . ARG F 3 380 ? 22.880  69.969 -73.547  1.00 42.25  ? 676 ARG B CZ    1 
ATOM   8630  N  NH1   . ARG F 3 380 ? 23.667  70.363 -74.535  1.00 42.70  ? 676 ARG B NH1   1 
ATOM   8631  N  NH2   . ARG F 3 380 ? 23.388  69.290 -72.524  1.00 43.08  ? 676 ARG B NH2   1 
ATOM   8632  N  N     . ARG F 3 381 ? 16.439  72.088 -77.811  1.00 37.88  ? 677 ARG B N     1 
ATOM   8633  C  CA    . ARG F 3 381 ? 15.629  72.987 -78.621  1.00 37.80  ? 677 ARG B CA    1 
ATOM   8634  C  C     . ARG F 3 381 ? 14.207  72.437 -78.674  1.00 37.86  ? 677 ARG B C     1 
ATOM   8635  O  O     . ARG F 3 381 ? 13.366  72.932 -79.418  1.00 38.59  ? 677 ARG B O     1 
ATOM   8636  C  CB    . ARG F 3 381 ? 16.192  73.087 -80.038  1.00 37.27  ? 677 ARG B CB    1 
ATOM   8637  C  CG    . ARG F 3 381 ? 17.599  73.638 -80.113  1.00 37.26  ? 677 ARG B CG    1 
ATOM   8638  C  CD    . ARG F 3 381 ? 18.060  73.803 -81.558  1.00 36.86  ? 677 ARG B CD    1 
ATOM   8639  N  NE    . ARG F 3 381 ? 19.442  74.260 -81.609  1.00 37.20  ? 677 ARG B NE    1 
ATOM   8640  C  CZ    . ARG F 3 381 ? 20.106  74.525 -82.728  1.00 37.18  ? 677 ARG B CZ    1 
ATOM   8641  N  NH1   . ARG F 3 381 ? 19.514  74.384 -83.907  1.00 37.20  ? 677 ARG B NH1   1 
ATOM   8642  N  NH2   . ARG F 3 381 ? 21.371  74.920 -82.665  1.00 37.23  ? 677 ARG B NH2   1 
ATOM   8643  N  N     . ASP F 3 382 ? 13.955  71.405 -77.877  1.00 37.21  ? 678 ASP B N     1 
ATOM   8644  C  CA    . ASP F 3 382 ? 12.649  70.765 -77.799  1.00 36.93  ? 678 ASP B CA    1 
ATOM   8645  C  C     . ASP F 3 382 ? 12.151  70.310 -79.169  1.00 36.35  ? 678 ASP B C     1 
ATOM   8646  O  O     . ASP F 3 382 ? 10.944  70.148 -79.391  1.00 34.98  ? 678 ASP B O     1 
ATOM   8647  C  CB    . ASP F 3 382 ? 11.634  71.709 -77.143  1.00 37.93  ? 678 ASP B CB    1 
ATOM   8648  C  CG    . ASP F 3 382 ? 10.323  71.016 -76.816  1.00 38.98  ? 678 ASP B CG    1 
ATOM   8649  O  OD1   . ASP F 3 382 ? 10.379  69.908 -76.242  1.00 40.17  ? 678 ASP B OD1   1 
ATOM   8650  O  OD2   . ASP F 3 382 ? 9.241   71.577 -77.119  1.00 38.82  ? 678 ASP B OD2   1 
ATOM   8651  N  N     . LEU F 3 383 ? 13.098  70.085 -80.076  1.00 35.59  ? 679 LEU B N     1 
ATOM   8652  C  CA    . LEU F 3 383 ? 12.784  69.637 -81.424  1.00 35.66  ? 679 LEU B CA    1 
ATOM   8653  C  C     . LEU F 3 383 ? 12.201  68.225 -81.360  1.00 35.61  ? 679 LEU B C     1 
ATOM   8654  O  O     . LEU F 3 383 ? 12.365  67.525 -80.359  1.00 35.39  ? 679 LEU B O     1 
ATOM   8655  C  CB    . LEU F 3 383 ? 14.051  69.630 -82.292  1.00 35.33  ? 679 LEU B CB    1 
ATOM   8656  C  CG    . LEU F 3 383 ? 14.944  70.881 -82.308  1.00 35.81  ? 679 LEU B CG    1 
ATOM   8657  C  CD1   . LEU F 3 383 ? 16.036  70.693 -83.351  1.00 36.30  ? 679 LEU B CD1   1 
ATOM   8658  C  CD2   . LEU F 3 383 ? 14.119  72.135 -82.635  1.00 35.26  ? 679 LEU B CD2   1 
ATOM   8659  N  N     . ASP F 3 384 ? 11.503  67.821 -82.414  1.00 35.68  ? 680 ASP B N     1 
ATOM   8660  C  CA    . ASP F 3 384 ? 10.926  66.476 -82.482  1.00 36.00  ? 680 ASP B CA    1 
ATOM   8661  C  C     . ASP F 3 384 ? 11.716  65.729 -83.550  1.00 35.57  ? 680 ASP B C     1 
ATOM   8662  O  O     . ASP F 3 384 ? 11.577  66.000 -84.748  1.00 35.35  ? 680 ASP B O     1 
ATOM   8663  C  CB    . ASP F 3 384 ? 9.445   66.526 -82.864  1.00 36.29  ? 680 ASP B CB    1 
ATOM   8664  C  CG    . ASP F 3 384 ? 8.787   65.144 -82.847  1.00 37.73  ? 680 ASP B CG    1 
ATOM   8665  O  OD1   . ASP F 3 384 ? 9.317   64.225 -83.511  1.00 37.73  ? 680 ASP B OD1   1 
ATOM   8666  O  OD2   . ASP F 3 384 ? 7.737   64.973 -82.177  1.00 37.23  ? 680 ASP B OD2   1 
ATOM   8667  N  N     . ILE F 3 385 ? 12.551  64.794 -83.112  1.00 35.42  ? 681 ILE B N     1 
ATOM   8668  C  CA    . ILE F 3 385 ? 13.390  64.035 -84.031  1.00 35.42  ? 681 ILE B CA    1 
ATOM   8669  C  C     . ILE F 3 385 ? 12.643  63.052 -84.928  1.00 35.82  ? 681 ILE B C     1 
ATOM   8670  O  O     . ILE F 3 385 ? 13.104  62.748 -86.031  1.00 35.77  ? 681 ILE B O     1 
ATOM   8671  C  CB    . ILE F 3 385 ? 14.505  63.296 -83.254  1.00 35.68  ? 681 ILE B CB    1 
ATOM   8672  C  CG1   . ILE F 3 385 ? 15.500  64.320 -82.699  1.00 35.62  ? 681 ILE B CG1   1 
ATOM   8673  C  CG2   . ILE F 3 385 ? 15.208  62.295 -84.151  1.00 34.99  ? 681 ILE B CG2   1 
ATOM   8674  C  CD1   . ILE F 3 385 ? 16.112  65.206 -83.770  1.00 35.72  ? 681 ILE B CD1   1 
ATOM   8675  N  N     . HIS F 3 386 ? 11.493  62.556 -84.485  1.00 35.65  ? 682 HIS B N     1 
ATOM   8676  C  CA    . HIS F 3 386 ? 10.763  61.622 -85.329  1.00 36.36  ? 682 HIS B CA    1 
ATOM   8677  C  C     . HIS F 3 386 ? 10.093  62.351 -86.487  1.00 37.10  ? 682 HIS B C     1 
ATOM   8678  O  O     . HIS F 3 386 ? 10.123  61.880 -87.631  1.00 36.87  ? 682 HIS B O     1 
ATOM   8679  C  CB    . HIS F 3 386 ? 9.732   60.852 -84.516  1.00 36.95  ? 682 HIS B CB    1 
ATOM   8680  C  CG    . HIS F 3 386 ? 10.332  60.004 -83.440  1.00 38.05  ? 682 HIS B CG    1 
ATOM   8681  N  ND1   . HIS F 3 386 ? 11.619  59.518 -83.511  1.00 38.68  ? 682 HIS B ND1   1 
ATOM   8682  C  CD2   . HIS F 3 386 ? 9.821   59.548 -82.271  1.00 38.83  ? 682 HIS B CD2   1 
ATOM   8683  C  CE1   . HIS F 3 386 ? 11.878  58.803 -82.430  1.00 39.08  ? 682 HIS B CE1   1 
ATOM   8684  N  NE2   . HIS F 3 386 ? 10.803  58.805 -81.661  1.00 39.34  ? 682 HIS B NE2   1 
ATOM   8685  N  N     . THR F 3 387 ? 9.500   63.506 -86.201  1.00 37.36  ? 683 THR B N     1 
ATOM   8686  C  CA    . THR F 3 387 ? 8.845   64.277 -87.252  1.00 37.78  ? 683 THR B CA    1 
ATOM   8687  C  C     . THR F 3 387 ? 9.910   64.745 -88.236  1.00 37.22  ? 683 THR B C     1 
ATOM   8688  O  O     . THR F 3 387 ? 9.689   64.754 -89.442  1.00 38.09  ? 683 THR B O     1 
ATOM   8689  C  CB    . THR F 3 387 ? 8.115   65.501 -86.682  1.00 38.49  ? 683 THR B CB    1 
ATOM   8690  O  OG1   . THR F 3 387 ? 9.059   66.345 -86.009  1.00 40.75  ? 683 THR B OG1   1 
ATOM   8691  C  CG2   . THR F 3 387 ? 7.030   65.070 -85.710  1.00 38.45  ? 683 THR B CG2   1 
ATOM   8692  N  N     . LYS F 3 388 ? 11.074  65.124 -87.718  1.00 36.13  ? 684 LYS B N     1 
ATOM   8693  C  CA    . LYS F 3 388 ? 12.158  65.577 -88.575  1.00 35.78  ? 684 LYS B CA    1 
ATOM   8694  C  C     . LYS F 3 388 ? 12.533  64.471 -89.553  1.00 35.43  ? 684 LYS B C     1 
ATOM   8695  O  O     . LYS F 3 388 ? 12.899  64.742 -90.693  1.00 34.60  ? 684 LYS B O     1 
ATOM   8696  C  CB    . LYS F 3 388 ? 13.368  65.975 -87.739  1.00 35.84  ? 684 LYS B CB    1 
ATOM   8697  C  CG    . LYS F 3 388 ? 14.491  66.621 -88.536  1.00 37.36  ? 684 LYS B CG    1 
ATOM   8698  C  CD    . LYS F 3 388 ? 15.658  66.954 -87.619  1.00 38.28  ? 684 LYS B CD    1 
ATOM   8699  C  CE    . LYS F 3 388 ? 16.821  67.582 -88.363  1.00 39.28  ? 684 LYS B CE    1 
ATOM   8700  N  NZ    . LYS F 3 388 ? 17.924  67.942 -87.413  1.00 39.73  ? 684 LYS B NZ    1 
ATOM   8701  N  N     . THR F 3 389 ? 12.435  63.219 -89.098  1.00 34.49  ? 685 THR B N     1 
ATOM   8702  C  CA    . THR F 3 389 ? 12.738  62.079 -89.944  1.00 33.64  ? 685 THR B CA    1 
ATOM   8703  C  C     . THR F 3 389 ? 11.609  61.850 -90.948  1.00 33.69  ? 685 THR B C     1 
ATOM   8704  O  O     . THR F 3 389 ? 11.867  61.615 -92.127  1.00 33.71  ? 685 THR B O     1 
ATOM   8705  C  CB    . THR F 3 389 ? 12.967  60.795 -89.101  1.00 33.20  ? 685 THR B CB    1 
ATOM   8706  O  OG1   . THR F 3 389 ? 14.255  60.868 -88.479  1.00 31.79  ? 685 THR B OG1   1 
ATOM   8707  C  CG2   . THR F 3 389 ? 12.891  59.552 -89.969  1.00 32.27  ? 685 THR B CG2   1 
ATOM   8708  N  N     . ALA F 3 390 ? 10.362  61.914 -90.487  1.00 33.98  ? 686 ALA B N     1 
ATOM   8709  C  CA    . ALA F 3 390 ? 9.222   61.740 -91.382  1.00 35.23  ? 686 ALA B CA    1 
ATOM   8710  C  C     . ALA F 3 390 ? 9.311   62.758 -92.526  1.00 36.00  ? 686 ALA B C     1 
ATOM   8711  O  O     . ALA F 3 390 ? 9.046   62.433 -93.679  1.00 36.30  ? 686 ALA B O     1 
ATOM   8712  C  CB    . ALA F 3 390 ? 7.909   61.916 -90.615  1.00 33.97  ? 686 ALA B CB    1 
ATOM   8713  N  N     . MET F 3 391 ? 9.701   63.987 -92.208  1.00 36.93  ? 687 MET B N     1 
ATOM   8714  C  CA    . MET F 3 391 ? 9.828   65.025 -93.234  1.00 38.00  ? 687 MET B CA    1 
ATOM   8715  C  C     . MET F 3 391 ? 10.873  64.655 -94.290  1.00 39.60  ? 687 MET B C     1 
ATOM   8716  O  O     . MET F 3 391 ? 10.605  64.718 -95.494  1.00 39.52  ? 687 MET B O     1 
ATOM   8717  C  CB    . MET F 3 391 ? 10.222  66.363 -92.596  1.00 36.54  ? 687 MET B CB    1 
ATOM   8718  C  CG    . MET F 3 391 ? 9.067   67.123 -91.955  1.00 35.28  ? 687 MET B CG    1 
ATOM   8719  S  SD    . MET F 3 391 ? 9.611   68.530 -90.916  1.00 34.89  ? 687 MET B SD    1 
ATOM   8720  C  CE    . MET F 3 391 ? 11.258  68.854 -91.505  1.00 34.88  ? 687 MET B CE    1 
ATOM   8721  N  N     . ASP F 3 392 ? 12.063  64.275 -93.826  1.00 40.72  ? 688 ASP B N     1 
ATOM   8722  C  CA    . ASP F 3 392 ? 13.167  63.912 -94.707  1.00 41.77  ? 688 ASP B CA    1 
ATOM   8723  C  C     . ASP F 3 392 ? 12.863  62.696 -95.570  1.00 42.51  ? 688 ASP B C     1 
ATOM   8724  O  O     . ASP F 3 392 ? 13.268  62.635 -96.727  1.00 43.02  ? 688 ASP B O     1 
ATOM   8725  C  CB    . ASP F 3 392 ? 14.420  63.628 -93.879  1.00 42.31  ? 688 ASP B CB    1 
ATOM   8726  C  CG    . ASP F 3 392 ? 15.601  63.180 -94.730  1.00 42.78  ? 688 ASP B CG    1 
ATOM   8727  O  OD1   . ASP F 3 392 ? 15.442  62.246 -95.545  1.00 42.97  ? 688 ASP B OD1   1 
ATOM   8728  O  OD2   . ASP F 3 392 ? 16.696  63.759 -94.578  1.00 43.10  ? 688 ASP B OD2   1 
ATOM   8729  N  N     . ILE F 3 393 ? 12.152  61.734 -94.997  1.00 42.90  ? 689 ILE B N     1 
ATOM   8730  C  CA    . ILE F 3 393 ? 11.810  60.495 -95.681  1.00 43.16  ? 689 ILE B CA    1 
ATOM   8731  C  C     . ILE F 3 393 ? 10.726  60.622 -96.746  1.00 43.49  ? 689 ILE B C     1 
ATOM   8732  O  O     . ILE F 3 393 ? 10.814  60.006 -97.809  1.00 43.09  ? 689 ILE B O     1 
ATOM   8733  C  CB    . ILE F 3 393 ? 11.371  59.426 -94.651  1.00 43.15  ? 689 ILE B CB    1 
ATOM   8734  C  CG1   . ILE F 3 393 ? 12.543  59.095 -93.723  1.00 43.47  ? 689 ILE B CG1   1 
ATOM   8735  C  CG2   . ILE F 3 393 ? 10.859  58.179 -95.361  1.00 43.58  ? 689 ILE B CG2   1 
ATOM   8736  C  CD1   . ILE F 3 393 ? 13.791  58.604 -94.448  1.00 43.70  ? 689 ILE B CD1   1 
ATOM   8737  N  N     . PHE F 3 394 ? 9.701   61.414 -96.458  1.00 43.96  ? 690 PHE B N     1 
ATOM   8738  C  CA    . PHE F 3 394 ? 8.592   61.586 -97.389  1.00 44.42  ? 690 PHE B CA    1 
ATOM   8739  C  C     . PHE F 3 394 ? 8.634   62.887 -98.190  1.00 44.72  ? 690 PHE B C     1 
ATOM   8740  O  O     . PHE F 3 394 ? 7.691   63.187 -98.922  1.00 44.27  ? 690 PHE B O     1 
ATOM   8741  C  CB    . PHE F 3 394 ? 7.274   61.509 -96.616  1.00 44.10  ? 690 PHE B CB    1 
ATOM   8742  C  CG    . PHE F 3 394 ? 7.130   60.262 -95.800  1.00 44.34  ? 690 PHE B CG    1 
ATOM   8743  C  CD1   . PHE F 3 394 ? 6.824   59.052 -96.405  1.00 44.22  ? 690 PHE B CD1   1 
ATOM   8744  C  CD2   . PHE F 3 394 ? 7.338   60.288 -94.426  1.00 44.33  ? 690 PHE B CD2   1 
ATOM   8745  C  CE1   . PHE F 3 394 ? 6.728   57.887 -95.657  1.00 44.00  ? 690 PHE B CE1   1 
ATOM   8746  C  CE2   . PHE F 3 394 ? 7.244   59.125 -93.670  1.00 44.42  ? 690 PHE B CE2   1 
ATOM   8747  C  CZ    . PHE F 3 394 ? 6.939   57.923 -94.289  1.00 44.22  ? 690 PHE B CZ    1 
ATOM   8748  N  N     . GLN F 3 395 ? 9.720   63.649 -98.074  1.00 45.55  ? 691 GLN B N     1 
ATOM   8749  C  CA    . GLN F 3 395 ? 9.808   64.923 -98.790  1.00 46.38  ? 691 GLN B CA    1 
ATOM   8750  C  C     . GLN F 3 395 ? 8.464   65.623 -98.623  1.00 46.73  ? 691 GLN B C     1 
ATOM   8751  O  O     . GLN F 3 395 ? 7.658   65.698 -99.556  1.00 46.55  ? 691 GLN B O     1 
ATOM   8752  C  CB    . GLN F 3 395 ? 10.089  64.699 -100.277 1.00 46.59  ? 691 GLN B CB    1 
ATOM   8753  C  CG    . GLN F 3 395 ? 11.559  64.556 -100.637 1.00 47.17  ? 691 GLN B CG    1 
ATOM   8754  C  CD    . GLN F 3 395 ? 12.247  63.496 -99.825  1.00 47.23  ? 691 GLN B CD    1 
ATOM   8755  O  OE1   . GLN F 3 395 ? 12.527  63.692 -98.647  1.00 47.93  ? 691 GLN B OE1   1 
ATOM   8756  N  NE2   . GLN F 3 395 ? 12.514  62.357 -100.443 1.00 47.38  ? 691 GLN B NE2   1 
ATOM   8757  N  N     . VAL F 3 396 ? 8.223   66.111 -97.413  1.00 47.06  ? 692 VAL B N     1 
ATOM   8758  C  CA    . VAL F 3 396 ? 6.977   66.784 -97.101  1.00 47.63  ? 692 VAL B CA    1 
ATOM   8759  C  C     . VAL F 3 396 ? 7.215   67.872 -96.067  1.00 47.90  ? 692 VAL B C     1 
ATOM   8760  O  O     . VAL F 3 396 ? 8.205   67.842 -95.331  1.00 48.38  ? 692 VAL B O     1 
ATOM   8761  C  CB    . VAL F 3 396 ? 5.937   65.777 -96.551  1.00 47.49  ? 692 VAL B CB    1 
ATOM   8762  C  CG1   . VAL F 3 396 ? 6.437   65.163 -95.251  1.00 47.27  ? 692 VAL B CG1   1 
ATOM   8763  C  CG2   . VAL F 3 396 ? 4.615   66.464 -96.327  1.00 47.22  ? 692 VAL B CG2   1 
ATOM   8764  N  N     . SER F 3 397 ? 6.316   68.847 -96.030  1.00 48.49  ? 693 SER B N     1 
ATOM   8765  C  CA    . SER F 3 397 ? 6.422   69.931 -95.067  1.00 48.79  ? 693 SER B CA    1 
ATOM   8766  C  C     . SER F 3 397 ? 6.018   69.345 -93.721  1.00 48.67  ? 693 SER B C     1 
ATOM   8767  O  O     . SER F 3 397 ? 5.504   68.230 -93.660  1.00 49.00  ? 693 SER B O     1 
ATOM   8768  C  CB    . SER F 3 397 ? 5.474   71.069 -95.446  1.00 49.02  ? 693 SER B CB    1 
ATOM   8769  O  OG    . SER F 3 397 ? 4.127   70.624 -95.445  1.00 49.42  ? 693 SER B OG    1 
ATOM   8770  N  N     . GLU F 3 398 ? 6.242   70.087 -92.647  1.00 48.80  ? 694 GLU B N     1 
ATOM   8771  C  CA    . GLU F 3 398 ? 5.880   69.607 -91.322  1.00 49.43  ? 694 GLU B CA    1 
ATOM   8772  C  C     . GLU F 3 398 ? 4.353   69.473 -91.177  1.00 49.92  ? 694 GLU B C     1 
ATOM   8773  O  O     . GLU F 3 398 ? 3.867   68.542 -90.538  1.00 49.28  ? 694 GLU B O     1 
ATOM   8774  C  CB    . GLU F 3 398 ? 6.433   70.561 -90.257  1.00 48.98  ? 694 GLU B CB    1 
ATOM   8775  C  CG    . GLU F 3 398 ? 6.530   69.960 -88.862  1.00 49.53  ? 694 GLU B CG    1 
ATOM   8776  C  CD    . GLU F 3 398 ? 6.981   70.965 -87.815  1.00 49.60  ? 694 GLU B CD    1 
ATOM   8777  O  OE1   . GLU F 3 398 ? 7.948   71.710 -88.072  1.00 51.46  ? 694 GLU B OE1   1 
ATOM   8778  O  OE2   . GLU F 3 398 ? 6.378   71.005 -86.727  1.00 49.57  ? 694 GLU B OE2   1 
ATOM   8779  N  N     . ASP F 3 399 ? 3.607   70.396 -91.787  1.00 50.71  ? 695 ASP B N     1 
ATOM   8780  C  CA    . ASP F 3 399 ? 2.141   70.406 -91.719  1.00 51.68  ? 695 ASP B CA    1 
ATOM   8781  C  C     . ASP F 3 399 ? 1.421   69.248 -92.415  1.00 52.33  ? 695 ASP B C     1 
ATOM   8782  O  O     . ASP F 3 399 ? 0.363   68.812 -91.957  1.00 52.48  ? 695 ASP B O     1 
ATOM   8783  C  CB    . ASP F 3 399 ? 1.596   71.722 -92.290  1.00 52.54  ? 695 ASP B CB    1 
ATOM   8784  C  CG    . ASP F 3 399 ? 1.822   72.902 -91.367  1.00 52.85  ? 695 ASP B CG    1 
ATOM   8785  O  OD1   . ASP F 3 399 ? 1.070   73.043 -90.376  1.00 53.47  ? 695 ASP B OD1   1 
ATOM   8786  O  OD2   . ASP F 3 399 ? 2.755   73.687 -91.630  1.00 53.18  ? 695 ASP B OD2   1 
ATOM   8787  N  N     . GLU F 3 400 ? 1.979   68.759 -93.519  1.00 52.95  ? 696 GLU B N     1 
ATOM   8788  C  CA    . GLU F 3 400 ? 1.355   67.668 -94.265  1.00 53.70  ? 696 GLU B CA    1 
ATOM   8789  C  C     . GLU F 3 400 ? 1.651   66.295 -93.658  1.00 53.84  ? 696 GLU B C     1 
ATOM   8790  O  O     . GLU F 3 400 ? 1.029   65.298 -94.031  1.00 53.90  ? 696 GLU B O     1 
ATOM   8791  C  CB    . GLU F 3 400 ? 1.832   67.665 -95.721  1.00 54.44  ? 696 GLU B CB    1 
ATOM   8792  C  CG    . GLU F 3 400 ? 1.961   69.030 -96.384  1.00 55.40  ? 696 GLU B CG    1 
ATOM   8793  C  CD    . GLU F 3 400 ? 2.620   68.940 -97.756  1.00 55.86  ? 696 GLU B CD    1 
ATOM   8794  O  OE1   . GLU F 3 400 ? 3.096   69.974 -98.267  1.00 56.14  ? 696 GLU B OE1   1 
ATOM   8795  O  OE2   . GLU F 3 400 ? 2.660   67.829 -98.330  1.00 56.43  ? 696 GLU B OE2   1 
ATOM   8796  N  N     . VAL F 3 401 ? 2.607   66.244 -92.735  1.00 53.76  ? 697 VAL B N     1 
ATOM   8797  C  CA    . VAL F 3 401 ? 2.978   64.987 -92.092  1.00 53.70  ? 697 VAL B CA    1 
ATOM   8798  C  C     . VAL F 3 401 ? 1.781   64.218 -91.529  1.00 53.44  ? 697 VAL B C     1 
ATOM   8799  O  O     . VAL F 3 401 ? 1.244   64.554 -90.478  1.00 53.26  ? 697 VAL B O     1 
ATOM   8800  C  CB    . VAL F 3 401 ? 4.001   65.219 -90.958  1.00 53.50  ? 697 VAL B CB    1 
ATOM   8801  C  CG1   . VAL F 3 401 ? 4.302   63.905 -90.248  1.00 53.95  ? 697 VAL B CG1   1 
ATOM   8802  C  CG2   . VAL F 3 401 ? 5.278   65.805 -91.529  1.00 53.52  ? 697 VAL B CG2   1 
ATOM   8803  N  N     . THR F 3 402 ? 1.380   63.184 -92.256  1.00 53.56  ? 698 THR B N     1 
ATOM   8804  C  CA    . THR F 3 402 ? 0.275   62.310 -91.883  1.00 54.11  ? 698 THR B CA    1 
ATOM   8805  C  C     . THR F 3 402 ? 0.591   61.670 -90.532  1.00 54.28  ? 698 THR B C     1 
ATOM   8806  O  O     . THR F 3 402 ? 1.737   61.708 -90.082  1.00 54.61  ? 698 THR B O     1 
ATOM   8807  C  CB    . THR F 3 402 ? 0.108   61.212 -92.979  1.00 54.40  ? 698 THR B CB    1 
ATOM   8808  O  OG1   . THR F 3 402 ? -0.627  61.759 -94.080  1.00 54.90  ? 698 THR B OG1   1 
ATOM   8809  C  CG2   . THR F 3 402 ? -0.597  59.971 -92.456  1.00 54.48  ? 698 THR B CG2   1 
ATOM   8810  N  N     . PRO F 3 403 ? -0.422  61.115 -89.842  1.00 54.22  ? 699 PRO B N     1 
ATOM   8811  C  CA    . PRO F 3 403 ? -0.118  60.488 -88.553  1.00 53.90  ? 699 PRO B CA    1 
ATOM   8812  C  C     . PRO F 3 403 ? 0.737   59.245 -88.784  1.00 53.62  ? 699 PRO B C     1 
ATOM   8813  O  O     . PRO F 3 403 ? 1.565   58.880 -87.950  1.00 53.89  ? 699 PRO B O     1 
ATOM   8814  C  CB    . PRO F 3 403 ? -1.499  60.146 -87.998  1.00 54.06  ? 699 PRO B CB    1 
ATOM   8815  C  CG    . PRO F 3 403 ? -2.336  59.971 -89.241  1.00 54.37  ? 699 PRO B CG    1 
ATOM   8816  C  CD    . PRO F 3 403 ? -1.877  61.144 -90.068  1.00 54.31  ? 699 PRO B CD    1 
ATOM   8817  N  N     . ASN F 3 404 ? 0.531   58.610 -89.935  1.00 53.17  ? 700 ASN B N     1 
ATOM   8818  C  CA    . ASN F 3 404 ? 1.266   57.406 -90.306  1.00 52.49  ? 700 ASN B CA    1 
ATOM   8819  C  C     . ASN F 3 404 ? 2.714   57.752 -90.642  1.00 51.74  ? 700 ASN B C     1 
ATOM   8820  O  O     . ASN F 3 404 ? 3.625   56.964 -90.387  1.00 51.66  ? 700 ASN B O     1 
ATOM   8821  C  CB    . ASN F 3 404 ? 0.578   56.724 -91.495  1.00 53.19  ? 700 ASN B CB    1 
ATOM   8822  C  CG    . ASN F 3 404 ? 1.324   55.484 -91.985  1.00 54.21  ? 700 ASN B CG    1 
ATOM   8823  O  OD1   . ASN F 3 404 ? 1.904   54.733 -91.193  1.00 54.69  ? 700 ASN B OD1   1 
ATOM   8824  N  ND2   . ASN F 3 404 ? 1.293   55.255 -93.296  1.00 53.84  ? 700 ASN B ND2   1 
ATOM   8825  N  N     . MET F 3 405 ? 2.920   58.935 -91.212  1.00 50.51  ? 701 MET B N     1 
ATOM   8826  C  CA    . MET F 3 405 ? 4.260   59.388 -91.560  1.00 49.39  ? 701 MET B CA    1 
ATOM   8827  C  C     . MET F 3 405 ? 5.142   59.429 -90.319  1.00 48.09  ? 701 MET B C     1 
ATOM   8828  O  O     . MET F 3 405 ? 6.255   58.916 -90.326  1.00 48.28  ? 701 MET B O     1 
ATOM   8829  C  CB    . MET F 3 405 ? 4.210   60.783 -92.194  1.00 49.69  ? 701 MET B CB    1 
ATOM   8830  C  CG    . MET F 3 405 ? 4.191   60.783 -93.718  1.00 50.35  ? 701 MET B CG    1 
ATOM   8831  S  SD    . MET F 3 405 ? 4.069   62.448 -94.417  1.00 51.14  ? 701 MET B SD    1 
ATOM   8832  C  CE    . MET F 3 405 ? 2.404   62.414 -95.054  1.00 51.40  ? 701 MET B CE    1 
ATOM   8833  N  N     . ARG F 3 406 ? 4.642   60.044 -89.251  1.00 46.93  ? 702 ARG B N     1 
ATOM   8834  C  CA    . ARG F 3 406 ? 5.410   60.134 -88.014  1.00 45.23  ? 702 ARG B CA    1 
ATOM   8835  C  C     . ARG F 3 406 ? 5.645   58.741 -87.445  1.00 44.02  ? 702 ARG B C     1 
ATOM   8836  O  O     . ARG F 3 406 ? 6.776   58.376 -87.136  1.00 43.76  ? 702 ARG B O     1 
ATOM   8837  C  CB    . ARG F 3 406 ? 4.682   61.001 -86.986  1.00 44.79  ? 702 ARG B CB    1 
ATOM   8838  C  CG    . ARG F 3 406 ? 5.470   61.207 -85.701  1.00 43.93  ? 702 ARG B CG    1 
ATOM   8839  C  CD    . ARG F 3 406 ? 4.887   62.343 -84.873  1.00 43.48  ? 702 ARG B CD    1 
ATOM   8840  N  NE    . ARG F 3 406 ? 5.714   62.660 -83.710  1.00 41.75  ? 702 ARG B NE    1 
ATOM   8841  C  CZ    . ARG F 3 406 ? 5.887   61.847 -82.675  1.00 40.52  ? 702 ARG B CZ    1 
ATOM   8842  N  NH1   . ARG F 3 406 ? 5.286   60.670 -82.660  1.00 40.43  ? 702 ARG B NH1   1 
ATOM   8843  N  NH2   . ARG F 3 406 ? 6.656   62.211 -81.659  1.00 39.52  ? 702 ARG B NH2   1 
ATOM   8844  N  N     . ARG F 3 407 ? 4.578   57.961 -87.309  1.00 42.99  ? 703 ARG B N     1 
ATOM   8845  C  CA    . ARG F 3 407 ? 4.726   56.608 -86.789  1.00 42.18  ? 703 ARG B CA    1 
ATOM   8846  C  C     . ARG F 3 407 ? 5.728   55.815 -87.615  1.00 41.50  ? 703 ARG B C     1 
ATOM   8847  O  O     . ARG F 3 407 ? 6.547   55.085 -87.059  1.00 41.75  ? 703 ARG B O     1 
ATOM   8848  C  CB    . ARG F 3 407 ? 3.391   55.869 -86.780  1.00 42.30  ? 703 ARG B CB    1 
ATOM   8849  C  CG    . ARG F 3 407 ? 2.453   56.293 -85.674  1.00 44.05  ? 703 ARG B CG    1 
ATOM   8850  C  CD    . ARG F 3 407 ? 1.235   55.374 -85.593  1.00 44.63  ? 703 ARG B CD    1 
ATOM   8851  N  NE    . ARG F 3 407 ? 1.406   54.262 -84.652  1.00 46.04  ? 703 ARG B NE    1 
ATOM   8852  C  CZ    . ARG F 3 407 ? 2.242   53.237 -84.817  1.00 46.60  ? 703 ARG B CZ    1 
ATOM   8853  N  NH1   . ARG F 3 407 ? 3.011   53.156 -85.895  1.00 47.26  ? 703 ARG B NH1   1 
ATOM   8854  N  NH2   . ARG F 3 407 ? 2.299   52.276 -83.902  1.00 46.64  ? 703 ARG B NH2   1 
ATOM   8855  N  N     . GLN F 3 408 ? 5.665   55.958 -88.939  1.00 40.87  ? 704 GLN B N     1 
ATOM   8856  C  CA    . GLN F 3 408 ? 6.572   55.234 -89.822  1.00 40.31  ? 704 GLN B CA    1 
ATOM   8857  C  C     . GLN F 3 408 ? 7.984   55.782 -89.692  1.00 39.44  ? 704 GLN B C     1 
ATOM   8858  O  O     . GLN F 3 408 ? 8.956   55.122 -90.065  1.00 39.70  ? 704 GLN B O     1 
ATOM   8859  C  CB    . GLN F 3 408 ? 6.110   55.329 -91.284  1.00 41.78  ? 704 GLN B CB    1 
ATOM   8860  C  CG    . GLN F 3 408 ? 6.749   54.280 -92.190  1.00 43.05  ? 704 GLN B CG    1 
ATOM   8861  C  CD    . GLN F 3 408 ? 6.294   54.374 -93.635  1.00 44.41  ? 704 GLN B CD    1 
ATOM   8862  O  OE1   . GLN F 3 408 ? 5.108   54.551 -93.921  1.00 45.12  ? 704 GLN B OE1   1 
ATOM   8863  N  NE2   . GLN F 3 408 ? 7.238   54.237 -94.558  1.00 44.80  ? 704 GLN B NE2   1 
ATOM   8864  N  N     . ALA F 3 409 ? 8.100   56.996 -89.166  1.00 37.88  ? 705 ALA B N     1 
ATOM   8865  C  CA    . ALA F 3 409 ? 9.410   57.600 -88.977  1.00 36.71  ? 705 ALA B CA    1 
ATOM   8866  C  C     . ALA F 3 409 ? 9.994   57.063 -87.670  1.00 36.07  ? 705 ALA B C     1 
ATOM   8867  O  O     . ALA F 3 409 ? 11.205  56.926 -87.528  1.00 34.88  ? 705 ALA B O     1 
ATOM   8868  C  CB    . ALA F 3 409 ? 9.288   59.117 -88.916  1.00 36.26  ? 705 ALA B CB    1 
ATOM   8869  N  N     . LYS F 3 410 ? 9.107   56.751 -86.728  1.00 35.65  ? 706 LYS B N     1 
ATOM   8870  C  CA    . LYS F 3 410 ? 9.487   56.241 -85.415  1.00 35.83  ? 706 LYS B CA    1 
ATOM   8871  C  C     . LYS F 3 410 ? 10.289  54.943 -85.549  1.00 35.47  ? 706 LYS B C     1 
ATOM   8872  O  O     . LYS F 3 410 ? 11.368  54.803 -84.973  1.00 35.38  ? 706 LYS B O     1 
ATOM   8873  C  CB    . LYS F 3 410 ? 8.217   56.012 -84.583  1.00 36.57  ? 706 LYS B CB    1 
ATOM   8874  C  CG    . LYS F 3 410 ? 8.413   56.027 -83.080  1.00 36.40  ? 706 LYS B CG    1 
ATOM   8875  C  CD    . LYS F 3 410 ? 7.081   55.881 -82.353  1.00 37.14  ? 706 LYS B CD    1 
ATOM   8876  C  CE    . LYS F 3 410 ? 6.154   57.058 -82.635  1.00 37.12  ? 706 LYS B CE    1 
ATOM   8877  N  NZ    . LYS F 3 410 ? 4.968   57.064 -81.734  1.00 37.73  ? 706 LYS B NZ    1 
ATOM   8878  N  N     . ALA F 3 411 ? 9.763   54.003 -86.327  1.00 35.25  ? 707 ALA B N     1 
ATOM   8879  C  CA    . ALA F 3 411 ? 10.435  52.730 -86.543  1.00 34.79  ? 707 ALA B CA    1 
ATOM   8880  C  C     . ALA F 3 411 ? 11.764  52.943 -87.272  1.00 34.58  ? 707 ALA B C     1 
ATOM   8881  O  O     . ALA F 3 411 ? 12.709  52.185 -87.092  1.00 33.87  ? 707 ALA B O     1 
ATOM   8882  C  CB    . ALA F 3 411 ? 9.529   51.795 -87.341  1.00 35.40  ? 707 ALA B CB    1 
ATOM   8883  N  N     . VAL F 3 412 ? 11.850  54.005 -88.065  1.00 34.31  ? 708 VAL B N     1 
ATOM   8884  C  CA    . VAL F 3 412 ? 13.071  54.281 -88.803  1.00 34.29  ? 708 VAL B CA    1 
ATOM   8885  C  C     . VAL F 3 412 ? 14.191  54.816 -87.920  1.00 34.28  ? 708 VAL B C     1 
ATOM   8886  O  O     . VAL F 3 412 ? 15.361  54.479 -88.122  1.00 32.65  ? 708 VAL B O     1 
ATOM   8887  C  CB    . VAL F 3 412 ? 12.826  55.289 -89.960  1.00 34.39  ? 708 VAL B CB    1 
ATOM   8888  C  CG1   . VAL F 3 412 ? 14.140  55.625 -90.649  1.00 33.22  ? 708 VAL B CG1   1 
ATOM   8889  C  CG2   . VAL F 3 412 ? 11.850  54.699 -90.964  1.00 35.41  ? 708 VAL B CG2   1 
ATOM   8890  N  N     . ASN F 3 413 ? 13.846  55.644 -86.936  1.00 34.80  ? 709 ASN B N     1 
ATOM   8891  C  CA    . ASN F 3 413 ? 14.873  56.205 -86.061  1.00 35.00  ? 709 ASN B CA    1 
ATOM   8892  C  C     . ASN F 3 413 ? 15.487  55.178 -85.105  1.00 34.95  ? 709 ASN B C     1 
ATOM   8893  O  O     . ASN F 3 413 ? 16.714  55.110 -84.948  1.00 34.18  ? 709 ASN B O     1 
ATOM   8894  C  CB    . ASN F 3 413 ? 14.308  57.377 -85.256  1.00 36.30  ? 709 ASN B CB    1 
ATOM   8895  C  CG    . ASN F 3 413 ? 13.872  58.519 -86.138  1.00 36.40  ? 709 ASN B CG    1 
ATOM   8896  O  OD1   . ASN F 3 413 ? 14.479  58.772 -87.175  1.00 36.51  ? 709 ASN B OD1   1 
ATOM   8897  N  ND2   . ASN F 3 413 ? 12.823  59.222 -85.730  1.00 37.21  ? 709 ASN B ND2   1 
ATOM   8898  N  N     . PHE F 3 414 ? 14.634  54.394 -84.458  1.00 34.40  ? 710 PHE B N     1 
ATOM   8899  C  CA    . PHE F 3 414 ? 15.108  53.381 -83.524  1.00 34.87  ? 710 PHE B CA    1 
ATOM   8900  C  C     . PHE F 3 414 ? 15.716  52.248 -84.326  1.00 34.80  ? 710 PHE B C     1 
ATOM   8901  O  O     . PHE F 3 414 ? 16.750  51.698 -83.950  1.00 34.35  ? 710 PHE B O     1 
ATOM   8902  C  CB    . PHE F 3 414 ? 13.956  52.875 -82.655  1.00 34.63  ? 710 PHE B CB    1 
ATOM   8903  C  CG    . PHE F 3 414 ? 13.360  53.940 -81.785  1.00 34.65  ? 710 PHE B CG    1 
ATOM   8904  C  CD1   . PHE F 3 414 ? 14.173  54.691 -80.941  1.00 34.58  ? 710 PHE B CD1   1 
ATOM   8905  C  CD2   . PHE F 3 414 ? 12.002  54.235 -81.847  1.00 33.71  ? 710 PHE B CD2   1 
ATOM   8906  C  CE1   . PHE F 3 414 ? 13.646  55.726 -80.176  1.00 34.22  ? 710 PHE B CE1   1 
ATOM   8907  C  CE2   . PHE F 3 414 ? 11.469  55.264 -81.089  1.00 33.77  ? 710 PHE B CE2   1 
ATOM   8908  C  CZ    . PHE F 3 414 ? 12.288  56.014 -80.255  1.00 33.41  ? 710 PHE B CZ    1 
ATOM   8909  N  N     . GLY F 3 415 ? 15.063  51.924 -85.440  1.00 35.13  ? 711 GLY B N     1 
ATOM   8910  C  CA    . GLY F 3 415 ? 15.552  50.887 -86.322  1.00 35.24  ? 711 GLY B CA    1 
ATOM   8911  C  C     . GLY F 3 415 ? 17.006  51.145 -86.683  1.00 35.21  ? 711 GLY B C     1 
ATOM   8912  O  O     . GLY F 3 415 ? 17.825  50.228 -86.650  1.00 35.24  ? 711 GLY B O     1 
ATOM   8913  N  N     . ILE F 3 416 ? 17.335  52.398 -86.990  1.00 34.23  ? 712 ILE B N     1 
ATOM   8914  C  CA    . ILE F 3 416 ? 18.700  52.755 -87.367  1.00 34.14  ? 712 ILE B CA    1 
ATOM   8915  C  C     . ILE F 3 416 ? 19.705  52.954 -86.221  1.00 33.03  ? 712 ILE B C     1 
ATOM   8916  O  O     . ILE F 3 416 ? 20.889  52.673 -86.384  1.00 32.72  ? 712 ILE B O     1 
ATOM   8917  C  CB    . ILE F 3 416 ? 18.710  54.016 -88.260  1.00 34.79  ? 712 ILE B CB    1 
ATOM   8918  C  CG1   . ILE F 3 416 ? 20.145  54.365 -88.647  1.00 35.08  ? 712 ILE B CG1   1 
ATOM   8919  C  CG2   . ILE F 3 416 ? 18.077  55.177 -87.527  1.00 35.65  ? 712 ILE B CG2   1 
ATOM   8920  C  CD1   . ILE F 3 416 ? 20.241  55.349 -89.778  1.00 35.44  ? 712 ILE B CD1   1 
ATOM   8921  N  N     . VAL F 3 417 ? 19.261  53.439 -85.068  1.00 32.15  ? 713 VAL B N     1 
ATOM   8922  C  CA    . VAL F 3 417 ? 20.200  53.618 -83.965  1.00 31.59  ? 713 VAL B CA    1 
ATOM   8923  C  C     . VAL F 3 417 ? 20.454  52.275 -83.288  1.00 31.16  ? 713 VAL B C     1 
ATOM   8924  O  O     . VAL F 3 417 ? 21.424  52.121 -82.554  1.00 30.57  ? 713 VAL B O     1 
ATOM   8925  C  CB    . VAL F 3 417 ? 19.688  54.634 -82.899  1.00 31.16  ? 713 VAL B CB    1 
ATOM   8926  C  CG1   . VAL F 3 417 ? 19.205  55.904 -83.594  1.00 31.01  ? 713 VAL B CG1   1 
ATOM   8927  C  CG2   . VAL F 3 417 ? 18.587  54.015 -82.050  1.00 29.58  ? 713 VAL B CG2   1 
ATOM   8928  N  N     . TYR F 3 418 ? 19.576  51.310 -83.543  1.00 30.98  ? 714 TYR B N     1 
ATOM   8929  C  CA    . TYR F 3 418 ? 19.712  49.986 -82.956  1.00 31.38  ? 714 TYR B CA    1 
ATOM   8930  C  C     . TYR F 3 418 ? 20.224  48.929 -83.934  1.00 31.17  ? 714 TYR B C     1 
ATOM   8931  O  O     . TYR F 3 418 ? 19.857  47.757 -83.831  1.00 31.32  ? 714 TYR B O     1 
ATOM   8932  C  CB    . TYR F 3 418 ? 18.377  49.538 -82.359  1.00 32.00  ? 714 TYR B CB    1 
ATOM   8933  C  CG    . TYR F 3 418 ? 17.953  50.337 -81.142  1.00 32.16  ? 714 TYR B CG    1 
ATOM   8934  C  CD1   . TYR F 3 418 ? 18.851  50.593 -80.104  1.00 31.74  ? 714 TYR B CD1   1 
ATOM   8935  C  CD2   . TYR F 3 418 ? 16.643  50.809 -81.011  1.00 32.46  ? 714 TYR B CD2   1 
ATOM   8936  C  CE1   . TYR F 3 418 ? 18.458  51.298 -78.964  1.00 32.59  ? 714 TYR B CE1   1 
ATOM   8937  C  CE2   . TYR F 3 418 ? 16.237  51.517 -79.867  1.00 32.03  ? 714 TYR B CE2   1 
ATOM   8938  C  CZ    . TYR F 3 418 ? 17.145  51.756 -78.853  1.00 32.33  ? 714 TYR B CZ    1 
ATOM   8939  O  OH    . TYR F 3 418 ? 16.753  52.440 -77.719  1.00 32.63  ? 714 TYR B OH    1 
ATOM   8940  N  N     . GLY F 3 419 ? 21.059  49.354 -84.885  1.00 31.53  ? 715 GLY B N     1 
ATOM   8941  C  CA    . GLY F 3 419 ? 21.663  48.446 -85.852  1.00 31.33  ? 715 GLY B CA    1 
ATOM   8942  C  C     . GLY F 3 419 ? 20.893  47.801 -87.004  1.00 32.20  ? 715 GLY B C     1 
ATOM   8943  O  O     . GLY F 3 419 ? 21.072  46.602 -87.273  1.00 30.75  ? 715 GLY B O     1 
ATOM   8944  N  N     . ILE F 3 420 ? 20.048  48.558 -87.701  1.00 32.32  ? 716 ILE B N     1 
ATOM   8945  C  CA    . ILE F 3 420 ? 19.315  47.983 -88.832  1.00 32.61  ? 716 ILE B CA    1 
ATOM   8946  C  C     . ILE F 3 420 ? 20.275  48.040 -90.018  1.00 33.15  ? 716 ILE B C     1 
ATOM   8947  O  O     . ILE F 3 420 ? 21.142  48.914 -90.063  1.00 33.31  ? 716 ILE B O     1 
ATOM   8948  C  CB    . ILE F 3 420 ? 18.051  48.795 -89.168  1.00 31.98  ? 716 ILE B CB    1 
ATOM   8949  C  CG1   . ILE F 3 420 ? 17.186  48.022 -90.172  1.00 32.17  ? 716 ILE B CG1   1 
ATOM   8950  C  CG2   . ILE F 3 420 ? 18.453  50.146 -89.735  1.00 32.22  ? 716 ILE B CG2   1 
ATOM   8951  C  CD1   . ILE F 3 420 ? 15.749  48.537 -90.305  1.00 31.17  ? 716 ILE B CD1   1 
ATOM   8952  N  N     . SER F 3 421 ? 20.152  47.105 -90.957  1.00 33.66  ? 717 SER B N     1 
ATOM   8953  C  CA    . SER F 3 421 ? 21.035  47.096 -92.131  1.00 34.97  ? 717 SER B CA    1 
ATOM   8954  C  C     . SER F 3 421 ? 20.346  47.816 -93.284  1.00 35.44  ? 717 SER B C     1 
ATOM   8955  O  O     . SER F 3 421 ? 19.156  48.117 -93.202  1.00 34.89  ? 717 SER B O     1 
ATOM   8956  C  CB    . SER F 3 421 ? 21.343  45.661 -92.554  1.00 34.54  ? 717 SER B CB    1 
ATOM   8957  O  OG    . SER F 3 421 ? 20.143  44.965 -92.856  1.00 34.97  ? 717 SER B OG    1 
ATOM   8958  N  N     . ASP F 3 422 ? 21.077  48.082 -94.363  1.00 37.07  ? 718 ASP B N     1 
ATOM   8959  C  CA    . ASP F 3 422 ? 20.463  48.757 -95.498  1.00 38.34  ? 718 ASP B CA    1 
ATOM   8960  C  C     . ASP F 3 422 ? 19.317  47.950 -96.099  1.00 38.96  ? 718 ASP B C     1 
ATOM   8961  O  O     . ASP F 3 422 ? 18.245  48.498 -96.359  1.00 39.04  ? 718 ASP B O     1 
ATOM   8962  C  CB    . ASP F 3 422 ? 21.496  49.095 -96.582  1.00 39.37  ? 718 ASP B CB    1 
ATOM   8963  C  CG    . ASP F 3 422 ? 22.651  48.117 -96.632  1.00 40.36  ? 718 ASP B CG    1 
ATOM   8964  O  OD1   . ASP F 3 422 ? 22.403  46.900 -96.756  1.00 40.37  ? 718 ASP B OD1   1 
ATOM   8965  O  OD2   . ASP F 3 422 ? 23.816  48.581 -96.556  1.00 41.59  ? 718 ASP B OD2   1 
ATOM   8966  N  N     . TYR F 3 423 ? 19.520  46.654 -96.310  1.00 39.54  ? 719 TYR B N     1 
ATOM   8967  C  CA    . TYR F 3 423 ? 18.453  45.838 -96.880  1.00 40.76  ? 719 TYR B CA    1 
ATOM   8968  C  C     . TYR F 3 423 ? 17.246  45.891 -95.970  1.00 41.00  ? 719 TYR B C     1 
ATOM   8969  O  O     . TYR F 3 423 ? 16.102  45.826 -96.430  1.00 41.67  ? 719 TYR B O     1 
ATOM   8970  C  CB    . TYR F 3 423 ? 18.899  44.377 -97.059  1.00 41.51  ? 719 TYR B CB    1 
ATOM   8971  C  CG    . TYR F 3 423 ? 19.779  44.169 -98.270  1.00 42.04  ? 719 TYR B CG    1 
ATOM   8972  C  CD1   . TYR F 3 423 ? 19.308  44.449 -99.556  1.00 41.71  ? 719 TYR B CD1   1 
ATOM   8973  C  CD2   . TYR F 3 423 ? 21.098  43.747 -98.129  1.00 42.60  ? 719 TYR B CD2   1 
ATOM   8974  C  CE1   . TYR F 3 423 ? 20.131  44.324 -100.667 1.00 42.28  ? 719 TYR B CE1   1 
ATOM   8975  C  CE2   . TYR F 3 423 ? 21.933  43.614 -99.233  1.00 42.82  ? 719 TYR B CE2   1 
ATOM   8976  C  CZ    . TYR F 3 423 ? 21.449  43.908 -100.500 1.00 42.72  ? 719 TYR B CZ    1 
ATOM   8977  O  OH    . TYR F 3 423 ? 22.301  43.818 -101.586 1.00 43.08  ? 719 TYR B OH    1 
ATOM   8978  N  N     . GLY F 3 424 ? 17.516  46.010 -94.672  1.00 41.05  ? 720 GLY B N     1 
ATOM   8979  C  CA    . GLY F 3 424 ? 16.454  46.063 -93.690  1.00 40.38  ? 720 GLY B CA    1 
ATOM   8980  C  C     . GLY F 3 424 ? 15.666  47.341 -93.817  1.00 40.23  ? 720 GLY B C     1 
ATOM   8981  O  O     . GLY F 3 424 ? 14.446  47.308 -93.873  1.00 39.68  ? 720 GLY B O     1 
ATOM   8982  N  N     . LEU F 3 425 ? 16.369  48.467 -93.857  1.00 40.55  ? 721 LEU B N     1 
ATOM   8983  C  CA    . LEU F 3 425 ? 15.725  49.762 -93.991  1.00 42.27  ? 721 LEU B CA    1 
ATOM   8984  C  C     . LEU F 3 425 ? 15.068  49.850 -95.371  1.00 43.28  ? 721 LEU B C     1 
ATOM   8985  O  O     . LEU F 3 425 ? 14.026  50.479 -95.534  1.00 44.33  ? 721 LEU B O     1 
ATOM   8986  C  CB    . LEU F 3 425 ? 16.755  50.887 -93.824  1.00 41.08  ? 721 LEU B CB    1 
ATOM   8987  C  CG    . LEU F 3 425 ? 16.242  52.326 -93.930  1.00 40.85  ? 721 LEU B CG    1 
ATOM   8988  C  CD1   . LEU F 3 425 ? 15.157  52.568 -92.885  1.00 40.73  ? 721 LEU B CD1   1 
ATOM   8989  C  CD2   . LEU F 3 425 ? 17.385  53.296 -93.740  1.00 40.20  ? 721 LEU B CD2   1 
ATOM   8990  N  N     . ALA F 3 426 ? 15.673  49.196 -96.354  1.00 44.63  ? 722 ALA B N     1 
ATOM   8991  C  CA    . ALA F 3 426 ? 15.156  49.201 -97.722  1.00 46.23  ? 722 ALA B CA    1 
ATOM   8992  C  C     . ALA F 3 426 ? 13.795  48.502 -97.818  1.00 47.13  ? 722 ALA B C     1 
ATOM   8993  O  O     . ALA F 3 426 ? 12.796  49.126 -98.200  1.00 47.12  ? 722 ALA B O     1 
ATOM   8994  C  CB    . ALA F 3 426 ? 16.156  48.535 -98.644  1.00 45.89  ? 722 ALA B CB    1 
ATOM   8995  N  N     . GLN F 3 427 ? 13.755  47.213 -97.485  1.00 48.51  ? 723 GLN B N     1 
ATOM   8996  C  CA    . GLN F 3 427 ? 12.500  46.461 -97.531  1.00 50.41  ? 723 GLN B CA    1 
ATOM   8997  C  C     . GLN F 3 427 ? 11.498  47.047 -96.534  1.00 51.25  ? 723 GLN B C     1 
ATOM   8998  O  O     . GLN F 3 427 ? 10.299  46.755 -96.593  1.00 50.98  ? 723 GLN B O     1 
ATOM   8999  C  CB    . GLN F 3 427 ? 12.752  44.969 -97.224  1.00 51.32  ? 723 GLN B CB    1 
ATOM   9000  C  CG    . GLN F 3 427 ? 11.524  44.070 -97.293  1.00 52.84  ? 723 GLN B CG    1 
ATOM   9001  C  CD    . GLN F 3 427 ? 10.993  43.846 -98.722  1.00 53.41  ? 723 GLN B CD    1 
ATOM   9002  O  OE1   . GLN F 3 427 ? 11.688  43.319 -99.593  1.00 53.58  ? 723 GLN B OE1   1 
ATOM   9003  N  NE2   . GLN F 3 427 ? 9.753   44.245 -98.950  1.00 53.73  ? 723 GLN B NE2   1 
ATOM   9004  N  N     . ASN F 3 428 ? 11.996  47.912 -95.653  1.00 52.18  ? 724 ASN B N     1 
ATOM   9005  C  CA    . ASN F 3 428 ? 11.176  48.551 -94.627  1.00 53.21  ? 724 ASN B CA    1 
ATOM   9006  C  C     . ASN F 3 428 ? 10.241  49.607 -95.216  1.00 53.47  ? 724 ASN B C     1 
ATOM   9007  O  O     . ASN F 3 428 ? 9.049   49.615 -94.936  1.00 53.70  ? 724 ASN B O     1 
ATOM   9008  C  CB    . ASN F 3 428 ? 12.090  49.199 -93.578  1.00 54.37  ? 724 ASN B CB    1 
ATOM   9009  C  CG    . ASN F 3 428 ? 11.333  49.707 -92.351  1.00 55.33  ? 724 ASN B CG    1 
ATOM   9010  O  OD1   . ASN F 3 428 ? 10.159  50.078 -92.432  1.00 56.07  ? 724 ASN B OD1   1 
ATOM   9011  N  ND2   . ASN F 3 428 ? 12.016  49.735 -91.204  1.00 55.60  ? 724 ASN B ND2   1 
ATOM   9012  N  N     . LEU F 3 429 ? 10.796  50.493 -96.037  1.00 53.25  ? 725 LEU B N     1 
ATOM   9013  C  CA    . LEU F 3 429 ? 10.033  51.567 -96.678  1.00 53.19  ? 725 LEU B CA    1 
ATOM   9014  C  C     . LEU F 3 429 ? 9.585   51.073 -98.057  1.00 53.53  ? 725 LEU B C     1 
ATOM   9015  O  O     . LEU F 3 429 ? 8.544   50.437 -98.198  1.00 53.81  ? 725 LEU B O     1 
ATOM   9016  C  CB    . LEU F 3 429 ? 10.941  52.793 -96.797  1.00 52.52  ? 725 LEU B CB    1 
ATOM   9017  C  CG    . LEU F 3 429 ? 11.859  53.092 -95.600  1.00 52.04  ? 725 LEU B CG    1 
ATOM   9018  C  CD1   . LEU F 3 429 ? 13.214  53.537 -96.088  1.00 51.68  ? 725 LEU B CD1   1 
ATOM   9019  C  CD2   . LEU F 3 429 ? 11.270  54.174 -94.731  1.00 51.85  ? 725 LEU B CD2   1 
ATOM   9020  N  N     . ASN F 3 430 ? 10.391  51.385 -99.063  1.00 53.69  ? 726 ASN B N     1 
ATOM   9021  C  CA    . ASN F 3 430 ? 10.206  50.960 -100.455 1.00 53.65  ? 726 ASN B CA    1 
ATOM   9022  C  C     . ASN F 3 430 ? 11.234  51.692 -101.293 1.00 53.07  ? 726 ASN B C     1 
ATOM   9023  O  O     . ASN F 3 430 ? 10.920  52.332 -102.294 1.00 53.63  ? 726 ASN B O     1 
ATOM   9024  C  CB    . ASN F 3 430 ? 8.815   51.245 -101.023 1.00 54.52  ? 726 ASN B CB    1 
ATOM   9025  C  CG    . ASN F 3 430 ? 8.624   50.602 -102.400 1.00 55.43  ? 726 ASN B CG    1 
ATOM   9026  O  OD1   . ASN F 3 430 ? 9.017   51.159 -103.430 1.00 55.39  ? 726 ASN B OD1   1 
ATOM   9027  N  ND2   . ASN F 3 430 ? 8.022   49.417 -102.418 1.00 55.76  ? 726 ASN B ND2   1 
ATOM   9028  N  N     . ILE F 3 431 ? 12.477  51.608 -100.848 1.00 52.24  ? 727 ILE B N     1 
ATOM   9029  C  CA    . ILE F 3 431 ? 13.575  52.256 -101.521 1.00 51.55  ? 727 ILE B CA    1 
ATOM   9030  C  C     . ILE F 3 431 ? 14.694  51.250 -101.682 1.00 51.59  ? 727 ILE B C     1 
ATOM   9031  O  O     . ILE F 3 431 ? 15.017  50.518 -100.748 1.00 51.74  ? 727 ILE B O     1 
ATOM   9032  C  CB    . ILE F 3 431 ? 14.072  53.488 -100.707 1.00 51.13  ? 727 ILE B CB    1 
ATOM   9033  C  CG1   . ILE F 3 431 ? 14.416  53.080 -99.271  1.00 50.48  ? 727 ILE B CG1   1 
ATOM   9034  C  CG2   . ILE F 3 431 ? 12.994  54.565 -100.682 1.00 51.08  ? 727 ILE B CG2   1 
ATOM   9035  C  CD1   . ILE F 3 431 ? 14.997  54.196 -98.443  1.00 49.06  ? 727 ILE B CD1   1 
ATOM   9036  N  N     . SER F 3 432 ? 15.250  51.189 -102.886 1.00 51.18  ? 728 SER B N     1 
ATOM   9037  C  CA    . SER F 3 432 ? 16.362  50.295 -103.180 1.00 50.71  ? 728 SER B CA    1 
ATOM   9038  C  C     . SER F 3 432 ? 17.306  50.249 -101.985 1.00 50.28  ? 728 SER B C     1 
ATOM   9039  O  O     . SER F 3 432 ? 17.233  51.085 -101.086 1.00 50.29  ? 728 SER B O     1 
ATOM   9040  C  CB    . SER F 3 432 ? 17.105  50.747 -104.443 1.00 50.45  ? 728 SER B CB    1 
ATOM   9041  O  OG    . SER F 3 432 ? 17.690  52.020 -104.254 1.00 50.41  ? 728 SER B OG    1 
ATOM   9042  N  N     . ARG F 3 433 ? 18.211  49.275 -102.001 1.00 49.96  ? 729 ARG B N     1 
ATOM   9043  C  CA    . ARG F 3 433 ? 19.211  49.146 -100.944 1.00 49.87  ? 729 ARG B CA    1 
ATOM   9044  C  C     . ARG F 3 433 ? 20.088  50.387 -100.924 1.00 49.50  ? 729 ARG B C     1 
ATOM   9045  O  O     . ARG F 3 433 ? 20.372  50.946 -99.862  1.00 49.34  ? 729 ARG B O     1 
ATOM   9046  C  CB    . ARG F 3 433 ? 20.102  47.927 -101.181 1.00 49.87  ? 729 ARG B CB    1 
ATOM   9047  C  CG    . ARG F 3 433 ? 21.358  47.931 -100.325 1.00 49.75  ? 729 ARG B CG    1 
ATOM   9048  C  CD    . ARG F 3 433 ? 22.509  47.267 -101.054 1.00 50.49  ? 729 ARG B CD    1 
ATOM   9049  N  NE    . ARG F 3 433 ? 22.695  47.849 -102.380 1.00 50.86  ? 729 ARG B NE    1 
ATOM   9050  C  CZ    . ARG F 3 433 ? 23.061  49.109 -102.605 1.00 51.19  ? 729 ARG B CZ    1 
ATOM   9051  N  NH1   . ARG F 3 433 ? 23.293  49.927 -101.588 1.00 51.52  ? 729 ARG B NH1   1 
ATOM   9052  N  NH2   . ARG F 3 433 ? 23.173  49.561 -103.851 1.00 51.11  ? 729 ARG B NH2   1 
ATOM   9053  N  N     . LYS F 3 434 ? 20.529  50.799 -102.108 1.00 49.28  ? 730 LYS B N     1 
ATOM   9054  C  CA    . LYS F 3 434 ? 21.379  51.973 -102.240 1.00 49.32  ? 730 LYS B CA    1 
ATOM   9055  C  C     . LYS F 3 434 ? 20.737  53.169 -101.554 1.00 49.09  ? 730 LYS B C     1 
ATOM   9056  O  O     . LYS F 3 434 ? 21.423  53.971 -100.927 1.00 48.66  ? 730 LYS B O     1 
ATOM   9057  C  CB    . LYS F 3 434 ? 21.613  52.300 -103.717 1.00 49.52  ? 730 LYS B CB    1 
ATOM   9058  C  CG    . LYS F 3 434 ? 22.632  53.410 -103.948 1.00 49.84  ? 730 LYS B CG    1 
ATOM   9059  C  CD    . LYS F 3 434 ? 22.849  53.668 -105.438 1.00 50.02  ? 730 LYS B CD    1 
ATOM   9060  C  CE    . LYS F 3 434 ? 21.621  54.306 -106.088 1.00 50.31  ? 730 LYS B CE    1 
ATOM   9061  N  NZ    . LYS F 3 434 ? 21.309  55.657 -105.527 1.00 49.72  ? 730 LYS B NZ    1 
ATOM   9062  N  N     . GLU F 3 435 ? 19.418  53.284 -101.679 1.00 49.07  ? 731 GLU B N     1 
ATOM   9063  C  CA    . GLU F 3 435 ? 18.705  54.396 -101.070 1.00 49.43  ? 731 GLU B CA    1 
ATOM   9064  C  C     . GLU F 3 435 ? 18.547  54.185 -99.565  1.00 49.09  ? 731 GLU B C     1 
ATOM   9065  O  O     . GLU F 3 435 ? 18.503  55.145 -98.793  1.00 48.36  ? 731 GLU B O     1 
ATOM   9066  C  CB    . GLU F 3 435 ? 17.348  54.591 -101.752 1.00 49.98  ? 731 GLU B CB    1 
ATOM   9067  C  CG    . GLU F 3 435 ? 17.494  54.980 -103.223 1.00 51.35  ? 731 GLU B CG    1 
ATOM   9068  C  CD    . GLU F 3 435 ? 16.182  55.352 -103.891 1.00 52.62  ? 731 GLU B CD    1 
ATOM   9069  O  OE1   . GLU F 3 435 ? 15.266  54.495 -103.950 1.00 53.08  ? 731 GLU B OE1   1 
ATOM   9070  O  OE2   . GLU F 3 435 ? 16.071  56.507 -104.369 1.00 52.99  ? 731 GLU B OE2   1 
ATOM   9071  N  N     . ALA F 3 436 ? 18.477  52.924 -99.150  1.00 48.83  ? 732 ALA B N     1 
ATOM   9072  C  CA    . ALA F 3 436 ? 18.358  52.608 -97.734  1.00 48.54  ? 732 ALA B CA    1 
ATOM   9073  C  C     . ALA F 3 436 ? 19.686  52.938 -97.070  1.00 48.27  ? 732 ALA B C     1 
ATOM   9074  O  O     . ALA F 3 436 ? 19.725  53.392 -95.924  1.00 48.16  ? 732 ALA B O     1 
ATOM   9075  C  CB    . ALA F 3 436 ? 18.038  51.140 -97.548  1.00 48.67  ? 732 ALA B CB    1 
ATOM   9076  N  N     . ALA F 3 437 ? 20.770  52.717 -97.812  1.00 47.97  ? 733 ALA B N     1 
ATOM   9077  C  CA    . ALA F 3 437 ? 22.121  52.965 -97.325  1.00 47.92  ? 733 ALA B CA    1 
ATOM   9078  C  C     . ALA F 3 437 ? 22.518  54.436 -97.382  1.00 47.62  ? 733 ALA B C     1 
ATOM   9079  O  O     . ALA F 3 437 ? 23.330  54.888 -96.581  1.00 47.19  ? 733 ALA B O     1 
ATOM   9080  C  CB    . ALA F 3 437 ? 23.118  52.125 -98.116  1.00 48.48  ? 733 ALA B CB    1 
ATOM   9081  N  N     . GLU F 3 438 ? 21.954  55.178 -98.332  1.00 47.83  ? 734 GLU B N     1 
ATOM   9082  C  CA    . GLU F 3 438 ? 22.263  56.603 -98.453  1.00 47.88  ? 734 GLU B CA    1 
ATOM   9083  C  C     . GLU F 3 438 ? 21.722  57.356 -97.241  1.00 47.11  ? 734 GLU B C     1 
ATOM   9084  O  O     . GLU F 3 438 ? 22.386  58.238 -96.704  1.00 47.05  ? 734 GLU B O     1 
ATOM   9085  C  CB    . GLU F 3 438 ? 21.648  57.192 -99.727  1.00 48.84  ? 734 GLU B CB    1 
ATOM   9086  C  CG    . GLU F 3 438 ? 22.181  56.591 -101.015 1.00 51.06  ? 734 GLU B CG    1 
ATOM   9087  C  CD    . GLU F 3 438 ? 21.528  57.178 -102.252 1.00 51.93  ? 734 GLU B CD    1 
ATOM   9088  O  OE1   . GLU F 3 438 ? 20.276  57.221 -102.305 1.00 52.33  ? 734 GLU B OE1   1 
ATOM   9089  O  OE2   . GLU F 3 438 ? 22.270  57.589 -103.172 1.00 52.47  ? 734 GLU B OE2   1 
ATOM   9090  N  N     . PHE F 3 439 ? 20.515  57.006 -96.807  1.00 46.51  ? 735 PHE B N     1 
ATOM   9091  C  CA    . PHE F 3 439 ? 19.920  57.669 -95.655  1.00 46.01  ? 735 PHE B CA    1 
ATOM   9092  C  C     . PHE F 3 439 ? 20.681  57.311 -94.384  1.00 45.32  ? 735 PHE B C     1 
ATOM   9093  O  O     . PHE F 3 439 ? 21.199  58.190 -93.693  1.00 45.28  ? 735 PHE B O     1 
ATOM   9094  C  CB    . PHE F 3 439 ? 18.459  57.271 -95.497  1.00 46.72  ? 735 PHE B CB    1 
ATOM   9095  C  CG    . PHE F 3 439 ? 17.718  58.111 -94.499  1.00 47.76  ? 735 PHE B CG    1 
ATOM   9096  C  CD1   . PHE F 3 439 ? 17.466  59.456 -94.760  1.00 47.73  ? 735 PHE B CD1   1 
ATOM   9097  C  CD2   . PHE F 3 439 ? 17.274  57.566 -93.298  1.00 48.12  ? 735 PHE B CD2   1 
ATOM   9098  C  CE1   . PHE F 3 439 ? 16.780  60.245 -93.839  1.00 48.20  ? 735 PHE B CE1   1 
ATOM   9099  C  CE2   . PHE F 3 439 ? 16.586  58.348 -92.370  1.00 48.16  ? 735 PHE B CE2   1 
ATOM   9100  C  CZ    . PHE F 3 439 ? 16.338  59.692 -92.644  1.00 48.22  ? 735 PHE B CZ    1 
ATOM   9101  N  N     . ILE F 3 440 ? 20.737  56.015 -94.082  1.00 44.24  ? 736 ILE B N     1 
ATOM   9102  C  CA    . ILE F 3 440 ? 21.448  55.520 -92.908  1.00 43.03  ? 736 ILE B CA    1 
ATOM   9103  C  C     . ILE F 3 440 ? 22.787  56.231 -92.711  1.00 42.69  ? 736 ILE B C     1 
ATOM   9104  O  O     . ILE F 3 440 ? 23.110  56.658 -91.607  1.00 41.87  ? 736 ILE B O     1 
ATOM   9105  C  CB    . ILE F 3 440 ? 21.705  53.994 -93.019  1.00 42.93  ? 736 ILE B CB    1 
ATOM   9106  C  CG1   . ILE F 3 440 ? 20.401  53.232 -92.764  1.00 42.73  ? 736 ILE B CG1   1 
ATOM   9107  C  CG2   . ILE F 3 440 ? 22.793  53.566 -92.044  1.00 42.45  ? 736 ILE B CG2   1 
ATOM   9108  C  CD1   . ILE F 3 440 ? 20.484  51.749 -93.038  1.00 42.71  ? 736 ILE B CD1   1 
ATOM   9109  N  N     . GLU F 3 441 ? 23.565  56.361 -93.779  1.00 42.71  ? 737 GLU B N     1 
ATOM   9110  C  CA    . GLU F 3 441 ? 24.861  57.022 -93.667  1.00 43.69  ? 737 GLU B CA    1 
ATOM   9111  C  C     . GLU F 3 441 ? 24.676  58.509 -93.340  1.00 43.73  ? 737 GLU B C     1 
ATOM   9112  O  O     . GLU F 3 441 ? 25.488  59.101 -92.630  1.00 43.59  ? 737 GLU B O     1 
ATOM   9113  C  CB    . GLU F 3 441 ? 25.674  56.840 -94.964  1.00 44.45  ? 737 GLU B CB    1 
ATOM   9114  C  CG    . GLU F 3 441 ? 27.119  57.320 -94.863  1.00 46.39  ? 737 GLU B CG    1 
ATOM   9115  C  CD    . GLU F 3 441 ? 28.026  56.719 -95.929  1.00 48.28  ? 737 GLU B CD    1 
ATOM   9116  O  OE1   . GLU F 3 441 ? 28.176  55.474 -95.962  1.00 48.55  ? 737 GLU B OE1   1 
ATOM   9117  O  OE2   . GLU F 3 441 ? 28.594  57.494 -96.734  1.00 49.55  ? 737 GLU B OE2   1 
ATOM   9118  N  N     . ARG F 3 442 ? 23.603  59.107 -93.850  1.00 43.83  ? 738 ARG B N     1 
ATOM   9119  C  CA    . ARG F 3 442 ? 23.326  60.517 -93.575  1.00 44.13  ? 738 ARG B CA    1 
ATOM   9120  C  C     . ARG F 3 442 ? 22.989  60.621 -92.091  1.00 43.05  ? 738 ARG B C     1 
ATOM   9121  O  O     . ARG F 3 442 ? 23.488  61.493 -91.373  1.00 42.58  ? 738 ARG B O     1 
ATOM   9122  C  CB    . ARG F 3 442 ? 22.129  61.005 -94.405  1.00 45.14  ? 738 ARG B CB    1 
ATOM   9123  C  CG    . ARG F 3 442 ? 22.356  60.953 -95.910  1.00 47.75  ? 738 ARG B CG    1 
ATOM   9124  C  CD    . ARG F 3 442 ? 21.049  60.968 -96.704  1.00 49.40  ? 738 ARG B CD    1 
ATOM   9125  N  NE    . ARG F 3 442 ? 20.351  62.250 -96.636  1.00 51.46  ? 738 ARG B NE    1 
ATOM   9126  C  CZ    . ARG F 3 442 ? 20.889  63.410 -96.994  1.00 52.12  ? 738 ARG B CZ    1 
ATOM   9127  N  NH1   . ARG F 3 442 ? 22.137  63.451 -97.444  1.00 52.71  ? 738 ARG B NH1   1 
ATOM   9128  N  NH2   . ARG F 3 442 ? 20.182  64.528 -96.903  1.00 52.70  ? 738 ARG B NH2   1 
ATOM   9129  N  N     . TYR F 3 443 ? 22.148  59.698 -91.649  1.00 42.06  ? 739 TYR B N     1 
ATOM   9130  C  CA    . TYR F 3 443 ? 21.692  59.641 -90.267  1.00 41.61  ? 739 TYR B CA    1 
ATOM   9131  C  C     . TYR F 3 443 ? 22.845  59.647 -89.274  1.00 40.96  ? 739 TYR B C     1 
ATOM   9132  O  O     . TYR F 3 443 ? 22.773  60.303 -88.243  1.00 40.28  ? 739 TYR B O     1 
ATOM   9133  C  CB    . TYR F 3 443 ? 20.863  58.385 -90.070  1.00 41.30  ? 739 TYR B CB    1 
ATOM   9134  C  CG    . TYR F 3 443 ? 19.787  58.489 -89.026  1.00 41.88  ? 739 TYR B CG    1 
ATOM   9135  C  CD1   . TYR F 3 443 ? 18.468  58.777 -89.386  1.00 41.77  ? 739 TYR B CD1   1 
ATOM   9136  C  CD2   . TYR F 3 443 ? 20.064  58.226 -87.682  1.00 41.77  ? 739 TYR B CD2   1 
ATOM   9137  C  CE1   . TYR F 3 443 ? 17.447  58.790 -88.438  1.00 41.50  ? 739 TYR B CE1   1 
ATOM   9138  C  CE2   . TYR F 3 443 ? 19.050  58.237 -86.726  1.00 41.78  ? 739 TYR B CE2   1 
ATOM   9139  C  CZ    . TYR F 3 443 ? 17.746  58.517 -87.115  1.00 41.90  ? 739 TYR B CZ    1 
ATOM   9140  O  OH    . TYR F 3 443 ? 16.740  58.505 -86.182  1.00 42.06  ? 739 TYR B OH    1 
ATOM   9141  N  N     . PHE F 3 444 ? 23.915  58.924 -89.585  1.00 40.84  ? 740 PHE B N     1 
ATOM   9142  C  CA    . PHE F 3 444 ? 25.054  58.873 -88.678  1.00 40.73  ? 740 PHE B CA    1 
ATOM   9143  C  C     . PHE F 3 444 ? 26.101  59.959 -88.889  1.00 40.69  ? 740 PHE B C     1 
ATOM   9144  O  O     . PHE F 3 444 ? 26.985  60.132 -88.051  1.00 40.54  ? 740 PHE B O     1 
ATOM   9145  C  CB    . PHE F 3 444 ? 25.695  57.481 -88.710  1.00 40.30  ? 740 PHE B CB    1 
ATOM   9146  C  CG    . PHE F 3 444 ? 24.840  56.419 -88.073  1.00 40.52  ? 740 PHE B CG    1 
ATOM   9147  C  CD1   . PHE F 3 444 ? 24.474  56.519 -86.730  1.00 39.94  ? 740 PHE B CD1   1 
ATOM   9148  C  CD2   . PHE F 3 444 ? 24.367  55.338 -88.815  1.00 40.01  ? 740 PHE B CD2   1 
ATOM   9149  C  CE1   . PHE F 3 444 ? 23.649  55.561 -86.140  1.00 40.06  ? 740 PHE B CE1   1 
ATOM   9150  C  CE2   . PHE F 3 444 ? 23.542  54.377 -88.231  1.00 39.73  ? 740 PHE B CE2   1 
ATOM   9151  C  CZ    . PHE F 3 444 ? 23.184  54.490 -86.891  1.00 39.59  ? 740 PHE B CZ    1 
ATOM   9152  N  N     . GLU F 3 445 ? 26.018  60.689 -90.000  1.00 40.81  ? 741 GLU B N     1 
ATOM   9153  C  CA    . GLU F 3 445 ? 26.965  61.780 -90.213  1.00 41.56  ? 741 GLU B CA    1 
ATOM   9154  C  C     . GLU F 3 445 ? 26.451  62.920 -89.346  1.00 41.17  ? 741 GLU B C     1 
ATOM   9155  O  O     . GLU F 3 445 ? 27.219  63.753 -88.861  1.00 41.55  ? 741 GLU B O     1 
ATOM   9156  C  CB    . GLU F 3 445 ? 27.012  62.218 -91.681  1.00 42.51  ? 741 GLU B CB    1 
ATOM   9157  C  CG    . GLU F 3 445 ? 27.907  61.347 -92.560  1.00 44.32  ? 741 GLU B CG    1 
ATOM   9158  C  CD    . GLU F 3 445 ? 28.095  61.899 -93.970  1.00 44.39  ? 741 GLU B CD    1 
ATOM   9159  O  OE1   . GLU F 3 445 ? 28.844  61.283 -94.752  1.00 45.57  ? 741 GLU B OE1   1 
ATOM   9160  O  OE2   . GLU F 3 445 ? 27.500  62.944 -94.300  1.00 45.74  ? 741 GLU B OE2   1 
ATOM   9161  N  N     . SER F 3 446 ? 25.136  62.933 -89.149  1.00 40.85  ? 742 SER B N     1 
ATOM   9162  C  CA    . SER F 3 446 ? 24.484  63.941 -88.332  1.00 40.55  ? 742 SER B CA    1 
ATOM   9163  C  C     . SER F 3 446 ? 24.640  63.591 -86.863  1.00 40.00  ? 742 SER B C     1 
ATOM   9164  O  O     . SER F 3 446 ? 24.830  64.479 -86.021  1.00 39.07  ? 742 SER B O     1 
ATOM   9165  C  CB    . SER F 3 446 ? 23.001  64.026 -88.678  1.00 40.74  ? 742 SER B CB    1 
ATOM   9166  O  OG    . SER F 3 446 ? 22.811  64.659 -89.932  1.00 42.45  ? 742 SER B OG    1 
ATOM   9167  N  N     . PHE F 3 447 ? 24.569  62.292 -86.567  1.00 39.13  ? 743 PHE B N     1 
ATOM   9168  C  CA    . PHE F 3 447 ? 24.696  61.810 -85.196  1.00 38.85  ? 743 PHE B CA    1 
ATOM   9169  C  C     . PHE F 3 447 ? 25.877  60.855 -85.013  1.00 38.51  ? 743 PHE B C     1 
ATOM   9170  O  O     . PHE F 3 447 ? 25.685  59.658 -84.803  1.00 38.12  ? 743 PHE B O     1 
ATOM   9171  C  CB    . PHE F 3 447 ? 23.404  61.108 -84.766  1.00 38.35  ? 743 PHE B CB    1 
ATOM   9172  C  CG    . PHE F 3 447 ? 22.182  61.980 -84.847  1.00 38.70  ? 743 PHE B CG    1 
ATOM   9173  C  CD1   . PHE F 3 447 ? 22.112  63.179 -84.132  1.00 38.17  ? 743 PHE B CD1   1 
ATOM   9174  C  CD2   . PHE F 3 447 ? 21.090  61.593 -85.615  1.00 37.78  ? 743 PHE B CD2   1 
ATOM   9175  C  CE1   . PHE F 3 447 ? 20.967  63.972 -84.184  1.00 37.60  ? 743 PHE B CE1   1 
ATOM   9176  C  CE2   . PHE F 3 447 ? 19.947  62.377 -85.670  1.00 37.84  ? 743 PHE B CE2   1 
ATOM   9177  C  CZ    . PHE F 3 447 ? 19.885  63.570 -84.953  1.00 37.44  ? 743 PHE B CZ    1 
ATOM   9178  N  N     . PRO F 3 448 ? 27.115  61.378 -85.082  1.00 38.34  ? 744 PRO B N     1 
ATOM   9179  C  CA    . PRO F 3 448 ? 28.338  60.579 -84.922  1.00 37.88  ? 744 PRO B CA    1 
ATOM   9180  C  C     . PRO F 3 448 ? 28.569  60.093 -83.487  1.00 37.98  ? 744 PRO B C     1 
ATOM   9181  O  O     . PRO F 3 448 ? 29.535  59.379 -83.208  1.00 38.28  ? 744 PRO B O     1 
ATOM   9182  C  CB    . PRO F 3 448 ? 29.436  61.532 -85.389  1.00 38.10  ? 744 PRO B CB    1 
ATOM   9183  C  CG    . PRO F 3 448 ? 28.903  62.875 -84.959  1.00 37.97  ? 744 PRO B CG    1 
ATOM   9184  C  CD    . PRO F 3 448 ? 27.442  62.789 -85.367  1.00 37.84  ? 744 PRO B CD    1 
ATOM   9185  N  N     . GLY F 3 449 ? 27.689  60.495 -82.577  1.00 37.32  ? 745 GLY B N     1 
ATOM   9186  C  CA    . GLY F 3 449 ? 27.811  60.075 -81.197  1.00 36.78  ? 745 GLY B CA    1 
ATOM   9187  C  C     . GLY F 3 449 ? 27.047  58.781 -81.021  1.00 36.73  ? 745 GLY B C     1 
ATOM   9188  O  O     . GLY F 3 449 ? 27.530  57.844 -80.381  1.00 36.68  ? 745 GLY B O     1 
ATOM   9189  N  N     . VAL F 3 450 ? 25.849  58.731 -81.592  1.00 36.18  ? 746 VAL B N     1 
ATOM   9190  C  CA    . VAL F 3 450 ? 25.028  57.534 -81.521  1.00 35.70  ? 746 VAL B CA    1 
ATOM   9191  C  C     . VAL F 3 450 ? 25.812  56.384 -82.161  1.00 35.76  ? 746 VAL B C     1 
ATOM   9192  O  O     . VAL F 3 450 ? 26.057  55.371 -81.514  1.00 34.92  ? 746 VAL B O     1 
ATOM   9193  C  CB    . VAL F 3 450 ? 23.686  57.741 -82.249  1.00 35.46  ? 746 VAL B CB    1 
ATOM   9194  C  CG1   . VAL F 3 450 ? 22.950  56.421 -82.395  1.00 34.74  ? 746 VAL B CG1   1 
ATOM   9195  C  CG2   . VAL F 3 450 ? 22.833  58.734 -81.465  1.00 35.60  ? 746 VAL B CG2   1 
ATOM   9196  N  N     . LYS F 3 451 ? 26.218  56.545 -83.421  1.00 35.97  ? 747 LYS B N     1 
ATOM   9197  C  CA    . LYS F 3 451 ? 26.994  55.501 -84.093  1.00 36.01  ? 747 LYS B CA    1 
ATOM   9198  C  C     . LYS F 3 451 ? 28.200  55.078 -83.255  1.00 36.29  ? 747 LYS B C     1 
ATOM   9199  O  O     . LYS F 3 451 ? 28.444  53.885 -83.068  1.00 35.41  ? 747 LYS B O     1 
ATOM   9200  C  CB    . LYS F 3 451 ? 27.504  55.964 -85.463  1.00 36.01  ? 747 LYS B CB    1 
ATOM   9201  C  CG    . LYS F 3 451 ? 28.463  54.953 -86.103  1.00 36.39  ? 747 LYS B CG    1 
ATOM   9202  C  CD    . LYS F 3 451 ? 29.036  55.401 -87.440  1.00 36.94  ? 747 LYS B CD    1 
ATOM   9203  C  CE    . LYS F 3 451 ? 29.974  54.315 -88.003  1.00 37.08  ? 747 LYS B CE    1 
ATOM   9204  N  NZ    . LYS F 3 451 ? 30.523  54.627 -89.357  1.00 36.42  ? 747 LYS B NZ    1 
ATOM   9205  N  N     . ARG F 3 452 ? 28.958  56.055 -82.762  1.00 36.50  ? 748 ARG B N     1 
ATOM   9206  C  CA    . ARG F 3 452 ? 30.138  55.756 -81.958  1.00 37.24  ? 748 ARG B CA    1 
ATOM   9207  C  C     . ARG F 3 452 ? 29.815  55.015 -80.667  1.00 37.70  ? 748 ARG B C     1 
ATOM   9208  O  O     . ARG F 3 452 ? 30.425  53.984 -80.357  1.00 37.25  ? 748 ARG B O     1 
ATOM   9209  C  CB    . ARG F 3 452 ? 30.893  57.036 -81.609  1.00 38.15  ? 748 ARG B CB    1 
ATOM   9210  C  CG    . ARG F 3 452 ? 32.037  56.790 -80.649  1.00 39.71  ? 748 ARG B CG    1 
ATOM   9211  C  CD    . ARG F 3 452 ? 32.614  58.083 -80.114  1.00 41.42  ? 748 ARG B CD    1 
ATOM   9212  N  NE    . ARG F 3 452 ? 32.896  59.032 -81.185  1.00 43.43  ? 748 ARG B NE    1 
ATOM   9213  C  CZ    . ARG F 3 452 ? 32.214  60.154 -81.378  1.00 44.02  ? 748 ARG B CZ    1 
ATOM   9214  N  NH1   . ARG F 3 452 ? 31.212  60.466 -80.564  1.00 45.02  ? 748 ARG B NH1   1 
ATOM   9215  N  NH2   . ARG F 3 452 ? 32.524  60.958 -82.385  1.00 44.64  ? 748 ARG B NH2   1 
ATOM   9216  N  N     . TYR F 3 453 ? 28.872  55.550 -79.896  1.00 37.34  ? 749 TYR B N     1 
ATOM   9217  C  CA    . TYR F 3 453 ? 28.488  54.912 -78.651  1.00 37.11  ? 749 TYR B CA    1 
ATOM   9218  C  C     . TYR F 3 453 ? 28.167  53.457 -78.955  1.00 37.16  ? 749 TYR B C     1 
ATOM   9219  O  O     . TYR F 3 453 ? 28.551  52.548 -78.218  1.00 36.32  ? 749 TYR B O     1 
ATOM   9220  C  CB    . TYR F 3 453 ? 27.244  55.578 -78.062  1.00 37.57  ? 749 TYR B CB    1 
ATOM   9221  C  CG    . TYR F 3 453 ? 26.461  54.664 -77.145  1.00 37.52  ? 749 TYR B CG    1 
ATOM   9222  C  CD1   . TYR F 3 453 ? 26.923  54.355 -75.866  1.00 37.10  ? 749 TYR B CD1   1 
ATOM   9223  C  CD2   . TYR F 3 453 ? 25.272  54.081 -77.574  1.00 37.87  ? 749 TYR B CD2   1 
ATOM   9224  C  CE1   . TYR F 3 453 ? 26.217  53.482 -75.039  1.00 37.85  ? 749 TYR B CE1   1 
ATOM   9225  C  CE2   . TYR F 3 453 ? 24.562  53.215 -76.762  1.00 37.76  ? 749 TYR B CE2   1 
ATOM   9226  C  CZ    . TYR F 3 453 ? 25.034  52.915 -75.498  1.00 38.31  ? 749 TYR B CZ    1 
ATOM   9227  O  OH    . TYR F 3 453 ? 24.325  52.035 -74.706  1.00 39.35  ? 749 TYR B OH    1 
ATOM   9228  N  N     . MET F 3 454 ? 27.449  53.253 -80.049  1.00 37.19  ? 750 MET B N     1 
ATOM   9229  C  CA    . MET F 3 454 ? 27.042  51.917 -80.451  1.00 37.53  ? 750 MET B CA    1 
ATOM   9230  C  C     . MET F 3 454 ? 28.245  51.017 -80.669  1.00 37.74  ? 750 MET B C     1 
ATOM   9231  O  O     . MET F 3 454 ? 28.195  49.814 -80.395  1.00 37.81  ? 750 MET B O     1 
ATOM   9232  C  CB    . MET F 3 454 ? 26.192  52.002 -81.710  1.00 37.29  ? 750 MET B CB    1 
ATOM   9233  C  CG    . MET F 3 454 ? 24.881  52.713 -81.462  1.00 37.85  ? 750 MET B CG    1 
ATOM   9234  S  SD    . MET F 3 454 ? 24.116  52.034 -79.979  1.00 38.05  ? 750 MET B SD    1 
ATOM   9235  C  CE    . MET F 3 454 ? 22.567  52.978 -79.894  1.00 38.46  ? 750 MET B CE    1 
ATOM   9236  N  N     . GLU F 3 455 ? 29.328  51.611 -81.154  1.00 36.99  ? 751 GLU B N     1 
ATOM   9237  C  CA    . GLU F 3 455 ? 30.546  50.863 -81.390  1.00 36.35  ? 751 GLU B CA    1 
ATOM   9238  C  C     . GLU F 3 455 ? 31.160  50.542 -80.034  1.00 36.36  ? 751 GLU B C     1 
ATOM   9239  O  O     . GLU F 3 455 ? 31.464  49.381 -79.737  1.00 35.24  ? 751 GLU B O     1 
ATOM   9240  C  CB    . GLU F 3 455 ? 31.524  51.698 -82.222  1.00 36.26  ? 751 GLU B CB    1 
ATOM   9241  C  CG    . GLU F 3 455 ? 31.081  51.936 -83.662  1.00 35.73  ? 751 GLU B CG    1 
ATOM   9242  C  CD    . GLU F 3 455 ? 32.053  52.811 -84.437  1.00 35.69  ? 751 GLU B CD    1 
ATOM   9243  O  OE1   . GLU F 3 455 ? 32.005  52.784 -85.687  1.00 35.25  ? 751 GLU B OE1   1 
ATOM   9244  O  OE2   . GLU F 3 455 ? 32.852  53.532 -83.793  1.00 34.99  ? 751 GLU B OE2   1 
ATOM   9245  N  N     . ASN F 3 456 ? 31.315  51.581 -79.213  1.00 35.97  ? 752 ASN B N     1 
ATOM   9246  C  CA    . ASN F 3 456 ? 31.909  51.460 -77.888  1.00 35.83  ? 752 ASN B CA    1 
ATOM   9247  C  C     . ASN F 3 456 ? 31.156  50.590 -76.895  1.00 35.49  ? 752 ASN B C     1 
ATOM   9248  O  O     . ASN F 3 456 ? 31.775  50.019 -75.993  1.00 35.66  ? 752 ASN B O     1 
ATOM   9249  C  CB    . ASN F 3 456 ? 32.115  52.841 -77.255  1.00 35.49  ? 752 ASN B CB    1 
ATOM   9250  C  CG    . ASN F 3 456 ? 33.207  53.642 -77.934  1.00 36.44  ? 752 ASN B CG    1 
ATOM   9251  O  OD1   . ASN F 3 456 ? 34.146  53.083 -78.504  1.00 36.32  ? 752 ASN B OD1   1 
ATOM   9252  N  ND2   . ASN F 3 456 ? 33.098  54.968 -77.861  1.00 36.56  ? 752 ASN B ND2   1 
ATOM   9253  N  N     . ILE F 3 457 ? 29.836  50.491 -77.041  1.00 34.72  ? 753 ILE B N     1 
ATOM   9254  C  CA    . ILE F 3 457 ? 29.048  49.686 -76.118  1.00 34.05  ? 753 ILE B CA    1 
ATOM   9255  C  C     . ILE F 3 457 ? 29.235  48.181 -76.334  1.00 34.14  ? 753 ILE B C     1 
ATOM   9256  O  O     . ILE F 3 457 ? 29.139  47.401 -75.392  1.00 33.61  ? 753 ILE B O     1 
ATOM   9257  C  CB    . ILE F 3 457 ? 27.544  50.022 -76.202  1.00 33.07  ? 753 ILE B CB    1 
ATOM   9258  C  CG1   . ILE F 3 457 ? 26.834  49.471 -74.966  1.00 32.73  ? 753 ILE B CG1   1 
ATOM   9259  C  CG2   . ILE F 3 457 ? 26.932  49.413 -77.450  1.00 33.16  ? 753 ILE B CG2   1 
ATOM   9260  C  CD1   . ILE F 3 457 ? 27.355  50.047 -73.652  1.00 31.15  ? 753 ILE B CD1   1 
ATOM   9261  N  N     . VAL F 3 458 ? 29.466  47.770 -77.575  1.00 34.16  ? 754 VAL B N     1 
ATOM   9262  C  CA    . VAL F 3 458 ? 29.687  46.358 -77.845  1.00 34.40  ? 754 VAL B CA    1 
ATOM   9263  C  C     . VAL F 3 458 ? 31.068  45.994 -77.296  1.00 34.41  ? 754 VAL B C     1 
ATOM   9264  O  O     . VAL F 3 458 ? 31.245  44.941 -76.693  1.00 33.89  ? 754 VAL B O     1 
ATOM   9265  C  CB    . VAL F 3 458 ? 29.638  46.045 -79.358  1.00 34.65  ? 754 VAL B CB    1 
ATOM   9266  C  CG1   . VAL F 3 458 ? 30.034  44.585 -79.593  1.00 33.94  ? 754 VAL B CG1   1 
ATOM   9267  C  CG2   . VAL F 3 458 ? 28.231  46.306 -79.896  1.00 33.43  ? 754 VAL B CG2   1 
ATOM   9268  N  N     . GLN F 3 459 ? 32.039  46.884 -77.501  1.00 34.68  ? 755 GLN B N     1 
ATOM   9269  C  CA    . GLN F 3 459 ? 33.392  46.665 -77.001  1.00 35.31  ? 755 GLN B CA    1 
ATOM   9270  C  C     . GLN F 3 459 ? 33.379  46.601 -75.464  1.00 34.98  ? 755 GLN B C     1 
ATOM   9271  O  O     . GLN F 3 459 ? 34.203  45.919 -74.844  1.00 34.31  ? 755 GLN B O     1 
ATOM   9272  C  CB    . GLN F 3 459 ? 34.327  47.783 -77.481  1.00 35.87  ? 755 GLN B CB    1 
ATOM   9273  C  CG    . GLN F 3 459 ? 34.602  47.767 -78.988  1.00 36.04  ? 755 GLN B CG    1 
ATOM   9274  C  CD    . GLN F 3 459 ? 34.934  46.375 -79.507  1.00 37.26  ? 755 GLN B CD    1 
ATOM   9275  O  OE1   . GLN F 3 459 ? 35.591  45.585 -78.822  1.00 38.41  ? 755 GLN B OE1   1 
ATOM   9276  N  NE2   . GLN F 3 459 ? 34.488  46.069 -80.729  1.00 36.59  ? 755 GLN B NE2   1 
ATOM   9277  N  N     . GLU F 3 460 ? 32.438  47.317 -74.859  1.00 34.10  ? 756 GLU B N     1 
ATOM   9278  C  CA    . GLU F 3 460 ? 32.295  47.319 -73.407  1.00 34.09  ? 756 GLU B CA    1 
ATOM   9279  C  C     . GLU F 3 460 ? 31.589  46.046 -72.956  1.00 33.09  ? 756 GLU B C     1 
ATOM   9280  O  O     . GLU F 3 460 ? 31.987  45.413 -71.970  1.00 32.70  ? 756 GLU B O     1 
ATOM   9281  C  CB    . GLU F 3 460 ? 31.476  48.515 -72.949  1.00 35.91  ? 756 GLU B CB    1 
ATOM   9282  C  CG    . GLU F 3 460 ? 31.391  48.623 -71.443  1.00 38.43  ? 756 GLU B CG    1 
ATOM   9283  C  CD    . GLU F 3 460 ? 30.376  49.645 -70.998  1.00 38.99  ? 756 GLU B CD    1 
ATOM   9284  O  OE1   . GLU F 3 460 ? 29.169  49.333 -71.039  1.00 40.09  ? 756 GLU B OE1   1 
ATOM   9285  O  OE2   . GLU F 3 460 ? 30.787  50.759 -70.617  1.00 40.60  ? 756 GLU B OE2   1 
ATOM   9286  N  N     . ALA F 3 461 ? 30.533  45.679 -73.676  1.00 31.62  ? 757 ALA B N     1 
ATOM   9287  C  CA    . ALA F 3 461 ? 29.790  44.475 -73.351  1.00 32.31  ? 757 ALA B CA    1 
ATOM   9288  C  C     . ALA F 3 461 ? 30.802  43.349 -73.296  1.00 32.80  ? 757 ALA B C     1 
ATOM   9289  O  O     . ALA F 3 461 ? 30.840  42.576 -72.347  1.00 33.74  ? 757 ALA B O     1 
ATOM   9290  C  CB    . ALA F 3 461 ? 28.765  44.191 -74.410  1.00 30.88  ? 757 ALA B CB    1 
ATOM   9291  N  N     . LYS F 3 462 ? 31.635  43.290 -74.328  1.00 33.55  ? 758 LYS B N     1 
ATOM   9292  C  CA    . LYS F 3 462 ? 32.676  42.285 -74.451  1.00 33.94  ? 758 LYS B CA    1 
ATOM   9293  C  C     . LYS F 3 462 ? 33.638  42.315 -73.257  1.00 33.48  ? 758 LYS B C     1 
ATOM   9294  O  O     . LYS F 3 462 ? 33.818  41.304 -72.594  1.00 33.71  ? 758 LYS B O     1 
ATOM   9295  C  CB    . LYS F 3 462 ? 33.446  42.513 -75.761  1.00 33.82  ? 758 LYS B CB    1 
ATOM   9296  C  CG    . LYS F 3 462 ? 34.416  41.403 -76.138  1.00 35.69  ? 758 LYS B CG    1 
ATOM   9297  C  CD    . LYS F 3 462 ? 34.119  40.852 -77.543  1.00 36.73  ? 758 LYS B CD    1 
ATOM   9298  C  CE    . LYS F 3 462 ? 34.272  41.919 -78.631  1.00 36.93  ? 758 LYS B CE    1 
ATOM   9299  N  NZ    . LYS F 3 462 ? 35.677  42.418 -78.739  1.00 37.11  ? 758 LYS B NZ    1 
ATOM   9300  N  N     . GLN F 3 463 ? 34.243  43.476 -72.989  1.00 33.38  ? 759 GLN B N     1 
ATOM   9301  C  CA    . GLN F 3 463 ? 35.195  43.629 -71.886  1.00 33.31  ? 759 GLN B CA    1 
ATOM   9302  C  C     . GLN F 3 463 ? 34.639  43.236 -70.517  1.00 32.95  ? 759 GLN B C     1 
ATOM   9303  O  O     . GLN F 3 463 ? 35.289  42.512 -69.754  1.00 32.45  ? 759 GLN B O     1 
ATOM   9304  C  CB    . GLN F 3 463 ? 35.715  45.077 -71.826  1.00 33.67  ? 759 GLN B CB    1 
ATOM   9305  C  CG    . GLN F 3 463 ? 36.780  45.345 -70.747  1.00 34.04  ? 759 GLN B CG    1 
ATOM   9306  C  CD    . GLN F 3 463 ? 36.240  46.026 -69.483  1.00 35.01  ? 759 GLN B CD    1 
ATOM   9307  O  OE1   . GLN F 3 463 ? 35.673  47.116 -69.549  1.00 36.03  ? 759 GLN B OE1   1 
ATOM   9308  N  NE2   . GLN F 3 463 ? 36.433  45.389 -68.327  1.00 33.94  ? 759 GLN B NE2   1 
ATOM   9309  N  N     . LYS F 3 464 ? 33.437  43.707 -70.208  1.00 32.55  ? 760 LYS B N     1 
ATOM   9310  C  CA    . LYS F 3 464 ? 32.815  43.412 -68.922  1.00 31.93  ? 760 LYS B CA    1 
ATOM   9311  C  C     . LYS F 3 464 ? 32.005  42.117 -68.913  1.00 30.63  ? 760 LYS B C     1 
ATOM   9312  O  O     . LYS F 3 464 ? 31.844  41.493 -67.871  1.00 30.75  ? 760 LYS B O     1 
ATOM   9313  C  CB    . LYS F 3 464 ? 31.921  44.575 -68.496  1.00 32.68  ? 760 LYS B CB    1 
ATOM   9314  C  CG    . LYS F 3 464 ? 32.696  45.837 -68.163  1.00 34.63  ? 760 LYS B CG    1 
ATOM   9315  C  CD    . LYS F 3 464 ? 31.785  46.918 -67.617  1.00 36.17  ? 760 LYS B CD    1 
ATOM   9316  C  CE    . LYS F 3 464 ? 32.566  48.183 -67.275  1.00 37.02  ? 760 LYS B CE    1 
ATOM   9317  N  NZ    . LYS F 3 464 ? 31.733  49.148 -66.491  1.00 37.33  ? 760 LYS B NZ    1 
ATOM   9318  N  N     . GLY F 3 465 ? 31.501  41.720 -70.073  1.00 29.46  ? 761 GLY B N     1 
ATOM   9319  C  CA    . GLY F 3 465 ? 30.702  40.507 -70.147  1.00 28.32  ? 761 GLY B CA    1 
ATOM   9320  C  C     . GLY F 3 465 ? 29.211  40.777 -70.040  1.00 27.81  ? 761 GLY B C     1 
ATOM   9321  O  O     . GLY F 3 465 ? 28.404  39.858 -70.094  1.00 27.63  ? 761 GLY B O     1 
ATOM   9322  N  N     . TYR F 3 466 ? 28.832  42.044 -69.899  1.00 27.67  ? 762 TYR B N     1 
ATOM   9323  C  CA    . TYR F 3 466 ? 27.415  42.401 -69.785  1.00 27.99  ? 762 TYR B CA    1 
ATOM   9324  C  C     . TYR F 3 466 ? 27.244  43.914 -70.011  1.00 27.53  ? 762 TYR B C     1 
ATOM   9325  O  O     . TYR F 3 466 ? 28.231  44.635 -70.176  1.00 26.64  ? 762 TYR B O     1 
ATOM   9326  C  CB    . TYR F 3 466 ? 26.893  42.023 -68.382  1.00 28.24  ? 762 TYR B CB    1 
ATOM   9327  C  CG    . TYR F 3 466 ? 27.565  42.776 -67.252  1.00 29.62  ? 762 TYR B CG    1 
ATOM   9328  C  CD1   . TYR F 3 466 ? 27.377  44.153 -67.091  1.00 30.52  ? 762 TYR B CD1   1 
ATOM   9329  C  CD2   . TYR F 3 466 ? 28.435  42.132 -66.376  1.00 29.49  ? 762 TYR B CD2   1 
ATOM   9330  C  CE1   . TYR F 3 466 ? 28.049  44.868 -66.090  1.00 30.00  ? 762 TYR B CE1   1 
ATOM   9331  C  CE2   . TYR F 3 466 ? 29.111  42.845 -65.366  1.00 30.52  ? 762 TYR B CE2   1 
ATOM   9332  C  CZ    . TYR F 3 466 ? 28.909  44.211 -65.239  1.00 30.97  ? 762 TYR B CZ    1 
ATOM   9333  O  OH    . TYR F 3 466 ? 29.579  44.925 -64.266  1.00 32.53  ? 762 TYR B OH    1 
ATOM   9334  N  N     . VAL F 3 467 ? 25.998  44.382 -70.027  1.00 27.63  ? 763 VAL B N     1 
ATOM   9335  C  CA    . VAL F 3 467 ? 25.729  45.815 -70.162  1.00 27.85  ? 763 VAL B CA    1 
ATOM   9336  C  C     . VAL F 3 467 ? 24.806  46.232 -69.022  1.00 29.08  ? 763 VAL B C     1 
ATOM   9337  O  O     . VAL F 3 467 ? 24.026  45.425 -68.520  1.00 29.60  ? 763 VAL B O     1 
ATOM   9338  C  CB    . VAL F 3 467 ? 25.054  46.188 -71.505  1.00 27.10  ? 763 VAL B CB    1 
ATOM   9339  C  CG1   . VAL F 3 467 ? 25.958  45.812 -72.669  1.00 27.25  ? 763 VAL B CG1   1 
ATOM   9340  C  CG2   . VAL F 3 467 ? 23.706  45.532 -71.613  1.00 26.51  ? 763 VAL B CG2   1 
ATOM   9341  N  N     . THR F 3 468 ? 24.877  47.499 -68.617  1.00 29.36  ? 764 THR B N     1 
ATOM   9342  C  CA    . THR F 3 468 ? 24.052  47.954 -67.511  1.00 28.91  ? 764 THR B CA    1 
ATOM   9343  C  C     . THR F 3 468 ? 23.255  49.212 -67.843  1.00 28.69  ? 764 THR B C     1 
ATOM   9344  O  O     . THR F 3 468 ? 23.624  49.966 -68.749  1.00 27.69  ? 764 THR B O     1 
ATOM   9345  C  CB    . THR F 3 468 ? 24.921  48.194 -66.272  1.00 29.64  ? 764 THR B CB    1 
ATOM   9346  O  OG1   . THR F 3 468 ? 25.907  49.185 -66.570  1.00 31.24  ? 764 THR B OG1   1 
ATOM   9347  C  CG2   . THR F 3 468 ? 25.647  46.905 -65.869  1.00 29.24  ? 764 THR B CG2   1 
ATOM   9348  N  N     . THR F 3 469 ? 22.154  49.418 -67.115  1.00 27.97  ? 765 THR B N     1 
ATOM   9349  C  CA    . THR F 3 469 ? 21.302  50.571 -67.347  1.00 28.10  ? 765 THR B CA    1 
ATOM   9350  C  C     . THR F 3 469 ? 21.609  51.727 -66.414  1.00 28.44  ? 765 THR B C     1 
ATOM   9351  O  O     . THR F 3 469 ? 22.617  51.736 -65.696  1.00 28.22  ? 765 THR B O     1 
ATOM   9352  C  CB    . THR F 3 469 ? 19.800  50.229 -67.188  1.00 27.99  ? 765 THR B CB    1 
ATOM   9353  O  OG1   . THR F 3 469 ? 19.537  49.805 -65.842  1.00 28.69  ? 765 THR B OG1   1 
ATOM   9354  C  CG2   . THR F 3 469 ? 19.393  49.150 -68.161  1.00 26.53  ? 765 THR B CG2   1 
ATOM   9355  N  N     . LEU F 3 470 ? 20.700  52.694 -66.408  1.00 27.80  ? 766 LEU B N     1 
ATOM   9356  C  CA    . LEU F 3 470 ? 20.867  53.866 -65.582  1.00 27.27  ? 766 LEU B CA    1 
ATOM   9357  C  C     . LEU F 3 470 ? 20.779  53.553 -64.090  1.00 26.52  ? 766 LEU B C     1 
ATOM   9358  O  O     . LEU F 3 470 ? 21.573  54.062 -63.297  1.00 26.25  ? 766 LEU B O     1 
ATOM   9359  C  CB    . LEU F 3 470 ? 19.832  54.933 -65.980  1.00 27.22  ? 766 LEU B CB    1 
ATOM   9360  C  CG    . LEU F 3 470 ? 20.377  56.242 -66.581  1.00 27.68  ? 766 LEU B CG    1 
ATOM   9361  C  CD1   . LEU F 3 470 ? 21.398  56.800 -65.613  1.00 27.38  ? 766 LEU B CD1   1 
ATOM   9362  C  CD2   . LEU F 3 470 ? 21.003  56.040 -67.961  1.00 26.11  ? 766 LEU B CD2   1 
ATOM   9363  N  N     . LEU F 3 471 ? 19.818  52.725 -63.696  1.00 26.32  ? 767 LEU B N     1 
ATOM   9364  C  CA    . LEU F 3 471 ? 19.680  52.406 -62.283  1.00 27.33  ? 767 LEU B CA    1 
ATOM   9365  C  C     . LEU F 3 471 ? 20.246  51.029 -61.955  1.00 27.53  ? 767 LEU B C     1 
ATOM   9366  O  O     . LEU F 3 471 ? 19.763  50.350 -61.058  1.00 28.00  ? 767 LEU B O     1 
ATOM   9367  C  CB    . LEU F 3 471 ? 18.220  52.507 -61.839  1.00 25.22  ? 767 LEU B CB    1 
ATOM   9368  C  CG    . LEU F 3 471 ? 17.568  53.874 -62.104  1.00 26.16  ? 767 LEU B CG    1 
ATOM   9369  C  CD1   . LEU F 3 471 ? 16.176  53.903 -61.536  1.00 25.63  ? 767 LEU B CD1   1 
ATOM   9370  C  CD2   . LEU F 3 471 ? 18.407  54.970 -61.493  1.00 24.55  ? 767 LEU B CD2   1 
ATOM   9371  N  N     . HIS F 3 472 ? 21.267  50.634 -62.714  1.00 28.48  ? 768 HIS B N     1 
ATOM   9372  C  CA    . HIS F 3 472 ? 21.980  49.369 -62.510  1.00 28.90  ? 768 HIS B CA    1 
ATOM   9373  C  C     . HIS F 3 472 ? 21.334  48.042 -62.912  1.00 28.85  ? 768 HIS B C     1 
ATOM   9374  O  O     . HIS F 3 472 ? 21.766  46.968 -62.456  1.00 29.09  ? 768 HIS B O     1 
ATOM   9375  C  CB    . HIS F 3 472 ? 22.443  49.296 -61.058  1.00 29.84  ? 768 HIS B CB    1 
ATOM   9376  C  CG    . HIS F 3 472 ? 23.361  50.412 -60.672  1.00 31.64  ? 768 HIS B CG    1 
ATOM   9377  N  ND1   . HIS F 3 472 ? 23.075  51.732 -60.941  1.00 33.48  ? 768 HIS B ND1   1 
ATOM   9378  C  CD2   . HIS F 3 472 ? 24.547  50.409 -60.020  1.00 33.21  ? 768 HIS B CD2   1 
ATOM   9379  C  CE1   . HIS F 3 472 ? 24.044  52.498 -60.470  1.00 32.94  ? 768 HIS B CE1   1 
ATOM   9380  N  NE2   . HIS F 3 472 ? 24.950  51.719 -59.905  1.00 34.49  ? 768 HIS B NE2   1 
ATOM   9381  N  N     . ARG F 3 473 ? 20.311  48.089 -63.752  1.00 28.54  ? 769 ARG B N     1 
ATOM   9382  C  CA    . ARG F 3 473 ? 19.702  46.854 -64.218  1.00 28.28  ? 769 ARG B CA    1 
ATOM   9383  C  C     . ARG F 3 473 ? 20.846  46.165 -64.981  1.00 29.01  ? 769 ARG B C     1 
ATOM   9384  O  O     . ARG F 3 473 ? 21.808  46.828 -65.384  1.00 28.86  ? 769 ARG B O     1 
ATOM   9385  C  CB    . ARG F 3 473 ? 18.535  47.164 -65.148  1.00 28.96  ? 769 ARG B CB    1 
ATOM   9386  C  CG    . ARG F 3 473 ? 17.685  45.976 -65.533  1.00 29.07  ? 769 ARG B CG    1 
ATOM   9387  C  CD    . ARG F 3 473 ? 16.424  46.445 -66.245  1.00 30.87  ? 769 ARG B CD    1 
ATOM   9388  N  NE    . ARG F 3 473 ? 15.658  47.414 -65.457  1.00 30.99  ? 769 ARG B NE    1 
ATOM   9389  C  CZ    . ARG F 3 473 ? 15.120  47.146 -64.270  1.00 31.67  ? 769 ARG B CZ    1 
ATOM   9390  N  NH1   . ARG F 3 473 ? 15.261  45.943 -63.732  1.00 32.37  ? 769 ARG B NH1   1 
ATOM   9391  N  NH2   . ARG F 3 473 ? 14.440  48.074 -63.616  1.00 32.07  ? 769 ARG B NH2   1 
ATOM   9392  N  N     . ARG F 3 474 ? 20.755  44.852 -65.175  1.00 28.42  ? 770 ARG B N     1 
ATOM   9393  C  CA    . ARG F 3 474 ? 21.825  44.125 -65.855  1.00 27.99  ? 770 ARG B CA    1 
ATOM   9394  C  C     . ARG F 3 474 ? 21.361  43.028 -66.796  1.00 27.30  ? 770 ARG B C     1 
ATOM   9395  O  O     . ARG F 3 474 ? 20.313  42.435 -66.591  1.00 25.74  ? 770 ARG B O     1 
ATOM   9396  C  CB    . ARG F 3 474 ? 22.767  43.519 -64.813  1.00 28.59  ? 770 ARG B CB    1 
ATOM   9397  C  CG    . ARG F 3 474 ? 24.013  42.904 -65.419  1.00 29.94  ? 770 ARG B CG    1 
ATOM   9398  C  CD    . ARG F 3 474 ? 24.977  42.383 -64.376  1.00 31.23  ? 770 ARG B CD    1 
ATOM   9399  N  NE    . ARG F 3 474 ? 25.518  43.449 -63.536  1.00 30.57  ? 770 ARG B NE    1 
ATOM   9400  C  CZ    . ARG F 3 474 ? 26.573  43.292 -62.745  1.00 30.65  ? 770 ARG B CZ    1 
ATOM   9401  N  NH1   . ARG F 3 474 ? 27.185  42.109 -62.697  1.00 30.09  ? 770 ARG B NH1   1 
ATOM   9402  N  NH2   . ARG F 3 474 ? 27.024  44.306 -62.012  1.00 28.66  ? 770 ARG B NH2   1 
ATOM   9403  N  N     . ARG F 3 475 ? 22.146  42.786 -67.842  1.00 27.83  ? 771 ARG B N     1 
ATOM   9404  C  CA    . ARG F 3 475 ? 21.860  41.728 -68.813  1.00 28.65  ? 771 ARG B CA    1 
ATOM   9405  C  C     . ARG F 3 475 ? 23.182  41.179 -69.322  1.00 29.11  ? 771 ARG B C     1 
ATOM   9406  O  O     . ARG F 3 475 ? 23.957  41.902 -69.949  1.00 30.07  ? 771 ARG B O     1 
ATOM   9407  C  CB    . ARG F 3 475 ? 21.060  42.239 -70.009  1.00 28.88  ? 771 ARG B CB    1 
ATOM   9408  C  CG    . ARG F 3 475 ? 20.529  41.107 -70.896  1.00 29.23  ? 771 ARG B CG    1 
ATOM   9409  C  CD    . ARG F 3 475 ? 19.795  41.631 -72.127  1.00 29.20  ? 771 ARG B CD    1 
ATOM   9410  N  NE    . ARG F 3 475 ? 19.180  40.545 -72.890  1.00 29.11  ? 771 ARG B NE    1 
ATOM   9411  C  CZ    . ARG F 3 475 ? 18.393  40.708 -73.948  1.00 29.80  ? 771 ARG B CZ    1 
ATOM   9412  N  NH1   . ARG F 3 475 ? 18.103  41.930 -74.403  1.00 28.95  ? 771 ARG B NH1   1 
ATOM   9413  N  NH2   . ARG F 3 475 ? 17.875  39.644 -74.548  1.00 29.14  ? 771 ARG B NH2   1 
ATOM   9414  N  N     . TYR F 3 476 ? 23.452  39.909 -69.038  1.00 29.17  ? 772 TYR B N     1 
ATOM   9415  C  CA    . TYR F 3 476 ? 24.691  39.305 -69.498  1.00 28.78  ? 772 TYR B CA    1 
ATOM   9416  C  C     . TYR F 3 476 ? 24.533  38.922 -70.963  1.00 28.69  ? 772 TYR B C     1 
ATOM   9417  O  O     . TYR F 3 476 ? 23.508  38.380 -71.357  1.00 29.44  ? 772 TYR B O     1 
ATOM   9418  C  CB    . TYR F 3 476 ? 25.041  38.081 -68.642  1.00 27.90  ? 772 TYR B CB    1 
ATOM   9419  C  CG    . TYR F 3 476 ? 25.443  38.435 -67.226  1.00 28.06  ? 772 TYR B CG    1 
ATOM   9420  C  CD1   . TYR F 3 476 ? 24.488  38.591 -66.215  1.00 27.56  ? 772 TYR B CD1   1 
ATOM   9421  C  CD2   . TYR F 3 476 ? 26.780  38.660 -66.905  1.00 27.91  ? 772 TYR B CD2   1 
ATOM   9422  C  CE1   . TYR F 3 476 ? 24.861  38.963 -64.919  1.00 27.90  ? 772 TYR B CE1   1 
ATOM   9423  C  CE2   . TYR F 3 476 ? 27.164  39.033 -65.627  1.00 27.51  ? 772 TYR B CE2   1 
ATOM   9424  C  CZ    . TYR F 3 476 ? 26.205  39.182 -64.635  1.00 28.67  ? 772 TYR B CZ    1 
ATOM   9425  O  OH    . TYR F 3 476 ? 26.603  39.548 -63.373  1.00 28.49  ? 772 TYR B OH    1 
ATOM   9426  N  N     . LEU F 3 477 ? 25.540  39.222 -71.774  1.00 30.03  ? 773 LEU B N     1 
ATOM   9427  C  CA    . LEU F 3 477 ? 25.495  38.896 -73.198  1.00 32.06  ? 773 LEU B CA    1 
ATOM   9428  C  C     . LEU F 3 477 ? 26.644  37.967 -73.581  1.00 33.71  ? 773 LEU B C     1 
ATOM   9429  O  O     . LEU F 3 477 ? 27.570  38.354 -74.306  1.00 34.07  ? 773 LEU B O     1 
ATOM   9430  C  CB    . LEU F 3 477 ? 25.531  40.189 -74.033  1.00 31.95  ? 773 LEU B CB    1 
ATOM   9431  C  CG    . LEU F 3 477 ? 24.350  41.116 -73.703  1.00 32.52  ? 773 LEU B CG    1 
ATOM   9432  C  CD1   . LEU F 3 477 ? 24.534  42.484 -74.358  1.00 32.88  ? 773 LEU B CD1   1 
ATOM   9433  C  CD2   . LEU F 3 477 ? 23.050  40.456 -74.149  1.00 31.98  ? 773 LEU B CD2   1 
ATOM   9434  N  N     . PRO F 3 478 ? 26.587  36.708 -73.109  1.00 34.99  ? 774 PRO B N     1 
ATOM   9435  C  CA    . PRO F 3 478 ? 27.637  35.726 -73.408  1.00 35.61  ? 774 PRO B CA    1 
ATOM   9436  C  C     . PRO F 3 478 ? 27.928  35.587 -74.905  1.00 35.38  ? 774 PRO B C     1 
ATOM   9437  O  O     . PRO F 3 478 ? 29.085  35.511 -75.309  1.00 35.72  ? 774 PRO B O     1 
ATOM   9438  C  CB    . PRO F 3 478 ? 27.096  34.437 -72.778  1.00 35.71  ? 774 PRO B CB    1 
ATOM   9439  C  CG    . PRO F 3 478 ? 25.604  34.616 -72.888  1.00 36.21  ? 774 PRO B CG    1 
ATOM   9440  C  CD    . PRO F 3 478 ? 25.435  36.060 -72.458  1.00 35.33  ? 774 PRO B CD    1 
ATOM   9441  N  N     . ASP F 3 479 ? 26.879  35.572 -75.720  1.00 35.76  ? 775 ASP B N     1 
ATOM   9442  C  CA    . ASP F 3 479 ? 27.024  35.452 -77.172  1.00 35.88  ? 775 ASP B CA    1 
ATOM   9443  C  C     . ASP F 3 479 ? 27.934  36.503 -77.790  1.00 35.47  ? 775 ASP B C     1 
ATOM   9444  O  O     . ASP F 3 479 ? 28.332  36.378 -78.946  1.00 35.79  ? 775 ASP B O     1 
ATOM   9445  C  CB    . ASP F 3 479 ? 25.658  35.536 -77.840  1.00 35.40  ? 775 ASP B CB    1 
ATOM   9446  C  CG    . ASP F 3 479 ? 24.840  34.291 -77.631  1.00 35.15  ? 775 ASP B CG    1 
ATOM   9447  O  OD1   . ASP F 3 479 ? 23.616  34.330 -77.875  1.00 34.42  ? 775 ASP B OD1   1 
ATOM   9448  O  OD2   . ASP F 3 479 ? 25.429  33.268 -77.226  1.00 35.86  ? 775 ASP B OD2   1 
ATOM   9449  N  N     . ILE F 3 480 ? 28.253  37.537 -77.020  1.00 35.88  ? 776 ILE B N     1 
ATOM   9450  C  CA    . ILE F 3 480 ? 29.093  38.626 -77.495  1.00 36.15  ? 776 ILE B CA    1 
ATOM   9451  C  C     . ILE F 3 480 ? 30.511  38.167 -77.874  1.00 36.53  ? 776 ILE B C     1 
ATOM   9452  O  O     . ILE F 3 480 ? 31.279  38.932 -78.456  1.00 36.78  ? 776 ILE B O     1 
ATOM   9453  C  CB    . ILE F 3 480 ? 29.174  39.742 -76.429  1.00 36.12  ? 776 ILE B CB    1 
ATOM   9454  C  CG1   . ILE F 3 480 ? 29.673  41.046 -77.056  1.00 36.64  ? 776 ILE B CG1   1 
ATOM   9455  C  CG2   . ILE F 3 480 ? 30.075  39.303 -75.293  1.00 37.29  ? 776 ILE B CG2   1 
ATOM   9456  C  CD1   . ILE F 3 480 ? 28.663  41.712 -77.998  1.00 36.10  ? 776 ILE B CD1   1 
ATOM   9457  N  N     . THR F 3 481 ? 30.859  36.926 -77.541  1.00 36.33  ? 777 THR B N     1 
ATOM   9458  C  CA    . THR F 3 481 ? 32.178  36.391 -77.871  1.00 36.23  ? 777 THR B CA    1 
ATOM   9459  C  C     . THR F 3 481 ? 32.050  35.154 -78.755  1.00 36.34  ? 777 THR B C     1 
ATOM   9460  O  O     . THR F 3 481 ? 33.032  34.452 -79.017  1.00 36.79  ? 777 THR B O     1 
ATOM   9461  C  CB    . THR F 3 481 ? 32.959  35.991 -76.606  1.00 36.39  ? 777 THR B CB    1 
ATOM   9462  O  OG1   . THR F 3 481 ? 32.202  35.027 -75.864  1.00 34.80  ? 777 THR B OG1   1 
ATOM   9463  C  CG2   . THR F 3 481 ? 33.236  37.211 -75.742  1.00 36.10  ? 777 THR B CG2   1 
ATOM   9464  N  N     . SER F 3 482 ? 30.832  34.890 -79.215  1.00 35.76  ? 778 SER B N     1 
ATOM   9465  C  CA    . SER F 3 482 ? 30.574  33.731 -80.051  1.00 34.86  ? 778 SER B CA    1 
ATOM   9466  C  C     . SER F 3 482 ? 31.381  33.797 -81.346  1.00 35.59  ? 778 SER B C     1 
ATOM   9467  O  O     . SER F 3 482 ? 31.642  34.880 -81.886  1.00 35.33  ? 778 SER B O     1 
ATOM   9468  C  CB    . SER F 3 482 ? 29.080  33.648 -80.360  1.00 34.26  ? 778 SER B CB    1 
ATOM   9469  O  OG    . SER F 3 482 ? 28.725  32.396 -80.912  1.00 31.97  ? 778 SER B OG    1 
ATOM   9470  N  N     . ARG F 3 483 ? 31.790  32.634 -81.838  1.00 35.62  ? 779 ARG B N     1 
ATOM   9471  C  CA    . ARG F 3 483 ? 32.554  32.566 -83.082  1.00 35.93  ? 779 ARG B CA    1 
ATOM   9472  C  C     . ARG F 3 483 ? 31.599  32.337 -84.242  1.00 35.20  ? 779 ARG B C     1 
ATOM   9473  O  O     . ARG F 3 483 ? 32.008  32.130 -85.385  1.00 35.54  ? 779 ARG B O     1 
ATOM   9474  C  CB    . ARG F 3 483 ? 33.606  31.457 -82.990  1.00 37.10  ? 779 ARG B CB    1 
ATOM   9475  C  CG    . ARG F 3 483 ? 34.736  31.838 -82.053  1.00 38.36  ? 779 ARG B CG    1 
ATOM   9476  C  CD    . ARG F 3 483 ? 35.603  30.662 -81.668  1.00 38.84  ? 779 ARG B CD    1 
ATOM   9477  N  NE    . ARG F 3 483 ? 36.681  31.096 -80.786  1.00 40.16  ? 779 ARG B NE    1 
ATOM   9478  C  CZ    . ARG F 3 483 ? 37.790  31.703 -81.197  1.00 41.17  ? 779 ARG B CZ    1 
ATOM   9479  N  NH1   . ARG F 3 483 ? 37.978  31.946 -82.489  1.00 42.02  ? 779 ARG B NH1   1 
ATOM   9480  N  NH2   . ARG F 3 483 ? 38.709  32.082 -80.315  1.00 40.98  ? 779 ARG B NH2   1 
ATOM   9481  N  N     . ASN F 3 484 ? 30.311  32.381 -83.927  1.00 34.26  ? 780 ASN B N     1 
ATOM   9482  C  CA    . ASN F 3 484 ? 29.273  32.218 -84.926  1.00 33.96  ? 780 ASN B CA    1 
ATOM   9483  C  C     . ASN F 3 484 ? 28.769  33.621 -85.292  1.00 34.24  ? 780 ASN B C     1 
ATOM   9484  O  O     . ASN F 3 484 ? 27.865  34.147 -84.635  1.00 34.54  ? 780 ASN B O     1 
ATOM   9485  C  CB    . ASN F 3 484 ? 28.120  31.390 -84.355  1.00 32.72  ? 780 ASN B CB    1 
ATOM   9486  C  CG    . ASN F 3 484 ? 26.975  31.270 -85.318  1.00 32.98  ? 780 ASN B CG    1 
ATOM   9487  O  OD1   . ASN F 3 484 ? 26.461  32.277 -85.825  1.00 30.46  ? 780 ASN B OD1   1 
ATOM   9488  N  ND2   . ASN F 3 484 ? 26.557  30.031 -85.587  1.00 32.44  ? 780 ASN B ND2   1 
ATOM   9489  N  N     . PHE F 3 485 ? 29.359  34.211 -86.332  1.00 33.65  ? 781 PHE B N     1 
ATOM   9490  C  CA    . PHE F 3 485 ? 29.015  35.560 -86.801  1.00 33.97  ? 781 PHE B CA    1 
ATOM   9491  C  C     . PHE F 3 485 ? 27.575  35.978 -86.491  1.00 33.11  ? 781 PHE B C     1 
ATOM   9492  O  O     . PHE F 3 485 ? 27.335  37.065 -85.976  1.00 33.05  ? 781 PHE B O     1 
ATOM   9493  C  CB    . PHE F 3 485 ? 29.239  35.670 -88.315  1.00 35.03  ? 781 PHE B CB    1 
ATOM   9494  C  CG    . PHE F 3 485 ? 30.608  35.235 -88.767  1.00 36.69  ? 781 PHE B CG    1 
ATOM   9495  C  CD1   . PHE F 3 485 ? 31.736  35.982 -88.443  1.00 37.73  ? 781 PHE B CD1   1 
ATOM   9496  C  CD2   . PHE F 3 485 ? 30.769  34.078 -89.523  1.00 37.83  ? 781 PHE B CD2   1 
ATOM   9497  C  CE1   . PHE F 3 485 ? 33.009  35.581 -88.869  1.00 37.84  ? 781 PHE B CE1   1 
ATOM   9498  C  CE2   . PHE F 3 485 ? 32.036  33.671 -89.952  1.00 38.35  ? 781 PHE B CE2   1 
ATOM   9499  C  CZ    . PHE F 3 485 ? 33.154  34.426 -89.622  1.00 37.97  ? 781 PHE B CZ    1 
ATOM   9500  N  N     . ASN F 3 486 ? 26.621  35.122 -86.822  1.00 32.20  ? 782 ASN B N     1 
ATOM   9501  C  CA    . ASN F 3 486 ? 25.223  35.441 -86.574  1.00 32.35  ? 782 ASN B CA    1 
ATOM   9502  C  C     . ASN F 3 486 ? 25.009  35.716 -85.087  1.00 31.81  ? 782 ASN B C     1 
ATOM   9503  O  O     . ASN F 3 486 ? 24.751  36.857 -84.681  1.00 31.31  ? 782 ASN B O     1 
ATOM   9504  C  CB    . ASN F 3 486 ? 24.326  34.294 -87.032  1.00 33.23  ? 782 ASN B CB    1 
ATOM   9505  C  CG    . ASN F 3 486 ? 22.861  34.697 -87.097  1.00 35.75  ? 782 ASN B CG    1 
ATOM   9506  O  OD1   . ASN F 3 486 ? 22.538  35.853 -87.391  1.00 35.87  ? 782 ASN B OD1   1 
ATOM   9507  N  ND2   . ASN F 3 486 ? 21.966  33.745 -86.840  1.00 36.61  ? 782 ASN B ND2   1 
ATOM   9508  N  N     . VAL F 3 487 ? 25.152  34.661 -84.290  1.00 29.55  ? 783 VAL B N     1 
ATOM   9509  C  CA    . VAL F 3 487 ? 24.991  34.713 -82.851  1.00 27.88  ? 783 VAL B CA    1 
ATOM   9510  C  C     . VAL F 3 487 ? 25.689  35.915 -82.221  1.00 27.46  ? 783 VAL B C     1 
ATOM   9511  O  O     . VAL F 3 487 ? 25.179  36.501 -81.266  1.00 26.49  ? 783 VAL B O     1 
ATOM   9512  C  CB    . VAL F 3 487 ? 25.522  33.395 -82.215  1.00 28.12  ? 783 VAL B CB    1 
ATOM   9513  C  CG1   . VAL F 3 487 ? 25.281  33.392 -80.711  1.00 26.82  ? 783 VAL B CG1   1 
ATOM   9514  C  CG2   . VAL F 3 487 ? 24.815  32.194 -82.870  1.00 26.50  ? 783 VAL B CG2   1 
ATOM   9515  N  N     . ARG F 3 488 ? 26.858  36.277 -82.744  1.00 26.21  ? 784 ARG B N     1 
ATOM   9516  C  CA    . ARG F 3 488 ? 27.586  37.411 -82.211  1.00 26.69  ? 784 ARG B CA    1 
ATOM   9517  C  C     . ARG F 3 488 ? 26.869  38.704 -82.586  1.00 27.27  ? 784 ARG B C     1 
ATOM   9518  O  O     . ARG F 3 488 ? 26.587  39.534 -81.724  1.00 28.16  ? 784 ARG B O     1 
ATOM   9519  C  CB    . ARG F 3 488 ? 29.026  37.456 -82.743  1.00 25.51  ? 784 ARG B CB    1 
ATOM   9520  C  CG    . ARG F 3 488 ? 29.739  38.750 -82.364  1.00 27.13  ? 784 ARG B CG    1 
ATOM   9521  C  CD    . ARG F 3 488 ? 31.212  38.749 -82.752  1.00 28.83  ? 784 ARG B CD    1 
ATOM   9522  N  NE    . ARG F 3 488 ? 31.973  37.748 -82.006  1.00 29.71  ? 784 ARG B NE    1 
ATOM   9523  C  CZ    . ARG F 3 488 ? 33.299  37.717 -81.948  1.00 31.31  ? 784 ARG B CZ    1 
ATOM   9524  N  NH1   . ARG F 3 488 ? 34.006  38.636 -82.589  1.00 32.15  ? 784 ARG B NH1   1 
ATOM   9525  N  NH2   . ARG F 3 488 ? 33.920  36.766 -81.257  1.00 32.10  ? 784 ARG B NH2   1 
ATOM   9526  N  N     . SER F 3 489 ? 26.575  38.866 -83.869  1.00 27.39  ? 785 SER B N     1 
ATOM   9527  C  CA    . SER F 3 489 ? 25.896  40.063 -84.340  1.00 28.18  ? 785 SER B CA    1 
ATOM   9528  C  C     . SER F 3 489 ? 24.639  40.399 -83.532  1.00 28.82  ? 785 SER B C     1 
ATOM   9529  O  O     . SER F 3 489 ? 24.474  41.544 -83.115  1.00 29.16  ? 785 SER B O     1 
ATOM   9530  C  CB    . SER F 3 489 ? 25.561  39.915 -85.817  1.00 27.92  ? 785 SER B CB    1 
ATOM   9531  O  OG    . SER F 3 489 ? 26.766  39.895 -86.573  1.00 29.33  ? 785 SER B OG    1 
ATOM   9532  N  N     . PHE F 3 490 ? 23.765  39.414 -83.322  1.00 29.16  ? 786 PHE B N     1 
ATOM   9533  C  CA    . PHE F 3 490 ? 22.532  39.607 -82.549  1.00 30.96  ? 786 PHE B CA    1 
ATOM   9534  C  C     . PHE F 3 490 ? 22.823  40.119 -81.135  1.00 31.71  ? 786 PHE B C     1 
ATOM   9535  O  O     . PHE F 3 490 ? 22.075  40.931 -80.593  1.00 32.49  ? 786 PHE B O     1 
ATOM   9536  C  CB    . PHE F 3 490 ? 21.763  38.291 -82.437  1.00 30.48  ? 786 PHE B CB    1 
ATOM   9537  C  CG    . PHE F 3 490 ? 20.727  38.096 -83.498  1.00 31.46  ? 786 PHE B CG    1 
ATOM   9538  C  CD1   . PHE F 3 490 ? 19.387  38.384 -83.241  1.00 31.39  ? 786 PHE B CD1   1 
ATOM   9539  C  CD2   . PHE F 3 490 ? 21.078  37.602 -84.752  1.00 31.49  ? 786 PHE B CD2   1 
ATOM   9540  C  CE1   . PHE F 3 490 ? 18.411  38.180 -84.219  1.00 31.37  ? 786 PHE B CE1   1 
ATOM   9541  C  CE2   . PHE F 3 490 ? 20.114  37.395 -85.735  1.00 31.49  ? 786 PHE B CE2   1 
ATOM   9542  C  CZ    . PHE F 3 490 ? 18.773  37.685 -85.469  1.00 31.74  ? 786 PHE B CZ    1 
ATOM   9543  N  N     . ALA F 3 491 ? 23.914  39.642 -80.547  1.00 31.73  ? 787 ALA B N     1 
ATOM   9544  C  CA    . ALA F 3 491 ? 24.286  40.042 -79.200  1.00 32.41  ? 787 ALA B CA    1 
ATOM   9545  C  C     . ALA F 3 491 ? 24.824  41.456 -79.255  1.00 32.72  ? 787 ALA B C     1 
ATOM   9546  O  O     . ALA F 3 491 ? 24.710  42.217 -78.295  1.00 32.76  ? 787 ALA B O     1 
ATOM   9547  C  CB    . ALA F 3 491 ? 25.341  39.083 -78.626  1.00 32.27  ? 787 ALA B CB    1 
ATOM   9548  N  N     . GLU F 3 492 ? 25.407  41.804 -80.393  1.00 33.08  ? 788 GLU B N     1 
ATOM   9549  C  CA    . GLU F 3 492 ? 25.951  43.140 -80.586  1.00 33.35  ? 788 GLU B CA    1 
ATOM   9550  C  C     . GLU F 3 492 ? 24.826  44.164 -80.568  1.00 32.20  ? 788 GLU B C     1 
ATOM   9551  O  O     . GLU F 3 492 ? 24.981  45.255 -80.018  1.00 31.79  ? 788 GLU B O     1 
ATOM   9552  C  CB    . GLU F 3 492 ? 26.683  43.234 -81.927  1.00 34.61  ? 788 GLU B CB    1 
ATOM   9553  C  CG    . GLU F 3 492 ? 28.183  43.051 -81.840  1.00 36.82  ? 788 GLU B CG    1 
ATOM   9554  C  CD    . GLU F 3 492 ? 28.847  43.083 -83.211  1.00 37.82  ? 788 GLU B CD    1 
ATOM   9555  O  OE1   . GLU F 3 492 ? 28.526  43.989 -84.011  1.00 39.12  ? 788 GLU B OE1   1 
ATOM   9556  O  OE2   . GLU F 3 492 ? 29.691  42.206 -83.489  1.00 38.95  ? 788 GLU B OE2   1 
ATOM   9557  N  N     . ARG F 3 493 ? 23.708  43.804 -81.189  1.00 30.55  ? 789 ARG B N     1 
ATOM   9558  C  CA    . ARG F 3 493 ? 22.551  44.680 -81.269  1.00 29.58  ? 789 ARG B CA    1 
ATOM   9559  C  C     . ARG F 3 493 ? 21.880  44.756 -79.904  1.00 28.89  ? 789 ARG B C     1 
ATOM   9560  O  O     . ARG F 3 493 ? 21.122  45.674 -79.633  1.00 28.28  ? 789 ARG B O     1 
ATOM   9561  C  CB    . ARG F 3 493 ? 21.554  44.167 -82.326  1.00 29.61  ? 789 ARG B CB    1 
ATOM   9562  C  CG    . ARG F 3 493 ? 22.038  44.327 -83.775  1.00 29.75  ? 789 ARG B CG    1 
ATOM   9563  C  CD    . ARG F 3 493 ? 20.915  44.108 -84.798  1.00 28.80  ? 789 ARG B CD    1 
ATOM   9564  N  NE    . ARG F 3 493 ? 20.580  42.703 -85.019  1.00 28.55  ? 789 ARG B NE    1 
ATOM   9565  C  CZ    . ARG F 3 493 ? 21.312  41.852 -85.737  1.00 29.87  ? 789 ARG B CZ    1 
ATOM   9566  N  NH1   . ARG F 3 493 ? 22.435  42.254 -86.316  1.00 29.34  ? 789 ARG B NH1   1 
ATOM   9567  N  NH2   . ARG F 3 493 ? 20.922  40.590 -85.876  1.00 29.31  ? 789 ARG B NH2   1 
ATOM   9568  N  N     . MET F 3 494 ? 22.156  43.773 -79.053  1.00 28.05  ? 790 MET B N     1 
ATOM   9569  C  CA    . MET F 3 494 ? 21.584  43.754 -77.715  1.00 26.47  ? 790 MET B CA    1 
ATOM   9570  C  C     . MET F 3 494 ? 22.405  44.666 -76.839  1.00 25.65  ? 790 MET B C     1 
ATOM   9571  O  O     . MET F 3 494 ? 21.894  45.212 -75.867  1.00 27.04  ? 790 MET B O     1 
ATOM   9572  C  CB    . MET F 3 494 ? 21.594  42.340 -77.129  1.00 27.31  ? 790 MET B CB    1 
ATOM   9573  C  CG    . MET F 3 494 ? 20.501  41.425 -77.640  1.00 25.69  ? 790 MET B CG    1 
ATOM   9574  S  SD    . MET F 3 494 ? 20.697  39.842 -76.835  1.00 27.38  ? 790 MET B SD    1 
ATOM   9575  C  CE    . MET F 3 494 ? 19.447  38.843 -77.637  1.00 24.51  ? 790 MET B CE    1 
ATOM   9576  N  N     . ALA F 3 495 ? 23.686  44.820 -77.170  1.00 24.34  ? 791 ALA B N     1 
ATOM   9577  C  CA    . ALA F 3 495 ? 24.556  45.699 -76.407  1.00 24.43  ? 791 ALA B CA    1 
ATOM   9578  C  C     . ALA F 3 495 ? 24.219  47.161 -76.692  1.00 25.38  ? 791 ALA B C     1 
ATOM   9579  O  O     . ALA F 3 495 ? 24.346  48.006 -75.813  1.00 26.75  ? 791 ALA B O     1 
ATOM   9580  C  CB    . ALA F 3 495 ? 26.016  45.442 -76.753  1.00 24.31  ? 791 ALA B CB    1 
ATOM   9581  N  N     . MET F 3 496 ? 23.821  47.462 -77.925  1.00 25.32  ? 792 MET B N     1 
ATOM   9582  C  CA    . MET F 3 496 ? 23.488  48.844 -78.299  1.00 25.97  ? 792 MET B CA    1 
ATOM   9583  C  C     . MET F 3 496 ? 22.119  49.198 -77.727  1.00 25.81  ? 792 MET B C     1 
ATOM   9584  O  O     . MET F 3 496 ? 21.915  50.279 -77.183  1.00 25.60  ? 792 MET B O     1 
ATOM   9585  C  CB    . MET F 3 496 ? 23.426  48.986 -79.822  1.00 27.65  ? 792 MET B CB    1 
ATOM   9586  C  CG    . MET F 3 496 ? 24.651  48.478 -80.584  1.00 29.17  ? 792 MET B CG    1 
ATOM   9587  S  SD    . MET F 3 496 ? 24.469  48.633 -82.368  1.00 33.61  ? 792 MET B SD    1 
ATOM   9588  C  CE    . MET F 3 496 ? 22.938  47.724 -82.654  1.00 31.96  ? 792 MET B CE    1 
ATOM   9589  N  N     . ASN F 3 497 ? 21.194  48.252 -77.837  1.00 24.39  ? 793 ASN B N     1 
ATOM   9590  C  CA    . ASN F 3 497 ? 19.822  48.441 -77.381  1.00 23.87  ? 793 ASN B CA    1 
ATOM   9591  C  C     . ASN F 3 497 ? 19.481  48.354 -75.873  1.00 23.65  ? 793 ASN B C     1 
ATOM   9592  O  O     . ASN F 3 497 ? 18.765  49.215 -75.365  1.00 23.46  ? 793 ASN B O     1 
ATOM   9593  C  CB    . ASN F 3 497 ? 18.929  47.483 -78.178  1.00 23.23  ? 793 ASN B CB    1 
ATOM   9594  C  CG    . ASN F 3 497 ? 17.456  47.604 -77.816  1.00 26.33  ? 793 ASN B CG    1 
ATOM   9595  O  OD1   . ASN F 3 497 ? 16.949  46.843 -76.999  1.00 26.86  ? 793 ASN B OD1   1 
ATOM   9596  N  ND2   . ASN F 3 497 ? 16.761  48.571 -78.430  1.00 26.68  ? 793 ASN B ND2   1 
ATOM   9597  N  N     . THR F 3 498 ? 19.966  47.338 -75.153  1.00 22.54  ? 794 THR B N     1 
ATOM   9598  C  CA    . THR F 3 498 ? 19.619  47.193 -73.730  1.00 22.52  ? 794 THR B CA    1 
ATOM   9599  C  C     . THR F 3 498 ? 19.887  48.396 -72.812  1.00 22.62  ? 794 THR B C     1 
ATOM   9600  O  O     . THR F 3 498 ? 19.031  48.774 -72.005  1.00 21.78  ? 794 THR B O     1 
ATOM   9601  C  CB    . THR F 3 498 ? 20.268  45.910 -73.108  1.00 22.77  ? 794 THR B CB    1 
ATOM   9602  O  OG1   . THR F 3 498 ? 19.599  44.745 -73.618  1.00 23.59  ? 794 THR B OG1   1 
ATOM   9603  C  CG2   . THR F 3 498 ? 20.136  45.918 -71.583  1.00 22.25  ? 794 THR B CG2   1 
ATOM   9604  N  N     . PRO F 3 499 ? 21.059  49.028 -72.925  1.00 23.55  ? 795 PRO B N     1 
ATOM   9605  C  CA    . PRO F 3 499 ? 21.282  50.169 -72.039  1.00 24.13  ? 795 PRO B CA    1 
ATOM   9606  C  C     . PRO F 3 499 ? 20.216  51.262 -72.236  1.00 25.58  ? 795 PRO B C     1 
ATOM   9607  O  O     . PRO F 3 499 ? 19.745  51.857 -71.273  1.00 26.20  ? 795 PRO B O     1 
ATOM   9608  C  CB    . PRO F 3 499 ? 22.669  50.641 -72.439  1.00 24.91  ? 795 PRO B CB    1 
ATOM   9609  C  CG    . PRO F 3 499 ? 23.351  49.378 -72.853  1.00 24.71  ? 795 PRO B CG    1 
ATOM   9610  C  CD    . PRO F 3 499 ? 22.286  48.690 -73.672  1.00 24.10  ? 795 PRO B CD    1 
ATOM   9611  N  N     . ILE F 3 500 ? 19.820  51.484 -73.481  1.00 26.03  ? 796 ILE B N     1 
ATOM   9612  C  CA    . ILE F 3 500 ? 18.841  52.516 -73.808  1.00 25.82  ? 796 ILE B CA    1 
ATOM   9613  C  C     . ILE F 3 500 ? 17.410  52.130 -73.429  1.00 26.32  ? 796 ILE B C     1 
ATOM   9614  O  O     . ILE F 3 500 ? 16.725  52.898 -72.755  1.00 26.27  ? 796 ILE B O     1 
ATOM   9615  C  CB    . ILE F 3 500 ? 18.885  52.858 -75.309  1.00 25.31  ? 796 ILE B CB    1 
ATOM   9616  C  CG1   . ILE F 3 500 ? 20.324  52.798 -75.825  1.00 25.04  ? 796 ILE B CG1   1 
ATOM   9617  C  CG2   . ILE F 3 500 ? 18.310  54.257 -75.541  1.00 26.72  ? 796 ILE B CG2   1 
ATOM   9618  C  CD1   . ILE F 3 500 ? 21.308  53.659 -75.042  1.00 23.63  ? 796 ILE B CD1   1 
ATOM   9619  N  N     . GLN F 3 501 ? 16.952  50.946 -73.837  1.00 25.59  ? 797 GLN B N     1 
ATOM   9620  C  CA    . GLN F 3 501 ? 15.589  50.544 -73.494  1.00 25.44  ? 797 GLN B CA    1 
ATOM   9621  C  C     . GLN F 3 501 ? 15.445  50.231 -71.998  1.00 25.80  ? 797 GLN B C     1 
ATOM   9622  O  O     . GLN F 3 501 ? 14.385  50.442 -71.392  1.00 24.84  ? 797 GLN B O     1 
ATOM   9623  C  CB    . GLN F 3 501 ? 15.149  49.331 -74.329  1.00 25.37  ? 797 GLN B CB    1 
ATOM   9624  C  CG    . GLN F 3 501 ? 13.694  48.934 -74.075  1.00 24.99  ? 797 GLN B CG    1 
ATOM   9625  C  CD    . GLN F 3 501 ? 13.249  47.713 -74.853  1.00 26.34  ? 797 GLN B CD    1 
ATOM   9626  O  OE1   . GLN F 3 501 ? 13.231  47.710 -76.091  1.00 27.30  ? 797 GLN B OE1   1 
ATOM   9627  N  NE2   . GLN F 3 501 ? 12.880  46.661 -74.130  1.00 25.76  ? 797 GLN B NE2   1 
ATOM   9628  N  N     . GLY F 3 502 ? 16.515  49.708 -71.411  1.00 26.82  ? 798 GLY B N     1 
ATOM   9629  C  CA    . GLY F 3 502 ? 16.508  49.368 -69.999  1.00 26.54  ? 798 GLY B CA    1 
ATOM   9630  C  C     . GLY F 3 502 ? 16.468  50.611 -69.127  1.00 27.06  ? 798 GLY B C     1 
ATOM   9631  O  O     . GLY F 3 502 ? 15.702  50.685 -68.160  1.00 27.00  ? 798 GLY B O     1 
ATOM   9632  N  N     . SER F 3 503 ? 17.281  51.597 -69.478  1.00 27.25  ? 799 SER B N     1 
ATOM   9633  C  CA    . SER F 3 503 ? 17.322  52.842 -68.711  1.00 28.23  ? 799 SER B CA    1 
ATOM   9634  C  C     . SER F 3 503 ? 15.992  53.607 -68.763  1.00 28.29  ? 799 SER B C     1 
ATOM   9635  O  O     . SER F 3 503 ? 15.716  54.432 -67.893  1.00 29.58  ? 799 SER B O     1 
ATOM   9636  C  CB    . SER F 3 503 ? 18.472  53.720 -69.207  1.00 27.67  ? 799 SER B CB    1 
ATOM   9637  O  OG    . SER F 3 503 ? 19.717  53.086 -68.932  1.00 28.56  ? 799 SER B OG    1 
ATOM   9638  N  N     . ALA F 3 504 ? 15.167  53.334 -69.769  1.00 28.22  ? 800 ALA B N     1 
ATOM   9639  C  CA    . ALA F 3 504 ? 13.866  54.003 -69.862  1.00 28.52  ? 800 ALA B CA    1 
ATOM   9640  C  C     . ALA F 3 504 ? 12.895  53.250 -68.966  1.00 28.18  ? 800 ALA B C     1 
ATOM   9641  O  O     . ALA F 3 504 ? 11.952  53.830 -68.446  1.00 28.84  ? 800 ALA B O     1 
ATOM   9642  C  CB    . ALA F 3 504 ? 13.349  54.013 -71.302  1.00 27.95  ? 800 ALA B CB    1 
ATOM   9643  N  N     . ALA F 3 505 ? 13.123  51.943 -68.811  1.00 27.16  ? 801 ALA B N     1 
ATOM   9644  C  CA    . ALA F 3 505 ? 12.293  51.112 -67.959  1.00 25.87  ? 801 ALA B CA    1 
ATOM   9645  C  C     . ALA F 3 505 ? 12.587  51.543 -66.529  1.00 25.38  ? 801 ALA B C     1 
ATOM   9646  O  O     . ALA F 3 505 ? 11.722  51.506 -65.660  1.00 24.70  ? 801 ALA B O     1 
ATOM   9647  C  CB    . ALA F 3 505 ? 12.627  49.620 -68.162  1.00 25.20  ? 801 ALA B CB    1 
ATOM   9648  N  N     . ASP F 3 506 ? 13.825  51.965 -66.302  1.00 26.44  ? 802 ASP B N     1 
ATOM   9649  C  CA    . ASP F 3 506 ? 14.263  52.450 -64.992  1.00 26.66  ? 802 ASP B CA    1 
ATOM   9650  C  C     . ASP F 3 506 ? 13.500  53.731 -64.672  1.00 25.95  ? 802 ASP B C     1 
ATOM   9651  O  O     . ASP F 3 506 ? 12.963  53.905 -63.584  1.00 26.40  ? 802 ASP B O     1 
ATOM   9652  C  CB    . ASP F 3 506 ? 15.755  52.776 -65.015  1.00 26.32  ? 802 ASP B CB    1 
ATOM   9653  C  CG    . ASP F 3 506 ? 16.637  51.536 -64.974  1.00 27.86  ? 802 ASP B CG    1 
ATOM   9654  O  OD1   . ASP F 3 506 ? 17.868  51.708 -65.054  1.00 26.43  ? 802 ASP B OD1   1 
ATOM   9655  O  OD2   . ASP F 3 506 ? 16.113  50.407 -64.857  1.00 27.74  ? 802 ASP B OD2   1 
ATOM   9656  N  N     . ILE F 3 507 ? 13.485  54.626 -65.647  1.00 26.77  ? 803 ILE B N     1 
ATOM   9657  C  CA    . ILE F 3 507 ? 12.818  55.914 -65.539  1.00 25.47  ? 803 ILE B CA    1 
ATOM   9658  C  C     . ILE F 3 507 ? 11.326  55.761 -65.262  1.00 25.10  ? 803 ILE B C     1 
ATOM   9659  O  O     . ILE F 3 507 ? 10.839  56.221 -64.234  1.00 25.32  ? 803 ILE B O     1 
ATOM   9660  C  CB    . ILE F 3 507 ? 13.021  56.721 -66.829  1.00 25.79  ? 803 ILE B CB    1 
ATOM   9661  C  CG1   . ILE F 3 507 ? 14.501  57.081 -66.976  1.00 25.06  ? 803 ILE B CG1   1 
ATOM   9662  C  CG2   . ILE F 3 507 ? 12.166  57.992 -66.812  1.00 24.99  ? 803 ILE B CG2   1 
ATOM   9663  C  CD1   . ILE F 3 507 ? 14.826  57.660 -68.333  1.00 26.33  ? 803 ILE B CD1   1 
ATOM   9664  N  N     . ILE F 3 508 ? 10.601  55.088 -66.149  1.00 24.79  ? 804 ILE B N     1 
ATOM   9665  C  CA    . ILE F 3 508 ? 9.173   54.942 -65.919  1.00 24.09  ? 804 ILE B CA    1 
ATOM   9666  C  C     . ILE F 3 508 ? 8.870   54.268 -64.586  1.00 25.44  ? 804 ILE B C     1 
ATOM   9667  O  O     . ILE F 3 508 ? 7.927   54.669 -63.892  1.00 24.07  ? 804 ILE B O     1 
ATOM   9668  C  CB    . ILE F 3 508 ? 8.464   54.188 -67.099  1.00 23.33  ? 804 ILE B CB    1 
ATOM   9669  C  CG1   . ILE F 3 508 ? 6.948   54.336 -66.973  1.00 23.99  ? 804 ILE B CG1   1 
ATOM   9670  C  CG2   . ILE F 3 508 ? 8.841   52.724 -67.122  1.00 23.28  ? 804 ILE B CG2   1 
ATOM   9671  C  CD1   . ILE F 3 508 ? 6.404   55.649 -67.543  1.00 22.02  ? 804 ILE B CD1   1 
ATOM   9672  N  N     . LYS F 3 509 ? 9.667   53.256 -64.214  1.00 25.69  ? 805 LYS B N     1 
ATOM   9673  C  CA    . LYS F 3 509 ? 9.451   52.546 -62.960  1.00 27.01  ? 805 LYS B CA    1 
ATOM   9674  C  C     . LYS F 3 509 ? 9.630   53.484 -61.783  1.00 26.79  ? 805 LYS B C     1 
ATOM   9675  O  O     . LYS F 3 509 ? 8.832   53.492 -60.844  1.00 27.56  ? 805 LYS B O     1 
ATOM   9676  C  CB    . LYS F 3 509 ? 10.414  51.344 -62.834  1.00 27.49  ? 805 LYS B CB    1 
ATOM   9677  C  CG    . LYS F 3 509 ? 10.024  50.156 -63.699  1.00 28.71  ? 805 LYS B CG    1 
ATOM   9678  C  CD    . LYS F 3 509 ? 10.964  48.962 -63.489  1.00 27.90  ? 805 LYS B CD    1 
ATOM   9679  C  CE    . LYS F 3 509 ? 10.289  47.662 -63.931  1.00 28.40  ? 805 LYS B CE    1 
ATOM   9680  N  NZ    . LYS F 3 509 ? 11.291  46.562 -64.122  1.00 28.00  ? 805 LYS B NZ    1 
ATOM   9681  N  N     . LYS F 3 510 ? 10.695  54.268 -61.821  1.00 27.65  ? 806 LYS B N     1 
ATOM   9682  C  CA    . LYS F 3 510 ? 10.943  55.239 -60.775  1.00 27.56  ? 806 LYS B CA    1 
ATOM   9683  C  C     . LYS F 3 510 ? 9.727   56.178 -60.725  1.00 28.34  ? 806 LYS B C     1 
ATOM   9684  O  O     . LYS F 3 510 ? 9.210   56.487 -59.645  1.00 28.30  ? 806 LYS B O     1 
ATOM   9685  C  CB    . LYS F 3 510 ? 12.236  56.000 -61.105  1.00 27.95  ? 806 LYS B CB    1 
ATOM   9686  C  CG    . LYS F 3 510 ? 12.466  57.325 -60.382  1.00 29.12  ? 806 LYS B CG    1 
ATOM   9687  C  CD    . LYS F 3 510 ? 12.239  57.255 -58.897  1.00 29.14  ? 806 LYS B CD    1 
ATOM   9688  C  CE    . LYS F 3 510 ? 13.102  58.274 -58.160  1.00 30.52  ? 806 LYS B CE    1 
ATOM   9689  N  NZ    . LYS F 3 510 ? 12.984  59.648 -58.715  1.00 30.57  ? 806 LYS B NZ    1 
ATOM   9690  N  N     . ALA F 3 511 ? 9.256   56.585 -61.903  1.00 28.80  ? 807 ALA B N     1 
ATOM   9691  C  CA    . ALA F 3 511 ? 8.124   57.503 -62.047  1.00 29.39  ? 807 ALA B CA    1 
ATOM   9692  C  C     . ALA F 3 511 ? 6.833   57.016 -61.412  1.00 30.26  ? 807 ALA B C     1 
ATOM   9693  O  O     . ALA F 3 511 ? 6.136   57.786 -60.756  1.00 30.74  ? 807 ALA B O     1 
ATOM   9694  C  CB    . ALA F 3 511 ? 7.886   57.800 -63.520  1.00 29.65  ? 807 ALA B CB    1 
ATOM   9695  N  N     . MET F 3 512 ? 6.507   55.741 -61.626  1.00 30.32  ? 808 MET B N     1 
ATOM   9696  C  CA    . MET F 3 512 ? 5.306   55.143 -61.057  1.00 30.32  ? 808 MET B CA    1 
ATOM   9697  C  C     . MET F 3 512 ? 5.314   55.209 -59.535  1.00 30.26  ? 808 MET B C     1 
ATOM   9698  O  O     . MET F 3 512 ? 4.279   55.426 -58.904  1.00 30.01  ? 808 MET B O     1 
ATOM   9699  C  CB    . MET F 3 512 ? 5.190   53.677 -61.483  1.00 30.77  ? 808 MET B CB    1 
ATOM   9700  C  CG    . MET F 3 512 ? 5.044   53.469 -62.968  1.00 30.05  ? 808 MET B CG    1 
ATOM   9701  S  SD    . MET F 3 512 ? 4.669   51.748 -63.359  1.00 30.38  ? 808 MET B SD    1 
ATOM   9702  C  CE    . MET F 3 512 ? 3.352   51.398 -62.254  1.00 27.88  ? 808 MET B CE    1 
ATOM   9703  N  N     . ILE F 3 513 ? 6.483   54.996 -58.946  1.00 30.61  ? 809 ILE B N     1 
ATOM   9704  C  CA    . ILE F 3 513 ? 6.622   55.022 -57.500  1.00 31.57  ? 809 ILE B CA    1 
ATOM   9705  C  C     . ILE F 3 513 ? 6.612   56.448 -56.956  1.00 31.14  ? 809 ILE B C     1 
ATOM   9706  O  O     . ILE F 3 513 ? 5.938   56.729 -55.964  1.00 30.41  ? 809 ILE B O     1 
ATOM   9707  C  CB    . ILE F 3 513 ? 7.916   54.305 -57.055  1.00 31.95  ? 809 ILE B CB    1 
ATOM   9708  C  CG1   . ILE F 3 513 ? 7.825   52.815 -57.401  1.00 32.91  ? 809 ILE B CG1   1 
ATOM   9709  C  CG2   . ILE F 3 513 ? 8.121   54.468 -55.567  1.00 32.50  ? 809 ILE B CG2   1 
ATOM   9710  C  CD1   . ILE F 3 513 ? 9.111   52.054 -57.120  1.00 33.37  ? 809 ILE B CD1   1 
ATOM   9711  N  N     . ASP F 3 514 ? 7.359   57.339 -57.595  1.00 31.42  ? 810 ASP B N     1 
ATOM   9712  C  CA    . ASP F 3 514 ? 7.405   58.741 -57.164  1.00 32.36  ? 810 ASP B CA    1 
ATOM   9713  C  C     . ASP F 3 514 ? 5.996   59.322 -57.177  1.00 32.83  ? 810 ASP B C     1 
ATOM   9714  O  O     . ASP F 3 514 ? 5.599   60.018 -56.246  1.00 32.93  ? 810 ASP B O     1 
ATOM   9715  C  CB    . ASP F 3 514 ? 8.297   59.567 -58.094  1.00 31.60  ? 810 ASP B CB    1 
ATOM   9716  C  CG    . ASP F 3 514 ? 9.783   59.413 -57.781  1.00 32.27  ? 810 ASP B CG    1 
ATOM   9717  O  OD1   . ASP F 3 514 ? 10.155  58.469 -57.034  1.00 31.86  ? 810 ASP B OD1   1 
ATOM   9718  O  OD2   . ASP F 3 514 ? 10.579  60.240 -58.287  1.00 30.31  ? 810 ASP B OD2   1 
ATOM   9719  N  N     . LEU F 3 515 ? 5.243   59.026 -58.236  1.00 33.72  ? 811 LEU B N     1 
ATOM   9720  C  CA    . LEU F 3 515 ? 3.882   59.529 -58.366  1.00 34.41  ? 811 LEU B CA    1 
ATOM   9721  C  C     . LEU F 3 515 ? 2.919   58.862 -57.397  1.00 34.94  ? 811 LEU B C     1 
ATOM   9722  O  O     . LEU F 3 515 ? 2.084   59.536 -56.797  1.00 35.13  ? 811 LEU B O     1 
ATOM   9723  C  CB    . LEU F 3 515 ? 3.369   59.341 -59.789  1.00 34.61  ? 811 LEU B CB    1 
ATOM   9724  C  CG    . LEU F 3 515 ? 1.920   59.780 -60.009  1.00 35.41  ? 811 LEU B CG    1 
ATOM   9725  C  CD1   . LEU F 3 515 ? 1.793   61.267 -59.760  1.00 35.10  ? 811 LEU B CD1   1 
ATOM   9726  C  CD2   . LEU F 3 515 ? 1.483   59.437 -61.424  1.00 36.33  ? 811 LEU B CD2   1 
ATOM   9727  N  N     . ASN F 3 516 ? 3.028   57.543 -57.247  1.00 34.76  ? 812 ASN B N     1 
ATOM   9728  C  CA    . ASN F 3 516 ? 2.150   56.807 -56.337  1.00 34.86  ? 812 ASN B CA    1 
ATOM   9729  C  C     . ASN F 3 516 ? 2.152   57.453 -54.955  1.00 34.88  ? 812 ASN B C     1 
ATOM   9730  O  O     . ASN F 3 516 ? 1.120   57.536 -54.275  1.00 34.41  ? 812 ASN B O     1 
ATOM   9731  C  CB    . ASN F 3 516 ? 2.604   55.356 -56.198  1.00 35.05  ? 812 ASN B CB    1 
ATOM   9732  C  CG    . ASN F 3 516 ? 1.729   54.575 -55.247  1.00 35.74  ? 812 ASN B CG    1 
ATOM   9733  O  OD1   . ASN F 3 516 ? 0.597   54.225 -55.579  1.00 36.68  ? 812 ASN B OD1   1 
ATOM   9734  N  ND2   . ASN F 3 516 ? 2.238   54.320 -54.044  1.00 35.96  ? 812 ASN B ND2   1 
ATOM   9735  N  N     . ALA F 3 517 ? 3.335   57.900 -54.554  1.00 34.39  ? 813 ALA B N     1 
ATOM   9736  C  CA    . ALA F 3 517 ? 3.536   58.553 -53.276  1.00 34.77  ? 813 ALA B CA    1 
ATOM   9737  C  C     . ALA F 3 517 ? 2.723   59.844 -53.230  1.00 35.43  ? 813 ALA B C     1 
ATOM   9738  O  O     . ALA F 3 517 ? 1.837   59.997 -52.389  1.00 34.41  ? 813 ALA B O     1 
ATOM   9739  C  CB    . ALA F 3 517 ? 5.006   58.861 -53.090  1.00 33.49  ? 813 ALA B CB    1 
ATOM   9740  N  N     . ARG F 3 518 ? 3.024   60.763 -54.144  1.00 35.88  ? 814 ARG B N     1 
ATOM   9741  C  CA    . ARG F 3 518 ? 2.319   62.039 -54.180  1.00 37.14  ? 814 ARG B CA    1 
ATOM   9742  C  C     . ARG F 3 518 ? 0.810   61.867 -54.162  1.00 36.79  ? 814 ARG B C     1 
ATOM   9743  O  O     . ARG F 3 518 ? 0.108   62.645 -53.525  1.00 37.52  ? 814 ARG B O     1 
ATOM   9744  C  CB    . ARG F 3 518 ? 2.733   62.852 -55.411  1.00 38.16  ? 814 ARG B CB    1 
ATOM   9745  C  CG    . ARG F 3 518 ? 4.148   63.413 -55.328  1.00 41.07  ? 814 ARG B CG    1 
ATOM   9746  C  CD    . ARG F 3 518 ? 4.354   64.564 -56.313  1.00 43.23  ? 814 ARG B CD    1 
ATOM   9747  N  NE    . ARG F 3 518 ? 3.479   65.701 -56.023  1.00 45.40  ? 814 ARG B NE    1 
ATOM   9748  C  CZ    . ARG F 3 518 ? 3.451   66.834 -56.726  1.00 46.71  ? 814 ARG B CZ    1 
ATOM   9749  N  NH1   . ARG F 3 518 ? 4.255   66.998 -57.769  1.00 46.68  ? 814 ARG B NH1   1 
ATOM   9750  N  NH2   . ARG F 3 518 ? 2.603   67.802 -56.394  1.00 47.26  ? 814 ARG B NH2   1 
ATOM   9751  N  N     . LEU F 3 519 ? 0.305   60.845 -54.848  1.00 36.80  ? 815 LEU B N     1 
ATOM   9752  C  CA    . LEU F 3 519 ? -1.133  60.615 -54.891  1.00 36.12  ? 815 LEU B CA    1 
ATOM   9753  C  C     . LEU F 3 519 ? -1.695  60.286 -53.514  1.00 36.56  ? 815 LEU B C     1 
ATOM   9754  O  O     . LEU F 3 519 ? -2.645  60.936 -53.054  1.00 36.47  ? 815 LEU B O     1 
ATOM   9755  C  CB    . LEU F 3 519 ? -1.471  59.508 -55.898  1.00 36.40  ? 815 LEU B CB    1 
ATOM   9756  C  CG    . LEU F 3 519 ? -1.224  59.886 -57.369  1.00 36.31  ? 815 LEU B CG    1 
ATOM   9757  C  CD1   . LEU F 3 519 ? -1.429  58.684 -58.273  1.00 36.49  ? 815 LEU B CD1   1 
ATOM   9758  C  CD2   . LEU F 3 519 ? -2.168  61.012 -57.774  1.00 36.18  ? 815 LEU B CD2   1 
ATOM   9759  N  N     . LYS F 3 520 ? -1.123  59.287 -52.848  1.00 36.22  ? 816 LYS B N     1 
ATOM   9760  C  CA    . LYS F 3 520 ? -1.599  58.928 -51.516  1.00 37.37  ? 816 LYS B CA    1 
ATOM   9761  C  C     . LYS F 3 520 ? -1.334  60.070 -50.553  1.00 37.50  ? 816 LYS B C     1 
ATOM   9762  O  O     . LYS F 3 520 ? -2.035  60.237 -49.554  1.00 37.88  ? 816 LYS B O     1 
ATOM   9763  C  CB    . LYS F 3 520 ? -0.912  57.653 -51.017  1.00 37.82  ? 816 LYS B CB    1 
ATOM   9764  C  CG    . LYS F 3 520 ? -1.380  56.401 -51.730  1.00 38.81  ? 816 LYS B CG    1 
ATOM   9765  C  CD    . LYS F 3 520 ? -1.055  55.141 -50.930  1.00 39.89  ? 816 LYS B CD    1 
ATOM   9766  C  CE    . LYS F 3 520 ? -1.388  53.902 -51.742  1.00 40.86  ? 816 LYS B CE    1 
ATOM   9767  N  NZ    . LYS F 3 520 ? -2.745  54.024 -52.358  1.00 41.96  ? 816 LYS B NZ    1 
ATOM   9768  N  N     . GLU F 3 521 ? -0.310  60.852 -50.863  1.00 37.72  ? 817 GLU B N     1 
ATOM   9769  C  CA    . GLU F 3 521 ? 0.059   62.001 -50.057  1.00 39.24  ? 817 GLU B CA    1 
ATOM   9770  C  C     . GLU F 3 521 ? -1.132  62.965 -49.932  1.00 39.32  ? 817 GLU B C     1 
ATOM   9771  O  O     . GLU F 3 521 ? -1.620  63.214 -48.831  1.00 39.30  ? 817 GLU B O     1 
ATOM   9772  C  CB    . GLU F 3 521 ? 1.238   62.724 -50.708  1.00 40.04  ? 817 GLU B CB    1 
ATOM   9773  C  CG    . GLU F 3 521 ? 1.878   63.777 -49.844  1.00 42.09  ? 817 GLU B CG    1 
ATOM   9774  C  CD    . GLU F 3 521 ? 2.675   63.179 -48.709  1.00 43.87  ? 817 GLU B CD    1 
ATOM   9775  O  OE1   . GLU F 3 521 ? 3.202   63.954 -47.879  1.00 44.69  ? 817 GLU B OE1   1 
ATOM   9776  O  OE2   . GLU F 3 521 ? 2.779   61.930 -48.648  1.00 45.66  ? 817 GLU B OE2   1 
ATOM   9777  N  N     . GLU F 3 522 ? -1.598  63.498 -51.063  1.00 40.02  ? 818 GLU B N     1 
ATOM   9778  C  CA    . GLU F 3 522 ? -2.731  64.441 -51.072  1.00 39.74  ? 818 GLU B CA    1 
ATOM   9779  C  C     . GLU F 3 522 ? -4.070  63.770 -50.839  1.00 39.14  ? 818 GLU B C     1 
ATOM   9780  O  O     . GLU F 3 522 ? -5.111  64.363 -51.083  1.00 38.95  ? 818 GLU B O     1 
ATOM   9781  C  CB    . GLU F 3 522 ? -2.825  65.188 -52.403  1.00 40.80  ? 818 GLU B CB    1 
ATOM   9782  C  CG    . GLU F 3 522 ? -1.915  66.374 -52.532  1.00 42.08  ? 818 GLU B CG    1 
ATOM   9783  C  CD    . GLU F 3 522 ? -0.492  65.959 -52.694  1.00 42.78  ? 818 GLU B CD    1 
ATOM   9784  O  OE1   . GLU F 3 522 ? -0.199  65.277 -53.699  1.00 43.71  ? 818 GLU B OE1   1 
ATOM   9785  O  OE2   . GLU F 3 522 ? 0.331   66.308 -51.821  1.00 44.19  ? 818 GLU B OE2   1 
ATOM   9786  N  N     . ARG F 3 523 ? -4.048  62.530 -50.381  1.00 39.27  ? 819 ARG B N     1 
ATOM   9787  C  CA    . ARG F 3 523 ? -5.290  61.810 -50.144  1.00 38.96  ? 819 ARG B CA    1 
ATOM   9788  C  C     . ARG F 3 523 ? -6.113  61.798 -51.432  1.00 37.68  ? 819 ARG B C     1 
ATOM   9789  O  O     . ARG F 3 523 ? -7.321  61.579 -51.392  1.00 38.13  ? 819 ARG B O     1 
ATOM   9790  C  CB    . ARG F 3 523 ? -6.109  62.487 -49.037  1.00 39.75  ? 819 ARG B CB    1 
ATOM   9791  C  CG    . ARG F 3 523 ? -5.345  62.865 -47.761  1.00 41.25  ? 819 ARG B CG    1 
ATOM   9792  C  CD    . ARG F 3 523 ? -5.055  61.661 -46.866  1.00 42.40  ? 819 ARG B CD    1 
ATOM   9793  N  NE    . ARG F 3 523 ? -5.070  62.020 -45.447  1.00 43.09  ? 819 ARG B NE    1 
ATOM   9794  C  CZ    . ARG F 3 523 ? -4.636  61.233 -44.464  1.00 43.73  ? 819 ARG B CZ    1 
ATOM   9795  N  NH1   . ARG F 3 523 ? -4.136  60.030 -44.736  1.00 44.29  ? 819 ARG B NH1   1 
ATOM   9796  N  NH2   . ARG F 3 523 ? -4.713  61.644 -43.203  1.00 43.59  ? 819 ARG B NH2   1 
ATOM   9797  N  N     . LEU F 3 524 ? -5.466  62.044 -52.569  1.00 36.34  ? 820 LEU B N     1 
ATOM   9798  C  CA    . LEU F 3 524 ? -6.170  62.046 -53.846  1.00 34.93  ? 820 LEU B CA    1 
ATOM   9799  C  C     . LEU F 3 524 ? -6.791  60.671 -54.077  1.00 33.88  ? 820 LEU B C     1 
ATOM   9800  O  O     . LEU F 3 524 ? -6.354  59.682 -53.498  1.00 33.87  ? 820 LEU B O     1 
ATOM   9801  C  CB    . LEU F 3 524 ? -5.216  62.382 -55.001  1.00 35.83  ? 820 LEU B CB    1 
ATOM   9802  C  CG    . LEU F 3 524 ? -4.626  63.795 -55.092  1.00 36.82  ? 820 LEU B CG    1 
ATOM   9803  C  CD1   . LEU F 3 524 ? -3.659  63.871 -56.271  1.00 36.60  ? 820 LEU B CD1   1 
ATOM   9804  C  CD2   . LEU F 3 524 ? -5.737  64.824 -55.257  1.00 36.86  ? 820 LEU B CD2   1 
ATOM   9805  N  N     . GLN F 3 525 ? -7.825  60.620 -54.906  1.00 32.56  ? 821 GLN B N     1 
ATOM   9806  C  CA    . GLN F 3 525 ? -8.498  59.367 -55.219  1.00 31.38  ? 821 GLN B CA    1 
ATOM   9807  C  C     . GLN F 3 525 ? -8.005  58.835 -56.556  1.00 31.08  ? 821 GLN B C     1 
ATOM   9808  O  O     . GLN F 3 525 ? -8.311  57.703 -56.933  1.00 31.43  ? 821 GLN B O     1 
ATOM   9809  C  CB    . GLN F 3 525 ? -10.012 59.564 -55.264  1.00 30.43  ? 821 GLN B CB    1 
ATOM   9810  C  CG    . GLN F 3 525 ? -10.719 59.343 -53.945  1.00 30.30  ? 821 GLN B CG    1 
ATOM   9811  C  CD    . GLN F 3 525 ? -12.204 59.634 -54.048  1.00 31.16  ? 821 GLN B CD    1 
ATOM   9812  O  OE1   . GLN F 3 525 ? -12.611 60.797 -54.089  1.00 31.27  ? 821 GLN B OE1   1 
ATOM   9813  N  NE2   . GLN F 3 525 ? -13.021 58.577 -54.127  1.00 30.55  ? 821 GLN B NE2   1 
ATOM   9814  N  N     . ALA F 3 526 ? -7.240  59.653 -57.273  1.00 31.18  ? 822 ALA B N     1 
ATOM   9815  C  CA    . ALA F 3 526 ? -6.690  59.231 -58.560  1.00 31.63  ? 822 ALA B CA    1 
ATOM   9816  C  C     . ALA F 3 526 ? -5.905  57.955 -58.297  1.00 31.60  ? 822 ALA B C     1 
ATOM   9817  O  O     . ALA F 3 526 ? -5.229  57.854 -57.285  1.00 31.92  ? 822 ALA B O     1 
ATOM   9818  C  CB    . ALA F 3 526 ? -5.755  60.289 -59.109  1.00 30.78  ? 822 ALA B CB    1 
ATOM   9819  N  N     . HIS F 3 527 ? -6.010  56.977 -59.185  1.00 32.93  ? 823 HIS B N     1 
ATOM   9820  C  CA    . HIS F 3 527 ? -5.250  55.741 -59.009  1.00 33.89  ? 823 HIS B CA    1 
ATOM   9821  C  C     . HIS F 3 527 ? -4.809  55.126 -60.336  1.00 33.93  ? 823 HIS B C     1 
ATOM   9822  O  O     . HIS F 3 527 ? -5.526  55.183 -61.340  1.00 34.26  ? 823 HIS B O     1 
ATOM   9823  C  CB    . HIS F 3 527 ? -6.043  54.738 -58.156  1.00 33.80  ? 823 HIS B CB    1 
ATOM   9824  C  CG    . HIS F 3 527 ? -7.299  54.228 -58.793  1.00 34.16  ? 823 HIS B CG    1 
ATOM   9825  N  ND1   . HIS F 3 527 ? -8.265  53.555 -58.076  1.00 35.36  ? 823 HIS B ND1   1 
ATOM   9826  C  CD2   . HIS F 3 527 ? -7.721  54.234 -60.076  1.00 35.22  ? 823 HIS B CD2   1 
ATOM   9827  C  CE1   . HIS F 3 527 ? -9.224  53.162 -58.893  1.00 35.61  ? 823 HIS B CE1   1 
ATOM   9828  N  NE2   . HIS F 3 527 ? -8.918  53.560 -60.114  1.00 35.83  ? 823 HIS B NE2   1 
ATOM   9829  N  N     . LEU F 3 528 ? -3.603  54.568 -60.349  1.00 34.38  ? 824 LEU B N     1 
ATOM   9830  C  CA    . LEU F 3 528 ? -3.071  53.957 -61.560  1.00 34.23  ? 824 LEU B CA    1 
ATOM   9831  C  C     . LEU F 3 528 ? -3.915  52.771 -61.986  1.00 34.08  ? 824 LEU B C     1 
ATOM   9832  O  O     . LEU F 3 528 ? -4.519  52.106 -61.150  1.00 35.06  ? 824 LEU B O     1 
ATOM   9833  C  CB    . LEU F 3 528 ? -1.625  53.507 -61.331  1.00 34.34  ? 824 LEU B CB    1 
ATOM   9834  C  CG    . LEU F 3 528 ? -0.636  54.659 -61.180  1.00 33.57  ? 824 LEU B CG    1 
ATOM   9835  C  CD1   . LEU F 3 528 ? 0.737   54.139 -60.759  1.00 34.96  ? 824 LEU B CD1   1 
ATOM   9836  C  CD2   . LEU F 3 528 ? -0.545  55.394 -62.502  1.00 34.81  ? 824 LEU B CD2   1 
ATOM   9837  N  N     . LEU F 3 529 ? -3.980  52.526 -63.290  1.00 34.11  ? 825 LEU B N     1 
ATOM   9838  C  CA    . LEU F 3 529 ? -4.729  51.392 -63.817  1.00 34.79  ? 825 LEU B CA    1 
ATOM   9839  C  C     . LEU F 3 529 ? -3.790  50.543 -64.654  1.00 34.99  ? 825 LEU B C     1 
ATOM   9840  O  O     . LEU F 3 529 ? -3.613  49.353 -64.404  1.00 35.49  ? 825 LEU B O     1 
ATOM   9841  C  CB    . LEU F 3 529 ? -5.891  51.847 -64.705  1.00 35.15  ? 825 LEU B CB    1 
ATOM   9842  C  CG    . LEU F 3 529 ? -7.113  52.490 -64.052  1.00 35.58  ? 825 LEU B CG    1 
ATOM   9843  C  CD1   . LEU F 3 529 ? -8.063  52.987 -65.130  1.00 35.35  ? 825 LEU B CD1   1 
ATOM   9844  C  CD2   . LEU F 3 529 ? -7.799  51.480 -63.141  1.00 36.06  ? 825 LEU B CD2   1 
ATOM   9845  N  N     . LEU F 3 530 ? -3.181  51.180 -65.647  1.00 35.49  ? 826 LEU B N     1 
ATOM   9846  C  CA    . LEU F 3 530 ? -2.277  50.505 -66.565  1.00 34.58  ? 826 LEU B CA    1 
ATOM   9847  C  C     . LEU F 3 530 ? -1.007  51.301 -66.838  1.00 34.11  ? 826 LEU B C     1 
ATOM   9848  O  O     . LEU F 3 530 ? -0.961  52.512 -66.630  1.00 34.35  ? 826 LEU B O     1 
ATOM   9849  C  CB    . LEU F 3 530 ? -2.988  50.280 -67.900  1.00 34.50  ? 826 LEU B CB    1 
ATOM   9850  C  CG    . LEU F 3 530 ? -4.404  49.706 -67.896  1.00 33.90  ? 826 LEU B CG    1 
ATOM   9851  C  CD1   . LEU F 3 530 ? -4.979  49.761 -69.307  1.00 33.44  ? 826 LEU B CD1   1 
ATOM   9852  C  CD2   . LEU F 3 530 ? -4.377  48.279 -67.384  1.00 34.45  ? 826 LEU B CD2   1 
ATOM   9853  N  N     . GLN F 3 531 ? 0.015   50.593 -67.313  1.00 33.43  ? 827 GLN B N     1 
ATOM   9854  C  CA    . GLN F 3 531 ? 1.295   51.175 -67.708  1.00 32.61  ? 827 GLN B CA    1 
ATOM   9855  C  C     . GLN F 3 531 ? 1.543   50.505 -69.049  1.00 32.69  ? 827 GLN B C     1 
ATOM   9856  O  O     . GLN F 3 531 ? 1.309   49.305 -69.193  1.00 33.58  ? 827 GLN B O     1 
ATOM   9857  C  CB    . GLN F 3 531 ? 2.417   50.814 -66.722  1.00 32.73  ? 827 GLN B CB    1 
ATOM   9858  C  CG    . GLN F 3 531 ? 3.804   51.386 -67.087  1.00 31.91  ? 827 GLN B CG    1 
ATOM   9859  C  CD    . GLN F 3 531 ? 4.751   50.346 -67.718  1.00 32.66  ? 827 GLN B CD    1 
ATOM   9860  O  OE1   . GLN F 3 531 ? 4.340   49.526 -68.541  1.00 32.39  ? 827 GLN B OE1   1 
ATOM   9861  N  NE2   . GLN F 3 531 ? 6.023   50.397 -67.338  1.00 32.65  ? 827 GLN B NE2   1 
ATOM   9862  N  N     . VAL F 3 532 ? 1.981   51.272 -70.037  1.00 32.31  ? 828 VAL B N     1 
ATOM   9863  C  CA    . VAL F 3 532 ? 2.239   50.723 -71.359  1.00 31.69  ? 828 VAL B CA    1 
ATOM   9864  C  C     . VAL F 3 532 ? 3.660   51.082 -71.807  1.00 31.32  ? 828 VAL B C     1 
ATOM   9865  O  O     . VAL F 3 532 ? 3.871   51.676 -72.864  1.00 31.08  ? 828 VAL B O     1 
ATOM   9866  C  CB    . VAL F 3 532 ? 1.182   51.227 -72.392  1.00 32.12  ? 828 VAL B CB    1 
ATOM   9867  C  CG1   . VAL F 3 532 ? 1.347   50.501 -73.716  1.00 32.40  ? 828 VAL B CG1   1 
ATOM   9868  C  CG2   . VAL F 3 532 ? -0.239  50.977 -71.863  1.00 31.70  ? 828 VAL B CG2   1 
ATOM   9869  N  N     . HIS F 3 533 ? 4.622   50.715 -70.962  1.00 30.67  ? 829 HIS B N     1 
ATOM   9870  C  CA    . HIS F 3 533 ? 6.059   50.917 -71.192  1.00 30.20  ? 829 HIS B CA    1 
ATOM   9871  C  C     . HIS F 3 533 ? 6.618   52.315 -71.008  1.00 30.77  ? 829 HIS B C     1 
ATOM   9872  O  O     . HIS F 3 533 ? 7.555   52.505 -70.239  1.00 30.55  ? 829 HIS B O     1 
ATOM   9873  C  CB    . HIS F 3 533 ? 6.440   50.354 -72.563  1.00 29.74  ? 829 HIS B CB    1 
ATOM   9874  C  CG    . HIS F 3 533 ? 6.205   48.879 -72.664  1.00 28.87  ? 829 HIS B CG    1 
ATOM   9875  N  ND1   . HIS F 3 533 ? 5.319   48.324 -73.559  1.00 29.08  ? 829 HIS B ND1   1 
ATOM   9876  C  CD2   . HIS F 3 533 ? 6.658   47.860 -71.899  1.00 28.28  ? 829 HIS B CD2   1 
ATOM   9877  C  CE1   . HIS F 3 533 ? 5.228   47.023 -73.337  1.00 28.82  ? 829 HIS B CE1   1 
ATOM   9878  N  NE2   . HIS F 3 533 ? 6.029   46.718 -72.335  1.00 28.76  ? 829 HIS B NE2   1 
ATOM   9879  N  N     . ASP F 3 534 ? 6.072   53.302 -71.710  1.00 31.85  ? 830 ASP B N     1 
ATOM   9880  C  CA    . ASP F 3 534 ? 6.571   54.656 -71.532  1.00 31.68  ? 830 ASP B CA    1 
ATOM   9881  C  C     . ASP F 3 534 ? 5.437   55.580 -71.126  1.00 32.52  ? 830 ASP B C     1 
ATOM   9882  O  O     . ASP F 3 534 ? 5.640   56.775 -70.902  1.00 31.98  ? 830 ASP B O     1 
ATOM   9883  C  CB    . ASP F 3 534 ? 7.221   55.169 -72.814  1.00 32.18  ? 830 ASP B CB    1 
ATOM   9884  C  CG    . ASP F 3 534 ? 6.216   55.431 -73.921  1.00 30.92  ? 830 ASP B CG    1 
ATOM   9885  O  OD1   . ASP F 3 534 ? 6.539   56.227 -74.808  1.00 31.70  ? 830 ASP B OD1   1 
ATOM   9886  O  OD2   . ASP F 3 534 ? 5.117   54.845 -73.926  1.00 31.81  ? 830 ASP B OD2   1 
ATOM   9887  N  N     . GLU F 3 535 ? 4.241   55.015 -71.017  1.00 33.30  ? 831 GLU B N     1 
ATOM   9888  C  CA    . GLU F 3 535 ? 3.075   55.799 -70.641  1.00 33.66  ? 831 GLU B CA    1 
ATOM   9889  C  C     . GLU F 3 535 ? 2.398   55.242 -69.391  1.00 33.59  ? 831 GLU B C     1 
ATOM   9890  O  O     . GLU F 3 535 ? 2.556   54.058 -69.037  1.00 34.32  ? 831 GLU B O     1 
ATOM   9891  C  CB    . GLU F 3 535 ? 2.083   55.836 -71.808  1.00 34.11  ? 831 GLU B CB    1 
ATOM   9892  C  CG    . GLU F 3 535 ? 1.438   54.499 -72.100  1.00 35.26  ? 831 GLU B CG    1 
ATOM   9893  C  CD    . GLU F 3 535 ? 0.876   54.402 -73.497  1.00 35.47  ? 831 GLU B CD    1 
ATOM   9894  O  OE1   . GLU F 3 535 ? 1.670   54.380 -74.468  1.00 37.48  ? 831 GLU B OE1   1 
ATOM   9895  O  OE2   . GLU F 3 535 ? -0.358  54.343 -73.627  1.00 35.83  ? 831 GLU B OE2   1 
ATOM   9896  N  N     . LEU F 3 536 ? 1.655   56.110 -68.715  1.00 32.76  ? 832 LEU B N     1 
ATOM   9897  C  CA    . LEU F 3 536 ? 0.928   55.753 -67.506  1.00 32.35  ? 832 LEU B CA    1 
ATOM   9898  C  C     . LEU F 3 536 ? -0.527  56.146 -67.677  1.00 32.57  ? 832 LEU B C     1 
ATOM   9899  O  O     . LEU F 3 536 ? -0.839  57.283 -68.045  1.00 31.68  ? 832 LEU B O     1 
ATOM   9900  C  CB    . LEU F 3 536 ? 1.513   56.470 -66.290  1.00 32.01  ? 832 LEU B CB    1 
ATOM   9901  C  CG    . LEU F 3 536 ? 2.889   55.991 -65.833  1.00 32.40  ? 832 LEU B CG    1 
ATOM   9902  C  CD1   . LEU F 3 536 ? 3.448   56.921 -64.749  1.00 31.16  ? 832 LEU B CD1   1 
ATOM   9903  C  CD2   . LEU F 3 536 ? 2.768   54.544 -65.350  1.00 30.65  ? 832 LEU B CD2   1 
ATOM   9904  N  N     . ILE F 3 537 ? -1.411  55.192 -67.416  1.00 32.40  ? 833 ILE B N     1 
ATOM   9905  C  CA    . ILE F 3 537 ? -2.832  55.416 -67.550  1.00 32.45  ? 833 ILE B CA    1 
ATOM   9906  C  C     . ILE F 3 537 ? -3.531  55.354 -66.197  1.00 32.05  ? 833 ILE B C     1 
ATOM   9907  O  O     . ILE F 3 537 ? -3.237  54.490 -65.371  1.00 31.14  ? 833 ILE B O     1 
ATOM   9908  C  CB    . ILE F 3 537 ? -3.435  54.382 -68.513  1.00 33.11  ? 833 ILE B CB    1 
ATOM   9909  C  CG1   . ILE F 3 537 ? -2.870  54.622 -69.917  1.00 33.33  ? 833 ILE B CG1   1 
ATOM   9910  C  CG2   . ILE F 3 537 ? -4.960  54.477 -68.516  1.00 33.22  ? 833 ILE B CG2   1 
ATOM   9911  C  CD1   . ILE F 3 537 ? -3.282  53.597 -70.917  1.00 33.11  ? 833 ILE B CD1   1 
ATOM   9912  N  N     . LEU F 3 538 ? -4.432  56.302 -65.962  1.00 31.59  ? 834 LEU B N     1 
ATOM   9913  C  CA    . LEU F 3 538 ? -5.183  56.340 -64.712  1.00 31.71  ? 834 LEU B CA    1 
ATOM   9914  C  C     . LEU F 3 538 ? -6.584  56.890 -64.828  1.00 31.37  ? 834 LEU B C     1 
ATOM   9915  O  O     . LEU F 3 538 ? -6.971  57.445 -65.858  1.00 31.49  ? 834 LEU B O     1 
ATOM   9916  C  CB    . LEU F 3 538 ? -4.434  57.118 -63.622  1.00 31.85  ? 834 LEU B CB    1 
ATOM   9917  C  CG    . LEU F 3 538 ? -3.558  58.342 -63.831  1.00 32.15  ? 834 LEU B CG    1 
ATOM   9918  C  CD1   . LEU F 3 538 ? -2.971  58.717 -62.472  1.00 32.93  ? 834 LEU B CD1   1 
ATOM   9919  C  CD2   . LEU F 3 538 ? -2.427  58.044 -64.794  1.00 32.18  ? 834 LEU B CD2   1 
ATOM   9920  N  N     . GLU F 3 539 ? -7.350  56.704 -63.762  1.00 31.00  ? 835 GLU B N     1 
ATOM   9921  C  CA    . GLU F 3 539 ? -8.715  57.190 -63.711  1.00 30.81  ? 835 GLU B CA    1 
ATOM   9922  C  C     . GLU F 3 539 ? -8.864  57.983 -62.415  1.00 30.97  ? 835 GLU B C     1 
ATOM   9923  O  O     . GLU F 3 539 ? -8.265  57.631 -61.403  1.00 30.20  ? 835 GLU B O     1 
ATOM   9924  C  CB    . GLU F 3 539 ? -9.703  56.021 -63.762  1.00 29.05  ? 835 GLU B CB    1 
ATOM   9925  C  CG    . GLU F 3 539 ? -9.900  55.271 -62.463  1.00 28.52  ? 835 GLU B CG    1 
ATOM   9926  C  CD    . GLU F 3 539 ? -10.951 54.186 -62.597  1.00 27.25  ? 835 GLU B CD    1 
ATOM   9927  O  OE1   . GLU F 3 539 ? -11.739 54.266 -63.551  1.00 27.41  ? 835 GLU B OE1   1 
ATOM   9928  O  OE2   . GLU F 3 539 ? -10.996 53.263 -61.758  1.00 27.25  ? 835 GLU B OE2   1 
ATOM   9929  N  N     . ALA F 3 540 ? -9.650  59.059 -62.454  1.00 31.27  ? 836 ALA B N     1 
ATOM   9930  C  CA    . ALA F 3 540 ? -9.839  59.905 -61.286  1.00 31.89  ? 836 ALA B CA    1 
ATOM   9931  C  C     . ALA F 3 540 ? -11.070 60.794 -61.435  1.00 32.90  ? 836 ALA B C     1 
ATOM   9932  O  O     . ALA F 3 540 ? -11.539 61.025 -62.546  1.00 31.38  ? 836 ALA B O     1 
ATOM   9933  C  CB    . ALA F 3 540 ? -8.607  60.776 -61.079  1.00 31.65  ? 836 ALA B CB    1 
ATOM   9934  N  N     . PRO F 3 541 ? -11.607 61.297 -60.305  1.00 34.11  ? 837 PRO B N     1 
ATOM   9935  C  CA    . PRO F 3 541 ? -12.790 62.172 -60.295  1.00 35.90  ? 837 PRO B CA    1 
ATOM   9936  C  C     . PRO F 3 541 ? -12.521 63.487 -61.036  1.00 36.92  ? 837 PRO B C     1 
ATOM   9937  O  O     . PRO F 3 541 ? -11.401 64.006 -61.013  1.00 36.25  ? 837 PRO B O     1 
ATOM   9938  C  CB    . PRO F 3 541 ? -13.044 62.399 -58.803  1.00 35.58  ? 837 PRO B CB    1 
ATOM   9939  C  CG    . PRO F 3 541 ? -12.540 61.124 -58.178  1.00 35.03  ? 837 PRO B CG    1 
ATOM   9940  C  CD    . PRO F 3 541 ? -11.244 60.895 -58.934  1.00 34.38  ? 837 PRO B CD    1 
ATOM   9941  N  N     . LYS F 3 542 ? -13.552 64.021 -61.686  1.00 38.80  ? 838 LYS B N     1 
ATOM   9942  C  CA    . LYS F 3 542 ? -13.426 65.273 -62.431  1.00 40.09  ? 838 LYS B CA    1 
ATOM   9943  C  C     . LYS F 3 542 ? -12.681 66.337 -61.633  1.00 40.54  ? 838 LYS B C     1 
ATOM   9944  O  O     . LYS F 3 542 ? -11.871 67.091 -62.181  1.00 40.63  ? 838 LYS B O     1 
ATOM   9945  C  CB    . LYS F 3 542 ? -14.811 65.818 -62.800  1.00 41.65  ? 838 LYS B CB    1 
ATOM   9946  C  CG    . LYS F 3 542 ? -15.486 65.130 -63.975  1.00 43.45  ? 838 LYS B CG    1 
ATOM   9947  C  CD    . LYS F 3 542 ? -16.672 65.956 -64.457  1.00 44.67  ? 838 LYS B CD    1 
ATOM   9948  C  CE    . LYS F 3 542 ? -17.342 65.348 -65.685  1.00 46.07  ? 838 LYS B CE    1 
ATOM   9949  N  NZ    . LYS F 3 542 ? -18.485 66.201 -66.154  1.00 47.00  ? 838 LYS B NZ    1 
ATOM   9950  N  N     . GLU F 3 543 ? -12.965 66.380 -60.335  1.00 40.68  ? 839 GLU B N     1 
ATOM   9951  C  CA    . GLU F 3 543 ? -12.378 67.351 -59.413  1.00 41.03  ? 839 GLU B CA    1 
ATOM   9952  C  C     . GLU F 3 543 ? -10.848 67.306 -59.354  1.00 40.60  ? 839 GLU B C     1 
ATOM   9953  O  O     . GLU F 3 543 ? -10.193 68.310 -59.053  1.00 40.13  ? 839 GLU B O     1 
ATOM   9954  C  CB    . GLU F 3 543 ? -12.945 67.114 -58.006  1.00 42.56  ? 839 GLU B CB    1 
ATOM   9955  C  CG    . GLU F 3 543 ? -14.256 66.313 -57.982  1.00 44.61  ? 839 GLU B CG    1 
ATOM   9956  C  CD    . GLU F 3 543 ? -14.473 65.593 -56.655  1.00 46.47  ? 839 GLU B CD    1 
ATOM   9957  O  OE1   . GLU F 3 543 ? -13.614 64.768 -56.279  1.00 47.44  ? 839 GLU B OE1   1 
ATOM   9958  O  OE2   . GLU F 3 543 ? -15.496 65.848 -55.981  1.00 47.78  ? 839 GLU B OE2   1 
ATOM   9959  N  N     . GLU F 3 544 ? -10.279 66.141 -59.652  1.00 40.36  ? 840 GLU B N     1 
ATOM   9960  C  CA    . GLU F 3 544 ? -8.834  65.961 -59.592  1.00 39.73  ? 840 GLU B CA    1 
ATOM   9961  C  C     . GLU F 3 544 ? -8.047  66.270 -60.862  1.00 39.37  ? 840 GLU B C     1 
ATOM   9962  O  O     . GLU F 3 544 ? -6.821  66.396 -60.808  1.00 38.93  ? 840 GLU B O     1 
ATOM   9963  C  CB    . GLU F 3 544 ? -8.515  64.532 -59.136  1.00 39.80  ? 840 GLU B CB    1 
ATOM   9964  C  CG    . GLU F 3 544 ? -8.997  64.228 -57.726  1.00 40.10  ? 840 GLU B CG    1 
ATOM   9965  C  CD    . GLU F 3 544 ? -8.063  63.300 -56.963  1.00 39.86  ? 840 GLU B CD    1 
ATOM   9966  O  OE1   . GLU F 3 544 ? -8.286  63.101 -55.750  1.00 39.67  ? 840 GLU B OE1   1 
ATOM   9967  O  OE2   . GLU F 3 544 ? -7.107  62.779 -57.570  1.00 39.47  ? 840 GLU B OE2   1 
ATOM   9968  N  N     . MET F 3 545 ? -8.736  66.398 -61.993  1.00 39.12  ? 841 MET B N     1 
ATOM   9969  C  CA    . MET F 3 545 ? -8.065  66.676 -63.260  1.00 38.74  ? 841 MET B CA    1 
ATOM   9970  C  C     . MET F 3 545 ? -7.107  67.870 -63.191  1.00 38.32  ? 841 MET B C     1 
ATOM   9971  O  O     . MET F 3 545 ? -5.964  67.783 -63.648  1.00 37.79  ? 841 MET B O     1 
ATOM   9972  C  CB    . MET F 3 545 ? -9.094  66.901 -64.375  1.00 39.24  ? 841 MET B CB    1 
ATOM   9973  C  CG    . MET F 3 545 ? -9.891  65.657 -64.795  1.00 40.62  ? 841 MET B CG    1 
ATOM   9974  S  SD    . MET F 3 545 ? -8.902  64.266 -65.463  1.00 40.22  ? 841 MET B SD    1 
ATOM   9975  C  CE    . MET F 3 545 ? -8.545  63.426 -63.935  1.00 40.99  ? 841 MET B CE    1 
ATOM   9976  N  N     . GLU F 3 546 ? -7.550  68.979 -62.609  1.00 37.50  ? 842 GLU B N     1 
ATOM   9977  C  CA    . GLU F 3 546 ? -6.681  70.155 -62.537  1.00 36.46  ? 842 GLU B CA    1 
ATOM   9978  C  C     . GLU F 3 546 ? -5.311  69.824 -61.943  1.00 35.86  ? 842 GLU B C     1 
ATOM   9979  O  O     . GLU F 3 546 ? -4.289  69.924 -62.625  1.00 33.57  ? 842 GLU B O     1 
ATOM   9980  C  CB    . GLU F 3 546 ? -7.345  71.277 -61.735  1.00 36.50  ? 842 GLU B CB    1 
ATOM   9981  C  CG    . GLU F 3 546 ? -8.551  71.899 -62.431  1.00 36.93  ? 842 GLU B CG    1 
ATOM   9982  C  CD    . GLU F 3 546 ? -8.199  72.553 -63.759  1.00 37.18  ? 842 GLU B CD    1 
ATOM   9983  O  OE1   . GLU F 3 546 ? -7.411  73.526 -63.769  1.00 37.44  ? 842 GLU B OE1   1 
ATOM   9984  O  OE2   . GLU F 3 546 ? -8.705  72.092 -64.802  1.00 36.80  ? 842 GLU B OE2   1 
ATOM   9985  N  N     . ARG F 3 547 ? -5.283  69.434 -60.675  1.00 35.41  ? 843 ARG B N     1 
ATOM   9986  C  CA    . ARG F 3 547 ? -4.008  69.111 -60.069  1.00 36.17  ? 843 ARG B CA    1 
ATOM   9987  C  C     . ARG F 3 547 ? -3.343  67.962 -60.817  1.00 34.71  ? 843 ARG B C     1 
ATOM   9988  O  O     . ARG F 3 547 ? -2.141  67.978 -61.028  1.00 33.99  ? 843 ARG B O     1 
ATOM   9989  C  CB    . ARG F 3 547 ? -4.163  68.733 -58.598  1.00 37.65  ? 843 ARG B CB    1 
ATOM   9990  C  CG    . ARG F 3 547 ? -2.825  68.451 -57.931  1.00 39.91  ? 843 ARG B CG    1 
ATOM   9991  C  CD    . ARG F 3 547 ? -2.981  68.251 -56.448  1.00 42.37  ? 843 ARG B CD    1 
ATOM   9992  N  NE    . ARG F 3 547 ? -3.197  69.510 -55.743  1.00 44.52  ? 843 ARG B NE    1 
ATOM   9993  C  CZ    . ARG F 3 547 ? -3.933  69.624 -54.641  1.00 45.15  ? 843 ARG B CZ    1 
ATOM   9994  N  NH1   . ARG F 3 547 ? -4.525  68.548 -54.132  1.00 45.13  ? 843 ARG B NH1   1 
ATOM   9995  N  NH2   . ARG F 3 547 ? -4.071  70.806 -54.049  1.00 44.04  ? 843 ARG B NH2   1 
ATOM   9996  N  N     . LEU F 3 548 ? -4.137  66.979 -61.223  1.00 34.52  ? 844 LEU B N     1 
ATOM   9997  C  CA    . LEU F 3 548 ? -3.604  65.824 -61.933  1.00 35.09  ? 844 LEU B CA    1 
ATOM   9998  C  C     . LEU F 3 548 ? -2.929  66.278 -63.234  1.00 35.35  ? 844 LEU B C     1 
ATOM   9999  O  O     . LEU F 3 548 ? -2.040  65.596 -63.749  1.00 35.31  ? 844 LEU B O     1 
ATOM   10000 C  CB    . LEU F 3 548 ? -4.728  64.807 -62.200  1.00 34.37  ? 844 LEU B CB    1 
ATOM   10001 C  CG    . LEU F 3 548 ? -4.438  63.314 -61.970  1.00 34.39  ? 844 LEU B CG    1 
ATOM   10002 C  CD1   . LEU F 3 548 ? -3.895  63.082 -60.579  1.00 33.54  ? 844 LEU B CD1   1 
ATOM   10003 C  CD2   . LEU F 3 548 ? -5.709  62.502 -62.174  1.00 34.11  ? 844 LEU B CD2   1 
ATOM   10004 N  N     . CYS F 3 549 ? -3.333  67.442 -63.749  1.00 34.75  ? 845 CYS B N     1 
ATOM   10005 C  CA    . CYS F 3 549 ? -2.737  67.983 -64.966  1.00 34.51  ? 845 CYS B CA    1 
ATOM   10006 C  C     . CYS F 3 549 ? -1.357  68.545 -64.691  1.00 34.40  ? 845 CYS B C     1 
ATOM   10007 O  O     . CYS F 3 549 ? -0.525  68.657 -65.590  1.00 33.85  ? 845 CYS B O     1 
ATOM   10008 C  CB    . CYS F 3 549 ? -3.614  69.087 -65.565  1.00 34.54  ? 845 CYS B CB    1 
ATOM   10009 S  SG    . CYS F 3 549 ? -4.979  68.447 -66.499  1.00 35.06  ? 845 CYS B SG    1 
ATOM   10010 N  N     . ARG F 3 550 ? -1.113  68.905 -63.441  1.00 34.60  ? 846 ARG B N     1 
ATOM   10011 C  CA    . ARG F 3 550 ? 0.179   69.453 -63.065  1.00 35.19  ? 846 ARG B CA    1 
ATOM   10012 C  C     . ARG F 3 550 ? 1.016   68.380 -62.363  1.00 35.28  ? 846 ARG B C     1 
ATOM   10013 O  O     . ARG F 3 550 ? 2.231   68.314 -62.536  1.00 35.57  ? 846 ARG B O     1 
ATOM   10014 C  CB    . ARG F 3 550 ? -0.020  70.648 -62.135  1.00 36.10  ? 846 ARG B CB    1 
ATOM   10015 C  CG    . ARG F 3 550 ? 1.103   71.663 -62.166  1.00 37.94  ? 846 ARG B CG    1 
ATOM   10016 C  CD    . ARG F 3 550 ? 0.834   72.826 -61.216  1.00 39.61  ? 846 ARG B CD    1 
ATOM   10017 N  NE    . ARG F 3 550 ? 1.898   73.829 -61.270  1.00 41.42  ? 846 ARG B NE    1 
ATOM   10018 C  CZ    . ARG F 3 550 ? 2.228   74.506 -62.365  1.00 42.15  ? 846 ARG B CZ    1 
ATOM   10019 N  NH1   . ARG F 3 550 ? 1.577   74.292 -63.499  1.00 43.26  ? 846 ARG B NH1   1 
ATOM   10020 N  NH2   . ARG F 3 550 ? 3.213   75.393 -62.332  1.00 43.90  ? 846 ARG B NH2   1 
ATOM   10021 N  N     . LEU F 3 551 ? 0.353   67.533 -61.585  1.00 35.19  ? 847 LEU B N     1 
ATOM   10022 C  CA    . LEU F 3 551 ? 1.030   66.478 -60.830  1.00 35.01  ? 847 LEU B CA    1 
ATOM   10023 C  C     . LEU F 3 551 ? 1.733   65.401 -61.658  1.00 34.63  ? 847 LEU B C     1 
ATOM   10024 O  O     . LEU F 3 551 ? 2.944   65.204 -61.526  1.00 34.66  ? 847 LEU B O     1 
ATOM   10025 C  CB    . LEU F 3 551 ? 0.035   65.817 -59.869  1.00 35.64  ? 847 LEU B CB    1 
ATOM   10026 C  CG    . LEU F 3 551 ? 0.415   64.490 -59.187  1.00 36.32  ? 847 LEU B CG    1 
ATOM   10027 C  CD1   . LEU F 3 551 ? 1.599   64.698 -58.267  1.00 35.65  ? 847 LEU B CD1   1 
ATOM   10028 C  CD2   . LEU F 3 551 ? -0.776  63.966 -58.395  1.00 36.10  ? 847 LEU B CD2   1 
ATOM   10029 N  N     . VAL F 3 552 ? 0.987   64.704 -62.507  1.00 34.54  ? 848 VAL B N     1 
ATOM   10030 C  CA    . VAL F 3 552 ? 1.573   63.632 -63.303  1.00 35.26  ? 848 VAL B CA    1 
ATOM   10031 C  C     . VAL F 3 552 ? 2.760   64.017 -64.186  1.00 35.31  ? 848 VAL B C     1 
ATOM   10032 O  O     . VAL F 3 552 ? 3.872   63.528 -63.975  1.00 34.35  ? 848 VAL B O     1 
ATOM   10033 C  CB    . VAL F 3 552 ? 0.506   62.927 -64.169  1.00 35.16  ? 848 VAL B CB    1 
ATOM   10034 C  CG1   . VAL F 3 552 ? 1.153   61.793 -64.960  1.00 35.44  ? 848 VAL B CG1   1 
ATOM   10035 C  CG2   . VAL F 3 552 ? -0.597  62.378 -63.279  1.00 35.33  ? 848 VAL B CG2   1 
ATOM   10036 N  N     . PRO F 3 553 ? 2.554   64.896 -65.184  1.00 35.41  ? 849 PRO B N     1 
ATOM   10037 C  CA    . PRO F 3 553 ? 3.698   65.257 -66.030  1.00 35.49  ? 849 PRO B CA    1 
ATOM   10038 C  C     . PRO F 3 553 ? 4.956   65.759 -65.304  1.00 35.81  ? 849 PRO B C     1 
ATOM   10039 O  O     . PRO F 3 553 ? 6.069   65.526 -65.779  1.00 36.09  ? 849 PRO B O     1 
ATOM   10040 C  CB    . PRO F 3 553 ? 3.107   66.288 -67.007  1.00 35.12  ? 849 PRO B CB    1 
ATOM   10041 C  CG    . PRO F 3 553 ? 1.930   66.849 -66.256  1.00 35.77  ? 849 PRO B CG    1 
ATOM   10042 C  CD    . PRO F 3 553 ? 1.343   65.623 -65.601  1.00 35.71  ? 849 PRO B CD    1 
ATOM   10043 N  N     . GLU F 3 554 ? 4.808   66.419 -64.157  1.00 35.48  ? 850 GLU B N     1 
ATOM   10044 C  CA    . GLU F 3 554 ? 5.993   66.900 -63.447  1.00 35.63  ? 850 GLU B CA    1 
ATOM   10045 C  C     . GLU F 3 554 ? 6.695   65.784 -62.673  1.00 34.97  ? 850 GLU B C     1 
ATOM   10046 O  O     . GLU F 3 554 ? 7.921   65.818 -62.488  1.00 34.58  ? 850 GLU B O     1 
ATOM   10047 C  CB    . GLU F 3 554 ? 5.643   68.026 -62.478  1.00 37.82  ? 850 GLU B CB    1 
ATOM   10048 C  CG    . GLU F 3 554 ? 4.738   67.617 -61.338  1.00 39.96  ? 850 GLU B CG    1 
ATOM   10049 C  CD    . GLU F 3 554 ? 5.005   68.424 -60.077  1.00 41.20  ? 850 GLU B CD    1 
ATOM   10050 O  OE1   . GLU F 3 554 ? 5.944   68.061 -59.331  1.00 41.95  ? 850 GLU B OE1   1 
ATOM   10051 O  OE2   . GLU F 3 554 ? 4.287   69.418 -59.841  1.00 40.49  ? 850 GLU B OE2   1 
ATOM   10052 N  N     . VAL F 3 555 ? 5.922   64.805 -62.215  1.00 33.47  ? 851 VAL B N     1 
ATOM   10053 C  CA    . VAL F 3 555 ? 6.485   63.680 -61.481  1.00 33.07  ? 851 VAL B CA    1 
ATOM   10054 C  C     . VAL F 3 555 ? 7.202   62.789 -62.488  1.00 32.85  ? 851 VAL B C     1 
ATOM   10055 O  O     . VAL F 3 555 ? 8.355   62.396 -62.272  1.00 33.63  ? 851 VAL B O     1 
ATOM   10056 C  CB    . VAL F 3 555 ? 5.387   62.875 -60.751  1.00 33.61  ? 851 VAL B CB    1 
ATOM   10057 C  CG1   . VAL F 3 555 ? 5.975   61.586 -60.166  1.00 33.18  ? 851 VAL B CG1   1 
ATOM   10058 C  CG2   . VAL F 3 555 ? 4.791   63.716 -59.642  1.00 32.00  ? 851 VAL B CG2   1 
ATOM   10059 N  N     . MET F 3 556 ? 6.519   62.483 -63.592  1.00 32.26  ? 852 MET B N     1 
ATOM   10060 C  CA    . MET F 3 556 ? 7.102   61.659 -64.649  1.00 31.53  ? 852 MET B CA    1 
ATOM   10061 C  C     . MET F 3 556 ? 8.327   62.362 -65.252  1.00 30.71  ? 852 MET B C     1 
ATOM   10062 O  O     . MET F 3 556 ? 9.372   61.750 -65.410  1.00 30.18  ? 852 MET B O     1 
ATOM   10063 C  CB    . MET F 3 556 ? 6.063   61.366 -65.750  1.00 31.52  ? 852 MET B CB    1 
ATOM   10064 C  CG    . MET F 3 556 ? 4.848   60.569 -65.285  1.00 32.25  ? 852 MET B CG    1 
ATOM   10065 S  SD    . MET F 3 556 ? 3.639   60.171 -66.597  1.00 35.75  ? 852 MET B SD    1 
ATOM   10066 C  CE    . MET F 3 556 ? 4.592   59.040 -67.633  1.00 33.90  ? 852 MET B CE    1 
ATOM   10067 N  N     . GLU F 3 557 ? 8.202   63.653 -65.558  1.00 29.81  ? 853 GLU B N     1 
ATOM   10068 C  CA    . GLU F 3 557 ? 9.296   64.420 -66.153  1.00 29.71  ? 853 GLU B CA    1 
ATOM   10069 C  C     . GLU F 3 557 ? 10.522  64.563 -65.267  1.00 29.33  ? 853 GLU B C     1 
ATOM   10070 O  O     . GLU F 3 557 ? 11.643  64.646 -65.764  1.00 28.36  ? 853 GLU B O     1 
ATOM   10071 C  CB    . GLU F 3 557 ? 8.813   65.824 -66.566  1.00 30.41  ? 853 GLU B CB    1 
ATOM   10072 C  CG    . GLU F 3 557 ? 7.884   65.825 -67.775  1.00 32.46  ? 853 GLU B CG    1 
ATOM   10073 C  CD    . GLU F 3 557 ? 7.149   67.151 -67.971  1.00 34.24  ? 853 GLU B CD    1 
ATOM   10074 O  OE1   . GLU F 3 557 ? 6.245   67.206 -68.841  1.00 34.61  ? 853 GLU B OE1   1 
ATOM   10075 O  OE2   . GLU F 3 557 ? 7.475   68.128 -67.259  1.00 34.97  ? 853 GLU B OE2   1 
ATOM   10076 N  N     . GLN F 3 558 ? 10.315  64.609 -63.956  1.00 29.76  ? 854 GLN B N     1 
ATOM   10077 C  CA    . GLN F 3 558 ? 11.426  64.746 -63.029  1.00 30.23  ? 854 GLN B CA    1 
ATOM   10078 C  C     . GLN F 3 558 ? 11.833  63.404 -62.413  1.00 30.24  ? 854 GLN B C     1 
ATOM   10079 O  O     . GLN F 3 558 ? 12.529  63.368 -61.400  1.00 29.62  ? 854 GLN B O     1 
ATOM   10080 C  CB    . GLN F 3 558 ? 11.061  65.728 -61.917  1.00 31.32  ? 854 GLN B CB    1 
ATOM   10081 C  CG    . GLN F 3 558 ? 10.869  67.177 -62.380  1.00 33.08  ? 854 GLN B CG    1 
ATOM   10082 C  CD    . GLN F 3 558 ? 12.161  67.820 -62.889  1.00 33.54  ? 854 GLN B CD    1 
ATOM   10083 O  OE1   . GLN F 3 558 ? 13.266  67.443 -62.474  1.00 33.88  ? 854 GLN B OE1   1 
ATOM   10084 N  NE2   . GLN F 3 558 ? 12.024  68.804 -63.776  1.00 32.80  ? 854 GLN B NE2   1 
ATOM   10085 N  N     . ALA F 3 559 ? 11.378  62.311 -63.019  1.00 31.00  ? 855 ALA B N     1 
ATOM   10086 C  CA    . ALA F 3 559 ? 11.684  60.956 -62.538  1.00 31.30  ? 855 ALA B CA    1 
ATOM   10087 C  C     . ALA F 3 559 ? 13.190  60.801 -62.358  1.00 31.69  ? 855 ALA B C     1 
ATOM   10088 O  O     . ALA F 3 559 ? 13.662  60.157 -61.418  1.00 32.67  ? 855 ALA B O     1 
ATOM   10089 C  CB    . ALA F 3 559 ? 11.161  59.928 -63.534  1.00 31.20  ? 855 ALA B CB    1 
ATOM   10090 N  N     . VAL F 3 560 ? 13.937  61.376 -63.290  1.00 31.91  ? 856 VAL B N     1 
ATOM   10091 C  CA    . VAL F 3 560 ? 15.391  61.367 -63.243  1.00 31.82  ? 856 VAL B CA    1 
ATOM   10092 C  C     . VAL F 3 560 ? 15.851  62.693 -63.825  1.00 32.63  ? 856 VAL B C     1 
ATOM   10093 O  O     . VAL F 3 560 ? 15.039  63.483 -64.326  1.00 32.74  ? 856 VAL B O     1 
ATOM   10094 C  CB    . VAL F 3 560 ? 16.004  60.202 -64.071  1.00 32.06  ? 856 VAL B CB    1 
ATOM   10095 C  CG1   . VAL F 3 560 ? 15.616  58.852 -63.452  1.00 30.14  ? 856 VAL B CG1   1 
ATOM   10096 C  CG2   . VAL F 3 560 ? 15.540  60.279 -65.521  1.00 31.40  ? 856 VAL B CG2   1 
ATOM   10097 N  N     . THR F 3 561 ? 17.144  62.962 -63.740  1.00 32.30  ? 857 THR B N     1 
ATOM   10098 C  CA    . THR F 3 561 ? 17.671  64.194 -64.292  1.00 32.83  ? 857 THR B CA    1 
ATOM   10099 C  C     . THR F 3 561 ? 18.716  63.793 -65.319  1.00 32.82  ? 857 THR B C     1 
ATOM   10100 O  O     . THR F 3 561 ? 19.796  63.316 -64.958  1.00 33.41  ? 857 THR B O     1 
ATOM   10101 C  CB    . THR F 3 561 ? 18.318  65.080 -63.192  1.00 33.47  ? 857 THR B CB    1 
ATOM   10102 O  OG1   . THR F 3 561 ? 17.293  65.613 -62.339  1.00 33.95  ? 857 THR B OG1   1 
ATOM   10103 C  CG2   . THR F 3 561 ? 19.102  66.222 -63.819  1.00 33.30  ? 857 THR B CG2   1 
ATOM   10104 N  N     . LEU F 3 562 ? 18.382  63.968 -66.595  1.00 32.02  ? 858 LEU B N     1 
ATOM   10105 C  CA    . LEU F 3 562 ? 19.289  63.613 -67.679  1.00 31.29  ? 858 LEU B CA    1 
ATOM   10106 C  C     . LEU F 3 562 ? 19.906  64.845 -68.303  1.00 31.92  ? 858 LEU B C     1 
ATOM   10107 O  O     . LEU F 3 562 ? 19.460  65.974 -68.056  1.00 31.74  ? 858 LEU B O     1 
ATOM   10108 C  CB    . LEU F 3 562 ? 18.549  62.842 -68.772  1.00 29.08  ? 858 LEU B CB    1 
ATOM   10109 C  CG    . LEU F 3 562 ? 17.822  61.555 -68.389  1.00 27.82  ? 858 LEU B CG    1 
ATOM   10110 C  CD1   . LEU F 3 562 ? 17.272  60.902 -69.637  1.00 26.98  ? 858 LEU B CD1   1 
ATOM   10111 C  CD2   . LEU F 3 562 ? 18.771  60.622 -67.664  1.00 27.07  ? 858 LEU B CD2   1 
ATOM   10112 N  N     . ARG F 3 563 ? 20.921  64.614 -69.132  1.00 31.57  ? 859 ARG B N     1 
ATOM   10113 C  CA    . ARG F 3 563 ? 21.606  65.686 -69.831  1.00 32.19  ? 859 ARG B CA    1 
ATOM   10114 C  C     . ARG F 3 563 ? 20.630  66.451 -70.724  1.00 32.33  ? 859 ARG B C     1 
ATOM   10115 O  O     . ARG F 3 563 ? 20.975  67.486 -71.281  1.00 33.20  ? 859 ARG B O     1 
ATOM   10116 C  CB    . ARG F 3 563 ? 22.756  65.116 -70.671  1.00 32.04  ? 859 ARG B CB    1 
ATOM   10117 C  CG    . ARG F 3 563 ? 23.735  64.291 -69.853  1.00 33.69  ? 859 ARG B CG    1 
ATOM   10118 C  CD    . ARG F 3 563 ? 24.999  63.924 -70.629  1.00 34.53  ? 859 ARG B CD    1 
ATOM   10119 N  NE    . ARG F 3 563 ? 25.966  63.283 -69.740  1.00 36.41  ? 859 ARG B NE    1 
ATOM   10120 C  CZ    . ARG F 3 563 ? 26.036  61.975 -69.505  1.00 36.49  ? 859 ARG B CZ    1 
ATOM   10121 N  NH1   . ARG F 3 563 ? 25.206  61.135 -70.104  1.00 36.32  ? 859 ARG B NH1   1 
ATOM   10122 N  NH2   . ARG F 3 563 ? 26.917  61.512 -68.631  1.00 37.90  ? 859 ARG B NH2   1 
ATOM   10123 N  N     . VAL F 3 564 ? 19.410  65.940 -70.864  1.00 32.52  ? 860 VAL B N     1 
ATOM   10124 C  CA    . VAL F 3 564 ? 18.399  66.606 -71.675  1.00 32.50  ? 860 VAL B CA    1 
ATOM   10125 C  C     . VAL F 3 564 ? 17.052  66.544 -70.969  1.00 32.48  ? 860 VAL B C     1 
ATOM   10126 O  O     . VAL F 3 564 ? 16.768  65.600 -70.231  1.00 32.12  ? 860 VAL B O     1 
ATOM   10127 C  CB    . VAL F 3 564 ? 18.246  65.957 -73.070  1.00 32.51  ? 860 VAL B CB    1 
ATOM   10128 C  CG1   . VAL F 3 564 ? 19.460  66.268 -73.924  1.00 32.12  ? 860 VAL B CG1   1 
ATOM   10129 C  CG2   . VAL F 3 564 ? 18.052  64.449 -72.925  1.00 32.40  ? 860 VAL B CG2   1 
ATOM   10130 N  N     . PRO F 3 565 ? 16.201  67.552 -71.197  1.00 32.42  ? 861 PRO B N     1 
ATOM   10131 C  CA    . PRO F 3 565 ? 14.877  67.596 -70.568  1.00 32.83  ? 861 PRO B CA    1 
ATOM   10132 C  C     . PRO F 3 565 ? 14.007  66.434 -71.008  1.00 32.90  ? 861 PRO B C     1 
ATOM   10133 O  O     . PRO F 3 565 ? 14.225  65.858 -72.065  1.00 33.83  ? 861 PRO B O     1 
ATOM   10134 C  CB    . PRO F 3 565 ? 14.318  68.944 -71.033  1.00 32.13  ? 861 PRO B CB    1 
ATOM   10135 C  CG    . PRO F 3 565 ? 14.944  69.114 -72.382  1.00 32.97  ? 861 PRO B CG    1 
ATOM   10136 C  CD    . PRO F 3 565 ? 16.367  68.653 -72.165  1.00 32.58  ? 861 PRO B CD    1 
ATOM   10137 N  N     . LEU F 3 566 ? 13.032  66.081 -70.182  1.00 33.51  ? 862 LEU B N     1 
ATOM   10138 C  CA    . LEU F 3 566 ? 12.103  65.006 -70.503  1.00 33.73  ? 862 LEU B CA    1 
ATOM   10139 C  C     . LEU F 3 566 ? 10.734  65.642 -70.708  1.00 34.52  ? 862 LEU B C     1 
ATOM   10140 O  O     . LEU F 3 566 ? 10.178  66.240 -69.793  1.00 34.50  ? 862 LEU B O     1 
ATOM   10141 C  CB    . LEU F 3 566 ? 12.026  63.987 -69.365  1.00 32.24  ? 862 LEU B CB    1 
ATOM   10142 C  CG    . LEU F 3 566 ? 13.167  62.967 -69.250  1.00 32.56  ? 862 LEU B CG    1 
ATOM   10143 C  CD1   . LEU F 3 566 ? 12.892  62.056 -68.079  1.00 31.46  ? 862 LEU B CD1   1 
ATOM   10144 C  CD2   . LEU F 3 566 ? 13.297  62.153 -70.541  1.00 31.53  ? 862 LEU B CD2   1 
ATOM   10145 N  N     . LYS F 3 567 ? 10.195  65.509 -71.911  1.00 35.59  ? 863 LYS B N     1 
ATOM   10146 C  CA    . LYS F 3 567 ? 8.899   66.085 -72.217  1.00 36.07  ? 863 LYS B CA    1 
ATOM   10147 C  C     . LYS F 3 567 ? 7.814   65.012 -72.176  1.00 36.83  ? 863 LYS B C     1 
ATOM   10148 O  O     . LYS F 3 567 ? 7.876   64.018 -72.906  1.00 37.94  ? 863 LYS B O     1 
ATOM   10149 C  CB    . LYS F 3 567 ? 8.947   66.734 -73.604  1.00 36.07  ? 863 LYS B CB    1 
ATOM   10150 C  CG    . LYS F 3 567 ? 7.890   67.819 -73.856  1.00 35.87  ? 863 LYS B CG    1 
ATOM   10151 C  CD    . LYS F 3 567 ? 7.971   68.358 -75.295  1.00 34.91  ? 863 LYS B CD    1 
ATOM   10152 C  CE    . LYS F 3 567 ? 7.417   67.363 -76.315  1.00 34.58  ? 863 LYS B CE    1 
ATOM   10153 N  NZ    . LYS F 3 567 ? 7.628   67.796 -77.736  1.00 34.28  ? 863 LYS B NZ    1 
ATOM   10154 N  N     . VAL F 3 568 ? 6.828   65.211 -71.308  1.00 36.92  ? 864 VAL B N     1 
ATOM   10155 C  CA    . VAL F 3 568 ? 5.709   64.289 -71.190  1.00 37.33  ? 864 VAL B CA    1 
ATOM   10156 C  C     . VAL F 3 568 ? 4.474   64.982 -71.764  1.00 38.54  ? 864 VAL B C     1 
ATOM   10157 O  O     . VAL F 3 568 ? 4.108   66.078 -71.335  1.00 38.48  ? 864 VAL B O     1 
ATOM   10158 C  CB    . VAL F 3 568 ? 5.410   63.915 -69.715  1.00 36.76  ? 864 VAL B CB    1 
ATOM   10159 C  CG1   . VAL F 3 568 ? 4.095   63.167 -69.622  1.00 36.88  ? 864 VAL B CG1   1 
ATOM   10160 C  CG2   . VAL F 3 568 ? 6.510   63.043 -69.160  1.00 36.25  ? 864 VAL B CG2   1 
ATOM   10161 N  N     . ASP F 3 569 ? 3.854   64.344 -72.749  1.00 39.22  ? 865 ASP B N     1 
ATOM   10162 C  CA    . ASP F 3 569 ? 2.643   64.862 -73.367  1.00 40.15  ? 865 ASP B CA    1 
ATOM   10163 C  C     . ASP F 3 569 ? 1.532   64.148 -72.608  1.00 39.79  ? 865 ASP B C     1 
ATOM   10164 O  O     . ASP F 3 569 ? 1.732   63.022 -72.148  1.00 39.93  ? 865 ASP B O     1 
ATOM   10165 C  CB    . ASP F 3 569 ? 2.617   64.491 -74.852  1.00 41.61  ? 865 ASP B CB    1 
ATOM   10166 C  CG    . ASP F 3 569 ? 3.916   64.849 -75.560  1.00 42.88  ? 865 ASP B CG    1 
ATOM   10167 O  OD1   . ASP F 3 569 ? 4.288   66.047 -75.566  1.00 43.51  ? 865 ASP B OD1   1 
ATOM   10168 O  OD2   . ASP F 3 569 ? 4.570   63.931 -76.104  1.00 43.90  ? 865 ASP B OD2   1 
ATOM   10169 N  N     . TYR F 3 570 ? 0.377   64.788 -72.462  1.00 39.39  ? 866 TYR B N     1 
ATOM   10170 C  CA    . TYR F 3 570 ? -0.718  64.183 -71.710  1.00 39.18  ? 866 TYR B CA    1 
ATOM   10171 C  C     . TYR F 3 570 ? -2.103  64.658 -72.119  1.00 39.48  ? 866 TYR B C     1 
ATOM   10172 O  O     . TYR F 3 570 ? -2.277  65.783 -72.596  1.00 39.76  ? 866 TYR B O     1 
ATOM   10173 C  CB    . TYR F 3 570 ? -0.508  64.446 -70.215  1.00 39.14  ? 866 TYR B CB    1 
ATOM   10174 C  CG    . TYR F 3 570 ? -0.339  65.916 -69.875  1.00 37.89  ? 866 TYR B CG    1 
ATOM   10175 C  CD1   . TYR F 3 570 ? -1.441  66.723 -69.593  1.00 37.79  ? 866 TYR B CD1   1 
ATOM   10176 C  CD2   . TYR F 3 570 ? 0.924   66.502 -69.863  1.00 37.93  ? 866 TYR B CD2   1 
ATOM   10177 C  CE1   . TYR F 3 570 ? -1.287  68.084 -69.306  1.00 38.20  ? 866 TYR B CE1   1 
ATOM   10178 C  CE2   . TYR F 3 570 ? 1.091   67.855 -69.578  1.00 37.87  ? 866 TYR B CE2   1 
ATOM   10179 C  CZ    . TYR F 3 570 ? -0.018  68.639 -69.303  1.00 38.17  ? 866 TYR B CZ    1 
ATOM   10180 O  OH    . TYR F 3 570 ? 0.155   69.975 -69.034  1.00 38.31  ? 866 TYR B OH    1 
ATOM   10181 N  N     . HIS F 3 571 ? -3.084  63.786 -71.912  1.00 39.87  ? 867 HIS B N     1 
ATOM   10182 C  CA    . HIS F 3 571 ? -4.477  64.062 -72.238  1.00 40.53  ? 867 HIS B CA    1 
ATOM   10183 C  C     . HIS F 3 571 ? -5.407  63.399 -71.232  1.00 40.51  ? 867 HIS B C     1 
ATOM   10184 O  O     . HIS F 3 571 ? -4.989  62.541 -70.456  1.00 40.80  ? 867 HIS B O     1 
ATOM   10185 C  CB    . HIS F 3 571 ? -4.803  63.528 -73.634  1.00 41.39  ? 867 HIS B CB    1 
ATOM   10186 C  CG    . HIS F 3 571 ? -3.980  64.141 -74.722  1.00 42.32  ? 867 HIS B CG    1 
ATOM   10187 N  ND1   . HIS F 3 571 ? -4.136  65.450 -75.126  1.00 43.30  ? 867 HIS B ND1   1 
ATOM   10188 C  CD2   . HIS F 3 571 ? -2.988  63.629 -75.486  1.00 42.48  ? 867 HIS B CD2   1 
ATOM   10189 C  CE1   . HIS F 3 571 ? -3.276  65.716 -76.093  1.00 42.82  ? 867 HIS B CE1   1 
ATOM   10190 N  NE2   . HIS F 3 571 ? -2.568  64.627 -76.331  1.00 42.82  ? 867 HIS B NE2   1 
ATOM   10191 N  N     . TYR F 3 572 ? -6.670  63.810 -71.250  1.00 40.72  ? 868 TYR B N     1 
ATOM   10192 C  CA    . TYR F 3 572 ? -7.686  63.248 -70.376  1.00 40.86  ? 868 TYR B CA    1 
ATOM   10193 C  C     . TYR F 3 572 ? -8.975  63.251 -71.174  1.00 41.25  ? 868 TYR B C     1 
ATOM   10194 O  O     . TYR F 3 572 ? -9.235  64.184 -71.934  1.00 41.64  ? 868 TYR B O     1 
ATOM   10195 C  CB    . TYR F 3 572 ? -7.850  64.085 -69.102  1.00 41.64  ? 868 TYR B CB    1 
ATOM   10196 C  CG    . TYR F 3 572 ? -8.620  65.379 -69.266  1.00 41.62  ? 868 TYR B CG    1 
ATOM   10197 C  CD1   . TYR F 3 572 ? -10.016 65.382 -69.354  1.00 41.95  ? 868 TYR B CD1   1 
ATOM   10198 C  CD2   . TYR F 3 572 ? -7.955  66.600 -69.332  1.00 41.85  ? 868 TYR B CD2   1 
ATOM   10199 C  CE1   . TYR F 3 572 ? -10.728 66.576 -69.505  1.00 42.08  ? 868 TYR B CE1   1 
ATOM   10200 C  CE2   . TYR F 3 572 ? -8.654  67.799 -69.482  1.00 41.56  ? 868 TYR B CE2   1 
ATOM   10201 C  CZ    . TYR F 3 572 ? -10.040 67.781 -69.568  1.00 41.60  ? 868 TYR B CZ    1 
ATOM   10202 O  OH    . TYR F 3 572 ? -10.738 68.962 -69.715  1.00 40.75  ? 868 TYR B OH    1 
ATOM   10203 N  N     . GLY F 3 573 ? -9.779  62.210 -71.008  1.00 40.99  ? 869 GLY B N     1 
ATOM   10204 C  CA    . GLY F 3 573 ? -11.024 62.128 -71.740  1.00 41.07  ? 869 GLY B CA    1 
ATOM   10205 C  C     . GLY F 3 573 ? -12.074 61.344 -70.981  1.00 40.84  ? 869 GLY B C     1 
ATOM   10206 O  O     . GLY F 3 573 ? -11.855 60.942 -69.840  1.00 40.80  ? 869 GLY B O     1 
ATOM   10207 N  N     . SER F 3 574 ? -13.210 61.119 -71.629  1.00 40.63  ? 870 SER B N     1 
ATOM   10208 C  CA    . SER F 3 574 ? -14.320 60.394 -71.028  1.00 40.72  ? 870 SER B CA    1 
ATOM   10209 C  C     . SER F 3 574 ? -14.104 58.876 -71.061  1.00 40.35  ? 870 SER B C     1 
ATOM   10210 O  O     . SER F 3 574 ? -14.732 58.131 -70.303  1.00 39.86  ? 870 SER B O     1 
ATOM   10211 C  CB    . SER F 3 574 ? -15.606 60.764 -71.762  1.00 41.56  ? 870 SER B CB    1 
ATOM   10212 O  OG    . SER F 3 574 ? -15.631 62.158 -72.048  1.00 42.09  ? 870 SER B OG    1 
ATOM   10213 N  N     . THR F 3 575 ? -13.228 58.428 -71.956  1.00 39.90  ? 871 THR B N     1 
ATOM   10214 C  CA    . THR F 3 575 ? -12.899 57.012 -72.092  1.00 39.61  ? 871 THR B CA    1 
ATOM   10215 C  C     . THR F 3 575 ? -11.431 56.977 -72.474  1.00 39.21  ? 871 THR B C     1 
ATOM   10216 O  O     . THR F 3 575 ? -10.825 58.027 -72.688  1.00 39.13  ? 871 THR B O     1 
ATOM   10217 C  CB    . THR F 3 575 ? -13.693 56.326 -73.222  1.00 40.06  ? 871 THR B CB    1 
ATOM   10218 O  OG1   . THR F 3 575 ? -13.117 56.675 -74.489  1.00 40.77  ? 871 THR B OG1   1 
ATOM   10219 C  CG2   . THR F 3 575 ? -15.152 56.757 -73.198  1.00 39.91  ? 871 THR B CG2   1 
ATOM   10220 N  N     . TRP F 3 576 ? -10.855 55.783 -72.572  1.00 38.19  ? 872 TRP B N     1 
ATOM   10221 C  CA    . TRP F 3 576 ? -9.451  55.664 -72.943  1.00 37.63  ? 872 TRP B CA    1 
ATOM   10222 C  C     . TRP F 3 576 ? -9.283  56.139 -74.381  1.00 38.20  ? 872 TRP B C     1 
ATOM   10223 O  O     . TRP F 3 576 ? -8.257  56.724 -74.749  1.00 38.54  ? 872 TRP B O     1 
ATOM   10224 C  CB    . TRP F 3 576 ? -8.993  54.207 -72.798  1.00 36.49  ? 872 TRP B CB    1 
ATOM   10225 C  CG    . TRP F 3 576 ? -7.526  53.974 -73.046  1.00 35.39  ? 872 TRP B CG    1 
ATOM   10226 C  CD1   . TRP F 3 576 ? -6.527  54.912 -73.069  1.00 35.43  ? 872 TRP B CD1   1 
ATOM   10227 C  CD2   . TRP F 3 576 ? -6.888  52.708 -73.234  1.00 34.57  ? 872 TRP B CD2   1 
ATOM   10228 N  NE1   . TRP F 3 576 ? -5.309  54.305 -73.255  1.00 34.62  ? 872 TRP B NE1   1 
ATOM   10229 C  CE2   . TRP F 3 576 ? -5.503  52.951 -73.362  1.00 35.17  ? 872 TRP B CE2   1 
ATOM   10230 C  CE3   . TRP F 3 576 ? -7.353  51.388 -73.303  1.00 35.15  ? 872 TRP B CE3   1 
ATOM   10231 C  CZ2   . TRP F 3 576 ? -4.575  51.920 -73.556  1.00 34.90  ? 872 TRP B CZ2   1 
ATOM   10232 C  CZ3   . TRP F 3 576 ? -6.429  50.359 -73.495  1.00 34.95  ? 872 TRP B CZ3   1 
ATOM   10233 C  CH2   . TRP F 3 576 ? -5.056  50.634 -73.619  1.00 35.07  ? 872 TRP B CH2   1 
ATOM   10234 N  N     . TYR F 3 577 ? -10.303 55.884 -75.192  1.00 38.50  ? 873 TYR B N     1 
ATOM   10235 C  CA    . TYR F 3 577 ? -10.297 56.287 -76.590  1.00 39.62  ? 873 TYR B CA    1 
ATOM   10236 C  C     . TYR F 3 577 ? -10.139 57.800 -76.768  1.00 39.50  ? 873 TYR B C     1 
ATOM   10237 O  O     . TYR F 3 577 ? -9.516  58.244 -77.726  1.00 39.65  ? 873 TYR B O     1 
ATOM   10238 C  CB    . TYR F 3 577 ? -11.598 55.840 -77.256  1.00 40.70  ? 873 TYR B CB    1 
ATOM   10239 C  CG    . TYR F 3 577 ? -11.759 56.281 -78.697  1.00 41.99  ? 873 TYR B CG    1 
ATOM   10240 C  CD1   . TYR F 3 577 ? -11.045 55.662 -79.725  1.00 42.54  ? 873 TYR B CD1   1 
ATOM   10241 C  CD2   . TYR F 3 577 ? -12.644 57.309 -79.036  1.00 42.36  ? 873 TYR B CD2   1 
ATOM   10242 C  CE1   . TYR F 3 577 ? -11.208 56.052 -81.053  1.00 42.41  ? 873 TYR B CE1   1 
ATOM   10243 C  CE2   . TYR F 3 577 ? -12.813 57.707 -80.362  1.00 42.31  ? 873 TYR B CE2   1 
ATOM   10244 C  CZ    . TYR F 3 577 ? -12.095 57.077 -81.364  1.00 42.85  ? 873 TYR B CZ    1 
ATOM   10245 O  OH    . TYR F 3 577 ? -12.259 57.466 -82.675  1.00 43.30  ? 873 TYR B OH    1 
ATOM   10246 N  N     . ASP F 3 578 ? -10.693 58.576 -75.839  1.00 39.99  ? 874 ASP B N     1 
ATOM   10247 C  CA    . ASP F 3 578 ? -10.661 60.043 -75.918  1.00 40.11  ? 874 ASP B CA    1 
ATOM   10248 C  C     . ASP F 3 578 ? -9.567  60.763 -75.141  1.00 40.63  ? 874 ASP B C     1 
ATOM   10249 O  O     . ASP F 3 578 ? -9.511  61.994 -75.140  1.00 40.67  ? 874 ASP B O     1 
ATOM   10250 C  CB    . ASP F 3 578 ? -12.014 60.609 -75.498  1.00 39.98  ? 874 ASP B CB    1 
ATOM   10251 C  CG    . ASP F 3 578 ? -13.159 59.988 -76.260  1.00 40.02  ? 874 ASP B CG    1 
ATOM   10252 O  OD1   . ASP F 3 578 ? -13.712 58.968 -75.795  1.00 40.48  ? 874 ASP B OD1   1 
ATOM   10253 O  OD2   . ASP F 3 578 ? -13.497 60.510 -77.341  1.00 40.61  ? 874 ASP B OD2   1 
ATOM   10254 N  N     . ALA F 3 579 ? -8.708  60.010 -74.467  1.00 40.86  ? 875 ALA B N     1 
ATOM   10255 C  CA    . ALA F 3 579 ? -7.620  60.621 -73.725  1.00 41.44  ? 875 ALA B CA    1 
ATOM   10256 C  C     . ALA F 3 579 ? -6.527  60.949 -74.739  1.00 41.97  ? 875 ALA B C     1 
ATOM   10257 O  O     . ALA F 3 579 ? -5.362  60.601 -74.541  1.00 41.75  ? 875 ALA B O     1 
ATOM   10258 C  CB    . ALA F 3 579 ? -7.094  59.646 -72.662  1.00 41.64  ? 875 ALA B CB    1 
ATOM   10259 N  N     . LYS F 3 580 ? -6.915  61.616 -75.828  1.00 42.41  ? 876 LYS B N     1 
ATOM   10260 C  CA    . LYS F 3 580 ? -5.980  61.978 -76.899  1.00 42.97  ? 876 LYS B CA    1 
ATOM   10261 C  C     . LYS F 3 580 ? -6.035  63.458 -77.288  1.00 43.15  ? 876 LYS B C     1 
ATOM   10262 O  O     . LYS F 3 580 ? -6.974  64.156 -76.843  1.00 42.72  ? 876 LYS B O     1 
ATOM   10263 C  CB    . LYS F 3 580 ? -6.260  61.128 -78.147  1.00 43.38  ? 876 LYS B CB    1 
ATOM   10264 C  CG    . LYS F 3 580 ? -7.661  61.317 -78.750  1.00 43.34  ? 876 LYS B CG    1 
ATOM   10265 C  CD    . LYS F 3 580 ? -7.878  60.405 -79.958  1.00 43.57  ? 876 LYS B CD    1 
ATOM   10266 C  CE    . LYS F 3 580 ? -9.285  60.537 -80.542  1.00 43.62  ? 876 LYS B CE    1 
ATOM   10267 N  NZ    . LYS F 3 580 ? -9.559  61.898 -81.092  1.00 43.36  ? 876 LYS B NZ    1 
ATOM   10268 O  OXT   . LYS F 3 580 ? -5.139  63.890 -78.051  1.00 42.94  ? 876 LYS B OXT   1 
HETATM 10269 MN MN    . MN  G 4 .   ? 47.036  33.991 -114.174 1.00 40.65  ? 1   MN  A MN    1 
HETATM 10270 MG MG    . MG  H 5 .   ? 45.987  30.611 -114.334 1.00 34.48  ? 205 MG  A MG    1 
HETATM 10271 S  S     . SO4 I 6 .   ? 38.221  41.980 -133.349 1.00 91.63  ? 203 SO4 A S     1 
HETATM 10272 O  O1    . SO4 I 6 .   ? 38.155  42.589 -134.692 1.00 91.24  ? 203 SO4 A O1    1 
HETATM 10273 O  O2    . SO4 I 6 .   ? 39.546  41.354 -133.162 1.00 91.25  ? 203 SO4 A O2    1 
HETATM 10274 O  O3    . SO4 I 6 .   ? 38.015  43.025 -132.325 1.00 91.21  ? 203 SO4 A O3    1 
HETATM 10275 O  O4    . SO4 I 6 .   ? 37.165  40.955 -133.218 1.00 91.16  ? 203 SO4 A O4    1 
HETATM 10276 N  N1    . DCP J 7 .   ? 39.695  34.455 -110.609 1.00 25.98  ? 201 DCP A N1    1 
HETATM 10277 C  C2    . DCP J 7 .   ? 38.668  34.958 -109.757 1.00 27.03  ? 201 DCP A C2    1 
HETATM 10278 N  N3    . DCP J 7 .   ? 38.605  34.522 -108.424 1.00 26.69  ? 201 DCP A N3    1 
HETATM 10279 C  C4    . DCP J 7 .   ? 39.551  33.595 -107.930 1.00 27.48  ? 201 DCP A C4    1 
HETATM 10280 C  C5    . DCP J 7 .   ? 40.553  33.087 -108.772 1.00 26.88  ? 201 DCP A C5    1 
HETATM 10281 C  C6    . DCP J 7 .   ? 40.624  33.517 -110.103 1.00 26.21  ? 201 DCP A C6    1 
HETATM 10282 O  O2    . DCP J 7 .   ? 37.842  35.774 -110.178 1.00 26.66  ? 201 DCP A O2    1 
HETATM 10283 N  N4    . DCP J 7 .   ? 39.513  33.230 -106.646 1.00 26.60  ? 201 DCP A N4    1 
HETATM 10284 C  "C1'" . DCP J 7 .   ? 39.851  35.012 -111.982 1.00 25.99  ? 201 DCP A "C1'" 1 
HETATM 10285 C  "C2'" . DCP J 7 .   ? 40.661  36.327 -111.894 1.00 26.15  ? 201 DCP A "C2'" 1 
HETATM 10286 C  "C3'" . DCP J 7 .   ? 42.062  35.893 -112.235 1.00 26.21  ? 201 DCP A "C3'" 1 
HETATM 10287 C  "C4'" . DCP J 7 .   ? 41.822  34.855 -113.314 1.00 26.98  ? 201 DCP A "C4'" 1 
HETATM 10288 O  "O4'" . DCP J 7 .   ? 40.665  34.104 -112.824 1.00 25.16  ? 201 DCP A "O4'" 1 
HETATM 10289 O  "O3'" . DCP J 7 .   ? 42.783  37.005 -112.771 1.00 25.58  ? 201 DCP A "O3'" 1 
HETATM 10290 C  "C5'" . DCP J 7 .   ? 43.025  33.967 -113.605 1.00 27.12  ? 201 DCP A "C5'" 1 
HETATM 10291 O  "O5'" . DCP J 7 .   ? 43.295  33.100 -112.498 1.00 29.33  ? 201 DCP A "O5'" 1 
HETATM 10292 P  PA    . DCP J 7 .   ? 44.784  32.999 -111.901 1.00 28.80  ? 201 DCP A PA    1 
HETATM 10293 O  O1A   . DCP J 7 .   ? 44.818  31.956 -110.867 1.00 29.00  ? 201 DCP A O1A   1 
HETATM 10294 O  O2A   . DCP J 7 .   ? 45.767  32.910 -113.014 1.00 30.10  ? 201 DCP A O2A   1 
HETATM 10295 O  O3A   . DCP J 7 .   ? 44.930  34.458 -111.161 1.00 29.92  ? 201 DCP A O3A   1 
HETATM 10296 P  PB    . DCP J 7 .   ? 45.783  35.734 -111.732 1.00 31.42  ? 201 DCP A PB    1 
HETATM 10297 O  O1B   . DCP J 7 .   ? 44.906  36.821 -111.230 1.00 30.92  ? 201 DCP A O1B   1 
HETATM 10298 O  O2B   . DCP J 7 .   ? 45.895  35.340 -113.143 1.00 32.96  ? 201 DCP A O2B   1 
HETATM 10299 O  O3B   . DCP J 7 .   ? 46.999  35.394 -110.730 1.00 32.71  ? 201 DCP A O3B   1 
HETATM 10300 P  PG    . DCP J 7 .   ? 48.402  34.814 -111.258 1.00 32.34  ? 201 DCP A PG    1 
HETATM 10301 O  O1G   . DCP J 7 .   ? 48.870  33.764 -110.316 1.00 33.57  ? 201 DCP A O1G   1 
HETATM 10302 O  O2G   . DCP J 7 .   ? 48.292  34.479 -112.691 1.00 33.25  ? 201 DCP A O2G   1 
HETATM 10303 O  O3G   . DCP J 7 .   ? 49.362  36.087 -111.126 1.00 32.50  ? 201 DCP A O3G   1 
HETATM 10304 MN MN    . MN  K 4 .   ? 6.519   58.093 -75.903  1.00 27.29  ? 2   MN  B MN    1 
HETATM 10305 S  S     . SO4 L 6 .   ? 17.188  54.081 -56.802  1.00 88.37  ? 204 SO4 B S     1 
HETATM 10306 O  O1    . SO4 L 6 .   ? 17.106  55.204 -57.758  1.00 87.91  ? 204 SO4 B O1    1 
HETATM 10307 O  O2    . SO4 L 6 .   ? 18.544  54.030 -56.220  1.00 87.98  ? 204 SO4 B O2    1 
HETATM 10308 O  O3    . SO4 L 6 .   ? 16.193  54.281 -55.727  1.00 87.91  ? 204 SO4 B O3    1 
HETATM 10309 O  O4    . SO4 L 6 .   ? 16.911  52.810 -57.501  1.00 87.87  ? 204 SO4 B O4    1 
HETATM 10310 N  N1    . DCP M 7 .   ? 10.149  51.781 -79.461  1.00 35.96  ? 202 DCP B N1    1 
HETATM 10311 C  C2    . DCP M 7 .   ? 10.825  50.879 -80.321  1.00 37.58  ? 202 DCP B C2    1 
HETATM 10312 N  N3    . DCP M 7 .   ? 10.293  50.612 -81.602  1.00 38.63  ? 202 DCP B N3    1 
HETATM 10313 C  C4    . DCP M 7 .   ? 9.100   51.243 -82.024  1.00 39.05  ? 202 DCP B C4    1 
HETATM 10314 C  C5    . DCP M 7 .   ? 8.429   52.126 -81.170  1.00 38.60  ? 202 DCP B C5    1 
HETATM 10315 C  C6    . DCP M 7 .   ? 8.951   52.396 -79.898  1.00 37.55  ? 202 DCP B C6    1 
HETATM 10316 O  O2    . DCP M 7 .   ? 11.866  50.326 -79.959  1.00 37.85  ? 202 DCP B O2    1 
HETATM 10317 N  N4    . DCP M 7 .   ? 8.626   51.015 -83.247  1.00 38.65  ? 202 DCP B N4    1 
HETATM 10318 C  "C1'" . DCP M 7 .   ? 10.747  52.127 -78.132  1.00 34.27  ? 202 DCP B "C1'" 1 
HETATM 10319 C  "C2'" . DCP M 7 .   ? 11.613  53.397 -78.265  1.00 33.04  ? 202 DCP B "C2'" 1 
HETATM 10320 C  "C3'" . DCP M 7 .   ? 10.625  54.499 -77.996  1.00 32.93  ? 202 DCP B "C3'" 1 
HETATM 10321 C  "C4'" . DCP M 7 .   ? 9.824   53.929 -76.849  1.00 32.63  ? 202 DCP B "C4'" 1 
HETATM 10322 O  "O4'" . DCP M 7 .   ? 9.671   52.499 -77.188  1.00 33.36  ? 202 DCP B "O4'" 1 
HETATM 10323 O  "O3'" . DCP M 7 .   ? 11.313  55.694 -77.583  1.00 31.84  ? 202 DCP B "O3'" 1 
HETATM 10324 C  "C5'" . DCP M 7 .   ? 8.490   54.657 -76.671  1.00 30.71  ? 202 DCP B "C5'" 1 
HETATM 10325 O  "O5'" . DCP M 7 .   ? 7.684   54.498 -77.826  1.00 28.88  ? 202 DCP B "O5'" 1 
HETATM 10326 P  PA    . DCP M 7 .   ? 6.744   55.721 -78.348  1.00 28.30  ? 202 DCP B PA    1 
HETATM 10327 O  O1A   . DCP M 7 .   ? 5.793   55.197 -79.340  1.00 27.29  ? 202 DCP B O1A   1 
HETATM 10328 O  O2A   . DCP M 7 .   ? 6.193   56.466 -77.176  1.00 27.91  ? 202 DCP B O2A   1 
HETATM 10329 O  O3A   . DCP M 7 .   ? 7.819   56.648 -79.109  1.00 24.38  ? 202 DCP B O3A   1 
HETATM 10330 P  PB    . DCP M 7 .   ? 8.598   57.897 -78.415  1.00 26.46  ? 202 DCP B PB    1 
HETATM 10331 O  O1B   . DCP M 7 .   ? 9.968   57.609 -78.916  1.00 22.72  ? 202 DCP B O1B   1 
HETATM 10332 O  O2B   . DCP M 7 .   ? 8.171   57.735 -77.024  1.00 22.54  ? 202 DCP B O2B   1 
HETATM 10333 O  O3B   . DCP M 7 .   ? 7.845   59.001 -79.345  1.00 26.08  ? 202 DCP B O3B   1 
HETATM 10334 P  PG    . DCP M 7 .   ? 6.482   59.746 -78.905  1.00 28.76  ? 202 DCP B PG    1 
HETATM 10335 O  O1G   . DCP M 7 .   ? 5.511   59.656 -80.007  1.00 27.94  ? 202 DCP B O1G   1 
HETATM 10336 O  O2G   . DCP M 7 .   ? 6.064   59.294 -77.556  1.00 27.55  ? 202 DCP B O2G   1 
HETATM 10337 O  O3G   . DCP M 7 .   ? 6.976   61.274 -78.774  1.00 29.71  ? 202 DCP B O3G   1 
HETATM 10338 O  O     . HOH N 8 .   ? 43.571  30.388 -108.861 1.00 25.01  ? 18  HOH C O     1 
HETATM 10339 O  O     . HOH O 8 .   ? 35.961  24.488 -114.585 1.00 24.42  ? 15  HOH D O     1 
HETATM 10340 O  O     . HOH O 8 .   ? 25.972  28.161 -118.358 1.00 47.84  ? 16  HOH D O     1 
HETATM 10341 O  O     . HOH O 8 .   ? 28.374  31.629 -109.869 1.00 24.72  ? 17  HOH D O     1 
HETATM 10342 O  O     . HOH O 8 .   ? 27.985  34.243 -93.906  1.00 57.58  ? 18  HOH D O     1 
HETATM 10343 O  O     . HOH O 8 .   ? 26.663  35.993 -95.811  1.00 43.08  ? 19  HOH D O     1 
HETATM 10344 O  O     . HOH O 8 .   ? 35.357  29.171 -115.705 1.00 39.64  ? 20  HOH D O     1 
HETATM 10345 O  O     . HOH O 8 .   ? 25.197  30.928 -114.351 1.00 45.71  ? 21  HOH D O     1 
HETATM 10346 O  O     . HOH O 8 .   ? 31.311  30.259 -106.620 1.00 44.69  ? 22  HOH D O     1 
HETATM 10347 O  O     . HOH O 8 .   ? 25.424  34.930 -109.282 1.00 42.12  ? 23  HOH D O     1 
HETATM 10348 O  O     . HOH O 8 .   ? 20.437  42.299 -94.693  1.00 36.80  ? 24  HOH D O     1 
HETATM 10349 O  O     . HOH O 8 .   ? 29.396  20.129 -118.774 1.00 44.42  ? 25  HOH D O     1 
HETATM 10350 O  O     . HOH P 8 .   ? 3.200   46.128 -75.961  1.00 36.48  ? 14  HOH E O     1 
HETATM 10351 O  O     . HOH P 8 .   ? 5.873   44.355 -84.198  1.00 41.46  ? 138 HOH E O     1 
HETATM 10352 O  O     . HOH Q 8 .   ? 10.715  41.485 -83.444  1.00 31.25  ? 51  HOH F O     1 
HETATM 10353 O  O     . HOH Q 8 .   ? -6.585  26.026 -84.140  1.00 54.32  ? 71  HOH F O     1 
HETATM 10354 O  O     . HOH Q 8 .   ? 3.263   43.674 -75.655  1.00 44.56  ? 79  HOH F O     1 
HETATM 10355 O  O     . HOH Q 8 .   ? 17.461  39.601 -80.826  1.00 42.79  ? 116 HOH F O     1 
HETATM 10356 O  O     . HOH Q 8 .   ? 0.924   31.359 -79.000  1.00 49.19  ? 149 HOH F O     1 
HETATM 10357 O  O     . HOH Q 8 .   ? 9.072   45.279 -85.366  1.00 52.47  ? 179 HOH F O     1 
HETATM 10358 O  O     . HOH R 8 .   ? 37.618  14.944 -114.870 1.00 36.04  ? 2   HOH A O     1 
HETATM 10359 O  O     . HOH R 8 .   ? 11.220  12.291 -150.311 1.00 50.82  ? 3   HOH A O     1 
HETATM 10360 O  O     . HOH R 8 .   ? 37.650  17.211 -113.654 1.00 31.30  ? 4   HOH A O     1 
HETATM 10361 O  O     . HOH R 8 .   ? 31.654  28.561 -123.260 1.00 25.15  ? 7   HOH A O     1 
HETATM 10362 O  O     . HOH R 8 .   ? 25.289  20.716 -131.477 1.00 81.05  ? 11  HOH A O     1 
HETATM 10363 O  O     . HOH R 8 .   ? 38.236  30.670 -120.527 1.00 18.07  ? 15  HOH A O     1 
HETATM 10364 O  O     . HOH R 8 .   ? 22.705  19.125 -135.219 1.00 32.32  ? 16  HOH A O     1 
HETATM 10365 O  O     . HOH R 8 .   ? 53.450  45.456 -115.259 1.00 21.31  ? 17  HOH A O     1 
HETATM 10366 O  O     . HOH R 8 .   ? 31.728  25.226 -133.651 1.00 22.13  ? 19  HOH A O     1 
HETATM 10367 O  O     . HOH R 8 .   ? 15.190  29.461 -127.865 1.00 41.42  ? 22  HOH A O     1 
HETATM 10368 O  O     . HOH R 8 .   ? 36.293  28.617 -140.726 1.00 35.89  ? 25  HOH A O     1 
HETATM 10369 O  O     . HOH R 8 .   ? 34.572  25.107 -136.796 1.00 35.61  ? 27  HOH A O     1 
HETATM 10370 O  O     . HOH R 8 .   ? 50.379  45.131 -123.716 1.00 45.15  ? 30  HOH A O     1 
HETATM 10371 O  O     . HOH R 8 .   ? 22.801  37.664 -121.808 1.00 24.31  ? 33  HOH A O     1 
HETATM 10372 O  O     . HOH R 8 .   ? 16.908  21.189 -133.671 1.00 23.82  ? 35  HOH A O     1 
HETATM 10373 O  O     . HOH R 8 .   ? 20.668  45.243 -104.195 1.00 37.84  ? 37  HOH A O     1 
HETATM 10374 O  O     . HOH R 8 .   ? 20.973  20.668 -133.651 1.00 29.64  ? 39  HOH A O     1 
HETATM 10375 O  O     . HOH R 8 .   ? 48.934  16.097 -128.819 1.00 35.83  ? 41  HOH A O     1 
HETATM 10376 O  O     . HOH R 8 .   ? 19.097  25.565 -159.931 1.00 41.02  ? 43  HOH A O     1 
HETATM 10377 O  O     . HOH R 8 .   ? 25.337  21.562 -139.053 1.00 32.26  ? 45  HOH A O     1 
HETATM 10378 O  O     . HOH R 8 .   ? 38.251  25.087 -155.711 1.00 42.75  ? 47  HOH A O     1 
HETATM 10379 O  O     . HOH R 8 .   ? 50.608  46.634 -97.706  1.00 36.53  ? 49  HOH A O     1 
HETATM 10380 O  O     . HOH R 8 .   ? 15.507  37.605 -130.563 1.00 37.11  ? 54  HOH A O     1 
HETATM 10381 O  O     . HOH R 8 .   ? 26.182  25.106 -125.323 1.00 37.59  ? 56  HOH A O     1 
HETATM 10382 O  O     . HOH R 8 .   ? 13.371  24.263 -141.414 1.00 27.78  ? 57  HOH A O     1 
HETATM 10383 O  O     . HOH R 8 .   ? 31.931  39.630 -85.971  1.00 50.29  ? 62  HOH A O     1 
HETATM 10384 O  O     . HOH R 8 .   ? 8.957   15.675 -148.073 1.00 42.29  ? 63  HOH A O     1 
HETATM 10385 O  O     . HOH R 8 .   ? 41.937  35.573 -119.343 1.00 37.27  ? 64  HOH A O     1 
HETATM 10386 O  O     . HOH R 8 .   ? 40.078  35.277 -116.669 1.00 35.95  ? 65  HOH A O     1 
HETATM 10387 O  O     . HOH R 8 .   ? 68.174  17.323 -123.761 1.00 44.42  ? 66  HOH A O     1 
HETATM 10388 O  O     . HOH R 8 .   ? 10.888  15.385 -125.597 1.00 38.39  ? 69  HOH A O     1 
HETATM 10389 O  O     . HOH R 8 .   ? 35.048  32.048 -97.463  1.00 47.72  ? 75  HOH A O     1 
HETATM 10390 O  O     . HOH R 8 .   ? 30.805  22.631 -128.928 1.00 44.97  ? 80  HOH A O     1 
HETATM 10391 O  O     . HOH R 8 .   ? 43.915  18.961 -125.928 1.00 27.92  ? 82  HOH A O     1 
HETATM 10392 O  O     . HOH R 8 .   ? 17.028  45.303 -122.510 1.00 45.21  ? 86  HOH A O     1 
HETATM 10393 O  O     . HOH R 8 .   ? 40.949  57.065 -109.616 1.00 45.32  ? 87  HOH A O     1 
HETATM 10394 O  O     . HOH R 8 .   ? 19.652  39.224 -115.044 1.00 37.78  ? 91  HOH A O     1 
HETATM 10395 O  O     . HOH R 8 .   ? 66.478  24.698 -123.728 1.00 49.51  ? 94  HOH A O     1 
HETATM 10396 O  O     . HOH R 8 .   ? 35.410  24.758 -117.135 1.00 31.20  ? 95  HOH A O     1 
HETATM 10397 O  O     . HOH R 8 .   ? 31.842  24.919 -128.593 1.00 36.36  ? 97  HOH A O     1 
HETATM 10398 O  O     . HOH R 8 .   ? 36.441  36.300 -112.391 1.00 46.36  ? 98  HOH A O     1 
HETATM 10399 O  O     . HOH R 8 .   ? 55.182  44.154 -105.510 1.00 47.74  ? 100 HOH A O     1 
HETATM 10400 O  O     . HOH R 8 .   ? 11.633  14.088 -138.827 1.00 38.36  ? 101 HOH A O     1 
HETATM 10401 O  O     . HOH R 8 .   ? 20.343  43.605 -130.701 1.00 43.18  ? 105 HOH A O     1 
HETATM 10402 O  O     . HOH R 8 .   ? 48.012  25.250 -132.149 1.00 37.47  ? 106 HOH A O     1 
HETATM 10403 O  O     . HOH R 8 .   ? 35.007  33.092 -139.863 1.00 43.82  ? 107 HOH A O     1 
HETATM 10404 O  O     . HOH R 8 .   ? 12.515  26.553 -133.798 1.00 40.01  ? 110 HOH A O     1 
HETATM 10405 O  O     . HOH R 8 .   ? 25.103  42.230 -142.272 1.00 47.14  ? 111 HOH A O     1 
HETATM 10406 O  O     . HOH R 8 .   ? 36.846  31.317 -139.466 1.00 32.06  ? 112 HOH A O     1 
HETATM 10407 O  O     . HOH R 8 .   ? 25.015  52.168 -108.400 1.00 36.69  ? 115 HOH A O     1 
HETATM 10408 O  O     . HOH R 8 .   ? 35.729  31.860 -145.040 1.00 36.35  ? 118 HOH A O     1 
HETATM 10409 O  O     . HOH R 8 .   ? 29.258  35.618 -125.626 1.00 37.59  ? 119 HOH A O     1 
HETATM 10410 O  O     . HOH R 8 .   ? 51.806  36.684 -111.641 1.00 38.37  ? 123 HOH A O     1 
HETATM 10411 O  O     . HOH R 8 .   ? 26.970  16.692 -135.488 1.00 47.25  ? 124 HOH A O     1 
HETATM 10412 O  O     . HOH R 8 .   ? 12.609  19.389 -137.792 1.00 42.55  ? 125 HOH A O     1 
HETATM 10413 O  O     . HOH R 8 .   ? 20.406  31.372 -118.787 1.00 50.90  ? 126 HOH A O     1 
HETATM 10414 O  O     . HOH R 8 .   ? 46.793  21.922 -131.514 1.00 40.97  ? 129 HOH A O     1 
HETATM 10415 O  O     . HOH R 8 .   ? 37.629  17.965 -140.351 1.00 48.89  ? 130 HOH A O     1 
HETATM 10416 O  O     . HOH R 8 .   ? 34.460  27.187 -117.343 1.00 40.64  ? 1