data_1LVK
# 
_entry.id   1LVK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LVK         
WWPDB D_1000174847 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LVK 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bauer, C.B.'   1 
'Kuhlman, P.A.' 2 
'Bagshaw, C.R.' 3 
'Rayment, I.'   4 
# 
_citation.id                        primary 
_citation.title                     
;X-ray crystal structure and solution fluorescence characterization of Mg.2'(3')-O-(N-methylanthraniloyl) nucleotides bound to the Dictyostelium discoideum myosin motor domain.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            274 
_citation.page_first                394 
_citation.page_last                 407 
_citation.year                      1997 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9405148 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1997.1325 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bauer, C.B.'   1 
primary 'Kuhlman, P.A.' 2 
primary 'Bagshaw, C.R.' 3 
primary 'Rayment, I.'   4 
# 
_cell.entry_id           1LVK 
_cell.length_a           103.900 
_cell.length_b           179.900 
_cell.length_c           53.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LVK 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man MYOSIN                                                   86753.109 1 ? 'Q760L, R761P, I762N' 'MOTOR DOMAIN' 
'GENETICALLY TRUNCATED HEAD OF MYOSIN FROM DICTYOSTELIUM' 
2 non-polymer syn 'MAGNESIUM ION'                                          24.305    1 ? ?                     ?              ? 
3 non-polymer syn "2'(3')-O-N-METHYLANTHRANILOYL-ADENOSINE-5'-DIPHOSPHATE" 544.349   1 ? ?                     ?              ? 
4 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'                              66.007    1 ? ?                     ?              ? 
5 water       nat water                                                    18.015    2 ? ?                     ?              ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTSERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEKYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTSERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEKYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   PRO n 
1 4   ILE n 
1 5   HIS n 
1 6   ASP n 
1 7   ARG n 
1 8   THR n 
1 9   SER n 
1 10  ASP n 
1 11  TYR n 
1 12  HIS n 
1 13  LYS n 
1 14  TYR n 
1 15  LEU n 
1 16  LYS n 
1 17  VAL n 
1 18  LYS n 
1 19  GLN n 
1 20  GLY n 
1 21  ASP n 
1 22  SER n 
1 23  ASP n 
1 24  LEU n 
1 25  PHE n 
1 26  LYS n 
1 27  LEU n 
1 28  THR n 
1 29  VAL n 
1 30  SER n 
1 31  ASP n 
1 32  LYS n 
1 33  ARG n 
1 34  TYR n 
1 35  ILE n 
1 36  TRP n 
1 37  TYR n 
1 38  ASN n 
1 39  PRO n 
1 40  ASP n 
1 41  PRO n 
1 42  LYS n 
1 43  GLU n 
1 44  ARG n 
1 45  ASP n 
1 46  SER n 
1 47  TYR n 
1 48  GLU n 
1 49  CYS n 
1 50  GLY n 
1 51  GLU n 
1 52  ILE n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  THR n 
1 57  SER n 
1 58  ASP n 
1 59  SER n 
1 60  PHE n 
1 61  THR n 
1 62  PHE n 
1 63  LYS n 
1 64  THR n 
1 65  SER n 
1 66  ASP n 
1 67  GLY n 
1 68  GLN n 
1 69  ASP n 
1 70  ARG n 
1 71  GLN n 
1 72  VAL n 
1 73  LYS n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  ALA n 
1 78  ASN n 
1 79  GLN n 
1 80  ARG n 
1 81  ASN n 
1 82  PRO n 
1 83  ILE n 
1 84  LYS n 
1 85  PHE n 
1 86  ASP n 
1 87  GLY n 
1 88  VAL n 
1 89  GLU n 
1 90  ASP n 
1 91  MET n 
1 92  SER n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  GLU n 
1 100 PRO n 
1 101 ALA n 
1 102 VAL n 
1 103 PHE n 
1 104 HIS n 
1 105 ASN n 
1 106 LEU n 
1 107 ARG n 
1 108 VAL n 
1 109 ARG n 
1 110 TYR n 
1 111 ASN n 
1 112 GLN n 
1 113 ASP n 
1 114 LEU n 
1 115 ILE n 
1 116 TYR n 
1 117 THR n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 LEU n 
1 122 PHE n 
1 123 LEU n 
1 124 VAL n 
1 125 ALA n 
1 126 VAL n 
1 127 ASN n 
1 128 PRO n 
1 129 PHE n 
1 130 LYS n 
1 131 ARG n 
1 132 ILE n 
1 133 PRO n 
1 134 ILE n 
1 135 TYR n 
1 136 THR n 
1 137 GLN n 
1 138 GLU n 
1 139 MET n 
1 140 VAL n 
1 141 ASP n 
1 142 ILE n 
1 143 PHE n 
1 144 LYS n 
1 145 GLY n 
1 146 ARG n 
1 147 ARG n 
1 148 ARG n 
1 149 ASN n 
1 150 GLU n 
1 151 VAL n 
1 152 ALA n 
1 153 PRO n 
1 154 HIS n 
1 155 ILE n 
1 156 PHE n 
1 157 ALA n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 VAL n 
1 162 ALA n 
1 163 TYR n 
1 164 ARG n 
1 165 SER n 
1 166 MET n 
1 167 LEU n 
1 168 ASP n 
1 169 ASP n 
1 170 ARG n 
1 171 GLN n 
1 172 ASN n 
1 173 GLN n 
1 174 SER n 
1 175 LEU n 
1 176 LEU n 
1 177 ILE n 
1 178 THR n 
1 179 GLY n 
1 180 GLU n 
1 181 SER n 
1 182 GLY n 
1 183 ALA n 
1 184 GLY n 
1 185 LYS n 
1 186 THR n 
1 187 GLU n 
1 188 ASN n 
1 189 THR n 
1 190 LYS n 
1 191 LYS n 
1 192 VAL n 
1 193 ILE n 
1 194 GLN n 
1 195 TYR n 
1 196 LEU n 
1 197 ALA n 
1 198 SER n 
1 199 VAL n 
1 200 ALA n 
1 201 GLY n 
1 202 ARG n 
1 203 ASN n 
1 204 GLN n 
1 205 ALA n 
1 206 ASN n 
1 207 GLY n 
1 208 SER n 
1 209 GLY n 
1 210 VAL n 
1 211 LEU n 
1 212 GLU n 
1 213 GLN n 
1 214 GLN n 
1 215 ILE n 
1 216 LEU n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 PRO n 
1 221 ILE n 
1 222 LEU n 
1 223 GLU n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 ASN n 
1 228 ALA n 
1 229 LYS n 
1 230 THR n 
1 231 THR n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 ASN n 
1 236 SER n 
1 237 SER n 
1 238 ARG n 
1 239 PHE n 
1 240 GLY n 
1 241 LYS n 
1 242 PHE n 
1 243 ILE n 
1 244 GLU n 
1 245 ILE n 
1 246 GLN n 
1 247 PHE n 
1 248 ASN n 
1 249 ASN n 
1 250 ALA n 
1 251 GLY n 
1 252 PHE n 
1 253 ILE n 
1 254 SER n 
1 255 GLY n 
1 256 ALA n 
1 257 SER n 
1 258 ILE n 
1 259 GLN n 
1 260 SER n 
1 261 TYR n 
1 262 LEU n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 ARG n 
1 268 VAL n 
1 269 VAL n 
1 270 PHE n 
1 271 GLN n 
1 272 SER n 
1 273 THR n 
1 274 SER n 
1 275 GLU n 
1 276 ARG n 
1 277 ASN n 
1 278 TYR n 
1 279 HIS n 
1 280 ILE n 
1 281 PHE n 
1 282 TYR n 
1 283 GLN n 
1 284 LEU n 
1 285 LEU n 
1 286 ALA n 
1 287 GLY n 
1 288 ALA n 
1 289 THR n 
1 290 ALA n 
1 291 GLU n 
1 292 GLU n 
1 293 LYS n 
1 294 LYS n 
1 295 ALA n 
1 296 LEU n 
1 297 HIS n 
1 298 LEU n 
1 299 ALA n 
1 300 GLY n 
1 301 PRO n 
1 302 GLU n 
1 303 SER n 
1 304 PHE n 
1 305 ASN n 
1 306 TYR n 
1 307 LEU n 
1 308 ASN n 
1 309 GLN n 
1 310 SER n 
1 311 GLY n 
1 312 CYS n 
1 313 VAL n 
1 314 ASP n 
1 315 ILE n 
1 316 LYS n 
1 317 GLY n 
1 318 VAL n 
1 319 SER n 
1 320 ASP n 
1 321 GLU n 
1 322 ASP n 
1 323 GLU n 
1 324 PHE n 
1 325 LYS n 
1 326 ILE n 
1 327 THR n 
1 328 ARG n 
1 329 GLN n 
1 330 ALA n 
1 331 MET n 
1 332 ASP n 
1 333 ILE n 
1 334 VAL n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 GLN n 
1 339 GLU n 
1 340 GLU n 
1 341 GLN n 
1 342 MET n 
1 343 SER n 
1 344 ILE n 
1 345 PHE n 
1 346 LYS n 
1 347 ILE n 
1 348 ILE n 
1 349 ALA n 
1 350 GLY n 
1 351 ILE n 
1 352 LEU n 
1 353 HIS n 
1 354 LEU n 
1 355 GLY n 
1 356 ASN n 
1 357 ILE n 
1 358 LYS n 
1 359 PHE n 
1 360 GLU n 
1 361 LYS n 
1 362 GLY n 
1 363 ALA n 
1 364 GLY n 
1 365 GLU n 
1 366 GLY n 
1 367 ALA n 
1 368 VAL n 
1 369 LEU n 
1 370 LYS n 
1 371 ASP n 
1 372 LYS n 
1 373 THR n 
1 374 ALA n 
1 375 LEU n 
1 376 ASN n 
1 377 ALA n 
1 378 ALA n 
1 379 SER n 
1 380 THR n 
1 381 VAL n 
1 382 PHE n 
1 383 GLY n 
1 384 VAL n 
1 385 ASN n 
1 386 PRO n 
1 387 SER n 
1 388 VAL n 
1 389 LEU n 
1 390 GLU n 
1 391 LYS n 
1 392 ALA n 
1 393 LEU n 
1 394 MET n 
1 395 GLU n 
1 396 PRO n 
1 397 ARG n 
1 398 ILE n 
1 399 LEU n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 ASP n 
1 404 LEU n 
1 405 VAL n 
1 406 ALA n 
1 407 GLN n 
1 408 HIS n 
1 409 LEU n 
1 410 ASN n 
1 411 VAL n 
1 412 GLU n 
1 413 LYS n 
1 414 SER n 
1 415 SER n 
1 416 SER n 
1 417 SER n 
1 418 ARG n 
1 419 ASP n 
1 420 ALA n 
1 421 LEU n 
1 422 VAL n 
1 423 LYS n 
1 424 ALA n 
1 425 LEU n 
1 426 TYR n 
1 427 GLY n 
1 428 ARG n 
1 429 LEU n 
1 430 PHE n 
1 431 LEU n 
1 432 TRP n 
1 433 LEU n 
1 434 VAL n 
1 435 LYS n 
1 436 LYS n 
1 437 ILE n 
1 438 ASN n 
1 439 ASN n 
1 440 VAL n 
1 441 LEU n 
1 442 CYS n 
1 443 SER n 
1 444 GLU n 
1 445 ARG n 
1 446 LYS n 
1 447 ALA n 
1 448 TYR n 
1 449 PHE n 
1 450 ILE n 
1 451 GLY n 
1 452 VAL n 
1 453 LEU n 
1 454 ASP n 
1 455 ILE n 
1 456 SER n 
1 457 GLY n 
1 458 PHE n 
1 459 GLU n 
1 460 ILE n 
1 461 PHE n 
1 462 LYS n 
1 463 VAL n 
1 464 ASN n 
1 465 SER n 
1 466 PHE n 
1 467 GLU n 
1 468 GLN n 
1 469 LEU n 
1 470 CYS n 
1 471 ILE n 
1 472 ASN n 
1 473 TYR n 
1 474 THR n 
1 475 ASN n 
1 476 GLU n 
1 477 LYS n 
1 478 LEU n 
1 479 GLN n 
1 480 GLN n 
1 481 PHE n 
1 482 PHE n 
1 483 ASN n 
1 484 HIS n 
1 485 HIS n 
1 486 MET n 
1 487 PHE n 
1 488 LYS n 
1 489 VAL n 
1 490 GLU n 
1 491 GLN n 
1 492 GLU n 
1 493 LYS n 
1 494 TYR n 
1 495 LEU n 
1 496 LYS n 
1 497 GLU n 
1 498 LYS n 
1 499 ILE n 
1 500 ASN n 
1 501 TRP n 
1 502 THR n 
1 503 PHE n 
1 504 ILE n 
1 505 ASP n 
1 506 PHE n 
1 507 GLY n 
1 508 LEU n 
1 509 ASP n 
1 510 SER n 
1 511 GLN n 
1 512 ALA n 
1 513 THR n 
1 514 ILE n 
1 515 ASP n 
1 516 LEU n 
1 517 ILE n 
1 518 ASP n 
1 519 GLY n 
1 520 ARG n 
1 521 GLN n 
1 522 PRO n 
1 523 PRO n 
1 524 GLY n 
1 525 ILE n 
1 526 LEU n 
1 527 ALA n 
1 528 LEU n 
1 529 LEU n 
1 530 ASP n 
1 531 GLU n 
1 532 GLN n 
1 533 SER n 
1 534 VAL n 
1 535 PHE n 
1 536 PRO n 
1 537 ASN n 
1 538 ALA n 
1 539 THR n 
1 540 ASP n 
1 541 ASN n 
1 542 THR n 
1 543 LEU n 
1 544 ILE n 
1 545 THR n 
1 546 LYS n 
1 547 LEU n 
1 548 HIS n 
1 549 SER n 
1 550 HIS n 
1 551 PHE n 
1 552 SER n 
1 553 LYS n 
1 554 LYS n 
1 555 ASN n 
1 556 ALA n 
1 557 LYS n 
1 558 TYR n 
1 559 GLU n 
1 560 GLU n 
1 561 PRO n 
1 562 ARG n 
1 563 PHE n 
1 564 SER n 
1 565 LYS n 
1 566 THR n 
1 567 GLU n 
1 568 PHE n 
1 569 GLY n 
1 570 VAL n 
1 571 THR n 
1 572 HIS n 
1 573 TYR n 
1 574 ALA n 
1 575 GLY n 
1 576 GLN n 
1 577 VAL n 
1 578 MET n 
1 579 TYR n 
1 580 GLU n 
1 581 ILE n 
1 582 GLN n 
1 583 ASP n 
1 584 TRP n 
1 585 LEU n 
1 586 GLU n 
1 587 LYS n 
1 588 ASN n 
1 589 LYS n 
1 590 ASP n 
1 591 PRO n 
1 592 LEU n 
1 593 GLN n 
1 594 GLN n 
1 595 ASP n 
1 596 LEU n 
1 597 GLU n 
1 598 LEU n 
1 599 CYS n 
1 600 PHE n 
1 601 LYS n 
1 602 ASP n 
1 603 SER n 
1 604 SER n 
1 605 ASP n 
1 606 ASN n 
1 607 VAL n 
1 608 VAL n 
1 609 THR n 
1 610 LYS n 
1 611 LEU n 
1 612 PHE n 
1 613 ASN n 
1 614 ASP n 
1 615 PRO n 
1 616 ASN n 
1 617 ILE n 
1 618 ALA n 
1 619 SER n 
1 620 ARG n 
1 621 ALA n 
1 622 LYS n 
1 623 LYS n 
1 624 GLY n 
1 625 ALA n 
1 626 ASN n 
1 627 PHE n 
1 628 LEU n 
1 629 THR n 
1 630 VAL n 
1 631 ALA n 
1 632 ALA n 
1 633 GLN n 
1 634 TYR n 
1 635 LYS n 
1 636 GLU n 
1 637 GLN n 
1 638 LEU n 
1 639 ALA n 
1 640 SER n 
1 641 LEU n 
1 642 MET n 
1 643 ALA n 
1 644 THR n 
1 645 LEU n 
1 646 GLU n 
1 647 THR n 
1 648 THR n 
1 649 ASN n 
1 650 PRO n 
1 651 HIS n 
1 652 PHE n 
1 653 VAL n 
1 654 ARG n 
1 655 CYS n 
1 656 ILE n 
1 657 ILE n 
1 658 PRO n 
1 659 ASN n 
1 660 ASN n 
1 661 LYS n 
1 662 GLN n 
1 663 LEU n 
1 664 PRO n 
1 665 ALA n 
1 666 LYS n 
1 667 LEU n 
1 668 GLU n 
1 669 ASP n 
1 670 LYS n 
1 671 VAL n 
1 672 VAL n 
1 673 LEU n 
1 674 ASP n 
1 675 GLN n 
1 676 LEU n 
1 677 ARG n 
1 678 CYS n 
1 679 ASN n 
1 680 GLY n 
1 681 VAL n 
1 682 LEU n 
1 683 GLU n 
1 684 GLY n 
1 685 ILE n 
1 686 ARG n 
1 687 ILE n 
1 688 THR n 
1 689 ARG n 
1 690 LYS n 
1 691 GLY n 
1 692 PHE n 
1 693 PRO n 
1 694 ASN n 
1 695 ARG n 
1 696 ILE n 
1 697 ILE n 
1 698 TYR n 
1 699 ALA n 
1 700 ASP n 
1 701 PHE n 
1 702 VAL n 
1 703 LYS n 
1 704 ARG n 
1 705 TYR n 
1 706 TYR n 
1 707 ASP n 
1 708 LEU n 
1 709 ALA n 
1 710 PRO n 
1 711 ASN n 
1 712 VAL n 
1 713 PRO n 
1 714 ARG n 
1 715 ASP n 
1 716 ALA n 
1 717 GLU n 
1 718 ASP n 
1 719 SER n 
1 720 GLN n 
1 721 LYS n 
1 722 ALA n 
1 723 THR n 
1 724 ASP n 
1 725 ALA n 
1 726 VAL n 
1 727 LEU n 
1 728 LYS n 
1 729 HIS n 
1 730 LEU n 
1 731 ASN n 
1 732 ILE n 
1 733 ASP n 
1 734 PRO n 
1 735 GLU n 
1 736 GLN n 
1 737 PHE n 
1 738 ARG n 
1 739 PHE n 
1 740 GLY n 
1 741 ILE n 
1 742 THR n 
1 743 LYS n 
1 744 ILE n 
1 745 PHE n 
1 746 PHE n 
1 747 ARG n 
1 748 ALA n 
1 749 GLY n 
1 750 GLN n 
1 751 LEU n 
1 752 ALA n 
1 753 ARG n 
1 754 ILE n 
1 755 GLU n 
1 756 GLU n 
1 757 ALA n 
1 758 ARG n 
1 759 GLU n 
1 760 LEU n 
1 761 PRO n 
1 762 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Dictyostelium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     44689 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     44689 
_entity_src_gen.host_org_genus                     Dictyostelium 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYS2_DICDI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08799 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGYVDIKGVSD
SEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEAREQRISEIIKAIQAATRGWIARKVYKQAREHTVAARIIQQNLR
AYIDFKSWPWWKLFSKARPLLKRRNFEKEIKEKEREILELKSNLTDSTTQKDKLEKSLKDTESNVLDLQRQLKAEKETLK
AMYDSKDALEAQKRELEIRVEDMESELDEKKLALENLQNQKRSVEEKVRDLEEELQEEQKLRNTLEKLKKKYEEELEEMK
RVNDGQSDTISRLEKIKDELQKEVEELTESFSEESKDKGVLEKTRVRLQSELDDLTVRLDSETKDKSELLRQKKKLEEEL
KQVQEALAAETAAKLAQEAANKKLQGEYTELNEKFNSEVTARSNVEKSKKTLESQLVAVNNELDEEKKNRDALEKKKKAL
DAMLEEMKDQLESTGGEKKSLYDLKVKQESDMEALRNQISELQSTIAKLEKIKSTLEGEVARLQGELEAEQLAKSNVEKQ
KKKVELDLEDKSAQLAEETAAKQALDKLKKKLEQELSEVQTQLSEANNKNVNSDSTNKHLETSFNNLKLELEAEQKAKQA
LEKKRLGLESELKHVNEQLEEEKKQKESNEKRKVDLEKEVSELKDQIEEEVASKKAVTEAKNKKESELDEIKRQYADVVS
SRDKSVEQLKTLQAKNEELRNTAEEAEGQLDRAERSKKKAEFDLEEAVKNLEEETAKKVKAEKAMKKAETDYRSTKSELD
DAKNVSSEQYVQIKRLNEELSELRSVLEEADERCNSAIKAKKTAESALESLKDEIDAANNAKAKAERKSKELEVRVAELE
ESLEDKSGTVNVEFIRKKDAEIDDLRARLDRETESRIKSDEDKKNTRKQFADLEAKVEEAQREVVTIDRLKKKLESDIID
LSTQLDTETKSRIKIEKSKKKLEQTLAERRAAEEGSSKAADEEIRKQVWQEVDELRAQLDSERAALNASEKKIKSLVAEV
DEVKEQLEDEILAKDKLVKAKRALEVELEEVRDQLEEEEDSRSELEDSKRRLTTEVEDIKKKYDAEVEQNTKLDEAKKKL
TDDVDTLKKQLEDEKKKLNESERAKKRLESENEDFLAKLDAEVKNRSRAEKDRKKYEKDLKDTKYKLNDEAATKTQTEIG
AAKLEDQIDELRSKLEQEQAKATQADKSKKTLEGEIDNLRAQIEDEGKIKMRLEKEKRALEGELEELRETVEEAEDSKSE
AEQSKRLVELELEDARRNLQKEIDAKEIAEDAKSNLQREIVEAKGRLEEESIARTNSDRSRKRLEAEIDALTAQVDAEQK
AKNQQIKENKKIETELKEYRKKFGESEKTKTKEFLVVEKLETDYKRAKKEAADEQQQRLTVENDLRKHLSEISLLKDAID
KLQRDHDKTKRELETETASKIEMQRKMADFFGGFKA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LVK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 759 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08799 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  759 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       759 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LVK SER A 65  ? UNP P08799 VAL 65  CONFLICT 65  1  
1 1LVK THR A 273 ? UNP P08799 GLU 273 CONFLICT 273 2  
1 1LVK SER A 274 ? UNP P08799 THR 274 CONFLICT 274 3  
1 1LVK CYS A 312 ? UNP P08799 TYR 312 CONFLICT 312 4  
1 1LVK GLU A 321 ? UNP P08799 SER 321 CONFLICT 321 5  
1 1LVK ASP A 322 ? UNP P08799 GLU 322 CONFLICT 322 6  
1 1LVK SER A 443 ? UNP P08799 GLN 443 CONFLICT 443 7  
1 1LVK VAL A 489 ? UNP P08799 LEU 489 CONFLICT 489 8  
1 1LVK LYS A 493 ? UNP P08799 GLU 493 CONFLICT 493 9  
1 1LVK LEU A 628 ? UNP P08799 ILE 628 CONFLICT 628 10 
1 1LVK ASP A 707 ? UNP P08799 LEU 707 CONFLICT 707 11 
1 1LVK PHE A 737 ? UNP P08799 TYR 737 CONFLICT 737 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                  ?        'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                 ?        'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                               ?        'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                          ?        'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION'                              ?        'Be F3 -1'          66.007  
CYS 'L-peptide linking' y CYSTEINE                                                 ?        'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                ?        'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                          ?        'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                  ?        'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                ?        'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                    ?        'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                               ?        'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                  ?        'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                   ?        'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                               ?        'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                          ?        'Mg 2'              24.305  
MNT non-polymer         . "2'(3')-O-N-METHYLANTHRANILOYL-ADENOSINE-5'-DIPHOSPHATE" MANT-ADP 'C18 H22 N6 O10 P2' 544.349 
PHE 'L-peptide linking' y PHENYLALANINE                                            ?        'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                  ?        'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                   ?        'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                ?        'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                               ?        'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                 ?        'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                   ?        'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1LVK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.62 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           174 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'PRINCETON 2K' 
_diffrn_detector.pdbx_collection_date   1997-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.918 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1LVK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   79437 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.0850000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        58.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.1680000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    20.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LVK 
_refine.ls_number_reflns_obs                     79437 
_refine.ls_number_reflns_all                     79437 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2000000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5906 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               5955 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.637 ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1LVK 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2000000 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1LVK 
_struct.title                     
;X-RAY CRYSTAL STRUCTURE OF THE MG (DOT) 2'(3')-O-(N-METHYLANTHRANILOYL) NUCLEOTIDE BOUND TO DICTYOSTELIUM DISCOIDEUM MYOSIN MOTOR DOMAIN
;
_struct.pdbx_descriptor           
;MYOSIN, 2'(3')-O-N-METHYLANTHRANILOYL-ADENOSINE-5'-DIPHOSPHATE, BERYLLIUM TRIFLUORIDE ION
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LVK 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            'MYOSIN, DICTYOSTELIUM, MOTOR, MANT, ATPASE, ACTIN-BINDING, COILED COIL, CONTRACTILE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 10  ? LEU A 15  ? ASP A 10  LEU A 15  1 ? 6  
HELX_P HELX_P2  2  PHE A 25  ? THR A 28  ? PHE A 25  THR A 28  5 ? 4  
HELX_P HELX_P3  3  LYS A 74  ? ASP A 76  ? LYS A 74  ASP A 76  5 ? 3  
HELX_P HELX_P4  4  ILE A 83  ? PHE A 85  ? ILE A 83  PHE A 85  5 ? 3  
HELX_P HELX_P5  5  MET A 91  ? GLU A 93  ? MET A 91  GLU A 93  5 ? 3  
HELX_P HELX_P6  6  GLU A 99  ? GLN A 112 ? GLU A 99  GLN A 112 1 ? 14 
HELX_P HELX_P7  7  GLN A 137 ? PHE A 143 ? GLN A 137 PHE A 143 1 ? 7  
HELX_P HELX_P8  8  ARG A 148 ? GLU A 150 ? ARG A 148 GLU A 150 5 ? 3  
HELX_P HELX_P9  9  ILE A 155 ? ASP A 169 ? ILE A 155 ASP A 169 1 ? 15 
HELX_P HELX_P10 10 LYS A 185 ? ALA A 200 ? LYS A 185 ALA A 200 1 ? 16 
HELX_P HELX_P11 11 VAL A 210 ? GLY A 226 ? VAL A 210 GLY A 226 1 ? 17 
HELX_P HELX_P12 12 LYS A 265 ? VAL A 268 ? LYS A 265 VAL A 268 5 ? 4  
HELX_P HELX_P13 13 HIS A 279 ? GLY A 287 ? HIS A 279 GLY A 287 1 ? 9  
HELX_P HELX_P14 14 ALA A 290 ? LEU A 296 ? ALA A 290 LEU A 296 1 ? 7  
HELX_P HELX_P15 15 PRO A 301 ? SER A 303 ? PRO A 301 SER A 303 5 ? 3  
HELX_P HELX_P16 16 ASP A 320 ? VAL A 334 ? ASP A 320 VAL A 334 1 ? 15 
HELX_P HELX_P17 17 GLN A 338 ? ASN A 356 ? GLN A 338 ASN A 356 1 ? 19 
HELX_P HELX_P18 18 THR A 373 ? PHE A 382 ? THR A 373 PHE A 382 1 ? 10 
HELX_P HELX_P19 19 PRO A 386 ? MET A 394 ? PRO A 386 MET A 394 1 ? 9  
HELX_P HELX_P20 20 VAL A 411 ? LEU A 441 ? VAL A 411 LEU A 441 1 ? 31 
HELX_P HELX_P21 21 PHE A 466 ? GLU A 497 ? PHE A 466 GLU A 497 1 ? 32 
HELX_P HELX_P22 22 SER A 510 ? ASP A 518 ? SER A 510 ASP A 518 1 ? 9  
HELX_P HELX_P23 23 ILE A 525 ? VAL A 534 ? ILE A 525 VAL A 534 1 ? 10 
HELX_P HELX_P24 24 ASP A 540 ? PHE A 551 ? ASP A 540 PHE A 551 1 ? 12 
HELX_P HELX_P25 25 TRP A 584 ? LYS A 589 ? TRP A 584 LYS A 589 1 ? 6  
HELX_P HELX_P26 26 GLN A 594 ? ASP A 602 ? GLN A 594 ASP A 602 1 ? 9  
HELX_P HELX_P27 27 ASN A 606 ? ASN A 613 ? ASN A 606 ASN A 613 1 ? 8  
HELX_P HELX_P28 28 PRO A 615 ? ALA A 618 ? PRO A 615 ALA A 618 1 ? 4  
HELX_P HELX_P29 29 VAL A 630 ? THR A 647 ? VAL A 630 THR A 647 1 ? 18 
HELX_P HELX_P30 30 ASP A 669 ? CYS A 678 ? ASP A 669 CYS A 678 1 ? 10 
HELX_P HELX_P31 31 VAL A 681 ? LYS A 690 ? VAL A 681 LYS A 690 1 ? 10 
HELX_P HELX_P32 32 TYR A 698 ? LEU A 708 ? TYR A 698 LEU A 708 1 ? 11 
HELX_P HELX_P33 33 SER A 719 ? LEU A 730 ? SER A 719 LEU A 730 1 ? 12 
HELX_P HELX_P34 34 PRO A 734 ? GLN A 736 ? PRO A 734 GLN A 736 5 ? 3  
HELX_P HELX_P35 35 GLN A 750 ? GLU A 755 ? GLN A 750 GLU A 755 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG  . MG  ? ? ? 1_555 A THR 186 OG1 ? ? A MG  998 A THR 186  1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc2 metalc ? ? B MG  . MG  ? ? ? 1_555 A SER 237 OG  ? ? A MG  998 A SER 237  1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc3 metalc ? ? B MG  . MG  ? ? ? 1_555 C MNT .   O2B ? ? A MG  998 A MNT 999  1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc4 metalc ? ? B MG  . MG  ? ? ? 1_555 D BEF .   F3  ? ? A MG  998 A BEF 1000 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc5 metalc ? ? C MNT . O3B ? ? ? 1_555 D BEF .   BE  ? ? A MNT 999 A BEF 1000 1_555 ? ? ? ? ? ? ? 1.613 ? 
metalc6 metalc ? ? B MG  . MG  ? ? ? 1_555 E HOH .   O   ? ? A MG  998 A HOH 996  1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc7 metalc ? ? B MG  . MG  ? ? ? 1_555 E HOH .   O   ? ? A MG  998 A HOH 997  1_555 ? ? ? ? ? ? ? 2.194 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           521 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            521 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    522 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     522 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 34  ? TYR A 37  ? TYR A 34  TYR A 37  
A 2 GLU A 48  ? GLU A 55  ? GLU A 48  GLU A 55  
A 3 SER A 59  ? LYS A 63  ? SER A 59  LYS A 63  
A 4 ASP A 69  ? LYS A 73  ? ASP A 69  LYS A 73  
B 1 TYR A 116 ? SER A 119 ? TYR A 116 SER A 119 
B 2 PHE A 122 ? VAL A 126 ? PHE A 122 VAL A 126 
B 3 ASN A 649 ? ILE A 656 ? ASN A 649 ILE A 656 
B 4 GLN A 173 ? GLY A 179 ? GLN A 173 GLY A 179 
B 5 TYR A 448 ? SER A 456 ? TYR A 448 SER A 456 
B 6 GLY A 240 ? PHE A 247 ? GLY A 240 PHE A 247 
B 7 ILE A 253 ? TYR A 261 ? ILE A 253 TYR A 261 
C 1 ARG A 397 ? LEU A 399 ? ARG A 397 LEU A 399 
C 2 LEU A 404 ? ALA A 406 ? LEU A 404 ALA A 406 
D 1 TYR A 558 ? GLU A 560 ? TYR A 558 GLU A 560 
D 2 GLU A 567 ? HIS A 572 ? GLU A 567 HIS A 572 
D 3 GLY A 575 ? GLU A 580 ? GLY A 575 GLU A 580 
E 1 ASN A 694 ? ILE A 697 ? ASN A 694 ILE A 697 
E 2 LYS A 743 ? PHE A 746 ? LYS A 743 PHE A 746 
E 3 PHE A 737 ? PHE A 739 ? PHE A 737 PHE A 739 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 35  ? O ILE A 35  N GLY A 50  ? N GLY A 50  
A 2 3 O GLU A 51  ? O GLU A 51  N LYS A 63  ? N LYS A 63  
A 3 4 O PHE A 60  ? O PHE A 60  N VAL A 72  ? N VAL A 72  
B 1 2 O THR A 117 ? O THR A 117 N VAL A 124 ? N VAL A 124 
B 2 3 O LEU A 123 ? O LEU A 123 N PHE A 652 ? N PHE A 652 
B 3 4 O ASN A 649 ? O ASN A 649 N SER A 174 ? N SER A 174 
B 4 5 O GLN A 173 ? O GLN A 173 N GLY A 451 ? N GLY A 451 
B 5 6 O TYR A 448 ? O TYR A 448 N PHE A 247 ? N PHE A 247 
B 6 7 O GLY A 240 ? O GLY A 240 N TYR A 261 ? N TYR A 261 
C 1 2 O ILE A 398 ? O ILE A 398 N VAL A 405 ? N VAL A 405 
D 1 2 O GLU A 559 ? O GLU A 559 N GLY A 569 ? N GLY A 569 
D 2 3 O PHE A 568 ? O PHE A 568 N TYR A 579 ? N TYR A 579 
E 1 2 O ASN A 694 ? O ASN A 694 N PHE A 746 ? N PHE A 746 
E 2 3 O PHE A 745 ? O PHE A 745 N ARG A 738 ? N ARG A 738 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 998'   
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE MNT A 999'  
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BEF A 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 186 ? THR A 186  . ? 1_555 ? 
2  AC1 6  SER A 237 ? SER A 237  . ? 1_555 ? 
3  AC1 6  HOH E .   ? HOH A 996  . ? 1_555 ? 
4  AC1 6  HOH E .   ? HOH A 997  . ? 1_555 ? 
5  AC1 6  MNT C .   ? MNT A 999  . ? 1_555 ? 
6  AC1 6  BEF D .   ? BEF A 1000 . ? 1_555 ? 
7  AC2 19 ASN A 127 ? ASN A 127  . ? 1_555 ? 
8  AC2 19 PRO A 128 ? PRO A 128  . ? 1_555 ? 
9  AC2 19 LYS A 130 ? LYS A 130  . ? 1_555 ? 
10 AC2 19 TYR A 135 ? TYR A 135  . ? 1_555 ? 
11 AC2 19 GLU A 180 ? GLU A 180  . ? 1_555 ? 
12 AC2 19 SER A 181 ? SER A 181  . ? 1_555 ? 
13 AC2 19 GLY A 182 ? GLY A 182  . ? 1_555 ? 
14 AC2 19 ALA A 183 ? ALA A 183  . ? 1_555 ? 
15 AC2 19 GLY A 184 ? GLY A 184  . ? 1_555 ? 
16 AC2 19 LYS A 185 ? LYS A 185  . ? 1_555 ? 
17 AC2 19 THR A 186 ? THR A 186  . ? 1_555 ? 
18 AC2 19 GLU A 187 ? GLU A 187  . ? 1_555 ? 
19 AC2 19 ASN A 233 ? ASN A 233  . ? 1_555 ? 
20 AC2 19 ASN A 234 ? ASN A 234  . ? 1_555 ? 
21 AC2 19 ASN A 235 ? ASN A 235  . ? 1_555 ? 
22 AC2 19 HOH E .   ? HOH A 996  . ? 1_555 ? 
23 AC2 19 HOH E .   ? HOH A 997  . ? 1_555 ? 
24 AC2 19 MG  B .   ? MG  A 998  . ? 1_555 ? 
25 AC2 19 BEF D .   ? BEF A 1000 . ? 1_555 ? 
26 AC3 10 SER A 181 ? SER A 181  . ? 1_555 ? 
27 AC3 10 GLY A 182 ? GLY A 182  . ? 1_555 ? 
28 AC3 10 LYS A 185 ? LYS A 185  . ? 1_555 ? 
29 AC3 10 ASN A 233 ? ASN A 233  . ? 1_555 ? 
30 AC3 10 SER A 236 ? SER A 236  . ? 1_555 ? 
31 AC3 10 SER A 237 ? SER A 237  . ? 1_555 ? 
32 AC3 10 HOH E .   ? HOH A 996  . ? 1_555 ? 
33 AC3 10 HOH E .   ? HOH A 997  . ? 1_555 ? 
34 AC3 10 MG  B .   ? MG  A 998  . ? 1_555 ? 
35 AC3 10 MNT C .   ? MNT A 999  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LVK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LVK 
_atom_sites.fract_transf_matrix[1][1]   0.009625 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005559 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018553 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BE 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 2   ? 50.697 44.758 -5.914  1.00 100.00 ? 2    ASN A N     1 
ATOM   2    C  CA    . ASN A 1 2   ? 49.566 44.336 -5.108  1.00 98.41  ? 2    ASN A CA    1 
ATOM   3    C  C     . ASN A 1 2   ? 50.039 43.988 -3.718  1.00 37.52  ? 2    ASN A C     1 
ATOM   4    O  O     . ASN A 1 2   ? 50.524 42.889 -3.444  1.00 74.11  ? 2    ASN A O     1 
ATOM   5    C  CB    . ASN A 1 2   ? 48.722 43.162 -5.709  1.00 71.16  ? 2    ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 2   ? 47.220 43.353 -5.608  1.00 100.00 ? 2    ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 2   ? 46.767 44.107 -4.718  1.00 100.00 ? 2    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 2   ? 46.453 42.695 -6.516  1.00 71.15  ? 2    ASN A ND2   1 
ATOM   9    N  N     . PRO A 1 3   ? 49.922 44.944 -2.823  1.00 100.00 ? 3    PRO A N     1 
ATOM   10   C  CA    . PRO A 1 3   ? 50.335 44.661 -1.479  1.00 92.33  ? 3    PRO A CA    1 
ATOM   11   C  C     . PRO A 1 3   ? 49.556 43.466 -0.983  1.00 40.28  ? 3    PRO A C     1 
ATOM   12   O  O     . PRO A 1 3   ? 50.032 42.755 -0.108  1.00 44.19  ? 3    PRO A O     1 
ATOM   13   C  CB    . PRO A 1 3   ? 50.103 45.924 -0.647  1.00 90.95  ? 3    PRO A CB    1 
ATOM   14   C  CG    . PRO A 1 3   ? 49.909 47.043 -1.649  1.00 64.60  ? 3    PRO A CG    1 
ATOM   15   C  CD    . PRO A 1 3   ? 49.659 46.395 -3.022  1.00 67.24  ? 3    PRO A CD    1 
ATOM   16   N  N     . ILE A 1 4   ? 48.404 43.196 -1.616  1.00 53.38  ? 4    ILE A N     1 
ATOM   17   C  CA    . ILE A 1 4   ? 47.555 42.052 -1.237  1.00 43.68  ? 4    ILE A CA    1 
ATOM   18   C  C     . ILE A 1 4   ? 48.284 40.763 -1.505  1.00 50.93  ? 4    ILE A C     1 
ATOM   19   O  O     . ILE A 1 4   ? 48.137 39.782 -0.800  1.00 46.42  ? 4    ILE A O     1 
ATOM   20   C  CB    . ILE A 1 4   ? 46.171 41.888 -1.893  1.00 39.21  ? 4    ILE A CB    1 
ATOM   21   C  CG1   . ILE A 1 4   ? 45.181 42.923 -1.416  1.00 41.46  ? 4    ILE A CG1   1 
ATOM   22   C  CG2   . ILE A 1 4   ? 45.631 40.560 -1.533  1.00 35.62  ? 4    ILE A CG2   1 
ATOM   23   C  CD1   . ILE A 1 4   ? 45.537 44.324 -1.907  1.00 76.46  ? 4    ILE A CD1   1 
ATOM   24   N  N     . HIS A 1 5   ? 49.085 40.786 -2.551  1.00 41.55  ? 5    HIS A N     1 
ATOM   25   C  CA    . HIS A 1 5   ? 49.847 39.619 -2.899  1.00 55.78  ? 5    HIS A CA    1 
ATOM   26   C  C     . HIS A 1 5   ? 51.274 39.727 -2.347  1.00 42.17  ? 5    HIS A C     1 
ATOM   27   O  O     . HIS A 1 5   ? 51.912 38.716 -2.105  1.00 100.00 ? 5    HIS A O     1 
ATOM   28   C  CB    . HIS A 1 5   ? 49.671 39.246 -4.396  1.00 60.67  ? 5    HIS A CB    1 
ATOM   29   C  CG    . HIS A 1 5   ? 48.243 39.386 -4.815  1.00 86.49  ? 5    HIS A CG    1 
ATOM   30   N  ND1   . HIS A 1 5   ? 47.289 38.440 -4.443  1.00 56.50  ? 5    HIS A ND1   1 
ATOM   31   C  CD2   . HIS A 1 5   ? 47.623 40.365 -5.558  1.00 100.00 ? 5    HIS A CD2   1 
ATOM   32   C  CE1   . HIS A 1 5   ? 46.121 38.869 -4.976  1.00 100.00 ? 5    HIS A CE1   1 
ATOM   33   N  NE2   . HIS A 1 5   ? 46.284 40.015 -5.652  1.00 100.00 ? 5    HIS A NE2   1 
ATOM   34   N  N     . ASP A 1 6   ? 51.721 40.980 -2.120  1.00 42.24  ? 6    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 6   ? 53.030 41.312 -1.586  1.00 33.20  ? 6    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 6   ? 53.170 41.098 -0.061  1.00 47.60  ? 6    ASP A C     1 
ATOM   37   O  O     . ASP A 1 6   ? 52.936 41.982 0.764   1.00 37.94  ? 6    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 6   ? 53.442 42.746 -1.951  1.00 33.71  ? 6    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 6   ? 54.853 43.006 -1.547  1.00 98.58  ? 6    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 6   ? 55.683 42.119 -1.391  1.00 72.95  ? 6    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 6   ? 55.096 44.290 -1.345  1.00 93.90  ? 6    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 7   ? 53.594 39.904 0.306   1.00 36.87  ? 7    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 7   ? 53.793 39.513 1.685   1.00 48.11  ? 7    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 7   ? 54.766 40.393 2.461   1.00 44.25  ? 7    ARG A C     1 
ATOM   45   O  O     . ARG A 1 7   ? 54.973 40.197 3.660   1.00 41.50  ? 7    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 7   ? 53.931 37.981 1.883   1.00 39.61  ? 7    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 7   ? 52.636 37.277 1.436   1.00 78.56  ? 7    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 7   ? 52.337 35.874 1.995   1.00 65.34  ? 7    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 7   ? 53.504 35.001 2.213   1.00 100.00 ? 7    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 7   ? 53.568 33.644 2.002   1.00 100.00 ? 7    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 7   ? 52.502 32.871 1.711   1.00 71.92  ? 7    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 7   ? 54.778 33.059 2.250   1.00 100.00 ? 7    ARG A NH2   1 
ATOM   53   N  N     . THR A 1 8   ? 55.313 41.421 1.816   1.00 50.17  ? 8    THR A N     1 
ATOM   54   C  CA    . THR A 1 8   ? 56.245 42.354 2.471   1.00 25.35  ? 8    THR A CA    1 
ATOM   55   C  C     . THR A 1 8   ? 55.625 43.746 2.691   1.00 25.82  ? 8    THR A C     1 
ATOM   56   O  O     . THR A 1 8   ? 56.205 44.640 3.330   1.00 31.27  ? 8    THR A O     1 
ATOM   57   C  CB    . THR A 1 8   ? 57.491 42.454 1.529   1.00 73.97  ? 8    THR A CB    1 
ATOM   58   O  OG1   . THR A 1 8   ? 57.154 43.116 0.276   1.00 42.58  ? 8    THR A OG1   1 
ATOM   59   C  CG2   . THR A 1 8   ? 57.929 41.035 1.154   1.00 55.82  ? 8    THR A CG2   1 
ATOM   60   N  N     . SER A 1 9   ? 54.387 43.906 2.170   1.00 24.46  ? 9    SER A N     1 
ATOM   61   C  CA    . SER A 1 9   ? 53.707 45.189 2.285   1.00 40.31  ? 9    SER A CA    1 
ATOM   62   C  C     . SER A 1 9   ? 53.211 45.432 3.701   1.00 31.44  ? 9    SER A C     1 
ATOM   63   O  O     . SER A 1 9   ? 53.119 44.486 4.498   1.00 31.13  ? 9    SER A O     1 
ATOM   64   C  CB    . SER A 1 9   ? 52.519 45.245 1.341   1.00 35.60  ? 9    SER A CB    1 
ATOM   65   O  OG    . SER A 1 9   ? 51.742 44.128 1.737   1.00 38.62  ? 9    SER A OG    1 
ATOM   66   N  N     . ASP A 1 10  ? 52.931 46.717 3.998   1.00 34.68  ? 10   ASP A N     1 
ATOM   67   C  CA    . ASP A 1 10  ? 52.389 47.153 5.271   1.00 33.22  ? 10   ASP A CA    1 
ATOM   68   C  C     . ASP A 1 10  ? 51.024 46.520 5.437   1.00 30.34  ? 10   ASP A C     1 
ATOM   69   O  O     . ASP A 1 10  ? 50.570 46.302 6.551   1.00 33.48  ? 10   ASP A O     1 
ATOM   70   C  CB    . ASP A 1 10  ? 52.185 48.659 5.236   1.00 25.93  ? 10   ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 10  ? 53.449 49.358 5.672   1.00 87.88  ? 10   ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 10  ? 54.501 48.804 5.682   1.00 34.15  ? 10   ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 10  ? 53.335 50.595 6.019   1.00 43.61  ? 10   ASP A OD2   1 
ATOM   74   N  N     . TYR A 1 11  ? 50.405 46.215 4.277   1.00 31.80  ? 11   TYR A N     1 
ATOM   75   C  CA    . TYR A 1 11  ? 49.116 45.553 4.179   1.00 27.36  ? 11   TYR A CA    1 
ATOM   76   C  C     . TYR A 1 11  ? 49.233 44.185 4.826   1.00 25.11  ? 11   TYR A C     1 
ATOM   77   O  O     . TYR A 1 11  ? 48.477 43.753 5.721   1.00 26.68  ? 11   TYR A O     1 
ATOM   78   C  CB    . TYR A 1 11  ? 48.564 45.466 2.736   1.00 22.15  ? 11   TYR A CB    1 
ATOM   79   C  CG    . TYR A 1 11  ? 47.360 44.512 2.715   1.00 25.81  ? 11   TYR A CG    1 
ATOM   80   C  CD1   . TYR A 1 11  ? 46.095 44.970 3.127   1.00 36.16  ? 11   TYR A CD1   1 
ATOM   81   C  CD2   . TYR A 1 11  ? 47.494 43.163 2.359   1.00 33.31  ? 11   TYR A CD2   1 
ATOM   82   C  CE1   . TYR A 1 11  ? 44.950 44.152 3.155   1.00 23.83  ? 11   TYR A CE1   1 
ATOM   83   C  CE2   . TYR A 1 11  ? 46.374 42.324 2.361   1.00 16.07  ? 11   TYR A CE2   1 
ATOM   84   C  CZ    . TYR A 1 11  ? 45.119 42.828 2.753   1.00 24.54  ? 11   TYR A CZ    1 
ATOM   85   O  OH    . TYR A 1 11  ? 44.062 42.002 2.730   1.00 21.12  ? 11   TYR A OH    1 
ATOM   86   N  N     . HIS A 1 12  ? 50.259 43.468 4.441   1.00 23.04  ? 12   HIS A N     1 
ATOM   87   C  CA    . HIS A 1 12  ? 50.430 42.185 5.082   1.00 24.04  ? 12   HIS A CA    1 
ATOM   88   C  C     . HIS A 1 12  ? 50.890 42.338 6.553   1.00 27.74  ? 12   HIS A C     1 
ATOM   89   O  O     . HIS A 1 12  ? 50.381 41.692 7.470   1.00 27.13  ? 12   HIS A O     1 
ATOM   90   C  CB    . HIS A 1 12  ? 51.424 41.306 4.270   1.00 21.64  ? 12   HIS A CB    1 
ATOM   91   C  CG    . HIS A 1 12  ? 50.671 40.559 3.223   1.00 46.24  ? 12   HIS A CG    1 
ATOM   92   N  ND1   . HIS A 1 12  ? 50.150 39.301 3.489   1.00 30.43  ? 12   HIS A ND1   1 
ATOM   93   C  CD2   . HIS A 1 12  ? 50.328 40.922 1.950   1.00 37.97  ? 12   HIS A CD2   1 
ATOM   94   C  CE1   . HIS A 1 12  ? 49.532 38.879 2.372   1.00 35.64  ? 12   HIS A CE1   1 
ATOM   95   N  NE2   . HIS A 1 12  ? 49.604 39.835 1.437   1.00 40.75  ? 12   HIS A NE2   1 
ATOM   96   N  N     . LYS A 1 13  ? 51.808 43.273 6.776   1.00 19.70  ? 13   LYS A N     1 
ATOM   97   C  CA    . LYS A 1 13  ? 52.339 43.487 8.098   1.00 35.34  ? 13   LYS A CA    1 
ATOM   98   C  C     . LYS A 1 13  ? 51.291 43.828 9.141   1.00 32.62  ? 13   LYS A C     1 
ATOM   99   O  O     . LYS A 1 13  ? 51.241 43.268 10.252  1.00 22.02  ? 13   LYS A O     1 
ATOM   100  C  CB    . LYS A 1 13  ? 53.406 44.581 7.973   1.00 30.87  ? 13   LYS A CB    1 
ATOM   101  C  CG    . LYS A 1 13  ? 54.361 44.732 9.148   1.00 35.37  ? 13   LYS A CG    1 
ATOM   102  C  CD    . LYS A 1 13  ? 55.823 45.074 8.714   1.00 31.21  ? 13   LYS A CD    1 
ATOM   103  C  CE    . LYS A 1 13  ? 56.477 43.963 7.903   1.00 67.32  ? 13   LYS A CE    1 
ATOM   104  N  NZ    . LYS A 1 13  ? 57.033 44.377 6.568   1.00 100.00 ? 13   LYS A NZ    1 
ATOM   105  N  N     . TYR A 1 14  ? 50.435 44.783 8.791   1.00 24.87  ? 14   TYR A N     1 
ATOM   106  C  CA    . TYR A 1 14  ? 49.482 45.294 9.774   1.00 18.19  ? 14   TYR A CA    1 
ATOM   107  C  C     . TYR A 1 14  ? 48.054 44.805 9.752   1.00 21.89  ? 14   TYR A C     1 
ATOM   108  O  O     . TYR A 1 14  ? 47.293 45.127 10.697  1.00 22.24  ? 14   TYR A O     1 
ATOM   109  C  CB    . TYR A 1 14  ? 49.504 46.798 9.667   1.00 14.76  ? 14   TYR A CB    1 
ATOM   110  C  CG    . TYR A 1 14  ? 50.867 47.451 10.011  1.00 29.93  ? 14   TYR A CG    1 
ATOM   111  C  CD1   . TYR A 1 14  ? 51.399 47.456 11.316  1.00 25.93  ? 14   TYR A CD1   1 
ATOM   112  C  CD2   . TYR A 1 14  ? 51.521 48.210 9.034   1.00 31.83  ? 14   TYR A CD2   1 
ATOM   113  C  CE1   . TYR A 1 14  ? 52.564 48.172 11.617  1.00 22.30  ? 14   TYR A CE1   1 
ATOM   114  C  CE2   . TYR A 1 14  ? 52.682 48.940 9.313   1.00 36.86  ? 14   TYR A CE2   1 
ATOM   115  C  CZ    . TYR A 1 14  ? 53.213 48.906 10.606  1.00 38.20  ? 14   TYR A CZ    1 
ATOM   116  O  OH    . TYR A 1 14  ? 54.360 49.647 10.857  1.00 31.00  ? 14   TYR A OH    1 
ATOM   117  N  N     . LEU A 1 15  ? 47.668 44.052 8.700   1.00 19.01  ? 15   LEU A N     1 
ATOM   118  C  CA    . LEU A 1 15  ? 46.259 43.631 8.595   1.00 25.65  ? 15   LEU A CA    1 
ATOM   119  C  C     . LEU A 1 15  ? 46.046 42.159 8.515   1.00 22.25  ? 15   LEU A C     1 
ATOM   120  O  O     . LEU A 1 15  ? 44.914 41.707 8.582   1.00 24.26  ? 15   LEU A O     1 
ATOM   121  C  CB    . LEU A 1 15  ? 45.632 44.250 7.355   1.00 17.95  ? 15   LEU A CB    1 
ATOM   122  C  CG    . LEU A 1 15  ? 45.471 45.740 7.648   1.00 22.19  ? 15   LEU A CG    1 
ATOM   123  C  CD1   . LEU A 1 15  ? 45.302 46.616 6.415   1.00 16.09  ? 15   LEU A CD1   1 
ATOM   124  C  CD2   . LEU A 1 15  ? 44.425 45.963 8.782   1.00 24.28  ? 15   LEU A CD2   1 
ATOM   125  N  N     . LYS A 1 16  ? 47.145 41.420 8.334   1.00 17.76  ? 16   LYS A N     1 
ATOM   126  C  CA    . LYS A 1 16  ? 47.033 39.977 8.169   1.00 18.68  ? 16   LYS A CA    1 
ATOM   127  C  C     . LYS A 1 16  ? 47.834 39.185 9.199   1.00 21.14  ? 16   LYS A C     1 
ATOM   128  O  O     . LYS A 1 16  ? 48.845 39.683 9.673   1.00 21.81  ? 16   LYS A O     1 
ATOM   129  C  CB    . LYS A 1 16  ? 47.644 39.504 6.767   1.00 21.93  ? 16   LYS A CB    1 
ATOM   130  C  CG    . LYS A 1 16  ? 47.125 40.246 5.563   1.00 22.30  ? 16   LYS A CG    1 
ATOM   131  C  CD    . LYS A 1 16  ? 45.736 39.765 5.348   1.00 16.84  ? 16   LYS A CD    1 
ATOM   132  C  CE    . LYS A 1 16  ? 45.587 38.268 5.134   1.00 24.11  ? 16   LYS A CE    1 
ATOM   133  N  NZ    . LYS A 1 16  ? 44.202 37.869 4.655   1.00 27.84  ? 16   LYS A NZ    1 
ATOM   134  N  N     . VAL A 1 17  ? 47.431 37.923 9.444   1.00 15.57  ? 17   VAL A N     1 
ATOM   135  C  CA    . VAL A 1 17  ? 48.227 37.056 10.232  1.00 19.35  ? 17   VAL A CA    1 
ATOM   136  C  C     . VAL A 1 17  ? 49.398 36.673 9.292   1.00 35.90  ? 17   VAL A C     1 
ATOM   137  O  O     . VAL A 1 17  ? 49.163 36.342 8.115   1.00 20.94  ? 17   VAL A O     1 
ATOM   138  C  CB    . VAL A 1 17  ? 47.435 35.846 10.583  1.00 20.09  ? 17   VAL A CB    1 
ATOM   139  C  CG1   . VAL A 1 17  ? 48.497 34.907 11.057  1.00 21.35  ? 17   VAL A CG1   1 
ATOM   140  C  CG2   . VAL A 1 17  ? 46.433 36.113 11.717  1.00 20.21  ? 17   VAL A CG2   1 
ATOM   141  N  N     . LYS A 1 18  ? 50.650 36.822 9.754   1.00 30.60  ? 18   LYS A N     1 
ATOM   142  C  CA    . LYS A 1 18  ? 51.822 36.528 8.925   1.00 20.33  ? 18   LYS A CA    1 
ATOM   143  C  C     . LYS A 1 18  ? 51.839 35.107 8.352   1.00 24.81  ? 18   LYS A C     1 
ATOM   144  O  O     . LYS A 1 18  ? 51.625 34.115 9.059   1.00 21.49  ? 18   LYS A O     1 
ATOM   145  C  CB    . LYS A 1 18  ? 53.160 36.844 9.517   1.00 27.95  ? 18   LYS A CB    1 
ATOM   146  C  CG    . LYS A 1 18  ? 54.224 36.965 8.450   1.00 21.53  ? 18   LYS A CG    1 
ATOM   147  C  CD    . LYS A 1 18  ? 55.522 37.510 9.081   1.00 21.58  ? 18   LYS A CD    1 
ATOM   148  C  CE    . LYS A 1 18  ? 56.650 37.447 8.034   1.00 30.44  ? 18   LYS A CE    1 
ATOM   149  N  NZ    . LYS A 1 18  ? 56.698 38.705 7.279   1.00 22.95  ? 18   LYS A NZ    1 
ATOM   150  N  N     . GLN A 1 19  ? 52.131 34.999 7.042   1.00 26.34  ? 19   GLN A N     1 
ATOM   151  C  CA    . GLN A 1 19  ? 52.138 33.685 6.451   1.00 22.86  ? 19   GLN A CA    1 
ATOM   152  C  C     . GLN A 1 19  ? 53.547 33.194 6.169   1.00 28.00  ? 19   GLN A C     1 
ATOM   153  O  O     . GLN A 1 19  ? 54.391 33.934 5.624   1.00 24.47  ? 19   GLN A O     1 
ATOM   154  C  CB    . GLN A 1 19  ? 51.305 33.637 5.145   1.00 56.62  ? 19   GLN A CB    1 
ATOM   155  C  CG    . GLN A 1 19  ? 49.762 33.769 5.194   1.00 45.15  ? 19   GLN A CG    1 
ATOM   156  C  CD    . GLN A 1 19  ? 49.414 34.724 4.072   1.00 100.00 ? 19   GLN A CD    1 
ATOM   157  O  OE1   . GLN A 1 19  ? 49.819 34.543 2.923   1.00 100.00 ? 19   GLN A OE1   1 
ATOM   158  N  NE2   . GLN A 1 19  ? 48.738 35.819 4.405   1.00 100.00 ? 19   GLN A NE2   1 
ATOM   159  N  N     . GLY A 1 20  ? 53.805 31.955 6.563   1.00 33.66  ? 20   GLY A N     1 
ATOM   160  C  CA    . GLY A 1 20  ? 55.111 31.376 6.308   1.00 60.05  ? 20   GLY A CA    1 
ATOM   161  C  C     . GLY A 1 20  ? 55.179 30.756 4.912   1.00 41.19  ? 20   GLY A C     1 
ATOM   162  O  O     . GLY A 1 20  ? 54.359 31.031 4.041   1.00 40.29  ? 20   GLY A O     1 
ATOM   163  N  N     . ASP A 1 21  ? 56.150 29.894 4.694   1.00 43.51  ? 21   ASP A N     1 
ATOM   164  C  CA    . ASP A 1 21  ? 56.367 29.239 3.408   1.00 77.52  ? 21   ASP A CA    1 
ATOM   165  C  C     . ASP A 1 21  ? 55.319 28.221 3.014   1.00 48.41  ? 21   ASP A C     1 
ATOM   166  O  O     . ASP A 1 21  ? 54.789 28.240 1.896   1.00 100.00 ? 21   ASP A O     1 
ATOM   167  C  CB    . ASP A 1 21  ? 57.650 28.398 3.435   1.00 30.28  ? 21   ASP A CB    1 
ATOM   168  C  CG    . ASP A 1 21  ? 58.841 29.305 3.548   1.00 100.00 ? 21   ASP A CG    1 
ATOM   169  O  OD1   . ASP A 1 21  ? 58.529 30.579 3.207   1.00 60.26  ? 21   ASP A OD1   1 
ATOM   170  O  OD2   . ASP A 1 21  ? 59.953 28.896 3.900   1.00 68.48  ? 21   ASP A OD2   1 
ATOM   171  N  N     . SER A 1 22  ? 55.067 27.290 3.934   1.00 60.33  ? 22   SER A N     1 
ATOM   172  C  CA    . SER A 1 22  ? 54.138 26.202 3.702   1.00 100.00 ? 22   SER A CA    1 
ATOM   173  C  C     . SER A 1 22  ? 52.758 26.414 4.304   1.00 100.00 ? 22   SER A C     1 
ATOM   174  O  O     . SER A 1 22  ? 52.574 27.056 5.345   1.00 46.03  ? 22   SER A O     1 
ATOM   175  C  CB    . SER A 1 22  ? 54.720 24.805 4.022   1.00 100.00 ? 22   SER A CB    1 
ATOM   176  O  OG    . SER A 1 22  ? 53.809 23.878 4.625   1.00 71.39  ? 22   SER A OG    1 
ATOM   177  N  N     . ASP A 1 23  ? 51.785 25.825 3.631   1.00 100.00 ? 23   ASP A N     1 
ATOM   178  C  CA    . ASP A 1 23  ? 50.408 25.901 4.072   1.00 100.00 ? 23   ASP A CA    1 
ATOM   179  C  C     . ASP A 1 23  ? 49.905 24.540 4.569   1.00 100.00 ? 23   ASP A C     1 
ATOM   180  O  O     . ASP A 1 23  ? 48.896 24.447 5.283   1.00 96.03  ? 23   ASP A O     1 
ATOM   181  C  CB    . ASP A 1 23  ? 49.545 26.563 2.951   1.00 100.00 ? 23   ASP A CB    1 
ATOM   182  C  CG    . ASP A 1 23  ? 49.822 26.092 1.529   1.00 100.00 ? 23   ASP A CG    1 
ATOM   183  O  OD1   . ASP A 1 23  ? 51.112 25.872 1.263   1.00 84.27  ? 23   ASP A OD1   1 
ATOM   184  O  OD2   . ASP A 1 23  ? 48.884 26.032 0.724   1.00 56.30  ? 23   ASP A OD2   1 
ATOM   185  N  N     . LEU A 1 24  ? 50.654 23.499 4.173   1.00 66.20  ? 24   LEU A N     1 
ATOM   186  C  CA    . LEU A 1 24  ? 50.424 22.088 4.466   1.00 75.14  ? 24   LEU A CA    1 
ATOM   187  C  C     . LEU A 1 24  ? 49.685 21.777 5.761   1.00 43.70  ? 24   LEU A C     1 
ATOM   188  O  O     . LEU A 1 24  ? 50.119 22.147 6.856   1.00 54.47  ? 24   LEU A O     1 
ATOM   189  C  CB    . LEU A 1 24  ? 51.751 21.318 4.371   1.00 73.97  ? 24   LEU A CB    1 
ATOM   190  C  CG    . LEU A 1 24  ? 52.343 21.476 2.976   1.00 100.00 ? 24   LEU A CG    1 
ATOM   191  C  CD1   . LEU A 1 24  ? 53.165 20.254 2.536   1.00 43.82  ? 24   LEU A CD1   1 
ATOM   192  C  CD2   . LEU A 1 24  ? 51.196 21.767 2.009   1.00 42.33  ? 24   LEU A CD2   1 
ATOM   193  N  N     . PHE A 1 25  ? 48.572 21.065 5.622   1.00 96.45  ? 25   PHE A N     1 
ATOM   194  C  CA    . PHE A 1 25  ? 47.750 20.653 6.748   1.00 94.63  ? 25   PHE A CA    1 
ATOM   195  C  C     . PHE A 1 25  ? 48.614 20.102 7.873   1.00 90.38  ? 25   PHE A C     1 
ATOM   196  O  O     . PHE A 1 25  ? 48.401 20.405 9.042   1.00 43.50  ? 25   PHE A O     1 
ATOM   197  C  CB    . PHE A 1 25  ? 46.773 19.543 6.243   1.00 47.52  ? 25   PHE A CB    1 
ATOM   198  C  CG    . PHE A 1 25  ? 45.917 18.752 7.236   1.00 59.00  ? 25   PHE A CG    1 
ATOM   199  C  CD1   . PHE A 1 25  ? 46.398 17.604 7.878   1.00 100.00 ? 25   PHE A CD1   1 
ATOM   200  C  CD2   . PHE A 1 25  ? 44.585 19.089 7.493   1.00 75.20  ? 25   PHE A CD2   1 
ATOM   201  C  CE1   . PHE A 1 25  ? 45.626 16.855 8.772   1.00 100.00 ? 25   PHE A CE1   1 
ATOM   202  C  CE2   . PHE A 1 25  ? 43.783 18.349 8.374   1.00 100.00 ? 25   PHE A CE2   1 
ATOM   203  C  CZ    . PHE A 1 25  ? 44.298 17.225 9.016   1.00 53.85  ? 25   PHE A CZ    1 
ATOM   204  N  N     . LYS A 1 26  ? 49.595 19.293 7.469   1.00 59.63  ? 26   LYS A N     1 
ATOM   205  C  CA    . LYS A 1 26  ? 50.534 18.593 8.324   1.00 51.42  ? 26   LYS A CA    1 
ATOM   206  C  C     . LYS A 1 26  ? 51.157 19.361 9.495   1.00 100.00 ? 26   LYS A C     1 
ATOM   207  O  O     . LYS A 1 26  ? 51.217 18.822 10.593  1.00 56.65  ? 26   LYS A O     1 
ATOM   208  C  CB    . LYS A 1 26  ? 51.608 17.929 7.474   1.00 85.04  ? 26   LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 26  ? 52.494 16.970 8.271   1.00 100.00 ? 26   LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 26  ? 53.753 16.504 7.522   1.00 100.00 ? 26   LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 26  ? 53.882 14.973 7.450   1.00 100.00 ? 26   LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 26  ? 55.268 14.496 7.239   1.00 100.00 ? 26   LYS A NZ    1 
ATOM   213  N  N     . LEU A 1 27  ? 51.658 20.581 9.275   1.00 44.20  ? 27   LEU A N     1 
ATOM   214  C  CA    . LEU A 1 27  ? 52.339 21.371 10.322  1.00 100.00 ? 27   LEU A CA    1 
ATOM   215  C  C     . LEU A 1 27  ? 51.637 21.434 11.675  1.00 48.06  ? 27   LEU A C     1 
ATOM   216  O  O     . LEU A 1 27  ? 52.193 21.071 12.742  1.00 51.07  ? 27   LEU A O     1 
ATOM   217  C  CB    . LEU A 1 27  ? 52.468 22.845 9.910   1.00 100.00 ? 27   LEU A CB    1 
ATOM   218  C  CG    . LEU A 1 27  ? 53.503 23.055 8.830   1.00 100.00 ? 27   LEU A CG    1 
ATOM   219  C  CD1   . LEU A 1 27  ? 54.140 21.721 8.399   1.00 67.01  ? 27   LEU A CD1   1 
ATOM   220  C  CD2   . LEU A 1 27  ? 52.858 23.773 7.672   1.00 61.40  ? 27   LEU A CD2   1 
ATOM   221  N  N     . THR A 1 28  ? 50.385 21.900 11.546  1.00 54.48  ? 28   THR A N     1 
ATOM   222  C  CA    . THR A 1 28  ? 49.438 22.152 12.608  1.00 78.09  ? 28   THR A CA    1 
ATOM   223  C  C     . THR A 1 28  ? 49.014 20.885 13.322  1.00 100.00 ? 28   THR A C     1 
ATOM   224  O  O     . THR A 1 28  ? 48.169 20.897 14.218  1.00 62.47  ? 28   THR A O     1 
ATOM   225  C  CB    . THR A 1 28  ? 48.261 23.028 12.067  1.00 51.01  ? 28   THR A CB    1 
ATOM   226  O  OG1   . THR A 1 28  ? 47.621 22.426 10.952  1.00 45.06  ? 28   THR A OG1   1 
ATOM   227  C  CG2   . THR A 1 28  ? 48.763 24.410 11.658  1.00 43.74  ? 28   THR A CG2   1 
ATOM   228  N  N     . VAL A 1 29  ? 49.610 19.774 12.917  1.00 41.71  ? 29   VAL A N     1 
ATOM   229  C  CA    . VAL A 1 29  ? 49.269 18.525 13.545  1.00 59.72  ? 29   VAL A CA    1 
ATOM   230  C  C     . VAL A 1 29  ? 49.740 18.386 15.006  1.00 100.00 ? 29   VAL A C     1 
ATOM   231  O  O     . VAL A 1 29  ? 50.856 18.764 15.399  1.00 46.45  ? 29   VAL A O     1 
ATOM   232  C  CB    . VAL A 1 29  ? 49.585 17.375 12.617  1.00 47.27  ? 29   VAL A CB    1 
ATOM   233  C  CG1   . VAL A 1 29  ? 49.234 16.082 13.362  1.00 100.00 ? 29   VAL A CG1   1 
ATOM   234  C  CG2   . VAL A 1 29  ? 48.750 17.491 11.344  1.00 65.50  ? 29   VAL A CG2   1 
ATOM   235  N  N     . SER A 1 30  ? 48.831 17.835 15.813  1.00 56.01  ? 30   SER A N     1 
ATOM   236  C  CA    . SER A 1 30  ? 49.044 17.579 17.238  1.00 100.00 ? 30   SER A CA    1 
ATOM   237  C  C     . SER A 1 30  ? 47.971 16.663 17.833  1.00 100.00 ? 30   SER A C     1 
ATOM   238  O  O     . SER A 1 30  ? 46.787 16.703 17.447  1.00 48.71  ? 30   SER A O     1 
ATOM   239  C  CB    . SER A 1 30  ? 49.219 18.829 18.092  1.00 45.07  ? 30   SER A CB    1 
ATOM   240  O  OG    . SER A 1 30  ? 49.861 18.522 19.339  1.00 53.18  ? 30   SER A OG    1 
ATOM   241  N  N     . ASP A 1 31  ? 48.416 15.846 18.802  1.00 79.03  ? 31   ASP A N     1 
ATOM   242  C  CA    . ASP A 1 31  ? 47.592 14.888 19.515  1.00 77.15  ? 31   ASP A CA    1 
ATOM   243  C  C     . ASP A 1 31  ? 46.715 15.495 20.636  1.00 50.94  ? 31   ASP A C     1 
ATOM   244  O  O     . ASP A 1 31  ? 45.597 15.044 20.905  1.00 50.79  ? 31   ASP A O     1 
ATOM   245  C  CB    . ASP A 1 31  ? 48.475 13.707 19.975  1.00 91.38  ? 31   ASP A CB    1 
ATOM   246  C  CG    . ASP A 1 31  ? 49.966 13.972 20.076  1.00 100.00 ? 31   ASP A CG    1 
ATOM   247  O  OD1   . ASP A 1 31  ? 50.361 15.041 19.428  1.00 88.04  ? 31   ASP A OD1   1 
ATOM   248  O  OD2   . ASP A 1 31  ? 50.708 13.253 20.712  1.00 100.00 ? 31   ASP A OD2   1 
ATOM   249  N  N     . LYS A 1 32  ? 47.232 16.531 21.285  1.00 78.09  ? 32   LYS A N     1 
ATOM   250  C  CA    . LYS A 1 32  ? 46.538 17.228 22.359  1.00 100.00 ? 32   LYS A CA    1 
ATOM   251  C  C     . LYS A 1 32  ? 45.169 17.799 21.953  1.00 53.81  ? 32   LYS A C     1 
ATOM   252  O  O     . LYS A 1 32  ? 44.978 18.304 20.837  1.00 69.64  ? 32   LYS A O     1 
ATOM   253  C  CB    . LYS A 1 32  ? 47.457 18.295 22.976  1.00 79.22  ? 32   LYS A CB    1 
ATOM   254  C  CG    . LYS A 1 32  ? 48.951 18.011 22.796  1.00 71.46  ? 32   LYS A CG    1 
ATOM   255  C  CD    . LYS A 1 32  ? 49.670 17.657 24.099  1.00 100.00 ? 32   LYS A CD    1 
ATOM   256  C  CE    . LYS A 1 32  ? 50.230 16.232 24.137  1.00 100.00 ? 32   LYS A CE    1 
ATOM   257  N  NZ    . LYS A 1 32  ? 49.656 15.270 23.297  1.00 100.00 ? 32   LYS A NZ    1 
ATOM   258  N  N     . ARG A 1 33  ? 44.232 17.730 22.903  1.00 43.45  ? 33   ARG A N     1 
ATOM   259  C  CA    . ARG A 1 33  ? 42.868 18.216 22.758  1.00 42.51  ? 33   ARG A CA    1 
ATOM   260  C  C     . ARG A 1 33  ? 42.526 19.038 23.976  1.00 38.29  ? 33   ARG A C     1 
ATOM   261  O  O     . ARG A 1 33  ? 42.461 18.515 25.072  1.00 66.56  ? 33   ARG A O     1 
ATOM   262  C  CB    . ARG A 1 33  ? 41.903 17.060 22.596  1.00 52.03  ? 33   ARG A CB    1 
ATOM   263  C  CG    . ARG A 1 33  ? 41.728 16.580 21.132  1.00 34.91  ? 33   ARG A CG    1 
ATOM   264  C  CD    . ARG A 1 33  ? 40.283 16.086 20.967  1.00 100.00 ? 33   ARG A CD    1 
ATOM   265  N  NE    . ARG A 1 33  ? 39.927 15.096 22.005  1.00 100.00 ? 33   ARG A NE    1 
ATOM   266  C  CZ    . ARG A 1 33  ? 38.701 14.758 22.505  1.00 100.00 ? 33   ARG A CZ    1 
ATOM   267  N  NH1   . ARG A 1 33  ? 37.521 15.346 22.072  1.00 55.28  ? 33   ARG A NH1   1 
ATOM   268  N  NH2   . ARG A 1 33  ? 38.667 13.785 23.461  1.00 100.00 ? 33   ARG A NH2   1 
ATOM   269  N  N     . TYR A 1 34  ? 42.321 20.329 23.789  1.00 37.36  ? 34   TYR A N     1 
ATOM   270  C  CA    . TYR A 1 34  ? 42.083 21.244 24.886  1.00 29.58  ? 34   TYR A CA    1 
ATOM   271  C  C     . TYR A 1 34  ? 40.645 21.677 25.178  1.00 36.52  ? 34   TYR A C     1 
ATOM   272  O  O     . TYR A 1 34  ? 39.688 21.553 24.420  1.00 24.64  ? 34   TYR A O     1 
ATOM   273  C  CB    . TYR A 1 34  ? 43.056 22.467 24.836  1.00 42.45  ? 34   TYR A CB    1 
ATOM   274  C  CG    . TYR A 1 34  ? 44.498 22.075 24.587  1.00 44.83  ? 34   TYR A CG    1 
ATOM   275  C  CD1   . TYR A 1 34  ? 45.302 21.652 25.655  1.00 55.89  ? 34   TYR A CD1   1 
ATOM   276  C  CD2   . TYR A 1 34  ? 45.062 22.028 23.306  1.00 100.00 ? 34   TYR A CD2   1 
ATOM   277  C  CE1   . TYR A 1 34  ? 46.609 21.237 25.463  1.00 86.77  ? 34   TYR A CE1   1 
ATOM   278  C  CE2   . TYR A 1 34  ? 46.368 21.619 23.074  1.00 44.97  ? 34   TYR A CE2   1 
ATOM   279  C  CZ    . TYR A 1 34  ? 47.146 21.182 24.170  1.00 100.00 ? 34   TYR A CZ    1 
ATOM   280  O  OH    . TYR A 1 34  ? 48.446 20.761 23.948  1.00 66.35  ? 34   TYR A OH    1 
ATOM   281  N  N     . ILE A 1 35  ? 40.526 22.294 26.333  1.00 33.05  ? 35   ILE A N     1 
ATOM   282  C  CA    . ILE A 1 35  ? 39.267 22.837 26.778  1.00 34.74  ? 35   ILE A CA    1 
ATOM   283  C  C     . ILE A 1 35  ? 39.491 24.180 27.485  1.00 40.48  ? 35   ILE A C     1 
ATOM   284  O  O     . ILE A 1 35  ? 40.565 24.460 27.998  1.00 39.82  ? 35   ILE A O     1 
ATOM   285  C  CB    . ILE A 1 35  ? 38.548 21.747 27.587  1.00 37.36  ? 35   ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 35  ? 37.044 21.882 27.359  1.00 72.55  ? 35   ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 35  ? 38.968 21.704 29.090  1.00 43.86  ? 35   ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 35  ? 36.167 21.545 28.555  1.00 47.64  ? 35   ILE A CD1   1 
ATOM   289  N  N     . TRP A 1 36  ? 38.494 25.049 27.468  1.00 29.62  ? 36   TRP A N     1 
ATOM   290  C  CA    . TRP A 1 36  ? 38.656 26.309 28.168  1.00 36.00  ? 36   TRP A CA    1 
ATOM   291  C  C     . TRP A 1 36  ? 37.947 26.139 29.498  1.00 49.20  ? 36   TRP A C     1 
ATOM   292  O  O     . TRP A 1 36  ? 36.804 25.687 29.534  1.00 32.70  ? 36   TRP A O     1 
ATOM   293  C  CB    . TRP A 1 36  ? 37.952 27.481 27.404  1.00 37.28  ? 36   TRP A CB    1 
ATOM   294  C  CG    . TRP A 1 36  ? 38.619 27.749 26.113  1.00 39.23  ? 36   TRP A CG    1 
ATOM   295  C  CD1   . TRP A 1 36  ? 38.118 27.519 24.852  1.00 23.28  ? 36   TRP A CD1   1 
ATOM   296  C  CD2   . TRP A 1 36  ? 39.984 28.186 25.957  1.00 20.96  ? 36   TRP A CD2   1 
ATOM   297  N  NE1   . TRP A 1 36  ? 39.014 27.970 23.926  1.00 26.97  ? 36   TRP A NE1   1 
ATOM   298  C  CE2   . TRP A 1 36  ? 40.173 28.396 24.546  1.00 23.40  ? 36   TRP A CE2   1 
ATOM   299  C  CE3   . TRP A 1 36  ? 41.007 28.555 26.854  1.00 23.87  ? 36   TRP A CE3   1 
ATOM   300  C  CZ2   . TRP A 1 36  ? 41.406 28.823 24.032  1.00 27.66  ? 36   TRP A CZ2   1 
ATOM   301  C  CZ3   . TRP A 1 36  ? 42.217 28.996 26.354  1.00 32.08  ? 36   TRP A CZ3   1 
ATOM   302  C  CH2   . TRP A 1 36  ? 42.400 29.111 24.968  1.00 48.89  ? 36   TRP A CH2   1 
ATOM   303  N  N     . TYR A 1 37  ? 38.606 26.449 30.599  1.00 48.42  ? 37   TYR A N     1 
ATOM   304  C  CA    . TYR A 1 37  ? 37.940 26.302 31.882  1.00 39.45  ? 37   TYR A CA    1 
ATOM   305  C  C     . TYR A 1 37  ? 38.233 27.503 32.740  1.00 38.20  ? 37   TYR A C     1 
ATOM   306  O  O     . TYR A 1 37  ? 39.276 28.131 32.565  1.00 42.12  ? 37   TYR A O     1 
ATOM   307  C  CB    . TYR A 1 37  ? 38.374 24.979 32.630  1.00 27.98  ? 37   TYR A CB    1 
ATOM   308  C  CG    . TYR A 1 37  ? 39.772 25.047 33.200  1.00 39.52  ? 37   TYR A CG    1 
ATOM   309  C  CD1   . TYR A 1 37  ? 40.855 24.682 32.400  1.00 41.09  ? 37   TYR A CD1   1 
ATOM   310  C  CD2   . TYR A 1 37  ? 40.026 25.503 34.493  1.00 47.90  ? 37   TYR A CD2   1 
ATOM   311  C  CE1   . TYR A 1 37  ? 42.161 24.785 32.875  1.00 42.91  ? 37   TYR A CE1   1 
ATOM   312  C  CE2   . TYR A 1 37  ? 41.329 25.552 34.992  1.00 32.09  ? 37   TYR A CE2   1 
ATOM   313  C  CZ    . TYR A 1 37  ? 42.408 25.221 34.175  1.00 45.48  ? 37   TYR A CZ    1 
ATOM   314  O  OH    . TYR A 1 37  ? 43.718 25.286 34.589  1.00 47.35  ? 37   TYR A OH    1 
ATOM   315  N  N     . ASN A 1 38  ? 37.322 27.786 33.664  1.00 38.99  ? 38   ASN A N     1 
ATOM   316  C  CA    . ASN A 1 38  ? 37.499 28.887 34.617  1.00 56.01  ? 38   ASN A CA    1 
ATOM   317  C  C     . ASN A 1 38  ? 38.329 28.400 35.767  1.00 30.33  ? 38   ASN A C     1 
ATOM   318  O  O     . ASN A 1 38  ? 37.950 27.439 36.456  1.00 47.21  ? 38   ASN A O     1 
ATOM   319  C  CB    . ASN A 1 38  ? 36.219 29.466 35.179  1.00 37.00  ? 38   ASN A CB    1 
ATOM   320  C  CG    . ASN A 1 38  ? 35.453 30.257 34.125  1.00 100.00 ? 38   ASN A CG    1 
ATOM   321  O  OD1   . ASN A 1 38  ? 34.259 29.942 33.859  1.00 57.09  ? 38   ASN A OD1   1 
ATOM   322  N  ND2   . ASN A 1 38  ? 36.145 31.267 33.509  1.00 43.40  ? 38   ASN A ND2   1 
ATOM   323  N  N     . PRO A 1 39  ? 39.503 28.996 35.927  1.00 93.08  ? 39   PRO A N     1 
ATOM   324  C  CA    . PRO A 1 39  ? 40.396 28.573 36.977  1.00 51.42  ? 39   PRO A CA    1 
ATOM   325  C  C     . PRO A 1 39  ? 39.769 28.810 38.368  1.00 62.53  ? 39   PRO A C     1 
ATOM   326  O  O     . PRO A 1 39  ? 40.429 28.642 39.397  1.00 76.35  ? 39   PRO A O     1 
ATOM   327  C  CB    . PRO A 1 39  ? 41.716 29.310 36.695  1.00 93.92  ? 39   PRO A CB    1 
ATOM   328  C  CG    . PRO A 1 39  ? 41.372 30.514 35.796  1.00 100.00 ? 39   PRO A CG    1 
ATOM   329  C  CD    . PRO A 1 39  ? 39.907 30.347 35.416  1.00 100.00 ? 39   PRO A CD    1 
ATOM   330  N  N     . ASP A 1 40  ? 38.469 29.050 38.374  1.00 77.80  ? 40   ASP A N     1 
ATOM   331  C  CA    . ASP A 1 40  ? 37.638 29.252 39.551  1.00 37.06  ? 40   ASP A CA    1 
ATOM   332  C  C     . ASP A 1 40  ? 36.433 30.137 39.287  1.00 48.84  ? 40   ASP A C     1 
ATOM   333  O  O     . ASP A 1 40  ? 36.580 31.161 38.604  1.00 53.16  ? 40   ASP A O     1 
ATOM   334  C  CB    . ASP A 1 40  ? 38.299 29.492 40.877  1.00 100.00 ? 40   ASP A CB    1 
ATOM   335  C  CG    . ASP A 1 40  ? 38.700 30.909 40.961  1.00 100.00 ? 40   ASP A CG    1 
ATOM   336  O  OD1   . ASP A 1 40  ? 39.601 31.354 40.263  1.00 97.07  ? 40   ASP A OD1   1 
ATOM   337  O  OD2   . ASP A 1 40  ? 37.966 31.574 41.830  1.00 54.56  ? 40   ASP A OD2   1 
ATOM   338  N  N     . PRO A 1 41  ? 35.246 29.728 39.773  1.00 45.35  ? 41   PRO A N     1 
ATOM   339  C  CA    . PRO A 1 41  ? 34.049 30.505 39.521  1.00 62.51  ? 41   PRO A CA    1 
ATOM   340  C  C     . PRO A 1 41  ? 33.923 31.762 40.340  1.00 100.00 ? 41   PRO A C     1 
ATOM   341  O  O     . PRO A 1 41  ? 32.904 32.451 40.296  1.00 98.92  ? 41   PRO A O     1 
ATOM   342  C  CB    . PRO A 1 41  ? 32.812 29.654 39.358  1.00 75.70  ? 41   PRO A CB    1 
ATOM   343  C  CG    . PRO A 1 41  ? 33.398 28.265 39.261  1.00 95.88  ? 41   PRO A CG    1 
ATOM   344  C  CD    . PRO A 1 41  ? 34.837 28.301 39.794  1.00 91.05  ? 41   PRO A CD    1 
ATOM   345  N  N     . LYS A 1 42  ? 34.988 32.068 41.068  1.00 56.83  ? 42   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 42  ? 35.009 33.311 41.788  1.00 86.65  ? 42   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 42  ? 35.001 34.379 40.694  1.00 100.00 ? 42   LYS A C     1 
ATOM   348  O  O     . LYS A 1 42  ? 34.598 35.528 40.867  1.00 100.00 ? 42   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 42  ? 36.305 33.434 42.574  1.00 72.12  ? 42   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 42  ? 36.344 32.648 43.894  1.00 100.00 ? 42   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 42  ? 37.031 33.420 45.030  1.00 100.00 ? 42   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 42  ? 37.331 32.641 46.315  1.00 100.00 ? 42   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 42  ? 37.534 33.500 47.493  1.00 100.00 ? 42   LYS A NZ    1 
ATOM   354  N  N     . GLU A 1 43  ? 35.471 33.937 39.520  1.00 100.00 ? 43   GLU A N     1 
ATOM   355  C  CA    . GLU A 1 43  ? 35.588 34.730 38.309  1.00 100.00 ? 43   GLU A CA    1 
ATOM   356  C  C     . GLU A 1 43  ? 34.451 34.435 37.334  1.00 93.84  ? 43   GLU A C     1 
ATOM   357  O  O     . GLU A 1 43  ? 33.311 34.853 37.562  1.00 100.00 ? 43   GLU A O     1 
ATOM   358  C  CB    . GLU A 1 43  ? 36.946 34.415 37.633  1.00 100.00 ? 43   GLU A CB    1 
ATOM   359  C  CG    . GLU A 1 43  ? 38.233 34.881 38.391  1.00 65.68  ? 43   GLU A CG    1 
ATOM   360  C  CD    . GLU A 1 43  ? 39.436 33.991 38.004  1.00 100.00 ? 43   GLU A CD    1 
ATOM   361  O  OE1   . GLU A 1 43  ? 39.302 32.935 37.325  1.00 100.00 ? 43   GLU A OE1   1 
ATOM   362  O  OE2   . GLU A 1 43  ? 40.615 34.454 38.459  1.00 100.00 ? 43   GLU A OE2   1 
ATOM   363  N  N     . ARG A 1 44  ? 34.790 33.734 36.251  1.00 35.31  ? 44   ARG A N     1 
ATOM   364  C  CA    . ARG A 1 44  ? 33.883 33.314 35.190  1.00 30.20  ? 44   ARG A CA    1 
ATOM   365  C  C     . ARG A 1 44  ? 34.327 33.759 33.793  1.00 100.00 ? 44   ARG A C     1 
ATOM   366  O  O     . ARG A 1 44  ? 34.053 33.108 32.787  1.00 55.98  ? 44   ARG A O     1 
ATOM   367  C  CB    . ARG A 1 44  ? 32.365 33.392 35.335  1.00 34.62  ? 44   ARG A CB    1 
ATOM   368  C  CG    . ARG A 1 44  ? 31.589 33.649 34.003  1.00 61.98  ? 44   ARG A CG    1 
ATOM   369  C  CD    . ARG A 1 44  ? 30.805 34.985 34.017  1.00 100.00 ? 44   ARG A CD    1 
ATOM   370  N  NE    . ARG A 1 44  ? 29.743 35.348 33.017  1.00 100.00 ? 44   ARG A NE    1 
ATOM   371  C  CZ    . ARG A 1 44  ? 28.547 34.772 32.676  1.00 100.00 ? 44   ARG A CZ    1 
ATOM   372  N  NH1   . ARG A 1 44  ? 28.155 33.588 33.145  1.00 100.00 ? 44   ARG A NH1   1 
ATOM   373  N  NH2   . ARG A 1 44  ? 27.735 35.385 31.803  1.00 93.08  ? 44   ARG A NH2   1 
ATOM   374  N  N     . ASP A 1 45  ? 35.023 34.891 33.714  1.00 100.00 ? 45   ASP A N     1 
ATOM   375  C  CA    . ASP A 1 45  ? 35.483 35.387 32.425  1.00 38.28  ? 45   ASP A CA    1 
ATOM   376  C  C     . ASP A 1 45  ? 36.950 35.109 32.260  1.00 37.90  ? 45   ASP A C     1 
ATOM   377  O  O     . ASP A 1 45  ? 37.514 35.255 31.173  1.00 49.03  ? 45   ASP A O     1 
ATOM   378  C  CB    . ASP A 1 45  ? 34.956 36.764 32.030  1.00 40.63  ? 45   ASP A CB    1 
ATOM   379  C  CG    . ASP A 1 45  ? 33.485 36.678 31.684  1.00 27.60  ? 45   ASP A CG    1 
ATOM   380  O  OD1   . ASP A 1 45  ? 33.063 35.426 31.342  1.00 57.50  ? 45   ASP A OD1   1 
ATOM   381  O  OD2   . ASP A 1 45  ? 32.748 37.701 31.705  1.00 41.45  ? 45   ASP A OD2   1 
ATOM   382  N  N     . SER A 1 46  ? 37.546 34.674 33.370  1.00 38.53  ? 46   SER A N     1 
ATOM   383  C  CA    . SER A 1 46  ? 38.930 34.313 33.365  1.00 44.37  ? 46   SER A CA    1 
ATOM   384  C  C     . SER A 1 46  ? 38.963 32.827 33.129  1.00 51.46  ? 46   SER A C     1 
ATOM   385  O  O     . SER A 1 46  ? 38.364 32.044 33.844  1.00 52.80  ? 46   SER A O     1 
ATOM   386  C  CB    . SER A 1 46  ? 39.949 34.917 34.362  1.00 48.89  ? 46   SER A CB    1 
ATOM   387  O  OG    . SER A 1 46  ? 41.133 34.117 34.482  1.00 56.50  ? 46   SER A OG    1 
ATOM   388  N  N     . TYR A 1 47  ? 39.575 32.458 32.042  1.00 44.17  ? 47   TYR A N     1 
ATOM   389  C  CA    . TYR A 1 47  ? 39.630 31.077 31.658  1.00 48.13  ? 47   TYR A CA    1 
ATOM   390  C  C     . TYR A 1 47  ? 41.043 30.711 31.397  1.00 31.70  ? 47   TYR A C     1 
ATOM   391  O  O     . TYR A 1 47  ? 41.875 31.556 31.148  1.00 44.99  ? 47   TYR A O     1 
ATOM   392  C  CB    . TYR A 1 47  ? 38.852 30.641 30.365  1.00 38.25  ? 47   TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 47  ? 37.370 30.905 30.225  1.00 37.53  ? 47   TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 47  ? 36.872 32.201 30.042  1.00 24.78  ? 47   TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 47  ? 36.517 29.804 30.117  1.00 37.85  ? 47   TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 47  ? 35.494 32.394 29.882  1.00 26.47  ? 47   TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 47  ? 35.136 29.989 29.982  1.00 30.40  ? 47   TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 47  ? 34.631 31.285 29.936  1.00 24.08  ? 47   TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 47  ? 33.255 31.429 29.785  1.00 48.74  ? 47   TYR A OH    1 
ATOM   400  N  N     . GLU A 1 48  ? 41.245 29.419 31.438  1.00 32.96  ? 48   GLU A N     1 
ATOM   401  C  CA    . GLU A 1 48  ? 42.495 28.782 31.227  1.00 29.33  ? 48   GLU A CA    1 
ATOM   402  C  C     . GLU A 1 48  ? 42.219 27.597 30.330  1.00 16.95  ? 48   GLU A C     1 
ATOM   403  O  O     . GLU A 1 48  ? 41.097 27.111 30.274  1.00 36.77  ? 48   GLU A O     1 
ATOM   404  C  CB    . GLU A 1 48  ? 43.041 28.280 32.573  1.00 100.00 ? 48   GLU A CB    1 
ATOM   405  C  CG    . GLU A 1 48  ? 44.575 28.428 32.675  1.00 100.00 ? 48   GLU A CG    1 
ATOM   406  C  CD    . GLU A 1 48  ? 45.056 29.865 32.818  1.00 100.00 ? 48   GLU A CD    1 
ATOM   407  O  OE1   . GLU A 1 48  ? 44.300 30.610 33.607  1.00 100.00 ? 48   GLU A OE1   1 
ATOM   408  O  OE2   . GLU A 1 48  ? 46.056 30.288 32.276  1.00 100.00 ? 48   GLU A OE2   1 
ATOM   409  N  N     . CYS A 1 49  ? 43.282 27.194 29.641  1.00 33.66  ? 49   CYS A N     1 
ATOM   410  C  CA    . CYS A 1 49  ? 43.270 26.105 28.694  1.00 45.54  ? 49   CYS A CA    1 
ATOM   411  C  C     . CYS A 1 49  ? 43.708 24.870 29.421  1.00 77.25  ? 49   CYS A C     1 
ATOM   412  O  O     . CYS A 1 49  ? 44.785 24.821 29.994  1.00 54.38  ? 49   CYS A O     1 
ATOM   413  C  CB    . CYS A 1 49  ? 44.223 26.412 27.472  1.00 28.88  ? 49   CYS A CB    1 
ATOM   414  S  SG    . CYS A 1 49  ? 44.408 24.933 26.435  1.00 40.92  ? 49   CYS A SG    1 
ATOM   415  N  N     . GLY A 1 50  ? 42.845 23.885 29.414  1.00 39.49  ? 50   GLY A N     1 
ATOM   416  C  CA    . GLY A 1 50  ? 43.143 22.655 30.102  1.00 40.57  ? 50   GLY A CA    1 
ATOM   417  C  C     . GLY A 1 50  ? 43.189 21.552 29.099  1.00 36.35  ? 50   GLY A C     1 
ATOM   418  O  O     . GLY A 1 50  ? 42.340 21.482 28.229  1.00 38.88  ? 50   GLY A O     1 
ATOM   419  N  N     . GLU A 1 51  ? 44.219 20.744 29.175  1.00 44.91  ? 51   GLU A N     1 
ATOM   420  C  CA    . GLU A 1 51  ? 44.301 19.664 28.217  1.00 45.73  ? 51   GLU A CA    1 
ATOM   421  C  C     . GLU A 1 51  ? 43.459 18.500 28.683  1.00 34.75  ? 51   GLU A C     1 
ATOM   422  O  O     . GLU A 1 51  ? 43.493 18.136 29.860  1.00 52.94  ? 51   GLU A O     1 
ATOM   423  C  CB    . GLU A 1 51  ? 45.719 19.195 27.852  1.00 37.62  ? 51   GLU A CB    1 
ATOM   424  C  CG    . GLU A 1 51  ? 45.643 17.853 27.128  1.00 48.53  ? 51   GLU A CG    1 
ATOM   425  C  CD    . GLU A 1 51  ? 46.955 17.150 27.004  1.00 100.00 ? 51   GLU A CD    1 
ATOM   426  O  OE1   . GLU A 1 51  ? 47.979 17.958 27.266  1.00 54.04  ? 51   GLU A OE1   1 
ATOM   427  O  OE2   . GLU A 1 51  ? 47.001 15.949 26.783  1.00 92.03  ? 51   GLU A OE2   1 
ATOM   428  N  N     . ILE A 1 52  ? 42.671 17.943 27.766  1.00 35.89  ? 52   ILE A N     1 
ATOM   429  C  CA    . ILE A 1 52  ? 41.844 16.810 28.084  1.00 23.99  ? 52   ILE A CA    1 
ATOM   430  C  C     . ILE A 1 52  ? 42.777 15.620 28.131  1.00 80.10  ? 52   ILE A C     1 
ATOM   431  O  O     . ILE A 1 52  ? 43.444 15.331 27.142  1.00 56.98  ? 52   ILE A O     1 
ATOM   432  C  CB    . ILE A 1 52  ? 40.818 16.539 27.018  1.00 38.46  ? 52   ILE A CB    1 
ATOM   433  C  CG1   . ILE A 1 52  ? 39.819 17.637 26.828  1.00 50.34  ? 52   ILE A CG1   1 
ATOM   434  C  CG2   . ILE A 1 52  ? 40.142 15.148 27.165  1.00 43.84  ? 52   ILE A CG2   1 
ATOM   435  C  CD1   . ILE A 1 52  ? 39.273 17.539 25.405  1.00 54.17  ? 52   ILE A CD1   1 
ATOM   436  N  N     . VAL A 1 53  ? 42.831 14.991 29.306  1.00 89.20  ? 53   VAL A N     1 
ATOM   437  C  CA    . VAL A 1 53  ? 43.706 13.865 29.613  1.00 49.86  ? 53   VAL A CA    1 
ATOM   438  C  C     . VAL A 1 53  ? 43.010 12.519 29.496  1.00 43.52  ? 53   VAL A C     1 
ATOM   439  O  O     . VAL A 1 53  ? 43.643 11.460 29.438  1.00 100.00 ? 53   VAL A O     1 
ATOM   440  C  CB    . VAL A 1 53  ? 44.397 14.130 30.947  1.00 100.00 ? 53   VAL A CB    1 
ATOM   441  C  CG1   . VAL A 1 53  ? 44.867 15.599 30.934  1.00 79.50  ? 53   VAL A CG1   1 
ATOM   442  C  CG2   . VAL A 1 53  ? 43.457 13.870 32.125  1.00 49.98  ? 53   VAL A CG2   1 
ATOM   443  N  N     . SER A 1 54  ? 41.691 12.628 29.443  1.00 36.94  ? 54   SER A N     1 
ATOM   444  C  CA    . SER A 1 54  ? 40.803 11.500 29.260  1.00 39.76  ? 54   SER A CA    1 
ATOM   445  C  C     . SER A 1 54  ? 39.352 11.928 29.291  1.00 41.63  ? 54   SER A C     1 
ATOM   446  O  O     . SER A 1 54  ? 38.970 13.018 29.740  1.00 39.92  ? 54   SER A O     1 
ATOM   447  C  CB    . SER A 1 54  ? 40.894 10.559 30.446  1.00 100.00 ? 54   SER A CB    1 
ATOM   448  O  OG    . SER A 1 54  ? 39.683 10.702 31.206  1.00 79.63  ? 54   SER A OG    1 
ATOM   449  N  N     . GLU A 1 55  ? 38.523 10.994 28.899  1.00 55.10  ? 55   GLU A N     1 
ATOM   450  C  CA    . GLU A 1 55  ? 37.127 11.296 28.900  1.00 60.05  ? 55   GLU A CA    1 
ATOM   451  C  C     . GLU A 1 55  ? 36.310 10.070 29.086  1.00 82.34  ? 55   GLU A C     1 
ATOM   452  O  O     . GLU A 1 55  ? 36.723 8.937  28.752  1.00 100.00 ? 55   GLU A O     1 
ATOM   453  C  CB    . GLU A 1 55  ? 36.725 11.742 27.503  1.00 100.00 ? 55   GLU A CB    1 
ATOM   454  C  CG    . GLU A 1 55  ? 37.377 10.764 26.508  1.00 69.91  ? 55   GLU A CG    1 
ATOM   455  C  CD    . GLU A 1 55  ? 37.131 11.162 25.085  1.00 100.00 ? 55   GLU A CD    1 
ATOM   456  O  OE1   . GLU A 1 55  ? 36.081 10.856 24.547  1.00 60.41  ? 55   GLU A OE1   1 
ATOM   457  O  OE2   . GLU A 1 55  ? 38.125 11.859 24.549  1.00 99.54  ? 55   GLU A OE2   1 
ATOM   458  N  N     . THR A 1 56  ? 35.104 10.356 29.512  1.00 100.00 ? 56   THR A N     1 
ATOM   459  C  CA    . THR A 1 56  ? 34.137 9.319  29.666  1.00 100.00 ? 56   THR A CA    1 
ATOM   460  C  C     . THR A 1 56  ? 33.107 9.474  28.576  1.00 100.00 ? 56   THR A C     1 
ATOM   461  O  O     . THR A 1 56  ? 33.064 10.463 27.832  1.00 87.09  ? 56   THR A O     1 
ATOM   462  C  CB    . THR A 1 56  ? 33.437 9.239  31.039  1.00 100.00 ? 56   THR A CB    1 
ATOM   463  O  OG1   . THR A 1 56  ? 32.463 10.259 31.168  1.00 44.77  ? 56   THR A OG1   1 
ATOM   464  C  CG2   . THR A 1 56  ? 34.421 9.187  32.197  1.00 59.33  ? 56   THR A CG2   1 
ATOM   465  N  N     . SER A 1 57  ? 32.282 8.461  28.512  1.00 100.00 ? 57   SER A N     1 
ATOM   466  C  CA    . SER A 1 57  ? 31.196 8.393  27.588  1.00 89.48  ? 57   SER A CA    1 
ATOM   467  C  C     . SER A 1 57  ? 30.284 9.614  27.720  1.00 99.28  ? 57   SER A C     1 
ATOM   468  O  O     . SER A 1 57  ? 29.489 9.882  26.820  1.00 93.86  ? 57   SER A O     1 
ATOM   469  C  CB    . SER A 1 57  ? 30.540 7.099  28.052  1.00 100.00 ? 57   SER A CB    1 
ATOM   470  O  OG    . SER A 1 57  ? 31.470 6.377  28.903  1.00 77.93  ? 57   SER A OG    1 
ATOM   471  N  N     . ASP A 1 58  ? 30.431 10.372 28.830  1.00 50.12  ? 58   ASP A N     1 
ATOM   472  C  CA    . ASP A 1 58  ? 29.583 11.530 29.134  1.00 43.69  ? 58   ASP A CA    1 
ATOM   473  C  C     . ASP A 1 58  ? 30.313 12.818 29.526  1.00 100.00 ? 58   ASP A C     1 
ATOM   474  O  O     . ASP A 1 58  ? 29.702 13.876 29.720  1.00 45.32  ? 58   ASP A O     1 
ATOM   475  C  CB    . ASP A 1 58  ? 28.856 11.163 30.458  1.00 100.00 ? 58   ASP A CB    1 
ATOM   476  C  CG    . ASP A 1 58  ? 29.774 10.644 31.590  1.00 100.00 ? 58   ASP A CG    1 
ATOM   477  O  OD1   . ASP A 1 58  ? 30.344 9.471  31.350  1.00 91.26  ? 58   ASP A OD1   1 
ATOM   478  O  OD2   . ASP A 1 58  ? 29.961 11.224 32.646  1.00 100.00 ? 58   ASP A OD2   1 
ATOM   479  N  N     . SER A 1 59  ? 31.605 12.740 29.805  1.00 74.73  ? 59   SER A N     1 
ATOM   480  C  CA    . SER A 1 59  ? 32.296 13.941 30.234  1.00 47.61  ? 59   SER A CA    1 
ATOM   481  C  C     . SER A 1 59  ? 33.776 13.845 29.968  1.00 100.00 ? 59   SER A C     1 
ATOM   482  O  O     . SER A 1 59  ? 34.290 12.858 29.422  1.00 52.40  ? 59   SER A O     1 
ATOM   483  C  CB    . SER A 1 59  ? 32.102 14.078 31.744  1.00 48.97  ? 59   SER A CB    1 
ATOM   484  O  OG    . SER A 1 59  ? 33.149 13.391 32.424  1.00 56.09  ? 59   SER A OG    1 
ATOM   485  N  N     . PHE A 1 60  ? 34.460 14.882 30.417  1.00 40.83  ? 60   PHE A N     1 
ATOM   486  C  CA    . PHE A 1 60  ? 35.884 14.893 30.234  1.00 42.65  ? 60   PHE A CA    1 
ATOM   487  C  C     . PHE A 1 60  ? 36.665 15.121 31.495  1.00 37.67  ? 60   PHE A C     1 
ATOM   488  O  O     . PHE A 1 60  ? 36.285 15.788 32.427  1.00 28.36  ? 60   PHE A O     1 
ATOM   489  C  CB    . PHE A 1 60  ? 36.212 16.097 29.357  1.00 37.26  ? 60   PHE A CB    1 
ATOM   490  C  CG    . PHE A 1 60  ? 35.800 15.948 27.923  1.00 87.41  ? 60   PHE A CG    1 
ATOM   491  C  CD1   . PHE A 1 60  ? 36.651 15.257 27.064  1.00 78.15  ? 60   PHE A CD1   1 
ATOM   492  C  CD2   . PHE A 1 60  ? 34.634 16.531 27.425  1.00 42.33  ? 60   PHE A CD2   1 
ATOM   493  C  CE1   . PHE A 1 60  ? 36.342 15.079 25.717  1.00 62.54  ? 60   PHE A CE1   1 
ATOM   494  C  CE2   . PHE A 1 60  ? 34.316 16.375 26.078  1.00 64.50  ? 60   PHE A CE2   1 
ATOM   495  C  CZ    . PHE A 1 60  ? 35.165 15.643 25.236  1.00 96.83  ? 60   PHE A CZ    1 
ATOM   496  N  N     . THR A 1 61  ? 37.855 14.628 31.472  1.00 35.39  ? 61   THR A N     1 
ATOM   497  C  CA    . THR A 1 61  ? 38.687 14.890 32.595  1.00 54.28  ? 61   THR A CA    1 
ATOM   498  C  C     . THR A 1 61  ? 39.879 15.591 32.015  1.00 43.18  ? 61   THR A C     1 
ATOM   499  O  O     . THR A 1 61  ? 40.416 15.104 31.017  1.00 62.40  ? 61   THR A O     1 
ATOM   500  C  CB    . THR A 1 61  ? 39.048 13.569 33.273  1.00 64.00  ? 61   THR A CB    1 
ATOM   501  O  OG1   . THR A 1 61  ? 37.848 12.923 33.447  1.00 50.67  ? 61   THR A OG1   1 
ATOM   502  C  CG2   . THR A 1 61  ? 39.778 13.752 34.586  1.00 61.72  ? 61   THR A CG2   1 
ATOM   503  N  N     . PHE A 1 62  ? 40.255 16.725 32.599  1.00 39.29  ? 62   PHE A N     1 
ATOM   504  C  CA    . PHE A 1 62  ? 41.409 17.481 32.134  1.00 57.69  ? 62   PHE A CA    1 
ATOM   505  C  C     . PHE A 1 62  ? 42.375 17.859 33.256  1.00 37.94  ? 62   PHE A C     1 
ATOM   506  O  O     . PHE A 1 62  ? 42.155 17.641 34.431  1.00 68.44  ? 62   PHE A O     1 
ATOM   507  C  CB    . PHE A 1 62  ? 41.012 18.730 31.292  1.00 47.10  ? 62   PHE A CB    1 
ATOM   508  C  CG    . PHE A 1 62  ? 40.198 19.697 32.106  1.00 96.38  ? 62   PHE A CG    1 
ATOM   509  C  CD1   . PHE A 1 62  ? 38.815 19.517 32.182  1.00 29.88  ? 62   PHE A CD1   1 
ATOM   510  C  CD2   . PHE A 1 62  ? 40.806 20.734 32.817  1.00 51.44  ? 62   PHE A CD2   1 
ATOM   511  C  CE1   . PHE A 1 62  ? 37.999 20.364 32.935  1.00 25.25  ? 62   PHE A CE1   1 
ATOM   512  C  CE2   . PHE A 1 62  ? 40.015 21.611 33.571  1.00 29.02  ? 62   PHE A CE2   1 
ATOM   513  C  CZ    . PHE A 1 62  ? 38.634 21.399 33.652  1.00 29.97  ? 62   PHE A CZ    1 
ATOM   514  N  N     . LYS A 1 63  ? 43.480 18.436 32.854  1.00 62.99  ? 63   LYS A N     1 
ATOM   515  C  CA    . LYS A 1 63  ? 44.455 18.879 33.791  1.00 58.78  ? 63   LYS A CA    1 
ATOM   516  C  C     . LYS A 1 63  ? 44.422 20.382 33.728  1.00 47.41  ? 63   LYS A C     1 
ATOM   517  O  O     . LYS A 1 63  ? 44.174 20.941 32.687  1.00 65.14  ? 63   LYS A O     1 
ATOM   518  C  CB    . LYS A 1 63  ? 45.815 18.390 33.346  1.00 49.77  ? 63   LYS A CB    1 
ATOM   519  C  CG    . LYS A 1 63  ? 46.485 17.476 34.340  1.00 72.69  ? 63   LYS A CG    1 
ATOM   520  C  CD    . LYS A 1 63  ? 46.793 16.105 33.772  1.00 100.00 ? 63   LYS A CD    1 
ATOM   521  C  CE    . LYS A 1 63  ? 46.210 14.915 34.493  1.00 100.00 ? 63   LYS A CE    1 
ATOM   522  N  NZ    . LYS A 1 63  ? 46.487 13.555 34.129  1.00 100.00 ? 63   LYS A NZ    1 
ATOM   523  N  N     . THR A 1 64  ? 44.693 21.000 34.847  1.00 46.96  ? 64   THR A N     1 
ATOM   524  C  CA    . THR A 1 64  ? 44.732 22.438 34.971  1.00 62.80  ? 64   THR A CA    1 
ATOM   525  C  C     . THR A 1 64  ? 46.146 22.932 34.724  1.00 100.00 ? 64   THR A C     1 
ATOM   526  O  O     . THR A 1 64  ? 47.048 22.116 34.411  1.00 46.22  ? 64   THR A O     1 
ATOM   527  C  CB    . THR A 1 64  ? 44.363 22.792 36.436  1.00 60.61  ? 64   THR A CB    1 
ATOM   528  O  OG1   . THR A 1 64  ? 45.246 22.178 37.380  1.00 36.70  ? 64   THR A OG1   1 
ATOM   529  C  CG2   . THR A 1 64  ? 42.966 22.269 36.720  1.00 42.25  ? 64   THR A CG2   1 
ATOM   530  N  N     . SER A 1 65  ? 46.334 24.258 34.884  1.00 70.24  ? 65   SER A N     1 
ATOM   531  C  CA    . SER A 1 65  ? 47.644 24.872 34.727  1.00 52.70  ? 65   SER A CA    1 
ATOM   532  C  C     . SER A 1 65  ? 48.596 24.363 35.818  1.00 59.23  ? 65   SER A C     1 
ATOM   533  O  O     . SER A 1 65  ? 49.765 24.060 35.565  1.00 100.00 ? 65   SER A O     1 
ATOM   534  C  CB    . SER A 1 65  ? 47.574 26.392 34.720  1.00 85.88  ? 65   SER A CB    1 
ATOM   535  O  OG    . SER A 1 65  ? 48.718 26.930 34.116  1.00 100.00 ? 65   SER A OG    1 
ATOM   536  N  N     . ASP A 1 66  ? 48.066 24.229 37.043  1.00 100.00 ? 66   ASP A N     1 
ATOM   537  C  CA    . ASP A 1 66  ? 48.812 23.721 38.189  1.00 55.50  ? 66   ASP A CA    1 
ATOM   538  C  C     . ASP A 1 66  ? 49.085 22.226 38.058  1.00 54.57  ? 66   ASP A C     1 
ATOM   539  O  O     . ASP A 1 66  ? 49.951 21.662 38.709  1.00 100.00 ? 66   ASP A O     1 
ATOM   540  C  CB    . ASP A 1 66  ? 48.069 24.008 39.491  1.00 86.39  ? 66   ASP A CB    1 
ATOM   541  C  CG    . ASP A 1 66  ? 46.807 24.757 39.195  1.00 100.00 ? 66   ASP A CG    1 
ATOM   542  O  OD1   . ASP A 1 66  ? 47.034 26.051 38.972  1.00 100.00 ? 66   ASP A OD1   1 
ATOM   543  O  OD2   . ASP A 1 66  ? 45.725 24.188 39.116  1.00 100.00 ? 66   ASP A OD2   1 
ATOM   544  N  N     . GLY A 1 67  ? 48.341 21.589 37.161  1.00 100.00 ? 67   GLY A N     1 
ATOM   545  C  CA    . GLY A 1 67  ? 48.476 20.172 36.901  1.00 69.34  ? 67   GLY A CA    1 
ATOM   546  C  C     . GLY A 1 67  ? 47.333 19.431 37.550  1.00 87.55  ? 67   GLY A C     1 
ATOM   547  O  O     . GLY A 1 67  ? 47.304 18.202 37.554  1.00 77.44  ? 67   GLY A O     1 
ATOM   548  N  N     . GLN A 1 68  ? 46.417 20.221 38.101  1.00 55.59  ? 68   GLN A N     1 
ATOM   549  C  CA    . GLN A 1 68  ? 45.263 19.678 38.782  1.00 77.40  ? 68   GLN A CA    1 
ATOM   550  C  C     . GLN A 1 68  ? 44.266 19.065 37.808  1.00 100.00 ? 68   GLN A C     1 
ATOM   551  O  O     . GLN A 1 68  ? 43.922 19.661 36.790  1.00 80.33  ? 68   GLN A O     1 
ATOM   552  C  CB    . GLN A 1 68  ? 44.660 20.659 39.769  1.00 89.98  ? 68   GLN A CB    1 
ATOM   553  N  N     . ASP A 1 69  ? 43.838 17.846 38.128  1.00 100.00 ? 69   ASP A N     1 
ATOM   554  C  CA    . ASP A 1 69  ? 42.888 17.139 37.312  1.00 100.00 ? 69   ASP A CA    1 
ATOM   555  C  C     . ASP A 1 69  ? 41.450 17.300 37.784  1.00 41.34  ? 69   ASP A C     1 
ATOM   556  O  O     . ASP A 1 69  ? 41.075 16.909 38.892  1.00 68.92  ? 69   ASP A O     1 
ATOM   557  C  CB    . ASP A 1 69  ? 43.323 15.767 36.892  1.00 52.54  ? 69   ASP A CB    1 
ATOM   558  N  N     . ARG A 1 70  ? 40.689 17.932 36.881  1.00 51.86  ? 70   ARG A N     1 
ATOM   559  C  CA    . ARG A 1 70  ? 39.277 18.243 37.007  1.00 48.80  ? 70   ARG A CA    1 
ATOM   560  C  C     . ARG A 1 70  ? 38.471 17.451 35.977  1.00 52.64  ? 70   ARG A C     1 
ATOM   561  O  O     . ARG A 1 70  ? 39.020 16.740 35.130  1.00 42.00  ? 70   ARG A O     1 
ATOM   562  C  CB    . ARG A 1 70  ? 38.990 19.766 37.060  1.00 46.72  ? 70   ARG A CB    1 
ATOM   563  N  N     . GLN A 1 71  ? 37.153 17.549 36.079  1.00 33.23  ? 71   GLN A N     1 
ATOM   564  C  CA    . GLN A 1 71  ? 36.282 16.824 35.196  1.00 39.92  ? 71   GLN A CA    1 
ATOM   565  C  C     . GLN A 1 71  ? 35.134 17.714 34.874  1.00 50.94  ? 71   GLN A C     1 
ATOM   566  O  O     . GLN A 1 71  ? 34.784 18.582 35.669  1.00 57.94  ? 71   GLN A O     1 
ATOM   567  C  CB    . GLN A 1 71  ? 35.755 15.514 35.789  1.00 70.91  ? 71   GLN A CB    1 
ATOM   568  C  CG    . GLN A 1 71  ? 36.632 14.311 35.422  1.00 78.06  ? 71   GLN A CG    1 
ATOM   569  C  CD    . GLN A 1 71  ? 35.754 13.140 35.038  1.00 100.00 ? 71   GLN A CD    1 
ATOM   570  O  OE1   . GLN A 1 71  ? 35.602 12.813 33.812  1.00 99.72  ? 71   GLN A OE1   1 
ATOM   571  N  NE2   . GLN A 1 71  ? 35.149 12.556 36.079  1.00 100.00 ? 71   GLN A NE2   1 
ATOM   572  N  N     . VAL A 1 72  ? 34.602 17.501 33.683  1.00 57.27  ? 72   VAL A N     1 
ATOM   573  C  CA    . VAL A 1 72  ? 33.525 18.319 33.165  1.00 100.00 ? 72   VAL A CA    1 
ATOM   574  C  C     . VAL A 1 72  ? 32.605 17.557 32.260  1.00 68.54  ? 72   VAL A C     1 
ATOM   575  O  O     . VAL A 1 72  ? 32.957 16.614 31.546  1.00 69.87  ? 72   VAL A O     1 
ATOM   576  C  CB    . VAL A 1 72  ? 33.921 19.497 32.262  1.00 100.00 ? 72   VAL A CB    1 
ATOM   577  C  CG1   . VAL A 1 72  ? 32.760 20.483 32.172  1.00 34.38  ? 72   VAL A CG1   1 
ATOM   578  C  CG2   . VAL A 1 72  ? 35.185 20.214 32.718  1.00 100.00 ? 72   VAL A CG2   1 
ATOM   579  N  N     . LYS A 1 73  ? 31.404 18.052 32.265  1.00 32.71  ? 73   LYS A N     1 
ATOM   580  C  CA    . LYS A 1 73  ? 30.418 17.433 31.446  1.00 42.02  ? 73   LYS A CA    1 
ATOM   581  C  C     . LYS A 1 73  ? 30.763 17.773 30.043  1.00 53.52  ? 73   LYS A C     1 
ATOM   582  O  O     . LYS A 1 73  ? 31.127 18.905 29.769  1.00 46.37  ? 73   LYS A O     1 
ATOM   583  C  CB    . LYS A 1 73  ? 29.014 17.932 31.771  1.00 36.94  ? 73   LYS A CB    1 
ATOM   584  C  CG    . LYS A 1 73  ? 28.136 16.841 32.319  1.00 100.00 ? 73   LYS A CG    1 
ATOM   585  C  CD    . LYS A 1 73  ? 28.660 15.478 31.873  1.00 100.00 ? 73   LYS A CD    1 
ATOM   586  C  CE    . LYS A 1 73  ? 28.421 14.338 32.851  1.00 100.00 ? 73   LYS A CE    1 
ATOM   587  N  NZ    . LYS A 1 73  ? 29.667 13.895 33.490  1.00 100.00 ? 73   LYS A NZ    1 
ATOM   588  N  N     . LYS A 1 74  ? 30.681 16.768 29.198  1.00 50.42  ? 74   LYS A N     1 
ATOM   589  C  CA    . LYS A 1 74  ? 30.924 16.984 27.806  1.00 100.00 ? 74   LYS A CA    1 
ATOM   590  C  C     . LYS A 1 74  ? 29.915 18.057 27.392  1.00 51.67  ? 74   LYS A C     1 
ATOM   591  O  O     . LYS A 1 74  ? 30.177 18.993 26.655  1.00 56.11  ? 74   LYS A O     1 
ATOM   592  C  CB    . LYS A 1 74  ? 30.701 15.667 27.052  1.00 53.46  ? 74   LYS A CB    1 
ATOM   593  C  CG    . LYS A 1 74  ? 31.885 14.711 27.083  1.00 48.34  ? 74   LYS A CG    1 
ATOM   594  C  CD    . LYS A 1 74  ? 31.528 13.342 26.499  1.00 43.21  ? 74   LYS A CD    1 
ATOM   595  C  CE    . LYS A 1 74  ? 32.632 12.802 25.633  1.00 66.54  ? 74   LYS A CE    1 
ATOM   596  N  NZ    . LYS A 1 74  ? 32.919 11.375 25.810  1.00 48.24  ? 74   LYS A NZ    1 
ATOM   597  N  N     . ASP A 1 75  ? 28.731 17.937 27.934  1.00 33.25  ? 75   ASP A N     1 
ATOM   598  C  CA    . ASP A 1 75  ? 27.670 18.850 27.627  1.00 79.19  ? 75   ASP A CA    1 
ATOM   599  C  C     . ASP A 1 75  ? 27.835 20.239 28.221  1.00 57.24  ? 75   ASP A C     1 
ATOM   600  O  O     . ASP A 1 75  ? 27.056 21.170 27.954  1.00 89.08  ? 75   ASP A O     1 
ATOM   601  C  CB    . ASP A 1 75  ? 26.275 18.203 27.608  1.00 100.00 ? 75   ASP A CB    1 
ATOM   602  C  CG    . ASP A 1 75  ? 26.045 17.499 26.282  1.00 100.00 ? 75   ASP A CG    1 
ATOM   603  O  OD1   . ASP A 1 75  ? 26.559 16.392 26.005  1.00 100.00 ? 75   ASP A OD1   1 
ATOM   604  O  OD2   . ASP A 1 75  ? 25.303 18.233 25.461  1.00 100.00 ? 75   ASP A OD2   1 
ATOM   605  N  N     . ASP A 1 76  ? 28.888 20.388 29.006  1.00 55.61  ? 76   ASP A N     1 
ATOM   606  C  CA    . ASP A 1 76  ? 29.134 21.695 29.604  1.00 100.00 ? 76   ASP A CA    1 
ATOM   607  C  C     . ASP A 1 76  ? 30.487 22.269 29.211  1.00 100.00 ? 76   ASP A C     1 
ATOM   608  O  O     . ASP A 1 76  ? 30.848 23.372 29.595  1.00 45.12  ? 76   ASP A O     1 
ATOM   609  C  CB    . ASP A 1 76  ? 29.010 21.635 31.139  1.00 100.00 ? 76   ASP A CB    1 
ATOM   610  C  CG    . ASP A 1 76  ? 27.575 21.469 31.532  1.00 100.00 ? 76   ASP A CG    1 
ATOM   611  O  OD1   . ASP A 1 76  ? 26.672 22.124 31.020  1.00 100.00 ? 76   ASP A OD1   1 
ATOM   612  O  OD2   . ASP A 1 76  ? 27.418 20.551 32.455  1.00 91.92  ? 76   ASP A OD2   1 
ATOM   613  N  N     . ALA A 1 77  ? 31.203 21.496 28.408  1.00 36.15  ? 77   ALA A N     1 
ATOM   614  C  CA    . ALA A 1 77  ? 32.548 21.808 27.999  1.00 61.92  ? 77   ALA A CA    1 
ATOM   615  C  C     . ALA A 1 77  ? 32.678 22.840 26.917  1.00 37.73  ? 77   ALA A C     1 
ATOM   616  O  O     . ALA A 1 77  ? 31.922 22.853 25.936  1.00 35.34  ? 77   ALA A O     1 
ATOM   617  C  CB    . ALA A 1 77  ? 33.312 20.527 27.651  1.00 45.81  ? 77   ALA A CB    1 
ATOM   618  N  N     . ASN A 1 78  ? 33.663 23.711 27.165  1.00 43.09  ? 78   ASN A N     1 
ATOM   619  C  CA    . ASN A 1 78  ? 34.046 24.745 26.225  1.00 38.24  ? 78   ASN A CA    1 
ATOM   620  C  C     . ASN A 1 78  ? 35.300 24.267 25.498  1.00 27.74  ? 78   ASN A C     1 
ATOM   621  O  O     . ASN A 1 78  ? 36.437 24.573 25.871  1.00 31.09  ? 78   ASN A O     1 
ATOM   622  C  CB    . ASN A 1 78  ? 34.251 26.152 26.735  1.00 28.91  ? 78   ASN A CB    1 
ATOM   623  C  CG    . ASN A 1 78  ? 33.137 26.705 27.613  1.00 35.82  ? 78   ASN A CG    1 
ATOM   624  O  OD1   . ASN A 1 78  ? 32.049 27.024 27.159  1.00 33.19  ? 78   ASN A OD1   1 
ATOM   625  N  ND2   . ASN A 1 78  ? 33.484 26.914 28.882  1.00 37.48  ? 78   ASN A ND2   1 
ATOM   626  N  N     . GLN A 1 79  ? 35.064 23.458 24.463  1.00 26.35  ? 79   GLN A N     1 
ATOM   627  C  CA    . GLN A 1 79  ? 36.156 22.908 23.698  1.00 25.67  ? 79   GLN A CA    1 
ATOM   628  C  C     . GLN A 1 79  ? 36.954 23.990 23.018  1.00 28.10  ? 79   GLN A C     1 
ATOM   629  O  O     . GLN A 1 79  ? 36.412 25.030 22.610  1.00 34.48  ? 79   GLN A O     1 
ATOM   630  C  CB    . GLN A 1 79  ? 35.579 21.848 22.788  1.00 56.77  ? 79   GLN A CB    1 
ATOM   631  C  CG    . GLN A 1 79  ? 35.228 20.581 23.619  1.00 33.89  ? 79   GLN A CG    1 
ATOM   632  C  CD    . GLN A 1 79  ? 35.175 19.435 22.671  1.00 32.47  ? 79   GLN A CD    1 
ATOM   633  O  OE1   . GLN A 1 79  ? 34.134 19.170 22.029  1.00 42.37  ? 79   GLN A OE1   1 
ATOM   634  N  NE2   . GLN A 1 79  ? 36.351 18.920 22.457  1.00 47.24  ? 79   GLN A NE2   1 
ATOM   635  N  N     . ARG A 1 80  ? 38.256 23.787 22.969  1.00 33.30  ? 80   ARG A N     1 
ATOM   636  C  CA    . ARG A 1 80  ? 39.143 24.742 22.335  1.00 19.78  ? 80   ARG A CA    1 
ATOM   637  C  C     . ARG A 1 80  ? 39.254 24.364 20.864  1.00 25.60  ? 80   ARG A C     1 
ATOM   638  O  O     . ARG A 1 80  ? 39.397 23.176 20.535  1.00 27.40  ? 80   ARG A O     1 
ATOM   639  C  CB    . ARG A 1 80  ? 40.508 24.802 23.032  1.00 20.15  ? 80   ARG A CB    1 
ATOM   640  C  CG    . ARG A 1 80  ? 41.344 25.959 22.464  1.00 22.40  ? 80   ARG A CG    1 
ATOM   641  C  CD    . ARG A 1 80  ? 42.798 25.891 22.840  1.00 25.33  ? 80   ARG A CD    1 
ATOM   642  N  NE    . ARG A 1 80  ? 43.661 26.731 22.007  1.00 34.78  ? 80   ARG A NE    1 
ATOM   643  C  CZ    . ARG A 1 80  ? 44.954 27.046 22.246  1.00 26.89  ? 80   ARG A CZ    1 
ATOM   644  N  NH1   . ARG A 1 80  ? 45.625 26.596 23.270  1.00 50.90  ? 80   ARG A NH1   1 
ATOM   645  N  NH2   . ARG A 1 80  ? 45.655 27.789 21.385  1.00 24.31  ? 80   ARG A NH2   1 
ATOM   646  N  N     . ASN A 1 81  ? 39.146 25.367 20.004  1.00 23.16  ? 81   ASN A N     1 
ATOM   647  C  CA    . ASN A 1 81  ? 39.292 25.171 18.578  1.00 19.79  ? 81   ASN A CA    1 
ATOM   648  C  C     . ASN A 1 81  ? 40.726 24.793 18.243  1.00 30.92  ? 81   ASN A C     1 
ATOM   649  O  O     . ASN A 1 81  ? 41.674 25.226 18.912  1.00 19.25  ? 81   ASN A O     1 
ATOM   650  C  CB    . ASN A 1 81  ? 39.028 26.460 17.721  1.00 17.51  ? 81   ASN A CB    1 
ATOM   651  C  CG    . ASN A 1 81  ? 37.569 26.548 17.478  1.00 18.24  ? 81   ASN A CG    1 
ATOM   652  O  OD1   . ASN A 1 81  ? 37.029 25.700 16.766  1.00 30.61  ? 81   ASN A OD1   1 
ATOM   653  N  ND2   . ASN A 1 81  ? 36.936 27.538 18.095  1.00 24.43  ? 81   ASN A ND2   1 
ATOM   654  N  N     . PRO A 1 82  ? 40.867 23.988 17.195  1.00 40.30  ? 82   PRO A N     1 
ATOM   655  C  CA    . PRO A 1 82  ? 42.194 23.597 16.735  1.00 31.26  ? 82   PRO A CA    1 
ATOM   656  C  C     . PRO A 1 82  ? 43.021 24.842 16.348  1.00 36.81  ? 82   PRO A C     1 
ATOM   657  O  O     . PRO A 1 82  ? 42.487 25.845 15.819  1.00 27.81  ? 82   PRO A O     1 
ATOM   658  C  CB    . PRO A 1 82  ? 41.947 22.604 15.578  1.00 30.00  ? 82   PRO A CB    1 
ATOM   659  C  CG    . PRO A 1 82  ? 40.474 22.154 15.664  1.00 45.29  ? 82   PRO A CG    1 
ATOM   660  C  CD    . PRO A 1 82  ? 39.751 23.267 16.454  1.00 32.12  ? 82   PRO A CD    1 
ATOM   661  N  N     . ILE A 1 83  ? 44.319 24.808 16.689  1.00 35.85  ? 83   ILE A N     1 
ATOM   662  C  CA    . ILE A 1 83  ? 45.267 25.894 16.454  1.00 37.50  ? 83   ILE A CA    1 
ATOM   663  C  C     . ILE A 1 83  ? 45.149 26.540 15.086  1.00 17.55  ? 83   ILE A C     1 
ATOM   664  O  O     . ILE A 1 83  ? 45.365 27.715 14.917  1.00 23.89  ? 83   ILE A O     1 
ATOM   665  C  CB    . ILE A 1 83  ? 46.727 25.552 16.809  1.00 40.44  ? 83   ILE A CB    1 
ATOM   666  C  CG1   . ILE A 1 83  ? 47.250 26.772 17.457  1.00 33.14  ? 83   ILE A CG1   1 
ATOM   667  C  CG2   . ILE A 1 83  ? 47.578 25.233 15.612  1.00 64.87  ? 83   ILE A CG2   1 
ATOM   668  C  CD1   . ILE A 1 83  ? 46.244 27.036 18.612  1.00 99.52  ? 83   ILE A CD1   1 
ATOM   669  N  N     . LYS A 1 84  ? 44.842 25.738 14.087  1.00 21.84  ? 84   LYS A N     1 
ATOM   670  C  CA    . LYS A 1 84  ? 44.660 26.272 12.767  1.00 31.67  ? 84   LYS A CA    1 
ATOM   671  C  C     . LYS A 1 84  ? 43.611 27.385 12.788  1.00 36.91  ? 84   LYS A C     1 
ATOM   672  O  O     . LYS A 1 84  ? 43.643 28.360 12.017  1.00 24.76  ? 84   LYS A O     1 
ATOM   673  C  CB    . LYS A 1 84  ? 44.249 25.096 11.834  1.00 38.65  ? 84   LYS A CB    1 
ATOM   674  C  CG    . LYS A 1 84  ? 43.599 25.498 10.477  1.00 100.00 ? 84   LYS A CG    1 
ATOM   675  C  CD    . LYS A 1 84  ? 42.053 25.480 10.470  1.00 100.00 ? 84   LYS A CD    1 
ATOM   676  C  CE    . LYS A 1 84  ? 41.357 25.907 9.163   1.00 100.00 ? 84   LYS A CE    1 
ATOM   677  N  NZ    . LYS A 1 84  ? 40.422 27.075 9.312   1.00 97.47  ? 84   LYS A NZ    1 
ATOM   678  N  N     . PHE A 1 85  ? 42.639 27.247 13.665  1.00 25.18  ? 85   PHE A N     1 
ATOM   679  C  CA    . PHE A 1 85  ? 41.614 28.274 13.681  1.00 26.09  ? 85   PHE A CA    1 
ATOM   680  C  C     . PHE A 1 85  ? 42.044 29.548 14.411  1.00 31.32  ? 85   PHE A C     1 
ATOM   681  O  O     . PHE A 1 85  ? 41.324 30.571 14.431  1.00 24.34  ? 85   PHE A O     1 
ATOM   682  C  CB    . PHE A 1 85  ? 40.304 27.794 14.327  1.00 29.68  ? 85   PHE A CB    1 
ATOM   683  C  CG    . PHE A 1 85  ? 39.618 26.714 13.572  1.00 26.20  ? 85   PHE A CG    1 
ATOM   684  C  CD1   . PHE A 1 85  ? 39.976 25.387 13.758  1.00 33.13  ? 85   PHE A CD1   1 
ATOM   685  C  CD2   . PHE A 1 85  ? 38.521 27.007 12.774  1.00 96.33  ? 85   PHE A CD2   1 
ATOM   686  C  CE1   . PHE A 1 85  ? 39.319 24.370 13.072  1.00 36.58  ? 85   PHE A CE1   1 
ATOM   687  C  CE2   . PHE A 1 85  ? 37.853 25.996 12.089  1.00 48.50  ? 85   PHE A CE2   1 
ATOM   688  C  CZ    . PHE A 1 85  ? 38.239 24.669 12.245  1.00 45.02  ? 85   PHE A CZ    1 
ATOM   689  N  N     . ASP A 1 86  ? 43.176 29.493 15.096  1.00 29.93  ? 86   ASP A N     1 
ATOM   690  C  CA    . ASP A 1 86  ? 43.606 30.673 15.819  1.00 18.05  ? 86   ASP A CA    1 
ATOM   691  C  C     . ASP A 1 86  ? 43.979 31.833 14.905  1.00 33.36  ? 86   ASP A C     1 
ATOM   692  O  O     . ASP A 1 86  ? 44.989 31.825 14.187  1.00 32.21  ? 86   ASP A O     1 
ATOM   693  C  CB    . ASP A 1 86  ? 44.786 30.284 16.822  1.00 16.86  ? 86   ASP A CB    1 
ATOM   694  C  CG    . ASP A 1 86  ? 44.256 29.606 18.065  1.00 29.59  ? 86   ASP A CG    1 
ATOM   695  O  OD1   . ASP A 1 86  ? 42.950 29.401 18.099  1.00 22.53  ? 86   ASP A OD1   1 
ATOM   696  O  OD2   . ASP A 1 86  ? 44.951 29.323 18.982  1.00 23.78  ? 86   ASP A OD2   1 
ATOM   697  N  N     . GLY A 1 87  ? 43.194 32.885 14.963  1.00 26.99  ? 87   GLY A N     1 
ATOM   698  C  CA    . GLY A 1 87  ? 43.519 34.044 14.162  1.00 11.89  ? 87   GLY A CA    1 
ATOM   699  C  C     . GLY A 1 87  ? 42.606 34.222 12.989  1.00 17.36  ? 87   GLY A C     1 
ATOM   700  O  O     . GLY A 1 87  ? 42.793 35.160 12.220  1.00 21.45  ? 87   GLY A O     1 
ATOM   701  N  N     . VAL A 1 88  ? 41.587 33.350 12.846  1.00 20.42  ? 88   VAL A N     1 
ATOM   702  C  CA    . VAL A 1 88  ? 40.678 33.529 11.690  1.00 21.41  ? 88   VAL A CA    1 
ATOM   703  C  C     . VAL A 1 88  ? 40.026 34.927 11.608  1.00 14.52  ? 88   VAL A C     1 
ATOM   704  O  O     . VAL A 1 88  ? 39.722 35.586 12.612  1.00 17.47  ? 88   VAL A O     1 
ATOM   705  C  CB    . VAL A 1 88  ? 39.684 32.393 11.405  1.00 20.20  ? 88   VAL A CB    1 
ATOM   706  C  CG1   . VAL A 1 88  ? 40.519 31.135 11.324  1.00 28.13  ? 88   VAL A CG1   1 
ATOM   707  C  CG2   . VAL A 1 88  ? 38.763 32.299 12.624  1.00 24.08  ? 88   VAL A CG2   1 
ATOM   708  N  N     . GLU A 1 89  ? 39.824 35.380 10.362  1.00 13.81  ? 89   GLU A N     1 
ATOM   709  C  CA    . GLU A 1 89  ? 39.291 36.660 10.080  1.00 19.58  ? 89   GLU A CA    1 
ATOM   710  C  C     . GLU A 1 89  ? 37.795 36.768 10.325  1.00 16.94  ? 89   GLU A C     1 
ATOM   711  O  O     . GLU A 1 89  ? 37.283 37.856 10.354  1.00 14.19  ? 89   GLU A O     1 
ATOM   712  C  CB    . GLU A 1 89  ? 39.646 37.034 8.661   1.00 24.83  ? 89   GLU A CB    1 
ATOM   713  C  CG    . GLU A 1 89  ? 41.148 37.302 8.597   1.00 20.12  ? 89   GLU A CG    1 
ATOM   714  C  CD    . GLU A 1 89  ? 41.632 37.703 7.226   1.00 32.23  ? 89   GLU A CD    1 
ATOM   715  O  OE1   . GLU A 1 89  ? 40.826 37.465 6.219   1.00 22.63  ? 89   GLU A OE1   1 
ATOM   716  O  OE2   . GLU A 1 89  ? 42.696 38.246 7.081   1.00 20.89  ? 89   GLU A OE2   1 
ATOM   717  N  N     . ASP A 1 90  ? 37.141 35.644 10.549  1.00 18.14  ? 90   ASP A N     1 
ATOM   718  C  CA    . ASP A 1 90  ? 35.702 35.671 10.797  1.00 27.84  ? 90   ASP A CA    1 
ATOM   719  C  C     . ASP A 1 90  ? 35.361 34.650 11.865  1.00 16.45  ? 90   ASP A C     1 
ATOM   720  O  O     . ASP A 1 90  ? 35.692 33.490 11.758  1.00 22.72  ? 90   ASP A O     1 
ATOM   721  C  CB    . ASP A 1 90  ? 34.910 35.434 9.486   1.00 21.29  ? 90   ASP A CB    1 
ATOM   722  C  CG    . ASP A 1 90  ? 33.411 35.557 9.520   1.00 29.49  ? 90   ASP A CG    1 
ATOM   723  O  OD1   . ASP A 1 90  ? 32.843 35.716 10.717  1.00 24.37  ? 90   ASP A OD1   1 
ATOM   724  O  OD2   . ASP A 1 90  ? 32.815 35.572 8.482   1.00 30.96  ? 90   ASP A OD2   1 
ATOM   725  N  N     . MET A 1 91  ? 34.726 35.077 12.941  1.00 22.08  ? 91   MET A N     1 
ATOM   726  C  CA    . MET A 1 91  ? 34.449 34.097 13.981  1.00 17.35  ? 91   MET A CA    1 
ATOM   727  C  C     . MET A 1 91  ? 33.511 33.010 13.490  1.00 20.48  ? 91   MET A C     1 
ATOM   728  O  O     . MET A 1 91  ? 33.432 31.932 14.067  1.00 24.37  ? 91   MET A O     1 
ATOM   729  C  CB    . MET A 1 91  ? 33.746 34.830 15.134  1.00 29.78  ? 91   MET A CB    1 
ATOM   730  C  CG    . MET A 1 91  ? 34.506 36.012 15.664  1.00 43.81  ? 91   MET A CG    1 
ATOM   731  S  SD    . MET A 1 91  ? 35.764 35.495 16.797  1.00 20.23  ? 91   MET A SD    1 
ATOM   732  C  CE    . MET A 1 91  ? 36.182 37.083 17.417  1.00 18.55  ? 91   MET A CE    1 
ATOM   733  N  N     . SER A 1 92  ? 32.771 33.318 12.424  1.00 30.54  ? 92   SER A N     1 
ATOM   734  C  CA    . SER A 1 92  ? 31.861 32.397 11.726  1.00 31.70  ? 92   SER A CA    1 
ATOM   735  C  C     . SER A 1 92  ? 32.575 31.124 11.207  1.00 34.14  ? 92   SER A C     1 
ATOM   736  O  O     . SER A 1 92  ? 31.986 30.047 10.995  1.00 27.74  ? 92   SER A O     1 
ATOM   737  C  CB    . SER A 1 92  ? 30.900 33.166 10.768  1.00 19.58  ? 92   SER A CB    1 
ATOM   738  O  OG    . SER A 1 92  ? 30.903 34.559 11.052  1.00 100.00 ? 92   SER A OG    1 
ATOM   739  N  N     . GLU A 1 93  ? 33.908 31.222 11.120  1.00 28.42  ? 93   GLU A N     1 
ATOM   740  C  CA    . GLU A 1 93  ? 34.762 30.120 10.700  1.00 30.32  ? 93   GLU A CA    1 
ATOM   741  C  C     . GLU A 1 93  ? 35.099 29.145 11.848  1.00 24.98  ? 93   GLU A C     1 
ATOM   742  O  O     . GLU A 1 93  ? 35.477 28.013 11.615  1.00 38.56  ? 93   GLU A O     1 
ATOM   743  C  CB    . GLU A 1 93  ? 36.062 30.698 10.031  1.00 27.49  ? 93   GLU A CB    1 
ATOM   744  C  CG    . GLU A 1 93  ? 35.946 31.762 8.901   1.00 24.75  ? 93   GLU A CG    1 
ATOM   745  C  CD    . GLU A 1 93  ? 37.360 32.134 8.272   1.00 27.24  ? 93   GLU A CD    1 
ATOM   746  O  OE1   . GLU A 1 93  ? 38.081 31.076 8.027   1.00 100.00 ? 93   GLU A OE1   1 
ATOM   747  O  OE2   . GLU A 1 93  ? 37.819 33.261 8.056   1.00 73.25  ? 93   GLU A OE2   1 
ATOM   748  N  N     . LEU A 1 94  ? 34.960 29.568 13.107  1.00 23.93  ? 94   LEU A N     1 
ATOM   749  C  CA    . LEU A 1 94  ? 35.242 28.685 14.232  1.00 21.34  ? 94   LEU A CA    1 
ATOM   750  C  C     . LEU A 1 94  ? 34.275 27.517 14.289  1.00 28.01  ? 94   LEU A C     1 
ATOM   751  O  O     . LEU A 1 94  ? 33.070 27.660 14.061  1.00 28.09  ? 94   LEU A O     1 
ATOM   752  C  CB    . LEU A 1 94  ? 35.224 29.423 15.605  1.00 12.57  ? 94   LEU A CB    1 
ATOM   753  C  CG    . LEU A 1 94  ? 36.089 30.605 15.516  1.00 21.75  ? 94   LEU A CG    1 
ATOM   754  C  CD1   . LEU A 1 94  ? 35.864 31.423 16.765  1.00 16.71  ? 94   LEU A CD1   1 
ATOM   755  C  CD2   . LEU A 1 94  ? 37.568 30.160 15.384  1.00 25.03  ? 94   LEU A CD2   1 
ATOM   756  N  N     . SER A 1 95  ? 34.810 26.360 14.625  1.00 26.03  ? 95   SER A N     1 
ATOM   757  C  CA    . SER A 1 95  ? 34.006 25.164 14.766  1.00 39.62  ? 95   SER A CA    1 
ATOM   758  C  C     . SER A 1 95  ? 33.220 25.141 16.084  1.00 26.85  ? 95   SER A C     1 
ATOM   759  O  O     . SER A 1 95  ? 31.997 25.016 16.077  1.00 27.87  ? 95   SER A O     1 
ATOM   760  C  CB    . SER A 1 95  ? 34.837 23.923 14.417  1.00 40.50  ? 95   SER A CB    1 
ATOM   761  O  OG    . SER A 1 95  ? 33.961 22.825 14.319  1.00 35.34  ? 95   SER A OG    1 
ATOM   762  N  N     . TYR A 1 96  ? 33.962 25.313 17.193  1.00 33.32  ? 96   TYR A N     1 
ATOM   763  C  CA    . TYR A 1 96  ? 33.503 25.444 18.586  1.00 32.07  ? 96   TYR A CA    1 
ATOM   764  C  C     . TYR A 1 96  ? 33.244 26.933 18.827  1.00 29.13  ? 96   TYR A C     1 
ATOM   765  O  O     . TYR A 1 96  ? 34.142 27.777 18.707  1.00 26.27  ? 96   TYR A O     1 
ATOM   766  C  CB    . TYR A 1 96  ? 34.532 24.870 19.606  1.00 25.14  ? 96   TYR A CB    1 
ATOM   767  C  CG    . TYR A 1 96  ? 34.833 23.395 19.415  1.00 27.66  ? 96   TYR A CG    1 
ATOM   768  C  CD1   . TYR A 1 96  ? 33.807 22.446 19.392  1.00 39.25  ? 96   TYR A CD1   1 
ATOM   769  C  CD2   . TYR A 1 96  ? 36.136 22.930 19.215  1.00 29.62  ? 96   TYR A CD2   1 
ATOM   770  C  CE1   . TYR A 1 96  ? 34.059 21.091 19.172  1.00 33.93  ? 96   TYR A CE1   1 
ATOM   771  C  CE2   . TYR A 1 96  ? 36.410 21.584 19.029  1.00 33.20  ? 96   TYR A CE2   1 
ATOM   772  C  CZ    . TYR A 1 96  ? 35.370 20.658 18.985  1.00 29.61  ? 96   TYR A CZ    1 
ATOM   773  O  OH    . TYR A 1 96  ? 35.624 19.346 18.698  1.00 40.63  ? 96   TYR A OH    1 
ATOM   774  N  N     . LEU A 1 97  ? 31.989 27.281 19.063  1.00 32.36  ? 97   LEU A N     1 
ATOM   775  C  CA    . LEU A 1 97  ? 31.573 28.666 19.111  1.00 53.00  ? 97   LEU A CA    1 
ATOM   776  C  C     . LEU A 1 97  ? 31.082 29.131 20.456  1.00 38.13  ? 97   LEU A C     1 
ATOM   777  O  O     . LEU A 1 97  ? 30.017 29.688 20.602  1.00 100.00 ? 97   LEU A O     1 
ATOM   778  C  CB    . LEU A 1 97  ? 30.569 28.905 17.950  1.00 54.69  ? 97   LEU A CB    1 
ATOM   779  C  CG    . LEU A 1 97  ? 31.126 28.764 16.506  1.00 100.00 ? 97   LEU A CG    1 
ATOM   780  C  CD1   . LEU A 1 97  ? 30.481 27.614 15.682  1.00 52.48  ? 97   LEU A CD1   1 
ATOM   781  C  CD2   . LEU A 1 97  ? 30.994 30.126 15.821  1.00 72.25  ? 97   LEU A CD2   1 
ATOM   782  N  N     . ASN A 1 98  ? 31.912 28.891 21.435  1.00 29.79  ? 98   ASN A N     1 
ATOM   783  C  CA    . ASN A 1 98  ? 31.644 29.232 22.817  1.00 28.49  ? 98   ASN A CA    1 
ATOM   784  C  C     . ASN A 1 98  ? 32.314 30.546 23.167  1.00 39.27  ? 98   ASN A C     1 
ATOM   785  O  O     . ASN A 1 98  ? 33.143 31.067 22.420  1.00 23.94  ? 98   ASN A O     1 
ATOM   786  C  CB    . ASN A 1 98  ? 32.020 27.954 23.670  1.00 28.21  ? 98   ASN A CB    1 
ATOM   787  C  CG    . ASN A 1 98  ? 33.514 27.512 23.601  1.00 37.23  ? 98   ASN A CG    1 
ATOM   788  O  OD1   . ASN A 1 98  ? 34.383 28.261 24.145  1.00 35.80  ? 98   ASN A OD1   1 
ATOM   789  N  ND2   . ASN A 1 98  ? 33.818 26.337 22.965  1.00 24.87  ? 98   ASN A ND2   1 
ATOM   790  N  N     . GLU A 1 99  ? 31.965 31.079 24.312  1.00 29.60  ? 99   GLU A N     1 
ATOM   791  C  CA    . GLU A 1 99  ? 32.485 32.344 24.776  1.00 27.90  ? 99   GLU A CA    1 
ATOM   792  C  C     . GLU A 1 99  ? 33.988 32.457 24.828  1.00 39.30  ? 99   GLU A C     1 
ATOM   793  O  O     . GLU A 1 99  ? 34.543 33.389 24.240  1.00 27.77  ? 99   GLU A O     1 
ATOM   794  C  CB    . GLU A 1 99  ? 31.927 32.714 26.162  1.00 26.15  ? 99   GLU A CB    1 
ATOM   795  C  CG    . GLU A 1 99  ? 30.406 33.052 26.021  1.00 42.92  ? 99   GLU A CG    1 
ATOM   796  C  CD    . GLU A 1 99  ? 29.788 33.629 27.250  1.00 90.91  ? 99   GLU A CD    1 
ATOM   797  O  OE1   . GLU A 1 99  ? 30.412 33.956 28.280  1.00 39.14  ? 99   GLU A OE1   1 
ATOM   798  O  OE2   . GLU A 1 99  ? 28.508 33.786 27.038  1.00 43.12  ? 99   GLU A OE2   1 
ATOM   799  N  N     . PRO A 1 100 ? 34.625 31.599 25.640  1.00 30.19  ? 100  PRO A N     1 
ATOM   800  C  CA    . PRO A 1 100 ? 36.076 31.651 25.771  1.00 23.99  ? 100  PRO A CA    1 
ATOM   801  C  C     . PRO A 1 100 ? 36.739 31.484 24.391  1.00 44.10  ? 100  PRO A C     1 
ATOM   802  O  O     . PRO A 1 100 ? 37.738 32.133 24.098  1.00 25.69  ? 100  PRO A O     1 
ATOM   803  C  CB    . PRO A 1 100 ? 36.463 30.499 26.732  1.00 21.58  ? 100  PRO A CB    1 
ATOM   804  C  CG    . PRO A 1 100 ? 35.274 29.592 26.732  1.00 30.01  ? 100  PRO A CG    1 
ATOM   805  C  CD    . PRO A 1 100 ? 34.060 30.398 26.298  1.00 27.59  ? 100  PRO A CD    1 
ATOM   806  N  N     . ALA A 1 101 ? 36.147 30.653 23.513  1.00 20.84  ? 101  ALA A N     1 
ATOM   807  C  CA    . ALA A 1 101 ? 36.720 30.424 22.202  1.00 26.94  ? 101  ALA A CA    1 
ATOM   808  C  C     . ALA A 1 101 ? 36.687 31.676 21.378  1.00 30.69  ? 101  ALA A C     1 
ATOM   809  O  O     . ALA A 1 101 ? 37.639 32.002 20.697  1.00 19.86  ? 101  ALA A O     1 
ATOM   810  C  CB    . ALA A 1 101 ? 36.003 29.329 21.426  1.00 21.04  ? 101  ALA A CB    1 
ATOM   811  N  N     . VAL A 1 102 ? 35.568 32.357 21.447  1.00 18.71  ? 102  VAL A N     1 
ATOM   812  C  CA    . VAL A 1 102 ? 35.406 33.589 20.734  1.00 16.97  ? 102  VAL A CA    1 
ATOM   813  C  C     . VAL A 1 102 ? 36.370 34.646 21.274  1.00 20.32  ? 102  VAL A C     1 
ATOM   814  O  O     . VAL A 1 102 ? 37.027 35.381 20.508  1.00 19.26  ? 102  VAL A O     1 
ATOM   815  C  CB    . VAL A 1 102 ? 33.928 33.963 20.728  1.00 22.74  ? 102  VAL A CB    1 
ATOM   816  C  CG1   . VAL A 1 102 ? 33.680 35.373 20.244  1.00 26.53  ? 102  VAL A CG1   1 
ATOM   817  C  CG2   . VAL A 1 102 ? 33.048 32.922 20.093  1.00 20.54  ? 102  VAL A CG2   1 
ATOM   818  N  N     . PHE A 1 103 ? 36.500 34.720 22.606  1.00 14.93  ? 103  PHE A N     1 
ATOM   819  C  CA    . PHE A 1 103 ? 37.396 35.702 23.154  1.00 19.18  ? 103  PHE A CA    1 
ATOM   820  C  C     . PHE A 1 103 ? 38.822 35.389 22.702  1.00 24.99  ? 103  PHE A C     1 
ATOM   821  O  O     . PHE A 1 103 ? 39.640 36.253 22.357  1.00 18.97  ? 103  PHE A O     1 
ATOM   822  C  CB    . PHE A 1 103 ? 37.354 35.820 24.707  1.00 24.14  ? 103  PHE A CB    1 
ATOM   823  C  CG    . PHE A 1 103 ? 38.376 36.820 25.288  1.00 20.52  ? 103  PHE A CG    1 
ATOM   824  C  CD1   . PHE A 1 103 ? 38.290 38.209 25.091  1.00 13.99  ? 103  PHE A CD1   1 
ATOM   825  C  CD2   . PHE A 1 103 ? 39.490 36.342 26.017  1.00 23.35  ? 103  PHE A CD2   1 
ATOM   826  C  CE1   . PHE A 1 103 ? 39.259 39.119 25.567  1.00 16.29  ? 103  PHE A CE1   1 
ATOM   827  C  CE2   . PHE A 1 103 ? 40.461 37.233 26.502  1.00 16.78  ? 103  PHE A CE2   1 
ATOM   828  C  CZ    . PHE A 1 103 ? 40.322 38.623 26.339  1.00 24.96  ? 103  PHE A CZ    1 
ATOM   829  N  N     . HIS A 1 104 ? 39.111 34.118 22.707  1.00 15.82  ? 104  HIS A N     1 
ATOM   830  C  CA    . HIS A 1 104 ? 40.436 33.680 22.353  1.00 19.39  ? 104  HIS A CA    1 
ATOM   831  C  C     . HIS A 1 104 ? 40.843 34.100 20.949  1.00 14.28  ? 104  HIS A C     1 
ATOM   832  O  O     . HIS A 1 104 ? 41.974 34.486 20.718  1.00 22.57  ? 104  HIS A O     1 
ATOM   833  C  CB    . HIS A 1 104 ? 40.506 32.189 22.468  1.00 17.81  ? 104  HIS A CB    1 
ATOM   834  C  CG    . HIS A 1 104 ? 41.841 31.672 22.062  1.00 30.29  ? 104  HIS A CG    1 
ATOM   835  N  ND1   . HIS A 1 104 ? 42.994 32.019 22.752  1.00 22.98  ? 104  HIS A ND1   1 
ATOM   836  C  CD2   . HIS A 1 104 ? 42.188 30.864 21.000  1.00 29.17  ? 104  HIS A CD2   1 
ATOM   837  C  CE1   . HIS A 1 104 ? 43.984 31.380 22.104  1.00 24.23  ? 104  HIS A CE1   1 
ATOM   838  N  NE2   . HIS A 1 104 ? 43.541 30.678 21.056  1.00 20.22  ? 104  HIS A NE2   1 
ATOM   839  N  N     . ASN A 1 105 ? 39.923 34.022 19.995  1.00 16.97  ? 105  ASN A N     1 
ATOM   840  C  CA    . ASN A 1 105 ? 40.268 34.401 18.616  1.00 21.34  ? 105  ASN A CA    1 
ATOM   841  C  C     . ASN A 1 105 ? 40.517 35.884 18.526  1.00 20.16  ? 105  ASN A C     1 
ATOM   842  O  O     . ASN A 1 105 ? 41.416 36.391 17.868  1.00 17.35  ? 105  ASN A O     1 
ATOM   843  C  CB    . ASN A 1 105 ? 39.178 33.969 17.555  1.00 20.99  ? 105  ASN A CB    1 
ATOM   844  C  CG    . ASN A 1 105 ? 39.633 34.206 16.132  1.00 23.76  ? 105  ASN A CG    1 
ATOM   845  O  OD1   . ASN A 1 105 ? 39.045 34.968 15.315  1.00 24.56  ? 105  ASN A OD1   1 
ATOM   846  N  ND2   . ASN A 1 105 ? 40.763 33.558 15.903  1.00 15.72  ? 105  ASN A ND2   1 
ATOM   847  N  N     . LEU A 1 106 ? 39.666 36.595 19.222  1.00 12.63  ? 106  LEU A N     1 
ATOM   848  C  CA    . LEU A 1 106 ? 39.856 38.013 19.231  1.00 16.77  ? 106  LEU A CA    1 
ATOM   849  C  C     . LEU A 1 106 ? 41.214 38.449 19.793  1.00 17.83  ? 106  LEU A C     1 
ATOM   850  O  O     . LEU A 1 106 ? 41.828 39.427 19.280  1.00 19.68  ? 106  LEU A O     1 
ATOM   851  C  CB    . LEU A 1 106 ? 38.782 38.619 20.154  1.00 22.48  ? 106  LEU A CB    1 
ATOM   852  C  CG    . LEU A 1 106 ? 38.184 39.921 19.771  1.00 45.64  ? 106  LEU A CG    1 
ATOM   853  C  CD1   . LEU A 1 106 ? 37.786 39.989 18.304  1.00 25.00  ? 106  LEU A CD1   1 
ATOM   854  C  CD2   . LEU A 1 106 ? 36.897 39.896 20.576  1.00 66.38  ? 106  LEU A CD2   1 
ATOM   855  N  N     . ARG A 1 107 ? 41.555 37.823 20.936  1.00 15.64  ? 107  ARG A N     1 
ATOM   856  C  CA    . ARG A 1 107 ? 42.804 38.093 21.664  1.00 13.44  ? 107  ARG A CA    1 
ATOM   857  C  C     . ARG A 1 107 ? 44.026 37.710 20.808  1.00 13.97  ? 107  ARG A C     1 
ATOM   858  O  O     . ARG A 1 107 ? 44.980 38.488 20.732  1.00 16.53  ? 107  ARG A O     1 
ATOM   859  C  CB    . ARG A 1 107 ? 42.768 37.115 22.842  1.00 15.98  ? 107  ARG A CB    1 
ATOM   860  C  CG    . ARG A 1 107 ? 44.066 37.149 23.628  1.00 20.62  ? 107  ARG A CG    1 
ATOM   861  C  CD    . ARG A 1 107 ? 44.089 35.960 24.626  1.00 23.14  ? 107  ARG A CD    1 
ATOM   862  N  NE    . ARG A 1 107 ? 44.117 36.716 25.849  1.00 34.97  ? 107  ARG A NE    1 
ATOM   863  C  CZ    . ARG A 1 107 ? 43.827 36.153 26.991  1.00 100.00 ? 107  ARG A CZ    1 
ATOM   864  N  NH1   . ARG A 1 107 ? 43.557 34.845 27.004  1.00 28.73  ? 107  ARG A NH1   1 
ATOM   865  N  NH2   . ARG A 1 107 ? 43.834 36.865 28.129  1.00 17.76  ? 107  ARG A NH2   1 
ATOM   866  N  N     . VAL A 1 108 ? 43.978 36.498 20.172  1.00 12.77  ? 108  VAL A N     1 
ATOM   867  C  CA    . VAL A 1 108 ? 45.095 36.078 19.298  1.00 16.39  ? 108  VAL A CA    1 
ATOM   868  C  C     . VAL A 1 108 ? 45.343 37.190 18.248  1.00 28.65  ? 108  VAL A C     1 
ATOM   869  O  O     . VAL A 1 108 ? 46.482 37.621 17.970  1.00 16.10  ? 108  VAL A O     1 
ATOM   870  C  CB    . VAL A 1 108 ? 44.733 34.749 18.641  1.00 17.46  ? 108  VAL A CB    1 
ATOM   871  C  CG1   . VAL A 1 108 ? 45.783 34.528 17.589  1.00 24.64  ? 108  VAL A CG1   1 
ATOM   872  C  CG2   . VAL A 1 108 ? 44.849 33.576 19.594  1.00 16.21  ? 108  VAL A CG2   1 
ATOM   873  N  N     . ARG A 1 109 ? 44.229 37.694 17.678  1.00 18.75  ? 109  ARG A N     1 
ATOM   874  C  CA    . ARG A 1 109 ? 44.272 38.750 16.691  1.00 9.67   ? 109  ARG A CA    1 
ATOM   875  C  C     . ARG A 1 109 ? 44.806 40.004 17.282  1.00 20.82  ? 109  ARG A C     1 
ATOM   876  O  O     . ARG A 1 109 ? 45.706 40.588 16.708  1.00 16.02  ? 109  ARG A O     1 
ATOM   877  C  CB    . ARG A 1 109 ? 42.955 38.947 15.896  1.00 9.01   ? 109  ARG A CB    1 
ATOM   878  C  CG    . ARG A 1 109 ? 42.721 37.637 15.130  1.00 9.91   ? 109  ARG A CG    1 
ATOM   879  C  CD    . ARG A 1 109 ? 41.446 37.706 14.289  1.00 17.28  ? 109  ARG A CD    1 
ATOM   880  N  NE    . ARG A 1 109 ? 41.415 38.931 13.400  1.00 17.45  ? 109  ARG A NE    1 
ATOM   881  C  CZ    . ARG A 1 109 ? 42.040 39.105 12.165  1.00 11.06  ? 109  ARG A CZ    1 
ATOM   882  N  NH1   . ARG A 1 109 ? 42.815 38.136 11.636  1.00 14.04  ? 109  ARG A NH1   1 
ATOM   883  N  NH2   . ARG A 1 109 ? 41.859 40.286 11.515  1.00 10.78  ? 109  ARG A NH2   1 
ATOM   884  N  N     . TYR A 1 110 ? 44.269 40.419 18.438  1.00 14.57  ? 110  TYR A N     1 
ATOM   885  C  CA    . TYR A 1 110 ? 44.679 41.677 19.026  1.00 13.06  ? 110  TYR A CA    1 
ATOM   886  C  C     . TYR A 1 110 ? 46.176 41.654 19.424  1.00 10.47  ? 110  TYR A C     1 
ATOM   887  O  O     . TYR A 1 110 ? 46.854 42.686 19.359  1.00 13.57  ? 110  TYR A O     1 
ATOM   888  C  CB    . TYR A 1 110 ? 43.812 41.843 20.307  1.00 11.64  ? 110  TYR A CB    1 
ATOM   889  C  CG    . TYR A 1 110 ? 43.849 43.246 20.895  1.00 10.89  ? 110  TYR A CG    1 
ATOM   890  C  CD1   . TYR A 1 110 ? 43.185 44.307 20.274  1.00 11.61  ? 110  TYR A CD1   1 
ATOM   891  C  CD2   . TYR A 1 110 ? 44.657 43.525 22.012  1.00 8.68   ? 110  TYR A CD2   1 
ATOM   892  C  CE1   . TYR A 1 110 ? 43.216 45.622 20.745  1.00 12.52  ? 110  TYR A CE1   1 
ATOM   893  C  CE2   . TYR A 1 110 ? 44.649 44.822 22.540  1.00 16.45  ? 110  TYR A CE2   1 
ATOM   894  C  CZ    . TYR A 1 110 ? 43.947 45.865 21.929  1.00 17.35  ? 110  TYR A CZ    1 
ATOM   895  O  OH    . TYR A 1 110 ? 43.958 47.121 22.495  1.00 15.69  ? 110  TYR A OH    1 
ATOM   896  N  N     . ASN A 1 111 ? 46.641 40.474 19.788  1.00 12.72  ? 111  ASN A N     1 
ATOM   897  C  CA    . ASN A 1 111 ? 48.073 40.285 20.149  1.00 19.14  ? 111  ASN A CA    1 
ATOM   898  C  C     . ASN A 1 111 ? 49.002 40.553 18.960  1.00 25.01  ? 111  ASN A C     1 
ATOM   899  O  O     . ASN A 1 111 ? 50.187 40.752 19.094  1.00 21.36  ? 111  ASN A O     1 
ATOM   900  C  CB    . ASN A 1 111 ? 48.395 38.854 20.631  1.00 15.47  ? 111  ASN A CB    1 
ATOM   901  C  CG    . ASN A 1 111 ? 47.885 38.472 22.017  1.00 11.21  ? 111  ASN A CG    1 
ATOM   902  O  OD1   . ASN A 1 111 ? 47.580 39.341 22.786  1.00 21.39  ? 111  ASN A OD1   1 
ATOM   903  N  ND2   . ASN A 1 111 ? 47.747 37.176 22.226  1.00 17.13  ? 111  ASN A ND2   1 
ATOM   904  N  N     . GLN A 1 112 ? 48.454 40.581 17.773  1.00 19.73  ? 112  GLN A N     1 
ATOM   905  C  CA    . GLN A 1 112 ? 49.238 40.853 16.584  1.00 14.11  ? 112  GLN A CA    1 
ATOM   906  C  C     . GLN A 1 112 ? 48.794 42.159 16.040  1.00 14.64  ? 112  GLN A C     1 
ATOM   907  O  O     . GLN A 1 112 ? 49.045 42.478 14.881  1.00 23.97  ? 112  GLN A O     1 
ATOM   908  C  CB    . GLN A 1 112 ? 48.988 39.713 15.555  1.00 14.88  ? 112  GLN A CB    1 
ATOM   909  C  CG    . GLN A 1 112 ? 49.531 38.365 16.021  1.00 8.94   ? 112  GLN A CG    1 
ATOM   910  C  CD    . GLN A 1 112 ? 49.162 37.178 15.235  1.00 21.78  ? 112  GLN A CD    1 
ATOM   911  O  OE1   . GLN A 1 112 ? 49.826 36.786 14.253  1.00 22.71  ? 112  GLN A OE1   1 
ATOM   912  N  NE2   . GLN A 1 112 ? 48.130 36.514 15.729  1.00 16.07  ? 112  GLN A NE2   1 
ATOM   913  N  N     . ASP A 1 113 ? 48.139 42.938 16.882  1.00 13.39  ? 113  ASP A N     1 
ATOM   914  C  CA    . ASP A 1 113 ? 47.645 44.237 16.500  1.00 12.28  ? 113  ASP A CA    1 
ATOM   915  C  C     . ASP A 1 113 ? 46.609 44.183 15.381  1.00 7.93   ? 113  ASP A C     1 
ATOM   916  O  O     . ASP A 1 113 ? 46.485 45.149 14.582  1.00 14.95  ? 113  ASP A O     1 
ATOM   917  C  CB    . ASP A 1 113 ? 48.726 45.209 16.035  1.00 18.74  ? 113  ASP A CB    1 
ATOM   918  C  CG    . ASP A 1 113 ? 49.581 45.747 17.140  1.00 39.63  ? 113  ASP A CG    1 
ATOM   919  O  OD1   . ASP A 1 113 ? 49.203 45.410 18.308  1.00 20.58  ? 113  ASP A OD1   1 
ATOM   920  O  OD2   . ASP A 1 113 ? 50.583 46.410 16.965  1.00 27.96  ? 113  ASP A OD2   1 
ATOM   921  N  N     . LEU A 1 114 ? 45.910 43.054 15.283  1.00 10.65  ? 114  LEU A N     1 
ATOM   922  C  CA    . LEU A 1 114 ? 44.827 42.936 14.292  1.00 18.93  ? 114  LEU A CA    1 
ATOM   923  C  C     . LEU A 1 114 ? 43.545 43.315 15.054  1.00 16.59  ? 114  LEU A C     1 
ATOM   924  O  O     . LEU A 1 114 ? 43.001 42.475 15.767  1.00 16.27  ? 114  LEU A O     1 
ATOM   925  C  CB    . LEU A 1 114 ? 44.766 41.501 13.714  1.00 14.10  ? 114  LEU A CB    1 
ATOM   926  C  CG    . LEU A 1 114 ? 46.156 41.169 13.075  1.00 16.09  ? 114  LEU A CG    1 
ATOM   927  C  CD1   . LEU A 1 114 ? 46.151 39.678 12.780  1.00 11.55  ? 114  LEU A CD1   1 
ATOM   928  C  CD2   . LEU A 1 114 ? 46.445 42.124 11.891  1.00 16.09  ? 114  LEU A CD2   1 
ATOM   929  N  N     . ILE A 1 115 ? 43.136 44.568 14.962  1.00 9.50   ? 115  ILE A N     1 
ATOM   930  C  CA    . ILE A 1 115 ? 42.033 45.100 15.723  1.00 11.49  ? 115  ILE A CA    1 
ATOM   931  C  C     . ILE A 1 115 ? 40.654 44.874 15.105  1.00 19.46  ? 115  ILE A C     1 
ATOM   932  O  O     . ILE A 1 115 ? 39.640 45.003 15.780  1.00 16.36  ? 115  ILE A O     1 
ATOM   933  C  CB    . ILE A 1 115 ? 42.195 46.566 16.026  1.00 10.55  ? 115  ILE A CB    1 
ATOM   934  C  CG1   . ILE A 1 115 ? 42.219 47.251 14.715  1.00 12.54  ? 115  ILE A CG1   1 
ATOM   935  C  CG2   . ILE A 1 115 ? 43.549 46.780 16.682  1.00 11.66  ? 115  ILE A CG2   1 
ATOM   936  C  CD1   . ILE A 1 115 ? 42.004 48.772 14.864  1.00 14.49  ? 115  ILE A CD1   1 
ATOM   937  N  N     . TYR A 1 116 ? 40.606 44.468 13.851  1.00 18.80  ? 116  TYR A N     1 
ATOM   938  C  CA    . TYR A 1 116 ? 39.336 44.202 13.157  1.00 23.49  ? 116  TYR A CA    1 
ATOM   939  C  C     . TYR A 1 116 ? 39.129 42.725 12.914  1.00 12.80  ? 116  TYR A C     1 
ATOM   940  O  O     . TYR A 1 116 ? 40.027 41.999 12.423  1.00 16.37  ? 116  TYR A O     1 
ATOM   941  C  CB    . TYR A 1 116 ? 39.210 44.947 11.794  1.00 11.13  ? 116  TYR A CB    1 
ATOM   942  C  CG    . TYR A 1 116 ? 39.292 46.424 11.940  1.00 15.46  ? 116  TYR A CG    1 
ATOM   943  C  CD1   . TYR A 1 116 ? 38.203 47.115 12.458  1.00 10.17  ? 116  TYR A CD1   1 
ATOM   944  C  CD2   . TYR A 1 116 ? 40.389 47.120 11.421  1.00 9.93   ? 116  TYR A CD2   1 
ATOM   945  C  CE1   . TYR A 1 116 ? 38.254 48.503 12.514  1.00 10.70  ? 116  TYR A CE1   1 
ATOM   946  C  CE2   . TYR A 1 116 ? 40.419 48.524 11.396  1.00 11.31  ? 116  TYR A CE2   1 
ATOM   947  C  CZ    . TYR A 1 116 ? 39.364 49.202 12.010  1.00 11.01  ? 116  TYR A CZ    1 
ATOM   948  O  OH    . TYR A 1 116 ? 39.357 50.540 12.037  1.00 12.04  ? 116  TYR A OH    1 
ATOM   949  N  N     . THR A 1 117 ? 37.910 42.234 13.238  1.00 12.84  ? 117  THR A N     1 
ATOM   950  C  CA    . THR A 1 117 ? 37.539 40.845 13.050  1.00 17.23  ? 117  THR A CA    1 
ATOM   951  C  C     . THR A 1 117 ? 36.052 40.756 12.762  1.00 18.83  ? 117  THR A C     1 
ATOM   952  O  O     . THR A 1 117 ? 35.291 41.408 13.443  1.00 17.17  ? 117  THR A O     1 
ATOM   953  C  CB    . THR A 1 117 ? 37.840 39.907 14.314  1.00 13.82  ? 117  THR A CB    1 
ATOM   954  O  OG1   . THR A 1 117 ? 39.122 40.272 14.860  1.00 16.90  ? 117  THR A OG1   1 
ATOM   955  C  CG2   . THR A 1 117 ? 37.609 38.357 14.114  1.00 13.13  ? 117  THR A CG2   1 
ATOM   956  N  N     . TYR A 1 118 ? 35.651 39.943 11.791  1.00 15.97  ? 118  TYR A N     1 
ATOM   957  C  CA    . TYR A 1 118 ? 34.251 39.760 11.513  1.00 16.92  ? 118  TYR A CA    1 
ATOM   958  C  C     . TYR A 1 118 ? 33.708 38.727 12.448  1.00 16.70  ? 118  TYR A C     1 
ATOM   959  O  O     . TYR A 1 118 ? 34.403 37.846 12.915  1.00 17.50  ? 118  TYR A O     1 
ATOM   960  C  CB    . TYR A 1 118 ? 33.957 39.214 10.075  1.00 13.40  ? 118  TYR A CB    1 
ATOM   961  C  CG    . TYR A 1 118 ? 34.386 40.252 8.995   1.00 20.49  ? 118  TYR A CG    1 
ATOM   962  C  CD1   . TYR A 1 118 ? 33.755 41.507 8.956   1.00 17.35  ? 118  TYR A CD1   1 
ATOM   963  C  CD2   . TYR A 1 118 ? 35.387 39.969 8.054   1.00 13.36  ? 118  TYR A CD2   1 
ATOM   964  C  CE1   . TYR A 1 118 ? 34.150 42.505 8.073   1.00 27.88  ? 118  TYR A CE1   1 
ATOM   965  C  CE2   . TYR A 1 118 ? 35.774 40.959 7.149   1.00 14.97  ? 118  TYR A CE2   1 
ATOM   966  C  CZ    . TYR A 1 118 ? 35.125 42.190 7.114   1.00 22.64  ? 118  TYR A CZ    1 
ATOM   967  O  OH    . TYR A 1 118 ? 35.460 43.098 6.174   1.00 19.65  ? 118  TYR A OH    1 
ATOM   968  N  N     . SER A 1 119 ? 32.412 38.845 12.702  1.00 21.28  ? 119  SER A N     1 
ATOM   969  C  CA    . SER A 1 119 ? 31.656 37.861 13.431  1.00 20.81  ? 119  SER A CA    1 
ATOM   970  C  C     . SER A 1 119 ? 30.322 37.726 12.692  1.00 17.53  ? 119  SER A C     1 
ATOM   971  O  O     . SER A 1 119 ? 29.406 38.509 12.962  1.00 15.74  ? 119  SER A O     1 
ATOM   972  C  CB    . SER A 1 119 ? 31.460 38.182 14.908  1.00 17.85  ? 119  SER A CB    1 
ATOM   973  O  OG    . SER A 1 119 ? 30.927 36.980 15.501  1.00 20.65  ? 119  SER A OG    1 
ATOM   974  N  N     . GLY A 1 120 ? 30.269 36.882 11.672  1.00 16.98  ? 120  GLY A N     1 
ATOM   975  C  CA    . GLY A 1 120 ? 29.048 36.824 10.866  1.00 13.49  ? 120  GLY A CA    1 
ATOM   976  C  C     . GLY A 1 120 ? 28.825 38.159 10.226  1.00 15.19  ? 120  GLY A C     1 
ATOM   977  O  O     . GLY A 1 120 ? 29.697 38.694 9.536   1.00 22.19  ? 120  GLY A O     1 
ATOM   978  N  N     . LEU A 1 121 ? 27.665 38.764 10.540  1.00 16.45  ? 121  LEU A N     1 
ATOM   979  C  CA    . LEU A 1 121 ? 27.338 40.054 10.004  1.00 13.62  ? 121  LEU A CA    1 
ATOM   980  C  C     . LEU A 1 121 ? 28.079 41.199 10.651  1.00 22.63  ? 121  LEU A C     1 
ATOM   981  O  O     . LEU A 1 121 ? 28.095 42.307 10.143  1.00 22.61  ? 121  LEU A O     1 
ATOM   982  C  CB    . LEU A 1 121 ? 25.836 40.373 10.122  1.00 19.30  ? 121  LEU A CB    1 
ATOM   983  C  CG    . LEU A 1 121 ? 24.982 39.398 9.287   1.00 24.56  ? 121  LEU A CG    1 
ATOM   984  C  CD1   . LEU A 1 121 ? 23.464 39.560 9.630   1.00 35.19  ? 121  LEU A CD1   1 
ATOM   985  C  CD2   . LEU A 1 121 ? 25.301 39.670 7.803   1.00 28.03  ? 121  LEU A CD2   1 
ATOM   986  N  N     . PHE A 1 122 ? 28.658 40.986 11.809  1.00 18.77  ? 122  PHE A N     1 
ATOM   987  C  CA    . PHE A 1 122 ? 29.318 42.124 12.412  1.00 16.16  ? 122  PHE A CA    1 
ATOM   988  C  C     . PHE A 1 122 ? 30.813 42.239 12.081  1.00 13.52  ? 122  PHE A C     1 
ATOM   989  O  O     . PHE A 1 122 ? 31.545 41.268 11.883  1.00 15.90  ? 122  PHE A O     1 
ATOM   990  C  CB    . PHE A 1 122 ? 29.339 42.011 13.920  1.00 14.79  ? 122  PHE A CB    1 
ATOM   991  C  CG    . PHE A 1 122 ? 28.010 41.989 14.638  1.00 14.87  ? 122  PHE A CG    1 
ATOM   992  C  CD1   . PHE A 1 122 ? 27.306 43.179 14.794  1.00 24.35  ? 122  PHE A CD1   1 
ATOM   993  C  CD2   . PHE A 1 122 ? 27.664 40.851 15.363  1.00 18.11  ? 122  PHE A CD2   1 
ATOM   994  C  CE1   . PHE A 1 122 ? 26.085 43.181 15.481  1.00 21.20  ? 122  PHE A CE1   1 
ATOM   995  C  CE2   . PHE A 1 122 ? 26.486 40.823 16.103  1.00 16.49  ? 122  PHE A CE2   1 
ATOM   996  C  CZ    . PHE A 1 122 ? 25.723 41.990 16.111  1.00 15.35  ? 122  PHE A CZ    1 
ATOM   997  N  N     . LEU A 1 123 ? 31.242 43.485 12.144  1.00 17.73  ? 123  LEU A N     1 
ATOM   998  C  CA    . LEU A 1 123 ? 32.641 43.807 12.094  1.00 26.81  ? 123  LEU A CA    1 
ATOM   999  C  C     . LEU A 1 123 ? 32.936 44.210 13.539  1.00 16.18  ? 123  LEU A C     1 
ATOM   1000 O  O     . LEU A 1 123 ? 32.404 45.150 14.069  1.00 16.33  ? 123  LEU A O     1 
ATOM   1001 C  CB    . LEU A 1 123 ? 33.042 44.980 11.148  1.00 13.07  ? 123  LEU A CB    1 
ATOM   1002 C  CG    . LEU A 1 123 ? 34.467 45.527 11.297  1.00 13.70  ? 123  LEU A CG    1 
ATOM   1003 C  CD1   . LEU A 1 123 ? 35.427 44.422 10.968  1.00 14.32  ? 123  LEU A CD1   1 
ATOM   1004 C  CD2   . LEU A 1 123 ? 34.632 46.780 10.409  1.00 14.70  ? 123  LEU A CD2   1 
ATOM   1005 N  N     . VAL A 1 124 ? 33.780 43.448 14.173  1.00 20.69  ? 124  VAL A N     1 
ATOM   1006 C  CA    . VAL A 1 124 ? 34.217 43.765 15.502  1.00 15.99  ? 124  VAL A CA    1 
ATOM   1007 C  C     . VAL A 1 124 ? 35.504 44.610 15.449  1.00 15.41  ? 124  VAL A C     1 
ATOM   1008 O  O     . VAL A 1 124 ? 36.441 44.327 14.722  1.00 13.73  ? 124  VAL A O     1 
ATOM   1009 C  CB    . VAL A 1 124 ? 34.352 42.484 16.281  1.00 18.04  ? 124  VAL A CB    1 
ATOM   1010 C  CG1   . VAL A 1 124 ? 34.754 42.870 17.738  1.00 13.87  ? 124  VAL A CG1   1 
ATOM   1011 C  CG2   . VAL A 1 124 ? 32.963 41.925 16.268  1.00 17.70  ? 124  VAL A CG2   1 
ATOM   1012 N  N     . ALA A 1 125 ? 35.551 45.654 16.228  1.00 14.50  ? 125  ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 125 ? 36.681 46.520 16.216  1.00 13.03  ? 125  ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 125 ? 37.123 46.824 17.645  1.00 23.17  ? 125  ALA A C     1 
ATOM   1015 O  O     . ALA A 1 125 ? 36.381 47.427 18.381  1.00 15.87  ? 125  ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 125 ? 36.395 47.789 15.418  1.00 11.81  ? 125  ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 126 ? 38.328 46.345 18.028  1.00 18.71  ? 126  VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 126 ? 38.866 46.563 19.358  1.00 20.49  ? 126  VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 126 ? 39.845 47.757 19.361  1.00 22.02  ? 126  VAL A C     1 
ATOM   1020 O  O     . VAL A 1 126 ? 40.793 47.784 18.588  1.00 17.12  ? 126  VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 126 ? 39.518 45.264 19.859  1.00 19.77  ? 126  VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 126 ? 39.863 45.446 21.336  1.00 15.60  ? 126  VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 126 ? 38.602 44.080 19.659  1.00 14.04  ? 126  VAL A CG2   1 
ATOM   1024 N  N     . ASN A 1 127 ? 39.617 48.783 20.190  1.00 14.16  ? 127  ASN A N     1 
ATOM   1025 C  CA    . ASN A 1 127 ? 40.487 49.934 20.245  1.00 17.77  ? 127  ASN A CA    1 
ATOM   1026 C  C     . ASN A 1 127 ? 41.878 49.498 20.605  1.00 16.78  ? 127  ASN A C     1 
ATOM   1027 O  O     . ASN A 1 127 ? 42.029 48.769 21.587  1.00 13.76  ? 127  ASN A O     1 
ATOM   1028 C  CB    . ASN A 1 127 ? 40.042 50.897 21.338  1.00 9.68   ? 127  ASN A CB    1 
ATOM   1029 C  CG    . ASN A 1 127 ? 40.631 52.228 21.203  1.00 12.07  ? 127  ASN A CG    1 
ATOM   1030 O  OD1   . ASN A 1 127 ? 41.729 52.431 20.628  1.00 13.49  ? 127  ASN A OD1   1 
ATOM   1031 N  ND2   . ASN A 1 127 ? 39.838 53.162 21.804  1.00 15.35  ? 127  ASN A ND2   1 
ATOM   1032 N  N     . PRO A 1 128 ? 42.835 49.925 19.791  1.00 20.62  ? 128  PRO A N     1 
ATOM   1033 C  CA    . PRO A 1 128 ? 44.224 49.571 20.044  1.00 17.48  ? 128  PRO A CA    1 
ATOM   1034 C  C     . PRO A 1 128 ? 44.846 50.498 21.085  1.00 24.29  ? 128  PRO A C     1 
ATOM   1035 O  O     . PRO A 1 128 ? 45.836 50.141 21.724  1.00 21.50  ? 128  PRO A O     1 
ATOM   1036 C  CB    . PRO A 1 128 ? 45.029 49.832 18.738  1.00 10.50  ? 128  PRO A CB    1 
ATOM   1037 C  CG    . PRO A 1 128 ? 44.186 50.812 17.977  1.00 13.78  ? 128  PRO A CG    1 
ATOM   1038 C  CD    . PRO A 1 128 ? 42.731 50.495 18.403  1.00 11.56  ? 128  PRO A CD    1 
ATOM   1039 N  N     . PHE A 1 129 ? 44.299 51.694 21.251  1.00 19.34  ? 129  PHE A N     1 
ATOM   1040 C  CA    . PHE A 1 129 ? 44.915 52.602 22.205  1.00 21.81  ? 129  PHE A CA    1 
ATOM   1041 C  C     . PHE A 1 129 ? 46.377 52.863 21.871  1.00 25.79  ? 129  PHE A C     1 
ATOM   1042 O  O     . PHE A 1 129 ? 47.170 53.110 22.752  1.00 20.94  ? 129  PHE A O     1 
ATOM   1043 C  CB    . PHE A 1 129 ? 44.820 52.221 23.695  1.00 11.97  ? 129  PHE A CB    1 
ATOM   1044 C  CG    . PHE A 1 129 ? 43.449 52.537 24.182  1.00 12.53  ? 129  PHE A CG    1 
ATOM   1045 C  CD1   . PHE A 1 129 ? 42.961 53.811 23.995  1.00 17.44  ? 129  PHE A CD1   1 
ATOM   1046 C  CD2   . PHE A 1 129 ? 42.739 51.563 24.879  1.00 16.96  ? 129  PHE A CD2   1 
ATOM   1047 C  CE1   . PHE A 1 129 ? 41.662 54.078 24.440  1.00 23.19  ? 129  PHE A CE1   1 
ATOM   1048 C  CE2   . PHE A 1 129 ? 41.468 51.838 25.372  1.00 16.31  ? 129  PHE A CE2   1 
ATOM   1049 C  CZ    . PHE A 1 129 ? 40.934 53.094 25.113  1.00 12.35  ? 129  PHE A CZ    1 
ATOM   1050 N  N     . LYS A 1 130 ? 46.691 52.808 20.595  1.00 20.45  ? 130  LYS A N     1 
ATOM   1051 C  CA    . LYS A 1 130 ? 47.978 53.152 20.041  1.00 22.75  ? 130  LYS A CA    1 
ATOM   1052 C  C     . LYS A 1 130 ? 47.822 53.302 18.535  1.00 26.87  ? 130  LYS A C     1 
ATOM   1053 O  O     . LYS A 1 130 ? 46.878 52.827 17.954  1.00 18.96  ? 130  LYS A O     1 
ATOM   1054 C  CB    . LYS A 1 130 ? 49.060 52.187 20.333  1.00 17.38  ? 130  LYS A CB    1 
ATOM   1055 C  CG    . LYS A 1 130 ? 48.861 50.930 19.541  1.00 17.19  ? 130  LYS A CG    1 
ATOM   1056 C  CD    . LYS A 1 130 ? 50.038 50.076 19.740  1.00 19.85  ? 130  LYS A CD    1 
ATOM   1057 C  CE    . LYS A 1 130 ? 50.239 49.104 18.627  1.00 31.67  ? 130  LYS A CE    1 
ATOM   1058 N  NZ    . LYS A 1 130 ? 51.526 48.371 18.797  1.00 33.48  ? 130  LYS A NZ    1 
ATOM   1059 N  N     . ARG A 1 131 ? 48.739 53.979 17.888  1.00 28.45  ? 131  ARG A N     1 
ATOM   1060 C  CA    . ARG A 1 131 ? 48.613 54.150 16.447  1.00 39.01  ? 131  ARG A CA    1 
ATOM   1061 C  C     . ARG A 1 131 ? 49.073 52.937 15.666  1.00 45.98  ? 131  ARG A C     1 
ATOM   1062 O  O     . ARG A 1 131 ? 50.076 52.295 16.007  1.00 23.35  ? 131  ARG A O     1 
ATOM   1063 C  CB    . ARG A 1 131 ? 49.111 55.469 15.866  1.00 36.42  ? 131  ARG A CB    1 
ATOM   1064 C  CG    . ARG A 1 131 ? 48.378 56.612 16.602  1.00 56.55  ? 131  ARG A CG    1 
ATOM   1065 C  CD    . ARG A 1 131 ? 47.871 57.736 15.707  1.00 100.00 ? 131  ARG A CD    1 
ATOM   1066 N  NE    . ARG A 1 131 ? 46.452 58.093 16.012  1.00 100.00 ? 131  ARG A NE    1 
ATOM   1067 C  CZ    . ARG A 1 131 ? 45.268 57.566 15.467  1.00 100.00 ? 131  ARG A CZ    1 
ATOM   1068 N  NH1   . ARG A 1 131 ? 45.315 56.640 14.492  1.00 100.00 ? 131  ARG A NH1   1 
ATOM   1069 N  NH2   . ARG A 1 131 ? 44.018 57.999 15.807  1.00 49.74  ? 131  ARG A NH2   1 
ATOM   1070 N  N     . ILE A 1 132 ? 48.236 52.613 14.678  1.00 22.87  ? 132  ILE A N     1 
ATOM   1071 C  CA    . ILE A 1 132 ? 48.389 51.526 13.692  1.00 24.32  ? 132  ILE A CA    1 
ATOM   1072 C  C     . ILE A 1 132 ? 48.185 52.200 12.345  1.00 30.10  ? 132  ILE A C     1 
ATOM   1073 O  O     . ILE A 1 132 ? 47.102 52.752 12.071  1.00 26.85  ? 132  ILE A O     1 
ATOM   1074 C  CB    . ILE A 1 132 ? 47.370 50.385 13.857  1.00 28.30  ? 132  ILE A CB    1 
ATOM   1075 C  CG1   . ILE A 1 132 ? 47.609 49.762 15.245  1.00 22.94  ? 132  ILE A CG1   1 
ATOM   1076 C  CG2   . ILE A 1 132 ? 47.671 49.336 12.774  1.00 19.83  ? 132  ILE A CG2   1 
ATOM   1077 C  CD1   . ILE A 1 132 ? 46.662 48.586 15.485  1.00 22.17  ? 132  ILE A CD1   1 
ATOM   1078 N  N     . PRO A 1 133 ? 49.250 52.234 11.564  1.00 22.30  ? 133  PRO A N     1 
ATOM   1079 C  CA    . PRO A 1 133 ? 49.244 52.939 10.298  1.00 16.70  ? 133  PRO A CA    1 
ATOM   1080 C  C     . PRO A 1 133 ? 48.515 52.198 9.200   1.00 19.69  ? 133  PRO A C     1 
ATOM   1081 O  O     . PRO A 1 133 ? 49.096 51.819 8.165   1.00 25.39  ? 133  PRO A O     1 
ATOM   1082 C  CB    . PRO A 1 133 ? 50.778 53.006 9.970   1.00 23.75  ? 133  PRO A CB    1 
ATOM   1083 C  CG    . PRO A 1 133 ? 51.317 51.699 10.469  1.00 30.59  ? 133  PRO A CG    1 
ATOM   1084 C  CD    . PRO A 1 133 ? 50.407 51.317 11.648  1.00 29.55  ? 133  PRO A CD    1 
ATOM   1085 N  N     . ILE A 1 134 ? 47.190 52.022 9.412   1.00 17.51  ? 134  ILE A N     1 
ATOM   1086 C  CA    . ILE A 1 134 ? 46.378 51.320 8.445   1.00 17.06  ? 134  ILE A CA    1 
ATOM   1087 C  C     . ILE A 1 134 ? 45.350 52.218 7.778   1.00 17.23  ? 134  ILE A C     1 
ATOM   1088 O  O     . ILE A 1 134 ? 44.426 51.755 7.098   1.00 20.12  ? 134  ILE A O     1 
ATOM   1089 C  CB    . ILE A 1 134 ? 45.738 50.124 9.135   1.00 21.20  ? 134  ILE A CB    1 
ATOM   1090 C  CG1   . ILE A 1 134 ? 45.006 50.517 10.459  1.00 12.77  ? 134  ILE A CG1   1 
ATOM   1091 C  CG2   . ILE A 1 134 ? 46.734 48.964 9.335   1.00 22.39  ? 134  ILE A CG2   1 
ATOM   1092 C  CD1   . ILE A 1 134 ? 44.067 49.426 10.951  1.00 10.11  ? 134  ILE A CD1   1 
ATOM   1093 N  N     . TYR A 1 135 ? 45.444 53.501 7.990   1.00 18.44  ? 135  TYR A N     1 
ATOM   1094 C  CA    . TYR A 1 135 ? 44.424 54.353 7.424   1.00 20.00  ? 135  TYR A CA    1 
ATOM   1095 C  C     . TYR A 1 135 ? 44.980 55.333 6.415   1.00 32.57  ? 135  TYR A C     1 
ATOM   1096 O  O     . TYR A 1 135 ? 44.471 56.420 6.291   1.00 24.48  ? 135  TYR A O     1 
ATOM   1097 C  CB    . TYR A 1 135 ? 43.894 55.169 8.626   1.00 15.11  ? 135  TYR A CB    1 
ATOM   1098 C  CG    . TYR A 1 135 ? 43.342 54.229 9.704   1.00 22.84  ? 135  TYR A CG    1 
ATOM   1099 C  CD1   . TYR A 1 135 ? 42.224 53.403 9.439   1.00 16.26  ? 135  TYR A CD1   1 
ATOM   1100 C  CD2   . TYR A 1 135 ? 43.917 54.178 10.978  1.00 18.05  ? 135  TYR A CD2   1 
ATOM   1101 C  CE1   . TYR A 1 135 ? 41.708 52.562 10.411  1.00 17.08  ? 135  TYR A CE1   1 
ATOM   1102 C  CE2   . TYR A 1 135 ? 43.369 53.361 11.961  1.00 19.85  ? 135  TYR A CE2   1 
ATOM   1103 C  CZ    . TYR A 1 135 ? 42.294 52.519 11.673  1.00 16.83  ? 135  TYR A CZ    1 
ATOM   1104 O  OH    . TYR A 1 135 ? 41.740 51.743 12.647  1.00 15.76  ? 135  TYR A OH    1 
ATOM   1105 N  N     . THR A 1 136 ? 46.076 54.967 5.736   1.00 25.52  ? 136  THR A N     1 
ATOM   1106 C  CA    . THR A 1 136 ? 46.688 55.841 4.789   1.00 22.90  ? 136  THR A CA    1 
ATOM   1107 C  C     . THR A 1 136 ? 45.956 55.785 3.477   1.00 19.94  ? 136  THR A C     1 
ATOM   1108 O  O     . THR A 1 136 ? 45.160 54.885 3.234   1.00 18.25  ? 136  THR A O     1 
ATOM   1109 C  CB    . THR A 1 136 ? 48.119 55.314 4.475   1.00 19.47  ? 136  THR A CB    1 
ATOM   1110 O  OG1   . THR A 1 136 ? 47.989 54.017 3.964   1.00 28.59  ? 136  THR A OG1   1 
ATOM   1111 C  CG2   . THR A 1 136 ? 48.998 55.198 5.735   1.00 28.85  ? 136  THR A CG2   1 
ATOM   1112 N  N     . GLN A 1 137 ? 46.327 56.724 2.595   1.00 24.71  ? 137  GLN A N     1 
ATOM   1113 C  CA    . GLN A 1 137 ? 45.739 56.709 1.308   1.00 21.61  ? 137  GLN A CA    1 
ATOM   1114 C  C     . GLN A 1 137 ? 46.058 55.433 0.604   1.00 22.85  ? 137  GLN A C     1 
ATOM   1115 O  O     . GLN A 1 137 ? 45.256 54.873 -0.166  1.00 26.59  ? 137  GLN A O     1 
ATOM   1116 C  CB    . GLN A 1 137 ? 46.080 57.936 0.488   1.00 26.80  ? 137  GLN A CB    1 
ATOM   1117 C  CG    . GLN A 1 137 ? 45.415 57.685 -0.879  1.00 35.01  ? 137  GLN A CG    1 
ATOM   1118 C  CD    . GLN A 1 137 ? 43.960 58.040 -0.896  1.00 25.95  ? 137  GLN A CD    1 
ATOM   1119 O  OE1   . GLN A 1 137 ? 43.567 59.026 -0.298  1.00 26.54  ? 137  GLN A OE1   1 
ATOM   1120 N  NE2   . GLN A 1 137 ? 43.187 57.211 -1.589  1.00 25.31  ? 137  GLN A NE2   1 
ATOM   1121 N  N     . GLU A 1 138 ? 47.245 54.946 0.879   1.00 26.51  ? 138  GLU A N     1 
ATOM   1122 C  CA    . GLU A 1 138 ? 47.665 53.717 0.258   1.00 23.53  ? 138  GLU A CA    1 
ATOM   1123 C  C     . GLU A 1 138 ? 46.782 52.582 0.728   1.00 25.96  ? 138  GLU A C     1 
ATOM   1124 O  O     . GLU A 1 138 ? 46.478 51.662 -0.028  1.00 26.08  ? 138  GLU A O     1 
ATOM   1125 C  CB    . GLU A 1 138 ? 49.168 53.375 0.468   1.00 26.41  ? 138  GLU A CB    1 
ATOM   1126 C  CG    . GLU A 1 138 ? 50.193 54.402 -0.121  1.00 30.14  ? 138  GLU A CG    1 
ATOM   1127 C  CD    . GLU A 1 138 ? 49.940 55.904 0.156   1.00 100.00 ? 138  GLU A CD    1 
ATOM   1128 O  OE1   . GLU A 1 138 ? 49.677 56.261 1.424   1.00 39.79  ? 138  GLU A OE1   1 
ATOM   1129 O  OE2   . GLU A 1 138 ? 50.116 56.759 -0.724  1.00 100.00 ? 138  GLU A OE2   1 
ATOM   1130 N  N     . MET A 1 139 ? 46.431 52.590 2.017   1.00 23.62  ? 139  MET A N     1 
ATOM   1131 C  CA    . MET A 1 139 ? 45.574 51.519 2.515   1.00 16.28  ? 139  MET A CA    1 
ATOM   1132 C  C     . MET A 1 139 ? 44.161 51.699 1.911   1.00 21.13  ? 139  MET A C     1 
ATOM   1133 O  O     . MET A 1 139 ? 43.483 50.747 1.582   1.00 24.92  ? 139  MET A O     1 
ATOM   1134 C  CB    . MET A 1 139 ? 45.467 51.672 4.033   1.00 31.26  ? 139  MET A CB    1 
ATOM   1135 C  CG    . MET A 1 139 ? 46.731 51.277 4.771   1.00 32.44  ? 139  MET A CG    1 
ATOM   1136 S  SD    . MET A 1 139 ? 46.868 49.502 4.923   1.00 27.04  ? 139  MET A SD    1 
ATOM   1137 C  CE    . MET A 1 139 ? 48.600 49.374 5.466   1.00 30.46  ? 139  MET A CE    1 
ATOM   1138 N  N     . VAL A 1 140 ? 43.731 52.972 1.747   1.00 25.10  ? 140  VAL A N     1 
ATOM   1139 C  CA    . VAL A 1 140 ? 42.455 53.264 1.119   1.00 20.03  ? 140  VAL A CA    1 
ATOM   1140 C  C     . VAL A 1 140 ? 42.364 52.553 -0.213  1.00 22.61  ? 140  VAL A C     1 
ATOM   1141 O  O     . VAL A 1 140 ? 41.411 51.844 -0.485  1.00 27.70  ? 140  VAL A O     1 
ATOM   1142 C  CB    . VAL A 1 140 ? 42.137 54.774 0.991   1.00 27.90  ? 140  VAL A CB    1 
ATOM   1143 C  CG1   . VAL A 1 140 ? 40.993 55.070 -0.027  1.00 18.90  ? 140  VAL A CG1   1 
ATOM   1144 C  CG2   . VAL A 1 140 ? 41.761 55.328 2.380   1.00 20.07  ? 140  VAL A CG2   1 
ATOM   1145 N  N     . ASP A 1 141 ? 43.392 52.782 -1.009  1.00 23.60  ? 141  ASP A N     1 
ATOM   1146 C  CA    . ASP A 1 141 ? 43.536 52.280 -2.351  1.00 23.76  ? 141  ASP A CA    1 
ATOM   1147 C  C     . ASP A 1 141 ? 43.371 50.807 -2.548  1.00 28.87  ? 141  ASP A C     1 
ATOM   1148 O  O     . ASP A 1 141 ? 42.789 50.393 -3.533  1.00 28.11  ? 141  ASP A O     1 
ATOM   1149 C  CB    . ASP A 1 141 ? 44.849 52.799 -2.973  1.00 30.37  ? 141  ASP A CB    1 
ATOM   1150 C  CG    . ASP A 1 141 ? 44.804 54.305 -3.246  1.00 42.97  ? 141  ASP A CG    1 
ATOM   1151 O  OD1   . ASP A 1 141 ? 43.631 54.810 -3.028  1.00 34.08  ? 141  ASP A OD1   1 
ATOM   1152 O  OD2   . ASP A 1 141 ? 45.760 54.978 -3.623  1.00 52.36  ? 141  ASP A OD2   1 
ATOM   1153 N  N     . ILE A 1 142 ? 43.912 50.008 -1.620  1.00 25.41  ? 142  ILE A N     1 
ATOM   1154 C  CA    . ILE A 1 142 ? 43.780 48.555 -1.708  1.00 15.22  ? 142  ILE A CA    1 
ATOM   1155 C  C     . ILE A 1 142 ? 42.352 47.992 -1.462  1.00 22.76  ? 142  ILE A C     1 
ATOM   1156 O  O     . ILE A 1 142 ? 41.981 46.883 -1.862  1.00 26.15  ? 142  ILE A O     1 
ATOM   1157 C  CB    . ILE A 1 142 ? 44.619 48.001 -0.529  1.00 36.28  ? 142  ILE A CB    1 
ATOM   1158 C  CG1   . ILE A 1 142 ? 46.049 48.509 -0.448  1.00 51.64  ? 142  ILE A CG1   1 
ATOM   1159 C  CG2   . ILE A 1 142 ? 44.419 46.505 -0.274  1.00 37.81  ? 142  ILE A CG2   1 
ATOM   1160 C  CD1   . ILE A 1 142 ? 46.392 49.072 0.920   1.00 54.18  ? 142  ILE A CD1   1 
ATOM   1161 N  N     . PHE A 1 143 ? 41.522 48.665 -0.680  1.00 20.44  ? 143  PHE A N     1 
ATOM   1162 C  CA    . PHE A 1 143 ? 40.197 48.116 -0.441  1.00 20.91  ? 143  PHE A CA    1 
ATOM   1163 C  C     . PHE A 1 143 ? 39.207 48.426 -1.569  1.00 31.28  ? 143  PHE A C     1 
ATOM   1164 O  O     . PHE A 1 143 ? 38.062 47.986 -1.519  1.00 40.25  ? 143  PHE A O     1 
ATOM   1165 C  CB    . PHE A 1 143 ? 39.550 48.657 0.913   1.00 28.12  ? 143  PHE A CB    1 
ATOM   1166 C  CG    . PHE A 1 143 ? 40.296 47.999 2.035   1.00 21.66  ? 143  PHE A CG    1 
ATOM   1167 C  CD1   . PHE A 1 143 ? 39.843 46.771 2.517   1.00 20.67  ? 143  PHE A CD1   1 
ATOM   1168 C  CD2   . PHE A 1 143 ? 41.436 48.594 2.574   1.00 22.06  ? 143  PHE A CD2   1 
ATOM   1169 C  CE1   . PHE A 1 143 ? 40.539 46.061 3.507   1.00 25.73  ? 143  PHE A CE1   1 
ATOM   1170 C  CE2   . PHE A 1 143 ? 42.128 47.916 3.582   1.00 16.78  ? 143  PHE A CE2   1 
ATOM   1171 C  CZ    . PHE A 1 143 ? 41.717 46.636 3.995   1.00 21.19  ? 143  PHE A CZ    1 
ATOM   1172 N  N     . LYS A 1 144 ? 39.623 49.215 -2.561  1.00 34.44  ? 144  LYS A N     1 
ATOM   1173 C  CA    . LYS A 1 144 ? 38.719 49.605 -3.648  1.00 22.74  ? 144  LYS A CA    1 
ATOM   1174 C  C     . LYS A 1 144 ? 38.206 48.457 -4.452  1.00 23.18  ? 144  LYS A C     1 
ATOM   1175 O  O     . LYS A 1 144 ? 38.946 47.703 -5.005  1.00 33.16  ? 144  LYS A O     1 
ATOM   1176 C  CB    . LYS A 1 144 ? 39.207 50.720 -4.483  1.00 36.10  ? 144  LYS A CB    1 
ATOM   1177 C  CG    . LYS A 1 144 ? 39.724 51.913 -3.593  1.00 42.00  ? 144  LYS A CG    1 
ATOM   1178 C  CD    . LYS A 1 144 ? 40.141 53.065 -4.442  1.00 100.00 ? 144  LYS A CD    1 
ATOM   1179 C  CE    . LYS A 1 144 ? 39.854 53.172 -5.960  1.00 62.78  ? 144  LYS A CE    1 
ATOM   1180 N  NZ    . LYS A 1 144 ? 40.565 53.689 -6.673  1.00 100.00 ? 144  LYS A NZ    1 
ATOM   1181 N  N     . GLY A 1 145 ? 36.899 48.336 -4.437  1.00 27.32  ? 145  GLY A N     1 
ATOM   1182 C  CA    . GLY A 1 145 ? 36.207 47.304 -5.166  1.00 20.71  ? 145  GLY A CA    1 
ATOM   1183 C  C     . GLY A 1 145 ? 36.513 45.891 -4.700  1.00 32.89  ? 145  GLY A C     1 
ATOM   1184 O  O     . GLY A 1 145 ? 36.237 44.934 -5.437  1.00 39.18  ? 145  GLY A O     1 
ATOM   1185 N  N     . ARG A 1 146 ? 37.054 45.707 -3.495  1.00 27.50  ? 146  ARG A N     1 
ATOM   1186 C  CA    . ARG A 1 146 ? 37.384 44.342 -3.075  1.00 25.91  ? 146  ARG A CA    1 
ATOM   1187 C  C     . ARG A 1 146 ? 36.300 43.713 -2.231  1.00 23.29  ? 146  ARG A C     1 
ATOM   1188 O  O     . ARG A 1 146 ? 35.772 44.382 -1.366  1.00 34.22  ? 146  ARG A O     1 
ATOM   1189 C  CB    . ARG A 1 146 ? 38.706 44.222 -2.306  1.00 22.19  ? 146  ARG A CB    1 
ATOM   1190 C  CG    . ARG A 1 146 ? 39.891 44.795 -3.061  1.00 25.82  ? 146  ARG A CG    1 
ATOM   1191 C  CD    . ARG A 1 146 ? 40.316 43.841 -4.137  1.00 52.41  ? 146  ARG A CD    1 
ATOM   1192 N  NE    . ARG A 1 146 ? 41.624 43.200 -4.012  1.00 53.61  ? 146  ARG A NE    1 
ATOM   1193 C  CZ    . ARG A 1 146 ? 42.393 43.044 -5.101  1.00 100.00 ? 146  ARG A CZ    1 
ATOM   1194 N  NH1   . ARG A 1 146 ? 42.049 43.495 -6.305  1.00 100.00 ? 146  ARG A NH1   1 
ATOM   1195 N  NH2   . ARG A 1 146 ? 43.553 42.416 -5.008  1.00 100.00 ? 146  ARG A NH2   1 
ATOM   1196 N  N     . ARG A 1 147 ? 35.989 42.448 -2.468  1.00 20.10  ? 147  ARG A N     1 
ATOM   1197 C  CA    . ARG A 1 147 ? 34.986 41.752 -1.707  1.00 24.21  ? 147  ARG A CA    1 
ATOM   1198 C  C     . ARG A 1 147 ? 35.511 41.492 -0.291  1.00 53.31  ? 147  ARG A C     1 
ATOM   1199 O  O     . ARG A 1 147 ? 36.714 41.344 -0.059  1.00 22.78  ? 147  ARG A O     1 
ATOM   1200 C  CB    . ARG A 1 147 ? 34.668 40.392 -2.275  1.00 24.87  ? 147  ARG A CB    1 
ATOM   1201 C  CG    . ARG A 1 147 ? 34.103 40.424 -3.671  1.00 48.82  ? 147  ARG A CG    1 
ATOM   1202 C  CD    . ARG A 1 147 ? 32.976 39.415 -3.917  1.00 92.61  ? 147  ARG A CD    1 
ATOM   1203 N  NE    . ARG A 1 147 ? 32.560 39.417 -5.320  1.00 100.00 ? 147  ARG A NE    1 
ATOM   1204 C  CZ    . ARG A 1 147 ? 33.401 39.275 -6.354  1.00 100.00 ? 147  ARG A CZ    1 
ATOM   1205 N  NH1   . ARG A 1 147 ? 34.717 39.008 -6.139  1.00 79.21  ? 147  ARG A NH1   1 
ATOM   1206 N  NH2   . ARG A 1 147 ? 32.928 39.292 -7.605  1.00 78.42  ? 147  ARG A NH2   1 
ATOM   1207 N  N     . ARG A 1 148 ? 34.572 41.417 0.662   1.00 30.94  ? 148  ARG A N     1 
ATOM   1208 C  CA    . ARG A 1 148 ? 34.852 41.148 2.074   1.00 57.36  ? 148  ARG A CA    1 
ATOM   1209 C  C     . ARG A 1 148 ? 35.819 39.979 2.262   1.00 34.50  ? 148  ARG A C     1 
ATOM   1210 O  O     . ARG A 1 148 ? 36.781 40.060 3.033   1.00 44.04  ? 148  ARG A O     1 
ATOM   1211 C  CB    . ARG A 1 148 ? 33.532 40.842 2.790   1.00 32.19  ? 148  ARG A CB    1 
ATOM   1212 C  CG    . ARG A 1 148 ? 33.700 40.687 4.298   1.00 52.58  ? 148  ARG A CG    1 
ATOM   1213 C  CD    . ARG A 1 148 ? 32.401 40.547 5.063   1.00 42.24  ? 148  ARG A CD    1 
ATOM   1214 N  NE    . ARG A 1 148 ? 32.355 39.369 5.952   1.00 30.31  ? 148  ARG A NE    1 
ATOM   1215 C  CZ    . ARG A 1 148 ? 31.540 39.318 7.057   1.00 20.34  ? 148  ARG A CZ    1 
ATOM   1216 N  NH1   . ARG A 1 148 ? 30.748 40.409 7.434   1.00 23.62  ? 148  ARG A NH1   1 
ATOM   1217 N  NH2   . ARG A 1 148 ? 31.611 38.172 7.741   1.00 27.74  ? 148  ARG A NH2   1 
ATOM   1218 N  N     . ASN A 1 149 ? 35.534 38.888 1.533   1.00 33.23  ? 149  ASN A N     1 
ATOM   1219 C  CA    . ASN A 1 149 ? 36.305 37.666 1.534   1.00 35.83  ? 149  ASN A CA    1 
ATOM   1220 C  C     . ASN A 1 149 ? 37.659 37.795 0.788   1.00 23.35  ? 149  ASN A C     1 
ATOM   1221 O  O     . ASN A 1 149 ? 38.464 36.858 0.787   1.00 59.27  ? 149  ASN A O     1 
ATOM   1222 C  CB    . ASN A 1 149 ? 35.408 36.600 0.807   1.00 40.58  ? 149  ASN A CB    1 
ATOM   1223 C  CG    . ASN A 1 149 ? 35.384 36.788 -0.759  1.00 100.00 ? 149  ASN A CG    1 
ATOM   1224 O  OD1   . ASN A 1 149 ? 34.345 37.062 -1.356  1.00 100.00 ? 149  ASN A OD1   1 
ATOM   1225 N  ND2   . ASN A 1 149 ? 36.528 36.586 -1.444  1.00 100.00 ? 149  ASN A ND2   1 
ATOM   1226 N  N     . GLU A 1 150 ? 37.879 38.939 0.125   1.00 21.45  ? 150  GLU A N     1 
ATOM   1227 C  CA    . GLU A 1 150 ? 39.063 39.133 -0.673  1.00 25.62  ? 150  GLU A CA    1 
ATOM   1228 C  C     . GLU A 1 150 ? 40.119 39.919 0.077   1.00 35.00  ? 150  GLU A C     1 
ATOM   1229 O  O     . GLU A 1 150 ? 41.280 39.954 -0.304  1.00 40.38  ? 150  GLU A O     1 
ATOM   1230 C  CB    . GLU A 1 150 ? 38.841 39.963 -1.993  1.00 33.19  ? 150  GLU A CB    1 
ATOM   1231 C  CG    . GLU A 1 150 ? 37.891 39.547 -3.150  1.00 50.49  ? 150  GLU A CG    1 
ATOM   1232 C  CD    . GLU A 1 150 ? 37.692 40.684 -4.176  1.00 35.70  ? 150  GLU A CD    1 
ATOM   1233 O  OE1   . GLU A 1 150 ? 38.242 41.809 -3.812  1.00 100.00 ? 150  GLU A OE1   1 
ATOM   1234 O  OE2   . GLU A 1 150 ? 37.105 40.577 -5.230  1.00 100.00 ? 150  GLU A OE2   1 
ATOM   1235 N  N     . VAL A 1 151 ? 39.719 40.621 1.114   1.00 27.16  ? 151  VAL A N     1 
ATOM   1236 C  CA    . VAL A 1 151 ? 40.694 41.413 1.851   1.00 19.86  ? 151  VAL A CA    1 
ATOM   1237 C  C     . VAL A 1 151 ? 40.497 41.211 3.339   1.00 22.66  ? 151  VAL A C     1 
ATOM   1238 O  O     . VAL A 1 151 ? 39.488 40.646 3.762   1.00 19.25  ? 151  VAL A O     1 
ATOM   1239 C  CB    . VAL A 1 151 ? 40.625 42.887 1.478   1.00 20.96  ? 151  VAL A CB    1 
ATOM   1240 C  CG1   . VAL A 1 151 ? 41.037 43.033 0.039   1.00 43.13  ? 151  VAL A CG1   1 
ATOM   1241 C  CG2   . VAL A 1 151 ? 39.176 43.274 1.671   1.00 17.25  ? 151  VAL A CG2   1 
ATOM   1242 N  N     . ALA A 1 152 ? 41.495 41.631 4.114   1.00 20.08  ? 152  ALA A N     1 
ATOM   1243 C  CA    . ALA A 1 152 ? 41.468 41.499 5.541   1.00 23.92  ? 152  ALA A CA    1 
ATOM   1244 C  C     . ALA A 1 152 ? 40.306 42.326 6.076   1.00 21.45  ? 152  ALA A C     1 
ATOM   1245 O  O     . ALA A 1 152 ? 39.800 43.237 5.419   1.00 18.55  ? 152  ALA A O     1 
ATOM   1246 C  CB    . ALA A 1 152 ? 42.755 42.189 6.094   1.00 17.21  ? 152  ALA A CB    1 
ATOM   1247 N  N     . PRO A 1 153 ? 39.890 42.021 7.293   1.00 20.61  ? 153  PRO A N     1 
ATOM   1248 C  CA    . PRO A 1 153 ? 38.876 42.821 7.934   1.00 16.05  ? 153  PRO A CA    1 
ATOM   1249 C  C     . PRO A 1 153 ? 39.425 44.238 8.150   1.00 18.29  ? 153  PRO A C     1 
ATOM   1250 O  O     . PRO A 1 153 ? 40.604 44.429 8.508   1.00 16.34  ? 153  PRO A O     1 
ATOM   1251 C  CB    . PRO A 1 153 ? 38.723 42.178 9.308   1.00 13.39  ? 153  PRO A CB    1 
ATOM   1252 C  CG    . PRO A 1 153 ? 39.139 40.681 9.044   1.00 13.00  ? 153  PRO A CG    1 
ATOM   1253 C  CD    . PRO A 1 153 ? 40.029 40.668 7.835   1.00 14.21  ? 153  PRO A CD    1 
ATOM   1254 N  N     . HIS A 1 154 ? 38.560 45.234 7.889   1.00 17.02  ? 154  HIS A N     1 
ATOM   1255 C  CA    . HIS A 1 154 ? 38.905 46.633 8.068   1.00 9.68   ? 154  HIS A CA    1 
ATOM   1256 C  C     . HIS A 1 154 ? 37.629 47.447 7.998   1.00 13.32  ? 154  HIS A C     1 
ATOM   1257 O  O     . HIS A 1 154 ? 36.720 47.048 7.263   1.00 16.12  ? 154  HIS A O     1 
ATOM   1258 C  CB    . HIS A 1 154 ? 39.813 47.030 6.866   1.00 12.50  ? 154  HIS A CB    1 
ATOM   1259 C  CG    . HIS A 1 154 ? 40.624 48.253 7.110   1.00 12.09  ? 154  HIS A CG    1 
ATOM   1260 N  ND1   . HIS A 1 154 ? 40.088 49.503 7.197   1.00 13.87  ? 154  HIS A ND1   1 
ATOM   1261 C  CD2   . HIS A 1 154 ? 41.974 48.405 7.276   1.00 15.53  ? 154  HIS A CD2   1 
ATOM   1262 C  CE1   . HIS A 1 154 ? 41.053 50.381 7.488   1.00 11.00  ? 154  HIS A CE1   1 
ATOM   1263 N  NE2   . HIS A 1 154 ? 42.211 49.743 7.514   1.00 12.97  ? 154  HIS A NE2   1 
ATOM   1264 N  N     . ILE A 1 155 ? 37.591 48.597 8.672   1.00 9.66   ? 155  ILE A N     1 
ATOM   1265 C  CA    . ILE A 1 155 ? 36.475 49.496 8.491   1.00 9.85   ? 155  ILE A CA    1 
ATOM   1266 C  C     . ILE A 1 155 ? 36.328 49.938 7.020   1.00 21.96  ? 155  ILE A C     1 
ATOM   1267 O  O     . ILE A 1 155 ? 35.235 50.200 6.493   1.00 16.27  ? 155  ILE A O     1 
ATOM   1268 C  CB    . ILE A 1 155 ? 36.563 50.699 9.480   1.00 13.45  ? 155  ILE A CB    1 
ATOM   1269 C  CG1   . ILE A 1 155 ? 35.323 51.666 9.504   1.00 13.75  ? 155  ILE A CG1   1 
ATOM   1270 C  CG2   . ILE A 1 155 ? 37.799 51.585 9.252   1.00 10.96  ? 155  ILE A CG2   1 
ATOM   1271 C  CD1   . ILE A 1 155 ? 34.057 51.041 10.166  1.00 14.54  ? 155  ILE A CD1   1 
ATOM   1272 N  N     . PHE A 1 156 ? 37.436 50.007 6.298   1.00 17.23  ? 156  PHE A N     1 
ATOM   1273 C  CA    . PHE A 1 156 ? 37.448 50.397 4.899   1.00 12.19  ? 156  PHE A CA    1 
ATOM   1274 C  C     . PHE A 1 156 ? 36.756 49.386 4.087   1.00 11.51  ? 156  PHE A C     1 
ATOM   1275 O  O     . PHE A 1 156 ? 36.128 49.702 3.084   1.00 18.35  ? 156  PHE A O     1 
ATOM   1276 C  CB    . PHE A 1 156 ? 38.854 50.482 4.203   1.00 13.86  ? 156  PHE A CB    1 
ATOM   1277 C  CG    . PHE A 1 156 ? 39.633 51.712 4.631   1.00 17.34  ? 156  PHE A CG    1 
ATOM   1278 C  CD1   . PHE A 1 156 ? 39.073 52.717 5.401   1.00 12.14  ? 156  PHE A CD1   1 
ATOM   1279 C  CD2   . PHE A 1 156 ? 41.006 51.853 4.419   1.00 21.59  ? 156  PHE A CD2   1 
ATOM   1280 C  CE1   . PHE A 1 156 ? 39.778 53.847 5.803   1.00 12.85  ? 156  PHE A CE1   1 
ATOM   1281 C  CE2   . PHE A 1 156 ? 41.728 52.974 4.842   1.00 14.34  ? 156  PHE A CE2   1 
ATOM   1282 C  CZ    . PHE A 1 156 ? 41.143 54.012 5.551   1.00 17.18  ? 156  PHE A CZ    1 
ATOM   1283 N  N     . ALA A 1 157 ? 36.910 48.163 4.505   1.00 13.89  ? 157  ALA A N     1 
ATOM   1284 C  CA    . ALA A 1 157 ? 36.338 47.087 3.794   1.00 12.28  ? 157  ALA A CA    1 
ATOM   1285 C  C     . ALA A 1 157 ? 34.834 47.169 3.851   1.00 39.42  ? 157  ALA A C     1 
ATOM   1286 O  O     . ALA A 1 157 ? 34.131 47.078 2.838   1.00 18.19  ? 157  ALA A O     1 
ATOM   1287 C  CB    . ALA A 1 157 ? 36.884 45.755 4.083   1.00 16.23  ? 157  ALA A CB    1 
ATOM   1288 N  N     . ILE A 1 158 ? 34.323 47.292 5.052   1.00 19.69  ? 158  ILE A N     1 
ATOM   1289 C  CA    . ILE A 1 158 ? 32.864 47.382 5.180   1.00 19.61  ? 158  ILE A CA    1 
ATOM   1290 C  C     . ILE A 1 158 ? 32.332 48.640 4.473   1.00 19.96  ? 158  ILE A C     1 
ATOM   1291 O  O     . ILE A 1 158 ? 31.245 48.627 3.884   1.00 20.75  ? 158  ILE A O     1 
ATOM   1292 C  CB    . ILE A 1 158 ? 32.350 46.866 6.548   1.00 28.37  ? 158  ILE A CB    1 
ATOM   1293 C  CG1   . ILE A 1 158 ? 31.683 47.921 7.340   1.00 38.50  ? 158  ILE A CG1   1 
ATOM   1294 C  CG2   . ILE A 1 158 ? 33.584 46.528 7.339   1.00 54.45  ? 158  ILE A CG2   1 
ATOM   1295 C  CD1   . ILE A 1 158 ? 32.721 48.954 7.615   1.00 29.79  ? 158  ILE A CD1   1 
ATOM   1296 N  N     . SER A 1 159 ? 33.118 49.712 4.520   1.00 10.09  ? 159  SER A N     1 
ATOM   1297 C  CA    . SER A 1 159 ? 32.762 50.894 3.819   1.00 13.25  ? 159  SER A CA    1 
ATOM   1298 C  C     . SER A 1 159 ? 32.662 50.646 2.282   1.00 22.11  ? 159  SER A C     1 
ATOM   1299 O  O     . SER A 1 159 ? 31.769 51.125 1.591   1.00 17.68  ? 159  SER A O     1 
ATOM   1300 C  CB    . SER A 1 159 ? 33.820 51.918 3.953   1.00 21.66  ? 159  SER A CB    1 
ATOM   1301 O  OG    . SER A 1 159 ? 33.761 52.384 5.226   1.00 17.59  ? 159  SER A OG    1 
ATOM   1302 N  N     . ASP A 1 160 ? 33.627 49.954 1.729   1.00 20.54  ? 160  ASP A N     1 
ATOM   1303 C  CA    . ASP A 1 160 ? 33.628 49.633 0.298   1.00 21.71  ? 160  ASP A CA    1 
ATOM   1304 C  C     . ASP A 1 160 ? 32.425 48.754 -0.047  1.00 21.14  ? 160  ASP A C     1 
ATOM   1305 O  O     . ASP A 1 160 ? 31.736 48.959 -1.048  1.00 17.79  ? 160  ASP A O     1 
ATOM   1306 C  CB    . ASP A 1 160 ? 34.958 48.979 -0.240  1.00 25.80  ? 160  ASP A CB    1 
ATOM   1307 C  CG    . ASP A 1 160 ? 35.065 49.093 -1.776  1.00 23.27  ? 160  ASP A CG    1 
ATOM   1308 O  OD1   . ASP A 1 160 ? 35.416 50.304 -2.214  1.00 24.33  ? 160  ASP A OD1   1 
ATOM   1309 O  OD2   . ASP A 1 160 ? 34.691 48.181 -2.502  1.00 24.66  ? 160  ASP A OD2   1 
ATOM   1310 N  N     . VAL A 1 161 ? 32.147 47.744 0.779   1.00 24.21  ? 161  VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 161 ? 31.014 46.862 0.531   1.00 25.24  ? 161  VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 161 ? 29.689 47.641 0.494   1.00 24.30  ? 161  VAL A C     1 
ATOM   1313 O  O     . VAL A 1 161 ? 28.787 47.329 -0.321  1.00 22.12  ? 161  VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 161 ? 30.965 45.728 1.531   1.00 25.49  ? 161  VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 161 ? 29.543 45.196 1.663   1.00 31.54  ? 161  VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 161 ? 32.075 44.657 1.270   1.00 20.04  ? 161  VAL A CG2   1 
ATOM   1317 N  N     . ALA A 1 162 ? 29.575 48.639 1.367   1.00 20.96  ? 162  ALA A N     1 
ATOM   1318 C  CA    . ALA A 1 162 ? 28.378 49.463 1.400   1.00 25.47  ? 162  ALA A CA    1 
ATOM   1319 C  C     . ALA A 1 162 ? 28.256 50.302 0.123   1.00 21.34  ? 162  ALA A C     1 
ATOM   1320 O  O     . ALA A 1 162 ? 27.197 50.435 -0.486  1.00 18.04  ? 162  ALA A O     1 
ATOM   1321 C  CB    . ALA A 1 162 ? 28.414 50.417 2.599   1.00 20.32  ? 162  ALA A CB    1 
ATOM   1322 N  N     . TYR A 1 163 ? 29.353 50.929 -0.248  1.00 15.33  ? 163  TYR A N     1 
ATOM   1323 C  CA    . TYR A 1 163 ? 29.395 51.741 -1.439  1.00 14.97  ? 163  TYR A CA    1 
ATOM   1324 C  C     . TYR A 1 163 ? 29.055 50.919 -2.697  1.00 19.73  ? 163  TYR A C     1 
ATOM   1325 O  O     . TYR A 1 163 ? 28.333 51.360 -3.575  1.00 20.86  ? 163  TYR A O     1 
ATOM   1326 C  CB    . TYR A 1 163 ? 30.810 52.243 -1.600  1.00 16.88  ? 163  TYR A CB    1 
ATOM   1327 C  CG    . TYR A 1 163 ? 30.929 53.206 -2.755  1.00 21.97  ? 163  TYR A CG    1 
ATOM   1328 C  CD1   . TYR A 1 163 ? 30.215 54.412 -2.756  1.00 19.60  ? 163  TYR A CD1   1 
ATOM   1329 C  CD2   . TYR A 1 163 ? 31.704 52.898 -3.876  1.00 27.52  ? 163  TYR A CD2   1 
ATOM   1330 C  CE1   . TYR A 1 163 ? 30.332 55.375 -3.770  1.00 19.93  ? 163  TYR A CE1   1 
ATOM   1331 C  CE2   . TYR A 1 163 ? 31.830 53.836 -4.921  1.00 16.86  ? 163  TYR A CE2   1 
ATOM   1332 C  CZ    . TYR A 1 163 ? 31.131 55.039 -4.875  1.00 18.60  ? 163  TYR A CZ    1 
ATOM   1333 O  OH    . TYR A 1 163 ? 31.196 55.960 -5.897  1.00 20.96  ? 163  TYR A OH    1 
ATOM   1334 N  N     . ARG A 1 164 ? 29.564 49.694 -2.787  1.00 19.68  ? 164  ARG A N     1 
ATOM   1335 C  CA    . ARG A 1 164 ? 29.311 48.826 -3.936  1.00 19.11  ? 164  ARG A CA    1 
ATOM   1336 C  C     . ARG A 1 164 ? 27.886 48.365 -4.002  1.00 25.69  ? 164  ARG A C     1 
ATOM   1337 O  O     . ARG A 1 164 ? 27.288 48.266 -5.059  1.00 22.05  ? 164  ARG A O     1 
ATOM   1338 C  CB    . ARG A 1 164 ? 30.183 47.575 -4.041  1.00 13.73  ? 164  ARG A CB    1 
ATOM   1339 C  CG    . ARG A 1 164 ? 31.668 47.844 -4.005  1.00 18.94  ? 164  ARG A CG    1 
ATOM   1340 C  CD    . ARG A 1 164 ? 32.147 48.744 -5.156  1.00 24.30  ? 164  ARG A CD    1 
ATOM   1341 N  NE    . ARG A 1 164 ? 33.413 49.387 -4.775  1.00 26.95  ? 164  ARG A NE    1 
ATOM   1342 C  CZ    . ARG A 1 164 ? 33.954 50.396 -5.378  1.00 31.54  ? 164  ARG A CZ    1 
ATOM   1343 N  NH1   . ARG A 1 164 ? 33.442 50.872 -6.505  1.00 41.93  ? 164  ARG A NH1   1 
ATOM   1344 N  NH2   . ARG A 1 164 ? 35.050 50.935 -4.841  1.00 26.24  ? 164  ARG A NH2   1 
ATOM   1345 N  N     . SER A 1 165 ? 27.369 48.037 -2.849  1.00 24.93  ? 165  SER A N     1 
ATOM   1346 C  CA    . SER A 1 165 ? 26.003 47.584 -2.749  1.00 18.03  ? 165  SER A CA    1 
ATOM   1347 C  C     . SER A 1 165 ? 25.082 48.732 -3.133  1.00 13.37  ? 165  SER A C     1 
ATOM   1348 O  O     . SER A 1 165 ? 24.035 48.564 -3.780  1.00 19.77  ? 165  SER A O     1 
ATOM   1349 C  CB    . SER A 1 165 ? 25.729 47.139 -1.305  1.00 26.10  ? 165  SER A CB    1 
ATOM   1350 O  OG    . SER A 1 165 ? 26.259 45.892 -1.064  1.00 23.18  ? 165  SER A OG    1 
ATOM   1351 N  N     . MET A 1 166 ? 25.422 49.890 -2.684  1.00 9.62   ? 166  MET A N     1 
ATOM   1352 C  CA    . MET A 1 166 ? 24.606 51.020 -3.004  1.00 14.94  ? 166  MET A CA    1 
ATOM   1353 C  C     . MET A 1 166 ? 24.502 51.156 -4.535  1.00 35.42  ? 166  MET A C     1 
ATOM   1354 O  O     . MET A 1 166 ? 23.435 51.261 -5.112  1.00 21.77  ? 166  MET A O     1 
ATOM   1355 C  CB    . MET A 1 166 ? 25.250 52.252 -2.402  1.00 16.83  ? 166  MET A CB    1 
ATOM   1356 C  CG    . MET A 1 166 ? 24.467 53.513 -2.750  1.00 11.90  ? 166  MET A CG    1 
ATOM   1357 S  SD    . MET A 1 166 ? 25.108 55.100 -2.337  1.00 23.27  ? 166  MET A SD    1 
ATOM   1358 C  CE    . MET A 1 166 ? 26.579 55.277 -3.538  1.00 13.25  ? 166  MET A CE    1 
ATOM   1359 N  N     . LEU A 1 167 ? 25.630 51.147 -5.225  1.00 23.63  ? 167  LEU A N     1 
ATOM   1360 C  CA    . LEU A 1 167 ? 25.657 51.274 -6.690  1.00 29.11  ? 167  LEU A CA    1 
ATOM   1361 C  C     . LEU A 1 167 ? 25.102 50.071 -7.475  1.00 20.86  ? 167  LEU A C     1 
ATOM   1362 O  O     . LEU A 1 167 ? 24.544 50.203 -8.542  1.00 30.15  ? 167  LEU A O     1 
ATOM   1363 C  CB    . LEU A 1 167 ? 27.114 51.463 -7.218  1.00 29.51  ? 167  LEU A CB    1 
ATOM   1364 C  CG    . LEU A 1 167 ? 28.013 52.510 -6.609  1.00 26.15  ? 167  LEU A CG    1 
ATOM   1365 C  CD1   . LEU A 1 167 ? 29.477 52.213 -6.868  1.00 38.03  ? 167  LEU A CD1   1 
ATOM   1366 C  CD2   . LEU A 1 167 ? 27.702 53.848 -7.107  1.00 24.85  ? 167  LEU A CD2   1 
ATOM   1367 N  N     . ASP A 1 168 ? 25.316 48.879 -6.963  1.00 12.76  ? 168  ASP A N     1 
ATOM   1368 C  CA    . ASP A 1 168 ? 24.879 47.705 -7.609  1.00 12.02  ? 168  ASP A CA    1 
ATOM   1369 C  C     . ASP A 1 168 ? 23.416 47.403 -7.376  1.00 34.59  ? 168  ASP A C     1 
ATOM   1370 O  O     . ASP A 1 168 ? 22.764 46.865 -8.224  1.00 27.60  ? 168  ASP A O     1 
ATOM   1371 C  CB    . ASP A 1 168 ? 25.581 46.457 -7.179  1.00 17.22  ? 168  ASP A CB    1 
ATOM   1372 C  CG    . ASP A 1 168 ? 27.058 46.526 -7.458  1.00 52.58  ? 168  ASP A CG    1 
ATOM   1373 O  OD1   . ASP A 1 168 ? 27.587 47.401 -8.105  1.00 44.55  ? 168  ASP A OD1   1 
ATOM   1374 O  OD2   . ASP A 1 168 ? 27.703 45.537 -6.932  1.00 28.66  ? 168  ASP A OD2   1 
ATOM   1375 N  N     . ASP A 1 169 ? 22.924 47.670 -6.200  1.00 24.65  ? 169  ASP A N     1 
ATOM   1376 C  CA    . ASP A 1 169 ? 21.571 47.365 -5.837  1.00 25.89  ? 169  ASP A CA    1 
ATOM   1377 C  C     . ASP A 1 169 ? 20.671 48.565 -5.927  1.00 16.04  ? 169  ASP A C     1 
ATOM   1378 O  O     . ASP A 1 169 ? 19.427 48.448 -5.862  1.00 23.36  ? 169  ASP A O     1 
ATOM   1379 C  CB    . ASP A 1 169 ? 21.453 46.819 -4.366  1.00 27.96  ? 169  ASP A CB    1 
ATOM   1380 C  CG    . ASP A 1 169 ? 22.224 45.549 -4.085  1.00 38.83  ? 169  ASP A CG    1 
ATOM   1381 O  OD1   . ASP A 1 169 ? 22.327 44.719 -5.078  1.00 26.34  ? 169  ASP A OD1   1 
ATOM   1382 O  OD2   . ASP A 1 169 ? 22.662 45.315 -2.982  1.00 28.26  ? 169  ASP A OD2   1 
ATOM   1383 N  N     . ARG A 1 170 ? 21.276 49.710 -6.077  1.00 11.24  ? 170  ARG A N     1 
ATOM   1384 C  CA    . ARG A 1 170 ? 20.510 50.949 -6.144  1.00 20.82  ? 170  ARG A CA    1 
ATOM   1385 C  C     . ARG A 1 170 ? 19.647 51.065 -4.921  1.00 30.39  ? 170  ARG A C     1 
ATOM   1386 O  O     . ARG A 1 170 ? 18.468 51.361 -4.973  1.00 16.52  ? 170  ARG A O     1 
ATOM   1387 C  CB    . ARG A 1 170 ? 19.757 51.290 -7.403  1.00 17.29  ? 170  ARG A CB    1 
ATOM   1388 C  CG    . ARG A 1 170 ? 20.233 50.393 -8.547  1.00 29.29  ? 170  ARG A CG    1 
ATOM   1389 C  CD    . ARG A 1 170 ? 21.572 50.851 -8.997  1.00 19.98  ? 170  ARG A CD    1 
ATOM   1390 N  NE    . ARG A 1 170 ? 21.495 52.296 -9.290  1.00 23.20  ? 170  ARG A NE    1 
ATOM   1391 C  CZ    . ARG A 1 170 ? 22.574 53.063 -9.639  1.00 25.59  ? 170  ARG A CZ    1 
ATOM   1392 N  NH1   . ARG A 1 170 ? 23.831 52.642 -9.696  1.00 41.06  ? 170  ARG A NH1   1 
ATOM   1393 N  NH2   . ARG A 1 170 ? 22.418 54.322 -9.974  1.00 25.60  ? 170  ARG A NH2   1 
ATOM   1394 N  N     . GLN A 1 171 ? 20.297 50.839 -3.796  1.00 26.06  ? 171  GLN A N     1 
ATOM   1395 C  CA    . GLN A 1 171 ? 19.623 50.863 -2.510  1.00 16.83  ? 171  GLN A CA    1 
ATOM   1396 C  C     . GLN A 1 171 ? 20.440 51.658 -1.514  1.00 20.93  ? 171  GLN A C     1 
ATOM   1397 O  O     . GLN A 1 171 ? 21.658 51.576 -1.496  1.00 17.72  ? 171  GLN A O     1 
ATOM   1398 C  CB    . GLN A 1 171 ? 19.620 49.373 -2.113  1.00 11.80  ? 171  GLN A CB    1 
ATOM   1399 C  CG    . GLN A 1 171 ? 18.919 49.198 -0.737  1.00 13.77  ? 171  GLN A CG    1 
ATOM   1400 C  CD    . GLN A 1 171 ? 18.901 47.754 -0.216  1.00 19.62  ? 171  GLN A CD    1 
ATOM   1401 O  OE1   . GLN A 1 171 ? 19.723 46.883 -0.501  1.00 36.26  ? 171  GLN A OE1   1 
ATOM   1402 N  NE2   . GLN A 1 171 ? 17.926 47.522 0.612   1.00 26.78  ? 171  GLN A NE2   1 
ATOM   1403 N  N     . ASN A 1 172 ? 19.785 52.485 -0.714  1.00 18.37  ? 172  ASN A N     1 
ATOM   1404 C  CA    . ASN A 1 172 ? 20.497 53.240 0.314   1.00 14.34  ? 172  ASN A CA    1 
ATOM   1405 C  C     . ASN A 1 172 ? 21.114 52.285 1.344   1.00 13.49  ? 172  ASN A C     1 
ATOM   1406 O  O     . ASN A 1 172 ? 20.610 51.178 1.562   1.00 15.11  ? 172  ASN A O     1 
ATOM   1407 C  CB    . ASN A 1 172 ? 19.543 54.181 0.987   1.00 13.49  ? 172  ASN A CB    1 
ATOM   1408 C  CG    . ASN A 1 172 ? 19.068 55.200 0.009   1.00 32.25  ? 172  ASN A CG    1 
ATOM   1409 O  OD1   . ASN A 1 172 ? 19.844 55.602 -0.868  1.00 24.44  ? 172  ASN A OD1   1 
ATOM   1410 N  ND2   . ASN A 1 172 ? 17.807 55.558 0.129   1.00 21.26  ? 172  ASN A ND2   1 
ATOM   1411 N  N     . GLN A 1 173 ? 22.207 52.754 2.003   1.00 14.79  ? 173  GLN A N     1 
ATOM   1412 C  CA    . GLN A 1 173 ? 22.891 51.908 2.952   1.00 14.13  ? 173  GLN A CA    1 
ATOM   1413 C  C     . GLN A 1 173 ? 23.020 52.597 4.292   1.00 10.29  ? 173  GLN A C     1 
ATOM   1414 O  O     . GLN A 1 173 ? 22.969 53.826 4.339   1.00 12.53  ? 173  GLN A O     1 
ATOM   1415 C  CB    . GLN A 1 173 ? 24.355 51.605 2.486   1.00 15.00  ? 173  GLN A CB    1 
ATOM   1416 C  CG    . GLN A 1 173 ? 24.453 51.069 0.995   1.00 13.06  ? 173  GLN A CG    1 
ATOM   1417 C  CD    . GLN A 1 173 ? 23.987 49.617 0.795   1.00 15.63  ? 173  GLN A CD    1 
ATOM   1418 O  OE1   . GLN A 1 173 ? 24.434 48.580 1.422   1.00 21.88  ? 173  GLN A OE1   1 
ATOM   1419 N  NE2   . GLN A 1 173 ? 23.065 49.448 -0.142  1.00 18.96  ? 173  GLN A NE2   1 
ATOM   1420 N  N     . SER A 1 174 ? 23.328 51.753 5.313   1.00 16.29  ? 174  SER A N     1 
ATOM   1421 C  CA    . SER A 1 174 ? 23.603 52.295 6.621   1.00 16.50  ? 174  SER A CA    1 
ATOM   1422 C  C     . SER A 1 174 ? 24.714 51.458 7.320   1.00 13.83  ? 174  SER A C     1 
ATOM   1423 O  O     . SER A 1 174 ? 24.859 50.258 7.088   1.00 19.25  ? 174  SER A O     1 
ATOM   1424 C  CB    . SER A 1 174 ? 22.333 52.387 7.479   1.00 16.82  ? 174  SER A CB    1 
ATOM   1425 O  OG    . SER A 1 174 ? 21.798 51.096 7.831   1.00 18.88  ? 174  SER A OG    1 
ATOM   1426 N  N     . LEU A 1 175 ? 25.497 52.190 8.140   1.00 20.13  ? 175  LEU A N     1 
ATOM   1427 C  CA    . LEU A 1 175 ? 26.575 51.681 8.989   1.00 17.83  ? 175  LEU A CA    1 
ATOM   1428 C  C     . LEU A 1 175 ? 26.302 52.183 10.427  1.00 7.70   ? 175  LEU A C     1 
ATOM   1429 O  O     . LEU A 1 175 ? 26.224 53.402 10.707  1.00 18.19  ? 175  LEU A O     1 
ATOM   1430 C  CB    . LEU A 1 175 ? 28.008 52.059 8.586   1.00 18.00  ? 175  LEU A CB    1 
ATOM   1431 C  CG    . LEU A 1 175 ? 28.660 51.321 7.410   1.00 27.00  ? 175  LEU A CG    1 
ATOM   1432 C  CD1   . LEU A 1 175 ? 27.994 51.731 6.150   1.00 29.90  ? 175  LEU A CD1   1 
ATOM   1433 C  CD2   . LEU A 1 175 ? 30.091 51.888 7.276   1.00 25.47  ? 175  LEU A CD2   1 
ATOM   1434 N  N     . LEU A 1 176 ? 26.004 51.194 11.272  1.00 14.66  ? 176  LEU A N     1 
ATOM   1435 C  CA    . LEU A 1 176 ? 25.721 51.493 12.642  1.00 12.90  ? 176  LEU A CA    1 
ATOM   1436 C  C     . LEU A 1 176 ? 26.937 51.072 13.441  1.00 10.82  ? 176  LEU A C     1 
ATOM   1437 O  O     . LEU A 1 176 ? 27.209 49.862 13.518  1.00 14.97  ? 176  LEU A O     1 
ATOM   1438 C  CB    . LEU A 1 176 ? 24.599 50.520 13.017  1.00 14.34  ? 176  LEU A CB    1 
ATOM   1439 C  CG    . LEU A 1 176 ? 23.289 51.034 12.387  1.00 22.98  ? 176  LEU A CG    1 
ATOM   1440 C  CD1   . LEU A 1 176 ? 23.204 50.533 10.999  1.00 26.61  ? 176  LEU A CD1   1 
ATOM   1441 C  CD2   . LEU A 1 176 ? 22.175 50.354 13.128  1.00 33.60  ? 176  LEU A CD2   1 
ATOM   1442 N  N     . ILE A 1 177 ? 27.563 52.121 13.967  1.00 18.87  ? 177  ILE A N     1 
ATOM   1443 C  CA    . ILE A 1 177 ? 28.785 52.061 14.760  1.00 20.80  ? 177  ILE A CA    1 
ATOM   1444 C  C     . ILE A 1 177 ? 28.470 52.471 16.198  1.00 10.81  ? 177  ILE A C     1 
ATOM   1445 O  O     . ILE A 1 177 ? 28.173 53.639 16.465  1.00 15.50  ? 177  ILE A O     1 
ATOM   1446 C  CB    . ILE A 1 177 ? 29.842 52.965 14.100  1.00 29.19  ? 177  ILE A CB    1 
ATOM   1447 C  CG1   . ILE A 1 177 ? 29.935 52.703 12.559  1.00 16.81  ? 177  ILE A CG1   1 
ATOM   1448 C  CG2   . ILE A 1 177 ? 31.186 52.718 14.804  1.00 15.44  ? 177  ILE A CG2   1 
ATOM   1449 C  CD1   . ILE A 1 177 ? 31.044 53.591 11.937  1.00 14.19  ? 177  ILE A CD1   1 
ATOM   1450 N  N     . THR A 1 178 ? 28.389 51.429 17.058  1.00 18.06  ? 178  THR A N     1 
ATOM   1451 C  CA    . THR A 1 178 ? 28.016 51.529 18.449  1.00 21.80  ? 178  THR A CA    1 
ATOM   1452 C  C     . THR A 1 178 ? 29.007 50.835 19.373  1.00 30.40  ? 178  THR A C     1 
ATOM   1453 O  O     . THR A 1 178 ? 29.871 50.061 18.951  1.00 18.34  ? 178  THR A O     1 
ATOM   1454 C  CB    . THR A 1 178 ? 26.597 50.914 18.651  1.00 16.48  ? 178  THR A CB    1 
ATOM   1455 O  OG1   . THR A 1 178 ? 26.677 49.506 18.389  1.00 20.05  ? 178  THR A OG1   1 
ATOM   1456 C  CG2   . THR A 1 178 ? 25.545 51.677 17.791  1.00 19.00  ? 178  THR A CG2   1 
ATOM   1457 N  N     . GLY A 1 179 ? 28.857 51.099 20.666  1.00 17.53  ? 179  GLY A N     1 
ATOM   1458 C  CA    . GLY A 1 179 ? 29.730 50.570 21.692  1.00 16.36  ? 179  GLY A CA    1 
ATOM   1459 C  C     . GLY A 1 179 ? 29.964 51.644 22.754  1.00 14.55  ? 179  GLY A C     1 
ATOM   1460 O  O     . GLY A 1 179 ? 29.445 52.775 22.643  1.00 14.49  ? 179  GLY A O     1 
ATOM   1461 N  N     . GLU A 1 180 ? 30.731 51.281 23.807  1.00 15.80  ? 180  GLU A N     1 
ATOM   1462 C  CA    . GLU A 1 180 ? 30.993 52.191 24.919  1.00 13.79  ? 180  GLU A CA    1 
ATOM   1463 C  C     . GLU A 1 180 ? 31.887 53.363 24.625  1.00 12.74  ? 180  GLU A C     1 
ATOM   1464 O  O     . GLU A 1 180 ? 32.644 53.412 23.678  1.00 16.56  ? 180  GLU A O     1 
ATOM   1465 C  CB    . GLU A 1 180 ? 31.824 51.502 26.009  1.00 26.59  ? 180  GLU A CB    1 
ATOM   1466 C  CG    . GLU A 1 180 ? 31.017 50.476 26.715  1.00 26.96  ? 180  GLU A CG    1 
ATOM   1467 C  CD    . GLU A 1 180 ? 31.809 49.836 27.821  1.00 79.42  ? 180  GLU A CD    1 
ATOM   1468 O  OE1   . GLU A 1 180 ? 32.635 50.696 28.489  1.00 37.40  ? 180  GLU A OE1   1 
ATOM   1469 O  OE2   . GLU A 1 180 ? 31.628 48.645 28.085  1.00 42.62  ? 180  GLU A OE2   1 
ATOM   1470 N  N     . SER A 1 181 ? 31.823 54.322 25.539  1.00 13.20  ? 181  SER A N     1 
ATOM   1471 C  CA    . SER A 1 181 ? 32.595 55.513 25.434  1.00 10.49  ? 181  SER A CA    1 
ATOM   1472 C  C     . SER A 1 181 ? 34.037 55.096 25.398  1.00 16.10  ? 181  SER A C     1 
ATOM   1473 O  O     . SER A 1 181 ? 34.490 54.285 26.234  1.00 18.19  ? 181  SER A O     1 
ATOM   1474 C  CB    . SER A 1 181 ? 32.230 56.416 26.644  1.00 19.74  ? 181  SER A CB    1 
ATOM   1475 O  OG    . SER A 1 181 ? 33.128 57.586 26.610  1.00 20.27  ? 181  SER A OG    1 
ATOM   1476 N  N     . GLY A 1 182 ? 34.763 55.655 24.463  1.00 17.82  ? 182  GLY A N     1 
ATOM   1477 C  CA    . GLY A 1 182 ? 36.171 55.276 24.374  1.00 12.09  ? 182  GLY A CA    1 
ATOM   1478 C  C     . GLY A 1 182 ? 36.454 54.043 23.529  1.00 21.28  ? 182  GLY A C     1 
ATOM   1479 O  O     . GLY A 1 182 ? 37.605 53.734 23.380  1.00 20.16  ? 182  GLY A O     1 
ATOM   1480 N  N     . ALA A 1 183 ? 35.417 53.345 22.989  1.00 18.51  ? 183  ALA A N     1 
ATOM   1481 C  CA    . ALA A 1 183 ? 35.512 52.133 22.156  1.00 13.13  ? 183  ALA A CA    1 
ATOM   1482 C  C     . ALA A 1 183 ? 36.122 52.364 20.774  1.00 12.34  ? 183  ALA A C     1 
ATOM   1483 O  O     . ALA A 1 183 ? 36.681 51.452 20.230  1.00 17.60  ? 183  ALA A O     1 
ATOM   1484 C  CB    . ALA A 1 183 ? 34.198 51.294 22.067  1.00 16.61  ? 183  ALA A CB    1 
ATOM   1485 N  N     . GLY A 1 184 ? 36.011 53.544 20.217  1.00 15.25  ? 184  GLY A N     1 
ATOM   1486 C  CA    . GLY A 1 184 ? 36.571 53.899 18.898  1.00 16.54  ? 184  GLY A CA    1 
ATOM   1487 C  C     . GLY A 1 184 ? 35.527 54.234 17.852  1.00 18.68  ? 184  GLY A C     1 
ATOM   1488 O  O     . GLY A 1 184 ? 35.850 54.239 16.684  1.00 15.22  ? 184  GLY A O     1 
ATOM   1489 N  N     . LYS A 1 185 ? 34.250 54.454 18.230  1.00 15.82  ? 185  LYS A N     1 
ATOM   1490 C  CA    . LYS A 1 185 ? 33.157 54.802 17.306  1.00 14.99  ? 185  LYS A CA    1 
ATOM   1491 C  C     . LYS A 1 185 ? 33.402 55.999 16.353  1.00 15.15  ? 185  LYS A C     1 
ATOM   1492 O  O     . LYS A 1 185 ? 33.222 55.908 15.147  1.00 13.78  ? 185  LYS A O     1 
ATOM   1493 C  CB    . LYS A 1 185 ? 31.804 55.036 18.047  1.00 15.27  ? 185  LYS A CB    1 
ATOM   1494 C  CG    . LYS A 1 185 ? 31.333 53.857 18.839  1.00 10.94  ? 185  LYS A CG    1 
ATOM   1495 C  CD    . LYS A 1 185 ? 30.020 54.167 19.618  1.00 8.95   ? 185  LYS A CD    1 
ATOM   1496 C  CE    . LYS A 1 185 ? 30.083 55.309 20.666  1.00 18.18  ? 185  LYS A CE    1 
ATOM   1497 N  NZ    . LYS A 1 185 ? 31.036 54.871 21.782  1.00 17.27  ? 185  LYS A NZ    1 
ATOM   1498 N  N     . THR A 1 186 ? 33.772 57.125 16.928  1.00 10.67  ? 186  THR A N     1 
ATOM   1499 C  CA    . THR A 1 186 ? 34.020 58.348 16.257  1.00 12.71  ? 186  THR A CA    1 
ATOM   1500 C  C     . THR A 1 186 ? 35.208 58.191 15.328  1.00 28.69  ? 186  THR A C     1 
ATOM   1501 O  O     . THR A 1 186 ? 35.185 58.625 14.173  1.00 17.22  ? 186  THR A O     1 
ATOM   1502 C  CB    . THR A 1 186 ? 34.193 59.521 17.242  1.00 15.97  ? 186  THR A CB    1 
ATOM   1503 O  OG1   . THR A 1 186 ? 32.969 59.673 18.009  1.00 27.27  ? 186  THR A OG1   1 
ATOM   1504 C  CG2   . THR A 1 186 ? 34.603 60.799 16.559  1.00 12.93  ? 186  THR A CG2   1 
ATOM   1505 N  N     . GLU A 1 187 ? 36.283 57.603 15.819  1.00 16.63  ? 187  GLU A N     1 
ATOM   1506 C  CA    . GLU A 1 187 ? 37.427 57.395 14.953  1.00 17.56  ? 187  GLU A CA    1 
ATOM   1507 C  C     . GLU A 1 187 ? 37.049 56.568 13.716  1.00 16.28  ? 187  GLU A C     1 
ATOM   1508 O  O     . GLU A 1 187 ? 37.392 56.854 12.597  1.00 19.84  ? 187  GLU A O     1 
ATOM   1509 C  CB    . GLU A 1 187 ? 38.522 56.678 15.761  1.00 19.80  ? 187  GLU A CB    1 
ATOM   1510 C  CG    . GLU A 1 187 ? 39.370 57.662 16.646  1.00 35.30  ? 187  GLU A CG    1 
ATOM   1511 C  CD    . GLU A 1 187 ? 39.727 59.019 16.111  1.00 45.92  ? 187  GLU A CD    1 
ATOM   1512 O  OE1   . GLU A 1 187 ? 40.270 59.047 14.905  1.00 30.73  ? 187  GLU A OE1   1 
ATOM   1513 O  OE2   . GLU A 1 187 ? 39.554 60.041 16.731  1.00 59.55  ? 187  GLU A OE2   1 
ATOM   1514 N  N     . ASN A 1 188 ? 36.335 55.479 13.943  1.00 13.22  ? 188  ASN A N     1 
ATOM   1515 C  CA    . ASN A 1 188 ? 35.857 54.635 12.893  1.00 20.03  ? 188  ASN A CA    1 
ATOM   1516 C  C     . ASN A 1 188 ? 34.878 55.358 12.009  1.00 21.80  ? 188  ASN A C     1 
ATOM   1517 O  O     . ASN A 1 188 ? 34.903 55.151 10.805  1.00 18.83  ? 188  ASN A O     1 
ATOM   1518 C  CB    . ASN A 1 188 ? 35.339 53.300 13.388  1.00 17.70  ? 188  ASN A CB    1 
ATOM   1519 C  CG    . ASN A 1 188 ? 36.489 52.349 13.679  1.00 26.23  ? 188  ASN A CG    1 
ATOM   1520 O  OD1   . ASN A 1 188 ? 37.016 51.696 12.805  1.00 17.63  ? 188  ASN A OD1   1 
ATOM   1521 N  ND2   . ASN A 1 188 ? 36.827 52.243 14.932  1.00 20.91  ? 188  ASN A ND2   1 
ATOM   1522 N  N     . THR A 1 189 ? 34.057 56.214 12.565  1.00 14.40  ? 189  THR A N     1 
ATOM   1523 C  CA    . THR A 1 189 ? 33.137 56.986 11.761  1.00 12.96  ? 189  THR A CA    1 
ATOM   1524 C  C     . THR A 1 189 ? 33.899 57.889 10.805  1.00 21.82  ? 189  THR A C     1 
ATOM   1525 O  O     . THR A 1 189 ? 33.605 57.994 9.616   1.00 17.53  ? 189  THR A O     1 
ATOM   1526 C  CB    . THR A 1 189 ? 32.176 57.830 12.687  1.00 12.24  ? 189  THR A CB    1 
ATOM   1527 O  OG1   . THR A 1 189 ? 31.314 56.887 13.299  1.00 14.19  ? 189  THR A OG1   1 
ATOM   1528 C  CG2   . THR A 1 189 ? 31.368 58.760 11.813  1.00 12.24  ? 189  THR A CG2   1 
ATOM   1529 N  N     . LYS A 1 190 ? 34.938 58.537 11.338  1.00 17.42  ? 190  LYS A N     1 
ATOM   1530 C  CA    . LYS A 1 190 ? 35.740 59.425 10.533  1.00 15.00  ? 190  LYS A CA    1 
ATOM   1531 C  C     . LYS A 1 190 ? 36.415 58.708 9.373   1.00 11.77  ? 190  LYS A C     1 
ATOM   1532 O  O     . LYS A 1 190 ? 36.560 59.245 8.307   1.00 17.98  ? 190  LYS A O     1 
ATOM   1533 C  CB    . LYS A 1 190 ? 36.712 60.164 11.431  1.00 24.75  ? 190  LYS A CB    1 
ATOM   1534 C  CG    . LYS A 1 190 ? 36.206 61.225 12.457  1.00 29.52  ? 190  LYS A CG    1 
ATOM   1535 C  CD    . LYS A 1 190 ? 37.382 61.471 13.439  1.00 25.86  ? 190  LYS A CD    1 
ATOM   1536 C  CE    . LYS A 1 190 ? 37.352 62.635 14.444  1.00 40.12  ? 190  LYS A CE    1 
ATOM   1537 N  NZ    . LYS A 1 190 ? 38.196 62.458 15.671  1.00 31.51  ? 190  LYS A NZ    1 
ATOM   1538 N  N     . LYS A 1 191 ? 36.789 57.489 9.601   1.00 11.85  ? 191  LYS A N     1 
ATOM   1539 C  CA    . LYS A 1 191 ? 37.439 56.656 8.600   1.00 18.11  ? 191  LYS A CA    1 
ATOM   1540 C  C     . LYS A 1 191 ? 36.470 56.253 7.490   1.00 30.73  ? 191  LYS A C     1 
ATOM   1541 O  O     . LYS A 1 191 ? 36.812 56.138 6.329   1.00 13.09  ? 191  LYS A O     1 
ATOM   1542 C  CB    . LYS A 1 191 ? 37.922 55.383 9.253   1.00 19.73  ? 191  LYS A CB    1 
ATOM   1543 C  CG    . LYS A 1 191 ? 39.162 55.477 10.183  1.00 18.68  ? 191  LYS A CG    1 
ATOM   1544 C  CD    . LYS A 1 191 ? 40.281 56.521 9.806   1.00 26.90  ? 191  LYS A CD    1 
ATOM   1545 C  CE    . LYS A 1 191 ? 40.123 57.925 10.381  1.00 83.82  ? 191  LYS A CE    1 
ATOM   1546 N  NZ    . LYS A 1 191 ? 40.784 58.963 9.526   1.00 50.89  ? 191  LYS A NZ    1 
ATOM   1547 N  N     . VAL A 1 192 ? 35.231 55.935 7.853   1.00 15.37  ? 192  VAL A N     1 
ATOM   1548 C  CA    . VAL A 1 192 ? 34.239 55.651 6.852   1.00 17.79  ? 192  VAL A CA    1 
ATOM   1549 C  C     . VAL A 1 192 ? 34.077 56.840 5.942   1.00 15.93  ? 192  VAL A C     1 
ATOM   1550 O  O     . VAL A 1 192 ? 34.007 56.732 4.731   1.00 20.24  ? 192  VAL A O     1 
ATOM   1551 C  CB    . VAL A 1 192 ? 32.879 55.460 7.533   1.00 18.03  ? 192  VAL A CB    1 
ATOM   1552 C  CG1   . VAL A 1 192 ? 31.747 55.321 6.513   1.00 13.27  ? 192  VAL A CG1   1 
ATOM   1553 C  CG2   . VAL A 1 192 ? 32.842 54.139 8.279   1.00 13.87  ? 192  VAL A CG2   1 
ATOM   1554 N  N     . ILE A 1 193 ? 33.993 58.001 6.549   1.00 10.72  ? 193  ILE A N     1 
ATOM   1555 C  CA    . ILE A 1 193 ? 33.815 59.161 5.708   1.00 13.69  ? 193  ILE A CA    1 
ATOM   1556 C  C     . ILE A 1 193 ? 35.037 59.461 4.855   1.00 33.85  ? 193  ILE A C     1 
ATOM   1557 O  O     . ILE A 1 193 ? 34.917 59.936 3.750   1.00 21.61  ? 193  ILE A O     1 
ATOM   1558 C  CB    . ILE A 1 193 ? 33.393 60.278 6.619   1.00 23.55  ? 193  ILE A CB    1 
ATOM   1559 C  CG1   . ILE A 1 193 ? 32.061 59.839 7.196   1.00 23.98  ? 193  ILE A CG1   1 
ATOM   1560 C  CG2   . ILE A 1 193 ? 33.255 61.668 5.946   1.00 17.56  ? 193  ILE A CG2   1 
ATOM   1561 C  CD1   . ILE A 1 193 ? 31.567 60.879 8.051   1.00 20.59  ? 193  ILE A CD1   1 
ATOM   1562 N  N     . GLN A 1 194 ? 36.207 59.218 5.402   1.00 14.08  ? 194  GLN A N     1 
ATOM   1563 C  CA    . GLN A 1 194 ? 37.377 59.509 4.674   1.00 12.54  ? 194  GLN A CA    1 
ATOM   1564 C  C     . GLN A 1 194 ? 37.433 58.610 3.500   1.00 11.97  ? 194  GLN A C     1 
ATOM   1565 O  O     . GLN A 1 194 ? 37.828 58.973 2.404   1.00 22.11  ? 194  GLN A O     1 
ATOM   1566 C  CB    . GLN A 1 194 ? 38.545 59.007 5.583   1.00 22.94  ? 194  GLN A CB    1 
ATOM   1567 C  CG    . GLN A 1 194 ? 39.754 58.525 4.703   1.00 35.08  ? 194  GLN A CG    1 
ATOM   1568 C  CD    . GLN A 1 194 ? 41.015 58.073 5.441   1.00 35.34  ? 194  GLN A CD    1 
ATOM   1569 O  OE1   . GLN A 1 194 ? 40.977 57.868 6.655   1.00 28.06  ? 194  GLN A OE1   1 
ATOM   1570 N  NE2   . GLN A 1 194 ? 42.128 57.888 4.744   1.00 21.50  ? 194  GLN A NE2   1 
ATOM   1571 N  N     . TYR A 1 195 ? 37.075 57.411 3.763   1.00 16.44  ? 195  TYR A N     1 
ATOM   1572 C  CA    . TYR A 1 195 ? 37.095 56.431 2.736   1.00 14.27  ? 195  TYR A CA    1 
ATOM   1573 C  C     . TYR A 1 195 ? 36.127 56.811 1.637   1.00 27.34  ? 195  TYR A C     1 
ATOM   1574 O  O     . TYR A 1 195 ? 36.464 56.761 0.445   1.00 20.99  ? 195  TYR A O     1 
ATOM   1575 C  CB    . TYR A 1 195 ? 36.748 55.020 3.256   1.00 16.65  ? 195  TYR A CB    1 
ATOM   1576 C  CG    . TYR A 1 195 ? 36.880 53.924 2.189   1.00 21.98  ? 195  TYR A CG    1 
ATOM   1577 C  CD1   . TYR A 1 195 ? 38.140 53.341 1.976   1.00 20.92  ? 195  TYR A CD1   1 
ATOM   1578 C  CD2   . TYR A 1 195 ? 35.808 53.533 1.372   1.00 17.32  ? 195  TYR A CD2   1 
ATOM   1579 C  CE1   . TYR A 1 195 ? 38.377 52.389 0.978   1.00 17.17  ? 195  TYR A CE1   1 
ATOM   1580 C  CE2   . TYR A 1 195 ? 36.016 52.524 0.444   1.00 21.48  ? 195  TYR A CE2   1 
ATOM   1581 C  CZ    . TYR A 1 195 ? 37.293 51.980 0.214   1.00 24.31  ? 195  TYR A CZ    1 
ATOM   1582 O  OH    . TYR A 1 195 ? 37.466 50.950 -0.714  1.00 28.57  ? 195  TYR A OH    1 
ATOM   1583 N  N     . LEU A 1 196 ? 34.907 57.142 2.032   1.00 16.57  ? 196  LEU A N     1 
ATOM   1584 C  CA    . LEU A 1 196 ? 33.924 57.448 1.027   1.00 22.41  ? 196  LEU A CA    1 
ATOM   1585 C  C     . LEU A 1 196 ? 34.369 58.665 0.210   1.00 34.23  ? 196  LEU A C     1 
ATOM   1586 O  O     . LEU A 1 196 ? 34.239 58.736 -1.013  1.00 24.96  ? 196  LEU A O     1 
ATOM   1587 C  CB    . LEU A 1 196 ? 32.530 57.766 1.660   1.00 19.84  ? 196  LEU A CB    1 
ATOM   1588 C  CG    . LEU A 1 196 ? 31.809 56.505 2.185   1.00 20.78  ? 196  LEU A CG    1 
ATOM   1589 C  CD1   . LEU A 1 196 ? 30.524 56.973 2.833   1.00 30.18  ? 196  LEU A CD1   1 
ATOM   1590 C  CD2   . LEU A 1 196 ? 31.599 55.405 1.104   1.00 16.27  ? 196  LEU A CD2   1 
ATOM   1591 N  N     . ALA A 1 197 ? 34.894 59.658 0.911   1.00 23.22  ? 197  ALA A N     1 
ATOM   1592 C  CA    . ALA A 1 197 ? 35.338 60.867 0.271   1.00 19.94  ? 197  ALA A CA    1 
ATOM   1593 C  C     . ALA A 1 197 ? 36.354 60.543 -0.782  1.00 26.54  ? 197  ALA A C     1 
ATOM   1594 O  O     . ALA A 1 197 ? 36.463 61.176 -1.798  1.00 25.18  ? 197  ALA A O     1 
ATOM   1595 C  CB    . ALA A 1 197 ? 36.056 61.659 1.324   1.00 26.87  ? 197  ALA A CB    1 
ATOM   1596 N  N     . SER A 1 198 ? 37.133 59.520 -0.538  1.00 26.04  ? 198  SER A N     1 
ATOM   1597 C  CA    . SER A 1 198 ? 38.101 59.180 -1.501  1.00 20.28  ? 198  SER A CA    1 
ATOM   1598 C  C     . SER A 1 198 ? 37.510 58.333 -2.615  1.00 29.56  ? 198  SER A C     1 
ATOM   1599 O  O     . SER A 1 198 ? 37.655 58.623 -3.802  1.00 40.10  ? 198  SER A O     1 
ATOM   1600 C  CB    . SER A 1 198 ? 39.243 58.480 -0.787  1.00 32.88  ? 198  SER A CB    1 
ATOM   1601 O  OG    . SER A 1 198 ? 40.115 57.771 -1.657  1.00 31.12  ? 198  SER A OG    1 
ATOM   1602 N  N     . VAL A 1 199 ? 36.836 57.252 -2.302  1.00 21.11  ? 199  VAL A N     1 
ATOM   1603 C  CA    . VAL A 1 199 ? 36.401 56.445 -3.429  1.00 24.31  ? 199  VAL A CA    1 
ATOM   1604 C  C     . VAL A 1 199 ? 35.367 57.082 -4.334  1.00 35.36  ? 199  VAL A C     1 
ATOM   1605 O  O     . VAL A 1 199 ? 35.163 56.590 -5.442  1.00 36.41  ? 199  VAL A O     1 
ATOM   1606 C  CB    . VAL A 1 199 ? 35.855 55.057 -3.084  1.00 27.08  ? 199  VAL A CB    1 
ATOM   1607 C  CG1   . VAL A 1 199 ? 36.920 54.330 -2.352  1.00 62.63  ? 199  VAL A CG1   1 
ATOM   1608 C  CG2   . VAL A 1 199 ? 34.602 55.191 -2.219  1.00 31.28  ? 199  VAL A CG2   1 
ATOM   1609 N  N     . ALA A 1 200 ? 34.674 58.101 -3.837  1.00 20.68  ? 200  ALA A N     1 
ATOM   1610 C  CA    . ALA A 1 200 ? 33.569 58.685 -4.557  1.00 26.17  ? 200  ALA A CA    1 
ATOM   1611 C  C     . ALA A 1 200 ? 33.617 60.184 -4.650  1.00 42.11  ? 200  ALA A C     1 
ATOM   1612 O  O     . ALA A 1 200 ? 32.613 60.809 -4.961  1.00 46.11  ? 200  ALA A O     1 
ATOM   1613 C  CB    . ALA A 1 200 ? 32.390 58.427 -3.667  1.00 20.28  ? 200  ALA A CB    1 
ATOM   1614 N  N     . GLY A 1 201 ? 34.760 60.791 -4.368  1.00 34.62  ? 201  GLY A N     1 
ATOM   1615 C  CA    . GLY A 1 201 ? 34.821 62.248 -4.405  1.00 29.35  ? 201  GLY A CA    1 
ATOM   1616 C  C     . GLY A 1 201 ? 35.157 62.740 -5.802  1.00 59.30  ? 201  GLY A C     1 
ATOM   1617 O  O     . GLY A 1 201 ? 35.694 61.964 -6.595  1.00 41.29  ? 201  GLY A O     1 
ATOM   1618 N  N     . ARG A 1 202 ? 34.835 64.005 -6.105  1.00 97.26  ? 202  ARG A N     1 
ATOM   1619 C  CA    . ARG A 1 202 ? 35.158 64.556 -7.410  1.00 100.00 ? 202  ARG A CA    1 
ATOM   1620 C  C     . ARG A 1 202 ? 36.580 65.131 -7.459  1.00 97.89  ? 202  ARG A C     1 
ATOM   1621 O  O     . ARG A 1 202 ? 36.829 66.290 -7.110  1.00 80.71  ? 202  ARG A O     1 
ATOM   1622 C  CB    . ARG A 1 202 ? 34.003 65.042 -8.290  1.00 100.00 ? 202  ARG A CB    1 
ATOM   1623 C  CG    . ARG A 1 202 ? 32.954 63.929 -8.609  1.00 54.15  ? 202  ARG A CG    1 
ATOM   1624 C  CD    . ARG A 1 202 ? 31.888 64.319 -9.664  1.00 100.00 ? 202  ARG A CD    1 
ATOM   1625 N  NE    . ARG A 1 202 ? 30.533 64.658 -9.163  1.00 100.00 ? 202  ARG A NE    1 
ATOM   1626 C  CZ    . ARG A 1 202 ? 30.138 64.860 -7.869  1.00 100.00 ? 202  ARG A CZ    1 
ATOM   1627 N  NH1   . ARG A 1 202 ? 31.019 64.793 -6.813  1.00 100.00 ? 202  ARG A NH1   1 
ATOM   1628 N  NH2   . ARG A 1 202 ? 28.804 65.185 -7.574  1.00 50.70  ? 202  ARG A NH2   1 
ATOM   1629 N  N     . ASN A 1 203 ? 37.504 64.226 -7.819  1.00 79.96  ? 203  ASN A N     1 
ATOM   1630 C  CA    . ASN A 1 203 ? 38.955 64.378 -7.919  1.00 100.00 ? 203  ASN A CA    1 
ATOM   1631 C  C     . ASN A 1 203 ? 39.505 65.696 -8.412  1.00 100.00 ? 203  ASN A C     1 
ATOM   1632 O  O     . ASN A 1 203 ? 39.164 66.766 -7.888  1.00 100.00 ? 203  ASN A O     1 
ATOM   1633 C  CB    . ASN A 1 203 ? 39.645 63.230 -8.648  1.00 81.46  ? 203  ASN A CB    1 
ATOM   1634 N  N     . GLN A 1 204 ? 40.391 65.556 -9.409  1.00 100.00 ? 204  GLN A N     1 
ATOM   1635 C  CA    . GLN A 1 204 ? 41.087 66.679 -9.991  1.00 100.00 ? 204  GLN A CA    1 
ATOM   1636 C  C     . GLN A 1 204 ? 42.268 66.987 -9.057  1.00 100.00 ? 204  GLN A C     1 
ATOM   1637 O  O     . GLN A 1 204 ? 43.401 66.506 -9.252  1.00 100.00 ? 204  GLN A O     1 
ATOM   1638 C  CB    . GLN A 1 204 ? 40.094 67.834 -10.306 1.00 58.22  ? 204  GLN A CB    1 
ATOM   1639 N  N     . ALA A 1 205 ? 41.952 67.736 -7.981  1.00 100.00 ? 205  ALA A N     1 
ATOM   1640 C  CA    . ALA A 1 205 ? 42.894 68.102 -6.917  1.00 100.00 ? 205  ALA A CA    1 
ATOM   1641 C  C     . ALA A 1 205 ? 43.003 66.876 -5.978  1.00 100.00 ? 205  ALA A C     1 
ATOM   1642 O  O     . ALA A 1 205 ? 42.169 65.911 -5.983  1.00 100.00 ? 205  ALA A O     1 
ATOM   1643 C  CB    . ALA A 1 205 ? 42.396 69.334 -6.153  1.00 83.08  ? 205  ALA A CB    1 
ATOM   1644 N  N     . GLY A 1 209 ? 38.697 68.871 -3.683  1.00 100.00 ? 209  GLY A N     1 
ATOM   1645 C  CA    . GLY A 1 209 ? 37.236 68.880 -3.650  1.00 100.00 ? 209  GLY A CA    1 
ATOM   1646 C  C     . GLY A 1 209 ? 36.674 69.854 -2.617  1.00 34.15  ? 209  GLY A C     1 
ATOM   1647 O  O     . GLY A 1 209 ? 37.055 69.839 -1.452  1.00 100.00 ? 209  GLY A O     1 
ATOM   1648 N  N     . VAL A 1 210 ? 35.795 70.741 -3.069  1.00 39.75  ? 210  VAL A N     1 
ATOM   1649 C  CA    . VAL A 1 210 ? 35.221 71.774 -2.233  1.00 40.68  ? 210  VAL A CA    1 
ATOM   1650 C  C     . VAL A 1 210 ? 34.105 71.290 -1.315  1.00 100.00 ? 210  VAL A C     1 
ATOM   1651 O  O     . VAL A 1 210 ? 34.082 71.607 -0.115  1.00 37.49  ? 210  VAL A O     1 
ATOM   1652 C  CB    . VAL A 1 210 ? 34.940 73.133 -2.906  1.00 31.26  ? 210  VAL A CB    1 
ATOM   1653 C  CG1   . VAL A 1 210 ? 34.210 72.991 -4.228  1.00 100.00 ? 210  VAL A CG1   1 
ATOM   1654 C  CG2   . VAL A 1 210 ? 34.055 73.943 -1.972  1.00 85.64  ? 210  VAL A CG2   1 
ATOM   1655 N  N     . LEU A 1 211 ? 33.165 70.542 -1.873  1.00 36.24  ? 211  LEU A N     1 
ATOM   1656 C  CA    . LEU A 1 211 ? 32.102 70.034 -1.045  1.00 52.63  ? 211  LEU A CA    1 
ATOM   1657 C  C     . LEU A 1 211 ? 32.696 69.035 -0.064  1.00 27.41  ? 211  LEU A C     1 
ATOM   1658 O  O     . LEU A 1 211 ? 32.439 69.051 1.128   1.00 43.48  ? 211  LEU A O     1 
ATOM   1659 C  CB    . LEU A 1 211 ? 31.255 69.175 -1.963  1.00 34.98  ? 211  LEU A CB    1 
ATOM   1660 C  CG    . LEU A 1 211 ? 29.769 69.211 -1.646  1.00 37.33  ? 211  LEU A CG    1 
ATOM   1661 C  CD1   . LEU A 1 211 ? 29.251 67.843 -2.065  1.00 38.29  ? 211  LEU A CD1   1 
ATOM   1662 C  CD2   . LEU A 1 211 ? 29.399 69.525 -0.178  1.00 23.63  ? 211  LEU A CD2   1 
ATOM   1663 N  N     . GLU A 1 212 ? 33.524 68.170 -0.603  1.00 17.62  ? 212  GLU A N     1 
ATOM   1664 C  CA    . GLU A 1 212 ? 34.194 67.149 0.145   1.00 33.10  ? 212  GLU A CA    1 
ATOM   1665 C  C     . GLU A 1 212 ? 34.941 67.734 1.344   1.00 44.74  ? 212  GLU A C     1 
ATOM   1666 O  O     . GLU A 1 212 ? 34.896 67.275 2.489   1.00 36.76  ? 212  GLU A O     1 
ATOM   1667 C  CB    . GLU A 1 212 ? 35.062 66.276 -0.809  1.00 29.60  ? 212  GLU A CB    1 
ATOM   1668 C  CG    . GLU A 1 212 ? 34.188 65.519 -1.868  1.00 76.96  ? 212  GLU A CG    1 
ATOM   1669 C  CD    . GLU A 1 212 ? 33.898 66.196 -3.226  1.00 100.00 ? 212  GLU A CD    1 
ATOM   1670 O  OE1   . GLU A 1 212 ? 34.051 67.399 -3.424  1.00 70.52  ? 212  GLU A OE1   1 
ATOM   1671 O  OE2   . GLU A 1 212 ? 33.421 65.377 -4.180  1.00 67.31  ? 212  GLU A OE2   1 
ATOM   1672 N  N     . GLN A 1 213 ? 35.661 68.793 1.067   1.00 29.57  ? 213  GLN A N     1 
ATOM   1673 C  CA    . GLN A 1 213 ? 36.388 69.501 2.078   1.00 31.15  ? 213  GLN A CA    1 
ATOM   1674 C  C     . GLN A 1 213 ? 35.441 70.046 3.131   1.00 26.26  ? 213  GLN A C     1 
ATOM   1675 O  O     . GLN A 1 213 ? 35.648 69.936 4.325   1.00 39.34  ? 213  GLN A O     1 
ATOM   1676 C  CB    . GLN A 1 213 ? 36.949 70.674 1.287   1.00 60.11  ? 213  GLN A CB    1 
ATOM   1677 C  CG    . GLN A 1 213 ? 37.965 71.498 2.050   1.00 100.00 ? 213  GLN A CG    1 
ATOM   1678 C  CD    . GLN A 1 213 ? 39.325 70.956 1.723   1.00 100.00 ? 213  GLN A CD    1 
ATOM   1679 O  OE1   . GLN A 1 213 ? 39.532 69.709 1.744   1.00 100.00 ? 213  GLN A OE1   1 
ATOM   1680 N  NE2   . GLN A 1 213 ? 40.218 71.884 1.368   1.00 100.00 ? 213  GLN A NE2   1 
ATOM   1681 N  N     . GLN A 1 214 ? 34.334 70.613 2.676   1.00 28.23  ? 214  GLN A N     1 
ATOM   1682 C  CA    . GLN A 1 214 ? 33.353 71.116 3.624   1.00 24.94  ? 214  GLN A CA    1 
ATOM   1683 C  C     . GLN A 1 214 ? 32.760 69.980 4.465   1.00 32.78  ? 214  GLN A C     1 
ATOM   1684 O  O     . GLN A 1 214 ? 32.567 70.084 5.679   1.00 26.94  ? 214  GLN A O     1 
ATOM   1685 C  CB    . GLN A 1 214 ? 32.274 71.916 2.946   1.00 22.61  ? 214  GLN A CB    1 
ATOM   1686 C  CG    . GLN A 1 214 ? 32.849 72.991 1.975   1.00 30.69  ? 214  GLN A CG    1 
ATOM   1687 C  CD    . GLN A 1 214 ? 31.682 73.519 1.151   1.00 36.47  ? 214  GLN A CD    1 
ATOM   1688 O  OE1   . GLN A 1 214 ? 31.106 72.803 0.335   1.00 55.22  ? 214  GLN A OE1   1 
ATOM   1689 N  NE2   . GLN A 1 214 ? 31.260 74.752 1.451   1.00 37.10  ? 214  GLN A NE2   1 
ATOM   1690 N  N     . ILE A 1 215 ? 32.499 68.854 3.816   1.00 29.30  ? 215  ILE A N     1 
ATOM   1691 C  CA    . ILE A 1 215 ? 32.012 67.698 4.536   1.00 30.86  ? 215  ILE A CA    1 
ATOM   1692 C  C     . ILE A 1 215 ? 33.014 67.289 5.593   1.00 71.70  ? 215  ILE A C     1 
ATOM   1693 O  O     . ILE A 1 215 ? 32.620 67.063 6.727   1.00 29.95  ? 215  ILE A O     1 
ATOM   1694 C  CB    . ILE A 1 215 ? 31.838 66.517 3.613   1.00 28.11  ? 215  ILE A CB    1 
ATOM   1695 C  CG1   . ILE A 1 215 ? 30.660 66.822 2.758   1.00 23.18  ? 215  ILE A CG1   1 
ATOM   1696 C  CG2   . ILE A 1 215 ? 31.561 65.248 4.395   1.00 25.33  ? 215  ILE A CG2   1 
ATOM   1697 C  CD1   . ILE A 1 215 ? 30.413 65.799 1.667   1.00 26.21  ? 215  ILE A CD1   1 
ATOM   1698 N  N     . LEU A 1 216 ? 34.301 67.199 5.206   1.00 30.66  ? 216  LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 216 ? 35.311 66.841 6.161   1.00 26.90  ? 216  LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 216 ? 35.463 67.836 7.279   1.00 31.73  ? 216  LEU A C     1 
ATOM   1701 O  O     . LEU A 1 216 ? 35.650 67.477 8.436   1.00 32.74  ? 216  LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 216 ? 36.653 66.475 5.617   1.00 32.70  ? 216  LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 216 ? 36.443 65.476 4.516   1.00 43.86  ? 216  LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 216 ? 37.583 65.570 3.526   1.00 57.22  ? 216  LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 216 ? 36.355 64.038 5.024   1.00 31.10  ? 216  LEU A CD2   1 
ATOM   1706 N  N     . GLN A 1 217 ? 35.327 69.086 6.942   1.00 25.36  ? 217  GLN A N     1 
ATOM   1707 C  CA    . GLN A 1 217 ? 35.482 70.117 7.926   1.00 30.78  ? 217  GLN A CA    1 
ATOM   1708 C  C     . GLN A 1 217 ? 34.316 70.287 8.872   1.00 25.63  ? 217  GLN A C     1 
ATOM   1709 O  O     . GLN A 1 217 ? 34.408 71.069 9.802   1.00 38.33  ? 217  GLN A O     1 
ATOM   1710 C  CB    . GLN A 1 217 ? 35.855 71.477 7.333   1.00 25.99  ? 217  GLN A CB    1 
ATOM   1711 C  CG    . GLN A 1 217 ? 37.139 71.312 6.543   1.00 28.52  ? 217  GLN A CG    1 
ATOM   1712 C  CD    . GLN A 1 217 ? 38.303 70.875 7.416   1.00 66.22  ? 217  GLN A CD    1 
ATOM   1713 O  OE1   . GLN A 1 217 ? 38.732 71.604 8.322   1.00 48.00  ? 217  GLN A OE1   1 
ATOM   1714 N  NE2   . GLN A 1 217 ? 38.834 69.672 7.224   1.00 66.39  ? 217  GLN A NE2   1 
ATOM   1715 N  N     . ALA A 1 218 ? 33.210 69.609 8.649   1.00 33.71  ? 218  ALA A N     1 
ATOM   1716 C  CA    . ALA A 1 218 ? 32.114 69.814 9.578   1.00 30.70  ? 218  ALA A CA    1 
ATOM   1717 C  C     . ALA A 1 218 ? 32.366 69.100 10.905  1.00 35.16  ? 218  ALA A C     1 
ATOM   1718 O  O     . ALA A 1 218 ? 32.036 69.627 11.952  1.00 29.32  ? 218  ALA A O     1 
ATOM   1719 C  CB    . ALA A 1 218 ? 30.763 69.421 9.006   1.00 33.20  ? 218  ALA A CB    1 
ATOM   1720 N  N     . ASN A 1 219 ? 32.974 67.921 10.865  1.00 30.76  ? 219  ASN A N     1 
ATOM   1721 C  CA    . ASN A 1 219 ? 33.266 67.185 12.088  1.00 73.77  ? 219  ASN A CA    1 
ATOM   1722 C  C     . ASN A 1 219 ? 33.911 68.007 13.191  1.00 38.91  ? 219  ASN A C     1 
ATOM   1723 O  O     . ASN A 1 219 ? 33.381 68.129 14.280  1.00 43.35  ? 219  ASN A O     1 
ATOM   1724 C  CB    . ASN A 1 219 ? 33.823 65.742 11.982  1.00 42.36  ? 219  ASN A CB    1 
ATOM   1725 C  CG    . ASN A 1 219 ? 32.581 64.806 12.018  1.00 100.00 ? 219  ASN A CG    1 
ATOM   1726 O  OD1   . ASN A 1 219 ? 32.517 63.968 12.937  1.00 82.87  ? 219  ASN A OD1   1 
ATOM   1727 N  ND2   . ASN A 1 219 ? 31.558 64.925 11.071  1.00 55.94  ? 219  ASN A ND2   1 
ATOM   1728 N  N     . PRO A 1 220 ? 35.057 68.577 12.861  1.00 32.99  ? 220  PRO A N     1 
ATOM   1729 C  CA    . PRO A 1 220 ? 35.896 69.421 13.703  1.00 36.99  ? 220  PRO A CA    1 
ATOM   1730 C  C     . PRO A 1 220 ? 35.141 70.519 14.395  1.00 55.06  ? 220  PRO A C     1 
ATOM   1731 O  O     . PRO A 1 220 ? 35.436 70.840 15.552  1.00 33.89  ? 220  PRO A O     1 
ATOM   1732 C  CB    . PRO A 1 220 ? 36.876 70.134 12.746  1.00 46.34  ? 220  PRO A CB    1 
ATOM   1733 C  CG    . PRO A 1 220 ? 36.565 69.558 11.345  1.00 47.70  ? 220  PRO A CG    1 
ATOM   1734 C  CD    . PRO A 1 220 ? 35.573 68.417 11.479  1.00 36.75  ? 220  PRO A CD    1 
ATOM   1735 N  N     . ILE A 1 221 ? 34.214 71.103 13.645  1.00 21.87  ? 221  ILE A N     1 
ATOM   1736 C  CA    . ILE A 1 221 ? 33.362 72.119 14.186  1.00 26.46  ? 221  ILE A CA    1 
ATOM   1737 C  C     . ILE A 1 221 ? 32.486 71.485 15.266  1.00 22.38  ? 221  ILE A C     1 
ATOM   1738 O  O     . ILE A 1 221 ? 32.370 71.993 16.375  1.00 22.18  ? 221  ILE A O     1 
ATOM   1739 C  CB    . ILE A 1 221 ? 32.433 72.583 13.085  1.00 39.98  ? 221  ILE A CB    1 
ATOM   1740 C  CG1   . ILE A 1 221 ? 33.289 73.266 12.004  1.00 31.83  ? 221  ILE A CG1   1 
ATOM   1741 C  CG2   . ILE A 1 221 ? 31.412 73.546 13.709  1.00 20.48  ? 221  ILE A CG2   1 
ATOM   1742 C  CD1   . ILE A 1 221 ? 32.514 74.001 10.928  1.00 22.05  ? 221  ILE A CD1   1 
ATOM   1743 N  N     . LEU A 1 222 ? 31.867 70.373 14.885  1.00 20.50  ? 222  LEU A N     1 
ATOM   1744 C  CA    . LEU A 1 222 ? 30.998 69.690 15.795  1.00 31.72  ? 222  LEU A CA    1 
ATOM   1745 C  C     . LEU A 1 222 ? 31.734 69.129 17.002  1.00 22.50  ? 222  LEU A C     1 
ATOM   1746 O  O     . LEU A 1 222 ? 31.230 69.132 18.125  1.00 21.88  ? 222  LEU A O     1 
ATOM   1747 C  CB    . LEU A 1 222 ? 30.206 68.631 15.057  1.00 23.77  ? 222  LEU A CB    1 
ATOM   1748 C  CG    . LEU A 1 222 ? 29.148 69.294 14.206  1.00 21.57  ? 222  LEU A CG    1 
ATOM   1749 C  CD1   . LEU A 1 222 ? 28.342 68.125 13.639  1.00 28.73  ? 222  LEU A CD1   1 
ATOM   1750 C  CD2   . LEU A 1 222 ? 28.359 70.380 14.926  1.00 22.47  ? 222  LEU A CD2   1 
ATOM   1751 N  N     . GLU A 1 223 ? 32.936 68.661 16.811  1.00 20.12  ? 223  GLU A N     1 
ATOM   1752 C  CA    . GLU A 1 223 ? 33.612 68.112 17.946  1.00 18.16  ? 223  GLU A CA    1 
ATOM   1753 C  C     . GLU A 1 223 ? 34.059 69.144 18.944  1.00 24.05  ? 223  GLU A C     1 
ATOM   1754 O  O     . GLU A 1 223 ? 34.185 68.852 20.132  1.00 27.21  ? 223  GLU A O     1 
ATOM   1755 C  CB    . GLU A 1 223 ? 34.804 67.323 17.567  1.00 15.27  ? 223  GLU A CB    1 
ATOM   1756 C  CG    . GLU A 1 223 ? 34.366 66.064 16.888  1.00 23.30  ? 223  GLU A CG    1 
ATOM   1757 C  CD    . GLU A 1 223 ? 35.452 65.021 16.646  1.00 31.62  ? 223  GLU A CD    1 
ATOM   1758 O  OE1   . GLU A 1 223 ? 36.593 65.047 17.020  1.00 28.19  ? 223  GLU A OE1   1 
ATOM   1759 O  OE2   . GLU A 1 223 ? 35.032 64.015 16.007  1.00 42.10  ? 223  GLU A OE2   1 
ATOM   1760 N  N     . ALA A 1 224 ? 34.332 70.350 18.460  1.00 20.02  ? 224  ALA A N     1 
ATOM   1761 C  CA    . ALA A 1 224 ? 34.796 71.406 19.342  1.00 16.76  ? 224  ALA A CA    1 
ATOM   1762 C  C     . ALA A 1 224 ? 33.691 71.788 20.306  1.00 25.27  ? 224  ALA A C     1 
ATOM   1763 O  O     . ALA A 1 224 ? 33.868 72.038 21.518  1.00 22.62  ? 224  ALA A O     1 
ATOM   1764 C  CB    . ALA A 1 224 ? 35.174 72.629 18.494  1.00 24.95  ? 224  ALA A CB    1 
ATOM   1765 N  N     . PHE A 1 225 ? 32.494 71.811 19.736  1.00 21.96  ? 225  PHE A N     1 
ATOM   1766 C  CA    . PHE A 1 225 ? 31.298 72.162 20.479  1.00 35.87  ? 225  PHE A CA    1 
ATOM   1767 C  C     . PHE A 1 225 ? 30.594 71.012 21.211  1.00 25.15  ? 225  PHE A C     1 
ATOM   1768 O  O     . PHE A 1 225 ? 29.854 71.269 22.172  1.00 20.99  ? 225  PHE A O     1 
ATOM   1769 C  CB    . PHE A 1 225 ? 30.291 72.893 19.550  1.00 26.84  ? 225  PHE A CB    1 
ATOM   1770 C  CG    . PHE A 1 225 ? 30.736 74.288 19.215  1.00 18.57  ? 225  PHE A CG    1 
ATOM   1771 C  CD1   . PHE A 1 225 ? 31.580 74.459 18.139  1.00 22.33  ? 225  PHE A CD1   1 
ATOM   1772 C  CD2   . PHE A 1 225 ? 30.234 75.401 19.894  1.00 20.95  ? 225  PHE A CD2   1 
ATOM   1773 C  CE1   . PHE A 1 225 ? 31.952 75.767 17.827  1.00 31.43  ? 225  PHE A CE1   1 
ATOM   1774 C  CE2   . PHE A 1 225 ? 30.602 76.709 19.590  1.00 34.69  ? 225  PHE A CE2   1 
ATOM   1775 C  CZ    . PHE A 1 225 ? 31.504 76.875 18.542  1.00 28.26  ? 225  PHE A CZ    1 
ATOM   1776 N  N     . GLY A 1 226 ? 30.769 69.764 20.745  1.00 19.52  ? 226  GLY A N     1 
ATOM   1777 C  CA    . GLY A 1 226 ? 30.045 68.650 21.354  1.00 18.20  ? 226  GLY A CA    1 
ATOM   1778 C  C     . GLY A 1 226 ? 30.879 67.570 21.969  1.00 14.09  ? 226  GLY A C     1 
ATOM   1779 O  O     . GLY A 1 226 ? 30.344 66.555 22.417  1.00 19.48  ? 226  GLY A O     1 
ATOM   1780 N  N     . ASN A 1 227 ? 32.193 67.786 21.985  1.00 16.11  ? 227  ASN A N     1 
ATOM   1781 C  CA    . ASN A 1 227 ? 33.068 66.765 22.514  1.00 15.95  ? 227  ASN A CA    1 
ATOM   1782 C  C     . ASN A 1 227 ? 33.829 67.361 23.680  1.00 21.47  ? 227  ASN A C     1 
ATOM   1783 O  O     . ASN A 1 227 ? 34.030 68.571 23.669  1.00 17.81  ? 227  ASN A O     1 
ATOM   1784 C  CB    . ASN A 1 227 ? 34.136 66.190 21.524  1.00 18.51  ? 227  ASN A CB    1 
ATOM   1785 C  CG    . ASN A 1 227 ? 33.558 65.212 20.510  1.00 23.37  ? 227  ASN A CG    1 
ATOM   1786 O  OD1   . ASN A 1 227 ? 32.369 65.326 20.144  1.00 22.95  ? 227  ASN A OD1   1 
ATOM   1787 N  ND2   . ASN A 1 227 ? 34.362 64.264 20.047  1.00 20.46  ? 227  ASN A ND2   1 
ATOM   1788 N  N     . ALA A 1 228 ? 34.162 66.489 24.653  1.00 30.57  ? 228  ALA A N     1 
ATOM   1789 C  CA    . ALA A 1 228 ? 34.830 66.850 25.886  1.00 18.82  ? 228  ALA A CA    1 
ATOM   1790 C  C     . ALA A 1 228 ? 35.592 65.701 26.484  1.00 23.05  ? 228  ALA A C     1 
ATOM   1791 O  O     . ALA A 1 228 ? 35.345 64.513 26.261  1.00 19.96  ? 228  ALA A O     1 
ATOM   1792 C  CB    . ALA A 1 228 ? 33.804 67.315 26.927  1.00 13.59  ? 228  ALA A CB    1 
ATOM   1793 N  N     . LYS A 1 229 ? 36.578 66.104 27.274  1.00 19.99  ? 229  LYS A N     1 
ATOM   1794 C  CA    . LYS A 1 229 ? 37.350 65.135 27.975  1.00 19.09  ? 229  LYS A CA    1 
ATOM   1795 C  C     . LYS A 1 229 ? 36.560 64.596 29.163  1.00 24.22  ? 229  LYS A C     1 
ATOM   1796 O  O     . LYS A 1 229 ? 36.120 65.324 30.032  1.00 24.96  ? 229  LYS A O     1 
ATOM   1797 C  CB    . LYS A 1 229 ? 38.578 65.839 28.548  1.00 19.68  ? 229  LYS A CB    1 
ATOM   1798 C  CG    . LYS A 1 229 ? 39.393 64.817 29.323  1.00 30.26  ? 229  LYS A CG    1 
ATOM   1799 C  CD    . LYS A 1 229 ? 40.144 65.447 30.479  1.00 27.28  ? 229  LYS A CD    1 
ATOM   1800 C  CE    . LYS A 1 229 ? 40.617 64.321 31.358  1.00 48.66  ? 229  LYS A CE    1 
ATOM   1801 N  NZ    . LYS A 1 229 ? 41.729 64.649 32.245  1.00 33.73  ? 229  LYS A NZ    1 
ATOM   1802 N  N     . THR A 1 230 ? 36.377 63.308 29.198  1.00 17.56  ? 230  THR A N     1 
ATOM   1803 C  CA    . THR A 1 230 ? 35.761 62.659 30.309  1.00 20.20  ? 230  THR A CA    1 
ATOM   1804 C  C     . THR A 1 230 ? 36.783 61.702 30.876  1.00 20.91  ? 230  THR A C     1 
ATOM   1805 O  O     . THR A 1 230 ? 37.883 61.554 30.328  1.00 23.86  ? 230  THR A O     1 
ATOM   1806 C  CB    . THR A 1 230 ? 34.487 61.890 29.953  1.00 25.69  ? 230  THR A CB    1 
ATOM   1807 O  OG1   . THR A 1 230 ? 34.887 60.726 29.261  1.00 19.17  ? 230  THR A OG1   1 
ATOM   1808 C  CG2   . THR A 1 230 ? 33.601 62.840 29.112  1.00 18.65  ? 230  THR A CG2   1 
ATOM   1809 N  N     . THR A 1 231 ? 36.401 61.000 31.943  1.00 19.88  ? 231  THR A N     1 
ATOM   1810 C  CA    . THR A 1 231 ? 37.301 60.013 32.527  1.00 21.34  ? 231  THR A CA    1 
ATOM   1811 C  C     . THR A 1 231 ? 37.460 58.768 31.657  1.00 32.85  ? 231  THR A C     1 
ATOM   1812 O  O     . THR A 1 231 ? 38.322 57.941 31.893  1.00 24.08  ? 231  THR A O     1 
ATOM   1813 C  CB    . THR A 1 231 ? 36.820 59.522 33.875  1.00 24.35  ? 231  THR A CB    1 
ATOM   1814 O  OG1   . THR A 1 231 ? 35.511 59.071 33.671  1.00 29.32  ? 231  THR A OG1   1 
ATOM   1815 C  CG2   . THR A 1 231 ? 36.771 60.721 34.840  1.00 25.05  ? 231  THR A CG2   1 
ATOM   1816 N  N     . ARG A 1 232 ? 36.568 58.557 30.706  1.00 22.69  ? 232  ARG A N     1 
ATOM   1817 C  CA    . ARG A 1 232 ? 36.661 57.410 29.832  1.00 17.48  ? 232  ARG A CA    1 
ATOM   1818 C  C     . ARG A 1 232 ? 37.293 57.724 28.465  1.00 17.08  ? 232  ARG A C     1 
ATOM   1819 O  O     . ARG A 1 232 ? 37.754 56.824 27.733  1.00 22.35  ? 232  ARG A O     1 
ATOM   1820 C  CB    . ARG A 1 232 ? 35.244 56.903 29.612  1.00 21.24  ? 232  ARG A CB    1 
ATOM   1821 C  CG    . ARG A 1 232 ? 34.694 56.557 31.005  1.00 23.13  ? 232  ARG A CG    1 
ATOM   1822 C  CD    . ARG A 1 232 ? 33.531 55.624 30.878  1.00 31.64  ? 232  ARG A CD    1 
ATOM   1823 N  NE    . ARG A 1 232 ? 32.513 55.685 31.930  1.00 100.00 ? 232  ARG A NE    1 
ATOM   1824 C  CZ    . ARG A 1 232 ? 31.769 56.787 32.228  1.00 100.00 ? 232  ARG A CZ    1 
ATOM   1825 N  NH1   . ARG A 1 232 ? 31.870 57.978 31.544  1.00 100.00 ? 232  ARG A NH1   1 
ATOM   1826 N  NH2   . ARG A 1 232 ? 30.885 56.678 33.247  1.00 100.00 ? 232  ARG A NH2   1 
ATOM   1827 N  N     . ASN A 1 233 ? 37.292 59.002 28.083  1.00 16.85  ? 233  ASN A N     1 
ATOM   1828 C  CA    . ASN A 1 233 ? 37.838 59.351 26.780  1.00 11.39  ? 233  ASN A CA    1 
ATOM   1829 C  C     . ASN A 1 233 ? 38.185 60.802 26.774  1.00 16.36  ? 233  ASN A C     1 
ATOM   1830 O  O     . ASN A 1 233 ? 37.373 61.618 27.149  1.00 29.46  ? 233  ASN A O     1 
ATOM   1831 C  CB    . ASN A 1 233 ? 36.682 59.020 25.702  1.00 14.02  ? 233  ASN A CB    1 
ATOM   1832 C  CG    . ASN A 1 233 ? 37.002 59.290 24.271  1.00 20.03  ? 233  ASN A CG    1 
ATOM   1833 O  OD1   . ASN A 1 233 ? 38.083 59.872 23.972  1.00 21.09  ? 233  ASN A OD1   1 
ATOM   1834 N  ND2   . ASN A 1 233 ? 36.026 58.940 23.448  1.00 17.12  ? 233  ASN A ND2   1 
ATOM   1835 N  N     . ASN A 1 234 ? 39.382 61.127 26.301  1.00 19.28  ? 234  ASN A N     1 
ATOM   1836 C  CA    . ASN A 1 234 ? 39.808 62.493 26.184  1.00 23.16  ? 234  ASN A CA    1 
ATOM   1837 C  C     . ASN A 1 234 ? 39.052 63.279 25.143  1.00 21.56  ? 234  ASN A C     1 
ATOM   1838 O  O     . ASN A 1 234 ? 39.106 64.511 25.141  1.00 21.88  ? 234  ASN A O     1 
ATOM   1839 C  CB    . ASN A 1 234 ? 41.289 62.568 25.748  1.00 27.33  ? 234  ASN A CB    1 
ATOM   1840 C  CG    . ASN A 1 234 ? 42.143 62.080 26.905  1.00 35.90  ? 234  ASN A CG    1 
ATOM   1841 O  OD1   . ASN A 1 234 ? 43.218 61.612 26.728  1.00 47.10  ? 234  ASN A OD1   1 
ATOM   1842 N  ND2   . ASN A 1 234 ? 41.687 62.129 28.131  1.00 22.14  ? 234  ASN A ND2   1 
ATOM   1843 N  N     . ASN A 1 235 ? 38.407 62.569 24.228  1.00 22.39  ? 235  ASN A N     1 
ATOM   1844 C  CA    . ASN A 1 235 ? 37.695 63.277 23.209  1.00 17.45  ? 235  ASN A CA    1 
ATOM   1845 C  C     . ASN A 1 235 ? 36.327 62.703 23.075  1.00 23.09  ? 235  ASN A C     1 
ATOM   1846 O  O     . ASN A 1 235 ? 35.913 62.368 21.989  1.00 20.88  ? 235  ASN A O     1 
ATOM   1847 C  CB    . ASN A 1 235 ? 38.430 63.216 21.896  1.00 23.66  ? 235  ASN A CB    1 
ATOM   1848 C  CG    . ASN A 1 235 ? 37.662 63.950 20.788  1.00 22.95  ? 235  ASN A CG    1 
ATOM   1849 O  OD1   . ASN A 1 235 ? 37.232 65.079 20.950  1.00 21.46  ? 235  ASN A OD1   1 
ATOM   1850 N  ND2   . ASN A 1 235 ? 37.508 63.318 19.653  1.00 23.87  ? 235  ASN A ND2   1 
ATOM   1851 N  N     . SER A 1 236 ? 35.627 62.586 24.197  1.00 16.09  ? 236  SER A N     1 
ATOM   1852 C  CA    . SER A 1 236 ? 34.291 61.980 24.232  1.00 21.90  ? 236  SER A CA    1 
ATOM   1853 C  C     . SER A 1 236 ? 33.226 62.779 23.474  1.00 12.82  ? 236  SER A C     1 
ATOM   1854 O  O     . SER A 1 236 ? 33.150 63.974 23.642  1.00 19.00  ? 236  SER A O     1 
ATOM   1855 C  CB    . SER A 1 236 ? 33.836 61.854 25.667  1.00 22.90  ? 236  SER A CB    1 
ATOM   1856 O  OG    . SER A 1 236 ? 32.684 61.030 25.777  1.00 20.86  ? 236  SER A OG    1 
ATOM   1857 N  N     . SER A 1 237 ? 32.408 62.095 22.643  1.00 19.12  ? 237  SER A N     1 
ATOM   1858 C  CA    . SER A 1 237 ? 31.323 62.731 21.922  1.00 14.17  ? 237  SER A CA    1 
ATOM   1859 C  C     . SER A 1 237 ? 30.193 62.850 22.920  1.00 8.84   ? 237  SER A C     1 
ATOM   1860 O  O     . SER A 1 237 ? 29.807 61.847 23.447  1.00 17.84  ? 237  SER A O     1 
ATOM   1861 C  CB    . SER A 1 237 ? 30.802 61.677 20.920  1.00 16.85  ? 237  SER A CB    1 
ATOM   1862 O  OG    . SER A 1 237 ? 31.837 61.278 19.925  1.00 16.54  ? 237  SER A OG    1 
ATOM   1863 N  N     . ARG A 1 238 ? 29.754 64.055 23.260  1.00 12.44  ? 238  ARG A N     1 
ATOM   1864 C  CA    . ARG A 1 238 ? 28.653 64.206 24.233  1.00 17.28  ? 238  ARG A CA    1 
ATOM   1865 C  C     . ARG A 1 238 ? 27.279 64.457 23.533  1.00 20.69  ? 238  ARG A C     1 
ATOM   1866 O  O     . ARG A 1 238 ? 26.368 65.123 24.045  1.00 15.68  ? 238  ARG A O     1 
ATOM   1867 C  CB    . ARG A 1 238 ? 28.909 65.358 25.247  1.00 13.83  ? 238  ARG A CB    1 
ATOM   1868 C  CG    . ARG A 1 238 ? 30.307 65.318 25.826  1.00 17.22  ? 238  ARG A CG    1 
ATOM   1869 C  CD    . ARG A 1 238 ? 30.038 64.817 27.182  1.00 58.38  ? 238  ARG A CD    1 
ATOM   1870 N  NE    . ARG A 1 238 ? 30.124 63.445 26.959  1.00 20.88  ? 238  ARG A NE    1 
ATOM   1871 C  CZ    . ARG A 1 238 ? 29.681 62.388 27.659  1.00 28.04  ? 238  ARG A CZ    1 
ATOM   1872 N  NH1   . ARG A 1 238 ? 28.982 62.329 28.767  1.00 26.59  ? 238  ARG A NH1   1 
ATOM   1873 N  NH2   . ARG A 1 238 ? 30.025 61.237 27.161  1.00 24.85  ? 238  ARG A NH2   1 
ATOM   1874 N  N     . PHE A 1 239 ? 27.166 63.888 22.340  1.00 19.66  ? 239  PHE A N     1 
ATOM   1875 C  CA    . PHE A 1 239 ? 25.973 63.896 21.525  1.00 18.97  ? 239  PHE A CA    1 
ATOM   1876 C  C     . PHE A 1 239 ? 26.085 62.689 20.624  1.00 15.63  ? 239  PHE A C     1 
ATOM   1877 O  O     . PHE A 1 239 ? 27.192 62.220 20.360  1.00 16.40  ? 239  PHE A O     1 
ATOM   1878 C  CB    . PHE A 1 239 ? 25.832 65.179 20.651  1.00 20.63  ? 239  PHE A CB    1 
ATOM   1879 C  CG    . PHE A 1 239 ? 26.968 65.401 19.612  1.00 20.14  ? 239  PHE A CG    1 
ATOM   1880 C  CD1   . PHE A 1 239 ? 28.236 65.837 20.017  1.00 15.53  ? 239  PHE A CD1   1 
ATOM   1881 C  CD2   . PHE A 1 239 ? 26.737 65.176 18.234  1.00 16.97  ? 239  PHE A CD2   1 
ATOM   1882 C  CE1   . PHE A 1 239 ? 29.214 66.057 19.028  1.00 19.55  ? 239  PHE A CE1   1 
ATOM   1883 C  CE2   . PHE A 1 239 ? 27.700 65.313 17.214  1.00 17.65  ? 239  PHE A CE2   1 
ATOM   1884 C  CZ    . PHE A 1 239 ? 28.955 65.783 17.662  1.00 19.47  ? 239  PHE A CZ    1 
ATOM   1885 N  N     . GLY A 1 240 ? 24.960 62.194 20.152  1.00 12.24  ? 240  GLY A N     1 
ATOM   1886 C  CA    . GLY A 1 240 ? 24.898 61.123 19.195  1.00 13.59  ? 240  GLY A CA    1 
ATOM   1887 C  C     . GLY A 1 240 ? 24.690 61.739 17.839  1.00 11.18  ? 240  GLY A C     1 
ATOM   1888 O  O     . GLY A 1 240 ? 24.182 62.886 17.725  1.00 12.53  ? 240  GLY A O     1 
ATOM   1889 N  N     . LYS A 1 241 ? 25.054 60.977 16.789  1.00 15.19  ? 241  LYS A N     1 
ATOM   1890 C  CA    . LYS A 1 241 ? 24.845 61.565 15.459  1.00 23.71  ? 241  LYS A CA    1 
ATOM   1891 C  C     . LYS A 1 241 ? 24.591 60.546 14.377  1.00 18.13  ? 241  LYS A C     1 
ATOM   1892 O  O     . LYS A 1 241 ? 25.005 59.386 14.401  1.00 17.01  ? 241  LYS A O     1 
ATOM   1893 C  CB    . LYS A 1 241 ? 25.940 62.570 15.056  1.00 20.63  ? 241  LYS A CB    1 
ATOM   1894 C  CG    . LYS A 1 241 ? 27.146 61.693 14.709  1.00 32.88  ? 241  LYS A CG    1 
ATOM   1895 C  CD    . LYS A 1 241 ? 28.390 62.299 14.031  1.00 27.11  ? 241  LYS A CD    1 
ATOM   1896 C  CE    . LYS A 1 241 ? 29.592 61.342 14.028  1.00 83.54  ? 241  LYS A CE    1 
ATOM   1897 N  NZ    . LYS A 1 241 ? 30.451 61.427 15.222  1.00 43.86  ? 241  LYS A NZ    1 
ATOM   1898 N  N     . PHE A 1 242 ? 23.868 61.029 13.385  1.00 18.99  ? 242  PHE A N     1 
ATOM   1899 C  CA    . PHE A 1 242 ? 23.595 60.216 12.226  1.00 21.92  ? 242  PHE A CA    1 
ATOM   1900 C  C     . PHE A 1 242 ? 23.960 61.071 11.026  1.00 19.93  ? 242  PHE A C     1 
ATOM   1901 O  O     . PHE A 1 242 ? 23.389 62.160 10.845  1.00 21.94  ? 242  PHE A O     1 
ATOM   1902 C  CB    . PHE A 1 242 ? 22.118 59.909 12.194  1.00 17.04  ? 242  PHE A CB    1 
ATOM   1903 C  CG    . PHE A 1 242 ? 21.808 59.002 11.040  1.00 20.04  ? 242  PHE A CG    1 
ATOM   1904 C  CD1   . PHE A 1 242 ? 22.297 57.712 10.917  1.00 16.74  ? 242  PHE A CD1   1 
ATOM   1905 C  CD2   . PHE A 1 242 ? 20.985 59.480 10.026  1.00 38.78  ? 242  PHE A CD2   1 
ATOM   1906 C  CE1   . PHE A 1 242 ? 21.972 56.909 9.822   1.00 23.32  ? 242  PHE A CE1   1 
ATOM   1907 C  CE2   . PHE A 1 242 ? 20.653 58.701 8.925   1.00 20.86  ? 242  PHE A CE2   1 
ATOM   1908 C  CZ    . PHE A 1 242 ? 21.136 57.400 8.813   1.00 22.68  ? 242  PHE A CZ    1 
ATOM   1909 N  N     . ILE A 1 243 ? 24.985 60.626 10.308  1.00 16.07  ? 243  ILE A N     1 
ATOM   1910 C  CA    . ILE A 1 243 ? 25.444 61.409 9.165   1.00 14.77  ? 243  ILE A CA    1 
ATOM   1911 C  C     . ILE A 1 243 ? 25.035 60.733 7.865   1.00 19.63  ? 243  ILE A C     1 
ATOM   1912 O  O     . ILE A 1 243 ? 25.269 59.540 7.684   1.00 23.61  ? 243  ILE A O     1 
ATOM   1913 C  CB    . ILE A 1 243 ? 26.982 61.396 9.174   1.00 23.54  ? 243  ILE A CB    1 
ATOM   1914 C  CG1   . ILE A 1 243 ? 27.411 62.125 10.453  1.00 31.45  ? 243  ILE A CG1   1 
ATOM   1915 C  CG2   . ILE A 1 243 ? 27.600 62.180 8.000   1.00 25.47  ? 243  ILE A CG2   1 
ATOM   1916 C  CD1   . ILE A 1 243 ? 28.805 61.736 10.930  1.00 48.83  ? 243  ILE A CD1   1 
ATOM   1917 N  N     . GLU A 1 244 ? 24.431 61.528 6.997   1.00 14.38  ? 244  GLU A N     1 
ATOM   1918 C  CA    . GLU A 1 244 ? 24.037 61.003 5.746   1.00 15.56  ? 244  GLU A CA    1 
ATOM   1919 C  C     . GLU A 1 244 ? 24.957 61.536 4.637   1.00 12.18  ? 244  GLU A C     1 
ATOM   1920 O  O     . GLU A 1 244 ? 25.038 62.724 4.345   1.00 20.83  ? 244  GLU A O     1 
ATOM   1921 C  CB    . GLU A 1 244 ? 22.698 61.658 5.536   1.00 22.08  ? 244  GLU A CB    1 
ATOM   1922 C  CG    . GLU A 1 244 ? 21.957 60.695 4.683   1.00 41.81  ? 244  GLU A CG    1 
ATOM   1923 C  CD    . GLU A 1 244 ? 20.652 61.264 4.415   1.00 74.99  ? 244  GLU A CD    1 
ATOM   1924 O  OE1   . GLU A 1 244 ? 20.701 62.171 3.459   1.00 35.17  ? 244  GLU A OE1   1 
ATOM   1925 O  OE2   . GLU A 1 244 ? 19.695 60.913 5.064   1.00 38.51  ? 244  GLU A OE2   1 
ATOM   1926 N  N     . ILE A 1 245 ? 25.711 60.625 4.080   1.00 20.53  ? 245  ILE A N     1 
ATOM   1927 C  CA    . ILE A 1 245 ? 26.548 60.977 2.953   1.00 26.33  ? 245  ILE A CA    1 
ATOM   1928 C  C     . ILE A 1 245 ? 25.707 60.710 1.698   1.00 21.91  ? 245  ILE A C     1 
ATOM   1929 O  O     . ILE A 1 245 ? 25.313 59.541 1.436   1.00 18.75  ? 245  ILE A O     1 
ATOM   1930 C  CB    . ILE A 1 245 ? 27.873 60.198 2.841   1.00 19.86  ? 245  ILE A CB    1 
ATOM   1931 C  CG1   . ILE A 1 245 ? 28.700 60.336 4.133   1.00 21.90  ? 245  ILE A CG1   1 
ATOM   1932 C  CG2   . ILE A 1 245 ? 28.620 60.784 1.649   1.00 21.35  ? 245  ILE A CG2   1 
ATOM   1933 C  CD1   . ILE A 1 245 ? 28.875 61.830 4.585   1.00 19.17  ? 245  ILE A CD1   1 
ATOM   1934 N  N     . GLN A 1 246 ? 25.405 61.838 1.013   1.00 22.44  ? 246  GLN A N     1 
ATOM   1935 C  CA    . GLN A 1 246 ? 24.575 61.891 -0.206  1.00 24.37  ? 246  GLN A CA    1 
ATOM   1936 C  C     . GLN A 1 246 ? 25.373 61.721 -1.527  1.00 22.27  ? 246  GLN A C     1 
ATOM   1937 O  O     . GLN A 1 246 ? 26.450 62.334 -1.706  1.00 25.47  ? 246  GLN A O     1 
ATOM   1938 C  CB    . GLN A 1 246 ? 23.753 63.195 -0.171  1.00 20.13  ? 246  GLN A CB    1 
ATOM   1939 C  CG    . GLN A 1 246 ? 22.991 63.257 1.140   1.00 19.61  ? 246  GLN A CG    1 
ATOM   1940 C  CD    . GLN A 1 246 ? 22.299 64.549 1.275   1.00 23.97  ? 246  GLN A CD    1 
ATOM   1941 O  OE1   . GLN A 1 246 ? 22.567 65.459 0.498   1.00 31.44  ? 246  GLN A OE1   1 
ATOM   1942 N  NE2   . GLN A 1 246 ? 21.417 64.612 2.283   1.00 39.44  ? 246  GLN A NE2   1 
ATOM   1943 N  N     . PHE A 1 247 ? 24.832 60.879 -2.437  1.00 28.23  ? 247  PHE A N     1 
ATOM   1944 C  CA    . PHE A 1 247 ? 25.449 60.576 -3.724  1.00 32.08  ? 247  PHE A CA    1 
ATOM   1945 C  C     . PHE A 1 247 ? 24.490 60.747 -4.894  1.00 39.40  ? 247  PHE A C     1 
ATOM   1946 O  O     . PHE A 1 247 ? 23.282 60.530 -4.758  1.00 21.69  ? 247  PHE A O     1 
ATOM   1947 C  CB    . PHE A 1 247 ? 25.845 59.123 -3.770  1.00 15.53  ? 247  PHE A CB    1 
ATOM   1948 C  CG    . PHE A 1 247 ? 26.835 58.774 -2.647  1.00 24.75  ? 247  PHE A CG    1 
ATOM   1949 C  CD1   . PHE A 1 247 ? 26.357 58.353 -1.374  1.00 16.76  ? 247  PHE A CD1   1 
ATOM   1950 C  CD2   . PHE A 1 247 ? 28.220 58.743 -2.887  1.00 14.96  ? 247  PHE A CD2   1 
ATOM   1951 C  CE1   . PHE A 1 247 ? 27.240 57.870 -0.393  1.00 18.87  ? 247  PHE A CE1   1 
ATOM   1952 C  CE2   . PHE A 1 247 ? 29.088 58.342 -1.855  1.00 23.57  ? 247  PHE A CE2   1 
ATOM   1953 C  CZ    . PHE A 1 247 ? 28.627 57.880 -0.615  1.00 17.00  ? 247  PHE A CZ    1 
ATOM   1954 N  N     . ASN A 1 248 ? 25.028 61.140 -6.054  1.00 23.44  ? 248  ASN A N     1 
ATOM   1955 C  CA    . ASN A 1 248 ? 24.167 61.238 -7.222  1.00 23.11  ? 248  ASN A CA    1 
ATOM   1956 C  C     . ASN A 1 248 ? 24.098 59.852 -7.820  1.00 23.45  ? 248  ASN A C     1 
ATOM   1957 O  O     . ASN A 1 248 ? 24.734 58.917 -7.342  1.00 24.67  ? 248  ASN A O     1 
ATOM   1958 C  CB    . ASN A 1 248 ? 24.631 62.302 -8.217  1.00 21.84  ? 248  ASN A CB    1 
ATOM   1959 C  CG    . ASN A 1 248 ? 26.069 62.041 -8.659  1.00 23.63  ? 248  ASN A CG    1 
ATOM   1960 O  OD1   . ASN A 1 248 ? 26.574 60.920 -8.634  1.00 22.67  ? 248  ASN A OD1   1 
ATOM   1961 N  ND2   . ASN A 1 248 ? 26.726 63.045 -9.165  1.00 25.84  ? 248  ASN A ND2   1 
ATOM   1962 N  N     . ASN A 1 249 ? 23.329 59.684 -8.889  1.00 29.07  ? 249  ASN A N     1 
ATOM   1963 C  CA    . ASN A 1 249 ? 23.130 58.395 -9.573  1.00 22.80  ? 249  ASN A CA    1 
ATOM   1964 C  C     . ASN A 1 249 ? 24.434 57.796 -10.057 1.00 14.35  ? 249  ASN A C     1 
ATOM   1965 O  O     . ASN A 1 249 ? 24.582 56.580 -10.212 1.00 24.29  ? 249  ASN A O     1 
ATOM   1966 C  CB    . ASN A 1 249 ? 22.136 58.687 -10.735 1.00 17.95  ? 249  ASN A CB    1 
ATOM   1967 C  CG    . ASN A 1 249 ? 21.999 60.228 -10.849 1.00 100.00 ? 249  ASN A CG    1 
ATOM   1968 O  OD1   . ASN A 1 249 ? 22.185 60.699 -11.963 1.00 100.00 ? 249  ASN A OD1   1 
ATOM   1969 N  ND2   . ASN A 1 249 ? 21.794 61.075 -9.760  1.00 44.91  ? 249  ASN A ND2   1 
ATOM   1970 N  N     . ALA A 1 250 ? 25.393 58.660 -10.311 1.00 26.28  ? 250  ALA A N     1 
ATOM   1971 C  CA    . ALA A 1 250 ? 26.703 58.224 -10.799 1.00 32.23  ? 250  ALA A CA    1 
ATOM   1972 C  C     . ALA A 1 250 ? 27.581 57.645 -9.675  1.00 37.73  ? 250  ALA A C     1 
ATOM   1973 O  O     . ALA A 1 250 ? 28.613 57.040 -9.930  1.00 39.02  ? 250  ALA A O     1 
ATOM   1974 C  CB    . ALA A 1 250 ? 27.392 59.355 -11.648 1.00 20.77  ? 250  ALA A CB    1 
ATOM   1975 N  N     . GLY A 1 251 ? 27.199 57.855 -8.409  1.00 25.92  ? 251  GLY A N     1 
ATOM   1976 C  CA    . GLY A 1 251 ? 28.009 57.315 -7.312  1.00 19.71  ? 251  GLY A CA    1 
ATOM   1977 C  C     . GLY A 1 251 ? 29.034 58.316 -6.793  1.00 16.79  ? 251  GLY A C     1 
ATOM   1978 O  O     . GLY A 1 251 ? 30.006 57.934 -6.165  1.00 31.10  ? 251  GLY A O     1 
ATOM   1979 N  N     . PHE A 1 252 ? 28.856 59.595 -7.100  1.00 16.08  ? 252  PHE A N     1 
ATOM   1980 C  CA    . PHE A 1 252 ? 29.690 60.661 -6.633  1.00 21.61  ? 252  PHE A CA    1 
ATOM   1981 C  C     . PHE A 1 252 ? 28.955 61.388 -5.538  1.00 25.33  ? 252  PHE A C     1 
ATOM   1982 O  O     . PHE A 1 252 ? 27.737 61.535 -5.590  1.00 24.52  ? 252  PHE A O     1 
ATOM   1983 C  CB    . PHE A 1 252 ? 30.074 61.737 -7.690  1.00 32.40  ? 252  PHE A CB    1 
ATOM   1984 C  CG    . PHE A 1 252 ? 30.883 61.075 -8.754  1.00 39.75  ? 252  PHE A CG    1 
ATOM   1985 C  CD1   . PHE A 1 252 ? 31.922 60.198 -8.392  1.00 40.24  ? 252  PHE A CD1   1 
ATOM   1986 C  CD2   . PHE A 1 252 ? 30.520 61.190 -10.096 1.00 46.96  ? 252  PHE A CD2   1 
ATOM   1987 C  CE1   . PHE A 1 252 ? 32.593 59.417 -9.326  1.00 46.22  ? 252  PHE A CE1   1 
ATOM   1988 C  CE2   . PHE A 1 252 ? 31.250 60.479 -11.053 1.00 36.19  ? 252  PHE A CE2   1 
ATOM   1989 C  CZ    . PHE A 1 252 ? 32.271 59.604 -10.668 1.00 67.79  ? 252  PHE A CZ    1 
ATOM   1990 N  N     . ILE A 1 253 ? 29.725 61.812 -4.536  1.00 23.52  ? 253  ILE A N     1 
ATOM   1991 C  CA    . ILE A 1 253 ? 29.174 62.500 -3.399  1.00 24.37  ? 253  ILE A CA    1 
ATOM   1992 C  C     . ILE A 1 253 ? 28.527 63.776 -3.821  1.00 38.74  ? 253  ILE A C     1 
ATOM   1993 O  O     . ILE A 1 253 ? 29.180 64.601 -4.459  1.00 25.01  ? 253  ILE A O     1 
ATOM   1994 C  CB    . ILE A 1 253 ? 30.327 62.825 -2.464  1.00 49.63  ? 253  ILE A CB    1 
ATOM   1995 C  CG1   . ILE A 1 253 ? 30.815 61.498 -1.946  1.00 36.80  ? 253  ILE A CG1   1 
ATOM   1996 C  CG2   . ILE A 1 253 ? 29.767 63.754 -1.348  1.00 37.12  ? 253  ILE A CG2   1 
ATOM   1997 C  CD1   . ILE A 1 253 ? 31.476 61.563 -0.588  1.00 49.23  ? 253  ILE A CD1   1 
ATOM   1998 N  N     . SER A 1 254 ? 27.260 63.921 -3.439  1.00 24.03  ? 254  SER A N     1 
ATOM   1999 C  CA    . SER A 1 254 ? 26.526 65.068 -3.841  1.00 26.52  ? 254  SER A CA    1 
ATOM   2000 C  C     . SER A 1 254 ? 26.197 65.954 -2.695  1.00 27.24  ? 254  SER A C     1 
ATOM   2001 O  O     . SER A 1 254 ? 25.788 67.093 -2.900  1.00 23.73  ? 254  SER A O     1 
ATOM   2002 C  CB    . SER A 1 254 ? 25.277 64.675 -4.610  1.00 25.94  ? 254  SER A CB    1 
ATOM   2003 O  OG    . SER A 1 254 ? 24.647 63.694 -3.917  1.00 24.39  ? 254  SER A OG    1 
ATOM   2004 N  N     . GLY A 1 255 ? 26.369 65.460 -1.489  1.00 17.71  ? 255  GLY A N     1 
ATOM   2005 C  CA    . GLY A 1 255 ? 26.074 66.336 -0.373  1.00 19.64  ? 255  GLY A CA    1 
ATOM   2006 C  C     . GLY A 1 255 ? 26.157 65.540 0.921   1.00 20.34  ? 255  GLY A C     1 
ATOM   2007 O  O     . GLY A 1 255 ? 26.705 64.430 0.955   1.00 22.64  ? 255  GLY A O     1 
ATOM   2008 N  N     . ALA A 1 256 ? 25.583 66.099 1.987   1.00 29.56  ? 256  ALA A N     1 
ATOM   2009 C  CA    . ALA A 1 256 ? 25.508 65.389 3.238   1.00 26.43  ? 256  ALA A CA    1 
ATOM   2010 C  C     . ALA A 1 256 ? 24.578 66.098 4.194   1.00 21.19  ? 256  ALA A C     1 
ATOM   2011 O  O     . ALA A 1 256 ? 24.315 67.297 4.098   1.00 18.57  ? 256  ALA A O     1 
ATOM   2012 C  CB    . ALA A 1 256 ? 26.878 65.119 3.881   1.00 28.55  ? 256  ALA A CB    1 
ATOM   2013 N  N     . SER A 1 257 ? 24.140 65.339 5.169   1.00 22.31  ? 257  SER A N     1 
ATOM   2014 C  CA    . SER A 1 257 ? 23.305 65.885 6.216   1.00 21.51  ? 257  SER A CA    1 
ATOM   2015 C  C     . SER A 1 257 ? 23.699 65.304 7.573   1.00 20.47  ? 257  SER A C     1 
ATOM   2016 O  O     . SER A 1 257 ? 24.067 64.124 7.654   1.00 21.49  ? 257  SER A O     1 
ATOM   2017 C  CB    . SER A 1 257 ? 21.891 65.315 6.028   1.00 19.46  ? 257  SER A CB    1 
ATOM   2018 O  OG    . SER A 1 257 ? 21.130 66.387 6.503   1.00 38.93  ? 257  SER A OG    1 
ATOM   2019 N  N     . ILE A 1 258 ? 23.507 66.090 8.635   1.00 19.97  ? 258  ILE A N     1 
ATOM   2020 C  CA    . ILE A 1 258 ? 23.786 65.619 9.988   1.00 17.69  ? 258  ILE A CA    1 
ATOM   2021 C  C     . ILE A 1 258 ? 22.622 65.763 10.894  1.00 14.99  ? 258  ILE A C     1 
ATOM   2022 O  O     . ILE A 1 258 ? 22.060 66.855 10.957  1.00 21.19  ? 258  ILE A O     1 
ATOM   2023 C  CB    . ILE A 1 258 ? 24.893 66.425 10.643  1.00 27.71  ? 258  ILE A CB    1 
ATOM   2024 C  CG1   . ILE A 1 258 ? 26.127 66.227 9.797   1.00 41.36  ? 258  ILE A CG1   1 
ATOM   2025 C  CG2   . ILE A 1 258 ? 25.204 65.822 11.975  1.00 20.87  ? 258  ILE A CG2   1 
ATOM   2026 C  CD1   . ILE A 1 258 ? 27.190 67.252 10.085  1.00 26.49  ? 258  ILE A CD1   1 
ATOM   2027 N  N     . GLN A 1 259 ? 22.302 64.680 11.591  1.00 20.64  ? 259  GLN A N     1 
ATOM   2028 C  CA    . GLN A 1 259 ? 21.313 64.676 12.654  1.00 18.09  ? 259  GLN A CA    1 
ATOM   2029 C  C     . GLN A 1 259 ? 22.066 64.469 14.003  1.00 20.61  ? 259  GLN A C     1 
ATOM   2030 O  O     . GLN A 1 259 ? 22.845 63.499 14.147  1.00 23.23  ? 259  GLN A O     1 
ATOM   2031 C  CB    . GLN A 1 259 ? 20.136 63.650 12.478  1.00 14.00  ? 259  GLN A CB    1 
ATOM   2032 C  CG    . GLN A 1 259 ? 19.136 63.637 13.734  1.00 91.91  ? 259  GLN A CG    1 
ATOM   2033 C  CD    . GLN A 1 259 ? 18.180 64.823 14.155  1.00 47.53  ? 259  GLN A CD    1 
ATOM   2034 O  OE1   . GLN A 1 259 ? 17.832 65.106 15.349  1.00 39.01  ? 259  GLN A OE1   1 
ATOM   2035 N  NE2   . GLN A 1 259 ? 17.682 65.504 13.145  1.00 100.00 ? 259  GLN A NE2   1 
ATOM   2036 N  N     . SER A 1 260 ? 21.884 65.376 14.987  1.00 18.03  ? 260  SER A N     1 
ATOM   2037 C  CA    . SER A 1 260 ? 22.480 65.254 16.319  1.00 20.59  ? 260  SER A CA    1 
ATOM   2038 C  C     . SER A 1 260 ? 21.435 64.861 17.376  1.00 25.19  ? 260  SER A C     1 
ATOM   2039 O  O     . SER A 1 260 ? 20.267 65.235 17.290  1.00 17.52  ? 260  SER A O     1 
ATOM   2040 C  CB    . SER A 1 260 ? 23.211 66.479 16.851  1.00 17.63  ? 260  SER A CB    1 
ATOM   2041 O  OG    . SER A 1 260 ? 22.328 67.575 17.065  1.00 27.17  ? 260  SER A OG    1 
ATOM   2042 N  N     . TYR A 1 261 ? 21.833 64.107 18.397  1.00 26.43  ? 261  TYR A N     1 
ATOM   2043 C  CA    . TYR A 1 261 ? 20.900 63.742 19.426  1.00 19.14  ? 261  TYR A CA    1 
ATOM   2044 C  C     . TYR A 1 261 ? 21.525 63.817 20.796  1.00 22.24  ? 261  TYR A C     1 
ATOM   2045 O  O     . TYR A 1 261 ? 22.730 63.611 20.939  1.00 18.37  ? 261  TYR A O     1 
ATOM   2046 C  CB    . TYR A 1 261 ? 20.672 62.264 19.262  1.00 13.10  ? 261  TYR A CB    1 
ATOM   2047 C  CG    . TYR A 1 261 ? 20.075 61.919 17.902  1.00 18.54  ? 261  TYR A CG    1 
ATOM   2048 C  CD1   . TYR A 1 261 ? 18.718 62.013 17.561  1.00 13.70  ? 261  TYR A CD1   1 
ATOM   2049 C  CD2   . TYR A 1 261 ? 20.974 61.379 16.979  1.00 16.62  ? 261  TYR A CD2   1 
ATOM   2050 C  CE1   . TYR A 1 261 ? 18.304 61.610 16.286  1.00 16.55  ? 261  TYR A CE1   1 
ATOM   2051 C  CE2   . TYR A 1 261 ? 20.578 61.003 15.695  1.00 26.36  ? 261  TYR A CE2   1 
ATOM   2052 C  CZ    . TYR A 1 261 ? 19.235 61.154 15.337  1.00 18.07  ? 261  TYR A CZ    1 
ATOM   2053 O  OH    . TYR A 1 261 ? 18.888 60.667 14.102  1.00 21.05  ? 261  TYR A OH    1 
ATOM   2054 N  N     . LEU A 1 262 ? 20.682 64.082 21.789  1.00 18.35  ? 262  LEU A N     1 
ATOM   2055 C  CA    . LEU A 1 262 ? 21.012 64.034 23.199  1.00 20.99  ? 262  LEU A CA    1 
ATOM   2056 C  C     . LEU A 1 262 ? 22.273 64.766 23.614  1.00 12.99  ? 262  LEU A C     1 
ATOM   2057 O  O     . LEU A 1 262 ? 23.173 64.226 24.245  1.00 15.65  ? 262  LEU A O     1 
ATOM   2058 C  CB    . LEU A 1 262 ? 21.138 62.475 23.398  1.00 20.93  ? 262  LEU A CB    1 
ATOM   2059 C  CG    . LEU A 1 262 ? 20.626 61.797 24.655  1.00 26.22  ? 262  LEU A CG    1 
ATOM   2060 C  CD1   . LEU A 1 262 ? 19.289 62.349 25.069  1.00 25.43  ? 262  LEU A CD1   1 
ATOM   2061 C  CD2   . LEU A 1 262 ? 20.492 60.326 24.361  1.00 33.80  ? 262  LEU A CD2   1 
ATOM   2062 N  N     . LEU A 1 263 ? 22.440 65.992 23.237  1.00 16.63  ? 263  LEU A N     1 
ATOM   2063 C  CA    . LEU A 1 263 ? 23.647 66.678 23.656  1.00 19.07  ? 263  LEU A CA    1 
ATOM   2064 C  C     . LEU A 1 263 ? 23.621 66.874 25.160  1.00 34.18  ? 263  LEU A C     1 
ATOM   2065 O  O     . LEU A 1 263 ? 22.601 67.284 25.689  1.00 23.15  ? 263  LEU A O     1 
ATOM   2066 C  CB    . LEU A 1 263 ? 23.733 68.065 22.952  1.00 20.20  ? 263  LEU A CB    1 
ATOM   2067 C  CG    . LEU A 1 263 ? 24.860 69.027 23.410  1.00 21.30  ? 263  LEU A CG    1 
ATOM   2068 C  CD1   . LEU A 1 263 ? 26.196 68.557 22.803  1.00 17.15  ? 263  LEU A CD1   1 
ATOM   2069 C  CD2   . LEU A 1 263 ? 24.553 70.513 22.938  1.00 18.77  ? 263  LEU A CD2   1 
ATOM   2070 N  N     . GLU A 1 264 ? 24.746 66.633 25.827  1.00 21.84  ? 264  GLU A N     1 
ATOM   2071 C  CA    . GLU A 1 264 ? 24.876 66.771 27.257  1.00 16.13  ? 264  GLU A CA    1 
ATOM   2072 C  C     . GLU A 1 264 ? 25.046 68.219 27.681  1.00 19.19  ? 264  GLU A C     1 
ATOM   2073 O  O     . GLU A 1 264 ? 26.114 68.669 28.104  1.00 26.32  ? 264  GLU A O     1 
ATOM   2074 C  CB    . GLU A 1 264 ? 26.119 65.941 27.691  1.00 24.10  ? 264  GLU A CB    1 
ATOM   2075 C  CG    . GLU A 1 264 ? 26.204 65.941 29.211  1.00 16.90  ? 264  GLU A CG    1 
ATOM   2076 C  CD    . GLU A 1 264 ? 27.236 64.926 29.604  1.00 22.38  ? 264  GLU A CD    1 
ATOM   2077 O  OE1   . GLU A 1 264 ? 28.399 65.221 29.230  1.00 17.63  ? 264  GLU A OE1   1 
ATOM   2078 O  OE2   . GLU A 1 264 ? 26.987 63.975 30.226  1.00 30.82  ? 264  GLU A OE2   1 
ATOM   2079 N  N     . LYS A 1 265 ? 23.927 68.938 27.626  1.00 21.52  ? 265  LYS A N     1 
ATOM   2080 C  CA    . LYS A 1 265 ? 23.941 70.349 27.953  1.00 23.26  ? 265  LYS A CA    1 
ATOM   2081 C  C     . LYS A 1 265 ? 24.410 70.592 29.376  1.00 27.89  ? 265  LYS A C     1 
ATOM   2082 O  O     . LYS A 1 265 ? 25.016 71.617 29.670  1.00 25.37  ? 265  LYS A O     1 
ATOM   2083 C  CB    . LYS A 1 265 ? 22.580 70.947 27.841  1.00 21.58  ? 265  LYS A CB    1 
ATOM   2084 C  CG    . LYS A 1 265 ? 22.273 71.044 26.356  1.00 26.15  ? 265  LYS A CG    1 
ATOM   2085 C  CD    . LYS A 1 265 ? 20.856 71.550 26.032  1.00 20.40  ? 265  LYS A CD    1 
ATOM   2086 C  CE    . LYS A 1 265 ? 19.790 70.484 26.176  1.00 25.46  ? 265  LYS A CE    1 
ATOM   2087 N  NZ    . LYS A 1 265 ? 18.507 71.157 26.502  1.00 28.55  ? 265  LYS A NZ    1 
ATOM   2088 N  N     . SER A 1 266 ? 24.117 69.634 30.262  1.00 17.24  ? 266  SER A N     1 
ATOM   2089 C  CA    . SER A 1 266 ? 24.505 69.861 31.631  1.00 26.00  ? 266  SER A CA    1 
ATOM   2090 C  C     . SER A 1 266 ? 26.017 70.057 31.851  1.00 33.38  ? 266  SER A C     1 
ATOM   2091 O  O     . SER A 1 266 ? 26.457 70.713 32.816  1.00 22.41  ? 266  SER A O     1 
ATOM   2092 C  CB    . SER A 1 266 ? 23.864 68.800 32.487  1.00 21.10  ? 266  SER A CB    1 
ATOM   2093 O  OG    . SER A 1 266 ? 24.267 67.557 31.940  1.00 24.76  ? 266  SER A OG    1 
ATOM   2094 N  N     . ARG A 1 267 ? 26.834 69.472 30.978  1.00 28.15  ? 267  ARG A N     1 
ATOM   2095 C  CA    . ARG A 1 267 ? 28.279 69.575 31.141  1.00 19.58  ? 267  ARG A CA    1 
ATOM   2096 C  C     . ARG A 1 267 ? 28.741 71.012 31.087  1.00 24.33  ? 267  ARG A C     1 
ATOM   2097 O  O     . ARG A 1 267 ? 29.812 71.376 31.586  1.00 18.04  ? 267  ARG A O     1 
ATOM   2098 C  CB    . ARG A 1 267 ? 28.916 68.786 30.025  1.00 19.34  ? 267  ARG A CB    1 
ATOM   2099 C  CG    . ARG A 1 267 ? 30.410 69.053 30.006  1.00 15.89  ? 267  ARG A CG    1 
ATOM   2100 C  CD    . ARG A 1 267 ? 31.052 68.086 29.030  1.00 10.69  ? 267  ARG A CD    1 
ATOM   2101 N  NE    . ARG A 1 267 ? 30.741 66.716 29.511  1.00 19.89  ? 267  ARG A NE    1 
ATOM   2102 C  CZ    . ARG A 1 267 ? 31.451 65.910 30.390  1.00 18.92  ? 267  ARG A CZ    1 
ATOM   2103 N  NH1   . ARG A 1 267 ? 32.672 66.253 30.912  1.00 21.62  ? 267  ARG A NH1   1 
ATOM   2104 N  NH2   . ARG A 1 267 ? 30.876 64.723 30.736  1.00 16.11  ? 267  ARG A NH2   1 
ATOM   2105 N  N     . VAL A 1 268 ? 27.937 71.856 30.450  1.00 19.83  ? 268  VAL A N     1 
ATOM   2106 C  CA    . VAL A 1 268 ? 28.363 73.238 30.378  1.00 20.09  ? 268  VAL A CA    1 
ATOM   2107 C  C     . VAL A 1 268 ? 28.489 73.891 31.780  1.00 27.27  ? 268  VAL A C     1 
ATOM   2108 O  O     . VAL A 1 268 ? 29.311 74.754 32.036  1.00 27.71  ? 268  VAL A O     1 
ATOM   2109 C  CB    . VAL A 1 268 ? 27.364 74.042 29.553  1.00 18.01  ? 268  VAL A CB    1 
ATOM   2110 C  CG1   . VAL A 1 268 ? 27.806 75.457 29.483  1.00 22.64  ? 268  VAL A CG1   1 
ATOM   2111 C  CG2   . VAL A 1 268 ? 27.292 73.600 28.117  1.00 15.70  ? 268  VAL A CG2   1 
ATOM   2112 N  N     . VAL A 1 269 ? 27.670 73.468 32.718  1.00 19.72  ? 269  VAL A N     1 
ATOM   2113 C  CA    . VAL A 1 269 ? 27.600 74.125 33.996  1.00 21.44  ? 269  VAL A CA    1 
ATOM   2114 C  C     . VAL A 1 269 ? 28.250 73.329 35.078  1.00 24.27  ? 269  VAL A C     1 
ATOM   2115 O  O     . VAL A 1 269 ? 28.552 73.802 36.155  1.00 46.62  ? 269  VAL A O     1 
ATOM   2116 C  CB    . VAL A 1 269 ? 26.123 74.514 34.394  1.00 26.24  ? 269  VAL A CB    1 
ATOM   2117 C  CG1   . VAL A 1 269 ? 25.394 75.506 33.439  1.00 19.69  ? 269  VAL A CG1   1 
ATOM   2118 C  CG2   . VAL A 1 269 ? 25.267 73.286 34.436  1.00 28.77  ? 269  VAL A CG2   1 
ATOM   2119 N  N     . PHE A 1 270 ? 28.496 72.090 34.774  1.00 29.14  ? 270  PHE A N     1 
ATOM   2120 C  CA    . PHE A 1 270 ? 29.116 71.232 35.752  1.00 20.36  ? 270  PHE A CA    1 
ATOM   2121 C  C     . PHE A 1 270 ? 29.920 70.124 35.114  1.00 23.89  ? 270  PHE A C     1 
ATOM   2122 O  O     . PHE A 1 270 ? 29.472 69.466 34.183  1.00 27.36  ? 270  PHE A O     1 
ATOM   2123 C  CB    . PHE A 1 270 ? 28.025 70.493 36.550  1.00 26.50  ? 270  PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1 270 ? 28.529 69.315 37.332  1.00 31.38  ? 270  PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1 270 ? 29.165 69.494 38.561  1.00 38.82  ? 270  PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1 270 ? 28.459 68.023 36.812  1.00 44.69  ? 270  PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1 270 ? 29.742 68.424 39.258  1.00 47.41  ? 270  PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1 270 ? 29.007 66.942 37.503  1.00 56.06  ? 270  PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1 270 ? 29.637 67.130 38.741  1.00 33.13  ? 270  PHE A CZ    1 
ATOM   2130 N  N     . GLN A 1 271 ? 31.088 69.888 35.667  1.00 20.29  ? 271  GLN A N     1 
ATOM   2131 C  CA    . GLN A 1 271 ? 31.919 68.766 35.239  1.00 24.77  ? 271  GLN A CA    1 
ATOM   2132 C  C     . GLN A 1 271 ? 32.508 67.991 36.446  1.00 37.39  ? 271  GLN A C     1 
ATOM   2133 O  O     . GLN A 1 271 ? 32.938 68.574 37.449  1.00 26.22  ? 271  GLN A O     1 
ATOM   2134 C  CB    . GLN A 1 271 ? 33.064 69.254 34.305  1.00 25.39  ? 271  GLN A CB    1 
ATOM   2135 C  CG    . GLN A 1 271 ? 32.642 70.226 33.213  1.00 21.17  ? 271  GLN A CG    1 
ATOM   2136 C  CD    . GLN A 1 271 ? 32.538 71.626 33.744  1.00 37.81  ? 271  GLN A CD    1 
ATOM   2137 O  OE1   . GLN A 1 271 ? 33.400 72.009 34.456  1.00 47.34  ? 271  GLN A OE1   1 
ATOM   2138 N  NE2   . GLN A 1 271 ? 31.481 72.354 33.432  1.00 22.69  ? 271  GLN A NE2   1 
ATOM   2139 N  N     . SER A 1 272 ? 32.585 66.673 36.345  1.00 29.82  ? 272  SER A N     1 
ATOM   2140 C  CA    . SER A 1 272 ? 33.202 65.861 37.369  1.00 36.22  ? 272  SER A CA    1 
ATOM   2141 C  C     . SER A 1 272 ? 34.716 66.108 37.426  1.00 25.50  ? 272  SER A C     1 
ATOM   2142 O  O     . SER A 1 272 ? 35.370 66.523 36.479  1.00 25.40  ? 272  SER A O     1 
ATOM   2143 C  CB    . SER A 1 272 ? 32.865 64.360 37.130  1.00 26.92  ? 272  SER A CB    1 
ATOM   2144 O  OG    . SER A 1 272 ? 31.480 64.207 36.886  1.00 54.59  ? 272  SER A OG    1 
ATOM   2145 N  N     . THR A 1 273 ? 35.315 65.834 38.577  1.00 35.18  ? 273  THR A N     1 
ATOM   2146 C  CA    . THR A 1 273 ? 36.740 66.058 38.690  1.00 40.14  ? 273  THR A CA    1 
ATOM   2147 C  C     . THR A 1 273 ? 37.570 65.265 37.683  1.00 23.22  ? 273  THR A C     1 
ATOM   2148 O  O     . THR A 1 273 ? 37.306 64.087 37.397  1.00 31.30  ? 273  THR A O     1 
ATOM   2149 C  CB    . THR A 1 273 ? 37.238 65.978 40.117  1.00 66.31  ? 273  THR A CB    1 
ATOM   2150 O  OG1   . THR A 1 273 ? 38.613 66.322 40.241  1.00 81.40  ? 273  THR A OG1   1 
ATOM   2151 C  CG2   . THR A 1 273 ? 36.954 64.571 40.510  1.00 27.37  ? 273  THR A CG2   1 
ATOM   2152 N  N     . SER A 1 274 ? 38.548 65.964 37.120  1.00 24.86  ? 274  SER A N     1 
ATOM   2153 C  CA    . SER A 1 274 ? 39.424 65.440 36.099  1.00 38.22  ? 274  SER A CA    1 
ATOM   2154 C  C     . SER A 1 274 ? 38.870 65.692 34.703  1.00 43.43  ? 274  SER A C     1 
ATOM   2155 O  O     . SER A 1 274 ? 39.639 65.695 33.765  1.00 32.06  ? 274  SER A O     1 
ATOM   2156 C  CB    . SER A 1 274 ? 39.864 63.989 36.321  1.00 33.95  ? 274  SER A CB    1 
ATOM   2157 O  OG    . SER A 1 274 ? 38.982 62.939 35.818  1.00 34.50  ? 274  SER A OG    1 
ATOM   2158 N  N     . GLU A 1 275 ? 37.548 65.846 34.579  1.00 25.63  ? 275  GLU A N     1 
ATOM   2159 C  CA    . GLU A 1 275 ? 36.920 66.077 33.284  1.00 29.90  ? 275  GLU A CA    1 
ATOM   2160 C  C     . GLU A 1 275 ? 37.030 67.522 32.858  1.00 38.37  ? 275  GLU A C     1 
ATOM   2161 O  O     . GLU A 1 275 ? 37.452 68.401 33.621  1.00 31.11  ? 275  GLU A O     1 
ATOM   2162 C  CB    . GLU A 1 275 ? 35.464 65.631 33.453  1.00 16.30  ? 275  GLU A CB    1 
ATOM   2163 C  CG    . GLU A 1 275 ? 35.346 64.124 33.674  1.00 17.64  ? 275  GLU A CG    1 
ATOM   2164 C  CD    . GLU A 1 275 ? 34.038 63.566 33.166  1.00 32.64  ? 275  GLU A CD    1 
ATOM   2165 O  OE1   . GLU A 1 275 ? 33.124 64.263 32.698  1.00 23.29  ? 275  GLU A OE1   1 
ATOM   2166 O  OE2   . GLU A 1 275 ? 33.960 62.279 33.275  1.00 25.52  ? 275  GLU A OE2   1 
ATOM   2167 N  N     . ARG A 1 276 ? 36.674 67.790 31.609  1.00 20.79  ? 276  ARG A N     1 
ATOM   2168 C  CA    . ARG A 1 276 ? 36.731 69.159 31.158  1.00 15.96  ? 276  ARG A CA    1 
ATOM   2169 C  C     . ARG A 1 276 ? 35.344 69.497 30.676  1.00 21.76  ? 276  ARG A C     1 
ATOM   2170 O  O     . ARG A 1 276 ? 34.549 68.574 30.485  1.00 19.77  ? 276  ARG A O     1 
ATOM   2171 C  CB    . ARG A 1 276 ? 37.682 69.382 30.008  1.00 21.05  ? 276  ARG A CB    1 
ATOM   2172 C  CG    . ARG A 1 276 ? 39.153 69.246 30.435  1.00 26.36  ? 276  ARG A CG    1 
ATOM   2173 C  CD    . ARG A 1 276 ? 40.032 70.197 29.614  1.00 19.81  ? 276  ARG A CD    1 
ATOM   2174 N  NE    . ARG A 1 276 ? 39.823 70.152 28.142  1.00 27.38  ? 276  ARG A NE    1 
ATOM   2175 C  CZ    . ARG A 1 276 ? 40.424 70.841 27.165  1.00 37.05  ? 276  ARG A CZ    1 
ATOM   2176 N  NH1   . ARG A 1 276 ? 41.357 71.749 27.431  1.00 31.16  ? 276  ARG A NH1   1 
ATOM   2177 N  NH2   . ARG A 1 276 ? 40.112 70.660 25.881  1.00 25.00  ? 276  ARG A NH2   1 
ATOM   2178 N  N     . ASN A 1 277 ? 35.078 70.801 30.457  1.00 19.46  ? 277  ASN A N     1 
ATOM   2179 C  CA    . ASN A 1 277 ? 33.867 71.283 29.802  1.00 19.21  ? 277  ASN A CA    1 
ATOM   2180 C  C     . ASN A 1 277 ? 34.097 71.053 28.289  1.00 66.57  ? 277  ASN A C     1 
ATOM   2181 O  O     . ASN A 1 277 ? 35.109 70.480 27.895  1.00 20.78  ? 277  ASN A O     1 
ATOM   2182 C  CB    . ASN A 1 277 ? 33.676 72.800 30.022  1.00 16.63  ? 277  ASN A CB    1 
ATOM   2183 C  CG    . ASN A 1 277 ? 32.253 73.277 29.833  1.00 21.58  ? 277  ASN A CG    1 
ATOM   2184 O  OD1   . ASN A 1 277 ? 31.480 72.745 29.010  1.00 21.20  ? 277  ASN A OD1   1 
ATOM   2185 N  ND2   . ASN A 1 277 ? 31.915 74.345 30.577  1.00 29.16  ? 277  ASN A ND2   1 
ATOM   2186 N  N     . TYR A 1 278 ? 33.185 71.487 27.413  1.00 24.41  ? 278  TYR A N     1 
ATOM   2187 C  CA    . TYR A 1 278 ? 33.390 71.320 25.986  1.00 14.35  ? 278  TYR A CA    1 
ATOM   2188 C  C     . TYR A 1 278 ? 34.694 71.953 25.557  1.00 16.57  ? 278  TYR A C     1 
ATOM   2189 O  O     . TYR A 1 278 ? 35.075 72.988 26.065  1.00 21.18  ? 278  TYR A O     1 
ATOM   2190 C  CB    . TYR A 1 278 ? 32.204 71.834 25.118  1.00 18.20  ? 278  TYR A CB    1 
ATOM   2191 C  CG    . TYR A 1 278 ? 30.978 70.972 25.355  1.00 19.84  ? 278  TYR A CG    1 
ATOM   2192 C  CD1   . TYR A 1 278 ? 30.912 69.710 24.763  1.00 17.79  ? 278  TYR A CD1   1 
ATOM   2193 C  CD2   . TYR A 1 278 ? 29.908 71.341 26.196  1.00 21.79  ? 278  TYR A CD2   1 
ATOM   2194 C  CE1   . TYR A 1 278 ? 29.811 68.867 24.949  1.00 16.62  ? 278  TYR A CE1   1 
ATOM   2195 C  CE2   . TYR A 1 278 ? 28.820 70.482 26.449  1.00 15.35  ? 278  TYR A CE2   1 
ATOM   2196 C  CZ    . TYR A 1 278 ? 28.793 69.216 25.840  1.00 13.88  ? 278  TYR A CZ    1 
ATOM   2197 O  OH    . TYR A 1 278 ? 27.801 68.256 26.095  1.00 16.88  ? 278  TYR A OH    1 
ATOM   2198 N  N     . HIS A 1 279 ? 35.358 71.322 24.592  1.00 23.15  ? 279  HIS A N     1 
ATOM   2199 C  CA    . HIS A 1 279 ? 36.643 71.799 24.038  1.00 20.81  ? 279  HIS A CA    1 
ATOM   2200 C  C     . HIS A 1 279 ? 36.712 73.278 23.660  1.00 28.19  ? 279  HIS A C     1 
ATOM   2201 O  O     . HIS A 1 279 ? 37.711 73.938 23.913  1.00 30.64  ? 279  HIS A O     1 
ATOM   2202 C  CB    . HIS A 1 279 ? 37.113 70.997 22.766  1.00 19.86  ? 279  HIS A CB    1 
ATOM   2203 C  CG    . HIS A 1 279 ? 37.266 69.524 22.931  1.00 16.12  ? 279  HIS A CG    1 
ATOM   2204 N  ND1   . HIS A 1 279 ? 37.849 68.935 24.064  1.00 21.84  ? 279  HIS A ND1   1 
ATOM   2205 C  CD2   . HIS A 1 279 ? 36.866 68.497 22.114  1.00 19.77  ? 279  HIS A CD2   1 
ATOM   2206 C  CE1   . HIS A 1 279 ? 37.851 67.600 23.924  1.00 20.33  ? 279  HIS A CE1   1 
ATOM   2207 N  NE2   . HIS A 1 279 ? 37.257 67.283 22.761  1.00 27.39  ? 279  HIS A NE2   1 
ATOM   2208 N  N     . ILE A 1 280 ? 35.663 73.798 23.048  1.00 21.15  ? 280  ILE A N     1 
ATOM   2209 C  CA    . ILE A 1 280 ? 35.707 75.155 22.576  1.00 23.39  ? 280  ILE A CA    1 
ATOM   2210 C  C     . ILE A 1 280 ? 35.957 76.143 23.659  1.00 34.37  ? 280  ILE A C     1 
ATOM   2211 O  O     . ILE A 1 280 ? 36.400 77.261 23.393  1.00 31.34  ? 280  ILE A O     1 
ATOM   2212 C  CB    . ILE A 1 280 ? 34.508 75.727 21.778  1.00 30.91  ? 280  ILE A CB    1 
ATOM   2213 C  CG1   . ILE A 1 280 ? 33.302 74.918 21.865  1.00 48.36  ? 280  ILE A CG1   1 
ATOM   2214 C  CG2   . ILE A 1 280 ? 34.668 76.695 20.583  1.00 21.96  ? 280  ILE A CG2   1 
ATOM   2215 C  CD1   . ILE A 1 280 ? 32.748 75.286 23.187  1.00 21.91  ? 280  ILE A CD1   1 
ATOM   2216 N  N     . PHE A 1 281 ? 35.571 75.805 24.863  1.00 21.20  ? 281  PHE A N     1 
ATOM   2217 C  CA    . PHE A 1 281 ? 35.784 76.804 25.868  1.00 26.44  ? 281  PHE A CA    1 
ATOM   2218 C  C     . PHE A 1 281 ? 37.269 77.069 26.020  1.00 23.99  ? 281  PHE A C     1 
ATOM   2219 O  O     . PHE A 1 281 ? 37.739 78.196 26.129  1.00 35.11  ? 281  PHE A O     1 
ATOM   2220 C  CB    . PHE A 1 281 ? 35.191 76.413 27.190  1.00 22.53  ? 281  PHE A CB    1 
ATOM   2221 C  CG    . PHE A 1 281 ? 33.682 76.528 27.108  1.00 22.13  ? 281  PHE A CG    1 
ATOM   2222 C  CD1   . PHE A 1 281 ? 33.046 77.763 27.155  1.00 25.01  ? 281  PHE A CD1   1 
ATOM   2223 C  CD2   . PHE A 1 281 ? 32.901 75.374 27.070  1.00 20.58  ? 281  PHE A CD2   1 
ATOM   2224 C  CE1   . PHE A 1 281 ? 31.651 77.886 27.156  1.00 28.80  ? 281  PHE A CE1   1 
ATOM   2225 C  CE2   . PHE A 1 281 ? 31.506 75.460 27.022  1.00 24.40  ? 281  PHE A CE2   1 
ATOM   2226 C  CZ    . PHE A 1 281 ? 30.887 76.717 27.086  1.00 27.27  ? 281  PHE A CZ    1 
ATOM   2227 N  N     . TYR A 1 282 ? 38.007 75.986 25.997  1.00 22.38  ? 282  TYR A N     1 
ATOM   2228 C  CA    . TYR A 1 282 ? 39.447 76.073 26.163  1.00 22.99  ? 282  TYR A CA    1 
ATOM   2229 C  C     . TYR A 1 282 ? 40.128 76.601 24.941  1.00 32.40  ? 282  TYR A C     1 
ATOM   2230 O  O     . TYR A 1 282 ? 41.162 77.244 25.028  1.00 31.68  ? 282  TYR A O     1 
ATOM   2231 C  CB    . TYR A 1 282 ? 39.989 74.745 26.619  1.00 28.70  ? 282  TYR A CB    1 
ATOM   2232 C  CG    . TYR A 1 282 ? 39.141 74.181 27.772  1.00 35.58  ? 282  TYR A CG    1 
ATOM   2233 C  CD1   . TYR A 1 282 ? 37.934 73.484 27.576  1.00 18.69  ? 282  TYR A CD1   1 
ATOM   2234 C  CD2   . TYR A 1 282 ? 39.525 74.475 29.085  1.00 33.51  ? 282  TYR A CD2   1 
ATOM   2235 C  CE1   . TYR A 1 282 ? 37.203 72.992 28.665  1.00 21.58  ? 282  TYR A CE1   1 
ATOM   2236 C  CE2   . TYR A 1 282 ? 38.805 73.993 30.178  1.00 27.32  ? 282  TYR A CE2   1 
ATOM   2237 C  CZ    . TYR A 1 282 ? 37.663 73.215 29.973  1.00 23.06  ? 282  TYR A CZ    1 
ATOM   2238 O  OH    . TYR A 1 282 ? 36.976 72.713 31.105  1.00 25.60  ? 282  TYR A OH    1 
ATOM   2239 N  N     . GLN A 1 283 ? 39.544 76.326 23.791  1.00 36.44  ? 283  GLN A N     1 
ATOM   2240 C  CA    . GLN A 1 283 ? 40.070 76.786 22.515  1.00 34.29  ? 283  GLN A CA    1 
ATOM   2241 C  C     . GLN A 1 283 ? 39.987 78.286 22.395  1.00 36.13  ? 283  GLN A C     1 
ATOM   2242 O  O     . GLN A 1 283 ? 40.908 78.978 21.988  1.00 42.04  ? 283  GLN A O     1 
ATOM   2243 C  CB    . GLN A 1 283 ? 39.349 76.091 21.358  1.00 27.04  ? 283  GLN A CB    1 
ATOM   2244 C  CG    . GLN A 1 283 ? 39.504 74.546 21.453  1.00 23.03  ? 283  GLN A CG    1 
ATOM   2245 C  CD    . GLN A 1 283 ? 38.974 73.855 20.223  1.00 23.02  ? 283  GLN A CD    1 
ATOM   2246 O  OE1   . GLN A 1 283 ? 38.994 72.602 20.041  1.00 32.66  ? 283  GLN A OE1   1 
ATOM   2247 N  NE2   . GLN A 1 283 ? 38.472 74.687 19.326  1.00 17.29  ? 283  GLN A NE2   1 
ATOM   2248 N  N     . LEU A 1 284 ? 38.857 78.812 22.741  1.00 29.50  ? 284  LEU A N     1 
ATOM   2249 C  CA    . LEU A 1 284 ? 38.698 80.234 22.677  1.00 41.31  ? 284  LEU A CA    1 
ATOM   2250 C  C     . LEU A 1 284 ? 39.697 80.946 23.580  1.00 37.56  ? 284  LEU A C     1 
ATOM   2251 O  O     . LEU A 1 284 ? 40.422 81.819 23.133  1.00 38.43  ? 284  LEU A O     1 
ATOM   2252 C  CB    . LEU A 1 284 ? 37.287 80.518 23.232  1.00 39.93  ? 284  LEU A CB    1 
ATOM   2253 C  CG    . LEU A 1 284 ? 36.913 81.978 23.227  1.00 37.54  ? 284  LEU A CG    1 
ATOM   2254 C  CD1   . LEU A 1 284 ? 37.306 82.483 21.816  1.00 30.47  ? 284  LEU A CD1   1 
ATOM   2255 C  CD2   . LEU A 1 284 ? 35.425 82.143 23.585  1.00 28.78  ? 284  LEU A CD2   1 
ATOM   2256 N  N     . LEU A 1 285 ? 39.674 80.588 24.865  1.00 31.01  ? 285  LEU A N     1 
ATOM   2257 C  CA    . LEU A 1 285 ? 40.501 81.213 25.878  1.00 37.23  ? 285  LEU A CA    1 
ATOM   2258 C  C     . LEU A 1 285 ? 41.998 81.065 25.668  1.00 46.00  ? 285  LEU A C     1 
ATOM   2259 O  O     . LEU A 1 285 ? 42.766 81.780 26.309  1.00 69.27  ? 285  LEU A O     1 
ATOM   2260 C  CB    . LEU A 1 285 ? 40.235 80.695 27.276  1.00 32.19  ? 285  LEU A CB    1 
ATOM   2261 C  CG    . LEU A 1 285 ? 38.855 80.907 27.854  1.00 32.88  ? 285  LEU A CG    1 
ATOM   2262 C  CD1   . LEU A 1 285 ? 38.968 80.653 29.330  1.00 34.36  ? 285  LEU A CD1   1 
ATOM   2263 C  CD2   . LEU A 1 285 ? 38.515 82.350 27.757  1.00 35.13  ? 285  LEU A CD2   1 
ATOM   2264 N  N     . ALA A 1 286 ? 42.405 80.104 24.835  1.00 55.35  ? 286  ALA A N     1 
ATOM   2265 C  CA    . ALA A 1 286 ? 43.815 79.850 24.548  1.00 35.34  ? 286  ALA A CA    1 
ATOM   2266 C  C     . ALA A 1 286 ? 44.240 80.448 23.225  1.00 44.48  ? 286  ALA A C     1 
ATOM   2267 O  O     . ALA A 1 286 ? 45.334 81.012 23.114  1.00 81.02  ? 286  ALA A O     1 
ATOM   2268 C  CB    . ALA A 1 286 ? 44.215 78.386 24.558  1.00 23.51  ? 286  ALA A CB    1 
ATOM   2269 N  N     . GLY A 1 287 ? 43.325 80.343 22.253  1.00 42.97  ? 287  GLY A N     1 
ATOM   2270 C  CA    . GLY A 1 287 ? 43.526 80.816 20.890  1.00 45.25  ? 287  GLY A CA    1 
ATOM   2271 C  C     . GLY A 1 287 ? 43.077 82.248 20.565  1.00 36.00  ? 287  GLY A C     1 
ATOM   2272 O  O     . GLY A 1 287 ? 43.460 82.772 19.523  1.00 67.20  ? 287  GLY A O     1 
ATOM   2273 N  N     . ALA A 1 288 ? 42.218 82.873 21.399  1.00 45.58  ? 288  ALA A N     1 
ATOM   2274 C  CA    . ALA A 1 288 ? 41.781 84.248 21.145  1.00 46.74  ? 288  ALA A CA    1 
ATOM   2275 C  C     . ALA A 1 288 ? 42.995 85.222 21.157  1.00 100.00 ? 288  ALA A C     1 
ATOM   2276 O  O     . ALA A 1 288 ? 43.905 85.102 21.988  1.00 100.00 ? 288  ALA A O     1 
ATOM   2277 C  CB    . ALA A 1 288 ? 40.676 84.666 22.114  1.00 40.38  ? 288  ALA A CB    1 
ATOM   2278 N  N     . THR A 1 289 ? 43.046 86.192 20.230  1.00 59.61  ? 289  THR A N     1 
ATOM   2279 C  CA    . THR A 1 289 ? 44.142 87.156 20.166  1.00 39.11  ? 289  THR A CA    1 
ATOM   2280 C  C     . THR A 1 289 ? 43.983 88.086 21.333  1.00 51.16  ? 289  THR A C     1 
ATOM   2281 O  O     . THR A 1 289 ? 42.846 88.381 21.694  1.00 73.88  ? 289  THR A O     1 
ATOM   2282 C  CB    . THR A 1 289 ? 43.890 88.005 18.955  1.00 42.57  ? 289  THR A CB    1 
ATOM   2283 O  OG1   . THR A 1 289 ? 42.568 88.488 19.164  1.00 52.32  ? 289  THR A OG1   1 
ATOM   2284 C  CG2   . THR A 1 289 ? 43.974 87.124 17.712  1.00 67.90  ? 289  THR A CG2   1 
ATOM   2285 N  N     . ALA A 1 290 ? 45.093 88.482 21.955  1.00 95.93  ? 290  ALA A N     1 
ATOM   2286 C  CA    . ALA A 1 290 ? 45.006 89.351 23.118  1.00 54.07  ? 290  ALA A CA    1 
ATOM   2287 C  C     . ALA A 1 290 ? 43.976 90.456 22.911  1.00 37.46  ? 290  ALA A C     1 
ATOM   2288 O  O     . ALA A 1 290 ? 43.410 90.983 23.858  1.00 80.67  ? 290  ALA A O     1 
ATOM   2289 C  CB    . ALA A 1 290 ? 46.353 89.777 23.709  1.00 57.32  ? 290  ALA A CB    1 
ATOM   2290 N  N     . GLU A 1 291 ? 43.711 90.738 21.639  1.00 74.25  ? 291  GLU A N     1 
ATOM   2291 C  CA    . GLU A 1 291 ? 42.770 91.756 21.230  1.00 33.79  ? 291  GLU A CA    1 
ATOM   2292 C  C     . GLU A 1 291 ? 41.315 91.322 21.297  1.00 64.22  ? 291  GLU A C     1 
ATOM   2293 O  O     . GLU A 1 291 ? 40.417 92.106 21.627  1.00 97.17  ? 291  GLU A O     1 
ATOM   2294 C  CB    . GLU A 1 291 ? 43.174 92.220 19.822  1.00 87.15  ? 291  GLU A CB    1 
ATOM   2295 C  CG    . GLU A 1 291 ? 44.666 91.901 19.568  1.00 100.00 ? 291  GLU A CG    1 
ATOM   2296 C  CD    . GLU A 1 291 ? 44.919 90.689 18.700  1.00 100.00 ? 291  GLU A CD    1 
ATOM   2297 O  OE1   . GLU A 1 291 ? 44.376 90.523 17.600  1.00 100.00 ? 291  GLU A OE1   1 
ATOM   2298 O  OE2   . GLU A 1 291 ? 45.775 89.831 19.253  1.00 100.00 ? 291  GLU A OE2   1 
ATOM   2299 N  N     . GLU A 1 292 ? 41.066 90.055 20.968  1.00 100.00 ? 292  GLU A N     1 
ATOM   2300 C  CA    . GLU A 1 292 ? 39.704 89.555 21.019  1.00 95.97  ? 292  GLU A CA    1 
ATOM   2301 C  C     . GLU A 1 292 ? 39.308 89.301 22.441  1.00 52.99  ? 292  GLU A C     1 
ATOM   2302 O  O     . GLU A 1 292 ? 38.117 89.355 22.789  1.00 51.96  ? 292  GLU A O     1 
ATOM   2303 C  CB    . GLU A 1 292 ? 39.484 88.221 20.352  1.00 59.87  ? 292  GLU A CB    1 
ATOM   2304 C  CG    . GLU A 1 292 ? 39.697 88.338 18.860  1.00 100.00 ? 292  GLU A CG    1 
ATOM   2305 C  CD    . GLU A 1 292 ? 40.001 87.001 18.279  1.00 100.00 ? 292  GLU A CD    1 
ATOM   2306 O  OE1   . GLU A 1 292 ? 39.133 86.191 18.001  1.00 100.00 ? 292  GLU A OE1   1 
ATOM   2307 O  OE2   . GLU A 1 292 ? 41.289 86.792 18.150  1.00 92.32  ? 292  GLU A OE2   1 
ATOM   2308 N  N     . LYS A 1 293 ? 40.337 89.043 23.260  1.00 54.59  ? 293  LYS A N     1 
ATOM   2309 C  CA    . LYS A 1 293 ? 40.113 88.782 24.659  1.00 43.82  ? 293  LYS A CA    1 
ATOM   2310 C  C     . LYS A 1 293 ? 39.494 89.981 25.306  1.00 60.67  ? 293  LYS A C     1 
ATOM   2311 O  O     . LYS A 1 293 ? 38.388 89.879 25.846  1.00 49.17  ? 293  LYS A O     1 
ATOM   2312 C  CB    . LYS A 1 293 ? 41.344 88.270 25.360  1.00 49.41  ? 293  LYS A CB    1 
ATOM   2313 C  CG    . LYS A 1 293 ? 41.806 86.916 24.805  1.00 100.00 ? 293  LYS A CG    1 
ATOM   2314 C  CD    . LYS A 1 293 ? 43.184 86.967 24.150  1.00 89.67  ? 293  LYS A CD    1 
ATOM   2315 C  CE    . LYS A 1 293 ? 44.120 85.865 24.609  1.00 82.72  ? 293  LYS A CE    1 
ATOM   2316 N  NZ    . LYS A 1 293 ? 45.496 86.102 24.136  1.00 100.00 ? 293  LYS A NZ    1 
ATOM   2317 N  N     . LYS A 1 294 ? 40.222 91.099 25.165  1.00 61.86  ? 294  LYS A N     1 
ATOM   2318 C  CA    . LYS A 1 294 ? 39.808 92.386 25.674  1.00 42.44  ? 294  LYS A CA    1 
ATOM   2319 C  C     . LYS A 1 294 ? 38.379 92.646 25.255  1.00 33.49  ? 294  LYS A C     1 
ATOM   2320 O  O     . LYS A 1 294 ? 37.533 93.023 26.037  1.00 51.42  ? 294  LYS A O     1 
ATOM   2321 C  CB    . LYS A 1 294 ? 40.709 93.494 25.148  1.00 100.00 ? 294  LYS A CB    1 
ATOM   2322 C  CG    . LYS A 1 294 ? 40.145 94.921 25.266  1.00 100.00 ? 294  LYS A CG    1 
ATOM   2323 C  CD    . LYS A 1 294 ? 41.223 96.006 25.009  1.00 100.00 ? 294  LYS A CD    1 
ATOM   2324 C  CE    . LYS A 1 294 ? 40.960 97.303 25.814  1.00 100.00 ? 294  LYS A CE    1 
ATOM   2325 N  NZ    . LYS A 1 294 ? 41.903 98.428 25.494  1.00 100.00 ? 294  LYS A NZ    1 
ATOM   2326 N  N     . ALA A 1 295 ? 38.109 92.422 23.984  1.00 34.76  ? 295  ALA A N     1 
ATOM   2327 C  CA    . ALA A 1 295 ? 36.782 92.653 23.494  1.00 38.91  ? 295  ALA A CA    1 
ATOM   2328 C  C     . ALA A 1 295 ? 35.780 91.671 24.074  1.00 69.81  ? 295  ALA A C     1 
ATOM   2329 O  O     . ALA A 1 295 ? 34.566 91.885 24.014  1.00 47.51  ? 295  ALA A O     1 
ATOM   2330 C  CB    . ALA A 1 295 ? 36.825 92.467 22.003  1.00 48.67  ? 295  ALA A CB    1 
ATOM   2331 N  N     . LEU A 1 296 ? 36.304 90.580 24.637  1.00 50.05  ? 296  LEU A N     1 
ATOM   2332 C  CA    . LEU A 1 296 ? 35.440 89.560 25.207  1.00 63.14  ? 296  LEU A CA    1 
ATOM   2333 C  C     . LEU A 1 296 ? 35.476 89.439 26.726  1.00 49.71  ? 296  LEU A C     1 
ATOM   2334 O  O     . LEU A 1 296 ? 34.756 88.638 27.329  1.00 40.26  ? 296  LEU A O     1 
ATOM   2335 C  CB    . LEU A 1 296 ? 35.499 88.182 24.520  1.00 35.11  ? 296  LEU A CB    1 
ATOM   2336 C  CG    . LEU A 1 296 ? 35.075 88.189 23.056  1.00 43.54  ? 296  LEU A CG    1 
ATOM   2337 C  CD1   . LEU A 1 296 ? 35.434 86.839 22.476  1.00 49.03  ? 296  LEU A CD1   1 
ATOM   2338 C  CD2   . LEU A 1 296 ? 33.599 88.454 22.800  1.00 40.36  ? 296  LEU A CD2   1 
ATOM   2339 N  N     . HIS A 1 297 ? 36.292 90.244 27.370  1.00 30.23  ? 297  HIS A N     1 
ATOM   2340 C  CA    . HIS A 1 297 ? 36.320 90.170 28.809  1.00 71.64  ? 297  HIS A CA    1 
ATOM   2341 C  C     . HIS A 1 297 ? 36.791 88.820 29.272  1.00 54.74  ? 297  HIS A C     1 
ATOM   2342 O  O     . HIS A 1 297 ? 36.450 88.353 30.372  1.00 44.19  ? 297  HIS A O     1 
ATOM   2343 C  CB    . HIS A 1 297 ? 34.915 90.469 29.321  1.00 51.41  ? 297  HIS A CB    1 
ATOM   2344 C  CG    . HIS A 1 297 ? 34.591 91.773 28.693  1.00 76.80  ? 297  HIS A CG    1 
ATOM   2345 N  ND1   . HIS A 1 297 ? 34.265 91.877 27.332  1.00 100.00 ? 297  HIS A ND1   1 
ATOM   2346 C  CD2   . HIS A 1 297 ? 34.654 93.026 29.213  1.00 58.09  ? 297  HIS A CD2   1 
ATOM   2347 C  CE1   . HIS A 1 297 ? 34.135 93.158 27.074  1.00 100.00 ? 297  HIS A CE1   1 
ATOM   2348 N  NE2   . HIS A 1 297 ? 34.217 93.888 28.155  1.00 100.00 ? 297  HIS A NE2   1 
ATOM   2349 N  N     . LEU A 1 298 ? 37.626 88.239 28.415  1.00 45.58  ? 298  LEU A N     1 
ATOM   2350 C  CA    . LEU A 1 298 ? 38.188 86.935 28.666  1.00 41.80  ? 298  LEU A CA    1 
ATOM   2351 C  C     . LEU A 1 298 ? 39.452 86.921 29.480  1.00 36.47  ? 298  LEU A C     1 
ATOM   2352 O  O     . LEU A 1 298 ? 40.362 87.690 29.262  1.00 91.90  ? 298  LEU A O     1 
ATOM   2353 C  CB    . LEU A 1 298 ? 38.591 86.356 27.337  1.00 50.89  ? 298  LEU A CB    1 
ATOM   2354 C  CG    . LEU A 1 298 ? 37.391 86.367 26.433  1.00 95.57  ? 298  LEU A CG    1 
ATOM   2355 C  CD1   . LEU A 1 298 ? 37.755 85.831 25.061  1.00 64.64  ? 298  LEU A CD1   1 
ATOM   2356 C  CD2   . LEU A 1 298 ? 36.323 85.532 27.103  1.00 31.73  ? 298  LEU A CD2   1 
ATOM   2357 N  N     . ALA A 1 299 ? 39.492 85.956 30.366  1.00 47.61  ? 299  ALA A N     1 
ATOM   2358 C  CA    . ALA A 1 299 ? 40.619 85.680 31.196  1.00 35.38  ? 299  ALA A CA    1 
ATOM   2359 C  C     . ALA A 1 299 ? 40.989 84.194 31.075  1.00 28.12  ? 299  ALA A C     1 
ATOM   2360 O  O     . ALA A 1 299 ? 40.703 83.524 30.080  1.00 79.08  ? 299  ALA A O     1 
ATOM   2361 C  CB    . ALA A 1 299 ? 40.279 86.052 32.627  1.00 100.00 ? 299  ALA A CB    1 
ATOM   2362 N  N     . GLY A 1 300 ? 41.645 83.685 32.109  1.00 33.33  ? 300  GLY A N     1 
ATOM   2363 C  CA    . GLY A 1 300 ? 42.009 82.306 32.095  1.00 44.12  ? 300  GLY A CA    1 
ATOM   2364 C  C     . GLY A 1 300 ? 40.864 81.457 32.592  1.00 30.09  ? 300  GLY A C     1 
ATOM   2365 O  O     . GLY A 1 300 ? 39.981 81.913 33.290  1.00 55.61  ? 300  GLY A O     1 
ATOM   2366 N  N     . PRO A 1 301 ? 40.920 80.194 32.235  1.00 32.17  ? 301  PRO A N     1 
ATOM   2367 C  CA    . PRO A 1 301 ? 39.927 79.238 32.680  1.00 33.09  ? 301  PRO A CA    1 
ATOM   2368 C  C     . PRO A 1 301 ? 39.788 79.216 34.190  1.00 34.61  ? 301  PRO A C     1 
ATOM   2369 O  O     . PRO A 1 301 ? 38.738 78.896 34.774  1.00 35.10  ? 301  PRO A O     1 
ATOM   2370 C  CB    . PRO A 1 301 ? 40.517 77.873 32.297  1.00 42.30  ? 301  PRO A CB    1 
ATOM   2371 C  CG    . PRO A 1 301 ? 41.930 78.121 31.781  1.00 34.70  ? 301  PRO A CG    1 
ATOM   2372 C  CD    . PRO A 1 301 ? 41.952 79.601 31.394  1.00 30.47  ? 301  PRO A CD    1 
ATOM   2373 N  N     . GLU A 1 302 ? 40.882 79.494 34.854  1.00 38.64  ? 302  GLU A N     1 
ATOM   2374 C  CA    . GLU A 1 302 ? 40.822 79.492 36.301  1.00 48.55  ? 302  GLU A CA    1 
ATOM   2375 C  C     . GLU A 1 302 ? 39.941 80.641 36.784  1.00 25.04  ? 302  GLU A C     1 
ATOM   2376 O  O     . GLU A 1 302 ? 39.285 80.576 37.814  1.00 42.46  ? 302  GLU A O     1 
ATOM   2377 C  CB    . GLU A 1 302 ? 42.182 79.244 37.018  1.00 58.90  ? 302  GLU A CB    1 
ATOM   2378 C  CG    . GLU A 1 302 ? 43.246 80.247 36.548  1.00 82.49  ? 302  GLU A CG    1 
ATOM   2379 C  CD    . GLU A 1 302 ? 43.478 80.267 35.049  1.00 100.00 ? 302  GLU A CD    1 
ATOM   2380 O  OE1   . GLU A 1 302 ? 43.742 79.269 34.322  1.00 97.96  ? 302  GLU A OE1   1 
ATOM   2381 O  OE2   . GLU A 1 302 ? 43.394 81.506 34.637  1.00 48.43  ? 302  GLU A OE2   1 
ATOM   2382 N  N     . SER A 1 303 ? 39.824 81.658 35.953  1.00 36.99  ? 303  SER A N     1 
ATOM   2383 C  CA    . SER A 1 303 ? 38.962 82.775 36.282  1.00 32.73  ? 303  SER A CA    1 
ATOM   2384 C  C     . SER A 1 303 ? 37.499 82.473 35.985  1.00 51.26  ? 303  SER A C     1 
ATOM   2385 O  O     . SER A 1 303 ? 36.672 83.362 36.099  1.00 50.53  ? 303  SER A O     1 
ATOM   2386 C  CB    . SER A 1 303 ? 39.345 84.018 35.475  1.00 28.65  ? 303  SER A CB    1 
ATOM   2387 O  OG    . SER A 1 303 ? 40.381 83.782 34.565  1.00 95.47  ? 303  SER A OG    1 
ATOM   2388 N  N     . PHE A 1 304 ? 37.159 81.255 35.575  1.00 38.76  ? 304  PHE A N     1 
ATOM   2389 C  CA    . PHE A 1 304 ? 35.762 80.995 35.238  1.00 38.48  ? 304  PHE A CA    1 
ATOM   2390 C  C     . PHE A 1 304 ? 35.182 79.866 36.009  1.00 34.19  ? 304  PHE A C     1 
ATOM   2391 O  O     . PHE A 1 304 ? 35.768 78.789 36.068  1.00 31.32  ? 304  PHE A O     1 
ATOM   2392 C  CB    . PHE A 1 304 ? 35.483 80.783 33.763  1.00 28.62  ? 304  PHE A CB    1 
ATOM   2393 C  CG    . PHE A 1 304 ? 35.872 81.995 32.946  1.00 28.51  ? 304  PHE A CG    1 
ATOM   2394 C  CD1   . PHE A 1 304 ? 34.970 83.052 32.814  1.00 29.96  ? 304  PHE A CD1   1 
ATOM   2395 C  CD2   . PHE A 1 304 ? 37.105 82.090 32.293  1.00 32.41  ? 304  PHE A CD2   1 
ATOM   2396 C  CE1   . PHE A 1 304 ? 35.262 84.182 32.048  1.00 31.41  ? 304  PHE A CE1   1 
ATOM   2397 C  CE2   . PHE A 1 304 ? 37.427 83.230 31.541  1.00 29.22  ? 304  PHE A CE2   1 
ATOM   2398 C  CZ    . PHE A 1 304 ? 36.507 84.280 31.419  1.00 29.80  ? 304  PHE A CZ    1 
ATOM   2399 N  N     . ASN A 1 305 ? 34.016 80.121 36.604  1.00 31.22  ? 305  ASN A N     1 
ATOM   2400 C  CA    . ASN A 1 305 ? 33.329 79.110 37.399  1.00 23.86  ? 305  ASN A CA    1 
ATOM   2401 C  C     . ASN A 1 305 ? 33.031 77.826 36.646  1.00 100.00 ? 305  ASN A C     1 
ATOM   2402 O  O     . ASN A 1 305 ? 33.085 76.726 37.198  1.00 28.03  ? 305  ASN A O     1 
ATOM   2403 C  CB    . ASN A 1 305 ? 31.960 79.547 37.961  1.00 31.58  ? 305  ASN A CB    1 
ATOM   2404 C  CG    . ASN A 1 305 ? 32.011 80.406 39.194  1.00 100.00 ? 305  ASN A CG    1 
ATOM   2405 O  OD1   . ASN A 1 305 ? 33.005 80.372 39.939  1.00 59.56  ? 305  ASN A OD1   1 
ATOM   2406 N  ND2   . ASN A 1 305 ? 30.940 81.174 39.404  1.00 57.10  ? 305  ASN A ND2   1 
ATOM   2407 N  N     . TYR A 1 306 ? 32.627 77.980 35.393  1.00 28.80  ? 306  TYR A N     1 
ATOM   2408 C  CA    . TYR A 1 306 ? 32.259 76.835 34.598  1.00 40.99  ? 306  TYR A CA    1 
ATOM   2409 C  C     . TYR A 1 306 ? 33.462 76.038 34.113  1.00 52.31  ? 306  TYR A C     1 
ATOM   2410 O  O     . TYR A 1 306 ? 33.293 75.012 33.475  1.00 24.96  ? 306  TYR A O     1 
ATOM   2411 C  CB    . TYR A 1 306 ? 31.403 77.300 33.402  1.00 21.84  ? 306  TYR A CB    1 
ATOM   2412 C  CG    . TYR A 1 306 ? 29.990 77.676 33.744  1.00 25.35  ? 306  TYR A CG    1 
ATOM   2413 C  CD1   . TYR A 1 306 ? 29.389 77.269 34.938  1.00 22.82  ? 306  TYR A CD1   1 
ATOM   2414 C  CD2   . TYR A 1 306 ? 29.227 78.421 32.816  1.00 22.14  ? 306  TYR A CD2   1 
ATOM   2415 C  CE1   . TYR A 1 306 ? 28.052 77.624 35.176  1.00 31.89  ? 306  TYR A CE1   1 
ATOM   2416 C  CE2   . TYR A 1 306 ? 27.907 78.777 33.079  1.00 21.44  ? 306  TYR A CE2   1 
ATOM   2417 C  CZ    . TYR A 1 306 ? 27.296 78.374 34.268  1.00 20.89  ? 306  TYR A CZ    1 
ATOM   2418 O  OH    . TYR A 1 306 ? 25.951 78.713 34.508  1.00 25.40  ? 306  TYR A OH    1 
ATOM   2419 N  N     . LEU A 1 307 ? 34.670 76.517 34.389  1.00 24.96  ? 307  LEU A N     1 
ATOM   2420 C  CA    . LEU A 1 307 ? 35.890 75.829 33.923  1.00 32.24  ? 307  LEU A CA    1 
ATOM   2421 C  C     . LEU A 1 307 ? 36.939 75.594 35.009  1.00 38.51  ? 307  LEU A C     1 
ATOM   2422 O  O     . LEU A 1 307 ? 37.968 75.003 34.772  1.00 31.67  ? 307  LEU A O     1 
ATOM   2423 C  CB    . LEU A 1 307 ? 36.633 76.598 32.786  1.00 21.32  ? 307  LEU A CB    1 
ATOM   2424 C  CG    . LEU A 1 307 ? 35.823 77.005 31.529  1.00 26.78  ? 307  LEU A CG    1 
ATOM   2425 C  CD1   . LEU A 1 307 ? 36.660 77.936 30.659  1.00 27.44  ? 307  LEU A CD1   1 
ATOM   2426 C  CD2   . LEU A 1 307 ? 35.215 75.854 30.713  1.00 22.24  ? 307  LEU A CD2   1 
ATOM   2427 N  N     . ASN A 1 308 ? 36.672 76.093 36.193  1.00 29.89  ? 308  ASN A N     1 
ATOM   2428 C  CA    . ASN A 1 308 ? 37.616 76.049 37.281  1.00 36.59  ? 308  ASN A CA    1 
ATOM   2429 C  C     . ASN A 1 308 ? 37.198 75.093 38.380  1.00 37.40  ? 308  ASN A C     1 
ATOM   2430 O  O     . ASN A 1 308 ? 37.792 74.992 39.440  1.00 44.50  ? 308  ASN A O     1 
ATOM   2431 C  CB    . ASN A 1 308 ? 37.810 77.493 37.731  1.00 43.02  ? 308  ASN A CB    1 
ATOM   2432 C  CG    . ASN A 1 308 ? 36.634 77.925 38.556  1.00 32.62  ? 308  ASN A CG    1 
ATOM   2433 O  OD1   . ASN A 1 308 ? 35.785 77.079 39.042  1.00 27.18  ? 308  ASN A OD1   1 
ATOM   2434 N  ND2   . ASN A 1 308 ? 36.604 79.251 38.704  1.00 54.07  ? 308  ASN A ND2   1 
ATOM   2435 N  N     . GLN A 1 309 ? 36.199 74.300 38.087  1.00 31.58  ? 309  GLN A N     1 
ATOM   2436 C  CA    . GLN A 1 309 ? 35.798 73.340 39.045  1.00 23.42  ? 309  GLN A CA    1 
ATOM   2437 C  C     . GLN A 1 309 ? 36.420 71.945 38.984  1.00 45.85  ? 309  GLN A C     1 
ATOM   2438 O  O     . GLN A 1 309 ? 36.731 71.382 40.028  1.00 45.16  ? 309  GLN A O     1 
ATOM   2439 C  CB    . GLN A 1 309 ? 34.288 73.352 39.336  1.00 70.57  ? 309  GLN A CB    1 
ATOM   2440 C  CG    . GLN A 1 309 ? 33.798 74.618 40.075  1.00 100.00 ? 309  GLN A CG    1 
ATOM   2441 C  CD    . GLN A 1 309 ? 34.349 74.906 41.477  1.00 100.00 ? 309  GLN A CD    1 
ATOM   2442 O  OE1   . GLN A 1 309 ? 34.219 74.073 42.414  1.00 72.38  ? 309  GLN A OE1   1 
ATOM   2443 N  NE2   . GLN A 1 309 ? 34.879 76.132 41.637  1.00 100.00 ? 309  GLN A NE2   1 
ATOM   2444 N  N     . SER A 1 310 ? 36.537 71.356 37.803  1.00 36.60  ? 310  SER A N     1 
ATOM   2445 C  CA    . SER A 1 310 ? 37.023 69.974 37.735  1.00 46.70  ? 310  SER A CA    1 
ATOM   2446 C  C     . SER A 1 310 ? 38.473 69.760 38.096  1.00 44.15  ? 310  SER A C     1 
ATOM   2447 O  O     . SER A 1 310 ? 38.920 68.655 38.352  1.00 41.55  ? 310  SER A O     1 
ATOM   2448 C  CB    . SER A 1 310 ? 36.902 69.293 36.377  1.00 28.72  ? 310  SER A CB    1 
ATOM   2449 O  OG    . SER A 1 310 ? 37.821 69.962 35.528  1.00 32.42  ? 310  SER A OG    1 
ATOM   2450 N  N     . GLY A 1 311 ? 39.267 70.778 38.080  1.00 28.08  ? 311  GLY A N     1 
ATOM   2451 C  CA    . GLY A 1 311 ? 40.646 70.494 38.369  1.00 42.57  ? 311  GLY A CA    1 
ATOM   2452 C  C     . GLY A 1 311 ? 41.436 70.217 37.104  1.00 92.04  ? 311  GLY A C     1 
ATOM   2453 O  O     . GLY A 1 311 ? 42.658 70.239 37.091  1.00 46.57  ? 311  GLY A O     1 
ATOM   2454 N  N     . CYS A 1 312 ? 40.731 69.981 36.013  1.00 56.99  ? 312  CYS A N     1 
ATOM   2455 C  CA    . CYS A 1 312 ? 41.429 69.730 34.778  1.00 26.54  ? 312  CYS A CA    1 
ATOM   2456 C  C     . CYS A 1 312 ? 41.112 70.805 33.755  1.00 27.42  ? 312  CYS A C     1 
ATOM   2457 O  O     . CYS A 1 312 ? 39.936 71.081 33.511  1.00 53.97  ? 312  CYS A O     1 
ATOM   2458 C  CB    . CYS A 1 312 ? 41.220 68.244 34.305  1.00 23.84  ? 312  CYS A CB    1 
ATOM   2459 S  SG    . CYS A 1 312 ? 41.803 68.147 32.525  1.00 39.52  ? 312  CYS A SG    1 
ATOM   2460 N  N     . VAL A 1 313 ? 42.153 71.417 33.180  1.00 21.91  ? 313  VAL A N     1 
ATOM   2461 C  CA    . VAL A 1 313 ? 41.923 72.454 32.186  1.00 25.37  ? 313  VAL A CA    1 
ATOM   2462 C  C     . VAL A 1 313 ? 42.656 72.184 30.879  1.00 27.88  ? 313  VAL A C     1 
ATOM   2463 O  O     . VAL A 1 313 ? 42.498 72.908 29.905  1.00 35.01  ? 313  VAL A O     1 
ATOM   2464 C  CB    . VAL A 1 313 ? 42.050 73.927 32.636  1.00 36.06  ? 313  VAL A CB    1 
ATOM   2465 C  CG1   . VAL A 1 313 ? 41.434 74.251 33.977  1.00 35.24  ? 313  VAL A CG1   1 
ATOM   2466 C  CG2   . VAL A 1 313 ? 43.423 74.542 32.414  1.00 41.02  ? 313  VAL A CG2   1 
ATOM   2467 N  N     . ASP A 1 314 ? 43.474 71.138 30.889  1.00 25.80  ? 314  ASP A N     1 
ATOM   2468 C  CA    . ASP A 1 314 ? 44.212 70.758 29.719  1.00 34.30  ? 314  ASP A CA    1 
ATOM   2469 C  C     . ASP A 1 314 ? 44.165 69.261 29.444  1.00 39.30  ? 314  ASP A C     1 
ATOM   2470 O  O     . ASP A 1 314 ? 43.870 68.461 30.332  1.00 34.55  ? 314  ASP A O     1 
ATOM   2471 C  CB    . ASP A 1 314 ? 45.521 71.496 29.423  1.00 38.51  ? 314  ASP A CB    1 
ATOM   2472 C  CG    . ASP A 1 314 ? 46.482 71.318 30.516  1.00 91.31  ? 314  ASP A CG    1 
ATOM   2473 O  OD1   . ASP A 1 314 ? 46.509 70.042 30.851  1.00 100.00 ? 314  ASP A OD1   1 
ATOM   2474 O  OD2   . ASP A 1 314 ? 47.104 72.260 31.006  1.00 100.00 ? 314  ASP A OD2   1 
ATOM   2475 N  N     . ILE A 1 315 ? 44.386 68.907 28.172  1.00 32.73  ? 315  ILE A N     1 
ATOM   2476 C  CA    . ILE A 1 315 ? 44.389 67.514 27.731  1.00 85.68  ? 315  ILE A CA    1 
ATOM   2477 C  C     . ILE A 1 315 ? 45.782 67.152 27.303  1.00 36.53  ? 315  ILE A C     1 
ATOM   2478 O  O     . ILE A 1 315 ? 46.419 67.879 26.541  1.00 36.49  ? 315  ILE A O     1 
ATOM   2479 C  CB    . ILE A 1 315 ? 43.410 67.054 26.628  1.00 46.30  ? 315  ILE A CB    1 
ATOM   2480 C  CG1   . ILE A 1 315 ? 41.981 67.391 27.016  1.00 24.37  ? 315  ILE A CG1   1 
ATOM   2481 C  CG2   . ILE A 1 315 ? 43.535 65.527 26.379  1.00 31.83  ? 315  ILE A CG2   1 
ATOM   2482 C  CD1   . ILE A 1 315 ? 40.956 67.012 25.947  1.00 30.87  ? 315  ILE A CD1   1 
ATOM   2483 N  N     . LYS A 1 316 ? 46.252 66.031 27.818  1.00 38.55  ? 316  LYS A N     1 
ATOM   2484 C  CA    . LYS A 1 316 ? 47.592 65.589 27.521  1.00 100.00 ? 316  LYS A CA    1 
ATOM   2485 C  C     . LYS A 1 316 ? 47.837 65.469 26.042  1.00 30.98  ? 316  LYS A C     1 
ATOM   2486 O  O     . LYS A 1 316 ? 47.168 64.715 25.322  1.00 48.83  ? 316  LYS A O     1 
ATOM   2487 C  CB    . LYS A 1 316 ? 48.065 64.353 28.297  1.00 100.00 ? 316  LYS A CB    1 
ATOM   2488 C  CG    . LYS A 1 316 ? 49.377 63.685 27.857  1.00 100.00 ? 316  LYS A CG    1 
ATOM   2489 C  CD    . LYS A 1 316 ? 49.385 62.155 28.043  1.00 100.00 ? 316  LYS A CD    1 
ATOM   2490 C  CE    . LYS A 1 316 ? 50.562 61.596 28.829  1.00 100.00 ? 316  LYS A CE    1 
ATOM   2491 N  NZ    . LYS A 1 316 ? 50.635 60.103 28.919  1.00 100.00 ? 316  LYS A NZ    1 
ATOM   2492 N  N     . GLY A 1 317 ? 48.827 66.241 25.599  1.00 55.47  ? 317  GLY A N     1 
ATOM   2493 C  CA    . GLY A 1 317 ? 49.176 66.201 24.213  1.00 29.23  ? 317  GLY A CA    1 
ATOM   2494 C  C     . GLY A 1 317 ? 48.128 66.856 23.356  1.00 57.19  ? 317  GLY A C     1 
ATOM   2495 O  O     . GLY A 1 317 ? 47.896 66.432 22.234  1.00 66.23  ? 317  GLY A O     1 
ATOM   2496 N  N     . VAL A 1 318 ? 47.521 67.900 23.902  1.00 52.04  ? 318  VAL A N     1 
ATOM   2497 C  CA    . VAL A 1 318 ? 46.543 68.674 23.186  1.00 33.77  ? 318  VAL A CA    1 
ATOM   2498 C  C     . VAL A 1 318 ? 46.778 70.148 23.386  1.00 37.03  ? 318  VAL A C     1 
ATOM   2499 O  O     . VAL A 1 318 ? 46.806 70.602 24.538  1.00 34.97  ? 318  VAL A O     1 
ATOM   2500 C  CB    . VAL A 1 318 ? 45.052 68.413 23.509  1.00 41.70  ? 318  VAL A CB    1 
ATOM   2501 C  CG1   . VAL A 1 318 ? 44.141 69.404 22.697  1.00 24.56  ? 318  VAL A CG1   1 
ATOM   2502 C  CG2   . VAL A 1 318 ? 44.768 66.955 23.191  1.00 27.98  ? 318  VAL A CG2   1 
ATOM   2503 N  N     . SER A 1 319 ? 46.895 70.849 22.230  1.00 37.60  ? 319  SER A N     1 
ATOM   2504 C  CA    . SER A 1 319 ? 47.094 72.303 22.150  1.00 48.05  ? 319  SER A CA    1 
ATOM   2505 C  C     . SER A 1 319 ? 45.794 72.996 21.806  1.00 42.55  ? 319  SER A C     1 
ATOM   2506 O  O     . SER A 1 319 ? 45.411 73.081 20.637  1.00 34.21  ? 319  SER A O     1 
ATOM   2507 C  CB    . SER A 1 319 ? 48.220 72.839 21.268  1.00 25.22  ? 319  SER A CB    1 
ATOM   2508 O  OG    . SER A 1 319 ? 47.912 74.160 20.879  1.00 34.33  ? 319  SER A OG    1 
ATOM   2509 N  N     . ASP A 1 320 ? 45.151 73.518 22.851  1.00 30.98  ? 320  ASP A N     1 
ATOM   2510 C  CA    . ASP A 1 320 ? 43.885 74.202 22.645  1.00 33.19  ? 320  ASP A CA    1 
ATOM   2511 C  C     . ASP A 1 320 ? 43.984 75.307 21.609  1.00 42.54  ? 320  ASP A C     1 
ATOM   2512 O  O     . ASP A 1 320 ? 43.140 75.463 20.727  1.00 35.06  ? 320  ASP A O     1 
ATOM   2513 C  CB    . ASP A 1 320 ? 43.185 74.467 23.996  1.00 34.39  ? 320  ASP A CB    1 
ATOM   2514 C  CG    . ASP A 1 320 ? 42.843 73.190 24.776  1.00 48.82  ? 320  ASP A CG    1 
ATOM   2515 O  OD1   . ASP A 1 320 ? 41.901 72.413 24.236  1.00 34.74  ? 320  ASP A OD1   1 
ATOM   2516 O  OD2   . ASP A 1 320 ? 43.385 72.925 25.840  1.00 38.61  ? 320  ASP A OD2   1 
ATOM   2517 N  N     . GLU A 1 321 ? 45.057 76.080 21.719  1.00 38.71  ? 321  GLU A N     1 
ATOM   2518 C  CA    . GLU A 1 321 ? 45.279 77.183 20.806  1.00 32.76  ? 321  GLU A CA    1 
ATOM   2519 C  C     . GLU A 1 321 ? 45.480 76.649 19.410  1.00 23.94  ? 321  GLU A C     1 
ATOM   2520 O  O     . GLU A 1 321 ? 45.003 77.234 18.447  1.00 27.60  ? 321  GLU A O     1 
ATOM   2521 C  CB    . GLU A 1 321 ? 46.567 77.939 21.206  1.00 55.31  ? 321  GLU A CB    1 
ATOM   2522 C  CG    . GLU A 1 321 ? 47.679 76.994 21.713  1.00 100.00 ? 321  GLU A CG    1 
ATOM   2523 C  CD    . GLU A 1 321 ? 47.359 76.395 23.070  1.00 100.00 ? 321  GLU A CD    1 
ATOM   2524 O  OE1   . GLU A 1 321 ? 46.492 76.842 23.805  1.00 91.76  ? 321  GLU A OE1   1 
ATOM   2525 O  OE2   . GLU A 1 321 ? 48.051 75.305 23.292  1.00 100.00 ? 321  GLU A OE2   1 
ATOM   2526 N  N     . ASP A 1 322 ? 46.199 75.543 19.309  1.00 26.31  ? 322  ASP A N     1 
ATOM   2527 C  CA    . ASP A 1 322 ? 46.401 74.973 17.993  1.00 41.67  ? 322  ASP A CA    1 
ATOM   2528 C  C     . ASP A 1 322 ? 45.070 74.470 17.453  1.00 69.01  ? 322  ASP A C     1 
ATOM   2529 O  O     . ASP A 1 322 ? 44.783 74.563 16.266  1.00 45.33  ? 322  ASP A O     1 
ATOM   2530 C  CB    . ASP A 1 322 ? 47.527 73.909 17.949  1.00 44.09  ? 322  ASP A CB    1 
ATOM   2531 C  CG    . ASP A 1 322 ? 48.900 74.564 17.917  1.00 100.00 ? 322  ASP A CG    1 
ATOM   2532 O  OD1   . ASP A 1 322 ? 49.054 75.716 17.551  1.00 100.00 ? 322  ASP A OD1   1 
ATOM   2533 O  OD2   . ASP A 1 322 ? 49.902 73.791 18.352  1.00 73.06  ? 322  ASP A OD2   1 
ATOM   2534 N  N     . GLU A 1 323 ? 44.225 73.947 18.349  1.00 39.09  ? 323  GLU A N     1 
ATOM   2535 C  CA    . GLU A 1 323 ? 42.908 73.431 17.976  1.00 29.11  ? 323  GLU A CA    1 
ATOM   2536 C  C     . GLU A 1 323 ? 41.952 74.539 17.592  1.00 22.92  ? 323  GLU A C     1 
ATOM   2537 O  O     . GLU A 1 323 ? 41.193 74.424 16.639  1.00 33.72  ? 323  GLU A O     1 
ATOM   2538 C  CB    . GLU A 1 323 ? 42.348 72.554 19.095  1.00 46.70  ? 323  GLU A CB    1 
ATOM   2539 C  CG    . GLU A 1 323 ? 43.072 71.200 19.177  1.00 37.84  ? 323  GLU A CG    1 
ATOM   2540 C  CD    . GLU A 1 323 ? 42.980 70.385 17.913  1.00 99.32  ? 323  GLU A CD    1 
ATOM   2541 O  OE1   . GLU A 1 323 ? 42.017 70.393 17.142  1.00 47.44  ? 323  GLU A OE1   1 
ATOM   2542 O  OE2   . GLU A 1 323 ? 44.053 69.668 17.744  1.00 41.11  ? 323  GLU A OE2   1 
ATOM   2543 N  N     . PHE A 1 324 ? 42.042 75.669 18.288  1.00 22.36  ? 324  PHE A N     1 
ATOM   2544 C  CA    . PHE A 1 324 ? 41.222 76.819 17.972  1.00 26.79  ? 324  PHE A CA    1 
ATOM   2545 C  C     . PHE A 1 324 ? 41.368 77.234 16.500  1.00 74.90  ? 324  PHE A C     1 
ATOM   2546 O  O     . PHE A 1 324 ? 40.427 77.653 15.786  1.00 32.47  ? 324  PHE A O     1 
ATOM   2547 C  CB    . PHE A 1 324 ? 41.588 77.973 18.971  1.00 25.96  ? 324  PHE A CB    1 
ATOM   2548 C  CG    . PHE A 1 324 ? 40.593 79.111 18.951  1.00 43.53  ? 324  PHE A CG    1 
ATOM   2549 C  CD1   . PHE A 1 324 ? 39.224 78.837 18.942  1.00 100.00 ? 324  PHE A CD1   1 
ATOM   2550 C  CD2   . PHE A 1 324 ? 40.959 80.451 18.885  1.00 39.12  ? 324  PHE A CD2   1 
ATOM   2551 C  CE1   . PHE A 1 324 ? 38.265 79.846 18.816  1.00 46.24  ? 324  PHE A CE1   1 
ATOM   2552 C  CE2   . PHE A 1 324 ? 40.018 81.477 18.876  1.00 35.08  ? 324  PHE A CE2   1 
ATOM   2553 C  CZ    . PHE A 1 324 ? 38.660 81.179 18.799  1.00 38.16  ? 324  PHE A CZ    1 
ATOM   2554 N  N     . LYS A 1 325 ? 42.608 77.102 16.041  1.00 46.11  ? 325  LYS A N     1 
ATOM   2555 C  CA    . LYS A 1 325 ? 42.967 77.479 14.694  1.00 73.81  ? 325  LYS A CA    1 
ATOM   2556 C  C     . LYS A 1 325 ? 42.248 76.588 13.726  1.00 33.29  ? 325  LYS A C     1 
ATOM   2557 O  O     . LYS A 1 325 ? 41.622 77.048 12.767  1.00 31.20  ? 325  LYS A O     1 
ATOM   2558 C  CB    . LYS A 1 325 ? 44.460 77.360 14.490  1.00 65.21  ? 325  LYS A CB    1 
ATOM   2559 C  CG    . LYS A 1 325 ? 45.115 78.724 14.459  1.00 100.00 ? 325  LYS A CG    1 
ATOM   2560 C  CD    . LYS A 1 325 ? 45.462 79.347 15.828  1.00 100.00 ? 325  LYS A CD    1 
ATOM   2561 C  CE    . LYS A 1 325 ? 44.376 79.303 16.911  1.00 83.15  ? 325  LYS A CE    1 
ATOM   2562 N  NZ    . LYS A 1 325 ? 44.074 80.595 17.546  1.00 59.97  ? 325  LYS A NZ    1 
ATOM   2563 N  N     . ILE A 1 326 ? 42.387 75.303 14.024  1.00 27.23  ? 326  ILE A N     1 
ATOM   2564 C  CA    . ILE A 1 326 ? 41.754 74.263 13.246  1.00 37.21  ? 326  ILE A CA    1 
ATOM   2565 C  C     . ILE A 1 326 ? 40.271 74.523 13.192  1.00 35.23  ? 326  ILE A C     1 
ATOM   2566 O  O     . ILE A 1 326 ? 39.675 74.501 12.114  1.00 40.02  ? 326  ILE A O     1 
ATOM   2567 C  CB    . ILE A 1 326 ? 41.980 72.990 13.945  1.00 30.67  ? 326  ILE A CB    1 
ATOM   2568 C  CG1   . ILE A 1 326 ? 43.436 72.710 13.918  1.00 43.78  ? 326  ILE A CG1   1 
ATOM   2569 C  CG2   . ILE A 1 326 ? 41.285 71.906 13.218  1.00 31.94  ? 326  ILE A CG2   1 
ATOM   2570 C  CD1   . ILE A 1 326 ? 43.675 71.262 14.204  1.00 34.26  ? 326  ILE A CD1   1 
ATOM   2571 N  N     . THR A 1 327 ? 39.701 74.864 14.357  1.00 38.38  ? 327  THR A N     1 
ATOM   2572 C  CA    . THR A 1 327 ? 38.285 75.162 14.471  1.00 44.47  ? 327  THR A CA    1 
ATOM   2573 C  C     . THR A 1 327 ? 37.848 76.334 13.596  1.00 30.34  ? 327  THR A C     1 
ATOM   2574 O  O     . THR A 1 327 ? 36.864 76.255 12.857  1.00 27.15  ? 327  THR A O     1 
ATOM   2575 C  CB    . THR A 1 327 ? 37.795 75.258 15.956  1.00 41.68  ? 327  THR A CB    1 
ATOM   2576 O  OG1   . THR A 1 327 ? 38.038 74.022 16.564  1.00 22.66  ? 327  THR A OG1   1 
ATOM   2577 C  CG2   . THR A 1 327 ? 36.317 75.645 16.135  1.00 28.96  ? 327  THR A CG2   1 
ATOM   2578 N  N     . ARG A 1 328 ? 38.569 77.450 13.728  1.00 28.92  ? 328  ARG A N     1 
ATOM   2579 C  CA    . ARG A 1 328 ? 38.268 78.647 12.952  1.00 30.54  ? 328  ARG A CA    1 
ATOM   2580 C  C     . ARG A 1 328 ? 38.494 78.374 11.457  1.00 37.30  ? 328  ARG A C     1 
ATOM   2581 O  O     . ARG A 1 328 ? 37.732 78.786 10.565  1.00 42.31  ? 328  ARG A O     1 
ATOM   2582 C  CB    . ARG A 1 328 ? 39.133 79.755 13.499  1.00 38.23  ? 328  ARG A CB    1 
ATOM   2583 C  CG    . ARG A 1 328 ? 38.538 80.580 14.621  1.00 40.48  ? 328  ARG A CG    1 
ATOM   2584 C  CD    . ARG A 1 328 ? 39.087 82.011 14.564  1.00 86.09  ? 328  ARG A CD    1 
ATOM   2585 N  NE    . ARG A 1 328 ? 40.428 82.152 15.138  1.00 91.70  ? 328  ARG A NE    1 
ATOM   2586 C  CZ    . ARG A 1 328 ? 40.743 83.088 16.050  1.00 100.00 ? 328  ARG A CZ    1 
ATOM   2587 N  NH1   . ARG A 1 328 ? 39.827 83.956 16.480  1.00 72.39  ? 328  ARG A NH1   1 
ATOM   2588 N  NH2   . ARG A 1 328 ? 41.984 83.162 16.582  1.00 65.50  ? 328  ARG A NH2   1 
ATOM   2589 N  N     . GLN A 1 329 ? 39.540 77.614 11.194  1.00 39.36  ? 329  GLN A N     1 
ATOM   2590 C  CA    . GLN A 1 329 ? 39.851 77.208 9.852   1.00 41.17  ? 329  GLN A CA    1 
ATOM   2591 C  C     . GLN A 1 329 ? 38.639 76.510 9.238   1.00 49.02  ? 329  GLN A C     1 
ATOM   2592 O  O     . GLN A 1 329 ? 38.138 76.919 8.213   1.00 43.83  ? 329  GLN A O     1 
ATOM   2593 C  CB    . GLN A 1 329 ? 41.000 76.258 10.051  1.00 34.52  ? 329  GLN A CB    1 
ATOM   2594 C  CG    . GLN A 1 329 ? 41.513 75.665 8.762   1.00 96.16  ? 329  GLN A CG    1 
ATOM   2595 C  CD    . GLN A 1 329 ? 42.957 76.065 8.614   1.00 100.00 ? 329  GLN A CD    1 
ATOM   2596 O  OE1   . GLN A 1 329 ? 43.422 76.227 7.469   1.00 100.00 ? 329  GLN A OE1   1 
ATOM   2597 N  NE2   . GLN A 1 329 ? 43.659 76.236 9.762   1.00 89.52  ? 329  GLN A NE2   1 
ATOM   2598 N  N     . ALA A 1 330 ? 38.131 75.475 9.902   1.00 32.97  ? 330  ALA A N     1 
ATOM   2599 C  CA    . ALA A 1 330 ? 36.929 74.733 9.462   1.00 37.66  ? 330  ALA A CA    1 
ATOM   2600 C  C     . ALA A 1 330 ? 35.691 75.619 9.276   1.00 26.10  ? 330  ALA A C     1 
ATOM   2601 O  O     . ALA A 1 330 ? 34.934 75.447 8.327   1.00 43.19  ? 330  ALA A O     1 
ATOM   2602 C  CB    . ALA A 1 330 ? 36.569 73.578 10.421  1.00 31.57  ? 330  ALA A CB    1 
ATOM   2603 N  N     . MET A 1 331 ? 35.440 76.544 10.204  1.00 40.47  ? 331  MET A N     1 
ATOM   2604 C  CA    . MET A 1 331 ? 34.290 77.401 10.082  1.00 26.87  ? 331  MET A CA    1 
ATOM   2605 C  C     . MET A 1 331 ? 34.376 78.201 8.811   1.00 40.25  ? 331  MET A C     1 
ATOM   2606 O  O     . MET A 1 331 ? 33.383 78.483 8.171   1.00 35.92  ? 331  MET A O     1 
ATOM   2607 C  CB    . MET A 1 331 ? 34.213 78.381 11.253  1.00 24.43  ? 331  MET A CB    1 
ATOM   2608 C  CG    . MET A 1 331 ? 33.776 77.739 12.531  1.00 30.08  ? 331  MET A CG    1 
ATOM   2609 S  SD    . MET A 1 331 ? 33.467 78.901 13.941  1.00 51.43  ? 331  MET A SD    1 
ATOM   2610 C  CE    . MET A 1 331 ? 35.083 78.820 14.765  1.00 100.00 ? 331  MET A CE    1 
ATOM   2611 N  N     . ASP A 1 332 ? 35.603 78.613 8.493   1.00 41.53  ? 332  ASP A N     1 
ATOM   2612 C  CA    . ASP A 1 332 ? 35.885 79.362 7.287   1.00 36.62  ? 332  ASP A CA    1 
ATOM   2613 C  C     . ASP A 1 332 ? 35.516 78.536 6.058   1.00 32.18  ? 332  ASP A C     1 
ATOM   2614 O  O     . ASP A 1 332 ? 34.793 78.982 5.164   1.00 57.04  ? 332  ASP A O     1 
ATOM   2615 C  CB    . ASP A 1 332 ? 37.396 79.650 7.174   1.00 41.62  ? 332  ASP A CB    1 
ATOM   2616 C  CG    . ASP A 1 332 ? 37.969 80.676 8.115   1.00 100.00 ? 332  ASP A CG    1 
ATOM   2617 O  OD1   . ASP A 1 332 ? 37.061 81.539 8.571   1.00 65.55  ? 332  ASP A OD1   1 
ATOM   2618 O  OD2   . ASP A 1 332 ? 39.164 80.660 8.410   1.00 62.07  ? 332  ASP A OD2   1 
ATOM   2619 N  N     . ILE A 1 333 ? 36.019 77.294 6.025   1.00 27.18  ? 333  ILE A N     1 
ATOM   2620 C  CA    . ILE A 1 333 ? 35.763 76.390 4.913   1.00 26.90  ? 333  ILE A CA    1 
ATOM   2621 C  C     . ILE A 1 333 ? 34.280 76.135 4.732   1.00 96.13  ? 333  ILE A C     1 
ATOM   2622 O  O     . ILE A 1 333 ? 33.708 76.343 3.651   1.00 36.65  ? 333  ILE A O     1 
ATOM   2623 C  CB    . ILE A 1 333 ? 36.463 75.071 5.113   1.00 36.23  ? 333  ILE A CB    1 
ATOM   2624 C  CG1   . ILE A 1 333 ? 37.978 75.200 4.864   1.00 76.70  ? 333  ILE A CG1   1 
ATOM   2625 C  CG2   . ILE A 1 333 ? 35.807 74.012 4.223   1.00 62.02  ? 333  ILE A CG2   1 
ATOM   2626 C  CD1   . ILE A 1 333 ? 38.863 75.205 6.118   1.00 69.45  ? 333  ILE A CD1   1 
ATOM   2627 N  N     . VAL A 1 334 ? 33.661 75.695 5.816   1.00 49.06  ? 334  VAL A N     1 
ATOM   2628 C  CA    . VAL A 1 334 ? 32.247 75.477 5.751   1.00 37.80  ? 334  VAL A CA    1 
ATOM   2629 C  C     . VAL A 1 334 ? 31.645 76.751 5.187   1.00 39.31  ? 334  VAL A C     1 
ATOM   2630 O  O     . VAL A 1 334 ? 31.032 76.758 4.122   1.00 62.44  ? 334  VAL A O     1 
ATOM   2631 C  CB    . VAL A 1 334 ? 31.611 74.859 7.021   1.00 37.64  ? 334  VAL A CB    1 
ATOM   2632 C  CG1   . VAL A 1 334 ? 30.104 74.584 6.856   1.00 27.48  ? 334  VAL A CG1   1 
ATOM   2633 C  CG2   . VAL A 1 334 ? 32.250 73.502 7.124   1.00 24.22  ? 334  VAL A CG2   1 
ATOM   2634 N  N     . GLY A 1 335 ? 31.907 77.858 5.847   1.00 48.21  ? 335  GLY A N     1 
ATOM   2635 C  CA    . GLY A 1 335 ? 31.410 79.109 5.345   1.00 41.23  ? 335  GLY A CA    1 
ATOM   2636 C  C     . GLY A 1 335 ? 30.838 79.999 6.417   1.00 43.61  ? 335  GLY A C     1 
ATOM   2637 O  O     . GLY A 1 335 ? 29.871 80.734 6.207   1.00 52.36  ? 335  GLY A O     1 
ATOM   2638 N  N     . PHE A 1 336 ? 31.428 79.952 7.595   1.00 74.22  ? 336  PHE A N     1 
ATOM   2639 C  CA    . PHE A 1 336 ? 30.931 80.823 8.624   1.00 90.13  ? 336  PHE A CA    1 
ATOM   2640 C  C     . PHE A 1 336 ? 31.558 82.174 8.408   1.00 70.35  ? 336  PHE A C     1 
ATOM   2641 O  O     . PHE A 1 336 ? 32.782 82.292 8.314   1.00 45.78  ? 336  PHE A O     1 
ATOM   2642 C  CB    . PHE A 1 336 ? 31.030 80.332 10.084  1.00 97.96  ? 336  PHE A CB    1 
ATOM   2643 C  CG    . PHE A 1 336 ? 30.098 79.174 10.411  1.00 34.72  ? 336  PHE A CG    1 
ATOM   2644 C  CD1   . PHE A 1 336 ? 30.449 77.866 10.080  1.00 100.00 ? 336  PHE A CD1   1 
ATOM   2645 C  CD2   . PHE A 1 336 ? 28.838 79.390 10.990  1.00 40.53  ? 336  PHE A CD2   1 
ATOM   2646 C  CE1   . PHE A 1 336 ? 29.606 76.789 10.354  1.00 28.15  ? 336  PHE A CE1   1 
ATOM   2647 C  CE2   . PHE A 1 336 ? 27.981 78.334 11.277  1.00 37.52  ? 336  PHE A CE2   1 
ATOM   2648 C  CZ    . PHE A 1 336 ? 28.363 77.031 10.944  1.00 34.67  ? 336  PHE A CZ    1 
ATOM   2649 N  N     . SER A 1 337 ? 30.692 83.158 8.262   1.00 44.38  ? 337  SER A N     1 
ATOM   2650 C  CA    . SER A 1 337 ? 31.150 84.500 8.058   1.00 56.79  ? 337  SER A CA    1 
ATOM   2651 C  C     . SER A 1 337 ? 31.870 84.959 9.293   1.00 47.30  ? 337  SER A C     1 
ATOM   2652 O  O     . SER A 1 337 ? 31.642 84.457 10.378  1.00 45.70  ? 337  SER A O     1 
ATOM   2653 C  CB    . SER A 1 337 ? 30.019 85.415 7.703   1.00 32.63  ? 337  SER A CB    1 
ATOM   2654 O  OG    . SER A 1 337 ? 29.379 85.911 8.851   1.00 43.76  ? 337  SER A OG    1 
ATOM   2655 N  N     . GLN A 1 338 ? 32.800 85.856 9.105   1.00 46.16  ? 338  GLN A N     1 
ATOM   2656 C  CA    . GLN A 1 338 ? 33.555 86.340 10.225  1.00 46.90  ? 338  GLN A CA    1 
ATOM   2657 C  C     . GLN A 1 338 ? 32.583 86.874 11.242  1.00 36.95  ? 338  GLN A C     1 
ATOM   2658 O  O     . GLN A 1 338 ? 32.768 86.805 12.440  1.00 44.47  ? 338  GLN A O     1 
ATOM   2659 C  CB    . GLN A 1 338 ? 34.442 87.508 9.758   1.00 100.00 ? 338  GLN A CB    1 
ATOM   2660 C  CG    . GLN A 1 338 ? 35.955 87.229 9.921   1.00 100.00 ? 338  GLN A CG    1 
ATOM   2661 C  CD    . GLN A 1 338 ? 36.280 85.755 10.105  1.00 82.08  ? 338  GLN A CD    1 
ATOM   2662 O  OE1   . GLN A 1 338 ? 36.701 85.340 11.190  1.00 99.24  ? 338  GLN A OE1   1 
ATOM   2663 N  NE2   . GLN A 1 338 ? 36.102 84.949 9.057   1.00 100.00 ? 338  GLN A NE2   1 
ATOM   2664 N  N     . GLU A 1 339 ? 31.533 87.456 10.737  1.00 36.63  ? 339  GLU A N     1 
ATOM   2665 C  CA    . GLU A 1 339 ? 30.570 88.030 11.619  1.00 40.14  ? 339  GLU A CA    1 
ATOM   2666 C  C     . GLU A 1 339 ? 29.912 86.971 12.516  1.00 56.87  ? 339  GLU A C     1 
ATOM   2667 O  O     . GLU A 1 339 ? 29.728 87.161 13.734  1.00 40.22  ? 339  GLU A O     1 
ATOM   2668 C  CB    . GLU A 1 339 ? 29.603 88.820 10.740  1.00 30.53  ? 339  GLU A CB    1 
ATOM   2669 C  CG    . GLU A 1 339 ? 29.925 90.308 10.932  1.00 100.00 ? 339  GLU A CG    1 
ATOM   2670 C  CD    . GLU A 1 339 ? 29.447 90.817 12.285  1.00 100.00 ? 339  GLU A CD    1 
ATOM   2671 O  OE1   . GLU A 1 339 ? 28.114 90.952 12.313  1.00 100.00 ? 339  GLU A OE1   1 
ATOM   2672 O  OE2   . GLU A 1 339 ? 30.215 91.038 13.253  1.00 100.00 ? 339  GLU A OE2   1 
ATOM   2673 N  N     . GLU A 1 340 ? 29.565 85.850 11.893  1.00 40.81  ? 340  GLU A N     1 
ATOM   2674 C  CA    . GLU A 1 340 ? 28.968 84.731 12.586  1.00 38.91  ? 340  GLU A CA    1 
ATOM   2675 C  C     . GLU A 1 340 ? 29.965 84.111 13.540  1.00 32.52  ? 340  GLU A C     1 
ATOM   2676 O  O     . GLU A 1 340 ? 29.653 83.739 14.668  1.00 42.47  ? 340  GLU A O     1 
ATOM   2677 C  CB    . GLU A 1 340 ? 28.497 83.717 11.578  1.00 49.24  ? 340  GLU A CB    1 
ATOM   2678 C  CG    . GLU A 1 340 ? 27.202 84.187 10.856  1.00 32.85  ? 340  GLU A CG    1 
ATOM   2679 C  CD    . GLU A 1 340 ? 26.828 83.256 9.692   1.00 31.99  ? 340  GLU A CD    1 
ATOM   2680 O  OE1   . GLU A 1 340 ? 27.861 82.562 9.143   1.00 49.22  ? 340  GLU A OE1   1 
ATOM   2681 O  OE2   . GLU A 1 340 ? 25.656 83.130 9.287   1.00 52.96  ? 340  GLU A OE2   1 
ATOM   2682 N  N     . GLN A 1 341 ? 31.200 84.000 13.104  1.00 29.34  ? 341  GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 341 ? 32.186 83.450 13.974  1.00 26.52  ? 341  GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 341 ? 32.290 84.295 15.228  1.00 33.89  ? 341  GLN A C     1 
ATOM   2685 O  O     . GLN A 1 341 ? 32.428 83.817 16.360  1.00 36.97  ? 341  GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 341 ? 33.495 83.390 13.172  1.00 22.40  ? 341  GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 341 ? 33.274 82.377 12.080  1.00 26.31  ? 341  GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 341 ? 34.544 82.061 11.350  1.00 39.13  ? 341  GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 341 ? 35.592 81.817 11.974  1.00 38.38  ? 341  GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 341 ? 34.432 81.990 10.007  1.00 36.65  ? 341  GLN A NE2   1 
ATOM   2691 N  N     . MET A 1 342 ? 32.183 85.589 15.011  1.00 48.71  ? 342  MET A N     1 
ATOM   2692 C  CA    . MET A 1 342 ? 32.281 86.539 16.092  1.00 35.22  ? 342  MET A CA    1 
ATOM   2693 C  C     . MET A 1 342 ? 31.257 86.281 17.134  1.00 30.99  ? 342  MET A C     1 
ATOM   2694 O  O     . MET A 1 342 ? 31.618 86.047 18.284  1.00 32.88  ? 342  MET A O     1 
ATOM   2695 C  CB    . MET A 1 342 ? 32.510 88.006 15.720  1.00 29.73  ? 342  MET A CB    1 
ATOM   2696 C  CG    . MET A 1 342 ? 33.879 88.173 15.004  1.00 100.00 ? 342  MET A CG    1 
ATOM   2697 S  SD    . MET A 1 342 ? 34.600 86.668 14.165  1.00 100.00 ? 342  MET A SD    1 
ATOM   2698 C  CE    . MET A 1 342 ? 36.060 86.188 15.141  1.00 100.00 ? 342  MET A CE    1 
ATOM   2699 N  N     . SER A 1 343 ? 29.999 86.265 16.690  1.00 31.58  ? 343  SER A N     1 
ATOM   2700 C  CA    . SER A 1 343 ? 28.866 85.962 17.562  1.00 38.80  ? 343  SER A CA    1 
ATOM   2701 C  C     . SER A 1 343 ? 28.903 84.560 18.236  1.00 26.73  ? 343  SER A C     1 
ATOM   2702 O  O     . SER A 1 343 ? 28.530 84.404 19.399  1.00 37.36  ? 343  SER A O     1 
ATOM   2703 C  CB    . SER A 1 343 ? 27.523 86.263 16.907  1.00 46.53  ? 343  SER A CB    1 
ATOM   2704 O  OG    . SER A 1 343 ? 27.653 87.258 15.948  1.00 46.63  ? 343  SER A OG    1 
ATOM   2705 N  N     . ILE A 1 344 ? 29.352 83.516 17.536  1.00 27.40  ? 344  ILE A N     1 
ATOM   2706 C  CA    . ILE A 1 344 ? 29.437 82.218 18.177  1.00 29.46  ? 344  ILE A CA    1 
ATOM   2707 C  C     . ILE A 1 344 ? 30.343 82.304 19.396  1.00 30.54  ? 344  ILE A C     1 
ATOM   2708 O  O     . ILE A 1 344 ? 30.031 81.822 20.488  1.00 28.35  ? 344  ILE A O     1 
ATOM   2709 C  CB    . ILE A 1 344 ? 30.011 81.220 17.179  1.00 27.32  ? 344  ILE A CB    1 
ATOM   2710 C  CG1   . ILE A 1 344 ? 28.925 80.980 16.167  1.00 24.15  ? 344  ILE A CG1   1 
ATOM   2711 C  CG2   . ILE A 1 344 ? 30.474 79.918 17.824  1.00 23.65  ? 344  ILE A CG2   1 
ATOM   2712 C  CD1   . ILE A 1 344 ? 29.435 80.413 14.855  1.00 25.78  ? 344  ILE A CD1   1 
ATOM   2713 N  N     . PHE A 1 345 ? 31.473 82.985 19.176  1.00 29.77  ? 345  PHE A N     1 
ATOM   2714 C  CA    . PHE A 1 345 ? 32.491 83.172 20.190  1.00 30.22  ? 345  PHE A CA    1 
ATOM   2715 C  C     . PHE A 1 345 ? 31.987 84.047 21.302  1.00 27.25  ? 345  PHE A C     1 
ATOM   2716 O  O     . PHE A 1 345 ? 32.324 83.859 22.467  1.00 33.57  ? 345  PHE A O     1 
ATOM   2717 C  CB    . PHE A 1 345 ? 33.633 83.837 19.504  1.00 36.41  ? 345  PHE A CB    1 
ATOM   2718 C  CG    . PHE A 1 345 ? 34.214 82.872 18.512  1.00 31.87  ? 345  PHE A CG    1 
ATOM   2719 C  CD1   . PHE A 1 345 ? 34.189 81.506 18.787  1.00 48.38  ? 345  PHE A CD1   1 
ATOM   2720 C  CD2   . PHE A 1 345 ? 34.831 83.333 17.347  1.00 72.34  ? 345  PHE A CD2   1 
ATOM   2721 C  CE1   . PHE A 1 345 ? 34.785 80.598 17.899  1.00 43.95  ? 345  PHE A CE1   1 
ATOM   2722 C  CE2   . PHE A 1 345 ? 35.408 82.447 16.440  1.00 45.62  ? 345  PHE A CE2   1 
ATOM   2723 C  CZ    . PHE A 1 345 ? 35.383 81.081 16.736  1.00 55.83  ? 345  PHE A CZ    1 
ATOM   2724 N  N     . LYS A 1 346 ? 31.173 85.016 20.903  1.00 26.85  ? 346  LYS A N     1 
ATOM   2725 C  CA    . LYS A 1 346 ? 30.556 85.920 21.842  1.00 27.42  ? 346  LYS A CA    1 
ATOM   2726 C  C     . LYS A 1 346 ? 29.618 85.156 22.754  1.00 31.97  ? 346  LYS A C     1 
ATOM   2727 O  O     . LYS A 1 346 ? 29.581 85.409 23.972  1.00 39.13  ? 346  LYS A O     1 
ATOM   2728 C  CB    . LYS A 1 346 ? 29.785 86.972 21.119  1.00 36.83  ? 346  LYS A CB    1 
ATOM   2729 C  CG    . LYS A 1 346 ? 30.735 88.121 20.742  1.00 33.44  ? 346  LYS A CG    1 
ATOM   2730 C  CD    . LYS A 1 346 ? 29.902 89.366 20.593  1.00 70.41  ? 346  LYS A CD    1 
ATOM   2731 C  CE    . LYS A 1 346 ? 30.096 90.077 19.285  1.00 49.24  ? 346  LYS A CE    1 
ATOM   2732 N  NZ    . LYS A 1 346 ? 30.514 91.473 19.574  1.00 100.00 ? 346  LYS A NZ    1 
ATOM   2733 N  N     . ILE A 1 347 ? 28.867 84.214 22.139  1.00 39.29  ? 347  ILE A N     1 
ATOM   2734 C  CA    . ILE A 1 347 ? 27.955 83.344 22.874  1.00 43.28  ? 347  ILE A CA    1 
ATOM   2735 C  C     . ILE A 1 347 ? 28.713 82.479 23.894  1.00 28.57  ? 347  ILE A C     1 
ATOM   2736 O  O     . ILE A 1 347 ? 28.306 82.339 25.055  1.00 25.28  ? 347  ILE A O     1 
ATOM   2737 C  CB    . ILE A 1 347 ? 27.059 82.529 21.961  1.00 38.44  ? 347  ILE A CB    1 
ATOM   2738 C  CG1   . ILE A 1 347 ? 26.113 83.469 21.241  1.00 31.58  ? 347  ILE A CG1   1 
ATOM   2739 C  CG2   . ILE A 1 347 ? 26.295 81.445 22.795  1.00 29.78  ? 347  ILE A CG2   1 
ATOM   2740 C  CD1   . ILE A 1 347 ? 25.324 82.866 20.047  1.00 22.84  ? 347  ILE A CD1   1 
ATOM   2741 N  N     . ILE A 1 348 ? 29.841 81.930 23.421  1.00 23.09  ? 348  ILE A N     1 
ATOM   2742 C  CA    . ILE A 1 348 ? 30.751 81.139 24.238  1.00 26.27  ? 348  ILE A CA    1 
ATOM   2743 C  C     . ILE A 1 348 ? 31.243 81.958 25.451  1.00 29.86  ? 348  ILE A C     1 
ATOM   2744 O  O     . ILE A 1 348 ? 31.206 81.496 26.621  1.00 25.96  ? 348  ILE A O     1 
ATOM   2745 C  CB    . ILE A 1 348 ? 31.827 80.607 23.300  1.00 28.04  ? 348  ILE A CB    1 
ATOM   2746 C  CG1   . ILE A 1 348 ? 31.209 79.581 22.340  1.00 34.73  ? 348  ILE A CG1   1 
ATOM   2747 C  CG2   . ILE A 1 348 ? 32.943 79.914 24.082  1.00 26.79  ? 348  ILE A CG2   1 
ATOM   2748 C  CD1   . ILE A 1 348 ? 30.333 78.518 23.038  1.00 31.11  ? 348  ILE A CD1   1 
ATOM   2749 N  N     . ALA A 1 349 ? 31.671 83.209 25.149  1.00 27.63  ? 349  ALA A N     1 
ATOM   2750 C  CA    . ALA A 1 349 ? 32.132 84.135 26.164  1.00 35.85  ? 349  ALA A CA    1 
ATOM   2751 C  C     . ALA A 1 349 ? 31.047 84.426 27.167  1.00 27.89  ? 349  ALA A C     1 
ATOM   2752 O  O     . ALA A 1 349 ? 31.200 84.207 28.405  1.00 25.10  ? 349  ALA A O     1 
ATOM   2753 C  CB    . ALA A 1 349 ? 32.462 85.440 25.461  1.00 33.60  ? 349  ALA A CB    1 
ATOM   2754 N  N     . GLY A 1 350 ? 29.919 84.894 26.576  1.00 22.62  ? 350  GLY A N     1 
ATOM   2755 C  CA    . GLY A 1 350 ? 28.735 85.228 27.366  1.00 27.68  ? 350  GLY A CA    1 
ATOM   2756 C  C     . GLY A 1 350 ? 28.386 84.129 28.380  1.00 43.23  ? 350  GLY A C     1 
ATOM   2757 O  O     . GLY A 1 350 ? 28.179 84.371 29.567  1.00 35.43  ? 350  GLY A O     1 
ATOM   2758 N  N     . ILE A 1 351 ? 28.325 82.889 27.880  1.00 31.37  ? 351  ILE A N     1 
ATOM   2759 C  CA    . ILE A 1 351 ? 28.017 81.765 28.739  1.00 20.51  ? 351  ILE A CA    1 
ATOM   2760 C  C     . ILE A 1 351 ? 29.013 81.700 29.873  1.00 23.13  ? 351  ILE A C     1 
ATOM   2761 O  O     . ILE A 1 351 ? 28.644 81.543 31.016  1.00 23.16  ? 351  ILE A O     1 
ATOM   2762 C  CB    . ILE A 1 351 ? 28.062 80.492 27.942  1.00 31.40  ? 351  ILE A CB    1 
ATOM   2763 C  CG1   . ILE A 1 351 ? 26.802 80.377 27.054  1.00 33.78  ? 351  ILE A CG1   1 
ATOM   2764 C  CG2   . ILE A 1 351 ? 28.147 79.346 28.929  1.00 25.67  ? 351  ILE A CG2   1 
ATOM   2765 C  CD1   . ILE A 1 351 ? 26.811 79.226 26.018  1.00 22.60  ? 351  ILE A CD1   1 
ATOM   2766 N  N     . LEU A 1 352 ? 30.298 81.866 29.555  1.00 30.54  ? 352  LEU A N     1 
ATOM   2767 C  CA    . LEU A 1 352 ? 31.283 81.825 30.617  1.00 24.24  ? 352  LEU A CA    1 
ATOM   2768 C  C     . LEU A 1 352 ? 30.967 82.925 31.611  1.00 28.94  ? 352  LEU A C     1 
ATOM   2769 O  O     . LEU A 1 352 ? 31.041 82.707 32.820  1.00 33.56  ? 352  LEU A O     1 
ATOM   2770 C  CB    . LEU A 1 352 ? 32.697 82.029 30.084  1.00 36.88  ? 352  LEU A CB    1 
ATOM   2771 C  CG    . LEU A 1 352 ? 33.168 80.745 29.405  1.00 27.66  ? 352  LEU A CG    1 
ATOM   2772 C  CD1   . LEU A 1 352 ? 34.469 80.885 28.629  1.00 28.40  ? 352  LEU A CD1   1 
ATOM   2773 C  CD2   . LEU A 1 352 ? 33.360 79.761 30.513  1.00 27.85  ? 352  LEU A CD2   1 
ATOM   2774 N  N     . HIS A 1 353 ? 30.575 84.090 31.079  1.00 36.74  ? 353  HIS A N     1 
ATOM   2775 C  CA    . HIS A 1 353 ? 30.163 85.246 31.902  1.00 45.31  ? 353  HIS A CA    1 
ATOM   2776 C  C     . HIS A 1 353 ? 28.985 84.901 32.811  1.00 64.18  ? 353  HIS A C     1 
ATOM   2777 O  O     . HIS A 1 353 ? 29.068 85.126 34.020  1.00 29.98  ? 353  HIS A O     1 
ATOM   2778 C  CB    . HIS A 1 353 ? 29.966 86.606 31.165  1.00 27.22  ? 353  HIS A CB    1 
ATOM   2779 C  CG    . HIS A 1 353 ? 31.303 87.080 30.597  1.00 33.61  ? 353  HIS A CG    1 
ATOM   2780 N  ND1   . HIS A 1 353 ? 32.479 87.033 31.366  1.00 45.44  ? 353  HIS A ND1   1 
ATOM   2781 C  CD2   . HIS A 1 353 ? 31.657 87.574 29.358  1.00 36.48  ? 353  HIS A CD2   1 
ATOM   2782 C  CE1   . HIS A 1 353 ? 33.486 87.487 30.606  1.00 76.55  ? 353  HIS A CE1   1 
ATOM   2783 N  NE2   . HIS A 1 353 ? 33.031 87.794 29.387  1.00 43.94  ? 353  HIS A NE2   1 
ATOM   2784 N  N     . LEU A 1 354 ? 27.920 84.314 32.241  1.00 26.68  ? 354  LEU A N     1 
ATOM   2785 C  CA    . LEU A 1 354 ? 26.752 83.924 33.021  1.00 31.76  ? 354  LEU A CA    1 
ATOM   2786 C  C     . LEU A 1 354 ? 27.139 83.048 34.212  1.00 25.78  ? 354  LEU A C     1 
ATOM   2787 O  O     . LEU A 1 354 ? 26.533 83.044 35.293  1.00 29.10  ? 354  LEU A O     1 
ATOM   2788 C  CB    . LEU A 1 354 ? 25.790 83.137 32.103  1.00 36.22  ? 354  LEU A CB    1 
ATOM   2789 C  CG    . LEU A 1 354 ? 25.112 83.980 31.026  1.00 27.79  ? 354  LEU A CG    1 
ATOM   2790 C  CD1   . LEU A 1 354 ? 23.938 83.206 30.325  1.00 19.65  ? 354  LEU A CD1   1 
ATOM   2791 C  CD2   . LEU A 1 354 ? 24.532 85.172 31.815  1.00 30.84  ? 354  LEU A CD2   1 
ATOM   2792 N  N     . GLY A 1 355 ? 28.142 82.223 33.986  1.00 27.61  ? 355  GLY A N     1 
ATOM   2793 C  CA    . GLY A 1 355 ? 28.568 81.314 35.034  1.00 28.94  ? 355  GLY A CA    1 
ATOM   2794 C  C     . GLY A 1 355 ? 29.242 82.035 36.212  1.00 39.43  ? 355  GLY A C     1 
ATOM   2795 O  O     . GLY A 1 355 ? 29.240 81.572 37.352  1.00 28.66  ? 355  GLY A O     1 
ATOM   2796 N  N     . ASN A 1 356 ? 29.795 83.204 35.937  1.00 30.64  ? 356  ASN A N     1 
ATOM   2797 C  CA    . ASN A 1 356 ? 30.486 83.930 36.965  1.00 30.25  ? 356  ASN A CA    1 
ATOM   2798 C  C     . ASN A 1 356 ? 29.639 84.816 37.831  1.00 35.99  ? 356  ASN A C     1 
ATOM   2799 O  O     . ASN A 1 356 ? 30.163 85.512 38.680  1.00 44.47  ? 356  ASN A O     1 
ATOM   2800 C  CB    . ASN A 1 356 ? 31.688 84.584 36.381  1.00 31.06  ? 356  ASN A CB    1 
ATOM   2801 C  CG    . ASN A 1 356 ? 32.920 83.640 36.337  1.00 38.83  ? 356  ASN A CG    1 
ATOM   2802 O  OD1   . ASN A 1 356 ? 32.944 82.491 36.864  1.00 47.51  ? 356  ASN A OD1   1 
ATOM   2803 N  ND2   . ASN A 1 356 ? 33.982 84.132 35.714  1.00 38.59  ? 356  ASN A ND2   1 
ATOM   2804 N  N     . ILE A 1 357 ? 28.346 84.783 37.597  1.00 36.62  ? 357  ILE A N     1 
ATOM   2805 C  CA    . ILE A 1 357 ? 27.352 85.532 38.362  1.00 35.03  ? 357  ILE A CA    1 
ATOM   2806 C  C     . ILE A 1 357 ? 27.179 84.910 39.731  1.00 46.29  ? 357  ILE A C     1 
ATOM   2807 O  O     . ILE A 1 357 ? 26.925 83.720 39.893  1.00 44.13  ? 357  ILE A O     1 
ATOM   2808 C  CB    . ILE A 1 357 ? 25.980 85.706 37.651  1.00 37.28  ? 357  ILE A CB    1 
ATOM   2809 C  CG1   . ILE A 1 357 ? 25.997 86.901 36.704  1.00 29.90  ? 357  ILE A CG1   1 
ATOM   2810 C  CG2   . ILE A 1 357 ? 24.834 85.946 38.597  1.00 30.94  ? 357  ILE A CG2   1 
ATOM   2811 C  CD1   . ILE A 1 357 ? 25.216 86.732 35.411  1.00 34.14  ? 357  ILE A CD1   1 
ATOM   2812 N  N     . LYS A 1 358 ? 27.322 85.753 40.736  1.00 91.82  ? 358  LYS A N     1 
ATOM   2813 C  CA    . LYS A 1 358 ? 27.208 85.309 42.102  1.00 34.59  ? 358  LYS A CA    1 
ATOM   2814 C  C     . LYS A 1 358 ? 26.022 85.923 42.828  1.00 36.29  ? 358  LYS A C     1 
ATOM   2815 O  O     . LYS A 1 358 ? 26.000 87.098 43.211  1.00 71.72  ? 358  LYS A O     1 
ATOM   2816 C  CB    . LYS A 1 358 ? 28.552 85.470 42.752  1.00 43.98  ? 358  LYS A CB    1 
ATOM   2817 C  CG    . LYS A 1 358 ? 28.473 85.849 44.202  1.00 64.71  ? 358  LYS A CG    1 
ATOM   2818 C  CD    . LYS A 1 358 ? 28.996 84.695 45.025  1.00 100.00 ? 358  LYS A CD    1 
ATOM   2819 C  CE    . LYS A 1 358 ? 28.271 83.396 44.714  1.00 100.00 ? 358  LYS A CE    1 
ATOM   2820 N  NZ    . LYS A 1 358 ? 28.852 82.616 43.600  1.00 100.00 ? 358  LYS A NZ    1 
ATOM   2821 N  N     . PHE A 1 359 ? 24.997 85.108 42.972  1.00 45.39  ? 359  PHE A N     1 
ATOM   2822 C  CA    . PHE A 1 359 ? 23.802 85.546 43.624  1.00 39.44  ? 359  PHE A CA    1 
ATOM   2823 C  C     . PHE A 1 359 ? 24.017 85.584 45.129  1.00 47.10  ? 359  PHE A C     1 
ATOM   2824 O  O     . PHE A 1 359 ? 24.577 84.650 45.709  1.00 49.87  ? 359  PHE A O     1 
ATOM   2825 C  CB    . PHE A 1 359 ? 22.563 84.677 43.253  1.00 50.25  ? 359  PHE A CB    1 
ATOM   2826 C  CG    . PHE A 1 359 ? 22.251 84.723 41.773  1.00 45.25  ? 359  PHE A CG    1 
ATOM   2827 C  CD1   . PHE A 1 359 ? 21.699 85.868 41.185  1.00 55.92  ? 359  PHE A CD1   1 
ATOM   2828 C  CD2   . PHE A 1 359 ? 22.545 83.636 40.939  1.00 63.68  ? 359  PHE A CD2   1 
ATOM   2829 C  CE1   . PHE A 1 359 ? 21.425 85.936 39.810  1.00 48.32  ? 359  PHE A CE1   1 
ATOM   2830 C  CE2   . PHE A 1 359 ? 22.327 83.698 39.553  1.00 37.85  ? 359  PHE A CE2   1 
ATOM   2831 C  CZ    . PHE A 1 359 ? 21.752 84.844 38.989  1.00 44.59  ? 359  PHE A CZ    1 
ATOM   2832 N  N     . GLU A 1 360 ? 23.526 86.663 45.750  1.00 51.85  ? 360  GLU A N     1 
ATOM   2833 C  CA    . GLU A 1 360 ? 23.616 86.787 47.178  1.00 100.00 ? 360  GLU A CA    1 
ATOM   2834 C  C     . GLU A 1 360 ? 22.224 86.919 47.797  1.00 100.00 ? 360  GLU A C     1 
ATOM   2835 O  O     . GLU A 1 360 ? 21.247 87.167 47.067  1.00 43.41  ? 360  GLU A O     1 
ATOM   2836 C  CB    . GLU A 1 360 ? 24.580 87.938 47.551  1.00 100.00 ? 360  GLU A CB    1 
ATOM   2837 C  CG    . GLU A 1 360 ? 25.925 87.927 46.768  1.00 57.00  ? 360  GLU A CG    1 
ATOM   2838 C  CD    . GLU A 1 360 ? 26.385 89.331 46.430  1.00 100.00 ? 360  GLU A CD    1 
ATOM   2839 O  OE1   . GLU A 1 360 ? 26.496 90.222 47.319  1.00 100.00 ? 360  GLU A OE1   1 
ATOM   2840 O  OE2   . GLU A 1 360 ? 26.662 89.457 45.110  1.00 100.00 ? 360  GLU A OE2   1 
ATOM   2841 N  N     . LYS A 1 361 ? 22.155 86.721 49.134  1.00 100.00 ? 361  LYS A N     1 
ATOM   2842 C  CA    . LYS A 1 361 ? 20.912 86.802 49.893  1.00 75.04  ? 361  LYS A CA    1 
ATOM   2843 C  C     . LYS A 1 361 ? 20.779 88.060 50.725  1.00 64.06  ? 361  LYS A C     1 
ATOM   2844 O  O     . LYS A 1 361 ? 20.658 89.168 50.169  1.00 70.63  ? 361  LYS A O     1 
ATOM   2845 C  CB    . LYS A 1 361 ? 20.692 85.615 50.822  1.00 47.36  ? 361  LYS A CB    1 
ATOM   2846 N  N     . GLY A 1 362 ? 20.843 87.809 52.063  1.00 100.00 ? 362  GLY A N     1 
ATOM   2847 C  CA    . GLY A 1 362 ? 20.708 88.784 53.152  1.00 100.00 ? 362  GLY A CA    1 
ATOM   2848 C  C     . GLY A 1 362 ? 19.299 89.387 53.200  1.00 100.00 ? 362  GLY A C     1 
ATOM   2849 O  O     . GLY A 1 362 ? 18.346 88.746 53.673  1.00 100.00 ? 362  GLY A O     1 
ATOM   2850 N  N     . ALA A 1 363 ? 19.215 90.611 52.641  1.00 100.00 ? 363  ALA A N     1 
ATOM   2851 C  CA    . ALA A 1 363 ? 18.029 91.456 52.497  1.00 100.00 ? 363  ALA A CA    1 
ATOM   2852 C  C     . ALA A 1 363 ? 16.754 90.831 53.043  1.00 100.00 ? 363  ALA A C     1 
ATOM   2853 O  O     . ALA A 1 363 ? 16.040 91.422 53.853  1.00 100.00 ? 363  ALA A O     1 
ATOM   2854 C  CB    . ALA A 1 363 ? 17.905 91.929 51.034  1.00 100.00 ? 363  ALA A CB    1 
ATOM   2855 N  N     . GLY A 1 364 ? 16.509 89.618 52.573  1.00 69.06  ? 364  GLY A N     1 
ATOM   2856 C  CA    . GLY A 1 364 ? 15.374 88.849 52.989  1.00 88.43  ? 364  GLY A CA    1 
ATOM   2857 C  C     . GLY A 1 364 ? 15.686 87.430 52.635  1.00 100.00 ? 364  GLY A C     1 
ATOM   2858 O  O     . GLY A 1 364 ? 16.560 86.811 53.243  1.00 100.00 ? 364  GLY A O     1 
ATOM   2859 N  N     . GLU A 1 365 ? 14.995 86.964 51.602  1.00 73.04  ? 365  GLU A N     1 
ATOM   2860 C  CA    . GLU A 1 365 ? 15.219 85.626 51.106  1.00 82.73  ? 365  GLU A CA    1 
ATOM   2861 C  C     . GLU A 1 365 ? 15.541 85.633 49.624  1.00 48.97  ? 365  GLU A C     1 
ATOM   2862 O  O     . GLU A 1 365 ? 16.264 84.763 49.144  1.00 100.00 ? 365  GLU A O     1 
ATOM   2863 C  CB    . GLU A 1 365 ? 14.128 84.669 51.454  1.00 55.79  ? 365  GLU A CB    1 
ATOM   2864 N  N     . GLY A 1 366 ? 15.021 86.657 48.932  1.00 54.53  ? 366  GLY A N     1 
ATOM   2865 C  CA    . GLY A 1 366 ? 15.210 86.872 47.508  1.00 44.64  ? 366  GLY A CA    1 
ATOM   2866 C  C     . GLY A 1 366 ? 16.640 87.287 47.219  1.00 83.44  ? 366  GLY A C     1 
ATOM   2867 O  O     . GLY A 1 366 ? 17.280 87.938 48.043  1.00 62.60  ? 366  GLY A O     1 
ATOM   2868 N  N     . ALA A 1 367 ? 17.122 86.908 46.039  1.00 44.42  ? 367  ALA A N     1 
ATOM   2869 C  CA    . ALA A 1 367 ? 18.485 87.191 45.631  1.00 34.93  ? 367  ALA A CA    1 
ATOM   2870 C  C     . ALA A 1 367 ? 18.718 88.573 45.064  1.00 63.18  ? 367  ALA A C     1 
ATOM   2871 O  O     . ALA A 1 367 ? 17.871 89.159 44.405  1.00 40.59  ? 367  ALA A O     1 
ATOM   2872 C  CB    . ALA A 1 367 ? 18.955 86.124 44.633  1.00 40.73  ? 367  ALA A CB    1 
ATOM   2873 N  N     . VAL A 1 368 ? 19.928 89.061 45.328  1.00 95.22  ? 368  VAL A N     1 
ATOM   2874 C  CA    . VAL A 1 368 ? 20.387 90.371 44.902  1.00 95.31  ? 368  VAL A CA    1 
ATOM   2875 C  C     . VAL A 1 368 ? 21.728 90.264 44.179  1.00 69.91  ? 368  VAL A C     1 
ATOM   2876 O  O     . VAL A 1 368 ? 22.460 89.303 44.388  1.00 41.63  ? 368  VAL A O     1 
ATOM   2877 C  CB    . VAL A 1 368 ? 20.482 91.234 46.179  1.00 59.98  ? 368  VAL A CB    1 
ATOM   2878 C  CG1   . VAL A 1 368 ? 19.084 91.639 46.641  1.00 100.00 ? 368  VAL A CG1   1 
ATOM   2879 C  CG2   . VAL A 1 368 ? 21.151 90.426 47.345  1.00 54.60  ? 368  VAL A CG2   1 
ATOM   2880 N  N     . LEU A 1 369 ? 22.038 91.243 43.339  1.00 64.70  ? 369  LEU A N     1 
ATOM   2881 C  CA    . LEU A 1 369 ? 23.286 91.231 42.616  1.00 44.11  ? 369  LEU A CA    1 
ATOM   2882 C  C     . LEU A 1 369 ? 24.157 92.424 43.007  1.00 61.17  ? 369  LEU A C     1 
ATOM   2883 O  O     . LEU A 1 369 ? 24.216 93.464 42.330  1.00 57.81  ? 369  LEU A O     1 
ATOM   2884 C  CB    . LEU A 1 369 ? 22.972 91.334 41.130  1.00 100.00 ? 369  LEU A CB    1 
ATOM   2885 C  CG    . LEU A 1 369 ? 23.723 90.331 40.291  1.00 37.16  ? 369  LEU A CG    1 
ATOM   2886 C  CD1   . LEU A 1 369 ? 23.684 88.946 40.867  1.00 33.63  ? 369  LEU A CD1   1 
ATOM   2887 C  CD2   . LEU A 1 369 ? 23.115 90.329 38.940  1.00 40.22  ? 369  LEU A CD2   1 
ATOM   2888 N  N     . LYS A 1 370 ? 24.857 92.257 44.112  1.00 50.99  ? 370  LYS A N     1 
ATOM   2889 C  CA    . LYS A 1 370 ? 25.717 93.306 44.636  1.00 77.13  ? 370  LYS A CA    1 
ATOM   2890 C  C     . LYS A 1 370 ? 26.689 93.799 43.584  1.00 48.13  ? 370  LYS A C     1 
ATOM   2891 O  O     . LYS A 1 370 ? 26.903 94.997 43.400  1.00 100.00 ? 370  LYS A O     1 
ATOM   2892 C  CB    . LYS A 1 370 ? 26.391 92.862 45.926  1.00 45.41  ? 370  LYS A CB    1 
ATOM   2893 C  CG    . LYS A 1 370 ? 25.492 93.117 47.142  1.00 81.19  ? 370  LYS A CG    1 
ATOM   2894 C  CD    . LYS A 1 370 ? 26.098 94.136 48.072  1.00 100.00 ? 370  LYS A CD    1 
ATOM   2895 C  CE    . LYS A 1 370 ? 25.921 95.583 47.637  1.00 100.00 ? 370  LYS A CE    1 
ATOM   2896 N  NZ    . LYS A 1 370 ? 26.350 96.509 48.660  1.00 100.00 ? 370  LYS A NZ    1 
ATOM   2897 N  N     . ASP A 1 371 ? 27.271 92.824 42.893  1.00 100.00 ? 371  ASP A N     1 
ATOM   2898 C  CA    . ASP A 1 371 ? 28.198 93.039 41.804  1.00 39.15  ? 371  ASP A CA    1 
ATOM   2899 C  C     . ASP A 1 371 ? 27.525 92.604 40.499  1.00 57.62  ? 371  ASP A C     1 
ATOM   2900 O  O     . ASP A 1 371 ? 26.797 91.609 40.443  1.00 77.31  ? 371  ASP A O     1 
ATOM   2901 C  CB    . ASP A 1 371 ? 29.538 92.330 42.051  1.00 100.00 ? 371  ASP A CB    1 
ATOM   2902 C  CG    . ASP A 1 371 ? 30.585 92.667 41.016  1.00 100.00 ? 371  ASP A CG    1 
ATOM   2903 O  OD1   . ASP A 1 371 ? 30.087 93.229 39.931  1.00 90.85  ? 371  ASP A OD1   1 
ATOM   2904 O  OD2   . ASP A 1 371 ? 31.774 92.433 41.168  1.00 90.11  ? 371  ASP A OD2   1 
ATOM   2905 N  N     . LYS A 1 372 ? 27.758 93.383 39.447  1.00 40.36  ? 372  LYS A N     1 
ATOM   2906 C  CA    . LYS A 1 372 ? 27.140 93.205 38.152  1.00 62.10  ? 372  LYS A CA    1 
ATOM   2907 C  C     . LYS A 1 372 ? 28.146 93.148 37.034  1.00 44.61  ? 372  LYS A C     1 
ATOM   2908 O  O     . LYS A 1 372 ? 27.778 93.241 35.858  1.00 40.11  ? 372  LYS A O     1 
ATOM   2909 C  CB    . LYS A 1 372 ? 26.382 94.467 37.839  1.00 34.05  ? 372  LYS A CB    1 
ATOM   2910 C  CG    . LYS A 1 372 ? 25.207 94.744 38.754  1.00 42.40  ? 372  LYS A CG    1 
ATOM   2911 C  CD    . LYS A 1 372 ? 25.228 96.190 39.284  1.00 100.00 ? 372  LYS A CD    1 
ATOM   2912 C  CE    . LYS A 1 372 ? 26.412 97.080 38.844  1.00 100.00 ? 372  LYS A CE    1 
ATOM   2913 N  NZ    . LYS A 1 372 ? 26.102 98.538 38.687  1.00 84.99  ? 372  LYS A NZ    1 
ATOM   2914 N  N     . THR A 1 373 ? 29.412 93.000 37.397  1.00 56.60  ? 373  THR A N     1 
ATOM   2915 C  CA    . THR A 1 373 ? 30.410 92.922 36.359  1.00 55.69  ? 373  THR A CA    1 
ATOM   2916 C  C     . THR A 1 373 ? 30.100 91.812 35.386  1.00 39.97  ? 373  THR A C     1 
ATOM   2917 O  O     . THR A 1 373 ? 30.021 92.054 34.191  1.00 43.22  ? 373  THR A O     1 
ATOM   2918 C  CB    . THR A 1 373 ? 31.828 92.680 36.856  1.00 100.00 ? 373  THR A CB    1 
ATOM   2919 O  OG1   . THR A 1 373 ? 32.070 93.453 38.016  1.00 63.40  ? 373  THR A OG1   1 
ATOM   2920 C  CG2   . THR A 1 373 ? 32.777 92.995 35.703  1.00 100.00 ? 373  THR A CG2   1 
ATOM   2921 N  N     . ALA A 1 374 ? 29.980 90.601 35.942  1.00 57.03  ? 374  ALA A N     1 
ATOM   2922 C  CA    . ALA A 1 374 ? 29.719 89.412 35.145  1.00 35.12  ? 374  ALA A CA    1 
ATOM   2923 C  C     . ALA A 1 374 ? 28.482 89.625 34.331  1.00 32.75  ? 374  ALA A C     1 
ATOM   2924 O  O     . ALA A 1 374 ? 28.467 89.430 33.101  1.00 42.06  ? 374  ALA A O     1 
ATOM   2925 C  CB    . ALA A 1 374 ? 29.591 88.226 36.049  1.00 34.15  ? 374  ALA A CB    1 
ATOM   2926 N  N     . LEU A 1 375 ? 27.467 90.094 35.036  1.00 40.99  ? 375  LEU A N     1 
ATOM   2927 C  CA    . LEU A 1 375 ? 26.237 90.408 34.358  1.00 43.82  ? 375  LEU A CA    1 
ATOM   2928 C  C     . LEU A 1 375 ? 26.479 91.338 33.173  1.00 40.68  ? 375  LEU A C     1 
ATOM   2929 O  O     . LEU A 1 375 ? 26.115 91.064 32.031  1.00 35.40  ? 375  LEU A O     1 
ATOM   2930 C  CB    . LEU A 1 375 ? 25.202 90.965 35.366  1.00 44.36  ? 375  LEU A CB    1 
ATOM   2931 C  CG    . LEU A 1 375 ? 23.958 91.526 34.681  1.00 53.08  ? 375  LEU A CG    1 
ATOM   2932 C  CD1   . LEU A 1 375 ? 22.750 90.589 34.781  1.00 44.61  ? 375  LEU A CD1   1 
ATOM   2933 C  CD2   . LEU A 1 375 ? 23.602 92.838 35.377  1.00 100.00 ? 375  LEU A CD2   1 
ATOM   2934 N  N     . ASN A 1 376 ? 27.154 92.435 33.446  1.00 48.73  ? 376  ASN A N     1 
ATOM   2935 C  CA    . ASN A 1 376 ? 27.424 93.409 32.421  1.00 40.31  ? 376  ASN A CA    1 
ATOM   2936 C  C     . ASN A 1 376 ? 28.101 92.808 31.227  1.00 24.73  ? 376  ASN A C     1 
ATOM   2937 O  O     . ASN A 1 376 ? 27.712 93.112 30.092  1.00 37.68  ? 376  ASN A O     1 
ATOM   2938 C  CB    . ASN A 1 376 ? 28.155 94.607 33.045  1.00 100.00 ? 376  ASN A CB    1 
ATOM   2939 C  CG    . ASN A 1 376 ? 27.253 95.252 34.097  1.00 100.00 ? 376  ASN A CG    1 
ATOM   2940 O  OD1   . ASN A 1 376 ? 26.060 95.460 33.841  1.00 45.66  ? 376  ASN A OD1   1 
ATOM   2941 N  ND2   . ASN A 1 376 ? 27.769 95.512 35.299  1.00 62.68  ? 376  ASN A ND2   1 
ATOM   2942 N  N     . ALA A 1 377 ? 29.077 91.948 31.543  1.00 30.29  ? 377  ALA A N     1 
ATOM   2943 C  CA    . ALA A 1 377 ? 29.930 91.234 30.588  1.00 32.08  ? 377  ALA A CA    1 
ATOM   2944 C  C     . ALA A 1 377 ? 29.119 90.307 29.718  1.00 45.90  ? 377  ALA A C     1 
ATOM   2945 O  O     . ALA A 1 377 ? 29.225 90.334 28.486  1.00 32.28  ? 377  ALA A O     1 
ATOM   2946 C  CB    . ALA A 1 377 ? 31.009 90.432 31.312  1.00 29.76  ? 377  ALA A CB    1 
ATOM   2947 N  N     . ALA A 1 378 ? 28.281 89.507 30.353  1.00 38.98  ? 378  ALA A N     1 
ATOM   2948 C  CA    . ALA A 1 378 ? 27.453 88.653 29.532  1.00 43.21  ? 378  ALA A CA    1 
ATOM   2949 C  C     . ALA A 1 378 ? 26.523 89.504 28.691  1.00 27.43  ? 378  ALA A C     1 
ATOM   2950 O  O     . ALA A 1 378 ? 26.335 89.287 27.499  1.00 34.77  ? 378  ALA A O     1 
ATOM   2951 C  CB    . ALA A 1 378 ? 26.612 87.716 30.371  1.00 28.00  ? 378  ALA A CB    1 
ATOM   2952 N  N     . SER A 1 379 ? 25.883 90.484 29.320  1.00 45.80  ? 379  SER A N     1 
ATOM   2953 C  CA    . SER A 1 379 ? 24.933 91.303 28.583  1.00 38.27  ? 379  SER A CA    1 
ATOM   2954 C  C     . SER A 1 379 ? 25.523 91.927 27.333  1.00 60.71  ? 379  SER A C     1 
ATOM   2955 O  O     . SER A 1 379 ? 24.938 91.893 26.224  1.00 39.99  ? 379  SER A O     1 
ATOM   2956 C  CB    . SER A 1 379 ? 24.105 92.206 29.461  1.00 35.14  ? 379  SER A CB    1 
ATOM   2957 O  OG    . SER A 1 379 ? 24.354 91.880 30.821  1.00 43.89  ? 379  SER A OG    1 
ATOM   2958 N  N     . THR A 1 380 ? 26.720 92.464 27.516  1.00 53.00  ? 380  THR A N     1 
ATOM   2959 C  CA    . THR A 1 380 ? 27.409 93.067 26.388  1.00 48.27  ? 380  THR A CA    1 
ATOM   2960 C  C     . THR A 1 380 ? 27.618 92.124 25.211  1.00 38.03  ? 380  THR A C     1 
ATOM   2961 O  O     . THR A 1 380 ? 27.159 92.357 24.107  1.00 50.62  ? 380  THR A O     1 
ATOM   2962 C  CB    . THR A 1 380 ? 28.579 94.067 26.675  1.00 100.00 ? 380  THR A CB    1 
ATOM   2963 O  OG1   . THR A 1 380 ? 29.813 93.744 25.965  1.00 50.54  ? 380  THR A OG1   1 
ATOM   2964 C  CG2   . THR A 1 380 ? 28.722 94.525 28.145  1.00 50.16  ? 380  THR A CG2   1 
ATOM   2965 N  N     . VAL A 1 381 ? 28.330 91.031 25.486  1.00 78.55  ? 381  VAL A N     1 
ATOM   2966 C  CA    . VAL A 1 381 ? 28.658 90.025 24.491  1.00 59.44  ? 381  VAL A CA    1 
ATOM   2967 C  C     . VAL A 1 381 ? 27.432 89.464 23.809  1.00 100.00 ? 381  VAL A C     1 
ATOM   2968 O  O     . VAL A 1 381 ? 27.449 89.183 22.616  1.00 44.44  ? 381  VAL A O     1 
ATOM   2969 C  CB    . VAL A 1 381 ? 29.611 88.909 24.960  1.00 45.61  ? 381  VAL A CB    1 
ATOM   2970 C  CG1   . VAL A 1 381 ? 30.977 89.505 25.264  1.00 34.22  ? 381  VAL A CG1   1 
ATOM   2971 C  CG2   . VAL A 1 381 ? 29.106 88.203 26.217  1.00 31.35  ? 381  VAL A CG2   1 
ATOM   2972 N  N     . PHE A 1 382 ? 26.358 89.336 24.590  1.00 32.78  ? 382  PHE A N     1 
ATOM   2973 C  CA    . PHE A 1 382 ? 25.104 88.793 24.122  1.00 31.82  ? 382  PHE A CA    1 
ATOM   2974 C  C     . PHE A 1 382 ? 24.304 89.813 23.385  1.00 41.73  ? 382  PHE A C     1 
ATOM   2975 O  O     . PHE A 1 382 ? 23.511 89.457 22.509  1.00 36.89  ? 382  PHE A O     1 
ATOM   2976 C  CB    . PHE A 1 382 ? 24.205 88.277 25.262  1.00 50.67  ? 382  PHE A CB    1 
ATOM   2977 C  CG    . PHE A 1 382 ? 24.655 86.954 25.812  1.00 48.10  ? 382  PHE A CG    1 
ATOM   2978 C  CD1   . PHE A 1 382 ? 24.963 85.874 24.982  1.00 24.50  ? 382  PHE A CD1   1 
ATOM   2979 C  CD2   . PHE A 1 382 ? 24.858 86.804 27.179  1.00 44.77  ? 382  PHE A CD2   1 
ATOM   2980 C  CE1   . PHE A 1 382 ? 25.373 84.644 25.476  1.00 26.23  ? 382  PHE A CE1   1 
ATOM   2981 C  CE2   . PHE A 1 382 ? 25.334 85.592 27.682  1.00 32.15  ? 382  PHE A CE2   1 
ATOM   2982 C  CZ    . PHE A 1 382 ? 25.593 84.511 26.846  1.00 24.50  ? 382  PHE A CZ    1 
ATOM   2983 N  N     . GLY A 1 383 ? 24.470 91.078 23.792  1.00 38.83  ? 383  GLY A N     1 
ATOM   2984 C  CA    . GLY A 1 383 ? 23.720 92.129 23.122  1.00 100.00 ? 383  GLY A CA    1 
ATOM   2985 C  C     . GLY A 1 383 ? 22.286 92.219 23.620  1.00 28.26  ? 383  GLY A C     1 
ATOM   2986 O  O     . GLY A 1 383 ? 21.361 92.572 22.858  1.00 78.19  ? 383  GLY A O     1 
ATOM   2987 N  N     . VAL A 1 384 ? 22.123 91.974 24.910  1.00 31.11  ? 384  VAL A N     1 
ATOM   2988 C  CA    . VAL A 1 384 ? 20.844 92.063 25.598  1.00 66.29  ? 384  VAL A CA    1 
ATOM   2989 C  C     . VAL A 1 384 ? 20.950 93.157 26.666  1.00 59.45  ? 384  VAL A C     1 
ATOM   2990 O  O     . VAL A 1 384 ? 22.044 93.617 26.996  1.00 66.88  ? 384  VAL A O     1 
ATOM   2991 C  CB    . VAL A 1 384 ? 20.427 90.708 26.212  1.00 29.23  ? 384  VAL A CB    1 
ATOM   2992 C  CG1   . VAL A 1 384 ? 20.186 89.683 25.099  1.00 27.79  ? 384  VAL A CG1   1 
ATOM   2993 C  CG2   . VAL A 1 384 ? 21.560 90.192 27.137  1.00 30.35  ? 384  VAL A CG2   1 
ATOM   2994 N  N     . ASN A 1 385 ? 19.830 93.557 27.245  1.00 49.33  ? 385  ASN A N     1 
ATOM   2995 C  CA    . ASN A 1 385 ? 19.845 94.591 28.263  1.00 39.32  ? 385  ASN A CA    1 
ATOM   2996 C  C     . ASN A 1 385 ? 20.005 94.052 29.690  1.00 34.26  ? 385  ASN A C     1 
ATOM   2997 O  O     . ASN A 1 385 ? 19.169 93.370 30.253  1.00 45.26  ? 385  ASN A O     1 
ATOM   2998 C  CB    . ASN A 1 385 ? 18.678 95.547 27.949  1.00 56.59  ? 385  ASN A CB    1 
ATOM   2999 C  CG    . ASN A 1 385 ? 18.451 96.651 28.914  1.00 42.57  ? 385  ASN A CG    1 
ATOM   3000 O  OD1   . ASN A 1 385 ? 19.311 96.949 29.737  1.00 70.67  ? 385  ASN A OD1   1 
ATOM   3001 N  ND2   . ASN A 1 385 ? 17.256 97.212 28.814  1.00 69.08  ? 385  ASN A ND2   1 
ATOM   3002 N  N     . PRO A 1 386 ? 21.128 94.387 30.271  1.00 51.30  ? 386  PRO A N     1 
ATOM   3003 C  CA    . PRO A 1 386 ? 21.484 93.960 31.600  1.00 32.17  ? 386  PRO A CA    1 
ATOM   3004 C  C     . PRO A 1 386 ? 20.389 94.060 32.625  1.00 49.27  ? 386  PRO A C     1 
ATOM   3005 O  O     . PRO A 1 386 ? 20.231 93.158 33.459  1.00 51.63  ? 386  PRO A O     1 
ATOM   3006 C  CB    . PRO A 1 386 ? 22.572 94.931 32.067  1.00 55.84  ? 386  PRO A CB    1 
ATOM   3007 C  CG    . PRO A 1 386 ? 23.101 95.644 30.826  1.00 55.10  ? 386  PRO A CG    1 
ATOM   3008 C  CD    . PRO A 1 386 ? 22.084 95.393 29.719  1.00 46.76  ? 386  PRO A CD    1 
ATOM   3009 N  N     . SER A 1 387 ? 19.690 95.185 32.651  1.00 48.58  ? 387  SER A N     1 
ATOM   3010 C  CA    . SER A 1 387 ? 18.676 95.319 33.687  1.00 43.51  ? 387  SER A CA    1 
ATOM   3011 C  C     . SER A 1 387 ? 17.556 94.323 33.483  1.00 30.37  ? 387  SER A C     1 
ATOM   3012 O  O     . SER A 1 387 ? 16.985 93.748 34.434  1.00 39.68  ? 387  SER A O     1 
ATOM   3013 C  CB    . SER A 1 387 ? 18.180 96.724 33.973  1.00 94.66  ? 387  SER A CB    1 
ATOM   3014 O  OG    . SER A 1 387 ? 18.539 97.588 32.925  1.00 100.00 ? 387  SER A OG    1 
ATOM   3015 N  N     . VAL A 1 388 ? 17.270 94.116 32.212  1.00 38.56  ? 388  VAL A N     1 
ATOM   3016 C  CA    . VAL A 1 388 ? 16.231 93.214 31.811  1.00 55.34  ? 388  VAL A CA    1 
ATOM   3017 C  C     . VAL A 1 388 ? 16.651 91.801 32.127  1.00 37.20  ? 388  VAL A C     1 
ATOM   3018 O  O     . VAL A 1 388 ? 15.902 90.972 32.648  1.00 38.03  ? 388  VAL A O     1 
ATOM   3019 C  CB    . VAL A 1 388 ? 16.125 93.455 30.321  1.00 51.08  ? 388  VAL A CB    1 
ATOM   3020 C  CG1   . VAL A 1 388 ? 14.792 93.000 29.735  1.00 80.22  ? 388  VAL A CG1   1 
ATOM   3021 C  CG2   . VAL A 1 388 ? 16.379 94.952 30.097  1.00 53.39  ? 388  VAL A CG2   1 
ATOM   3022 N  N     . LEU A 1 389 ? 17.897 91.555 31.823  1.00 36.76  ? 389  LEU A N     1 
ATOM   3023 C  CA    . LEU A 1 389 ? 18.426 90.251 32.083  1.00 61.38  ? 389  LEU A CA    1 
ATOM   3024 C  C     . LEU A 1 389 ? 18.301 89.982 33.576  1.00 48.48  ? 389  LEU A C     1 
ATOM   3025 O  O     . LEU A 1 389 ? 17.759 88.978 34.052  1.00 41.67  ? 389  LEU A O     1 
ATOM   3026 C  CB    . LEU A 1 389 ? 19.908 90.278 31.565  1.00 36.56  ? 389  LEU A CB    1 
ATOM   3027 C  CG    . LEU A 1 389 ? 20.532 88.898 31.783  1.00 81.46  ? 389  LEU A CG    1 
ATOM   3028 C  CD1   . LEU A 1 389 ? 19.764 87.723 31.108  1.00 40.04  ? 389  LEU A CD1   1 
ATOM   3029 C  CD2   . LEU A 1 389 ? 21.967 88.919 31.299  1.00 36.49  ? 389  LEU A CD2   1 
ATOM   3030 N  N     . GLU A 1 390 ? 18.811 90.960 34.298  1.00 43.72  ? 390  GLU A N     1 
ATOM   3031 C  CA    . GLU A 1 390 ? 18.862 90.938 35.730  1.00 31.35  ? 390  GLU A CA    1 
ATOM   3032 C  C     . GLU A 1 390 ? 17.544 90.575 36.363  1.00 37.65  ? 390  GLU A C     1 
ATOM   3033 O  O     . GLU A 1 390 ? 17.474 89.706 37.244  1.00 39.39  ? 390  GLU A O     1 
ATOM   3034 C  CB    . GLU A 1 390 ? 19.390 92.314 36.179  1.00 42.85  ? 390  GLU A CB    1 
ATOM   3035 C  CG    . GLU A 1 390 ? 19.658 92.365 37.697  1.00 41.23  ? 390  GLU A CG    1 
ATOM   3036 C  CD    . GLU A 1 390 ? 20.476 93.559 38.097  1.00 100.00 ? 390  GLU A CD    1 
ATOM   3037 O  OE1   . GLU A 1 390 ? 20.429 94.520 37.184  1.00 100.00 ? 390  GLU A OE1   1 
ATOM   3038 O  OE2   . GLU A 1 390 ? 21.107 93.598 39.147  1.00 100.00 ? 390  GLU A OE2   1 
ATOM   3039 N  N     . LYS A 1 391 ? 16.502 91.267 35.925  1.00 38.77  ? 391  LYS A N     1 
ATOM   3040 C  CA    . LYS A 1 391 ? 15.201 91.016 36.491  1.00 50.22  ? 391  LYS A CA    1 
ATOM   3041 C  C     . LYS A 1 391 ? 14.643 89.680 36.049  1.00 41.01  ? 391  LYS A C     1 
ATOM   3042 O  O     . LYS A 1 391 ? 13.975 89.002 36.843  1.00 46.69  ? 391  LYS A O     1 
ATOM   3043 C  CB    . LYS A 1 391 ? 14.216 92.082 36.102  1.00 55.81  ? 391  LYS A CB    1 
ATOM   3044 C  CG    . LYS A 1 391 ? 14.590 93.439 36.627  1.00 44.52  ? 391  LYS A CG    1 
ATOM   3045 C  CD    . LYS A 1 391 ? 13.405 94.370 36.776  1.00 100.00 ? 391  LYS A CD    1 
ATOM   3046 C  CE    . LYS A 1 391 ? 13.654 95.377 37.893  1.00 100.00 ? 391  LYS A CE    1 
ATOM   3047 N  NZ    . LYS A 1 391 ? 14.411 94.806 38.975  1.00 100.00 ? 391  LYS A NZ    1 
ATOM   3048 N  N     . ALA A 1 392 ? 14.911 89.354 34.769  1.00 37.11  ? 392  ALA A N     1 
ATOM   3049 C  CA    . ALA A 1 392 ? 14.475 88.105 34.149  1.00 26.44  ? 392  ALA A CA    1 
ATOM   3050 C  C     . ALA A 1 392 ? 15.048 86.929 34.913  1.00 33.14  ? 392  ALA A C     1 
ATOM   3051 O  O     . ALA A 1 392 ? 14.447 85.870 34.976  1.00 31.35  ? 392  ALA A O     1 
ATOM   3052 C  CB    . ALA A 1 392 ? 14.899 88.034 32.727  1.00 25.18  ? 392  ALA A CB    1 
ATOM   3053 N  N     . LEU A 1 393 ? 16.213 87.143 35.543  1.00 33.27  ? 393  LEU A N     1 
ATOM   3054 C  CA    . LEU A 1 393 ? 16.869 86.125 36.342  1.00 32.85  ? 393  LEU A CA    1 
ATOM   3055 C  C     . LEU A 1 393 ? 16.351 86.024 37.751  1.00 40.31  ? 393  LEU A C     1 
ATOM   3056 O  O     . LEU A 1 393 ? 16.103 84.909 38.248  1.00 31.13  ? 393  LEU A O     1 
ATOM   3057 C  CB    . LEU A 1 393 ? 18.369 86.313 36.514  1.00 23.51  ? 393  LEU A CB    1 
ATOM   3058 C  CG    . LEU A 1 393 ? 19.101 86.170 35.199  1.00 32.56  ? 393  LEU A CG    1 
ATOM   3059 C  CD1   . LEU A 1 393 ? 20.432 86.844 35.391  1.00 33.03  ? 393  LEU A CD1   1 
ATOM   3060 C  CD2   . LEU A 1 393 ? 19.284 84.694 34.726  1.00 24.56  ? 393  LEU A CD2   1 
ATOM   3061 N  N     . MET A 1 394 ? 16.244 87.167 38.438  1.00 32.66  ? 394  MET A N     1 
ATOM   3062 C  CA    . MET A 1 394 ? 15.774 87.042 39.807  1.00 35.38  ? 394  MET A CA    1 
ATOM   3063 C  C     . MET A 1 394 ? 14.319 87.361 40.032  1.00 26.65  ? 394  MET A C     1 
ATOM   3064 O  O     . MET A 1 394 ? 13.723 86.908 40.986  1.00 44.10  ? 394  MET A O     1 
ATOM   3065 C  CB    . MET A 1 394 ? 16.682 87.531 40.902  1.00 34.19  ? 394  MET A CB    1 
ATOM   3066 C  CG    . MET A 1 394 ? 18.155 87.338 40.567  1.00 39.71  ? 394  MET A CG    1 
ATOM   3067 S  SD    . MET A 1 394 ? 19.239 88.466 41.490  1.00 43.58  ? 394  MET A SD    1 
ATOM   3068 C  CE    . MET A 1 394 ? 19.276 89.698 40.202  1.00 32.26  ? 394  MET A CE    1 
ATOM   3069 N  N     . GLU A 1 395 ? 13.743 88.107 39.124  1.00 32.01  ? 395  GLU A N     1 
ATOM   3070 C  CA    . GLU A 1 395 ? 12.374 88.508 39.297  1.00 36.75  ? 395  GLU A CA    1 
ATOM   3071 C  C     . GLU A 1 395 ? 11.529 88.244 38.091  1.00 59.11  ? 395  GLU A C     1 
ATOM   3072 O  O     . GLU A 1 395 ? 10.919 89.160 37.536  1.00 34.79  ? 395  GLU A O     1 
ATOM   3073 C  CB    . GLU A 1 395 ? 12.455 90.005 39.534  1.00 36.59  ? 395  GLU A CB    1 
ATOM   3074 C  CG    . GLU A 1 395 ? 12.791 90.260 40.994  1.00 54.36  ? 395  GLU A CG    1 
ATOM   3075 C  CD    . GLU A 1 395 ? 12.108 91.533 41.469  1.00 100.00 ? 395  GLU A CD    1 
ATOM   3076 O  OE1   . GLU A 1 395 ? 12.648 92.645 41.376  1.00 54.69  ? 395  GLU A OE1   1 
ATOM   3077 O  OE2   . GLU A 1 395 ? 10.897 91.342 41.970  1.00 100.00 ? 395  GLU A OE2   1 
ATOM   3078 N  N     . PRO A 1 396 ? 11.521 86.974 37.693  1.00 51.40  ? 396  PRO A N     1 
ATOM   3079 C  CA    . PRO A 1 396 ? 10.750 86.565 36.550  1.00 36.92  ? 396  PRO A CA    1 
ATOM   3080 C  C     . PRO A 1 396 ? 9.266  86.736 36.829  1.00 33.16  ? 396  PRO A C     1 
ATOM   3081 O  O     . PRO A 1 396 ? 8.803  86.415 37.913  1.00 39.36  ? 396  PRO A O     1 
ATOM   3082 C  CB    . PRO A 1 396 ? 10.963 85.011 36.423  1.00 28.28  ? 396  PRO A CB    1 
ATOM   3083 C  CG    . PRO A 1 396 ? 11.211 84.529 37.843  1.00 26.08  ? 396  PRO A CG    1 
ATOM   3084 C  CD    . PRO A 1 396 ? 12.008 85.737 38.402  1.00 34.58  ? 396  PRO A CD    1 
ATOM   3085 N  N     . ARG A 1 397 ? 8.522  87.196 35.822  1.00 38.93  ? 397  ARG A N     1 
ATOM   3086 C  CA    . ARG A 1 397 ? 7.081  87.319 35.917  1.00 33.03  ? 397  ARG A CA    1 
ATOM   3087 C  C     . ARG A 1 397 ? 6.369  85.970 35.742  1.00 42.38  ? 397  ARG A C     1 
ATOM   3088 O  O     . ARG A 1 397 ? 6.458  85.286 34.722  1.00 40.91  ? 397  ARG A O     1 
ATOM   3089 C  CB    . ARG A 1 397 ? 6.646  88.321 34.891  1.00 27.94  ? 397  ARG A CB    1 
ATOM   3090 C  CG    . ARG A 1 397 ? 6.444  89.603 35.604  1.00 34.97  ? 397  ARG A CG    1 
ATOM   3091 C  CD    . ARG A 1 397 ? 6.097  90.545 34.500  1.00 40.15  ? 397  ARG A CD    1 
ATOM   3092 N  NE    . ARG A 1 397 ? 6.766  90.146 33.285  1.00 38.27  ? 397  ARG A NE    1 
ATOM   3093 C  CZ    . ARG A 1 397 ? 6.402  90.628 32.068  1.00 100.00 ? 397  ARG A CZ    1 
ATOM   3094 N  NH1   . ARG A 1 397 ? 5.416  91.540 31.922  1.00 100.00 ? 397  ARG A NH1   1 
ATOM   3095 N  NH2   . ARG A 1 397 ? 7.034  90.166 30.944  1.00 55.18  ? 397  ARG A NH2   1 
ATOM   3096 N  N     . ILE A 1 398 ? 5.611  85.552 36.735  1.00 35.46  ? 398  ILE A N     1 
ATOM   3097 C  CA    . ILE A 1 398 ? 4.967  84.271 36.595  1.00 28.60  ? 398  ILE A CA    1 
ATOM   3098 C  C     . ILE A 1 398 ? 3.462  84.345 36.679  1.00 68.41  ? 398  ILE A C     1 
ATOM   3099 O  O     . ILE A 1 398 ? 2.885  85.001 37.562  1.00 45.52  ? 398  ILE A O     1 
ATOM   3100 C  CB    . ILE A 1 398 ? 5.478  83.289 37.638  1.00 35.94  ? 398  ILE A CB    1 
ATOM   3101 C  CG1   . ILE A 1 398 ? 6.883  82.827 37.290  1.00 36.84  ? 398  ILE A CG1   1 
ATOM   3102 C  CG2   . ILE A 1 398 ? 4.551  82.109 37.791  1.00 47.25  ? 398  ILE A CG2   1 
ATOM   3103 C  CD1   . ILE A 1 398 ? 7.867  83.362 38.315  1.00 51.21  ? 398  ILE A CD1   1 
ATOM   3104 N  N     . LEU A 1 399 ? 2.860  83.590 35.764  1.00 38.41  ? 399  LEU A N     1 
ATOM   3105 C  CA    . LEU A 1 399 ? 1.424  83.460 35.590  1.00 51.73  ? 399  LEU A CA    1 
ATOM   3106 C  C     . LEU A 1 399 ? 0.679  82.653 36.645  1.00 51.82  ? 399  LEU A C     1 
ATOM   3107 O  O     . LEU A 1 399 ? 0.725  81.430 36.638  1.00 100.00 ? 399  LEU A O     1 
ATOM   3108 C  CB    . LEU A 1 399 ? 1.210  82.763 34.255  1.00 45.38  ? 399  LEU A CB    1 
ATOM   3109 C  CG    . LEU A 1 399 ? -0.257 82.687 33.882  1.00 57.66  ? 399  LEU A CG    1 
ATOM   3110 C  CD1   . LEU A 1 399 ? -1.056 83.693 34.686  1.00 47.00  ? 399  LEU A CD1   1 
ATOM   3111 C  CD2   . LEU A 1 399 ? -0.364 83.077 32.417  1.00 100.00 ? 399  LEU A CD2   1 
ATOM   3112 N  N     . ALA A 1 400 ? -0.058 83.338 37.512  1.00 100.00 ? 400  ALA A N     1 
ATOM   3113 C  CA    . ALA A 1 400 ? -0.847 82.664 38.535  1.00 100.00 ? 400  ALA A CA    1 
ATOM   3114 C  C     . ALA A 1 400 ? -2.305 82.564 38.127  1.00 60.55  ? 400  ALA A C     1 
ATOM   3115 O  O     . ALA A 1 400 ? -3.206 82.776 38.935  1.00 100.00 ? 400  ALA A O     1 
ATOM   3116 C  CB    . ALA A 1 400 ? -0.771 83.347 39.900  1.00 86.82  ? 400  ALA A CB    1 
ATOM   3117 N  N     . GLY A 1 401 ? -2.543 82.267 36.862  1.00 100.00 ? 401  GLY A N     1 
ATOM   3118 C  CA    . GLY A 1 401 ? -3.902 82.155 36.391  1.00 37.29  ? 401  GLY A CA    1 
ATOM   3119 C  C     . GLY A 1 401 ? -4.281 83.259 35.440  1.00 84.46  ? 401  GLY A C     1 
ATOM   3120 O  O     . GLY A 1 401 ? -4.227 83.141 34.198  1.00 50.89  ? 401  GLY A O     1 
ATOM   3121 N  N     . ARG A 1 402 ? -4.709 84.341 36.071  1.00 58.05  ? 402  ARG A N     1 
ATOM   3122 C  CA    . ARG A 1 402 ? -5.072 85.525 35.337  1.00 93.56  ? 402  ARG A CA    1 
ATOM   3123 C  C     . ARG A 1 402 ? -3.955 86.519 35.589  1.00 34.43  ? 402  ARG A C     1 
ATOM   3124 O  O     . ARG A 1 402 ? -3.529 87.268 34.730  1.00 50.06  ? 402  ARG A O     1 
ATOM   3125 C  CB    . ARG A 1 402 ? -6.510 85.974 35.643  1.00 100.00 ? 402  ARG A CB    1 
ATOM   3126 C  CG    . ARG A 1 402 ? -7.564 85.418 34.665  1.00 92.76  ? 402  ARG A CG    1 
ATOM   3127 C  CD    . ARG A 1 402 ? -8.991 86.049 34.682  1.00 100.00 ? 402  ARG A CD    1 
ATOM   3128 N  NE    . ARG A 1 402 ? -9.505 86.600 35.952  1.00 41.52  ? 402  ARG A NE    1 
ATOM   3129 C  CZ    . ARG A 1 402 ? -9.500 87.912 36.164  1.00 70.31  ? 402  ARG A CZ    1 
ATOM   3130 N  NH1   . ARG A 1 402 ? -9.019 88.742 35.225  1.00 100.00 ? 402  ARG A NH1   1 
ATOM   3131 N  NH2   . ARG A 1 402 ? -9.995 88.398 37.315  1.00 61.14  ? 402  ARG A NH2   1 
ATOM   3132 N  N     . ASP A 1 403 ? -3.422 86.364 36.787  1.00 38.01  ? 403  ASP A N     1 
ATOM   3133 C  CA    . ASP A 1 403 ? -2.311 87.128 37.302  1.00 44.24  ? 403  ASP A CA    1 
ATOM   3134 C  C     . ASP A 1 403 ? -0.964 86.754 36.702  1.00 47.36  ? 403  ASP A C     1 
ATOM   3135 O  O     . ASP A 1 403 ? -0.532 85.619 36.646  1.00 54.48  ? 403  ASP A O     1 
ATOM   3136 C  CB    . ASP A 1 403 ? -2.147 86.950 38.844  1.00 100.00 ? 403  ASP A CB    1 
ATOM   3137 C  CG    . ASP A 1 403 ? -3.133 87.689 39.727  1.00 92.51  ? 403  ASP A CG    1 
ATOM   3138 O  OD1   . ASP A 1 403 ? -4.361 87.246 39.622  1.00 100.00 ? 403  ASP A OD1   1 
ATOM   3139 O  OD2   . ASP A 1 403 ? -2.814 88.577 40.501  1.00 70.93  ? 403  ASP A OD2   1 
ATOM   3140 N  N     . LEU A 1 404 ? -0.244 87.753 36.294  1.00 39.59  ? 404  LEU A N     1 
ATOM   3141 C  CA    . LEU A 1 404 ? 1.072  87.587 35.801  1.00 40.78  ? 404  LEU A CA    1 
ATOM   3142 C  C     . LEU A 1 404 ? 1.871  88.467 36.717  1.00 48.32  ? 404  LEU A C     1 
ATOM   3143 O  O     . LEU A 1 404 ? 1.818  89.670 36.593  1.00 45.07  ? 404  LEU A O     1 
ATOM   3144 C  CB    . LEU A 1 404 ? 1.155  87.958 34.292  1.00 38.22  ? 404  LEU A CB    1 
ATOM   3145 C  CG    . LEU A 1 404 ? 2.539  87.749 33.651  1.00 37.00  ? 404  LEU A CG    1 
ATOM   3146 C  CD1   . LEU A 1 404 ? 3.439  88.859 34.135  1.00 59.34  ? 404  LEU A CD1   1 
ATOM   3147 C  CD2   . LEU A 1 404 ? 3.187  86.408 34.098  1.00 31.45  ? 404  LEU A CD2   1 
ATOM   3148 N  N     . VAL A 1 405 ? 2.507  87.870 37.699  1.00 43.36  ? 405  VAL A N     1 
ATOM   3149 C  CA    . VAL A 1 405 ? 3.254  88.630 38.674  1.00 46.06  ? 405  VAL A CA    1 
ATOM   3150 C  C     . VAL A 1 405 ? 4.722  88.219 38.757  1.00 100.00 ? 405  VAL A C     1 
ATOM   3151 O  O     . VAL A 1 405 ? 5.077  87.037 38.762  1.00 33.85  ? 405  VAL A O     1 
ATOM   3152 C  CB    . VAL A 1 405 ? 2.567  88.258 39.998  1.00 58.19  ? 405  VAL A CB    1 
ATOM   3153 C  CG1   . VAL A 1 405 ? 3.195  88.889 41.239  1.00 37.19  ? 405  VAL A CG1   1 
ATOM   3154 C  CG2   . VAL A 1 405 ? 1.075  88.478 39.880  1.00 100.00 ? 405  VAL A CG2   1 
ATOM   3155 N  N     . ALA A 1 406 ? 5.587  89.214 38.880  1.00 39.33  ? 406  ALA A N     1 
ATOM   3156 C  CA    . ALA A 1 406 ? 7.006  88.968 39.041  1.00 39.89  ? 406  ALA A CA    1 
ATOM   3157 C  C     . ALA A 1 406 ? 7.349  88.359 40.399  1.00 37.83  ? 406  ALA A C     1 
ATOM   3158 O  O     . ALA A 1 406 ? 6.843  88.778 41.451  1.00 48.91  ? 406  ALA A O     1 
ATOM   3159 C  CB    . ALA A 1 406 ? 7.847  90.202 38.816  1.00 74.98  ? 406  ALA A CB    1 
ATOM   3160 N  N     . GLN A 1 407 ? 8.212  87.350 40.364  1.00 95.96  ? 407  GLN A N     1 
ATOM   3161 C  CA    . GLN A 1 407 ? 8.647  86.660 41.566  1.00 42.62  ? 407  GLN A CA    1 
ATOM   3162 C  C     . GLN A 1 407 ? 10.097 86.892 41.879  1.00 51.55  ? 407  GLN A C     1 
ATOM   3163 O  O     . GLN A 1 407 ? 10.977 86.954 41.022  1.00 60.27  ? 407  GLN A O     1 
ATOM   3164 C  CB    . GLN A 1 407 ? 8.375  85.158 41.677  1.00 42.74  ? 407  GLN A CB    1 
ATOM   3165 C  CG    . GLN A 1 407 ? 7.153  84.723 40.855  1.00 51.90  ? 407  GLN A CG    1 
ATOM   3166 C  CD    . GLN A 1 407 ? 5.893  84.530 41.685  1.00 100.00 ? 407  GLN A CD    1 
ATOM   3167 O  OE1   . GLN A 1 407 ? 5.576  83.396 42.059  1.00 100.00 ? 407  GLN A OE1   1 
ATOM   3168 N  NE2   . GLN A 1 407 ? 5.190  85.627 41.924  1.00 100.00 ? 407  GLN A NE2   1 
ATOM   3169 N  N     . HIS A 1 408 ? 10.320 87.009 43.154  1.00 39.44  ? 408  HIS A N     1 
ATOM   3170 C  CA    . HIS A 1 408 ? 11.636 87.257 43.651  1.00 52.20  ? 408  HIS A CA    1 
ATOM   3171 C  C     . HIS A 1 408 ? 12.298 85.955 44.022  1.00 46.61  ? 408  HIS A C     1 
ATOM   3172 O  O     . HIS A 1 408 ? 12.195 85.501 45.148  1.00 70.16  ? 408  HIS A O     1 
ATOM   3173 C  CB    . HIS A 1 408 ? 11.590 88.154 44.880  1.00 44.98  ? 408  HIS A CB    1 
ATOM   3174 C  CG    . HIS A 1 408 ? 12.924 88.698 44.928  1.00 47.03  ? 408  HIS A CG    1 
ATOM   3175 N  ND1   . HIS A 1 408 ? 13.967 87.956 44.404  1.00 96.53  ? 408  HIS A ND1   1 
ATOM   3176 C  CD2   . HIS A 1 408 ? 13.367 89.893 45.305  1.00 53.92  ? 408  HIS A CD2   1 
ATOM   3177 C  CE1   . HIS A 1 408 ? 15.041 88.691 44.509  1.00 100.00 ? 408  HIS A CE1   1 
ATOM   3178 N  NE2   . HIS A 1 408 ? 14.707 89.864 44.991  1.00 49.38  ? 408  HIS A NE2   1 
ATOM   3179 N  N     . LEU A 1 409 ? 13.016 85.363 43.075  1.00 51.20  ? 409  LEU A N     1 
ATOM   3180 C  CA    . LEU A 1 409 ? 13.662 84.126 43.381  1.00 33.39  ? 409  LEU A CA    1 
ATOM   3181 C  C     . LEU A 1 409 ? 14.834 84.331 44.290  1.00 28.83  ? 409  LEU A C     1 
ATOM   3182 O  O     . LEU A 1 409 ? 15.572 85.313 44.182  1.00 35.91  ? 409  LEU A O     1 
ATOM   3183 C  CB    . LEU A 1 409 ? 14.232 83.416 42.187  1.00 33.94  ? 409  LEU A CB    1 
ATOM   3184 C  CG    . LEU A 1 409 ? 13.226 83.296 41.070  1.00 22.39  ? 409  LEU A CG    1 
ATOM   3185 C  CD1   . LEU A 1 409 ? 14.035 82.725 39.872  1.00 28.94  ? 409  LEU A CD1   1 
ATOM   3186 C  CD2   . LEU A 1 409 ? 12.217 82.250 41.468  1.00 30.10  ? 409  LEU A CD2   1 
ATOM   3187 N  N     . ASN A 1 410 ? 14.925 83.329 45.165  1.00 31.93  ? 410  ASN A N     1 
ATOM   3188 C  CA    . ASN A 1 410 ? 16.025 83.159 46.099  1.00 47.09  ? 410  ASN A CA    1 
ATOM   3189 C  C     . ASN A 1 410 ? 17.290 82.896 45.295  1.00 55.53  ? 410  ASN A C     1 
ATOM   3190 O  O     . ASN A 1 410 ? 17.235 82.945 44.062  1.00 39.16  ? 410  ASN A O     1 
ATOM   3191 C  CB    . ASN A 1 410 ? 15.766 82.102 47.209  1.00 34.71  ? 410  ASN A CB    1 
ATOM   3192 C  CG    . ASN A 1 410 ? 15.737 80.710 46.654  1.00 58.08  ? 410  ASN A CG    1 
ATOM   3193 O  OD1   . ASN A 1 410 ? 16.385 80.418 45.645  1.00 59.71  ? 410  ASN A OD1   1 
ATOM   3194 N  ND2   . ASN A 1 410 ? 14.944 79.842 47.280  1.00 36.33  ? 410  ASN A ND2   1 
ATOM   3195 N  N     . VAL A 1 411 ? 18.400 82.572 45.993  1.00 51.63  ? 411  VAL A N     1 
ATOM   3196 C  CA    . VAL A 1 411 ? 19.710 82.356 45.381  1.00 100.00 ? 411  VAL A CA    1 
ATOM   3197 C  C     . VAL A 1 411 ? 19.807 81.100 44.498  1.00 33.25  ? 411  VAL A C     1 
ATOM   3198 O  O     . VAL A 1 411 ? 20.188 81.135 43.315  1.00 40.63  ? 411  VAL A O     1 
ATOM   3199 C  CB    . VAL A 1 411 ? 20.769 82.532 46.506  1.00 64.83  ? 411  VAL A CB    1 
ATOM   3200 C  CG1   . VAL A 1 411 ? 21.883 81.517 46.440  1.00 37.41  ? 411  VAL A CG1   1 
ATOM   3201 C  CG2   . VAL A 1 411 ? 21.445 83.925 46.485  1.00 42.37  ? 411  VAL A CG2   1 
ATOM   3202 N  N     . GLU A 1 412 ? 19.393 80.000 45.104  1.00 29.44  ? 412  GLU A N     1 
ATOM   3203 C  CA    . GLU A 1 412 ? 19.397 78.696 44.507  1.00 29.34  ? 412  GLU A CA    1 
ATOM   3204 C  C     . GLU A 1 412 ? 18.538 78.640 43.305  1.00 37.89  ? 412  GLU A C     1 
ATOM   3205 O  O     . GLU A 1 412 ? 18.922 77.945 42.351  1.00 45.00  ? 412  GLU A O     1 
ATOM   3206 C  CB    . GLU A 1 412 ? 18.677 77.688 45.388  1.00 30.11  ? 412  GLU A CB    1 
ATOM   3207 C  CG    . GLU A 1 412 ? 18.128 76.428 44.652  1.00 100.00 ? 412  GLU A CG    1 
ATOM   3208 C  CD    . GLU A 1 412 ? 16.683 76.010 44.933  1.00 100.00 ? 412  GLU A CD    1 
ATOM   3209 O  OE1   . GLU A 1 412 ? 16.450 75.528 46.151  1.00 100.00 ? 412  GLU A OE1   1 
ATOM   3210 O  OE2   . GLU A 1 412 ? 15.814 76.082 44.058  1.00 100.00 ? 412  GLU A OE2   1 
ATOM   3211 N  N     . LYS A 1 413 ? 17.370 79.296 43.397  1.00 36.92  ? 413  LYS A N     1 
ATOM   3212 C  CA    . LYS A 1 413 ? 16.429 79.338 42.297  1.00 21.92  ? 413  LYS A CA    1 
ATOM   3213 C  C     . LYS A 1 413 ? 16.965 80.279 41.227  1.00 36.49  ? 413  LYS A C     1 
ATOM   3214 O  O     . LYS A 1 413 ? 16.862 80.077 40.011  1.00 30.04  ? 413  LYS A O     1 
ATOM   3215 C  CB    . LYS A 1 413 ? 15.044 79.772 42.732  1.00 28.64  ? 413  LYS A CB    1 
ATOM   3216 C  CG    . LYS A 1 413 ? 14.171 78.718 43.426  1.00 29.35  ? 413  LYS A CG    1 
ATOM   3217 C  CD    . LYS A 1 413 ? 13.467 79.302 44.710  1.00 100.00 ? 413  LYS A CD    1 
ATOM   3218 C  CE    . LYS A 1 413 ? 12.544 80.566 44.626  1.00 100.00 ? 413  LYS A CE    1 
ATOM   3219 N  NZ    . LYS A 1 413 ? 12.814 81.773 45.504  1.00 40.58  ? 413  LYS A NZ    1 
ATOM   3220 N  N     . SER A 1 414 ? 17.556 81.347 41.700  1.00 34.58  ? 414  SER A N     1 
ATOM   3221 C  CA    . SER A 1 414 ? 18.104 82.275 40.786  1.00 33.22  ? 414  SER A CA    1 
ATOM   3222 C  C     . SER A 1 414 ? 19.212 81.563 40.020  1.00 30.44  ? 414  SER A C     1 
ATOM   3223 O  O     . SER A 1 414 ? 19.309 81.645 38.801  1.00 39.49  ? 414  SER A O     1 
ATOM   3224 C  CB    . SER A 1 414 ? 18.529 83.547 41.602  1.00 33.48  ? 414  SER A CB    1 
ATOM   3225 O  OG    . SER A 1 414 ? 17.454 84.455 41.785  1.00 36.13  ? 414  SER A OG    1 
ATOM   3226 N  N     . SER A 1 415 ? 19.997 80.827 40.767  1.00 23.29  ? 415  SER A N     1 
ATOM   3227 C  CA    . SER A 1 415 ? 21.149 80.123 40.238  1.00 36.00  ? 415  SER A CA    1 
ATOM   3228 C  C     . SER A 1 415 ? 20.844 79.072 39.187  1.00 21.59  ? 415  SER A C     1 
ATOM   3229 O  O     . SER A 1 415 ? 21.488 79.023 38.122  1.00 26.64  ? 415  SER A O     1 
ATOM   3230 C  CB    . SER A 1 415 ? 22.172 79.729 41.299  1.00 35.68  ? 415  SER A CB    1 
ATOM   3231 O  OG    . SER A 1 415 ? 23.351 79.477 40.572  1.00 42.79  ? 415  SER A OG    1 
ATOM   3232 N  N     . SER A 1 416 ? 19.829 78.281 39.509  1.00 22.56  ? 416  SER A N     1 
ATOM   3233 C  CA    . SER A 1 416 ? 19.305 77.244 38.641  1.00 31.15  ? 416  SER A CA    1 
ATOM   3234 C  C     . SER A 1 416 ? 18.797 77.843 37.354  1.00 35.32  ? 416  SER A C     1 
ATOM   3235 O  O     . SER A 1 416 ? 18.986 77.301 36.297  1.00 21.94  ? 416  SER A O     1 
ATOM   3236 C  CB    . SER A 1 416 ? 18.128 76.615 39.329  1.00 27.92  ? 416  SER A CB    1 
ATOM   3237 O  OG    . SER A 1 416 ? 18.650 75.859 40.417  1.00 41.57  ? 416  SER A OG    1 
ATOM   3238 N  N     . SER A 1 417 ? 18.145 78.993 37.478  1.00 34.42  ? 417  SER A N     1 
ATOM   3239 C  CA    . SER A 1 417 ? 17.578 79.699 36.344  1.00 21.57  ? 417  SER A CA    1 
ATOM   3240 C  C     . SER A 1 417 ? 18.654 80.113 35.357  1.00 23.21  ? 417  SER A C     1 
ATOM   3241 O  O     . SER A 1 417 ? 18.517 79.951 34.116  1.00 25.59  ? 417  SER A O     1 
ATOM   3242 C  CB    . SER A 1 417 ? 16.622 80.758 36.822  1.00 26.10  ? 417  SER A CB    1 
ATOM   3243 O  OG    . SER A 1 417 ? 15.861 81.195 35.732  1.00 29.54  ? 417  SER A OG    1 
ATOM   3244 N  N     . ARG A 1 418 ? 19.710 80.659 35.945  1.00 22.18  ? 418  ARG A N     1 
ATOM   3245 C  CA    . ARG A 1 418 ? 20.890 81.084 35.245  1.00 25.28  ? 418  ARG A CA    1 
ATOM   3246 C  C     . ARG A 1 418 ? 21.464 79.870 34.528  1.00 23.94  ? 418  ARG A C     1 
ATOM   3247 O  O     . ARG A 1 418 ? 21.814 79.914 33.348  1.00 22.73  ? 418  ARG A O     1 
ATOM   3248 C  CB    . ARG A 1 418 ? 21.919 81.589 36.243  1.00 20.51  ? 418  ARG A CB    1 
ATOM   3249 C  CG    . ARG A 1 418 ? 23.207 81.991 35.488  1.00 33.61  ? 418  ARG A CG    1 
ATOM   3250 C  CD    . ARG A 1 418 ? 24.338 80.953 35.717  1.00 29.45  ? 418  ARG A CD    1 
ATOM   3251 N  NE    . ARG A 1 418 ? 24.264 80.530 37.089  1.00 35.44  ? 418  ARG A NE    1 
ATOM   3252 C  CZ    . ARG A 1 418 ? 24.911 81.257 38.003  1.00 35.23  ? 418  ARG A CZ    1 
ATOM   3253 N  NH1   . ARG A 1 418 ? 25.703 82.286 37.628  1.00 27.22  ? 418  ARG A NH1   1 
ATOM   3254 N  NH2   . ARG A 1 418 ? 24.792 80.889 39.284  1.00 37.26  ? 418  ARG A NH2   1 
ATOM   3255 N  N     . ASP A 1 419 ? 21.539 78.762 35.265  1.00 22.65  ? 419  ASP A N     1 
ATOM   3256 C  CA    . ASP A 1 419 ? 22.020 77.527 34.660  1.00 19.16  ? 419  ASP A CA    1 
ATOM   3257 C  C     . ASP A 1 419 ? 21.169 77.080 33.462  1.00 26.81  ? 419  ASP A C     1 
ATOM   3258 O  O     . ASP A 1 419 ? 21.658 76.664 32.384  1.00 23.49  ? 419  ASP A O     1 
ATOM   3259 C  CB    . ASP A 1 419 ? 22.134 76.446 35.712  1.00 16.55  ? 419  ASP A CB    1 
ATOM   3260 C  CG    . ASP A 1 419 ? 23.404 76.620 36.539  1.00 22.15  ? 419  ASP A CG    1 
ATOM   3261 O  OD1   . ASP A 1 419 ? 24.203 77.557 36.389  1.00 28.47  ? 419  ASP A OD1   1 
ATOM   3262 O  OD2   . ASP A 1 419 ? 23.543 75.671 37.430  1.00 29.79  ? 419  ASP A OD2   1 
ATOM   3263 N  N     . ALA A 1 420 ? 19.840 77.163 33.637  1.00 24.58  ? 420  ALA A N     1 
ATOM   3264 C  CA    . ALA A 1 420 ? 18.922 76.803 32.575  1.00 17.86  ? 420  ALA A CA    1 
ATOM   3265 C  C     . ALA A 1 420 ? 19.124 77.687 31.374  1.00 36.94  ? 420  ALA A C     1 
ATOM   3266 O  O     . ALA A 1 420 ? 19.037 77.187 30.248  1.00 23.71  ? 420  ALA A O     1 
ATOM   3267 C  CB    . ALA A 1 420 ? 17.451 76.857 32.895  1.00 21.46  ? 420  ALA A CB    1 
ATOM   3268 N  N     . LEU A 1 421 ? 19.387 78.988 31.636  1.00 27.67  ? 421  LEU A N     1 
ATOM   3269 C  CA    . LEU A 1 421 ? 19.651 79.948 30.572  1.00 25.58  ? 421  LEU A CA    1 
ATOM   3270 C  C     . LEU A 1 421 ? 20.883 79.552 29.762  1.00 25.39  ? 421  LEU A C     1 
ATOM   3271 O  O     . LEU A 1 421 ? 20.909 79.482 28.538  1.00 20.24  ? 421  LEU A O     1 
ATOM   3272 C  CB    . LEU A 1 421 ? 19.757 81.382 31.054  1.00 23.15  ? 421  LEU A CB    1 
ATOM   3273 C  CG    . LEU A 1 421 ? 20.315 82.288 29.949  1.00 26.29  ? 421  LEU A CG    1 
ATOM   3274 C  CD1   . LEU A 1 421 ? 19.245 82.401 28.860  1.00 29.12  ? 421  LEU A CD1   1 
ATOM   3275 C  CD2   . LEU A 1 421 ? 20.687 83.717 30.477  1.00 27.67  ? 421  LEU A CD2   1 
ATOM   3276 N  N     . VAL A 1 422 ? 21.918 79.218 30.492  1.00 23.71  ? 422  VAL A N     1 
ATOM   3277 C  CA    . VAL A 1 422 ? 23.132 78.791 29.848  1.00 28.18  ? 422  VAL A CA    1 
ATOM   3278 C  C     . VAL A 1 422 ? 22.911 77.507 29.043  1.00 25.53  ? 422  VAL A C     1 
ATOM   3279 O  O     . VAL A 1 422 ? 23.386 77.382 27.917  1.00 22.06  ? 422  VAL A O     1 
ATOM   3280 C  CB    . VAL A 1 422 ? 24.192 78.682 30.980  1.00 33.02  ? 422  VAL A CB    1 
ATOM   3281 C  CG1   . VAL A 1 422 ? 25.196 77.546 30.845  1.00 22.81  ? 422  VAL A CG1   1 
ATOM   3282 C  CG2   . VAL A 1 422 ? 24.793 80.040 31.450  1.00 23.54  ? 422  VAL A CG2   1 
ATOM   3283 N  N     . LYS A 1 423 ? 22.243 76.509 29.627  1.00 19.31  ? 423  LYS A N     1 
ATOM   3284 C  CA    . LYS A 1 423 ? 22.039 75.272 28.892  1.00 16.81  ? 423  LYS A CA    1 
ATOM   3285 C  C     . LYS A 1 423 ? 21.232 75.477 27.634  1.00 21.49  ? 423  LYS A C     1 
ATOM   3286 O  O     . LYS A 1 423 ? 21.536 74.859 26.619  1.00 27.08  ? 423  LYS A O     1 
ATOM   3287 C  CB    . LYS A 1 423 ? 21.491 74.125 29.686  1.00 18.46  ? 423  LYS A CB    1 
ATOM   3288 C  CG    . LYS A 1 423 ? 22.509 73.923 30.828  1.00 18.51  ? 423  LYS A CG    1 
ATOM   3289 C  CD    . LYS A 1 423 ? 22.068 72.818 31.742  1.00 26.33  ? 423  LYS A CD    1 
ATOM   3290 C  CE    . LYS A 1 423 ? 20.710 72.991 32.336  1.00 39.57  ? 423  LYS A CE    1 
ATOM   3291 N  NZ    . LYS A 1 423 ? 20.318 71.738 33.002  1.00 34.75  ? 423  LYS A NZ    1 
ATOM   3292 N  N     . ALA A 1 424 ? 20.215 76.353 27.685  1.00 18.56  ? 424  ALA A N     1 
ATOM   3293 C  CA    . ALA A 1 424 ? 19.392 76.645 26.531  1.00 23.69  ? 424  ALA A CA    1 
ATOM   3294 C  C     . ALA A 1 424 ? 20.208 77.328 25.468  1.00 20.97  ? 424  ALA A C     1 
ATOM   3295 O  O     . ALA A 1 424 ? 20.133 76.991 24.311  1.00 21.50  ? 424  ALA A O     1 
ATOM   3296 C  CB    . ALA A 1 424 ? 18.186 77.460 26.892  1.00 19.94  ? 424  ALA A CB    1 
ATOM   3297 N  N     . LEU A 1 425 ? 21.019 78.283 25.864  1.00 21.86  ? 425  LEU A N     1 
ATOM   3298 C  CA    . LEU A 1 425 ? 21.851 78.949 24.900  1.00 16.89  ? 425  LEU A CA    1 
ATOM   3299 C  C     . LEU A 1 425 ? 22.759 78.017 24.145  1.00 19.57  ? 425  LEU A C     1 
ATOM   3300 O  O     . LEU A 1 425 ? 22.894 78.095 22.925  1.00 24.29  ? 425  LEU A O     1 
ATOM   3301 C  CB    . LEU A 1 425 ? 22.702 79.957 25.660  1.00 27.62  ? 425  LEU A CB    1 
ATOM   3302 C  CG    . LEU A 1 425 ? 21.938 81.267 26.006  1.00 42.55  ? 425  LEU A CG    1 
ATOM   3303 C  CD1   . LEU A 1 425 ? 22.724 81.962 27.125  1.00 23.59  ? 425  LEU A CD1   1 
ATOM   3304 C  CD2   . LEU A 1 425 ? 21.684 82.196 24.778  1.00 24.43  ? 425  LEU A CD2   1 
ATOM   3305 N  N     . TYR A 1 426 ? 23.405 77.133 24.895  1.00 27.97  ? 426  TYR A N     1 
ATOM   3306 C  CA    . TYR A 1 426 ? 24.362 76.155 24.374  1.00 23.29  ? 426  TYR A CA    1 
ATOM   3307 C  C     . TYR A 1 426 ? 23.710 75.119 23.471  1.00 19.64  ? 426  TYR A C     1 
ATOM   3308 O  O     . TYR A 1 426 ? 24.212 74.806 22.396  1.00 25.01  ? 426  TYR A O     1 
ATOM   3309 C  CB    . TYR A 1 426 ? 25.255 75.483 25.484  1.00 18.67  ? 426  TYR A CB    1 
ATOM   3310 C  CG    . TYR A 1 426 ? 26.563 74.901 24.950  1.00 20.25  ? 426  TYR A CG    1 
ATOM   3311 C  CD1   . TYR A 1 426 ? 27.667 75.737 24.740  1.00 19.74  ? 426  TYR A CD1   1 
ATOM   3312 C  CD2   . TYR A 1 426 ? 26.670 73.541 24.587  1.00 18.05  ? 426  TYR A CD2   1 
ATOM   3313 C  CE1   . TYR A 1 426 ? 28.909 75.282 24.275  1.00 20.64  ? 426  TYR A CE1   1 
ATOM   3314 C  CE2   . TYR A 1 426 ? 27.875 73.067 24.057  1.00 16.15  ? 426  TYR A CE2   1 
ATOM   3315 C  CZ    . TYR A 1 426 ? 28.985 73.938 23.906  1.00 19.96  ? 426  TYR A CZ    1 
ATOM   3316 O  OH    . TYR A 1 426 ? 30.206 73.469 23.447  1.00 21.95  ? 426  TYR A OH    1 
ATOM   3317 N  N     . GLY A 1 427 ? 22.584 74.565 23.912  1.00 26.87  ? 427  GLY A N     1 
ATOM   3318 C  CA    . GLY A 1 427 ? 21.892 73.564 23.088  1.00 18.98  ? 427  GLY A CA    1 
ATOM   3319 C  C     . GLY A 1 427 ? 21.391 74.159 21.785  1.00 15.25  ? 427  GLY A C     1 
ATOM   3320 O  O     . GLY A 1 427 ? 21.437 73.530 20.690  1.00 20.35  ? 427  GLY A O     1 
ATOM   3321 N  N     . ARG A 1 428 ? 20.873 75.384 21.930  1.00 20.94  ? 428  ARG A N     1 
ATOM   3322 C  CA    . ARG A 1 428 ? 20.361 76.097 20.755  1.00 22.82  ? 428  ARG A CA    1 
ATOM   3323 C  C     . ARG A 1 428 ? 21.479 76.463 19.804  1.00 29.92  ? 428  ARG A C     1 
ATOM   3324 O  O     . ARG A 1 428 ? 21.382 76.320 18.614  1.00 21.73  ? 428  ARG A O     1 
ATOM   3325 C  CB    . ARG A 1 428 ? 19.575 77.324 21.007  1.00 21.53  ? 428  ARG A CB    1 
ATOM   3326 C  CG    . ARG A 1 428 ? 18.249 76.971 21.678  1.00 24.29  ? 428  ARG A CG    1 
ATOM   3327 C  CD    . ARG A 1 428 ? 17.772 78.171 22.454  1.00 32.09  ? 428  ARG A CD    1 
ATOM   3328 N  NE    . ARG A 1 428 ? 16.663 77.822 23.293  1.00 30.24  ? 428  ARG A NE    1 
ATOM   3329 C  CZ    . ARG A 1 428 ? 15.601 78.558 23.520  1.00 31.62  ? 428  ARG A CZ    1 
ATOM   3330 N  NH1   . ARG A 1 428 ? 15.418 79.735 22.926  1.00 22.82  ? 428  ARG A NH1   1 
ATOM   3331 N  NH2   . ARG A 1 428 ? 14.765 78.086 24.458  1.00 32.66  ? 428  ARG A NH2   1 
ATOM   3332 N  N     . LEU A 1 429 ? 22.566 76.959 20.318  1.00 21.64  ? 429  LEU A N     1 
ATOM   3333 C  CA    . LEU A 1 429 ? 23.688 77.232 19.427  1.00 21.22  ? 429  LEU A CA    1 
ATOM   3334 C  C     . LEU A 1 429 ? 24.155 75.988 18.689  1.00 22.47  ? 429  LEU A C     1 
ATOM   3335 O  O     . LEU A 1 429 ? 24.491 76.002 17.522  1.00 23.68  ? 429  LEU A O     1 
ATOM   3336 C  CB    . LEU A 1 429 ? 24.849 77.645 20.348  1.00 19.20  ? 429  LEU A CB    1 
ATOM   3337 C  CG    . LEU A 1 429 ? 26.167 77.692 19.594  1.00 84.09  ? 429  LEU A CG    1 
ATOM   3338 C  CD1   . LEU A 1 429 ? 25.929 78.506 18.310  1.00 37.33  ? 429  LEU A CD1   1 
ATOM   3339 C  CD2   . LEU A 1 429 ? 27.291 78.306 20.460  1.00 52.79  ? 429  LEU A CD2   1 
ATOM   3340 N  N     . PHE A 1 430 ? 24.207 74.892 19.409  1.00 15.85  ? 430  PHE A N     1 
ATOM   3341 C  CA    . PHE A 1 430 ? 24.643 73.663 18.838  1.00 11.04  ? 430  PHE A CA    1 
ATOM   3342 C  C     . PHE A 1 430 ? 23.717 73.268 17.734  1.00 22.47  ? 430  PHE A C     1 
ATOM   3343 O  O     . PHE A 1 430 ? 24.146 72.831 16.669  1.00 24.47  ? 430  PHE A O     1 
ATOM   3344 C  CB    . PHE A 1 430 ? 24.793 72.564 19.892  1.00 16.25  ? 430  PHE A CB    1 
ATOM   3345 C  CG    . PHE A 1 430 ? 25.487 71.316 19.381  1.00 21.71  ? 430  PHE A CG    1 
ATOM   3346 C  CD1   . PHE A 1 430 ? 26.882 71.296 19.375  1.00 19.80  ? 430  PHE A CD1   1 
ATOM   3347 C  CD2   . PHE A 1 430 ? 24.784 70.188 18.910  1.00 14.75  ? 430  PHE A CD2   1 
ATOM   3348 C  CE1   . PHE A 1 430 ? 27.593 70.194 18.904  1.00 19.90  ? 430  PHE A CE1   1 
ATOM   3349 C  CE2   . PHE A 1 430 ? 25.470 69.065 18.460  1.00 23.42  ? 430  PHE A CE2   1 
ATOM   3350 C  CZ    . PHE A 1 430 ? 26.877 69.082 18.485  1.00 18.26  ? 430  PHE A CZ    1 
ATOM   3351 N  N     . LEU A 1 431 ? 22.428 73.416 17.976  1.00 19.46  ? 431  LEU A N     1 
ATOM   3352 C  CA    . LEU A 1 431 ? 21.444 73.086 16.949  1.00 16.94  ? 431  LEU A CA    1 
ATOM   3353 C  C     . LEU A 1 431 ? 21.599 73.972 15.686  1.00 18.05  ? 431  LEU A C     1 
ATOM   3354 O  O     . LEU A 1 431 ? 21.444 73.553 14.530  1.00 21.96  ? 431  LEU A O     1 
ATOM   3355 C  CB    . LEU A 1 431 ? 20.096 73.492 17.560  1.00 38.83  ? 431  LEU A CB    1 
ATOM   3356 C  CG    . LEU A 1 431 ? 19.338 72.387 18.253  1.00 83.89  ? 431  LEU A CG    1 
ATOM   3357 C  CD1   . LEU A 1 431 ? 18.000 72.882 18.699  1.00 46.08  ? 431  LEU A CD1   1 
ATOM   3358 C  CD2   . LEU A 1 431 ? 19.096 71.257 17.274  1.00 48.55  ? 431  LEU A CD2   1 
ATOM   3359 N  N     . TRP A 1 432 ? 21.804 75.240 15.961  1.00 19.30  ? 432  TRP A N     1 
ATOM   3360 C  CA    . TRP A 1 432 ? 22.026 76.282 14.957  1.00 21.55  ? 432  TRP A CA    1 
ATOM   3361 C  C     . TRP A 1 432 ? 23.274 75.930 14.146  1.00 41.43  ? 432  TRP A C     1 
ATOM   3362 O  O     . TRP A 1 432 ? 23.292 75.948 12.920  1.00 27.74  ? 432  TRP A O     1 
ATOM   3363 C  CB    . TRP A 1 432 ? 22.179 77.618 15.675  1.00 20.51  ? 432  TRP A CB    1 
ATOM   3364 C  CG    . TRP A 1 432 ? 22.401 78.756 14.733  1.00 53.83  ? 432  TRP A CG    1 
ATOM   3365 C  CD1   . TRP A 1 432 ? 21.419 79.548 14.202  1.00 29.79  ? 432  TRP A CD1   1 
ATOM   3366 C  CD2   . TRP A 1 432 ? 23.649 79.236 14.197  1.00 32.20  ? 432  TRP A CD2   1 
ATOM   3367 N  NE1   . TRP A 1 432 ? 21.996 80.417 13.309  1.00 34.68  ? 432  TRP A NE1   1 
ATOM   3368 C  CE2   . TRP A 1 432 ? 23.353 80.308 13.320  1.00 36.25  ? 432  TRP A CE2   1 
ATOM   3369 C  CE3   . TRP A 1 432 ? 24.993 78.902 14.394  1.00 39.06  ? 432  TRP A CE3   1 
ATOM   3370 C  CZ2   . TRP A 1 432 ? 24.353 81.029 12.641  1.00 36.03  ? 432  TRP A CZ2   1 
ATOM   3371 C  CZ3   . TRP A 1 432 ? 25.997 79.663 13.783  1.00 39.55  ? 432  TRP A CZ3   1 
ATOM   3372 C  CH2   . TRP A 1 432 ? 25.665 80.677 12.847  1.00 34.37  ? 432  TRP A CH2   1 
ATOM   3373 N  N     . LEU A 1 433 ? 24.329 75.551 14.828  1.00 32.41  ? 433  LEU A N     1 
ATOM   3374 C  CA    . LEU A 1 433 ? 25.531 75.188 14.118  1.00 23.45  ? 433  LEU A CA    1 
ATOM   3375 C  C     . LEU A 1 433 ? 25.224 74.065 13.155  1.00 22.25  ? 433  LEU A C     1 
ATOM   3376 O  O     . LEU A 1 433 ? 25.633 74.080 12.002  1.00 25.72  ? 433  LEU A O     1 
ATOM   3377 C  CB    . LEU A 1 433 ? 26.610 74.646 15.127  1.00 25.93  ? 433  LEU A CB    1 
ATOM   3378 C  CG    . LEU A 1 433 ? 27.209 75.726 16.018  1.00 28.75  ? 433  LEU A CG    1 
ATOM   3379 C  CD1   . LEU A 1 433 ? 28.050 75.102 17.120  1.00 21.28  ? 433  LEU A CD1   1 
ATOM   3380 C  CD2   . LEU A 1 433 ? 28.096 76.600 15.129  1.00 37.30  ? 433  LEU A CD2   1 
ATOM   3381 N  N     . VAL A 1 434 ? 24.506 73.053 13.643  1.00 23.01  ? 434  VAL A N     1 
ATOM   3382 C  CA    . VAL A 1 434 ? 24.172 71.908 12.809  1.00 22.18  ? 434  VAL A CA    1 
ATOM   3383 C  C     . VAL A 1 434 ? 23.381 72.308 11.554  1.00 30.21  ? 434  VAL A C     1 
ATOM   3384 O  O     . VAL A 1 434 ? 23.617 71.874 10.429  1.00 17.43  ? 434  VAL A O     1 
ATOM   3385 C  CB    . VAL A 1 434 ? 23.512 70.771 13.616  1.00 22.11  ? 434  VAL A CB    1 
ATOM   3386 C  CG1   . VAL A 1 434 ? 23.260 69.527 12.728  1.00 24.29  ? 434  VAL A CG1   1 
ATOM   3387 C  CG2   . VAL A 1 434 ? 24.395 70.490 14.843  1.00 20.00  ? 434  VAL A CG2   1 
ATOM   3388 N  N     . LYS A 1 435 ? 22.382 73.121 11.790  1.00 25.48  ? 435  LYS A N     1 
ATOM   3389 C  CA    . LYS A 1 435 ? 21.547 73.555 10.684  1.00 32.84  ? 435  LYS A CA    1 
ATOM   3390 C  C     . LYS A 1 435 ? 22.347 74.366 9.721   1.00 21.28  ? 435  LYS A C     1 
ATOM   3391 O  O     . LYS A 1 435 ? 22.228 74.186 8.532   1.00 28.32  ? 435  LYS A O     1 
ATOM   3392 C  CB    . LYS A 1 435 ? 20.365 74.366 11.150  1.00 37.18  ? 435  LYS A CB    1 
ATOM   3393 C  CG    . LYS A 1 435 ? 19.366 73.521 11.994  1.00 52.17  ? 435  LYS A CG    1 
ATOM   3394 C  CD    . LYS A 1 435 ? 17.976 74.187 12.039  1.00 100.00 ? 435  LYS A CD    1 
ATOM   3395 C  CE    . LYS A 1 435 ? 17.697 75.226 10.913  1.00 100.00 ? 435  LYS A CE    1 
ATOM   3396 N  NZ    . LYS A 1 435 ? 16.300 75.759 10.872  1.00 81.54  ? 435  LYS A NZ    1 
ATOM   3397 N  N     . LYS A 1 436 ? 23.174 75.245 10.249  1.00 22.37  ? 436  LYS A N     1 
ATOM   3398 C  CA    . LYS A 1 436 ? 24.024 76.058 9.387   1.00 32.66  ? 436  LYS A CA    1 
ATOM   3399 C  C     . LYS A 1 436 ? 24.833 75.154 8.475   1.00 43.80  ? 436  LYS A C     1 
ATOM   3400 O  O     . LYS A 1 436 ? 24.920 75.331 7.266   1.00 23.40  ? 436  LYS A O     1 
ATOM   3401 C  CB    . LYS A 1 436 ? 25.003 76.981 10.144  1.00 22.93  ? 436  LYS A CB    1 
ATOM   3402 C  CG    . LYS A 1 436 ? 24.342 78.105 10.877  1.00 79.21  ? 436  LYS A CG    1 
ATOM   3403 C  CD    . LYS A 1 436 ? 23.602 79.049 9.947   1.00 70.36  ? 436  LYS A CD    1 
ATOM   3404 C  CE    . LYS A 1 436 ? 24.555 79.931 9.153   1.00 100.00 ? 436  LYS A CE    1 
ATOM   3405 N  NZ    . LYS A 1 436 ? 25.806 79.251 8.802   1.00 97.51  ? 436  LYS A NZ    1 
ATOM   3406 N  N     . ILE A 1 437 ? 25.442 74.155 9.075   1.00 23.03  ? 437  ILE A N     1 
ATOM   3407 C  CA    . ILE A 1 437 ? 26.245 73.256 8.267   1.00 22.09  ? 437  ILE A CA    1 
ATOM   3408 C  C     . ILE A 1 437 ? 25.380 72.466 7.275   1.00 29.20  ? 437  ILE A C     1 
ATOM   3409 O  O     . ILE A 1 437 ? 25.731 72.233 6.134   1.00 24.47  ? 437  ILE A O     1 
ATOM   3410 C  CB    . ILE A 1 437 ? 26.918 72.321 9.221   1.00 28.40  ? 437  ILE A CB    1 
ATOM   3411 C  CG1   . ILE A 1 437 ? 27.940 72.913 10.167  1.00 27.01  ? 437  ILE A CG1   1 
ATOM   3412 C  CG2   . ILE A 1 437 ? 27.453 71.128 8.523   1.00 23.71  ? 437  ILE A CG2   1 
ATOM   3413 C  CD1   . ILE A 1 437 ? 28.458 71.877 11.166  1.00 26.58  ? 437  ILE A CD1   1 
ATOM   3414 N  N     . ASN A 1 438 ? 24.225 72.029 7.700   1.00 19.65  ? 438  ASN A N     1 
ATOM   3415 C  CA    . ASN A 1 438 ? 23.446 71.281 6.787   1.00 21.51  ? 438  ASN A CA    1 
ATOM   3416 C  C     . ASN A 1 438 ? 23.056 72.105 5.578   1.00 27.21  ? 438  ASN A C     1 
ATOM   3417 O  O     . ASN A 1 438 ? 22.891 71.585 4.489   1.00 25.84  ? 438  ASN A O     1 
ATOM   3418 C  CB    . ASN A 1 438 ? 22.162 70.874 7.461   1.00 18.35  ? 438  ASN A CB    1 
ATOM   3419 C  CG    . ASN A 1 438 ? 22.376 69.574 8.279   1.00 37.37  ? 438  ASN A CG    1 
ATOM   3420 O  OD1   . ASN A 1 438 ? 23.245 68.781 8.041   1.00 26.21  ? 438  ASN A OD1   1 
ATOM   3421 N  ND2   . ASN A 1 438 ? 21.570 69.272 9.271   1.00 22.05  ? 438  ASN A ND2   1 
ATOM   3422 N  N     . ASN A 1 439 ? 22.841 73.384 5.823   1.00 30.75  ? 439  ASN A N     1 
ATOM   3423 C  CA    . ASN A 1 439 ? 22.451 74.324 4.780   1.00 25.51  ? 439  ASN A CA    1 
ATOM   3424 C  C     . ASN A 1 439 ? 23.496 74.320 3.708   1.00 33.71  ? 439  ASN A C     1 
ATOM   3425 O  O     . ASN A 1 439 ? 23.240 74.274 2.527   1.00 37.49  ? 439  ASN A O     1 
ATOM   3426 C  CB    . ASN A 1 439 ? 22.393 75.739 5.361   1.00 48.62  ? 439  ASN A CB    1 
ATOM   3427 C  CG    . ASN A 1 439 ? 21.083 76.030 6.094   1.00 45.72  ? 439  ASN A CG    1 
ATOM   3428 O  OD1   . ASN A 1 439 ? 20.972 77.060 6.841   1.00 100.00 ? 439  ASN A OD1   1 
ATOM   3429 N  ND2   . ASN A 1 439 ? 20.100 75.132 5.908   1.00 100.00 ? 439  ASN A ND2   1 
ATOM   3430 N  N     . VAL A 1 440 ? 24.712 74.347 4.152   1.00 24.60  ? 440  VAL A N     1 
ATOM   3431 C  CA    . VAL A 1 440 ? 25.778 74.267 3.232   1.00 27.21  ? 440  VAL A CA    1 
ATOM   3432 C  C     . VAL A 1 440 ? 25.874 72.924 2.551   1.00 50.74  ? 440  VAL A C     1 
ATOM   3433 O  O     . VAL A 1 440 ? 25.994 72.823 1.343   1.00 47.36  ? 440  VAL A O     1 
ATOM   3434 C  CB    . VAL A 1 440 ? 27.063 74.565 3.945   1.00 22.41  ? 440  VAL A CB    1 
ATOM   3435 C  CG1   . VAL A 1 440 ? 28.221 74.524 2.949   1.00 31.26  ? 440  VAL A CG1   1 
ATOM   3436 C  CG2   . VAL A 1 440 ? 26.895 75.974 4.428   1.00 25.22  ? 440  VAL A CG2   1 
ATOM   3437 N  N     . LEU A 1 441 ? 25.874 71.854 3.293   1.00 36.95  ? 441  LEU A N     1 
ATOM   3438 C  CA    . LEU A 1 441 ? 26.118 70.604 2.617   1.00 35.08  ? 441  LEU A CA    1 
ATOM   3439 C  C     . LEU A 1 441 ? 24.927 69.872 2.007   1.00 20.10  ? 441  LEU A C     1 
ATOM   3440 O  O     . LEU A 1 441 ? 25.072 68.980 1.161   1.00 27.54  ? 441  LEU A O     1 
ATOM   3441 C  CB    . LEU A 1 441 ? 26.705 69.691 3.757   1.00 28.10  ? 441  LEU A CB    1 
ATOM   3442 C  CG    . LEU A 1 441 ? 27.964 70.162 4.527   1.00 28.04  ? 441  LEU A CG    1 
ATOM   3443 C  CD1   . LEU A 1 441 ? 28.338 69.044 5.498   1.00 21.93  ? 441  LEU A CD1   1 
ATOM   3444 C  CD2   . LEU A 1 441 ? 29.195 70.381 3.601   1.00 30.97  ? 441  LEU A CD2   1 
ATOM   3445 N  N     . CYS A 1 442 ? 23.790 70.112 2.629   1.00 27.59  ? 442  CYS A N     1 
ATOM   3446 C  CA    . CYS A 1 442 ? 22.638 69.358 2.307   1.00 30.20  ? 442  CYS A CA    1 
ATOM   3447 C  C     . CYS A 1 442 ? 22.087 69.666 0.950   1.00 76.91  ? 442  CYS A C     1 
ATOM   3448 O  O     . CYS A 1 442 ? 22.070 70.832 0.578   1.00 45.16  ? 442  CYS A O     1 
ATOM   3449 C  CB    . CYS A 1 442 ? 21.606 69.177 3.453   1.00 29.56  ? 442  CYS A CB    1 
ATOM   3450 S  SG    . CYS A 1 442 ? 20.501 67.856 2.863   1.00 56.63  ? 442  CYS A SG    1 
ATOM   3451 N  N     . SER A 1 443 ? 21.698 68.579 0.258   1.00 51.62  ? 443  SER A N     1 
ATOM   3452 C  CA    . SER A 1 443 ? 21.103 68.575 -1.083  1.00 100.00 ? 443  SER A CA    1 
ATOM   3453 C  C     . SER A 1 443 ? 19.691 67.999 -1.090  1.00 72.22  ? 443  SER A C     1 
ATOM   3454 O  O     . SER A 1 443 ? 19.462 66.833 -0.766  1.00 73.53  ? 443  SER A O     1 
ATOM   3455 C  CB    . SER A 1 443 ? 21.964 67.959 -2.216  1.00 100.00 ? 443  SER A CB    1 
ATOM   3456 O  OG    . SER A 1 443 ? 21.855 66.532 -2.333  1.00 95.50  ? 443  SER A OG    1 
ATOM   3457 N  N     . GLU A 1 444 ? 18.744 68.839 -1.488  1.00 100.00 ? 444  GLU A N     1 
ATOM   3458 C  CA    . GLU A 1 444 ? 17.359 68.430 -1.571  1.00 100.00 ? 444  GLU A CA    1 
ATOM   3459 C  C     . GLU A 1 444 ? 17.188 67.401 -2.679  1.00 100.00 ? 444  GLU A C     1 
ATOM   3460 O  O     . GLU A 1 444 ? 16.253 66.602 -2.672  1.00 89.53  ? 444  GLU A O     1 
ATOM   3461 C  CB    . GLU A 1 444 ? 16.363 69.623 -1.717  1.00 100.00 ? 444  GLU A CB    1 
ATOM   3462 C  CG    . GLU A 1 444 ? 16.807 71.010 -1.160  1.00 100.00 ? 444  GLU A CG    1 
ATOM   3463 C  CD    . GLU A 1 444 ? 16.777 72.183 -2.154  1.00 100.00 ? 444  GLU A CD    1 
ATOM   3464 O  OE1   . GLU A 1 444 ? 15.712 72.194 -2.933  1.00 100.00 ? 444  GLU A OE1   1 
ATOM   3465 O  OE2   . GLU A 1 444 ? 17.653 73.049 -2.209  1.00 100.00 ? 444  GLU A OE2   1 
ATOM   3466 N  N     . ARG A 1 445 ? 18.132 67.388 -3.615  1.00 77.34  ? 445  ARG A N     1 
ATOM   3467 C  CA    . ARG A 1 445 ? 18.016 66.458 -4.704  1.00 59.62  ? 445  ARG A CA    1 
ATOM   3468 C  C     . ARG A 1 445 ? 19.036 65.330 -4.751  1.00 72.82  ? 445  ARG A C     1 
ATOM   3469 O  O     . ARG A 1 445 ? 19.695 65.137 -5.768  1.00 73.36  ? 445  ARG A O     1 
ATOM   3470 C  CB    . ARG A 1 445 ? 17.767 67.152 -6.035  1.00 100.00 ? 445  ARG A CB    1 
ATOM   3471 N  N     . LYS A 1 446 ? 19.123 64.502 -3.704  1.00 50.71  ? 446  LYS A N     1 
ATOM   3472 C  CA    . LYS A 1 446 ? 20.057 63.388 -3.794  1.00 44.21  ? 446  LYS A CA    1 
ATOM   3473 C  C     . LYS A 1 446 ? 19.428 62.118 -4.360  1.00 35.18  ? 446  LYS A C     1 
ATOM   3474 O  O     . LYS A 1 446 ? 18.211 61.878 -4.252  1.00 38.97  ? 446  LYS A O     1 
ATOM   3475 C  CB    . LYS A 1 446 ? 20.732 63.004 -2.531  1.00 39.92  ? 446  LYS A CB    1 
ATOM   3476 C  CG    . LYS A 1 446 ? 19.648 62.924 -1.495  1.00 41.02  ? 446  LYS A CG    1 
ATOM   3477 C  CD    . LYS A 1 446 ? 19.630 61.601 -0.774  1.00 45.41  ? 446  LYS A CD    1 
ATOM   3478 C  CE    . LYS A 1 446 ? 18.438 61.443 0.187   1.00 100.00 ? 446  LYS A CE    1 
ATOM   3479 N  NZ    . LYS A 1 446 ? 18.283 62.478 1.228   1.00 87.40  ? 446  LYS A NZ    1 
ATOM   3480 N  N     . ALA A 1 447 ? 20.274 61.291 -4.963  1.00 24.40  ? 447  ALA A N     1 
ATOM   3481 C  CA    . ALA A 1 447 ? 19.761 60.067 -5.508  1.00 22.56  ? 447  ALA A CA    1 
ATOM   3482 C  C     . ALA A 1 447 ? 19.817 58.935 -4.496  1.00 29.77  ? 447  ALA A C     1 
ATOM   3483 O  O     . ALA A 1 447 ? 18.887 58.132 -4.387  1.00 26.99  ? 447  ALA A O     1 
ATOM   3484 C  CB    . ALA A 1 447 ? 20.556 59.676 -6.753  1.00 30.56  ? 447  ALA A CB    1 
ATOM   3485 N  N     . TYR A 1 448 ? 20.972 58.828 -3.822  1.00 23.95  ? 448  TYR A N     1 
ATOM   3486 C  CA    . TYR A 1 448 ? 21.235 57.741 -2.890  1.00 16.79  ? 448  TYR A CA    1 
ATOM   3487 C  C     . TYR A 1 448 ? 21.957 58.276 -1.660  1.00 15.03  ? 448  TYR A C     1 
ATOM   3488 O  O     . TYR A 1 448 ? 22.386 59.447 -1.649  1.00 17.61  ? 448  TYR A O     1 
ATOM   3489 C  CB    . TYR A 1 448 ? 22.003 56.509 -3.519  1.00 18.14  ? 448  TYR A CB    1 
ATOM   3490 C  CG    . TYR A 1 448 ? 21.235 55.865 -4.699  1.00 39.55  ? 448  TYR A CG    1 
ATOM   3491 C  CD1   . TYR A 1 448 ? 20.093 55.089 -4.451  1.00 37.38  ? 448  TYR A CD1   1 
ATOM   3492 C  CD2   . TYR A 1 448 ? 21.510 56.225 -6.027  1.00 32.95  ? 448  TYR A CD2   1 
ATOM   3493 C  CE1   . TYR A 1 448 ? 19.259 54.623 -5.471  1.00 25.58  ? 448  TYR A CE1   1 
ATOM   3494 C  CE2   . TYR A 1 448 ? 20.682 55.759 -7.069  1.00 19.43  ? 448  TYR A CE2   1 
ATOM   3495 C  CZ    . TYR A 1 448 ? 19.573 54.949 -6.797  1.00 23.43  ? 448  TYR A CZ    1 
ATOM   3496 O  OH    . TYR A 1 448 ? 18.779 54.546 -7.837  1.00 24.14  ? 448  TYR A OH    1 
ATOM   3497 N  N     . PHE A 1 449 ? 22.007 57.433 -0.601  1.00 20.96  ? 449  PHE A N     1 
ATOM   3498 C  CA    . PHE A 1 449 ? 22.767 57.883 0.602   1.00 20.17  ? 449  PHE A CA    1 
ATOM   3499 C  C     . PHE A 1 449 ? 23.261 56.676 1.328   1.00 12.55  ? 449  PHE A C     1 
ATOM   3500 O  O     . PHE A 1 449 ? 22.775 55.565 1.102   1.00 15.09  ? 449  PHE A O     1 
ATOM   3501 C  CB    . PHE A 1 449 ? 22.116 58.842 1.563   1.00 19.53  ? 449  PHE A CB    1 
ATOM   3502 C  CG    . PHE A 1 449 ? 21.024 58.090 2.318   1.00 21.70  ? 449  PHE A CG    1 
ATOM   3503 C  CD1   . PHE A 1 449 ? 21.310 57.439 3.523   1.00 20.21  ? 449  PHE A CD1   1 
ATOM   3504 C  CD2   . PHE A 1 449 ? 19.701 58.100 1.862   1.00 11.58  ? 449  PHE A CD2   1 
ATOM   3505 C  CE1   . PHE A 1 449 ? 20.298 56.787 4.218   1.00 17.64  ? 449  PHE A CE1   1 
ATOM   3506 C  CE2   . PHE A 1 449 ? 18.650 57.446 2.518   1.00 17.52  ? 449  PHE A CE2   1 
ATOM   3507 C  CZ    . PHE A 1 449 ? 18.999 56.766 3.687   1.00 23.71  ? 449  PHE A CZ    1 
ATOM   3508 N  N     . ILE A 1 450 ? 24.340 56.915 2.094   1.00 21.97  ? 450  ILE A N     1 
ATOM   3509 C  CA    . ILE A 1 450 ? 24.965 55.939 2.966   1.00 16.61  ? 450  ILE A CA    1 
ATOM   3510 C  C     . ILE A 1 450 ? 25.014 56.687 4.306   1.00 18.59  ? 450  ILE A C     1 
ATOM   3511 O  O     . ILE A 1 450 ? 25.581 57.784 4.391   1.00 20.15  ? 450  ILE A O     1 
ATOM   3512 C  CB    . ILE A 1 450 ? 26.371 55.584 2.492   1.00 21.15  ? 450  ILE A CB    1 
ATOM   3513 C  CG1   . ILE A 1 450 ? 26.289 54.797 1.180   1.00 22.88  ? 450  ILE A CG1   1 
ATOM   3514 C  CG2   . ILE A 1 450 ? 26.921 54.690 3.610   1.00 23.18  ? 450  ILE A CG2   1 
ATOM   3515 C  CD1   . ILE A 1 450 ? 27.675 54.287 0.754   1.00 15.64  ? 450  ILE A CD1   1 
ATOM   3516 N  N     . GLY A 1 451 ? 24.261 56.220 5.282   1.00 19.38  ? 451  GLY A N     1 
ATOM   3517 C  CA    . GLY A 1 451 ? 24.148 56.935 6.569   1.00 21.56  ? 451  GLY A CA    1 
ATOM   3518 C  C     . GLY A 1 451 ? 24.992 56.238 7.626   1.00 16.08  ? 451  GLY A C     1 
ATOM   3519 O  O     . GLY A 1 451 ? 25.069 55.017 7.668   1.00 20.33  ? 451  GLY A O     1 
ATOM   3520 N  N     . VAL A 1 452 ? 25.700 57.038 8.398   1.00 14.72  ? 452  VAL A N     1 
ATOM   3521 C  CA    . VAL A 1 452 ? 26.522 56.505 9.471   1.00 36.45  ? 452  VAL A CA    1 
ATOM   3522 C  C     . VAL A 1 452 ? 25.975 56.984 10.830  1.00 14.04  ? 452  VAL A C     1 
ATOM   3523 O  O     . VAL A 1 452 ? 25.784 58.217 11.076  1.00 16.64  ? 452  VAL A O     1 
ATOM   3524 C  CB    . VAL A 1 452 ? 27.991 56.857 9.345   1.00 39.15  ? 452  VAL A CB    1 
ATOM   3525 C  CG1   . VAL A 1 452 ? 28.832 56.127 10.413  1.00 13.62  ? 452  VAL A CG1   1 
ATOM   3526 C  CG2   . VAL A 1 452 ? 28.392 56.623 7.883   1.00 26.16  ? 452  VAL A CG2   1 
ATOM   3527 N  N     . LEU A 1 453 ? 25.775 55.977 11.686  1.00 11.70  ? 453  LEU A N     1 
ATOM   3528 C  CA    . LEU A 1 453 ? 25.245 56.341 12.960  1.00 15.92  ? 453  LEU A CA    1 
ATOM   3529 C  C     . LEU A 1 453 ? 26.348 56.097 13.974  1.00 15.58  ? 453  LEU A C     1 
ATOM   3530 O  O     . LEU A 1 453 ? 26.790 54.965 14.095  1.00 18.98  ? 453  LEU A O     1 
ATOM   3531 C  CB    . LEU A 1 453 ? 24.052 55.399 13.245  1.00 15.92  ? 453  LEU A CB    1 
ATOM   3532 C  CG    . LEU A 1 453 ? 23.410 55.643 14.606  1.00 15.63  ? 453  LEU A CG    1 
ATOM   3533 C  CD1   . LEU A 1 453 ? 22.591 56.912 14.583  1.00 12.61  ? 453  LEU A CD1   1 
ATOM   3534 C  CD2   . LEU A 1 453 ? 22.484 54.450 14.877  1.00 22.93  ? 453  LEU A CD2   1 
ATOM   3535 N  N     . ASP A 1 454 ? 26.744 57.153 14.670  1.00 18.13  ? 454  ASP A N     1 
ATOM   3536 C  CA    . ASP A 1 454 ? 27.778 57.045 15.684  1.00 19.33  ? 454  ASP A CA    1 
ATOM   3537 C  C     . ASP A 1 454 ? 27.153 57.423 16.996  1.00 26.94  ? 454  ASP A C     1 
ATOM   3538 O  O     . ASP A 1 454 ? 26.911 58.607 17.267  1.00 17.18  ? 454  ASP A O     1 
ATOM   3539 C  CB    . ASP A 1 454 ? 28.903 58.022 15.285  1.00 20.61  ? 454  ASP A CB    1 
ATOM   3540 C  CG    . ASP A 1 454 ? 29.952 58.253 16.365  1.00 31.36  ? 454  ASP A CG    1 
ATOM   3541 O  OD1   . ASP A 1 454 ? 29.955 57.405 17.344  1.00 20.70  ? 454  ASP A OD1   1 
ATOM   3542 O  OD2   . ASP A 1 454 ? 30.781 59.124 16.284  1.00 25.38  ? 454  ASP A OD2   1 
ATOM   3543 N  N     . ILE A 1 455 ? 26.875 56.377 17.775  1.00 18.52  ? 455  ILE A N     1 
ATOM   3544 C  CA    . ILE A 1 455 ? 26.142 56.578 18.994  1.00 20.10  ? 455  ILE A CA    1 
ATOM   3545 C  C     . ILE A 1 455 ? 26.525 55.537 20.012  1.00 8.74   ? 455  ILE A C     1 
ATOM   3546 O  O     . ILE A 1 455 ? 26.876 54.401 19.667  1.00 18.51  ? 455  ILE A O     1 
ATOM   3547 C  CB    . ILE A 1 455 ? 24.703 56.363 18.436  1.00 27.48  ? 455  ILE A CB    1 
ATOM   3548 C  CG1   . ILE A 1 455 ? 23.950 57.630 18.173  1.00 16.79  ? 455  ILE A CG1   1 
ATOM   3549 C  CG2   . ILE A 1 455 ? 23.739 55.276 18.902  1.00 25.45  ? 455  ILE A CG2   1 
ATOM   3550 C  CD1   . ILE A 1 455 ? 24.252 58.273 16.788  1.00 100.00 ? 455  ILE A CD1   1 
ATOM   3551 N  N     . SER A 1 456 ? 26.386 55.901 21.267  1.00 12.18  ? 456  SER A N     1 
ATOM   3552 C  CA    . SER A 1 456 ? 26.679 54.852 22.293  1.00 18.18  ? 456  SER A CA    1 
ATOM   3553 C  C     . SER A 1 456 ? 25.817 53.599 22.214  1.00 30.14  ? 456  SER A C     1 
ATOM   3554 O  O     . SER A 1 456 ? 24.689 53.632 21.751  1.00 27.16  ? 456  SER A O     1 
ATOM   3555 C  CB    . SER A 1 456 ? 26.616 55.401 23.746  1.00 24.98  ? 456  SER A CB    1 
ATOM   3556 O  OG    . SER A 1 456 ? 26.460 54.383 24.716  1.00 37.63  ? 456  SER A OG    1 
ATOM   3557 N  N     . GLY A 1 457 ? 26.354 52.483 22.671  1.00 14.36  ? 457  GLY A N     1 
ATOM   3558 C  CA    . GLY A 1 457 ? 25.576 51.284 22.759  1.00 9.59   ? 457  GLY A CA    1 
ATOM   3559 C  C     . GLY A 1 457 ? 24.851 51.449 24.144  1.00 14.00  ? 457  GLY A C     1 
ATOM   3560 O  O     . GLY A 1 457 ? 24.737 52.554 24.660  1.00 16.88  ? 457  GLY A O     1 
ATOM   3561 N  N     . PHE A 1 458 ? 24.389 50.358 24.744  1.00 17.06  ? 458  PHE A N     1 
ATOM   3562 C  CA    . PHE A 1 458 ? 23.731 50.391 26.025  1.00 16.74  ? 458  PHE A CA    1 
ATOM   3563 C  C     . PHE A 1 458 ? 24.623 51.012 27.068  1.00 22.37  ? 458  PHE A C     1 
ATOM   3564 O  O     . PHE A 1 458 ? 25.806 50.732 27.067  1.00 25.93  ? 458  PHE A O     1 
ATOM   3565 C  CB    . PHE A 1 458 ? 23.409 48.927 26.493  1.00 13.90  ? 458  PHE A CB    1 
ATOM   3566 C  CG    . PHE A 1 458 ? 22.197 48.305 25.781  1.00 25.22  ? 458  PHE A CG    1 
ATOM   3567 C  CD1   . PHE A 1 458 ? 20.900 48.687 26.161  1.00 25.42  ? 458  PHE A CD1   1 
ATOM   3568 C  CD2   . PHE A 1 458 ? 22.346 47.380 24.732  1.00 20.11  ? 458  PHE A CD2   1 
ATOM   3569 C  CE1   . PHE A 1 458 ? 19.790 48.142 25.509  1.00 19.71  ? 458  PHE A CE1   1 
ATOM   3570 C  CE2   . PHE A 1 458 ? 21.265 46.812 24.037  1.00 20.67  ? 458  PHE A CE2   1 
ATOM   3571 C  CZ    . PHE A 1 458 ? 19.993 47.205 24.483  1.00 18.39  ? 458  PHE A CZ    1 
ATOM   3572 N  N     . GLU A 1 459 ? 24.055 51.845 27.934  1.00 22.09  ? 459  GLU A N     1 
ATOM   3573 C  CA    . GLU A 1 459 ? 24.779 52.491 29.001  1.00 24.22  ? 459  GLU A CA    1 
ATOM   3574 C  C     . GLU A 1 459 ? 24.306 51.964 30.346  1.00 32.20  ? 459  GLU A C     1 
ATOM   3575 O  O     . GLU A 1 459 ? 23.119 52.166 30.717  1.00 19.79  ? 459  GLU A O     1 
ATOM   3576 C  CB    . GLU A 1 459 ? 24.379 53.946 29.003  1.00 24.32  ? 459  GLU A CB    1 
ATOM   3577 C  CG    . GLU A 1 459 ? 25.074 54.689 27.882  1.00 22.07  ? 459  GLU A CG    1 
ATOM   3578 C  CD    . GLU A 1 459 ? 25.020 56.178 27.983  1.00 66.22  ? 459  GLU A CD    1 
ATOM   3579 O  OE1   . GLU A 1 459 ? 24.298 56.890 28.642  1.00 27.47  ? 459  GLU A OE1   1 
ATOM   3580 O  OE2   . GLU A 1 459 ? 25.916 56.654 27.242  1.00 31.29  ? 459  GLU A OE2   1 
ATOM   3581 N  N     . ILE A 1 460 ? 25.186 51.254 31.057  1.00 19.14  ? 460  ILE A N     1 
ATOM   3582 C  CA    . ILE A 1 460 ? 24.830 50.798 32.409  1.00 21.29  ? 460  ILE A CA    1 
ATOM   3583 C  C     . ILE A 1 460 ? 25.863 51.329 33.397  1.00 31.06  ? 460  ILE A C     1 
ATOM   3584 O  O     . ILE A 1 460 ? 26.885 50.677 33.586  1.00 30.16  ? 460  ILE A O     1 
ATOM   3585 C  CB    . ILE A 1 460 ? 24.832 49.300 32.491  1.00 29.79  ? 460  ILE A CB    1 
ATOM   3586 C  CG1   . ILE A 1 460 ? 24.316 48.809 31.135  1.00 56.08  ? 460  ILE A CG1   1 
ATOM   3587 C  CG2   . ILE A 1 460 ? 23.985 48.838 33.695  1.00 25.94  ? 460  ILE A CG2   1 
ATOM   3588 C  CD1   . ILE A 1 460 ? 23.463 47.563 31.209  1.00 41.49  ? 460  ILE A CD1   1 
ATOM   3589 N  N     . PHE A 1 461 ? 25.641 52.539 33.953  1.00 22.65  ? 461  PHE A N     1 
ATOM   3590 C  CA    . PHE A 1 461 ? 26.543 53.211 34.857  1.00 13.95  ? 461  PHE A CA    1 
ATOM   3591 C  C     . PHE A 1 461 ? 26.170 53.017 36.311  1.00 29.21  ? 461  PHE A C     1 
ATOM   3592 O  O     . PHE A 1 461 ? 25.202 52.330 36.633  1.00 25.43  ? 461  PHE A O     1 
ATOM   3593 C  CB    . PHE A 1 461 ? 26.400 54.701 34.615  1.00 14.40  ? 461  PHE A CB    1 
ATOM   3594 C  CG    . PHE A 1 461 ? 26.705 55.040 33.155  1.00 21.82  ? 461  PHE A CG    1 
ATOM   3595 C  CD1   . PHE A 1 461 ? 27.583 54.285 32.386  1.00 30.71  ? 461  PHE A CD1   1 
ATOM   3596 C  CD2   . PHE A 1 461 ? 26.211 56.214 32.595  1.00 37.72  ? 461  PHE A CD2   1 
ATOM   3597 C  CE1   . PHE A 1 461 ? 27.946 54.619 31.084  1.00 33.03  ? 461  PHE A CE1   1 
ATOM   3598 C  CE2   . PHE A 1 461 ? 26.568 56.582 31.297  1.00 44.36  ? 461  PHE A CE2   1 
ATOM   3599 C  CZ    . PHE A 1 461 ? 27.424 55.786 30.538  1.00 28.09  ? 461  PHE A CZ    1 
ATOM   3600 N  N     . LYS A 1 462 ? 26.943 53.639 37.177  1.00 29.18  ? 462  LYS A N     1 
ATOM   3601 C  CA    . LYS A 1 462 ? 26.749 53.579 38.617  1.00 33.20  ? 462  LYS A CA    1 
ATOM   3602 C  C     . LYS A 1 462 ? 25.403 54.151 38.879  1.00 25.33  ? 462  LYS A C     1 
ATOM   3603 O  O     . LYS A 1 462 ? 24.662 53.646 39.691  1.00 34.13  ? 462  LYS A O     1 
ATOM   3604 C  CB    . LYS A 1 462 ? 27.582 54.688 39.321  1.00 38.19  ? 462  LYS A CB    1 
ATOM   3605 C  CG    . LYS A 1 462 ? 28.945 54.333 39.834  1.00 96.14  ? 462  LYS A CG    1 
ATOM   3606 C  CD    . LYS A 1 462 ? 29.381 52.904 39.548  1.00 49.18  ? 462  LYS A CD    1 
ATOM   3607 C  CE    . LYS A 1 462 ? 30.678 52.602 40.306  1.00 100.00 ? 462  LYS A CE    1 
ATOM   3608 N  NZ    . LYS A 1 462 ? 30.754 53.193 41.675  1.00 100.00 ? 462  LYS A NZ    1 
ATOM   3609 N  N     . VAL A 1 463 ? 25.163 55.255 38.171  1.00 21.82  ? 463  VAL A N     1 
ATOM   3610 C  CA    . VAL A 1 463 ? 23.924 55.988 38.309  1.00 22.62  ? 463  VAL A CA    1 
ATOM   3611 C  C     . VAL A 1 463 ? 23.306 56.128 36.946  1.00 29.61  ? 463  VAL A C     1 
ATOM   3612 O  O     . VAL A 1 463 ? 23.983 56.628 36.055  1.00 22.70  ? 463  VAL A O     1 
ATOM   3613 C  CB    . VAL A 1 463 ? 24.125 57.432 38.798  1.00 26.29  ? 463  VAL A CB    1 
ATOM   3614 C  CG1   . VAL A 1 463 ? 22.778 58.153 38.954  1.00 27.02  ? 463  VAL A CG1   1 
ATOM   3615 C  CG2   . VAL A 1 463 ? 24.723 57.353 40.149  1.00 42.47  ? 463  VAL A CG2   1 
ATOM   3616 N  N     . ASN A 1 464 ? 22.076 55.657 36.787  1.00 21.45  ? 464  ASN A N     1 
ATOM   3617 C  CA    . ASN A 1 464 ? 21.414 55.764 35.505  1.00 17.87  ? 464  ASN A CA    1 
ATOM   3618 C  C     . ASN A 1 464 ? 20.228 56.710 35.632  1.00 17.43  ? 464  ASN A C     1 
ATOM   3619 O  O     . ASN A 1 464 ? 19.432 56.521 36.518  1.00 15.93  ? 464  ASN A O     1 
ATOM   3620 C  CB    . ASN A 1 464 ? 21.048 54.396 34.920  1.00 10.93  ? 464  ASN A CB    1 
ATOM   3621 C  CG    . ASN A 1 464 ? 22.269 53.581 34.788  1.00 15.97  ? 464  ASN A CG    1 
ATOM   3622 O  OD1   . ASN A 1 464 ? 23.191 53.842 33.927  1.00 17.90  ? 464  ASN A OD1   1 
ATOM   3623 N  ND2   . ASN A 1 464 ? 22.238 52.536 35.564  1.00 20.93  ? 464  ASN A ND2   1 
ATOM   3624 N  N     . SER A 1 465 ? 20.152 57.749 34.776  1.00 17.89  ? 465  SER A N     1 
ATOM   3625 C  CA    . SER A 1 465 ? 19.101 58.744 34.806  1.00 17.05  ? 465  SER A CA    1 
ATOM   3626 C  C     . SER A 1 465 ? 18.345 58.752 33.484  1.00 9.45   ? 465  SER A C     1 
ATOM   3627 O  O     . SER A 1 465 ? 18.422 57.795 32.732  1.00 17.30  ? 465  SER A O     1 
ATOM   3628 C  CB    . SER A 1 465 ? 19.687 60.136 35.115  1.00 14.63  ? 465  SER A CB    1 
ATOM   3629 O  OG    . SER A 1 465 ? 18.670 61.036 35.528  1.00 26.82  ? 465  SER A OG    1 
ATOM   3630 N  N     . PHE A 1 466 ? 17.570 59.803 33.251  1.00 14.07  ? 466  PHE A N     1 
ATOM   3631 C  CA    . PHE A 1 466 ? 16.709 59.880 32.085  1.00 16.15  ? 466  PHE A CA    1 
ATOM   3632 C  C     . PHE A 1 466 ? 17.425 59.695 30.744  1.00 17.63  ? 466  PHE A C     1 
ATOM   3633 O  O     . PHE A 1 466 ? 16.952 58.995 29.866  1.00 15.40  ? 466  PHE A O     1 
ATOM   3634 C  CB    . PHE A 1 466 ? 16.002 61.232 32.151  1.00 17.34  ? 466  PHE A CB    1 
ATOM   3635 C  CG    . PHE A 1 466 ? 15.029 61.395 31.039  1.00 18.41  ? 466  PHE A CG    1 
ATOM   3636 C  CD1   . PHE A 1 466 ? 14.008 60.445 30.885  1.00 16.87  ? 466  PHE A CD1   1 
ATOM   3637 C  CD2   . PHE A 1 466 ? 15.184 62.470 30.159  1.00 27.36  ? 466  PHE A CD2   1 
ATOM   3638 C  CE1   . PHE A 1 466 ? 13.100 60.665 29.845  1.00 29.87  ? 466  PHE A CE1   1 
ATOM   3639 C  CE2   . PHE A 1 466 ? 14.294 62.704 29.104  1.00 27.86  ? 466  PHE A CE2   1 
ATOM   3640 C  CZ    . PHE A 1 466 ? 13.267 61.762 28.975  1.00 27.19  ? 466  PHE A CZ    1 
ATOM   3641 N  N     . GLU A 1 467 ? 18.588 60.313 30.609  1.00 13.41  ? 467  GLU A N     1 
ATOM   3642 C  CA    . GLU A 1 467 ? 19.345 60.226 29.377  1.00 16.62  ? 467  GLU A CA    1 
ATOM   3643 C  C     . GLU A 1 467 ? 19.784 58.814 29.133  1.00 21.64  ? 467  GLU A C     1 
ATOM   3644 O  O     . GLU A 1 467 ? 19.834 58.395 27.972  1.00 20.38  ? 467  GLU A O     1 
ATOM   3645 C  CB    . GLU A 1 467 ? 20.595 61.091 29.430  1.00 17.62  ? 467  GLU A CB    1 
ATOM   3646 C  CG    . GLU A 1 467 ? 20.177 62.544 29.534  1.00 23.56  ? 467  GLU A CG    1 
ATOM   3647 C  CD    . GLU A 1 467 ? 19.711 62.967 30.925  1.00 52.10  ? 467  GLU A CD    1 
ATOM   3648 O  OE1   . GLU A 1 467 ? 19.799 62.316 31.936  1.00 21.12  ? 467  GLU A OE1   1 
ATOM   3649 O  OE2   . GLU A 1 467 ? 19.198 64.161 30.940  1.00 44.33  ? 467  GLU A OE2   1 
ATOM   3650 N  N     . GLN A 1 468 ? 20.074 58.070 30.232  1.00 15.69  ? 468  GLN A N     1 
ATOM   3651 C  CA    . GLN A 1 468 ? 20.432 56.658 30.137  1.00 12.67  ? 468  GLN A CA    1 
ATOM   3652 C  C     . GLN A 1 468 ? 19.223 55.824 29.602  1.00 13.60  ? 468  GLN A C     1 
ATOM   3653 O  O     . GLN A 1 468 ? 19.321 54.836 28.830  1.00 11.06  ? 468  GLN A O     1 
ATOM   3654 C  CB    . GLN A 1 468 ? 21.000 55.980 31.375  1.00 10.69  ? 468  GLN A CB    1 
ATOM   3655 C  CG    . GLN A 1 468 ? 22.486 56.245 31.629  1.00 14.50  ? 468  GLN A CG    1 
ATOM   3656 C  CD    . GLN A 1 468 ? 22.680 57.722 31.878  1.00 21.13  ? 468  GLN A CD    1 
ATOM   3657 O  OE1   . GLN A 1 468 ? 22.131 58.365 32.842  1.00 20.62  ? 468  GLN A OE1   1 
ATOM   3658 N  NE2   . GLN A 1 468 ? 23.507 58.315 31.019  1.00 18.13  ? 468  GLN A NE2   1 
ATOM   3659 N  N     . LEU A 1 469 ? 18.063 56.156 30.104  1.00 15.52  ? 469  LEU A N     1 
ATOM   3660 C  CA    . LEU A 1 469 ? 16.888 55.418 29.635  1.00 15.39  ? 469  LEU A CA    1 
ATOM   3661 C  C     . LEU A 1 469 ? 16.710 55.671 28.123  1.00 12.74  ? 469  LEU A C     1 
ATOM   3662 O  O     . LEU A 1 469 ? 16.403 54.738 27.365  1.00 15.14  ? 469  LEU A O     1 
ATOM   3663 C  CB    . LEU A 1 469 ? 15.623 55.901 30.380  1.00 22.02  ? 469  LEU A CB    1 
ATOM   3664 C  CG    . LEU A 1 469 ? 14.296 55.217 29.944  1.00 18.14  ? 469  LEU A CG    1 
ATOM   3665 C  CD1   . LEU A 1 469 ? 14.320 53.742 30.208  1.00 21.57  ? 469  LEU A CD1   1 
ATOM   3666 C  CD2   . LEU A 1 469 ? 13.113 55.852 30.691  1.00 14.09  ? 469  LEU A CD2   1 
ATOM   3667 N  N     . CYS A 1 470 ? 16.897 56.912 27.724  1.00 14.27  ? 470  CYS A N     1 
ATOM   3668 C  CA    . CYS A 1 470 ? 16.761 57.268 26.337  1.00 12.84  ? 470  CYS A CA    1 
ATOM   3669 C  C     . CYS A 1 470 ? 17.668 56.426 25.430  1.00 17.27  ? 470  CYS A C     1 
ATOM   3670 O  O     . CYS A 1 470 ? 17.240 55.760 24.457  1.00 15.75  ? 470  CYS A O     1 
ATOM   3671 C  CB    . CYS A 1 470 ? 17.045 58.750 26.229  1.00 10.74  ? 470  CYS A CB    1 
ATOM   3672 S  SG    . CYS A 1 470 ? 15.620 59.767 26.799  1.00 18.58  ? 470  CYS A SG    1 
ATOM   3673 N  N     . ILE A 1 471 ? 18.947 56.494 25.735  1.00 15.96  ? 471  ILE A N     1 
ATOM   3674 C  CA    . ILE A 1 471 ? 19.924 55.783 24.956  1.00 10.34  ? 471  ILE A CA    1 
ATOM   3675 C  C     . ILE A 1 471 ? 19.648 54.294 24.979  1.00 9.81   ? 471  ILE A C     1 
ATOM   3676 O  O     . ILE A 1 471 ? 19.842 53.589 23.999  1.00 13.63  ? 471  ILE A O     1 
ATOM   3677 C  CB    . ILE A 1 471 ? 21.427 56.241 25.285  1.00 18.91  ? 471  ILE A CB    1 
ATOM   3678 C  CG1   . ILE A 1 471 ? 22.393 55.684 24.279  1.00 17.53  ? 471  ILE A CG1   1 
ATOM   3679 C  CG2   . ILE A 1 471 ? 21.967 55.543 26.488  1.00 19.85  ? 471  ILE A CG2   1 
ATOM   3680 C  CD1   . ILE A 1 471 ? 22.047 56.218 22.894  1.00 18.25  ? 471  ILE A CD1   1 
ATOM   3681 N  N     . ASN A 1 472 ? 19.231 53.745 26.135  1.00 10.07  ? 472  ASN A N     1 
ATOM   3682 C  CA    . ASN A 1 472 ? 19.023 52.309 26.191  1.00 7.28   ? 472  ASN A CA    1 
ATOM   3683 C  C     . ASN A 1 472 ? 17.782 51.913 25.406  1.00 11.68  ? 472  ASN A C     1 
ATOM   3684 O  O     . ASN A 1 472 ? 17.721 50.803 24.826  1.00 11.68  ? 472  ASN A O     1 
ATOM   3685 C  CB    . ASN A 1 472 ? 18.789 51.947 27.653  1.00 15.77  ? 472  ASN A CB    1 
ATOM   3686 C  CG    . ASN A 1 472 ? 20.150 51.977 28.308  1.00 34.04  ? 472  ASN A CG    1 
ATOM   3687 O  OD1   . ASN A 1 472 ? 21.136 51.959 27.583  1.00 15.75  ? 472  ASN A OD1   1 
ATOM   3688 N  ND2   . ASN A 1 472 ? 20.237 51.988 29.646  1.00 14.67  ? 472  ASN A ND2   1 
ATOM   3689 N  N     . TYR A 1 473 ? 16.829 52.869 25.394  1.00 16.14  ? 473  TYR A N     1 
ATOM   3690 C  CA    . TYR A 1 473 ? 15.600 52.705 24.593  1.00 12.90  ? 473  TYR A CA    1 
ATOM   3691 C  C     . TYR A 1 473 ? 15.977 52.592 23.068  1.00 16.90  ? 473  TYR A C     1 
ATOM   3692 O  O     . TYR A 1 473 ? 15.564 51.693 22.309  1.00 14.03  ? 473  TYR A O     1 
ATOM   3693 C  CB    . TYR A 1 473 ? 14.744 53.977 24.794  1.00 13.43  ? 473  TYR A CB    1 
ATOM   3694 C  CG    . TYR A 1 473 ? 13.444 54.130 23.922  1.00 18.68  ? 473  TYR A CG    1 
ATOM   3695 C  CD1   . TYR A 1 473 ? 12.693 53.024 23.491  1.00 15.00  ? 473  TYR A CD1   1 
ATOM   3696 C  CD2   . TYR A 1 473 ? 13.015 55.421 23.571  1.00 16.73  ? 473  TYR A CD2   1 
ATOM   3697 C  CE1   . TYR A 1 473 ? 11.589 53.172 22.648  1.00 17.58  ? 473  TYR A CE1   1 
ATOM   3698 C  CE2   . TYR A 1 473 ? 11.945 55.603 22.678  1.00 22.33  ? 473  TYR A CE2   1 
ATOM   3699 C  CZ    . TYR A 1 473 ? 11.220 54.468 22.281  1.00 15.86  ? 473  TYR A CZ    1 
ATOM   3700 O  OH    . TYR A 1 473 ? 10.057 54.649 21.550  1.00 18.99  ? 473  TYR A OH    1 
ATOM   3701 N  N     . THR A 1 474 ? 16.815 53.512 22.640  1.00 14.09  ? 474  THR A N     1 
ATOM   3702 C  CA    . THR A 1 474 ? 17.298 53.466 21.265  1.00 18.37  ? 474  THR A CA    1 
ATOM   3703 C  C     . THR A 1 474 ? 17.970 52.140 20.962  1.00 11.53  ? 474  THR A C     1 
ATOM   3704 O  O     . THR A 1 474 ? 17.817 51.488 19.910  1.00 13.04  ? 474  THR A O     1 
ATOM   3705 C  CB    . THR A 1 474 ? 18.286 54.672 21.087  1.00 13.01  ? 474  THR A CB    1 
ATOM   3706 O  OG1   . THR A 1 474 ? 17.674 55.991 21.228  1.00 14.27  ? 474  THR A OG1   1 
ATOM   3707 C  CG2   . THR A 1 474 ? 18.990 54.533 19.712  1.00 13.26  ? 474  THR A CG2   1 
ATOM   3708 N  N     . ASN A 1 475 ? 18.785 51.719 21.935  1.00 21.54  ? 475  ASN A N     1 
ATOM   3709 C  CA    . ASN A 1 475 ? 19.549 50.504 21.821  1.00 16.06  ? 475  ASN A CA    1 
ATOM   3710 C  C     . ASN A 1 475 ? 18.673 49.279 21.693  1.00 16.33  ? 475  ASN A C     1 
ATOM   3711 O  O     . ASN A 1 475 ? 18.976 48.362 20.926  1.00 14.54  ? 475  ASN A O     1 
ATOM   3712 C  CB    . ASN A 1 475 ? 20.689 50.456 22.839  1.00 12.48  ? 475  ASN A CB    1 
ATOM   3713 C  CG    . ASN A 1 475 ? 21.924 51.268 22.220  1.00 20.11  ? 475  ASN A CG    1 
ATOM   3714 O  OD1   . ASN A 1 475 ? 22.653 50.757 21.298  1.00 19.37  ? 475  ASN A OD1   1 
ATOM   3715 N  ND2   . ASN A 1 475 ? 22.180 52.497 22.652  1.00 13.80  ? 475  ASN A ND2   1 
ATOM   3716 N  N     . GLU A 1 476 ? 17.532 49.250 22.423  1.00 14.05  ? 476  GLU A N     1 
ATOM   3717 C  CA    . GLU A 1 476 ? 16.640 48.092 22.298  1.00 13.14  ? 476  GLU A CA    1 
ATOM   3718 C  C     . GLU A 1 476 ? 16.109 48.031 20.886  1.00 11.33  ? 476  GLU A C     1 
ATOM   3719 O  O     . GLU A 1 476 ? 15.887 46.947 20.315  1.00 20.52  ? 476  GLU A O     1 
ATOM   3720 C  CB    . GLU A 1 476 ? 15.346 48.344 23.076  1.00 23.77  ? 476  GLU A CB    1 
ATOM   3721 C  CG    . GLU A 1 476 ? 15.529 48.178 24.569  1.00 24.75  ? 476  GLU A CG    1 
ATOM   3722 C  CD    . GLU A 1 476 ? 15.951 46.796 25.033  1.00 24.34  ? 476  GLU A CD    1 
ATOM   3723 O  OE1   . GLU A 1 476 ? 15.699 45.800 24.221  1.00 23.96  ? 476  GLU A OE1   1 
ATOM   3724 O  OE2   . GLU A 1 476 ? 16.438 46.616 26.125  1.00 20.90  ? 476  GLU A OE2   1 
ATOM   3725 N  N     . LYS A 1 477 ? 15.828 49.243 20.371  1.00 12.67  ? 477  LYS A N     1 
ATOM   3726 C  CA    . LYS A 1 477 ? 15.330 49.341 18.995  1.00 21.07  ? 477  LYS A CA    1 
ATOM   3727 C  C     . LYS A 1 477 ? 16.347 48.844 17.962  1.00 19.83  ? 477  LYS A C     1 
ATOM   3728 O  O     . LYS A 1 477 ? 16.028 48.069 17.041  1.00 14.15  ? 477  LYS A O     1 
ATOM   3729 C  CB    . LYS A 1 477 ? 14.732 50.708 18.627  1.00 14.62  ? 477  LYS A CB    1 
ATOM   3730 C  CG    . LYS A 1 477 ? 13.292 50.817 19.205  1.00 20.35  ? 477  LYS A CG    1 
ATOM   3731 C  CD    . LYS A 1 477 ? 12.378 51.906 18.635  1.00 26.96  ? 477  LYS A CD    1 
ATOM   3732 C  CE    . LYS A 1 477 ? 10.889 51.626 18.906  1.00 20.70  ? 477  LYS A CE    1 
ATOM   3733 N  NZ    . LYS A 1 477 ? 10.103 52.679 18.268  1.00 32.17  ? 477  LYS A NZ    1 
ATOM   3734 N  N     . LEU A 1 478 ? 17.610 49.295 18.122  1.00 18.94  ? 478  LEU A N     1 
ATOM   3735 C  CA    . LEU A 1 478 ? 18.653 48.879 17.157  1.00 17.03  ? 478  LEU A CA    1 
ATOM   3736 C  C     . LEU A 1 478 ? 18.946 47.415 17.277  1.00 15.46  ? 478  LEU A C     1 
ATOM   3737 O  O     . LEU A 1 478 ? 19.206 46.738 16.310  1.00 16.85  ? 478  LEU A O     1 
ATOM   3738 C  CB    . LEU A 1 478 ? 19.915 49.683 17.387  1.00 19.53  ? 478  LEU A CB    1 
ATOM   3739 C  CG    . LEU A 1 478 ? 19.722 51.178 17.269  1.00 21.97  ? 478  LEU A CG    1 
ATOM   3740 C  CD1   . LEU A 1 478 ? 21.021 51.833 17.618  1.00 13.42  ? 478  LEU A CD1   1 
ATOM   3741 C  CD2   . LEU A 1 478 ? 19.267 51.580 15.832  1.00 22.49  ? 478  LEU A CD2   1 
ATOM   3742 N  N     . GLN A 1 479 ? 18.924 46.896 18.503  1.00 15.77  ? 479  GLN A N     1 
ATOM   3743 C  CA    . GLN A 1 479 ? 19.150 45.471 18.673  1.00 12.34  ? 479  GLN A CA    1 
ATOM   3744 C  C     . GLN A 1 479 ? 18.043 44.650 18.014  1.00 21.51  ? 479  GLN A C     1 
ATOM   3745 O  O     . GLN A 1 479 ? 18.288 43.604 17.385  1.00 13.34  ? 479  GLN A O     1 
ATOM   3746 C  CB    . GLN A 1 479 ? 19.397 45.114 20.194  1.00 12.47  ? 479  GLN A CB    1 
ATOM   3747 C  CG    . GLN A 1 479 ? 19.653 43.620 20.433  1.00 18.10  ? 479  GLN A CG    1 
ATOM   3748 C  CD    . GLN A 1 479 ? 20.913 43.075 19.673  1.00 26.48  ? 479  GLN A CD    1 
ATOM   3749 O  OE1   . GLN A 1 479 ? 22.033 43.681 19.713  1.00 20.90  ? 479  GLN A OE1   1 
ATOM   3750 N  NE2   . GLN A 1 479 ? 20.767 41.983 18.890  1.00 22.63  ? 479  GLN A NE2   1 
ATOM   3751 N  N     . GLN A 1 480 ? 16.805 45.100 18.172  1.00 19.94  ? 480  GLN A N     1 
ATOM   3752 C  CA    . GLN A 1 480 ? 15.685 44.424 17.564  1.00 14.17  ? 480  GLN A CA    1 
ATOM   3753 C  C     . GLN A 1 480 ? 15.793 44.497 16.003  1.00 10.82  ? 480  GLN A C     1 
ATOM   3754 O  O     . GLN A 1 480 ? 15.480 43.535 15.282  1.00 18.93  ? 480  GLN A O     1 
ATOM   3755 C  CB    . GLN A 1 480 ? 14.435 45.129 18.158  1.00 16.67  ? 480  GLN A CB    1 
ATOM   3756 C  CG    . GLN A 1 480 ? 13.151 44.708 17.341  1.00 26.92  ? 480  GLN A CG    1 
ATOM   3757 C  CD    . GLN A 1 480 ? 11.848 45.398 17.737  1.00 16.76  ? 480  GLN A CD    1 
ATOM   3758 O  OE1   . GLN A 1 480 ? 11.810 46.600 17.593  1.00 17.66  ? 480  GLN A OE1   1 
ATOM   3759 N  NE2   . GLN A 1 480 ? 10.864 44.616 18.265  1.00 17.80  ? 480  GLN A NE2   1 
ATOM   3760 N  N     . PHE A 1 481 ? 16.219 45.650 15.491  1.00 14.03  ? 481  PHE A N     1 
ATOM   3761 C  CA    . PHE A 1 481 ? 16.450 45.798 14.060  1.00 13.34  ? 481  PHE A CA    1 
ATOM   3762 C  C     . PHE A 1 481 ? 17.536 44.842 13.610  1.00 23.18  ? 481  PHE A C     1 
ATOM   3763 O  O     . PHE A 1 481 ? 17.472 44.195 12.566  1.00 19.20  ? 481  PHE A O     1 
ATOM   3764 C  CB    . PHE A 1 481 ? 16.980 47.161 13.944  1.00 10.78  ? 481  PHE A CB    1 
ATOM   3765 C  CG    . PHE A 1 481 ? 17.388 47.578 12.544  1.00 22.17  ? 481  PHE A CG    1 
ATOM   3766 C  CD1   . PHE A 1 481 ? 16.433 47.903 11.566  1.00 32.71  ? 481  PHE A CD1   1 
ATOM   3767 C  CD2   . PHE A 1 481 ? 18.729 47.828 12.230  1.00 17.16  ? 481  PHE A CD2   1 
ATOM   3768 C  CE1   . PHE A 1 481 ? 16.801 48.334 10.276  1.00 31.31  ? 481  PHE A CE1   1 
ATOM   3769 C  CE2   . PHE A 1 481 ? 19.120 48.256 10.953  1.00 28.97  ? 481  PHE A CE2   1 
ATOM   3770 C  CZ    . PHE A 1 481 ? 18.162 48.511 9.973   1.00 17.77  ? 481  PHE A CZ    1 
ATOM   3771 N  N     . PHE A 1 482 ? 18.575 44.704 14.416  1.00 19.37  ? 482  PHE A N     1 
ATOM   3772 C  CA    . PHE A 1 482 ? 19.593 43.742 14.066  1.00 15.34  ? 482  PHE A CA    1 
ATOM   3773 C  C     . PHE A 1 482 ? 19.044 42.317 13.998  1.00 20.08  ? 482  PHE A C     1 
ATOM   3774 O  O     . PHE A 1 482 ? 19.236 41.547 13.031  1.00 19.63  ? 482  PHE A O     1 
ATOM   3775 C  CB    . PHE A 1 482 ? 20.858 43.821 14.992  1.00 9.67   ? 482  PHE A CB    1 
ATOM   3776 C  CG    . PHE A 1 482 ? 21.830 42.735 14.620  1.00 12.88  ? 482  PHE A CG    1 
ATOM   3777 C  CD1   . PHE A 1 482 ? 22.752 42.948 13.576  1.00 18.95  ? 482  PHE A CD1   1 
ATOM   3778 C  CD2   . PHE A 1 482 ? 21.790 41.481 15.226  1.00 18.41  ? 482  PHE A CD2   1 
ATOM   3779 C  CE1   . PHE A 1 482 ? 23.643 41.943 13.160  1.00 17.84  ? 482  PHE A CE1   1 
ATOM   3780 C  CE2   . PHE A 1 482 ? 22.665 40.457 14.828  1.00 20.14  ? 482  PHE A CE2   1 
ATOM   3781 C  CZ    . PHE A 1 482 ? 23.571 40.683 13.778  1.00 17.46  ? 482  PHE A CZ    1 
ATOM   3782 N  N     . ASN A 1 483 ? 18.332 41.937 15.044  1.00 18.91  ? 483  ASN A N     1 
ATOM   3783 C  CA    . ASN A 1 483 ? 17.758 40.622 15.094  1.00 14.80  ? 483  ASN A CA    1 
ATOM   3784 C  C     . ASN A 1 483 ? 16.871 40.328 13.915  1.00 24.62  ? 483  ASN A C     1 
ATOM   3785 O  O     . ASN A 1 483 ? 16.954 39.258 13.331  1.00 25.01  ? 483  ASN A O     1 
ATOM   3786 C  CB    . ASN A 1 483 ? 17.087 40.303 16.387  1.00 18.52  ? 483  ASN A CB    1 
ATOM   3787 C  CG    . ASN A 1 483 ? 18.210 40.047 17.444  1.00 29.84  ? 483  ASN A CG    1 
ATOM   3788 O  OD1   . ASN A 1 483 ? 19.142 39.236 17.249  1.00 53.08  ? 483  ASN A OD1   1 
ATOM   3789 N  ND2   . ASN A 1 483 ? 18.093 40.725 18.565  1.00 42.23  ? 483  ASN A ND2   1 
ATOM   3790 N  N     . HIS A 1 484 ? 16.041 41.296 13.554  1.00 19.35  ? 484  HIS A N     1 
ATOM   3791 C  CA    . HIS A 1 484 ? 15.181 41.115 12.411  1.00 22.09  ? 484  HIS A CA    1 
ATOM   3792 C  C     . HIS A 1 484 ? 16.013 40.956 11.167  1.00 29.04  ? 484  HIS A C     1 
ATOM   3793 O  O     . HIS A 1 484 ? 15.759 40.116 10.315  1.00 29.24  ? 484  HIS A O     1 
ATOM   3794 C  CB    . HIS A 1 484 ? 14.203 42.243 12.165  1.00 30.51  ? 484  HIS A CB    1 
ATOM   3795 C  CG    . HIS A 1 484 ? 13.053 42.275 13.128  1.00 100.00 ? 484  HIS A CG    1 
ATOM   3796 N  ND1   . HIS A 1 484 ? 12.733 41.165 13.906  1.00 100.00 ? 484  HIS A ND1   1 
ATOM   3797 C  CD2   . HIS A 1 484 ? 12.174 43.292 13.437  1.00 100.00 ? 484  HIS A CD2   1 
ATOM   3798 C  CE1   . HIS A 1 484 ? 11.683 41.514 14.661  1.00 100.00 ? 484  HIS A CE1   1 
ATOM   3799 N  NE2   . HIS A 1 484 ? 11.320 42.784 14.405  1.00 100.00 ? 484  HIS A NE2   1 
ATOM   3800 N  N     . HIS A 1 485 ? 17.008 41.801 11.056  1.00 26.82  ? 485  HIS A N     1 
ATOM   3801 C  CA    . HIS A 1 485 ? 17.864 41.732 9.899   1.00 21.10  ? 485  HIS A CA    1 
ATOM   3802 C  C     . HIS A 1 485 ? 18.586 40.402 9.812   1.00 28.55  ? 485  HIS A C     1 
ATOM   3803 O  O     . HIS A 1 485 ? 18.639 39.775 8.750   1.00 28.33  ? 485  HIS A O     1 
ATOM   3804 C  CB    . HIS A 1 485 ? 18.855 42.809 9.999   1.00 19.90  ? 485  HIS A CB    1 
ATOM   3805 C  CG    . HIS A 1 485 ? 19.613 42.850 8.724   1.00 75.01  ? 485  HIS A CG    1 
ATOM   3806 N  ND1   . HIS A 1 485 ? 18.959 43.206 7.533   1.00 28.68  ? 485  HIS A ND1   1 
ATOM   3807 C  CD2   . HIS A 1 485 ? 20.953 42.663 8.487   1.00 39.54  ? 485  HIS A CD2   1 
ATOM   3808 C  CE1   . HIS A 1 485 ? 19.930 43.155 6.629   1.00 24.13  ? 485  HIS A CE1   1 
ATOM   3809 N  NE2   . HIS A 1 485 ? 21.142 42.865 7.135   1.00 34.65  ? 485  HIS A NE2   1 
ATOM   3810 N  N     . MET A 1 486 ? 19.175 39.978 10.917  1.00 32.26  ? 486  MET A N     1 
ATOM   3811 C  CA    . MET A 1 486 ? 19.885 38.714 10.926  1.00 28.04  ? 486  MET A CA    1 
ATOM   3812 C  C     . MET A 1 486 ? 18.987 37.584 10.501  1.00 32.99  ? 486  MET A C     1 
ATOM   3813 O  O     . MET A 1 486 ? 19.401 36.680 9.789   1.00 42.91  ? 486  MET A O     1 
ATOM   3814 C  CB    . MET A 1 486 ? 20.414 38.372 12.287  1.00 24.98  ? 486  MET A CB    1 
ATOM   3815 C  CG    . MET A 1 486 ? 21.405 37.229 12.305  1.00 50.25  ? 486  MET A CG    1 
ATOM   3816 S  SD    . MET A 1 486 ? 21.715 36.642 14.040  1.00 40.69  ? 486  MET A SD    1 
ATOM   3817 C  CE    . MET A 1 486 ? 22.561 35.002 13.937  1.00 37.06  ? 486  MET A CE    1 
ATOM   3818 N  N     . PHE A 1 487 ? 17.746 37.654 10.933  1.00 34.58  ? 487  PHE A N     1 
ATOM   3819 C  CA    . PHE A 1 487 ? 16.760 36.655 10.583  1.00 27.69  ? 487  PHE A CA    1 
ATOM   3820 C  C     . PHE A 1 487 ? 16.566 36.520 9.081   1.00 41.96  ? 487  PHE A C     1 
ATOM   3821 O  O     . PHE A 1 487 ? 16.626 35.428 8.532   1.00 50.83  ? 487  PHE A O     1 
ATOM   3822 C  CB    . PHE A 1 487 ? 15.422 37.252 11.062  1.00 46.56  ? 487  PHE A CB    1 
ATOM   3823 C  CG    . PHE A 1 487 ? 14.221 36.394 10.783  1.00 82.92  ? 487  PHE A CG    1 
ATOM   3824 C  CD1   . PHE A 1 487 ? 14.164 35.088 11.269  1.00 100.00 ? 487  PHE A CD1   1 
ATOM   3825 C  CD2   . PHE A 1 487 ? 13.082 36.904 10.166  1.00 100.00 ? 487  PHE A CD2   1 
ATOM   3826 C  CE1   . PHE A 1 487 ? 13.027 34.296 11.116  1.00 95.01  ? 487  PHE A CE1   1 
ATOM   3827 C  CE2   . PHE A 1 487 ? 11.934 36.123 10.004  1.00 85.18  ? 487  PHE A CE2   1 
ATOM   3828 C  CZ    . PHE A 1 487 ? 11.897 34.815 10.479  1.00 56.24  ? 487  PHE A CZ    1 
ATOM   3829 N  N     . LYS A 1 488 ? 16.288 37.622 8.387   1.00 37.54  ? 488  LYS A N     1 
ATOM   3830 C  CA    . LYS A 1 488 ? 16.079 37.523 6.949   1.00 28.65  ? 488  LYS A CA    1 
ATOM   3831 C  C     . LYS A 1 488 ? 17.304 37.039 6.182   1.00 29.77  ? 488  LYS A C     1 
ATOM   3832 O  O     . LYS A 1 488 ? 17.272 36.165 5.285   1.00 28.31  ? 488  LYS A O     1 
ATOM   3833 C  CB    . LYS A 1 488 ? 15.633 38.836 6.380   1.00 42.00  ? 488  LYS A CB    1 
ATOM   3834 C  CG    . LYS A 1 488 ? 14.601 39.478 7.282   1.00 75.72  ? 488  LYS A CG    1 
ATOM   3835 C  CD    . LYS A 1 488 ? 13.975 40.673 6.600   1.00 100.00 ? 488  LYS A CD    1 
ATOM   3836 C  CE    . LYS A 1 488 ? 14.893 41.863 6.331   1.00 100.00 ? 488  LYS A CE    1 
ATOM   3837 N  NZ    . LYS A 1 488 ? 14.346 43.048 7.005   1.00 41.15  ? 488  LYS A NZ    1 
ATOM   3838 N  N     . VAL A 1 489 ? 18.418 37.612 6.591   1.00 27.05  ? 489  VAL A N     1 
ATOM   3839 C  CA    . VAL A 1 489 ? 19.676 37.356 5.964   1.00 28.41  ? 489  VAL A CA    1 
ATOM   3840 C  C     . VAL A 1 489 ? 20.135 35.909 6.072   1.00 53.64  ? 489  VAL A C     1 
ATOM   3841 O  O     . VAL A 1 489 ? 20.720 35.303 5.144   1.00 40.55  ? 489  VAL A O     1 
ATOM   3842 C  CB    . VAL A 1 489 ? 20.581 38.556 6.208   1.00 53.75  ? 489  VAL A CB    1 
ATOM   3843 C  CG1   . VAL A 1 489 ? 21.902 38.105 6.725   1.00 56.28  ? 489  VAL A CG1   1 
ATOM   3844 C  CG2   . VAL A 1 489 ? 20.686 39.462 4.963   1.00 29.07  ? 489  VAL A CG2   1 
ATOM   3845 N  N     . GLU A 1 490 ? 19.805 35.330 7.220   1.00 54.80  ? 490  GLU A N     1 
ATOM   3846 C  CA    . GLU A 1 490 ? 20.132 33.938 7.452   1.00 48.96  ? 490  GLU A CA    1 
ATOM   3847 C  C     . GLU A 1 490 ? 19.197 33.079 6.644   1.00 84.28  ? 490  GLU A C     1 
ATOM   3848 O  O     . GLU A 1 490 ? 19.627 32.113 6.010   1.00 37.93  ? 490  GLU A O     1 
ATOM   3849 C  CB    . GLU A 1 490 ? 20.146 33.493 8.927   1.00 59.44  ? 490  GLU A CB    1 
ATOM   3850 C  CG    . GLU A 1 490 ? 21.457 33.929 9.637   1.00 45.18  ? 490  GLU A CG    1 
ATOM   3851 C  CD    . GLU A 1 490 ? 22.612 33.092 9.244   1.00 95.30  ? 490  GLU A CD    1 
ATOM   3852 O  OE1   . GLU A 1 490 ? 23.161 33.294 8.173   1.00 39.32  ? 490  GLU A OE1   1 
ATOM   3853 O  OE2   . GLU A 1 490 ? 22.833 32.127 10.125  1.00 50.74  ? 490  GLU A OE2   1 
ATOM   3854 N  N     . GLN A 1 491 ? 17.925 33.467 6.633   1.00 26.17  ? 491  GLN A N     1 
ATOM   3855 C  CA    . GLN A 1 491 ? 16.929 32.723 5.879   1.00 41.02  ? 491  GLN A CA    1 
ATOM   3856 C  C     . GLN A 1 491 ? 17.262 32.715 4.380   1.00 59.80  ? 491  GLN A C     1 
ATOM   3857 O  O     . GLN A 1 491 ? 17.218 31.694 3.688   1.00 35.25  ? 491  GLN A O     1 
ATOM   3858 C  CB    . GLN A 1 491 ? 15.645 33.519 5.998   1.00 30.59  ? 491  GLN A CB    1 
ATOM   3859 C  CG    . GLN A 1 491 ? 14.602 33.025 6.982   1.00 59.31  ? 491  GLN A CG    1 
ATOM   3860 C  CD    . GLN A 1 491 ? 13.434 33.805 6.474   1.00 92.39  ? 491  GLN A CD    1 
ATOM   3861 O  OE1   . GLN A 1 491 ? 12.289 33.710 6.920   1.00 73.06  ? 491  GLN A OE1   1 
ATOM   3862 N  NE2   . GLN A 1 491 ? 13.760 34.597 5.449   1.00 100.00 ? 491  GLN A NE2   1 
ATOM   3863 N  N     . GLU A 1 492 ? 17.617 33.897 3.873   1.00 40.69  ? 492  GLU A N     1 
ATOM   3864 C  CA    . GLU A 1 492 ? 17.926 34.048 2.471   1.00 52.90  ? 492  GLU A CA    1 
ATOM   3865 C  C     . GLU A 1 492 ? 19.090 33.176 2.069   1.00 47.74  ? 492  GLU A C     1 
ATOM   3866 O  O     . GLU A 1 492 ? 19.112 32.606 0.977   1.00 83.74  ? 492  GLU A O     1 
ATOM   3867 C  CB    . GLU A 1 492 ? 18.506 35.420 2.276   1.00 27.43  ? 492  GLU A CB    1 
ATOM   3868 C  CG    . GLU A 1 492 ? 17.511 36.561 2.307   1.00 73.96  ? 492  GLU A CG    1 
ATOM   3869 C  CD    . GLU A 1 492 ? 18.299 37.772 1.855   1.00 100.00 ? 492  GLU A CD    1 
ATOM   3870 O  OE1   . GLU A 1 492 ? 19.453 37.460 1.229   1.00 77.11  ? 492  GLU A OE1   1 
ATOM   3871 O  OE2   . GLU A 1 492 ? 17.935 38.921 2.048   1.00 100.00 ? 492  GLU A OE2   1 
ATOM   3872 N  N     . LYS A 1 493 ? 20.100 33.129 2.944   1.00 69.44  ? 493  LYS A N     1 
ATOM   3873 C  CA    . LYS A 1 493 ? 21.284 32.331 2.706   1.00 96.78  ? 493  LYS A CA    1 
ATOM   3874 C  C     . LYS A 1 493 ? 20.919 30.859 2.597   1.00 58.38  ? 493  LYS A C     1 
ATOM   3875 O  O     . LYS A 1 493 ? 21.269 30.184 1.664   1.00 36.59  ? 493  LYS A O     1 
ATOM   3876 C  CB    . LYS A 1 493 ? 22.396 32.568 3.701   1.00 40.74  ? 493  LYS A CB    1 
ATOM   3877 C  CG    . LYS A 1 493 ? 23.547 31.533 3.578   1.00 100.00 ? 493  LYS A CG    1 
ATOM   3878 C  CD    . LYS A 1 493 ? 24.598 31.808 2.493   1.00 100.00 ? 493  LYS A CD    1 
ATOM   3879 C  CE    . LYS A 1 493 ? 25.959 31.165 2.772   1.00 54.36  ? 493  LYS A CE    1 
ATOM   3880 N  NZ    . LYS A 1 493 ? 26.613 31.757 3.945   1.00 93.19  ? 493  LYS A NZ    1 
ATOM   3881 N  N     . TYR A 1 494 ? 20.159 30.378 3.552   1.00 44.73  ? 494  TYR A N     1 
ATOM   3882 C  CA    . TYR A 1 494 ? 19.721 28.999 3.568   1.00 100.00 ? 494  TYR A CA    1 
ATOM   3883 C  C     . TYR A 1 494 ? 18.942 28.701 2.309   1.00 73.33  ? 494  TYR A C     1 
ATOM   3884 O  O     . TYR A 1 494 ? 19.048 27.608 1.757   1.00 93.09  ? 494  TYR A O     1 
ATOM   3885 C  CB    . TYR A 1 494 ? 18.876 28.653 4.821   1.00 64.41  ? 494  TYR A CB    1 
ATOM   3886 C  CG    . TYR A 1 494 ? 19.767 28.236 5.963   1.00 94.00  ? 494  TYR A CG    1 
ATOM   3887 C  CD1   . TYR A 1 494 ? 20.828 29.044 6.374   1.00 44.51  ? 494  TYR A CD1   1 
ATOM   3888 C  CD2   . TYR A 1 494 ? 19.571 27.033 6.641   1.00 82.23  ? 494  TYR A CD2   1 
ATOM   3889 C  CE1   . TYR A 1 494 ? 21.683 28.635 7.399   1.00 78.37  ? 494  TYR A CE1   1 
ATOM   3890 C  CE2   . TYR A 1 494 ? 20.377 26.636 7.711   1.00 98.79  ? 494  TYR A CE2   1 
ATOM   3891 C  CZ    . TYR A 1 494 ? 21.452 27.444 8.090   1.00 76.46  ? 494  TYR A CZ    1 
ATOM   3892 O  OH    . TYR A 1 494 ? 22.275 27.120 9.154   1.00 64.15  ? 494  TYR A OH    1 
ATOM   3893 N  N     . LEU A 1 495 ? 18.175 29.701 1.878   1.00 63.58  ? 495  LEU A N     1 
ATOM   3894 C  CA    . LEU A 1 495 ? 17.344 29.598 0.688   1.00 68.54  ? 495  LEU A CA    1 
ATOM   3895 C  C     . LEU A 1 495 ? 18.104 29.502 -0.631  1.00 92.20  ? 495  LEU A C     1 
ATOM   3896 O  O     . LEU A 1 495 ? 17.702 28.716 -1.490  1.00 54.26  ? 495  LEU A O     1 
ATOM   3897 C  CB    . LEU A 1 495 ? 16.245 30.632 0.640   1.00 58.37  ? 495  LEU A CB    1 
ATOM   3898 C  CG    . LEU A 1 495 ? 14.955 29.888 0.558   1.00 100.00 ? 495  LEU A CG    1 
ATOM   3899 C  CD1   . LEU A 1 495 ? 14.063 30.276 1.742   1.00 100.00 ? 495  LEU A CD1   1 
ATOM   3900 C  CD2   . LEU A 1 495 ? 14.382 30.051 -0.832  1.00 73.85  ? 495  LEU A CD2   1 
ATOM   3901 N  N     . LYS A 1 496 ? 19.182 30.297 -0.769  1.00 43.02  ? 496  LYS A N     1 
ATOM   3902 C  CA    . LYS A 1 496 ? 20.061 30.339 -1.945  1.00 100.00 ? 496  LYS A CA    1 
ATOM   3903 C  C     . LYS A 1 496 ? 20.960 29.082 -2.121  1.00 100.00 ? 496  LYS A C     1 
ATOM   3904 O  O     . LYS A 1 496 ? 21.554 28.837 -3.192  1.00 83.71  ? 496  LYS A O     1 
ATOM   3905 C  CB    . LYS A 1 496 ? 20.802 31.702 -2.102  1.00 32.42  ? 496  LYS A CB    1 
ATOM   3906 C  CG    . LYS A 1 496 ? 19.910 32.943 -2.002  1.00 96.94  ? 496  LYS A CG    1 
ATOM   3907 C  CD    . LYS A 1 496 ? 19.895 33.798 -3.262  1.00 100.00 ? 496  LYS A CD    1 
ATOM   3908 C  CE    . LYS A 1 496 ? 20.740 35.087 -3.203  1.00 100.00 ? 496  LYS A CE    1 
ATOM   3909 N  NZ    . LYS A 1 496 ? 20.194 36.176 -4.044  1.00 100.00 ? 496  LYS A NZ    1 
ATOM   3910 N  N     . GLU A 1 497 ? 21.043 28.261 -1.055  1.00 58.52  ? 497  GLU A N     1 
ATOM   3911 C  CA    . GLU A 1 497 ? 21.828 27.028 -1.038  1.00 49.26  ? 497  GLU A CA    1 
ATOM   3912 C  C     . GLU A 1 497 ? 20.958 25.762 -1.082  1.00 100.00 ? 497  GLU A C     1 
ATOM   3913 O  O     . GLU A 1 497 ? 21.411 24.671 -1.501  1.00 100.00 ? 497  GLU A O     1 
ATOM   3914 C  CB    . GLU A 1 497 ? 22.841 27.002 0.132   1.00 86.08  ? 497  GLU A CB    1 
ATOM   3915 C  CG    . GLU A 1 497 ? 23.972 28.055 -0.007  1.00 46.33  ? 497  GLU A CG    1 
ATOM   3916 C  CD    . GLU A 1 497 ? 25.054 27.702 -0.997  1.00 62.93  ? 497  GLU A CD    1 
ATOM   3917 O  OE1   . GLU A 1 497 ? 25.614 26.539 -0.774  1.00 63.39  ? 497  GLU A OE1   1 
ATOM   3918 O  OE2   . GLU A 1 497 ? 25.393 28.432 -1.895  1.00 71.51  ? 497  GLU A OE2   1 
ATOM   3919 N  N     . LYS A 1 498 ? 19.697 25.942 -0.692  1.00 43.63  ? 498  LYS A N     1 
ATOM   3920 C  CA    . LYS A 1 498 ? 18.687 24.896 -0.608  1.00 75.03  ? 498  LYS A CA    1 
ATOM   3921 C  C     . LYS A 1 498 ? 18.831 24.135 0.714   1.00 70.83  ? 498  LYS A C     1 
ATOM   3922 O  O     . LYS A 1 498 ? 19.229 22.936 0.717   1.00 100.00 ? 498  LYS A O     1 
ATOM   3923 C  CB    . LYS A 1 498 ? 18.686 24.061 -1.927  1.00 89.57  ? 498  LYS A CB    1 
ATOM   3924 C  CG    . LYS A 1 498 ? 17.584 22.984 -2.091  1.00 100.00 ? 498  LYS A CG    1 
ATOM   3925 C  CD    . LYS A 1 498 ? 18.018 21.645 -2.753  1.00 100.00 ? 498  LYS A CD    1 
ATOM   3926 C  CE    . LYS A 1 498 ? 18.814 20.632 -1.898  1.00 100.00 ? 498  LYS A CE    1 
ATOM   3927 N  NZ    . LYS A 1 498 ? 18.039 19.482 -1.355  1.00 100.00 ? 498  LYS A NZ    1 
ATOM   3928 N  N     . ILE A 1 499 ? 18.663 24.833 1.858   1.00 100.00 ? 499  ILE A N     1 
ATOM   3929 C  CA    . ILE A 1 499 ? 18.858 24.289 3.215   1.00 38.78  ? 499  ILE A CA    1 
ATOM   3930 C  C     . ILE A 1 499 ? 17.602 24.058 4.126   1.00 83.06  ? 499  ILE A C     1 
ATOM   3931 O  O     . ILE A 1 499 ? 16.599 23.599 3.724   1.00 95.26  ? 499  ILE A O     1 
ATOM   3932 C  CB    . ILE A 1 499 ? 20.314 24.460 3.819   1.00 40.82  ? 499  ILE A CB    1 
ATOM   3933 C  CG1   . ILE A 1 499 ? 21.465 24.241 2.835   1.00 36.69  ? 499  ILE A CG1   1 
ATOM   3934 C  CG2   . ILE A 1 499 ? 20.596 23.568 4.991   1.00 34.18  ? 499  ILE A CG2   1 
ATOM   3935 C  CD1   . ILE A 1 499 ? 22.783 23.864 3.487   1.00 75.79  ? 499  ILE A CD1   1 
ATOM   3936 N  N     . ASN A 1 500 ? 17.729 24.465 5.422   1.00 100.00 ? 500  ASN A N     1 
ATOM   3937 C  CA    . ASN A 1 500 ? 16.676 24.299 6.478   1.00 100.00 ? 500  ASN A CA    1 
ATOM   3938 C  C     . ASN A 1 500 ? 16.044 25.626 7.041   1.00 100.00 ? 500  ASN A C     1 
ATOM   3939 O  O     . ASN A 1 500 ? 15.021 25.690 7.763   1.00 74.88  ? 500  ASN A O     1 
ATOM   3940 C  CB    . ASN A 1 500 ? 17.326 23.534 7.655   1.00 56.27  ? 500  ASN A CB    1 
ATOM   3941 N  N     . LEU A 1 508 ? 11.168 36.460 20.496  1.00 100.00 ? 508  LEU A N     1 
ATOM   3942 C  CA    . LEU A 1 508 ? 11.427 37.898 20.605  1.00 100.00 ? 508  LEU A CA    1 
ATOM   3943 C  C     . LEU A 1 508 ? 11.992 38.231 21.951  1.00 100.00 ? 508  LEU A C     1 
ATOM   3944 O  O     . LEU A 1 508 ? 12.969 37.620 22.404  1.00 100.00 ? 508  LEU A O     1 
ATOM   3945 C  CB    . LEU A 1 508 ? 10.114 38.710 20.627  1.00 62.38  ? 508  LEU A CB    1 
ATOM   3946 C  CG    . LEU A 1 508 ? 10.255 39.921 19.793  1.00 50.98  ? 508  LEU A CG    1 
ATOM   3947 C  CD1   . LEU A 1 508 ? 10.256 39.506 18.299  1.00 67.80  ? 508  LEU A CD1   1 
ATOM   3948 C  CD2   . LEU A 1 508 ? 9.032  40.685 20.191  1.00 45.50  ? 508  LEU A CD2   1 
ATOM   3949 N  N     . ASP A 1 509 ? 11.276 39.222 22.510  1.00 65.09  ? 509  ASP A N     1 
ATOM   3950 C  CA    . ASP A 1 509 ? 11.458 39.766 23.839  1.00 100.00 ? 509  ASP A CA    1 
ATOM   3951 C  C     . ASP A 1 509 ? 11.701 41.263 23.806  1.00 38.02  ? 509  ASP A C     1 
ATOM   3952 O  O     . ASP A 1 509 ? 11.446 41.983 24.799  1.00 40.06  ? 509  ASP A O     1 
ATOM   3953 C  CB    . ASP A 1 509 ? 12.554 39.087 24.715  1.00 100.00 ? 509  ASP A CB    1 
ATOM   3954 C  CG    . ASP A 1 509 ? 12.139 38.729 26.141  1.00 100.00 ? 509  ASP A CG    1 
ATOM   3955 O  OD1   . ASP A 1 509 ? 11.306 39.563 26.671  1.00 100.00 ? 509  ASP A OD1   1 
ATOM   3956 O  OD2   . ASP A 1 509 ? 12.584 37.727 26.741  1.00 100.00 ? 509  ASP A OD2   1 
ATOM   3957 N  N     . SER A 1 510 ? 12.258 41.756 22.685  1.00 30.63  ? 510  SER A N     1 
ATOM   3958 C  CA    . SER A 1 510 ? 12.609 43.193 22.558  1.00 45.18  ? 510  SER A CA    1 
ATOM   3959 C  C     . SER A 1 510 ? 11.353 44.038 22.647  1.00 20.35  ? 510  SER A C     1 
ATOM   3960 O  O     . SER A 1 510 ? 11.373 45.172 23.175  1.00 24.16  ? 510  SER A O     1 
ATOM   3961 C  CB    . SER A 1 510 ? 13.613 43.509 21.358  1.00 24.58  ? 510  SER A CB    1 
ATOM   3962 O  OG    . SER A 1 510 ? 14.792 44.385 21.698  1.00 60.70  ? 510  SER A OG    1 
ATOM   3963 N  N     . GLN A 1 511 ? 10.250 43.427 22.137  1.00 18.48  ? 511  GLN A N     1 
ATOM   3964 C  CA    . GLN A 1 511 ? 8.983  44.151 22.161  1.00 25.92  ? 511  GLN A CA    1 
ATOM   3965 C  C     . GLN A 1 511 ? 8.454  44.557 23.540  1.00 9.26   ? 511  GLN A C     1 
ATOM   3966 O  O     . GLN A 1 511 ? 8.037  45.702 23.743  1.00 16.89  ? 511  GLN A O     1 
ATOM   3967 C  CB    . GLN A 1 511 ? 7.857  43.685 21.245  1.00 20.21  ? 511  GLN A CB    1 
ATOM   3968 C  CG    . GLN A 1 511 ? 6.923  44.880 20.998  1.00 14.28  ? 511  GLN A CG    1 
ATOM   3969 C  CD    . GLN A 1 511 ? 7.475  45.910 20.076  1.00 14.50  ? 511  GLN A CD    1 
ATOM   3970 O  OE1   . GLN A 1 511 ? 8.122  45.554 19.054  1.00 26.57  ? 511  GLN A OE1   1 
ATOM   3971 N  NE2   . GLN A 1 511 ? 7.282  47.157 20.415  1.00 23.53  ? 511  GLN A NE2   1 
ATOM   3972 N  N     . ALA A 1 512 ? 8.549  43.615 24.452  1.00 12.53  ? 512  ALA A N     1 
ATOM   3973 C  CA    . ALA A 1 512 ? 8.034  43.846 25.788  1.00 16.77  ? 512  ALA A CA    1 
ATOM   3974 C  C     . ALA A 1 512 ? 8.751  44.982 26.473  1.00 15.58  ? 512  ALA A C     1 
ATOM   3975 O  O     . ALA A 1 512 ? 8.163  45.820 27.156  1.00 15.37  ? 512  ALA A O     1 
ATOM   3976 C  CB    . ALA A 1 512 ? 8.147  42.571 26.614  1.00 14.56  ? 512  ALA A CB    1 
ATOM   3977 N  N     . THR A 1 513 ? 10.065 44.979 26.315  1.00 16.74  ? 513  THR A N     1 
ATOM   3978 C  CA    . THR A 1 513 ? 10.862 46.022 26.941  1.00 14.37  ? 513  THR A CA    1 
ATOM   3979 C  C     . THR A 1 513 ? 10.529 47.325 26.259  1.00 15.87  ? 513  THR A C     1 
ATOM   3980 O  O     . THR A 1 513 ? 10.336 48.343 26.919  1.00 12.94  ? 513  THR A O     1 
ATOM   3981 C  CB    . THR A 1 513 ? 12.421 45.742 26.868  1.00 16.06  ? 513  THR A CB    1 
ATOM   3982 O  OG1   . THR A 1 513 ? 12.695 44.614 27.596  1.00 22.75  ? 513  THR A OG1   1 
ATOM   3983 C  CG2   . THR A 1 513 ? 13.215 46.862 27.515  1.00 20.12  ? 513  THR A CG2   1 
ATOM   3984 N  N     . ILE A 1 514 ? 10.506 47.305 24.905  1.00 13.28  ? 514  ILE A N     1 
ATOM   3985 C  CA    . ILE A 1 514 ? 10.214 48.519 24.161  1.00 14.12  ? 514  ILE A CA    1 
ATOM   3986 C  C     . ILE A 1 514 ? 8.850  49.048 24.579  1.00 16.82  ? 514  ILE A C     1 
ATOM   3987 O  O     . ILE A 1 514 ? 8.652  50.250 24.803  1.00 13.23  ? 514  ILE A O     1 
ATOM   3988 C  CB    . ILE A 1 514 ? 10.205 48.168 22.706  1.00 14.16  ? 514  ILE A CB    1 
ATOM   3989 C  CG1   . ILE A 1 514 ? 11.700 48.012 22.216  1.00 13.20  ? 514  ILE A CG1   1 
ATOM   3990 C  CG2   . ILE A 1 514 ? 9.532  49.359 22.052  1.00 12.97  ? 514  ILE A CG2   1 
ATOM   3991 C  CD1   . ILE A 1 514 ? 11.850 47.495 20.787  1.00 14.15  ? 514  ILE A CD1   1 
ATOM   3992 N  N     . ASP A 1 515 ? 7.901  48.117 24.716  1.00 18.13  ? 515  ASP A N     1 
ATOM   3993 C  CA    . ASP A 1 515 ? 6.562  48.557 25.131  1.00 12.62  ? 515  ASP A CA    1 
ATOM   3994 C  C     . ASP A 1 515 ? 6.531  49.095 26.526  1.00 18.18  ? 515  ASP A C     1 
ATOM   3995 O  O     . ASP A 1 515 ? 5.857  50.088 26.765  1.00 15.49  ? 515  ASP A O     1 
ATOM   3996 C  CB    . ASP A 1 515 ? 5.573  47.463 25.098  1.00 16.20  ? 515  ASP A CB    1 
ATOM   3997 C  CG    . ASP A 1 515 ? 5.364  46.914 23.700  1.00 100.00 ? 515  ASP A CG    1 
ATOM   3998 O  OD1   . ASP A 1 515 ? 5.575  47.698 22.696  1.00 24.70  ? 515  ASP A OD1   1 
ATOM   3999 O  OD2   . ASP A 1 515 ? 4.959  45.833 23.497  1.00 33.60  ? 515  ASP A OD2   1 
ATOM   4000 N  N     . LEU A 1 516 ? 7.269  48.469 27.456  1.00 17.01  ? 516  LEU A N     1 
ATOM   4001 C  CA    . LEU A 1 516 ? 7.279  49.037 28.787  1.00 13.46  ? 516  LEU A CA    1 
ATOM   4002 C  C     . LEU A 1 516 ? 7.737  50.502 28.784  1.00 15.87  ? 516  LEU A C     1 
ATOM   4003 O  O     . LEU A 1 516 ? 7.343  51.417 29.526  1.00 15.78  ? 516  LEU A O     1 
ATOM   4004 C  CB    . LEU A 1 516 ? 8.197  48.162 29.662  1.00 16.71  ? 516  LEU A CB    1 
ATOM   4005 C  CG    . LEU A 1 516 ? 8.468  48.733 31.042  1.00 18.05  ? 516  LEU A CG    1 
ATOM   4006 C  CD1   . LEU A 1 516 ? 7.166  48.826 31.874  1.00 11.80  ? 516  LEU A CD1   1 
ATOM   4007 C  CD2   . LEU A 1 516 ? 9.427  47.819 31.755  1.00 12.35  ? 516  LEU A CD2   1 
ATOM   4008 N  N     . ILE A 1 517 ? 8.672  50.799 27.936  1.00 13.97  ? 517  ILE A N     1 
ATOM   4009 C  CA    . ILE A 1 517 ? 9.126  52.180 27.923  1.00 8.94   ? 517  ILE A CA    1 
ATOM   4010 C  C     . ILE A 1 517 ? 8.244  53.072 27.125  1.00 11.71  ? 517  ILE A C     1 
ATOM   4011 O  O     . ILE A 1 517 ? 7.818  54.145 27.610  1.00 12.27  ? 517  ILE A O     1 
ATOM   4012 C  CB    . ILE A 1 517 ? 10.485 52.189 27.210  1.00 17.93  ? 517  ILE A CB    1 
ATOM   4013 C  CG1   . ILE A 1 517 ? 11.486 51.337 28.029  1.00 14.36  ? 517  ILE A CG1   1 
ATOM   4014 C  CG2   . ILE A 1 517 ? 11.021 53.585 26.947  1.00 15.06  ? 517  ILE A CG2   1 
ATOM   4015 C  CD1   . ILE A 1 517 ? 12.859 51.148 27.395  1.00 23.76  ? 517  ILE A CD1   1 
ATOM   4016 N  N     . ASP A 1 518 ? 7.964  52.676 25.866  1.00 16.07  ? 518  ASP A N     1 
ATOM   4017 C  CA    . ASP A 1 518 ? 7.240  53.659 25.039  1.00 14.32  ? 518  ASP A CA    1 
ATOM   4018 C  C     . ASP A 1 518 ? 5.725  53.452 24.766  1.00 15.70  ? 518  ASP A C     1 
ATOM   4019 O  O     . ASP A 1 518 ? 5.144  54.188 23.986  1.00 15.08  ? 518  ASP A O     1 
ATOM   4020 C  CB    . ASP A 1 518 ? 7.965  53.825 23.700  1.00 13.39  ? 518  ASP A CB    1 
ATOM   4021 C  CG    . ASP A 1 518 ? 7.681  52.690 22.744  1.00 19.55  ? 518  ASP A CG    1 
ATOM   4022 O  OD1   . ASP A 1 518 ? 6.904  51.730 22.955  1.00 19.47  ? 518  ASP A OD1   1 
ATOM   4023 O  OD2   . ASP A 1 518 ? 8.383  52.817 21.614  1.00 24.00  ? 518  ASP A OD2   1 
ATOM   4024 N  N     . GLY A 1 519 ? 5.126  52.426 25.351  1.00 18.36  ? 519  GLY A N     1 
ATOM   4025 C  CA    . GLY A 1 519 ? 3.713  52.132 25.156  1.00 21.66  ? 519  GLY A CA    1 
ATOM   4026 C  C     . GLY A 1 519 ? 2.755  53.304 25.417  1.00 16.40  ? 519  GLY A C     1 
ATOM   4027 O  O     . GLY A 1 519 ? 2.944  54.181 26.273  1.00 16.10  ? 519  GLY A O     1 
ATOM   4028 N  N     . ARG A 1 520 ? 1.639  53.320 24.658  1.00 16.01  ? 520  ARG A N     1 
ATOM   4029 C  CA    . ARG A 1 520 ? 0.631  54.374 24.877  1.00 21.82  ? 520  ARG A CA    1 
ATOM   4030 C  C     . ARG A 1 520 ? -0.542 53.851 25.737  1.00 27.74  ? 520  ARG A C     1 
ATOM   4031 O  O     . ARG A 1 520 ? -0.976 54.477 26.673  1.00 27.59  ? 520  ARG A O     1 
ATOM   4032 C  CB    . ARG A 1 520 ? 0.171  55.002 23.562  1.00 32.19  ? 520  ARG A CB    1 
ATOM   4033 C  CG    . ARG A 1 520 ? 0.981  56.258 23.202  1.00 44.20  ? 520  ARG A CG    1 
ATOM   4034 C  CD    . ARG A 1 520 ? 0.363  57.000 22.028  1.00 100.00 ? 520  ARG A CD    1 
ATOM   4035 N  NE    . ARG A 1 520 ? 0.198  58.431 22.281  1.00 100.00 ? 520  ARG A NE    1 
ATOM   4036 C  CZ    . ARG A 1 520 ? -0.979 59.050 22.447  1.00 100.00 ? 520  ARG A CZ    1 
ATOM   4037 N  NH1   . ARG A 1 520 ? -2.135 58.351 22.462  1.00 100.00 ? 520  ARG A NH1   1 
ATOM   4038 N  NH2   . ARG A 1 520 ? -1.007 60.388 22.745  1.00 100.00 ? 520  ARG A NH2   1 
ATOM   4039 N  N     . GLN A 1 521 ? -1.002 52.657 25.461  1.00 21.16  ? 521  GLN A N     1 
ATOM   4040 C  CA    . GLN A 1 521 ? -2.062 52.052 26.209  1.00 28.66  ? 521  GLN A CA    1 
ATOM   4041 C  C     . GLN A 1 521 ? -1.899 50.549 26.208  1.00 22.35  ? 521  GLN A C     1 
ATOM   4042 O  O     . GLN A 1 521 ? -2.009 49.927 25.150  1.00 36.30  ? 521  GLN A O     1 
ATOM   4043 C  CB    . GLN A 1 521 ? -3.422 52.290 25.482  1.00 21.06  ? 521  GLN A CB    1 
ATOM   4044 C  CG    . GLN A 1 521 ? -4.069 53.580 25.945  1.00 22.62  ? 521  GLN A CG    1 
ATOM   4045 C  CD    . GLN A 1 521 ? -4.398 53.647 27.476  1.00 25.28  ? 521  GLN A CD    1 
ATOM   4046 O  OE1   . GLN A 1 521 ? -4.520 52.609 28.184  1.00 33.50  ? 521  GLN A OE1   1 
ATOM   4047 N  NE2   . GLN A 1 521 ? -4.526 54.905 27.900  1.00 26.76  ? 521  GLN A NE2   1 
ATOM   4048 N  N     . PRO A 1 522 ? -1.683 49.939 27.391  1.00 27.64  ? 522  PRO A N     1 
ATOM   4049 C  CA    . PRO A 1 522 ? -1.487 50.651 28.665  1.00 26.41  ? 522  PRO A CA    1 
ATOM   4050 C  C     . PRO A 1 522 ? -0.260 51.562 28.544  1.00 32.75  ? 522  PRO A C     1 
ATOM   4051 O  O     . PRO A 1 522 ? 0.655  51.403 27.729  1.00 15.51  ? 522  PRO A O     1 
ATOM   4052 C  CB    . PRO A 1 522 ? -1.216 49.582 29.701  1.00 18.96  ? 522  PRO A CB    1 
ATOM   4053 C  CG    . PRO A 1 522 ? -0.839 48.324 28.910  1.00 24.87  ? 522  PRO A CG    1 
ATOM   4054 C  CD    . PRO A 1 522 ? -1.372 48.515 27.467  1.00 21.23  ? 522  PRO A CD    1 
ATOM   4055 N  N     . PRO A 1 523 ? -0.237 52.580 29.333  1.00 18.56  ? 523  PRO A N     1 
ATOM   4056 C  CA    . PRO A 1 523 ? 0.849  53.510 29.196  1.00 17.08  ? 523  PRO A CA    1 
ATOM   4057 C  C     . PRO A 1 523 ? 2.167  52.947 29.691  1.00 38.46  ? 523  PRO A C     1 
ATOM   4058 O  O     . PRO A 1 523 ? 2.174  52.190 30.668  1.00 14.11  ? 523  PRO A O     1 
ATOM   4059 C  CB    . PRO A 1 523 ? 0.344  54.735 29.947  1.00 19.69  ? 523  PRO A CB    1 
ATOM   4060 C  CG    . PRO A 1 523 ? -0.638 54.204 30.976  1.00 22.52  ? 523  PRO A CG    1 
ATOM   4061 C  CD    . PRO A 1 523 ? -1.230 52.964 30.323  1.00 20.92  ? 523  PRO A CD    1 
ATOM   4062 N  N     . GLY A 1 524 ? 3.266  53.304 29.000  1.00 20.25  ? 524  GLY A N     1 
ATOM   4063 C  CA    . GLY A 1 524 ? 4.586  52.880 29.418  1.00 10.65  ? 524  GLY A CA    1 
ATOM   4064 C  C     . GLY A 1 524 ? 5.211  53.994 30.280  1.00 11.14  ? 524  GLY A C     1 
ATOM   4065 O  O     . GLY A 1 524 ? 4.579  54.976 30.651  1.00 13.88  ? 524  GLY A O     1 
ATOM   4066 N  N     . ILE A 1 525 ? 6.515  53.830 30.578  1.00 17.64  ? 525  ILE A N     1 
ATOM   4067 C  CA    . ILE A 1 525 ? 7.227  54.781 31.414  1.00 13.25  ? 525  ILE A CA    1 
ATOM   4068 C  C     . ILE A 1 525 ? 7.138  56.166 30.866  1.00 17.77  ? 525  ILE A C     1 
ATOM   4069 O  O     . ILE A 1 525 ? 6.836  57.133 31.593  1.00 14.80  ? 525  ILE A O     1 
ATOM   4070 C  CB    . ILE A 1 525 ? 8.715  54.336 31.612  1.00 11.53  ? 525  ILE A CB    1 
ATOM   4071 C  CG1   . ILE A 1 525 ? 8.755  53.000 32.345  1.00 12.96  ? 525  ILE A CG1   1 
ATOM   4072 C  CG2   . ILE A 1 525 ? 9.562  55.426 32.313  1.00 13.40  ? 525  ILE A CG2   1 
ATOM   4073 C  CD1   . ILE A 1 525 ? 10.022 52.186 32.159  1.00 10.60  ? 525  ILE A CD1   1 
ATOM   4074 N  N     . LEU A 1 526 ? 7.462  56.341 29.578  1.00 13.55  ? 526  LEU A N     1 
ATOM   4075 C  CA    . LEU A 1 526 ? 7.433  57.690 29.054  1.00 11.55  ? 526  LEU A CA    1 
ATOM   4076 C  C     . LEU A 1 526 ? 6.053  58.345 29.041  1.00 12.84  ? 526  LEU A C     1 
ATOM   4077 O  O     . LEU A 1 526 ? 5.962  59.598 29.189  1.00 15.39  ? 526  LEU A O     1 
ATOM   4078 C  CB    . LEU A 1 526 ? 8.064  57.744 27.633  1.00 12.84  ? 526  LEU A CB    1 
ATOM   4079 C  CG    . LEU A 1 526 ? 9.521  57.217 27.470  1.00 18.67  ? 526  LEU A CG    1 
ATOM   4080 C  CD1   . LEU A 1 526 ? 9.969  57.213 25.941  1.00 14.69  ? 526  LEU A CD1   1 
ATOM   4081 C  CD2   . LEU A 1 526 ? 10.483 58.076 28.349  1.00 15.75  ? 526  LEU A CD2   1 
ATOM   4082 N  N     . ALA A 1 527 ? 5.005  57.531 28.756  1.00 20.08  ? 527  ALA A N     1 
ATOM   4083 C  CA    . ALA A 1 527 ? 3.640  58.097 28.726  1.00 14.38  ? 527  ALA A CA    1 
ATOM   4084 C  C     . ALA A 1 527 ? 3.294  58.598 30.143  1.00 16.51  ? 527  ALA A C     1 
ATOM   4085 O  O     . ALA A 1 527 ? 2.811  59.688 30.300  1.00 17.94  ? 527  ALA A O     1 
ATOM   4086 C  CB    . ALA A 1 527 ? 2.732  56.949 28.336  1.00 11.31  ? 527  ALA A CB    1 
ATOM   4087 N  N     . LEU A 1 528 ? 3.584  57.799 31.187  1.00 13.08  ? 528  LEU A N     1 
ATOM   4088 C  CA    . LEU A 1 528 ? 3.348  58.234 32.563  1.00 12.71  ? 528  LEU A CA    1 
ATOM   4089 C  C     . LEU A 1 528 ? 4.137  59.486 32.930  1.00 19.95  ? 528  LEU A C     1 
ATOM   4090 O  O     . LEU A 1 528 ? 3.680  60.385 33.664  1.00 23.17  ? 528  LEU A O     1 
ATOM   4091 C  CB    . LEU A 1 528 ? 3.615  57.113 33.586  1.00 13.07  ? 528  LEU A CB    1 
ATOM   4092 C  CG    . LEU A 1 528 ? 2.700  55.931 33.362  1.00 18.54  ? 528  LEU A CG    1 
ATOM   4093 C  CD1   . LEU A 1 528 ? 3.139  54.781 34.272  1.00 15.92  ? 528  LEU A CD1   1 
ATOM   4094 C  CD2   . LEU A 1 528 ? 1.295  56.407 33.691  1.00 12.66  ? 528  LEU A CD2   1 
ATOM   4095 N  N     . LEU A 1 529 ? 5.372  59.557 32.459  1.00 17.90  ? 529  LEU A N     1 
ATOM   4096 C  CA    . LEU A 1 529 ? 6.225  60.690 32.732  1.00 16.85  ? 529  LEU A CA    1 
ATOM   4097 C  C     . LEU A 1 529 ? 5.592  61.895 32.100  1.00 15.09  ? 529  LEU A C     1 
ATOM   4098 O  O     . LEU A 1 529 ? 5.450  62.967 32.716  1.00 17.22  ? 529  LEU A O     1 
ATOM   4099 C  CB    . LEU A 1 529 ? 7.721  60.357 32.244  1.00 14.31  ? 529  LEU A CB    1 
ATOM   4100 C  CG    . LEU A 1 529 ? 8.669  61.560 32.049  1.00 20.63  ? 529  LEU A CG    1 
ATOM   4101 C  CD1   . LEU A 1 529 ? 8.944  62.249 33.398  1.00 18.47  ? 529  LEU A CD1   1 
ATOM   4102 C  CD2   . LEU A 1 529 ? 10.037 61.231 31.424  1.00 18.92  ? 529  LEU A CD2   1 
ATOM   4103 N  N     . ASP A 1 530 ? 5.169  61.713 30.851  1.00 14.75  ? 530  ASP A N     1 
ATOM   4104 C  CA    . ASP A 1 530 ? 4.589  62.857 30.212  1.00 11.40  ? 530  ASP A CA    1 
ATOM   4105 C  C     . ASP A 1 530 ? 3.380  63.293 30.989  1.00 22.80  ? 530  ASP A C     1 
ATOM   4106 O  O     . ASP A 1 530 ? 3.136  64.472 31.168  1.00 26.18  ? 530  ASP A O     1 
ATOM   4107 C  CB    . ASP A 1 530 ? 4.081  62.433 28.849  1.00 13.16  ? 530  ASP A CB    1 
ATOM   4108 C  CG    . ASP A 1 530 ? 5.192  62.576 27.826  1.00 38.05  ? 530  ASP A CG    1 
ATOM   4109 O  OD1   . ASP A 1 530 ? 6.208  63.221 28.299  1.00 20.12  ? 530  ASP A OD1   1 
ATOM   4110 O  OD2   . ASP A 1 530 ? 5.140  62.172 26.680  1.00 35.65  ? 530  ASP A OD2   1 
ATOM   4111 N  N     . GLU A 1 531 ? 2.634  62.341 31.452  1.00 17.47  ? 531  GLU A N     1 
ATOM   4112 C  CA    . GLU A 1 531 ? 1.434  62.767 32.148  1.00 27.88  ? 531  GLU A CA    1 
ATOM   4113 C  C     . GLU A 1 531 ? 1.688  63.584 33.403  1.00 35.33  ? 531  GLU A C     1 
ATOM   4114 O  O     . GLU A 1 531 ? 0.999  64.560 33.705  1.00 25.83  ? 531  GLU A O     1 
ATOM   4115 C  CB    . GLU A 1 531 ? 0.596  61.560 32.430  1.00 30.31  ? 531  GLU A CB    1 
ATOM   4116 C  CG    . GLU A 1 531 ? -0.480 61.944 33.416  1.00 100.00 ? 531  GLU A CG    1 
ATOM   4117 C  CD    . GLU A 1 531 ? -1.726 61.181 33.165  1.00 100.00 ? 531  GLU A CD    1 
ATOM   4118 O  OE1   . GLU A 1 531 ? -1.526 59.877 33.413  1.00 78.61  ? 531  GLU A OE1   1 
ATOM   4119 O  OE2   . GLU A 1 531 ? -2.757 61.727 32.754  1.00 100.00 ? 531  GLU A OE2   1 
ATOM   4120 N  N     . GLN A 1 532 ? 2.696  63.184 34.164  1.00 32.16  ? 532  GLN A N     1 
ATOM   4121 C  CA    . GLN A 1 532 ? 3.031  63.929 35.377  1.00 19.92  ? 532  GLN A CA    1 
ATOM   4122 C  C     . GLN A 1 532 ? 3.563  65.297 35.006  1.00 34.55  ? 532  GLN A C     1 
ATOM   4123 O  O     . GLN A 1 532 ? 3.590  66.215 35.799  1.00 35.91  ? 532  GLN A O     1 
ATOM   4124 C  CB    . GLN A 1 532 ? 4.139  63.139 36.176  1.00 21.44  ? 532  GLN A CB    1 
ATOM   4125 C  CG    . GLN A 1 532 ? 3.676  61.768 36.713  1.00 24.88  ? 532  GLN A CG    1 
ATOM   4126 C  CD    . GLN A 1 532 ? 3.179  61.939 38.134  1.00 64.33  ? 532  GLN A CD    1 
ATOM   4127 O  OE1   . GLN A 1 532 ? 3.951  62.235 39.066  1.00 37.38  ? 532  GLN A OE1   1 
ATOM   4128 N  NE2   . GLN A 1 532 ? 1.879  61.780 38.315  1.00 38.33  ? 532  GLN A NE2   1 
ATOM   4129 N  N     . SER A 1 533 ? 3.944  65.436 33.750  1.00 39.09  ? 533  SER A N     1 
ATOM   4130 C  CA    . SER A 1 533 ? 4.537  66.666 33.272  1.00 79.10  ? 533  SER A CA    1 
ATOM   4131 C  C     . SER A 1 533 ? 3.665  67.918 33.208  1.00 36.28  ? 533  SER A C     1 
ATOM   4132 O  O     . SER A 1 533 ? 4.158  69.048 33.232  1.00 48.32  ? 533  SER A O     1 
ATOM   4133 C  CB    . SER A 1 533 ? 5.385  66.382 32.063  1.00 100.00 ? 533  SER A CB    1 
ATOM   4134 O  OG    . SER A 1 533 ? 6.574  65.711 32.524  1.00 29.27  ? 533  SER A OG    1 
ATOM   4135 N  N     . VAL A 1 534 ? 2.379  67.733 33.097  1.00 44.36  ? 534  VAL A N     1 
ATOM   4136 C  CA    . VAL A 1 534 ? 1.424  68.840 32.998  1.00 50.62  ? 534  VAL A CA    1 
ATOM   4137 C  C     . VAL A 1 534 ? 1.124  69.516 34.341  1.00 38.96  ? 534  VAL A C     1 
ATOM   4138 O  O     . VAL A 1 534 ? 0.577  70.628 34.397  1.00 56.77  ? 534  VAL A O     1 
ATOM   4139 C  CB    . VAL A 1 534 ? 0.178  68.112 32.547  1.00 39.43  ? 534  VAL A CB    1 
ATOM   4140 C  CG1   . VAL A 1 534 ? -0.960 69.097 32.358  1.00 41.46  ? 534  VAL A CG1   1 
ATOM   4141 C  CG2   . VAL A 1 534 ? 0.601  67.321 31.305  1.00 32.47  ? 534  VAL A CG2   1 
ATOM   4142 N  N     . PHE A 1 535 ? 1.452  68.769 35.413  1.00 59.82  ? 535  PHE A N     1 
ATOM   4143 C  CA    . PHE A 1 535 ? 1.250  69.157 36.807  1.00 33.29  ? 535  PHE A CA    1 
ATOM   4144 C  C     . PHE A 1 535 ? 2.459  69.829 37.389  1.00 100.00 ? 535  PHE A C     1 
ATOM   4145 O  O     . PHE A 1 535 ? 3.450  69.173 37.763  1.00 37.33  ? 535  PHE A O     1 
ATOM   4146 C  CB    . PHE A 1 535 ? 0.933  68.006 37.747  1.00 22.57  ? 535  PHE A CB    1 
ATOM   4147 C  CG    . PHE A 1 535 ? -0.303 67.554 37.154  1.00 37.34  ? 535  PHE A CG    1 
ATOM   4148 C  CD1   . PHE A 1 535 ? -0.224 66.685 36.056  1.00 31.42  ? 535  PHE A CD1   1 
ATOM   4149 C  CD2   . PHE A 1 535 ? -1.488 68.206 37.510  1.00 45.80  ? 535  PHE A CD2   1 
ATOM   4150 C  CE1   . PHE A 1 535 ? -1.393 66.299 35.389  1.00 51.33  ? 535  PHE A CE1   1 
ATOM   4151 C  CE2   . PHE A 1 535 ? -2.654 67.828 36.844  1.00 40.17  ? 535  PHE A CE2   1 
ATOM   4152 C  CZ    . PHE A 1 535 ? -2.596 66.875 35.809  1.00 100.00 ? 535  PHE A CZ    1 
ATOM   4153 N  N     . PRO A 1 536 ? 2.313  71.145 37.470  1.00 100.00 ? 536  PRO A N     1 
ATOM   4154 C  CA    . PRO A 1 536 ? 3.308  72.043 38.013  1.00 100.00 ? 536  PRO A CA    1 
ATOM   4155 C  C     . PRO A 1 536 ? 3.799  71.589 39.384  1.00 100.00 ? 536  PRO A C     1 
ATOM   4156 O  O     . PRO A 1 536 ? 4.977  71.733 39.750  1.00 47.11  ? 536  PRO A O     1 
ATOM   4157 C  CB    . PRO A 1 536 ? 2.528  73.362 38.183  1.00 100.00 ? 536  PRO A CB    1 
ATOM   4158 C  CG    . PRO A 1 536 ? 1.072  73.152 37.740  1.00 100.00 ? 536  PRO A CG    1 
ATOM   4159 C  CD    . PRO A 1 536 ? 1.023  71.795 37.062  1.00 78.37  ? 536  PRO A CD    1 
ATOM   4160 N  N     . ASN A 1 537 ? 2.872  71.038 40.160  1.00 36.14  ? 537  ASN A N     1 
ATOM   4161 C  CA    . ASN A 1 537 ? 3.258  70.613 41.481  1.00 51.36  ? 537  ASN A CA    1 
ATOM   4162 C  C     . ASN A 1 537 ? 3.752  69.185 41.600  1.00 100.00 ? 537  ASN A C     1 
ATOM   4163 O  O     . ASN A 1 537 ? 4.084  68.769 42.716  1.00 31.04  ? 537  ASN A O     1 
ATOM   4164 C  CB    . ASN A 1 537 ? 2.109  70.942 42.422  1.00 61.99  ? 537  ASN A CB    1 
ATOM   4165 C  CG    . ASN A 1 537 ? 1.970  72.443 42.507  1.00 54.88  ? 537  ASN A CG    1 
ATOM   4166 O  OD1   . ASN A 1 537 ? 2.971  73.183 42.299  1.00 44.23  ? 537  ASN A OD1   1 
ATOM   4167 N  ND2   . ASN A 1 537 ? 0.755  72.884 42.795  1.00 100.00 ? 537  ASN A ND2   1 
ATOM   4168 N  N     . ALA A 1 538 ? 3.819  68.436 40.486  1.00 34.91  ? 538  ALA A N     1 
ATOM   4169 C  CA    . ALA A 1 538 ? 4.250  67.042 40.592  1.00 30.26  ? 538  ALA A CA    1 
ATOM   4170 C  C     . ALA A 1 538 ? 5.683  66.947 41.086  1.00 23.69  ? 538  ALA A C     1 
ATOM   4171 O  O     . ALA A 1 538 ? 6.501  67.854 40.886  1.00 36.37  ? 538  ALA A O     1 
ATOM   4172 C  CB    . ALA A 1 538 ? 3.954  66.127 39.364  1.00 26.32  ? 538  ALA A CB    1 
ATOM   4173 N  N     . THR A 1 539 ? 5.984  65.813 41.712  1.00 25.47  ? 539  THR A N     1 
ATOM   4174 C  CA    . THR A 1 539 ? 7.303  65.605 42.248  1.00 24.40  ? 539  THR A CA    1 
ATOM   4175 C  C     . THR A 1 539 ? 7.888  64.267 41.803  1.00 27.27  ? 539  THR A C     1 
ATOM   4176 O  O     . THR A 1 539 ? 7.201  63.369 41.294  1.00 23.04  ? 539  THR A O     1 
ATOM   4177 C  CB    . THR A 1 539 ? 7.188  65.539 43.813  1.00 19.85  ? 539  THR A CB    1 
ATOM   4178 O  OG1   . THR A 1 539 ? 6.526  64.335 44.317  1.00 24.56  ? 539  THR A OG1   1 
ATOM   4179 C  CG2   . THR A 1 539 ? 6.541  66.787 44.430  1.00 23.74  ? 539  THR A CG2   1 
ATOM   4180 N  N     . ASP A 1 540 ? 9.173  64.113 42.064  1.00 28.84  ? 540  ASP A N     1 
ATOM   4181 C  CA    . ASP A 1 540 ? 9.850  62.878 41.818  1.00 53.75  ? 540  ASP A CA    1 
ATOM   4182 C  C     . ASP A 1 540 ? 9.128  61.724 42.540  1.00 29.65  ? 540  ASP A C     1 
ATOM   4183 O  O     . ASP A 1 540 ? 8.996  60.603 41.987  1.00 30.15  ? 540  ASP A O     1 
ATOM   4184 C  CB    . ASP A 1 540 ? 11.387 63.014 42.077  1.00 48.42  ? 540  ASP A CB    1 
ATOM   4185 C  CG    . ASP A 1 540 ? 12.182 64.082 41.248  1.00 100.00 ? 540  ASP A CG    1 
ATOM   4186 O  OD1   . ASP A 1 540 ? 11.653 64.571 40.065  1.00 33.96  ? 540  ASP A OD1   1 
ATOM   4187 O  OD2   . ASP A 1 540 ? 13.282 64.442 41.675  1.00 57.56  ? 540  ASP A OD2   1 
ATOM   4188 N  N     . ASN A 1 541 ? 8.597  62.008 43.755  1.00 21.99  ? 541  ASN A N     1 
ATOM   4189 C  CA    . ASN A 1 541 ? 7.893  60.994 44.495  1.00 18.33  ? 541  ASN A CA    1 
ATOM   4190 C  C     . ASN A 1 541 ? 6.552  60.606 43.840  1.00 13.21  ? 541  ASN A C     1 
ATOM   4191 O  O     . ASN A 1 541 ? 6.201  59.435 43.787  1.00 18.69  ? 541  ASN A O     1 
ATOM   4192 C  CB    . ASN A 1 541 ? 7.758  61.343 45.997  1.00 25.47  ? 541  ASN A CB    1 
ATOM   4193 C  CG    . ASN A 1 541 ? 6.935  60.233 46.669  1.00 32.85  ? 541  ASN A CG    1 
ATOM   4194 O  OD1   . ASN A 1 541 ? 5.723  60.385 46.908  1.00 34.75  ? 541  ASN A OD1   1 
ATOM   4195 N  ND2   . ASN A 1 541 ? 7.573  59.053 46.896  1.00 22.69  ? 541  ASN A ND2   1 
ATOM   4196 N  N     . THR A 1 542 ? 5.832  61.588 43.313  1.00 16.99  ? 542  THR A N     1 
ATOM   4197 C  CA    . THR A 1 542 ? 4.575  61.252 42.674  1.00 16.69  ? 542  THR A CA    1 
ATOM   4198 C  C     . THR A 1 542 ? 4.847  60.403 41.466  1.00 20.03  ? 542  THR A C     1 
ATOM   4199 O  O     . THR A 1 542 ? 4.250  59.374 41.256  1.00 17.08  ? 542  THR A O     1 
ATOM   4200 C  CB    . THR A 1 542 ? 3.771  62.480 42.259  1.00 18.78  ? 542  THR A CB    1 
ATOM   4201 O  OG1   . THR A 1 542 ? 4.520  63.418 41.604  1.00 32.28  ? 542  THR A OG1   1 
ATOM   4202 C  CG2   . THR A 1 542 ? 3.402  63.161 43.557  1.00 39.59  ? 542  THR A CG2   1 
ATOM   4203 N  N     . LEU A 1 543 ? 5.840  60.818 40.704  1.00 25.08  ? 543  LEU A N     1 
ATOM   4204 C  CA    . LEU A 1 543 ? 6.261  60.065 39.530  1.00 19.37  ? 543  LEU A CA    1 
ATOM   4205 C  C     . LEU A 1 543 ? 6.673  58.618 39.845  1.00 16.90  ? 543  LEU A C     1 
ATOM   4206 O  O     . LEU A 1 543 ? 6.117  57.625 39.313  1.00 17.48  ? 543  LEU A O     1 
ATOM   4207 C  CB    . LEU A 1 543 ? 7.426  60.877 38.891  1.00 23.94  ? 543  LEU A CB    1 
ATOM   4208 C  CG    . LEU A 1 543 ? 8.054  60.162 37.692  1.00 30.70  ? 543  LEU A CG    1 
ATOM   4209 C  CD1   . LEU A 1 543 ? 7.041  59.810 36.557  1.00 15.45  ? 543  LEU A CD1   1 
ATOM   4210 C  CD2   . LEU A 1 543 ? 9.215  61.087 37.263  1.00 24.14  ? 543  LEU A CD2   1 
ATOM   4211 N  N     . ILE A 1 544 ? 7.694  58.428 40.683  1.00 18.77  ? 544  ILE A N     1 
ATOM   4212 C  CA    . ILE A 1 544 ? 8.097  57.052 40.962  1.00 16.82  ? 544  ILE A CA    1 
ATOM   4213 C  C     . ILE A 1 544 ? 6.955  56.178 41.540  1.00 20.93  ? 544  ILE A C     1 
ATOM   4214 O  O     . ILE A 1 544 ? 6.849  54.971 41.273  1.00 14.47  ? 544  ILE A O     1 
ATOM   4215 C  CB    . ILE A 1 544 ? 9.336  56.871 41.864  1.00 28.21  ? 544  ILE A CB    1 
ATOM   4216 C  CG1   . ILE A 1 544 ? 9.630  55.381 41.787  1.00 31.35  ? 544  ILE A CG1   1 
ATOM   4217 C  CG2   . ILE A 1 544 ? 9.090  57.302 43.356  1.00 21.10  ? 544  ILE A CG2   1 
ATOM   4218 C  CD1   . ILE A 1 544 ? 10.889 55.048 41.115  1.00 23.85  ? 544  ILE A CD1   1 
ATOM   4219 N  N     . THR A 1 545 ? 6.080  56.773 42.351  1.00 23.80  ? 545  THR A N     1 
ATOM   4220 C  CA    . THR A 1 545 ? 4.943  55.995 42.917  1.00 19.01  ? 545  THR A CA    1 
ATOM   4221 C  C     . THR A 1 545 ? 4.015  55.539 41.787  1.00 15.80  ? 545  THR A C     1 
ATOM   4222 O  O     . THR A 1 545 ? 3.569  54.406 41.786  1.00 17.36  ? 545  THR A O     1 
ATOM   4223 C  CB    . THR A 1 545 ? 4.133  56.863 43.926  1.00 23.04  ? 545  THR A CB    1 
ATOM   4224 O  OG1   . THR A 1 545 ? 5.048  57.392 44.850  1.00 19.45  ? 545  THR A OG1   1 
ATOM   4225 C  CG2   . THR A 1 545 ? 2.892  56.184 44.543  1.00 18.12  ? 545  THR A CG2   1 
ATOM   4226 N  N     . LYS A 1 546 ? 3.730  56.465 40.844  1.00 16.62  ? 546  LYS A N     1 
ATOM   4227 C  CA    . LYS A 1 546 ? 2.888  56.118 39.688  1.00 14.62  ? 546  LYS A CA    1 
ATOM   4228 C  C     . LYS A 1 546 ? 3.497  54.963 38.904  1.00 16.85  ? 546  LYS A C     1 
ATOM   4229 O  O     . LYS A 1 546 ? 2.827  53.975 38.578  1.00 18.02  ? 546  LYS A O     1 
ATOM   4230 C  CB    . LYS A 1 546 ? 2.717  57.307 38.777  1.00 19.02  ? 546  LYS A CB    1 
ATOM   4231 C  CG    . LYS A 1 546 ? 1.504  57.012 37.901  1.00 28.56  ? 546  LYS A CG    1 
ATOM   4232 C  CD    . LYS A 1 546 ? 0.570  58.226 37.658  1.00 38.54  ? 546  LYS A CD    1 
ATOM   4233 C  CE    . LYS A 1 546 ? -0.938 57.901 37.788  1.00 100.00 ? 546  LYS A CE    1 
ATOM   4234 N  NZ    . LYS A 1 546 ? -1.623 57.275 36.681  1.00 100.00 ? 546  LYS A NZ    1 
ATOM   4235 N  N     . LEU A 1 547 ? 4.820  55.086 38.578  1.00 18.28  ? 547  LEU A N     1 
ATOM   4236 C  CA    . LEU A 1 547 ? 5.539  54.009 37.864  1.00 10.41  ? 547  LEU A CA    1 
ATOM   4237 C  C     . LEU A 1 547 ? 5.407  52.682 38.593  1.00 17.13  ? 547  LEU A C     1 
ATOM   4238 O  O     . LEU A 1 547 ? 5.040  51.667 38.039  1.00 15.45  ? 547  LEU A O     1 
ATOM   4239 C  CB    . LEU A 1 547 ? 7.080  54.333 37.629  1.00 13.20  ? 547  LEU A CB    1 
ATOM   4240 C  CG    . LEU A 1 547 ? 7.368  55.629 36.850  1.00 18.04  ? 547  LEU A CG    1 
ATOM   4241 C  CD1   . LEU A 1 547 ? 8.887  55.819 36.725  1.00 11.50  ? 547  LEU A CD1   1 
ATOM   4242 C  CD2   . LEU A 1 547 ? 6.863  55.356 35.404  1.00 15.93  ? 547  LEU A CD2   1 
ATOM   4243 N  N     . HIS A 1 548 ? 5.723  52.603 39.886  1.00 9.95   ? 548  HIS A N     1 
ATOM   4244 C  CA    . HIS A 1 548 ? 5.569  51.327 40.578  1.00 11.44  ? 548  HIS A CA    1 
ATOM   4245 C  C     . HIS A 1 548 ? 4.075  50.891 40.591  1.00 12.16  ? 548  HIS A C     1 
ATOM   4246 O  O     . HIS A 1 548 ? 3.781  49.672 40.489  1.00 14.95  ? 548  HIS A O     1 
ATOM   4247 C  CB    . HIS A 1 548 ? 5.936  51.492 42.079  1.00 14.85  ? 548  HIS A CB    1 
ATOM   4248 C  CG    . HIS A 1 548 ? 7.410  51.806 42.349  1.00 22.29  ? 548  HIS A CG    1 
ATOM   4249 N  ND1   . HIS A 1 548 ? 8.417  51.318 41.527  1.00 15.05  ? 548  HIS A ND1   1 
ATOM   4250 C  CD2   . HIS A 1 548 ? 8.026  52.601 43.305  1.00 20.92  ? 548  HIS A CD2   1 
ATOM   4251 C  CE1   . HIS A 1 548 ? 9.595  51.753 41.950  1.00 17.86  ? 548  HIS A CE1   1 
ATOM   4252 N  NE2   . HIS A 1 548 ? 9.398  52.545 43.019  1.00 16.77  ? 548  HIS A NE2   1 
ATOM   4253 N  N     . SER A 1 549 ? 3.163  51.882 40.738  1.00 18.01  ? 549  SER A N     1 
ATOM   4254 C  CA    . SER A 1 549 ? 1.740  51.609 40.765  1.00 13.51  ? 549  SER A CA    1 
ATOM   4255 C  C     . SER A 1 549 ? 1.349  50.824 39.522  1.00 16.05  ? 549  SER A C     1 
ATOM   4256 O  O     . SER A 1 549 ? 0.594  49.846 39.544  1.00 16.83  ? 549  SER A O     1 
ATOM   4257 C  CB    . SER A 1 549 ? 0.898  52.906 40.861  1.00 14.92  ? 549  SER A CB    1 
ATOM   4258 O  OG    . SER A 1 549 ? -0.385 52.349 41.247  1.00 19.82  ? 549  SER A OG    1 
ATOM   4259 N  N     . HIS A 1 550 ? 1.891  51.228 38.376  1.00 12.66  ? 550  HIS A N     1 
ATOM   4260 C  CA    . HIS A 1 550 ? 1.468  50.525 37.179  1.00 9.86   ? 550  HIS A CA    1 
ATOM   4261 C  C     . HIS A 1 550 ? 2.286  49.339 36.886  1.00 16.33  ? 550  HIS A C     1 
ATOM   4262 O  O     . HIS A 1 550 ? 1.741  48.467 36.216  1.00 19.02  ? 550  HIS A O     1 
ATOM   4263 C  CB    . HIS A 1 550 ? 1.679  51.405 35.967  1.00 12.05  ? 550  HIS A CB    1 
ATOM   4264 C  CG    . HIS A 1 550 ? 0.655  52.397 35.866  1.00 19.03  ? 550  HIS A CG    1 
ATOM   4265 N  ND1   . HIS A 1 550 ? 0.557  53.442 36.816  1.00 15.63  ? 550  HIS A ND1   1 
ATOM   4266 C  CD2   . HIS A 1 550 ? -0.285 52.527 34.869  1.00 7.41   ? 550  HIS A CD2   1 
ATOM   4267 C  CE1   . HIS A 1 550 ? -0.478 54.165 36.444  1.00 13.71  ? 550  HIS A CE1   1 
ATOM   4268 N  NE2   . HIS A 1 550 ? -0.996 53.646 35.251  1.00 13.82  ? 550  HIS A NE2   1 
ATOM   4269 N  N     . PHE A 1 551 ? 3.582  49.257 37.308  1.00 13.43  ? 551  PHE A N     1 
ATOM   4270 C  CA    . PHE A 1 551 ? 4.365  48.123 36.827  1.00 13.04  ? 551  PHE A CA    1 
ATOM   4271 C  C     . PHE A 1 551 ? 4.975  47.178 37.860  1.00 15.45  ? 551  PHE A C     1 
ATOM   4272 O  O     . PHE A 1 551 ? 5.379  46.046 37.517  1.00 11.89  ? 551  PHE A O     1 
ATOM   4273 C  CB    . PHE A 1 551 ? 5.597  48.610 35.966  1.00 14.68  ? 551  PHE A CB    1 
ATOM   4274 C  CG    . PHE A 1 551 ? 5.237  49.657 34.971  1.00 13.28  ? 551  PHE A CG    1 
ATOM   4275 C  CD1   . PHE A 1 551 ? 4.308  49.365 33.991  1.00 18.16  ? 551  PHE A CD1   1 
ATOM   4276 C  CD2   . PHE A 1 551 ? 5.792  50.930 35.008  1.00 11.16  ? 551  PHE A CD2   1 
ATOM   4277 C  CE1   . PHE A 1 551 ? 3.910  50.339 33.079  1.00 15.28  ? 551  PHE A CE1   1 
ATOM   4278 C  CE2   . PHE A 1 551 ? 5.404  51.918 34.121  1.00 12.44  ? 551  PHE A CE2   1 
ATOM   4279 C  CZ    . PHE A 1 551 ? 4.469  51.612 33.155  1.00 11.71  ? 551  PHE A CZ    1 
ATOM   4280 N  N     . SER A 1 552 ? 5.016  47.602 39.127  1.00 14.99  ? 552  SER A N     1 
ATOM   4281 C  CA    . SER A 1 552 ? 5.621  46.693 40.145  1.00 17.45  ? 552  SER A CA    1 
ATOM   4282 C  C     . SER A 1 552 ? 4.817  45.405 40.347  1.00 20.66  ? 552  SER A C     1 
ATOM   4283 O  O     . SER A 1 552 ? 3.664  45.463 40.808  1.00 18.82  ? 552  SER A O     1 
ATOM   4284 C  CB    . SER A 1 552 ? 5.933  47.421 41.511  1.00 14.81  ? 552  SER A CB    1 
ATOM   4285 O  OG    . SER A 1 552 ? 6.404  46.402 42.348  1.00 14.81  ? 552  SER A OG    1 
ATOM   4286 N  N     . LYS A 1 553 ? 5.400  44.242 39.980  1.00 16.34  ? 553  LYS A N     1 
ATOM   4287 C  CA    . LYS A 1 553 ? 4.771  42.913 40.056  1.00 23.77  ? 553  LYS A CA    1 
ATOM   4288 C  C     . LYS A 1 553 ? 3.699  42.774 39.001  1.00 15.26  ? 553  LYS A C     1 
ATOM   4289 O  O     . LYS A 1 553 ? 2.892  41.876 39.020  1.00 21.50  ? 553  LYS A O     1 
ATOM   4290 C  CB    . LYS A 1 553 ? 3.962  42.779 41.328  1.00 21.99  ? 553  LYS A CB    1 
ATOM   4291 C  CG    . LYS A 1 553 ? 4.832  42.636 42.508  1.00 23.80  ? 553  LYS A CG    1 
ATOM   4292 C  CD    . LYS A 1 553 ? 5.987  41.727 42.229  1.00 31.41  ? 553  LYS A CD    1 
ATOM   4293 C  CE    . LYS A 1 553 ? 6.452  41.006 43.503  1.00 100.00 ? 553  LYS A CE    1 
ATOM   4294 N  NZ    . LYS A 1 553 ? 7.822  40.443 43.398  1.00 100.00 ? 553  LYS A NZ    1 
ATOM   4295 N  N     . LYS A 1 554 ? 3.643  43.751 38.123  1.00 17.62  ? 554  LYS A N     1 
ATOM   4296 C  CA    . LYS A 1 554 ? 2.611  43.777 37.094  1.00 15.72  ? 554  LYS A CA    1 
ATOM   4297 C  C     . LYS A 1 554 ? 3.216  43.664 35.710  1.00 30.25  ? 554  LYS A C     1 
ATOM   4298 O  O     . LYS A 1 554 ? 2.597  43.095 34.849  1.00 22.96  ? 554  LYS A O     1 
ATOM   4299 C  CB    . LYS A 1 554 ? 1.790  45.066 37.221  1.00 15.98  ? 554  LYS A CB    1 
ATOM   4300 C  CG    . LYS A 1 554 ? 1.042  45.065 38.606  1.00 17.78  ? 554  LYS A CG    1 
ATOM   4301 C  CD    . LYS A 1 554 ? 0.336  46.350 38.979  1.00 16.17  ? 554  LYS A CD    1 
ATOM   4302 C  CE    . LYS A 1 554 ? -0.263 46.082 40.351  1.00 14.15  ? 554  LYS A CE    1 
ATOM   4303 N  NZ    . LYS A 1 554 ? -0.708 47.404 40.850  1.00 14.12  ? 554  LYS A NZ    1 
ATOM   4304 N  N     . ASN A 1 555 ? 4.408  44.216 35.492  1.00 17.61  ? 555  ASN A N     1 
ATOM   4305 C  CA    . ASN A 1 555 ? 5.063  44.106 34.231  1.00 14.39  ? 555  ASN A CA    1 
ATOM   4306 C  C     . ASN A 1 555 ? 6.323  43.334 34.483  1.00 15.02  ? 555  ASN A C     1 
ATOM   4307 O  O     . ASN A 1 555 ? 7.123  43.736 35.258  1.00 17.63  ? 555  ASN A O     1 
ATOM   4308 C  CB    . ASN A 1 555 ? 5.399  45.475 33.646  1.00 14.98  ? 555  ASN A CB    1 
ATOM   4309 C  CG    . ASN A 1 555 ? 5.963  45.302 32.210  1.00 22.01  ? 555  ASN A CG    1 
ATOM   4310 O  OD1   . ASN A 1 555 ? 6.982  44.633 31.954  1.00 19.94  ? 555  ASN A OD1   1 
ATOM   4311 N  ND2   . ASN A 1 555 ? 5.281  45.866 31.252  1.00 16.35  ? 555  ASN A ND2   1 
ATOM   4312 N  N     . ALA A 1 556 ? 6.502  42.233 33.809  1.00 16.86  ? 556  ALA A N     1 
ATOM   4313 C  CA    . ALA A 1 556 ? 7.669  41.402 33.963  1.00 20.82  ? 556  ALA A CA    1 
ATOM   4314 C  C     . ALA A 1 556 ? 9.069  42.034 33.682  1.00 18.64  ? 556  ALA A C     1 
ATOM   4315 O  O     . ALA A 1 556 ? 10.079 41.542 34.156  1.00 31.50  ? 556  ALA A O     1 
ATOM   4316 C  CB    . ALA A 1 556 ? 7.512  40.128 33.005  1.00 20.16  ? 556  ALA A CB    1 
ATOM   4317 N  N     . LYS A 1 557 ? 9.176  43.083 32.893  1.00 17.58  ? 557  LYS A N     1 
ATOM   4318 C  CA    . LYS A 1 557 ? 10.480 43.662 32.608  1.00 14.78  ? 557  LYS A CA    1 
ATOM   4319 C  C     . LYS A 1 557 ? 10.816 44.762 33.598  1.00 15.33  ? 557  LYS A C     1 
ATOM   4320 O  O     . LYS A 1 557 ? 11.755 45.500 33.422  1.00 16.69  ? 557  LYS A O     1 
ATOM   4321 C  CB    . LYS A 1 557 ? 10.360 44.334 31.247  1.00 15.10  ? 557  LYS A CB    1 
ATOM   4322 C  CG    . LYS A 1 557 ? 10.097 43.362 30.114  1.00 14.30  ? 557  LYS A CG    1 
ATOM   4323 C  CD    . LYS A 1 557 ? 11.183 42.325 30.009  1.00 17.42  ? 557  LYS A CD    1 
ATOM   4324 C  CE    . LYS A 1 557 ? 11.193 41.572 28.710  1.00 22.68  ? 557  LYS A CE    1 
ATOM   4325 N  NZ    . LYS A 1 557 ? 12.209 40.499 28.751  1.00 29.07  ? 557  LYS A NZ    1 
ATOM   4326 N  N     . TYR A 1 558 ? 9.929  44.941 34.607  1.00 18.32  ? 558  TYR A N     1 
ATOM   4327 C  CA    . TYR A 1 558 ? 10.063 45.995 35.565  1.00 11.31  ? 558  TYR A CA    1 
ATOM   4328 C  C     . TYR A 1 558 ? 10.345 45.498 36.933  1.00 12.14  ? 558  TYR A C     1 
ATOM   4329 O  O     . TYR A 1 558 ? 9.811  44.494 37.307  1.00 17.83  ? 558  TYR A O     1 
ATOM   4330 C  CB    . TYR A 1 558 ? 8.777  46.791 35.760  1.00 13.99  ? 558  TYR A CB    1 
ATOM   4331 C  CG    . TYR A 1 558 ? 8.841  48.056 36.615  1.00 15.69  ? 558  TYR A CG    1 
ATOM   4332 C  CD1   . TYR A 1 558 ? 9.074  49.306 36.050  1.00 13.81  ? 558  TYR A CD1   1 
ATOM   4333 C  CD2   . TYR A 1 558 ? 8.527  48.043 37.984  1.00 13.43  ? 558  TYR A CD2   1 
ATOM   4334 C  CE1   . TYR A 1 558 ? 9.105  50.482 36.804  1.00 17.49  ? 558  TYR A CE1   1 
ATOM   4335 C  CE2   . TYR A 1 558 ? 8.430  49.223 38.721  1.00 10.84  ? 558  TYR A CE2   1 
ATOM   4336 C  CZ    . TYR A 1 558 ? 8.705  50.461 38.151  1.00 15.16  ? 558  TYR A CZ    1 
ATOM   4337 O  OH    . TYR A 1 558 ? 8.692  51.673 38.888  1.00 14.60  ? 558  TYR A OH    1 
ATOM   4338 N  N     . GLU A 1 559 ? 11.117 46.258 37.692  1.00 16.49  ? 559  GLU A N     1 
ATOM   4339 C  CA    . GLU A 1 559 ? 11.305 45.862 39.062  1.00 16.49  ? 559  GLU A CA    1 
ATOM   4340 C  C     . GLU A 1 559 ? 11.358 47.023 40.025  1.00 18.43  ? 559  GLU A C     1 
ATOM   4341 O  O     . GLU A 1 559 ? 12.144 47.961 39.861  1.00 15.83  ? 559  GLU A O     1 
ATOM   4342 C  CB    . GLU A 1 559 ? 12.463 44.902 39.344  1.00 25.17  ? 559  GLU A CB    1 
ATOM   4343 C  CG    . GLU A 1 559 ? 12.841 44.897 40.865  1.00 39.42  ? 559  GLU A CG    1 
ATOM   4344 C  CD    . GLU A 1 559 ? 13.935 43.980 41.424  1.00 100.00 ? 559  GLU A CD    1 
ATOM   4345 O  OE1   . GLU A 1 559 ? 14.696 43.418 40.552  1.00 31.94  ? 559  GLU A OE1   1 
ATOM   4346 O  OE2   . GLU A 1 559 ? 14.152 43.789 42.621  1.00 91.59  ? 559  GLU A OE2   1 
ATOM   4347 N  N     . GLU A 1 560 ? 10.501 46.940 41.059  1.00 14.71  ? 560  GLU A N     1 
ATOM   4348 C  CA    . GLU A 1 560 ? 10.542 47.943 42.124  1.00 12.95  ? 560  GLU A CA    1 
ATOM   4349 C  C     . GLU A 1 560 ? 11.638 47.517 43.148  1.00 13.19  ? 560  GLU A C     1 
ATOM   4350 O  O     . GLU A 1 560 ? 11.643 46.376 43.641  1.00 19.96  ? 560  GLU A O     1 
ATOM   4351 C  CB    . GLU A 1 560 ? 9.150  47.996 42.865  1.00 16.04  ? 560  GLU A CB    1 
ATOM   4352 C  CG    . GLU A 1 560 ? 9.117  48.868 44.164  1.00 15.32  ? 560  GLU A CG    1 
ATOM   4353 C  CD    . GLU A 1 560 ? 7.688  48.972 44.749  1.00 19.07  ? 560  GLU A CD    1 
ATOM   4354 O  OE1   . GLU A 1 560 ? 6.794  48.300 44.307  1.00 20.93  ? 560  GLU A OE1   1 
ATOM   4355 O  OE2   . GLU A 1 560 ? 7.548  49.916 45.656  1.00 22.37  ? 560  GLU A OE2   1 
ATOM   4356 N  N     . PRO A 1 561 ? 12.621 48.358 43.440  1.00 15.55  ? 561  PRO A N     1 
ATOM   4357 C  CA    . PRO A 1 561 ? 13.665 47.956 44.371  1.00 23.68  ? 561  PRO A CA    1 
ATOM   4358 C  C     . PRO A 1 561 ? 13.171 47.577 45.770  1.00 21.71  ? 561  PRO A C     1 
ATOM   4359 O  O     . PRO A 1 561 ? 12.156 48.081 46.287  1.00 13.29  ? 561  PRO A O     1 
ATOM   4360 C  CB    . PRO A 1 561 ? 14.462 49.239 44.586  1.00 21.75  ? 561  PRO A CB    1 
ATOM   4361 C  CG    . PRO A 1 561 ? 13.998 50.283 43.614  1.00 20.45  ? 561  PRO A CG    1 
ATOM   4362 C  CD    . PRO A 1 561 ? 12.614 49.825 43.203  1.00 11.29  ? 561  PRO A CD    1 
ATOM   4363 N  N     . ARG A 1 562 ? 13.953 46.716 46.421  1.00 22.50  ? 562  ARG A N     1 
ATOM   4364 C  CA    . ARG A 1 562 ? 13.661 46.284 47.761  1.00 22.81  ? 562  ARG A CA    1 
ATOM   4365 C  C     . ARG A 1 562 ? 13.634 47.428 48.747  1.00 22.33  ? 562  ARG A C     1 
ATOM   4366 O  O     . ARG A 1 562 ? 12.761 47.486 49.600  1.00 24.91  ? 562  ARG A O     1 
ATOM   4367 C  CB    . ARG A 1 562 ? 14.657 45.296 48.220  1.00 30.81  ? 562  ARG A CB    1 
ATOM   4368 C  CG    . ARG A 1 562 ? 14.190 43.877 48.284  1.00 57.81  ? 562  ARG A CG    1 
ATOM   4369 C  CD    . ARG A 1 562 ? 15.153 43.047 49.146  1.00 40.61  ? 562  ARG A CD    1 
ATOM   4370 N  NE    . ARG A 1 562 ? 16.533 43.310 48.732  1.00 98.13  ? 562  ARG A NE    1 
ATOM   4371 C  CZ    . ARG A 1 562 ? 17.647 42.848 49.339  1.00 100.00 ? 562  ARG A CZ    1 
ATOM   4372 N  NH1   . ARG A 1 562 ? 17.589 42.035 50.428  1.00 61.00  ? 562  ARG A NH1   1 
ATOM   4373 N  NH2   . ARG A 1 562 ? 18.852 43.212 48.819  1.00 37.52  ? 562  ARG A NH2   1 
ATOM   4374 N  N     . PHE A 1 563 ? 14.554 48.369 48.635  1.00 13.78  ? 563  PHE A N     1 
ATOM   4375 C  CA    . PHE A 1 563 ? 14.508 49.460 49.617  1.00 12.61  ? 563  PHE A CA    1 
ATOM   4376 C  C     . PHE A 1 563 ? 14.540 50.858 49.035  1.00 21.26  ? 563  PHE A C     1 
ATOM   4377 O  O     . PHE A 1 563 ? 14.021 51.783 49.638  1.00 22.27  ? 563  PHE A O     1 
ATOM   4378 C  CB    . PHE A 1 563 ? 15.842 49.322 50.471  1.00 14.91  ? 563  PHE A CB    1 
ATOM   4379 C  CG    . PHE A 1 563 ? 15.986 47.903 50.985  1.00 63.73  ? 563  PHE A CG    1 
ATOM   4380 C  CD1   . PHE A 1 563 ? 15.133 47.409 51.991  1.00 23.01  ? 563  PHE A CD1   1 
ATOM   4381 C  CD2   . PHE A 1 563 ? 17.009 47.066 50.507  1.00 23.90  ? 563  PHE A CD2   1 
ATOM   4382 C  CE1   . PHE A 1 563 ? 15.253 46.116 52.498  1.00 16.70  ? 563  PHE A CE1   1 
ATOM   4383 C  CE2   . PHE A 1 563 ? 17.149 45.784 51.059  1.00 20.75  ? 563  PHE A CE2   1 
ATOM   4384 C  CZ    . PHE A 1 563 ? 16.261 45.285 52.016  1.00 15.79  ? 563  PHE A CZ    1 
ATOM   4385 N  N     . SER A 1 564 ? 15.253 51.069 47.937  1.00 22.70  ? 564  SER A N     1 
ATOM   4386 C  CA    . SER A 1 564 ? 15.343 52.399 47.371  1.00 14.93  ? 564  SER A CA    1 
ATOM   4387 C  C     . SER A 1 564 ? 13.951 52.869 47.002  1.00 14.44  ? 564  SER A C     1 
ATOM   4388 O  O     . SER A 1 564 ? 13.183 52.093 46.467  1.00 17.00  ? 564  SER A O     1 
ATOM   4389 C  CB    . SER A 1 564 ? 16.170 52.499 46.028  1.00 15.81  ? 564  SER A CB    1 
ATOM   4390 O  OG    . SER A 1 564 ? 16.181 53.856 45.620  1.00 19.65  ? 564  SER A OG    1 
ATOM   4391 N  N     . LYS A 1 565 ? 13.665 54.123 47.305  1.00 26.34  ? 565  LYS A N     1 
ATOM   4392 C  CA    . LYS A 1 565 ? 12.396 54.771 47.018  1.00 36.13  ? 565  LYS A CA    1 
ATOM   4393 C  C     . LYS A 1 565 ? 12.542 55.660 45.784  1.00 16.86  ? 565  LYS A C     1 
ATOM   4394 O  O     . LYS A 1 565 ? 11.609 56.360 45.425  1.00 20.43  ? 565  LYS A O     1 
ATOM   4395 C  CB    . LYS A 1 565 ? 12.087 55.891 48.065  1.00 18.68  ? 565  LYS A CB    1 
ATOM   4396 C  CG    . LYS A 1 565 ? 11.432 55.453 49.307  1.00 40.08  ? 565  LYS A CG    1 
ATOM   4397 C  CD    . LYS A 1 565 ? 12.114 54.257 49.834  1.00 38.30  ? 565  LYS A CD    1 
ATOM   4398 C  CE    . LYS A 1 565 ? 11.430 53.735 51.085  1.00 100.00 ? 565  LYS A CE    1 
ATOM   4399 N  NZ    . LYS A 1 565 ? 10.389 52.770 50.751  1.00 57.65  ? 565  LYS A NZ    1 
ATOM   4400 N  N     . THR A 1 566 ? 13.754 55.741 45.211  1.00 15.12  ? 566  THR A N     1 
ATOM   4401 C  CA    . THR A 1 566 ? 13.879 56.669 44.114  1.00 11.78  ? 566  THR A CA    1 
ATOM   4402 C  C     . THR A 1 566 ? 14.309 55.983 42.831  1.00 14.65  ? 566  THR A C     1 
ATOM   4403 O  O     . THR A 1 566 ? 14.629 56.605 41.796  1.00 18.68  ? 566  THR A O     1 
ATOM   4404 C  CB    . THR A 1 566 ? 14.870 57.835 44.436  1.00 23.30  ? 566  THR A CB    1 
ATOM   4405 O  OG1   . THR A 1 566 ? 16.038 57.215 44.966  1.00 26.03  ? 566  THR A OG1   1 
ATOM   4406 C  CG2   . THR A 1 566 ? 14.355 58.854 45.461  1.00 20.03  ? 566  THR A CG2   1 
ATOM   4407 N  N     . GLU A 1 567 ? 14.371 54.690 42.869  1.00 13.48  ? 567  GLU A N     1 
ATOM   4408 C  CA    . GLU A 1 567 ? 14.839 54.065 41.657  1.00 14.48  ? 567  GLU A CA    1 
ATOM   4409 C  C     . GLU A 1 567 ? 13.895 52.990 41.213  1.00 20.34  ? 567  GLU A C     1 
ATOM   4410 O  O     . GLU A 1 567 ? 13.005 52.608 41.949  1.00 17.77  ? 567  GLU A O     1 
ATOM   4411 C  CB    . GLU A 1 567 ? 16.141 53.287 41.984  1.00 11.72  ? 567  GLU A CB    1 
ATOM   4412 C  CG    . GLU A 1 567 ? 17.328 54.252 42.167  1.00 19.22  ? 567  GLU A CG    1 
ATOM   4413 C  CD    . GLU A 1 567 ? 18.626 53.790 42.863  1.00 27.81  ? 567  GLU A CD    1 
ATOM   4414 O  OE1   . GLU A 1 567 ? 18.958 52.618 42.930  1.00 26.44  ? 567  GLU A OE1   1 
ATOM   4415 O  OE2   . GLU A 1 567 ? 19.308 54.807 43.425  1.00 35.44  ? 567  GLU A OE2   1 
ATOM   4416 N  N     . PHE A 1 568 ? 14.157 52.501 40.009  1.00 15.33  ? 568  PHE A N     1 
ATOM   4417 C  CA    . PHE A 1 568 ? 13.390 51.397 39.431  1.00 12.02  ? 568  PHE A CA    1 
ATOM   4418 C  C     . PHE A 1 568 ? 14.237 50.714 38.405  1.00 21.93  ? 568  PHE A C     1 
ATOM   4419 O  O     . PHE A 1 568 ? 15.137 51.324 37.815  1.00 19.28  ? 568  PHE A O     1 
ATOM   4420 C  CB    . PHE A 1 568 ? 12.052 51.793 38.799  1.00 17.97  ? 568  PHE A CB    1 
ATOM   4421 C  CG    . PHE A 1 568 ? 12.157 52.548 37.504  1.00 13.61  ? 568  PHE A CG    1 
ATOM   4422 C  CD1   . PHE A 1 568 ? 12.340 53.929 37.551  1.00 14.65  ? 568  PHE A CD1   1 
ATOM   4423 C  CD2   . PHE A 1 568 ? 12.154 51.823 36.313  1.00 17.21  ? 568  PHE A CD2   1 
ATOM   4424 C  CE1   . PHE A 1 568 ? 12.538 54.659 36.385  1.00 20.69  ? 568  PHE A CE1   1 
ATOM   4425 C  CE2   . PHE A 1 568 ? 12.250 52.568 35.138  1.00 14.91  ? 568  PHE A CE2   1 
ATOM   4426 C  CZ    . PHE A 1 568 ? 12.488 53.943 35.200  1.00 11.54  ? 568  PHE A CZ    1 
ATOM   4427 N  N     . GLY A 1 569 ? 13.945 49.439 38.242  1.00 18.00  ? 569  GLY A N     1 
ATOM   4428 C  CA    . GLY A 1 569 ? 14.709 48.621 37.301  1.00 17.41  ? 569  GLY A CA    1 
ATOM   4429 C  C     . GLY A 1 569 ? 13.939 48.216 36.075  1.00 23.09  ? 569  GLY A C     1 
ATOM   4430 O  O     . GLY A 1 569 ? 12.774 47.858 36.111  1.00 15.83  ? 569  GLY A O     1 
ATOM   4431 N  N     . VAL A 1 570 ? 14.685 48.210 34.990  1.00 15.48  ? 570  VAL A N     1 
ATOM   4432 C  CA    . VAL A 1 570 ? 14.206 47.741 33.697  1.00 19.36  ? 570  VAL A CA    1 
ATOM   4433 C  C     . VAL A 1 570 ? 15.071 46.610 33.212  1.00 13.58  ? 570  VAL A C     1 
ATOM   4434 O  O     . VAL A 1 570 ? 16.306 46.674 33.223  1.00 14.06  ? 570  VAL A O     1 
ATOM   4435 C  CB    . VAL A 1 570 ? 14.147 48.838 32.618  1.00 23.16  ? 570  VAL A CB    1 
ATOM   4436 C  CG1   . VAL A 1 570 ? 13.742 48.270 31.226  1.00 12.63  ? 570  VAL A CG1   1 
ATOM   4437 C  CG2   . VAL A 1 570 ? 13.173 50.000 33.028  1.00 12.09  ? 570  VAL A CG2   1 
ATOM   4438 N  N     . THR A 1 571 ? 14.434 45.528 32.795  1.00 13.33  ? 571  THR A N     1 
ATOM   4439 C  CA    . THR A 1 571 ? 15.166 44.420 32.207  1.00 15.00  ? 571  THR A CA    1 
ATOM   4440 C  C     . THR A 1 571 ? 15.379 44.690 30.732  1.00 25.13  ? 571  THR A C     1 
ATOM   4441 O  O     . THR A 1 571 ? 14.492 44.592 29.926  1.00 18.65  ? 571  THR A O     1 
ATOM   4442 C  CB    . THR A 1 571 ? 14.541 43.054 32.339  1.00 35.33  ? 571  THR A CB    1 
ATOM   4443 O  OG1   . THR A 1 571 ? 14.388 42.849 33.752  1.00 22.72  ? 571  THR A OG1   1 
ATOM   4444 C  CG2   . THR A 1 571 ? 15.461 42.049 31.600  1.00 23.97  ? 571  THR A CG2   1 
ATOM   4445 N  N     . HIS A 1 572 ? 16.579 45.061 30.394  1.00 20.94  ? 572  HIS A N     1 
ATOM   4446 C  CA    . HIS A 1 572 ? 16.921 45.371 29.041  1.00 12.39  ? 572  HIS A CA    1 
ATOM   4447 C  C     . HIS A 1 572 ? 17.595 44.183 28.402  1.00 16.88  ? 572  HIS A C     1 
ATOM   4448 O  O     . HIS A 1 572 ? 17.788 43.143 29.032  1.00 20.20  ? 572  HIS A O     1 
ATOM   4449 C  CB    . HIS A 1 572 ? 17.865 46.528 28.998  1.00 7.64   ? 572  HIS A CB    1 
ATOM   4450 C  CG    . HIS A 1 572 ? 17.257 47.863 29.213  1.00 11.54  ? 572  HIS A CG    1 
ATOM   4451 N  ND1   . HIS A 1 572 ? 16.577 48.520 28.165  1.00 17.24  ? 572  HIS A ND1   1 
ATOM   4452 C  CD2   . HIS A 1 572 ? 17.293 48.708 30.313  1.00 13.65  ? 572  HIS A CD2   1 
ATOM   4453 C  CE1   . HIS A 1 572 ? 16.253 49.713 28.688  1.00 16.17  ? 572  HIS A CE1   1 
ATOM   4454 N  NE2   . HIS A 1 572 ? 16.704 49.873 29.914  1.00 14.19  ? 572  HIS A NE2   1 
ATOM   4455 N  N     . TYR A 1 573 ? 17.828 44.299 27.088  1.00 21.16  ? 573  TYR A N     1 
ATOM   4456 C  CA    . TYR A 1 573 ? 18.464 43.256 26.302  1.00 17.02  ? 573  TYR A CA    1 
ATOM   4457 C  C     . TYR A 1 573 ? 19.844 42.933 26.964  1.00 15.23  ? 573  TYR A C     1 
ATOM   4458 O  O     . TYR A 1 573 ? 20.207 41.786 27.146  1.00 29.45  ? 573  TYR A O     1 
ATOM   4459 C  CB    . TYR A 1 573 ? 18.780 43.822 24.868  1.00 26.87  ? 573  TYR A CB    1 
ATOM   4460 C  CG    . TYR A 1 573 ? 19.629 42.868 24.048  1.00 23.44  ? 573  TYR A CG    1 
ATOM   4461 C  CD1   . TYR A 1 573 ? 19.017 41.778 23.398  1.00 31.12  ? 573  TYR A CD1   1 
ATOM   4462 C  CD2   . TYR A 1 573 ? 21.029 43.012 24.013  1.00 18.86  ? 573  TYR A CD2   1 
ATOM   4463 C  CE1   . TYR A 1 573 ? 19.744 40.823 22.665  1.00 30.68  ? 573  TYR A CE1   1 
ATOM   4464 C  CE2   . TYR A 1 573 ? 21.786 42.032 23.364  1.00 18.66  ? 573  TYR A CE2   1 
ATOM   4465 C  CZ    . TYR A 1 573 ? 21.138 40.980 22.700  1.00 29.55  ? 573  TYR A CZ    1 
ATOM   4466 O  OH    . TYR A 1 573 ? 21.922 40.029 22.098  1.00 45.02  ? 573  TYR A OH    1 
ATOM   4467 N  N     . ALA A 1 574 ? 20.565 43.975 27.323  1.00 21.73  ? 574  ALA A N     1 
ATOM   4468 C  CA    . ALA A 1 574 ? 21.859 43.820 27.922  1.00 27.75  ? 574  ALA A CA    1 
ATOM   4469 C  C     . ALA A 1 574 ? 21.795 43.463 29.390  1.00 38.36  ? 574  ALA A C     1 
ATOM   4470 O  O     . ALA A 1 574 ? 22.815 43.407 30.023  1.00 33.42  ? 574  ALA A O     1 
ATOM   4471 C  CB    . ALA A 1 574 ? 22.450 45.207 27.893  1.00 19.32  ? 574  ALA A CB    1 
ATOM   4472 N  N     . GLY A 1 575 ? 20.610 43.269 29.943  1.00 31.90  ? 575  GLY A N     1 
ATOM   4473 C  CA    . GLY A 1 575 ? 20.461 42.972 31.352  1.00 23.12  ? 575  GLY A CA    1 
ATOM   4474 C  C     . GLY A 1 575 ? 19.678 44.055 32.095  1.00 17.86  ? 575  GLY A C     1 
ATOM   4475 O  O     . GLY A 1 575 ? 19.278 45.041 31.502  1.00 14.24  ? 575  GLY A O     1 
ATOM   4476 N  N     . GLN A 1 576 ? 19.477 43.896 33.422  1.00 19.27  ? 576  GLN A N     1 
ATOM   4477 C  CA    . GLN A 1 576 ? 18.761 44.889 34.211  1.00 18.05  ? 576  GLN A CA    1 
ATOM   4478 C  C     . GLN A 1 576 ? 19.520 46.180 34.441  1.00 23.50  ? 576  GLN A C     1 
ATOM   4479 O  O     . GLN A 1 576 ? 20.731 46.223 34.697  1.00 21.16  ? 576  GLN A O     1 
ATOM   4480 C  CB    . GLN A 1 576 ? 18.369 44.366 35.600  1.00 16.82  ? 576  GLN A CB    1 
ATOM   4481 C  CG    . GLN A 1 576 ? 17.653 45.512 36.314  1.00 17.75  ? 576  GLN A CG    1 
ATOM   4482 C  CD    . GLN A 1 576 ? 17.136 44.996 37.597  1.00 32.55  ? 576  GLN A CD    1 
ATOM   4483 O  OE1   . GLN A 1 576 ? 17.938 44.763 38.459  1.00 31.46  ? 576  GLN A OE1   1 
ATOM   4484 N  NE2   . GLN A 1 576 ? 15.871 44.632 37.690  1.00 23.24  ? 576  GLN A NE2   1 
ATOM   4485 N  N     . VAL A 1 577 ? 18.810 47.272 34.299  1.00 12.40  ? 577  VAL A N     1 
ATOM   4486 C  CA    . VAL A 1 577 ? 19.387 48.558 34.528  1.00 13.83  ? 577  VAL A CA    1 
ATOM   4487 C  C     . VAL A 1 577 ? 18.517 49.231 35.578  1.00 18.67  ? 577  VAL A C     1 
ATOM   4488 O  O     . VAL A 1 577 ? 17.303 49.266 35.457  1.00 21.95  ? 577  VAL A O     1 
ATOM   4489 C  CB    . VAL A 1 577 ? 19.447 49.451 33.263  1.00 17.80  ? 577  VAL A CB    1 
ATOM   4490 C  CG1   . VAL A 1 577 ? 19.873 50.932 33.508  1.00 10.88  ? 577  VAL A CG1   1 
ATOM   4491 C  CG2   . VAL A 1 577 ? 20.317 48.829 32.184  1.00 17.49  ? 577  VAL A CG2   1 
ATOM   4492 N  N     . MET A 1 578 ? 19.150 49.803 36.590  1.00 17.18  ? 578  MET A N     1 
ATOM   4493 C  CA    . MET A 1 578 ? 18.474 50.524 37.627  1.00 18.73  ? 578  MET A CA    1 
ATOM   4494 C  C     . MET A 1 578 ? 18.572 52.007 37.342  1.00 17.62  ? 578  MET A C     1 
ATOM   4495 O  O     . MET A 1 578 ? 19.678 52.530 37.247  1.00 19.17  ? 578  MET A O     1 
ATOM   4496 C  CB    . MET A 1 578 ? 19.016 50.164 39.022  1.00 11.78  ? 578  MET A CB    1 
ATOM   4497 C  CG    . MET A 1 578 ? 18.540 48.803 39.447  1.00 28.38  ? 578  MET A CG    1 
ATOM   4498 S  SD    . MET A 1 578 ? 16.845 48.899 40.119  1.00 31.43  ? 578  MET A SD    1 
ATOM   4499 C  CE    . MET A 1 578 ? 16.881 50.626 40.436  1.00 50.39  ? 578  MET A CE    1 
ATOM   4500 N  N     . TYR A 1 579 ? 17.399 52.658 37.231  1.00 15.85  ? 579  TYR A N     1 
ATOM   4501 C  CA    . TYR A 1 579 ? 17.313 54.096 36.981  1.00 13.08  ? 579  TYR A CA    1 
ATOM   4502 C  C     . TYR A 1 579 ? 16.784 54.778 38.221  1.00 16.44  ? 579  TYR A C     1 
ATOM   4503 O  O     . TYR A 1 579 ? 15.996 54.174 38.953  1.00 26.10  ? 579  TYR A O     1 
ATOM   4504 C  CB    . TYR A 1 579 ? 16.206 54.371 35.967  1.00 9.46   ? 579  TYR A CB    1 
ATOM   4505 C  CG    . TYR A 1 579 ? 16.552 53.776 34.650  1.00 16.23  ? 579  TYR A CG    1 
ATOM   4506 C  CD1   . TYR A 1 579 ? 17.436 54.448 33.817  1.00 14.33  ? 579  TYR A CD1   1 
ATOM   4507 C  CD2   . TYR A 1 579 ? 16.095 52.509 34.317  1.00 12.14  ? 579  TYR A CD2   1 
ATOM   4508 C  CE1   . TYR A 1 579 ? 17.805 53.914 32.584  1.00 15.89  ? 579  TYR A CE1   1 
ATOM   4509 C  CE2   . TYR A 1 579 ? 16.460 51.952 33.100  1.00 15.81  ? 579  TYR A CE2   1 
ATOM   4510 C  CZ    . TYR A 1 579 ? 17.270 52.675 32.212  1.00 19.04  ? 579  TYR A CZ    1 
ATOM   4511 O  OH    . TYR A 1 579 ? 17.654 52.067 31.000  1.00 15.22  ? 579  TYR A OH    1 
ATOM   4512 N  N     . GLU A 1 580 ? 17.304 55.974 38.416  1.00 9.96   ? 580  GLU A N     1 
ATOM   4513 C  CA    . GLU A 1 580 ? 17.027 56.942 39.457  1.00 16.47  ? 580  GLU A CA    1 
ATOM   4514 C  C     . GLU A 1 580 ? 16.152 58.009 38.801  1.00 25.36  ? 580  GLU A C     1 
ATOM   4515 O  O     . GLU A 1 580 ? 16.416 58.480 37.678  1.00 30.43  ? 580  GLU A O     1 
ATOM   4516 C  CB    . GLU A 1 580 ? 18.414 57.586 39.910  1.00 18.41  ? 580  GLU A CB    1 
ATOM   4517 C  CG    . GLU A 1 580 ? 18.452 58.980 40.581  1.00 53.27  ? 580  GLU A CG    1 
ATOM   4518 C  CD    . GLU A 1 580 ? 17.711 59.045 41.919  1.00 100.00 ? 580  GLU A CD    1 
ATOM   4519 O  OE1   . GLU A 1 580 ? 18.201 58.204 42.829  1.00 76.20  ? 580  GLU A OE1   1 
ATOM   4520 O  OE2   . GLU A 1 580 ? 16.729 59.804 42.145  1.00 27.19  ? 580  GLU A OE2   1 
ATOM   4521 N  N     . ILE A 1 581 ? 15.103 58.400 39.499  1.00 18.35  ? 581  ILE A N     1 
ATOM   4522 C  CA    . ILE A 1 581 ? 14.122 59.328 38.963  1.00 17.23  ? 581  ILE A CA    1 
ATOM   4523 C  C     . ILE A 1 581 ? 14.354 60.810 39.255  1.00 18.48  ? 581  ILE A C     1 
ATOM   4524 O  O     . ILE A 1 581 ? 13.622 61.667 38.795  1.00 16.81  ? 581  ILE A O     1 
ATOM   4525 C  CB    . ILE A 1 581 ? 12.779 58.827 39.629  1.00 33.80  ? 581  ILE A CB    1 
ATOM   4526 C  CG1   . ILE A 1 581 ? 11.683 59.106 38.653  1.00 43.73  ? 581  ILE A CG1   1 
ATOM   4527 C  CG2   . ILE A 1 581 ? 12.461 59.409 41.097  1.00 16.19  ? 581  ILE A CG2   1 
ATOM   4528 C  CD1   . ILE A 1 581 ? 11.679 58.013 37.631  1.00 24.57  ? 581  ILE A CD1   1 
ATOM   4529 N  N     . GLN A 1 582 ? 15.368 61.143 40.027  1.00 12.38  ? 582  GLN A N     1 
ATOM   4530 C  CA    . GLN A 1 582 ? 15.535 62.532 40.371  1.00 13.84  ? 582  GLN A CA    1 
ATOM   4531 C  C     . GLN A 1 582 ? 15.611 63.469 39.185  1.00 21.12  ? 582  GLN A C     1 
ATOM   4532 O  O     . GLN A 1 582 ? 16.312 63.187 38.228  1.00 20.17  ? 582  GLN A O     1 
ATOM   4533 C  CB    . GLN A 1 582 ? 16.770 62.700 41.292  1.00 18.40  ? 582  GLN A CB    1 
ATOM   4534 C  CG    . GLN A 1 582 ? 17.334 64.105 41.316  1.00 46.64  ? 582  GLN A CG    1 
ATOM   4535 C  CD    . GLN A 1 582 ? 17.940 64.522 42.691  1.00 100.00 ? 582  GLN A CD    1 
ATOM   4536 O  OE1   . GLN A 1 582 ? 18.877 65.359 42.750  1.00 100.00 ? 582  GLN A OE1   1 
ATOM   4537 N  NE2   . GLN A 1 582 ? 17.448 63.964 43.815  1.00 100.00 ? 582  GLN A NE2   1 
ATOM   4538 N  N     . ASP A 1 583 ? 14.816 64.546 39.286  1.00 14.93  ? 583  ASP A N     1 
ATOM   4539 C  CA    . ASP A 1 583 ? 14.732 65.609 38.299  1.00 22.30  ? 583  ASP A CA    1 
ATOM   4540 C  C     . ASP A 1 583 ? 14.132 65.223 36.945  1.00 13.77  ? 583  ASP A C     1 
ATOM   4541 O  O     . ASP A 1 583 ? 14.173 66.015 36.009  1.00 20.80  ? 583  ASP A O     1 
ATOM   4542 C  CB    . ASP A 1 583 ? 16.095 66.317 38.034  1.00 23.38  ? 583  ASP A CB    1 
ATOM   4543 C  CG    . ASP A 1 583 ? 16.737 66.764 39.323  1.00 26.75  ? 583  ASP A CG    1 
ATOM   4544 O  OD1   . ASP A 1 583 ? 15.866 67.131 40.186  1.00 41.70  ? 583  ASP A OD1   1 
ATOM   4545 O  OD2   . ASP A 1 583 ? 17.928 66.646 39.518  1.00 59.32  ? 583  ASP A OD2   1 
ATOM   4546 N  N     . TRP A 1 584 ? 13.594 64.035 36.844  1.00 16.51  ? 584  TRP A N     1 
ATOM   4547 C  CA    . TRP A 1 584 ? 13.004 63.630 35.572  1.00 18.99  ? 584  TRP A CA    1 
ATOM   4548 C  C     . TRP A 1 584 ? 11.932 64.574 35.135  1.00 30.09  ? 584  TRP A C     1 
ATOM   4549 O  O     . TRP A 1 584 ? 11.771 64.813 33.931  1.00 22.65  ? 584  TRP A O     1 
ATOM   4550 C  CB    . TRP A 1 584 ? 12.515 62.192 35.502  1.00 17.81  ? 584  TRP A CB    1 
ATOM   4551 C  CG    . TRP A 1 584 ? 13.659 61.160 35.419  1.00 17.34  ? 584  TRP A CG    1 
ATOM   4552 C  CD1   . TRP A 1 584 ? 14.946 61.263 35.865  1.00 14.87  ? 584  TRP A CD1   1 
ATOM   4553 C  CD2   . TRP A 1 584 ? 13.545 59.888 34.894  1.00 15.49  ? 584  TRP A CD2   1 
ATOM   4554 N  NE1   . TRP A 1 584 ? 15.640 60.104 35.649  1.00 13.85  ? 584  TRP A NE1   1 
ATOM   4555 C  CE2   . TRP A 1 584 ? 14.806 59.232 35.082  1.00 15.62  ? 584  TRP A CE2   1 
ATOM   4556 C  CE3   . TRP A 1 584 ? 12.455 59.185 34.305  1.00 14.73  ? 584  TRP A CE3   1 
ATOM   4557 C  CZ2   . TRP A 1 584 ? 15.057 57.970 34.591  1.00 18.78  ? 584  TRP A CZ2   1 
ATOM   4558 C  CZ3   . TRP A 1 584 ? 12.706 57.901 33.814  1.00 14.48  ? 584  TRP A CZ3   1 
ATOM   4559 C  CH2   . TRP A 1 584 ? 13.982 57.332 33.969  1.00 15.32  ? 584  TRP A CH2   1 
ATOM   4560 N  N     . LEU A 1 585 ? 11.153 65.077 36.091  1.00 19.01  ? 585  LEU A N     1 
ATOM   4561 C  CA    . LEU A 1 585 ? 10.096 66.008 35.731  1.00 18.63  ? 585  LEU A CA    1 
ATOM   4562 C  C     . LEU A 1 585 ? 10.641 67.232 35.033  1.00 32.47  ? 585  LEU A C     1 
ATOM   4563 O  O     . LEU A 1 585 ? 10.116 67.684 34.007  1.00 19.01  ? 585  LEU A O     1 
ATOM   4564 C  CB    . LEU A 1 585 ? 9.130  66.388 36.857  1.00 26.20  ? 585  LEU A CB    1 
ATOM   4565 C  CG    . LEU A 1 585 ? 8.385  65.185 37.498  1.00 25.87  ? 585  LEU A CG    1 
ATOM   4566 C  CD1   . LEU A 1 585 ? 7.778  65.545 38.848  1.00 31.98  ? 585  LEU A CD1   1 
ATOM   4567 C  CD2   . LEU A 1 585 ? 7.262  64.628 36.622  1.00 25.67  ? 585  LEU A CD2   1 
ATOM   4568 N  N     . GLU A 1 586 ? 11.732 67.752 35.580  1.00 20.97  ? 586  GLU A N     1 
ATOM   4569 C  CA    . GLU A 1 586 ? 12.374 68.931 35.058  1.00 21.40  ? 586  GLU A CA    1 
ATOM   4570 C  C     . GLU A 1 586 ? 13.039 68.711 33.722  1.00 16.93  ? 586  GLU A C     1 
ATOM   4571 O  O     . GLU A 1 586 ? 12.937 69.555 32.784  1.00 17.53  ? 586  GLU A O     1 
ATOM   4572 C  CB    . GLU A 1 586 ? 13.456 69.252 36.079  1.00 25.68  ? 586  GLU A CB    1 
ATOM   4573 C  CG    . GLU A 1 586 ? 14.026 70.616 35.684  1.00 36.84  ? 586  GLU A CG    1 
ATOM   4574 C  CD    . GLU A 1 586 ? 14.990 71.114 36.689  1.00 96.41  ? 586  GLU A CD    1 
ATOM   4575 O  OE1   . GLU A 1 586 ? 15.146 70.570 37.772  1.00 71.00  ? 586  GLU A OE1   1 
ATOM   4576 O  OE2   . GLU A 1 586 ? 15.608 72.177 36.241  1.00 86.78  ? 586  GLU A OE2   1 
ATOM   4577 N  N     . LYS A 1 587 ? 13.712 67.555 33.671  1.00 17.31  ? 587  LYS A N     1 
ATOM   4578 C  CA    . LYS A 1 587 ? 14.361 67.140 32.431  1.00 29.88  ? 587  LYS A CA    1 
ATOM   4579 C  C     . LYS A 1 587 ? 13.341 66.988 31.272  1.00 35.38  ? 587  LYS A C     1 
ATOM   4580 O  O     . LYS A 1 587 ? 13.637 67.275 30.123  1.00 24.66  ? 587  LYS A O     1 
ATOM   4581 C  CB    . LYS A 1 587 ? 15.151 65.842 32.577  1.00 18.12  ? 587  LYS A CB    1 
ATOM   4582 C  CG    . LYS A 1 587 ? 16.417 65.839 33.442  1.00 19.37  ? 587  LYS A CG    1 
ATOM   4583 C  CD    . LYS A 1 587 ? 16.838 64.429 33.971  1.00 19.55  ? 587  LYS A CD    1 
ATOM   4584 C  CE    . LYS A 1 587 ? 17.985 64.591 34.996  1.00 35.85  ? 587  LYS A CE    1 
ATOM   4585 N  NZ    . LYS A 1 587 ? 19.311 64.214 34.412  1.00 36.45  ? 587  LYS A NZ    1 
ATOM   4586 N  N     . ASN A 1 588 ? 12.141 66.495 31.599  1.00 22.29  ? 588  ASN A N     1 
ATOM   4587 C  CA    . ASN A 1 588 ? 11.090 66.273 30.636  1.00 25.85  ? 588  ASN A CA    1 
ATOM   4588 C  C     . ASN A 1 588 ? 10.586 67.565 30.056  1.00 20.86  ? 588  ASN A C     1 
ATOM   4589 O  O     . ASN A 1 588 ? 10.223 67.628 28.902  1.00 25.25  ? 588  ASN A O     1 
ATOM   4590 C  CB    . ASN A 1 588 ? 9.931  65.366 31.139  1.00 14.94  ? 588  ASN A CB    1 
ATOM   4591 C  CG    . ASN A 1 588 ? 9.196  64.737 29.955  1.00 21.73  ? 588  ASN A CG    1 
ATOM   4592 O  OD1   . ASN A 1 588 ? 9.829  64.335 28.941  1.00 24.05  ? 588  ASN A OD1   1 
ATOM   4593 N  ND2   . ASN A 1 588 ? 7.900  64.598 30.072  1.00 15.72  ? 588  ASN A ND2   1 
ATOM   4594 N  N     . LYS A 1 589 ? 10.571 68.614 30.870  1.00 23.23  ? 589  LYS A N     1 
ATOM   4595 C  CA    . LYS A 1 589 ? 10.098 69.908 30.420  1.00 29.52  ? 589  LYS A CA    1 
ATOM   4596 C  C     . LYS A 1 589 ? 11.194 70.838 29.925  1.00 55.44  ? 589  LYS A C     1 
ATOM   4597 O  O     . LYS A 1 589 ? 10.938 71.683 29.053  1.00 29.16  ? 589  LYS A O     1 
ATOM   4598 C  CB    . LYS A 1 589 ? 9.301  70.647 31.467  1.00 26.65  ? 589  LYS A CB    1 
ATOM   4599 C  CG    . LYS A 1 589 ? 8.149  69.815 32.075  1.00 41.81  ? 589  LYS A CG    1 
ATOM   4600 C  CD    . LYS A 1 589 ? 8.161  69.813 33.609  1.00 100.00 ? 589  LYS A CD    1 
ATOM   4601 C  CE    . LYS A 1 589 ? 7.203  70.811 34.238  1.00 33.46  ? 589  LYS A CE    1 
ATOM   4602 N  NZ    . LYS A 1 589 ? 7.494  71.179 35.663  1.00 71.87  ? 589  LYS A NZ    1 
ATOM   4603 N  N     . ASP A 1 590 ? 12.382 70.721 30.518  1.00 23.35  ? 590  ASP A N     1 
ATOM   4604 C  CA    . ASP A 1 590 ? 13.461 71.579 30.109  1.00 21.38  ? 590  ASP A CA    1 
ATOM   4605 C  C     . ASP A 1 590 ? 13.027 73.048 30.129  1.00 24.17  ? 590  ASP A C     1 
ATOM   4606 O  O     . ASP A 1 590 ? 13.203 73.815 29.178  1.00 29.06  ? 590  ASP A O     1 
ATOM   4607 C  CB    . ASP A 1 590 ? 13.788 71.107 28.709  1.00 20.84  ? 590  ASP A CB    1 
ATOM   4608 C  CG    . ASP A 1 590 ? 15.193 71.488 28.435  1.00 35.96  ? 590  ASP A CG    1 
ATOM   4609 O  OD1   . ASP A 1 590 ? 15.843 71.689 29.550  1.00 37.18  ? 590  ASP A OD1   1 
ATOM   4610 O  OD2   . ASP A 1 590 ? 15.642 71.628 27.336  1.00 39.31  ? 590  ASP A OD2   1 
ATOM   4611 N  N     . PRO A 1 591 ? 12.397 73.450 31.229  1.00 32.49  ? 591  PRO A N     1 
ATOM   4612 C  CA    . PRO A 1 591 ? 11.890 74.791 31.302  1.00 27.00  ? 591  PRO A CA    1 
ATOM   4613 C  C     . PRO A 1 591 ? 12.922 75.910 31.304  1.00 46.62  ? 591  PRO A C     1 
ATOM   4614 O  O     . PRO A 1 591 ? 14.072 75.822 31.752  1.00 26.17  ? 591  PRO A O     1 
ATOM   4615 C  CB    . PRO A 1 591 ? 11.123 74.825 32.582  1.00 22.14  ? 591  PRO A CB    1 
ATOM   4616 C  CG    . PRO A 1 591 ? 11.850 73.930 33.490  1.00 21.86  ? 591  PRO A CG    1 
ATOM   4617 C  CD    . PRO A 1 591 ? 12.581 72.945 32.622  1.00 20.12  ? 591  PRO A CD    1 
ATOM   4618 N  N     . LEU A 1 592 ? 12.456 77.020 30.790  1.00 23.81  ? 592  LEU A N     1 
ATOM   4619 C  CA    . LEU A 1 592 ? 13.215 78.262 30.785  1.00 29.03  ? 592  LEU A CA    1 
ATOM   4620 C  C     . LEU A 1 592 ? 12.194 79.364 31.031  1.00 32.88  ? 592  LEU A C     1 
ATOM   4621 O  O     . LEU A 1 592 ? 11.139 79.333 30.419  1.00 24.39  ? 592  LEU A O     1 
ATOM   4622 C  CB    . LEU A 1 592 ? 14.061 78.464 29.484  1.00 25.90  ? 592  LEU A CB    1 
ATOM   4623 C  CG    . LEU A 1 592 ? 14.789 79.805 29.346  1.00 21.69  ? 592  LEU A CG    1 
ATOM   4624 C  CD1   . LEU A 1 592 ? 16.017 79.829 30.233  1.00 24.95  ? 592  LEU A CD1   1 
ATOM   4625 C  CD2   . LEU A 1 592 ? 15.296 80.020 27.912  1.00 26.82  ? 592  LEU A CD2   1 
ATOM   4626 N  N     . GLN A 1 593 ? 12.465 80.287 31.924  1.00 22.04  ? 593  GLN A N     1 
ATOM   4627 C  CA    . GLN A 1 593 ? 11.506 81.320 32.230  1.00 28.48  ? 593  GLN A CA    1 
ATOM   4628 C  C     . GLN A 1 593 ? 11.177 82.179 31.010  1.00 45.54  ? 593  GLN A C     1 
ATOM   4629 O  O     . GLN A 1 593 ? 12.080 82.575 30.273  1.00 27.88  ? 593  GLN A O     1 
ATOM   4630 C  CB    . GLN A 1 593 ? 12.110 82.246 33.291  1.00 23.89  ? 593  GLN A CB    1 
ATOM   4631 C  CG    . GLN A 1 593 ? 12.023 81.771 34.747  1.00 28.43  ? 593  GLN A CG    1 
ATOM   4632 C  CD    . GLN A 1 593 ? 10.585 81.563 35.114  1.00 100.00 ? 593  GLN A CD    1 
ATOM   4633 O  OE1   . GLN A 1 593 ? 9.662  82.070 34.450  1.00 36.79  ? 593  GLN A OE1   1 
ATOM   4634 N  NE2   . GLN A 1 593 ? 10.398 80.842 36.206  1.00 25.88  ? 593  GLN A NE2   1 
ATOM   4635 N  N     . GLN A 1 594 ? 9.884  82.501 30.814  1.00 27.11  ? 594  GLN A N     1 
ATOM   4636 C  CA    . GLN A 1 594 ? 9.495  83.353 29.675  1.00 33.41  ? 594  GLN A CA    1 
ATOM   4637 C  C     . GLN A 1 594 ? 10.262 84.676 29.592  1.00 30.69  ? 594  GLN A C     1 
ATOM   4638 O  O     . GLN A 1 594 ? 10.681 85.122 28.511  1.00 32.03  ? 594  GLN A O     1 
ATOM   4639 C  CB    . GLN A 1 594 ? 7.959  83.553 29.596  1.00 42.31  ? 594  GLN A CB    1 
ATOM   4640 C  CG    . GLN A 1 594 ? 7.499  84.509 28.487  1.00 36.96  ? 594  GLN A CG    1 
ATOM   4641 C  CD    . GLN A 1 594 ? 7.821  84.035 27.075  1.00 100.00 ? 594  GLN A CD    1 
ATOM   4642 O  OE1   . GLN A 1 594 ? 7.639  84.765 26.066  1.00 82.16  ? 594  GLN A OE1   1 
ATOM   4643 N  NE2   . GLN A 1 594 ? 8.324  82.805 27.001  1.00 46.11  ? 594  GLN A NE2   1 
ATOM   4644 N  N     . ASP A 1 595 ? 10.467 85.307 30.771  1.00 30.29  ? 595  ASP A N     1 
ATOM   4645 C  CA    . ASP A 1 595 ? 11.191 86.560 30.766  1.00 28.88  ? 595  ASP A CA    1 
ATOM   4646 C  C     . ASP A 1 595 ? 12.550 86.450 30.085  1.00 38.47  ? 595  ASP A C     1 
ATOM   4647 O  O     . ASP A 1 595 ? 12.955 87.273 29.229  1.00 44.16  ? 595  ASP A O     1 
ATOM   4648 C  CB    . ASP A 1 595 ? 11.161 87.211 32.127  1.00 38.26  ? 595  ASP A CB    1 
ATOM   4649 C  CG    . ASP A 1 595 ? 9.787  87.839 32.333  1.00 43.44  ? 595  ASP A CG    1 
ATOM   4650 O  OD1   . ASP A 1 595 ? 8.944  87.714 31.349  1.00 33.81  ? 595  ASP A OD1   1 
ATOM   4651 O  OD2   . ASP A 1 595 ? 9.462  88.399 33.340  1.00 38.83  ? 595  ASP A OD2   1 
ATOM   4652 N  N     . LEU A 1 596 ? 13.249 85.377 30.421  1.00 37.35  ? 596  LEU A N     1 
ATOM   4653 C  CA    . LEU A 1 596 ? 14.535 85.153 29.796  1.00 34.80  ? 596  LEU A CA    1 
ATOM   4654 C  C     . LEU A 1 596 ? 14.392 85.014 28.285  1.00 41.15  ? 596  LEU A C     1 
ATOM   4655 O  O     . LEU A 1 596 ? 15.224 85.497 27.515  1.00 29.97  ? 596  LEU A O     1 
ATOM   4656 C  CB    . LEU A 1 596 ? 15.194 83.930 30.476  1.00 28.20  ? 596  LEU A CB    1 
ATOM   4657 C  CG    . LEU A 1 596 ? 15.520 84.296 31.890  1.00 23.97  ? 596  LEU A CG    1 
ATOM   4658 C  CD1   . LEU A 1 596 ? 15.694 83.037 32.708  1.00 34.18  ? 596  LEU A CD1   1 
ATOM   4659 C  CD2   . LEU A 1 596 ? 16.841 85.089 31.924  1.00 22.15  ? 596  LEU A CD2   1 
ATOM   4660 N  N     . GLU A 1 597 ? 13.326 84.348 27.828  1.00 28.00  ? 597  GLU A N     1 
ATOM   4661 C  CA    . GLU A 1 597 ? 13.155 84.229 26.381  1.00 30.80  ? 597  GLU A CA    1 
ATOM   4662 C  C     . GLU A 1 597 ? 12.928 85.576 25.733  1.00 42.96  ? 597  GLU A C     1 
ATOM   4663 O  O     . GLU A 1 597 ? 13.383 85.811 24.611  1.00 32.50  ? 597  GLU A O     1 
ATOM   4664 C  CB    . GLU A 1 597 ? 11.872 83.498 26.067  1.00 33.45  ? 597  GLU A CB    1 
ATOM   4665 C  CG    . GLU A 1 597 ? 11.937 82.032 26.431  1.00 36.68  ? 597  GLU A CG    1 
ATOM   4666 C  CD    . GLU A 1 597 ? 12.789 81.278 25.428  1.00 71.12  ? 597  GLU A CD    1 
ATOM   4667 O  OE1   . GLU A 1 597 ? 13.462 81.795 24.540  1.00 75.25  ? 597  GLU A OE1   1 
ATOM   4668 O  OE2   . GLU A 1 597 ? 12.793 79.986 25.636  1.00 43.08  ? 597  GLU A OE2   1 
ATOM   4669 N  N     . LEU A 1 598 ? 12.163 86.396 26.475  1.00 33.29  ? 598  LEU A N     1 
ATOM   4670 C  CA    . LEU A 1 598 ? 11.799 87.735 26.067  1.00 33.94  ? 598  LEU A CA    1 
ATOM   4671 C  C     . LEU A 1 598 ? 13.005 88.619 26.021  1.00 35.02  ? 598  LEU A C     1 
ATOM   4672 O  O     . LEU A 1 598 ? 13.191 89.364 25.061  1.00 34.11  ? 598  LEU A O     1 
ATOM   4673 C  CB    . LEU A 1 598 ? 10.846 88.375 27.048  1.00 26.30  ? 598  LEU A CB    1 
ATOM   4674 C  CG    . LEU A 1 598 ? 9.512  87.675 26.871  1.00 29.67  ? 598  LEU A CG    1 
ATOM   4675 C  CD1   . LEU A 1 598 ? 8.552  88.236 27.885  1.00 36.09  ? 598  LEU A CD1   1 
ATOM   4676 C  CD2   . LEU A 1 598 ? 8.937  87.781 25.472  1.00 30.39  ? 598  LEU A CD2   1 
ATOM   4677 N  N     . CYS A 1 599 ? 13.832 88.485 27.050  1.00 29.88  ? 599  CYS A N     1 
ATOM   4678 C  CA    . CYS A 1 599 ? 15.069 89.242 27.120  1.00 24.42  ? 599  CYS A CA    1 
ATOM   4679 C  C     . CYS A 1 599 ? 15.955 88.995 25.915  1.00 33.98  ? 599  CYS A C     1 
ATOM   4680 O  O     . CYS A 1 599 ? 16.397 89.919 25.249  1.00 44.54  ? 599  CYS A O     1 
ATOM   4681 C  CB    . CYS A 1 599 ? 15.799 88.875 28.405  1.00 31.71  ? 599  CYS A CB    1 
ATOM   4682 S  SG    . CYS A 1 599 ? 17.426 89.669 28.681  1.00 41.43  ? 599  CYS A SG    1 
ATOM   4683 N  N     . PHE A 1 600 ? 16.228 87.723 25.648  1.00 44.17  ? 600  PHE A N     1 
ATOM   4684 C  CA    . PHE A 1 600 ? 17.111 87.284 24.574  1.00 36.85  ? 600  PHE A CA    1 
ATOM   4685 C  C     . PHE A 1 600 ? 16.553 87.526 23.183  1.00 42.13  ? 600  PHE A C     1 
ATOM   4686 O  O     . PHE A 1 600 ? 17.308 87.733 22.231  1.00 35.73  ? 600  PHE A O     1 
ATOM   4687 C  CB    . PHE A 1 600 ? 17.656 85.826 24.845  1.00 34.52  ? 600  PHE A CB    1 
ATOM   4688 C  CG    . PHE A 1 600 ? 18.770 85.859 25.876  1.00 30.15  ? 600  PHE A CG    1 
ATOM   4689 C  CD1   . PHE A 1 600 ? 18.474 85.955 27.239  1.00 25.35  ? 600  PHE A CD1   1 
ATOM   4690 C  CD2   . PHE A 1 600 ? 20.108 85.887 25.466  1.00 25.40  ? 600  PHE A CD2   1 
ATOM   4691 C  CE1   . PHE A 1 600 ? 19.477 86.109 28.199  1.00 28.89  ? 600  PHE A CE1   1 
ATOM   4692 C  CE2   . PHE A 1 600 ? 21.142 85.939 26.413  1.00 36.69  ? 600  PHE A CE2   1 
ATOM   4693 C  CZ    . PHE A 1 600 ? 20.820 86.077 27.773  1.00 35.47  ? 600  PHE A CZ    1 
ATOM   4694 N  N     . LYS A 1 601 ? 15.221 87.439 23.050  1.00 25.92  ? 601  LYS A N     1 
ATOM   4695 C  CA    . LYS A 1 601 ? 14.614 87.708 21.754  1.00 46.87  ? 601  LYS A CA    1 
ATOM   4696 C  C     . LYS A 1 601 ? 14.979 89.092 21.144  1.00 43.39  ? 601  LYS A C     1 
ATOM   4697 O  O     . LYS A 1 601 ? 14.977 89.239 19.919  1.00 47.78  ? 601  LYS A O     1 
ATOM   4698 C  CB    . LYS A 1 601 ? 13.105 87.599 21.880  1.00 31.68  ? 601  LYS A CB    1 
ATOM   4699 C  CG    . LYS A 1 601 ? 12.575 86.164 21.783  1.00 34.05  ? 601  LYS A CG    1 
ATOM   4700 C  CD    . LYS A 1 601 ? 11.063 86.180 21.673  1.00 28.75  ? 601  LYS A CD    1 
ATOM   4701 C  CE    . LYS A 1 601 ? 10.410 84.868 21.284  1.00 49.92  ? 601  LYS A CE    1 
ATOM   4702 N  NZ    . LYS A 1 601 ? 9.264  84.558 22.173  1.00 68.41  ? 601  LYS A NZ    1 
ATOM   4703 N  N     . ASP A 1 602 ? 15.245 90.086 22.029  1.00 40.43  ? 602  ASP A N     1 
ATOM   4704 C  CA    . ASP A 1 602 ? 15.609 91.479 21.737  1.00 94.50  ? 602  ASP A CA    1 
ATOM   4705 C  C     . ASP A 1 602 ? 17.113 91.669 21.594  1.00 75.10  ? 602  ASP A C     1 
ATOM   4706 O  O     . ASP A 1 602 ? 17.636 92.781 21.599  1.00 100.00 ? 602  ASP A O     1 
ATOM   4707 C  CB    . ASP A 1 602 ? 15.201 92.431 22.919  1.00 66.48  ? 602  ASP A CB    1 
ATOM   4708 C  CG    . ASP A 1 602 ? 13.748 92.543 23.402  1.00 100.00 ? 602  ASP A CG    1 
ATOM   4709 O  OD1   . ASP A 1 602 ? 12.855 92.302 22.455  1.00 100.00 ? 602  ASP A OD1   1 
ATOM   4710 O  OD2   . ASP A 1 602 ? 13.445 92.936 24.562  1.00 100.00 ? 602  ASP A OD2   1 
ATOM   4711 N  N     . SER A 1 603 ? 17.819 90.571 21.517  1.00 49.97  ? 603  SER A N     1 
ATOM   4712 C  CA    . SER A 1 603 ? 19.246 90.687 21.403  1.00 61.03  ? 603  SER A CA    1 
ATOM   4713 C  C     . SER A 1 603 ? 19.593 91.462 20.151  1.00 60.24  ? 603  SER A C     1 
ATOM   4714 O  O     . SER A 1 603 ? 18.927 91.314 19.120  1.00 39.18  ? 603  SER A O     1 
ATOM   4715 C  CB    . SER A 1 603 ? 19.837 89.263 21.299  1.00 37.00  ? 603  SER A CB    1 
ATOM   4716 O  OG    . SER A 1 603 ? 21.245 89.305 21.376  1.00 31.99  ? 603  SER A OG    1 
ATOM   4717 N  N     . SER A 1 604 ? 20.651 92.262 20.238  1.00 44.61  ? 604  SER A N     1 
ATOM   4718 C  CA    . SER A 1 604 ? 21.131 92.945 19.062  1.00 60.06  ? 604  SER A CA    1 
ATOM   4719 C  C     . SER A 1 604 ? 22.031 92.016 18.245  1.00 72.92  ? 604  SER A C     1 
ATOM   4720 O  O     . SER A 1 604 ? 22.359 92.294 17.102  1.00 51.92  ? 604  SER A O     1 
ATOM   4721 C  CB    . SER A 1 604 ? 21.909 94.165 19.419  1.00 41.57  ? 604  SER A CB    1 
ATOM   4722 O  OG    . SER A 1 604 ? 22.764 93.802 20.496  1.00 64.31  ? 604  SER A OG    1 
ATOM   4723 N  N     . ASP A 1 605 ? 22.457 90.905 18.843  1.00 51.10  ? 605  ASP A N     1 
ATOM   4724 C  CA    . ASP A 1 605 ? 23.308 89.964 18.136  1.00 55.00  ? 605  ASP A CA    1 
ATOM   4725 C  C     . ASP A 1 605 ? 22.566 89.213 17.040  1.00 32.87  ? 605  ASP A C     1 
ATOM   4726 O  O     . ASP A 1 605 ? 21.459 88.744 17.226  1.00 44.18  ? 605  ASP A O     1 
ATOM   4727 C  CB    . ASP A 1 605 ? 24.127 89.016 19.021  1.00 51.88  ? 605  ASP A CB    1 
ATOM   4728 C  CG    . ASP A 1 605 ? 25.065 88.168 18.219  1.00 44.29  ? 605  ASP A CG    1 
ATOM   4729 O  OD1   . ASP A 1 605 ? 24.735 87.076 17.728  1.00 35.60  ? 605  ASP A OD1   1 
ATOM   4730 O  OD2   . ASP A 1 605 ? 26.258 88.753 18.050  1.00 42.13  ? 605  ASP A OD2   1 
ATOM   4731 N  N     . ASN A 1 606 ? 23.225 89.136 15.889  1.00 49.27  ? 606  ASN A N     1 
ATOM   4732 C  CA    . ASN A 1 606 ? 22.649 88.499 14.721  1.00 32.99  ? 606  ASN A CA    1 
ATOM   4733 C  C     . ASN A 1 606 ? 22.330 87.024 14.844  1.00 67.75  ? 606  ASN A C     1 
ATOM   4734 O  O     . ASN A 1 606 ? 21.346 86.503 14.274  1.00 42.25  ? 606  ASN A O     1 
ATOM   4735 C  CB    . ASN A 1 606 ? 22.708 89.255 13.381  1.00 100.00 ? 606  ASN A CB    1 
ATOM   4736 C  CG    . ASN A 1 606 ? 21.979 90.598 13.516  1.00 100.00 ? 606  ASN A CG    1 
ATOM   4737 O  OD1   . ASN A 1 606 ? 22.621 91.675 13.581  1.00 100.00 ? 606  ASN A OD1   1 
ATOM   4738 N  ND2   . ASN A 1 606 ? 20.626 90.532 13.584  1.00 100.00 ? 606  ASN A ND2   1 
ATOM   4739 N  N     . VAL A 1 607 ? 23.181 86.363 15.616  1.00 52.29  ? 607  VAL A N     1 
ATOM   4740 C  CA    . VAL A 1 607 ? 23.017 84.948 15.836  1.00 36.10  ? 607  VAL A CA    1 
ATOM   4741 C  C     . VAL A 1 607 ? 22.076 84.684 16.999  1.00 39.74  ? 607  VAL A C     1 
ATOM   4742 O  O     . VAL A 1 607 ? 21.183 83.845 16.939  1.00 29.41  ? 607  VAL A O     1 
ATOM   4743 C  CB    . VAL A 1 607 ? 24.340 84.230 15.878  1.00 36.56  ? 607  VAL A CB    1 
ATOM   4744 C  CG1   . VAL A 1 607 ? 24.047 82.755 16.165  1.00 49.35  ? 607  VAL A CG1   1 
ATOM   4745 C  CG2   . VAL A 1 607 ? 25.007 84.371 14.503  1.00 27.38  ? 607  VAL A CG2   1 
ATOM   4746 N  N     . VAL A 1 608 ? 22.258 85.462 18.044  1.00 34.55  ? 608  VAL A N     1 
ATOM   4747 C  CA    . VAL A 1 608 ? 21.429 85.314 19.210  1.00 27.20  ? 608  VAL A CA    1 
ATOM   4748 C  C     . VAL A 1 608 ? 19.955 85.397 18.889  1.00 48.60  ? 608  VAL A C     1 
ATOM   4749 O  O     . VAL A 1 608 ? 19.138 84.614 19.385  1.00 40.43  ? 608  VAL A O     1 
ATOM   4750 C  CB    . VAL A 1 608 ? 21.853 86.152 20.404  1.00 45.17  ? 608  VAL A CB    1 
ATOM   4751 C  CG1   . VAL A 1 608 ? 20.846 85.885 21.563  1.00 30.50  ? 608  VAL A CG1   1 
ATOM   4752 C  CG2   . VAL A 1 608 ? 23.305 85.767 20.783  1.00 23.92  ? 608  VAL A CG2   1 
ATOM   4753 N  N     . THR A 1 609 ? 19.617 86.344 18.037  1.00 40.19  ? 609  THR A N     1 
ATOM   4754 C  CA    . THR A 1 609 ? 18.249 86.528 17.632  1.00 41.02  ? 609  THR A CA    1 
ATOM   4755 C  C     . THR A 1 609 ? 17.639 85.231 17.103  1.00 45.82  ? 609  THR A C     1 
ATOM   4756 O  O     . THR A 1 609 ? 16.513 84.820 17.461  1.00 43.41  ? 609  THR A O     1 
ATOM   4757 C  CB    . THR A 1 609 ? 18.185 87.741 16.684  1.00 33.11  ? 609  THR A CB    1 
ATOM   4758 O  OG1   . THR A 1 609 ? 18.281 88.900 17.529  1.00 64.95  ? 609  THR A OG1   1 
ATOM   4759 C  CG2   . THR A 1 609 ? 16.818 87.740 16.025  1.00 50.34  ? 609  THR A CG2   1 
ATOM   4760 N  N     . LYS A 1 610 ? 18.403 84.529 16.269  1.00 28.64  ? 610  LYS A N     1 
ATOM   4761 C  CA    . LYS A 1 610 ? 17.932 83.268 15.717  1.00 33.05  ? 610  LYS A CA    1 
ATOM   4762 C  C     . LYS A 1 610 ? 17.575 82.204 16.759  1.00 25.70  ? 610  LYS A C     1 
ATOM   4763 O  O     . LYS A 1 610 ? 16.644 81.433 16.589  1.00 26.75  ? 610  LYS A O     1 
ATOM   4764 C  CB    . LYS A 1 610 ? 19.054 82.671 14.862  1.00 36.40  ? 610  LYS A CB    1 
ATOM   4765 C  CG    . LYS A 1 610 ? 19.192 83.364 13.543  1.00 43.89  ? 610  LYS A CG    1 
ATOM   4766 C  CD    . LYS A 1 610 ? 18.276 82.673 12.565  1.00 100.00 ? 610  LYS A CD    1 
ATOM   4767 C  CE    . LYS A 1 610 ? 17.775 83.563 11.449  1.00 100.00 ? 610  LYS A CE    1 
ATOM   4768 N  NZ    . LYS A 1 610 ? 16.784 82.857 10.605  1.00 100.00 ? 610  LYS A NZ    1 
ATOM   4769 N  N     . LEU A 1 611 ? 18.411 82.101 17.772  1.00 43.51  ? 611  LEU A N     1 
ATOM   4770 C  CA    . LEU A 1 611 ? 18.288 81.098 18.826  1.00 45.48  ? 611  LEU A CA    1 
ATOM   4771 C  C     . LEU A 1 611 ? 17.002 81.245 19.614  1.00 41.34  ? 611  LEU A C     1 
ATOM   4772 O  O     . LEU A 1 611 ? 16.426 80.261 20.081  1.00 27.21  ? 611  LEU A O     1 
ATOM   4773 C  CB    . LEU A 1 611 ? 19.551 81.007 19.764  1.00 26.15  ? 611  LEU A CB    1 
ATOM   4774 C  CG    . LEU A 1 611 ? 20.924 80.881 19.082  1.00 20.19  ? 611  LEU A CG    1 
ATOM   4775 C  CD1   . LEU A 1 611 ? 21.891 80.548 20.174  1.00 31.59  ? 611  LEU A CD1   1 
ATOM   4776 C  CD2   . LEU A 1 611 ? 20.851 79.765 18.062  1.00 28.57  ? 611  LEU A CD2   1 
ATOM   4777 N  N     . PHE A 1 612 ? 16.523 82.479 19.769  1.00 38.00  ? 612  PHE A N     1 
ATOM   4778 C  CA    . PHE A 1 612 ? 15.283 82.684 20.513  1.00 34.67  ? 612  PHE A CA    1 
ATOM   4779 C  C     . PHE A 1 612 ? 14.083 82.952 19.613  1.00 42.09  ? 612  PHE A C     1 
ATOM   4780 O  O     . PHE A 1 612 ? 12.938 82.758 19.997  1.00 30.47  ? 612  PHE A O     1 
ATOM   4781 C  CB    . PHE A 1 612 ? 15.523 83.884 21.453  1.00 26.72  ? 612  PHE A CB    1 
ATOM   4782 C  CG    . PHE A 1 612 ? 16.415 83.388 22.560  1.00 27.97  ? 612  PHE A CG    1 
ATOM   4783 C  CD1   . PHE A 1 612 ? 17.811 83.361 22.414  1.00 25.90  ? 612  PHE A CD1   1 
ATOM   4784 C  CD2   . PHE A 1 612 ? 15.858 82.814 23.702  1.00 30.01  ? 612  PHE A CD2   1 
ATOM   4785 C  CE1   . PHE A 1 612 ? 18.619 82.772 23.391  1.00 38.54  ? 612  PHE A CE1   1 
ATOM   4786 C  CE2   . PHE A 1 612 ? 16.657 82.237 24.696  1.00 37.06  ? 612  PHE A CE2   1 
ATOM   4787 C  CZ    . PHE A 1 612 ? 18.046 82.225 24.544  1.00 33.24  ? 612  PHE A CZ    1 
ATOM   4788 N  N     . ASN A 1 613 ? 14.367 83.429 18.390  1.00 33.96  ? 613  ASN A N     1 
ATOM   4789 C  CA    . ASN A 1 613 ? 13.321 83.818 17.449  1.00 30.37  ? 613  ASN A CA    1 
ATOM   4790 C  C     . ASN A 1 613 ? 12.925 82.755 16.448  1.00 38.82  ? 613  ASN A C     1 
ATOM   4791 O  O     . ASN A 1 613 ? 11.793 82.743 15.969  1.00 100.00 ? 613  ASN A O     1 
ATOM   4792 C  CB    . ASN A 1 613 ? 13.604 85.231 16.846  1.00 36.72  ? 613  ASN A CB    1 
ATOM   4793 C  CG    . ASN A 1 613 ? 13.264 86.392 17.799  1.00 27.77  ? 613  ASN A CG    1 
ATOM   4794 O  OD1   . ASN A 1 613 ? 14.124 87.183 18.252  1.00 48.56  ? 613  ASN A OD1   1 
ATOM   4795 N  ND2   . ASN A 1 613 ? 11.983 86.414 18.184  1.00 46.07  ? 613  ASN A ND2   1 
ATOM   4796 N  N     . ASP A 1 614 ? 13.852 81.853 16.128  1.00 71.99  ? 614  ASP A N     1 
ATOM   4797 C  CA    . ASP A 1 614 ? 13.540 80.773 15.212  1.00 22.09  ? 614  ASP A CA    1 
ATOM   4798 C  C     . ASP A 1 614 ? 12.944 79.585 15.983  1.00 38.67  ? 614  ASP A C     1 
ATOM   4799 O  O     . ASP A 1 614 ? 13.624 78.858 16.678  1.00 34.21  ? 614  ASP A O     1 
ATOM   4800 C  CB    . ASP A 1 614 ? 14.765 80.327 14.408  1.00 26.84  ? 614  ASP A CB    1 
ATOM   4801 C  CG    . ASP A 1 614 ? 14.327 79.215 13.494  1.00 40.64  ? 614  ASP A CG    1 
ATOM   4802 O  OD1   . ASP A 1 614 ? 13.200 78.728 13.505  1.00 41.56  ? 614  ASP A OD1   1 
ATOM   4803 O  OD2   . ASP A 1 614 ? 15.263 78.841 12.624  1.00 61.55  ? 614  ASP A OD2   1 
ATOM   4804 N  N     . PRO A 1 615 ? 11.643 79.405 15.901  1.00 40.26  ? 615  PRO A N     1 
ATOM   4805 C  CA    . PRO A 1 615 ? 10.950 78.338 16.605  1.00 39.40  ? 615  PRO A CA    1 
ATOM   4806 C  C     . PRO A 1 615 ? 11.514 76.963 16.306  1.00 45.01  ? 615  PRO A C     1 
ATOM   4807 O  O     . PRO A 1 615 ? 11.411 75.996 17.073  1.00 34.34  ? 615  PRO A O     1 
ATOM   4808 C  CB    . PRO A 1 615 ? 9.547  78.329 16.045  1.00 65.23  ? 615  PRO A CB    1 
ATOM   4809 C  CG    . PRO A 1 615 ? 9.504  79.349 14.905  1.00 52.10  ? 615  PRO A CG    1 
ATOM   4810 C  CD    . PRO A 1 615 ? 10.912 79.896 14.728  1.00 35.94  ? 615  PRO A CD    1 
ATOM   4811 N  N     . ASN A 1 616 ? 12.078 76.853 15.123  1.00 31.24  ? 616  ASN A N     1 
ATOM   4812 C  CA    . ASN A 1 616 ? 12.702 75.602 14.728  1.00 31.55  ? 616  ASN A CA    1 
ATOM   4813 C  C     . ASN A 1 616 ? 13.884 75.315 15.647  1.00 38.29  ? 616  ASN A C     1 
ATOM   4814 O  O     . ASN A 1 616 ? 14.347 74.188 15.769  1.00 35.30  ? 616  ASN A O     1 
ATOM   4815 C  CB    . ASN A 1 616 ? 13.306 75.737 13.327  1.00 38.19  ? 616  ASN A CB    1 
ATOM   4816 C  CG    . ASN A 1 616 ? 12.382 75.432 12.179  1.00 96.57  ? 616  ASN A CG    1 
ATOM   4817 O  OD1   . ASN A 1 616 ? 11.377 74.742 12.411  1.00 41.55  ? 616  ASN A OD1   1 
ATOM   4818 N  ND2   . ASN A 1 616 ? 12.723 75.947 10.984  1.00 100.00 ? 616  ASN A ND2   1 
ATOM   4819 N  N     . ILE A 1 617 ? 14.424 76.376 16.236  1.00 32.74  ? 617  ILE A N     1 
ATOM   4820 C  CA    . ILE A 1 617 ? 15.545 76.326 17.150  1.00 34.31  ? 617  ILE A CA    1 
ATOM   4821 C  C     . ILE A 1 617 ? 15.048 76.584 18.563  1.00 24.57  ? 617  ILE A C     1 
ATOM   4822 O  O     . ILE A 1 617 ? 15.371 75.883 19.480  1.00 26.20  ? 617  ILE A O     1 
ATOM   4823 C  CB    . ILE A 1 617 ? 16.694 77.353 16.752  1.00 25.12  ? 617  ILE A CB    1 
ATOM   4824 C  CG1   . ILE A 1 617 ? 17.419 76.810 15.507  1.00 24.44  ? 617  ILE A CG1   1 
ATOM   4825 C  CG2   . ILE A 1 617 ? 17.804 77.471 17.817  1.00 25.58  ? 617  ILE A CG2   1 
ATOM   4826 C  CD1   . ILE A 1 617 ? 18.491 77.772 15.018  1.00 55.40  ? 617  ILE A CD1   1 
ATOM   4827 N  N     . ALA A 1 618 ? 14.276 77.618 18.737  1.00 28.38  ? 618  ALA A N     1 
ATOM   4828 C  CA    . ALA A 1 618 ? 13.848 77.976 20.053  1.00 26.83  ? 618  ALA A CA    1 
ATOM   4829 C  C     . ALA A 1 618 ? 12.893 77.007 20.685  1.00 35.25  ? 618  ALA A C     1 
ATOM   4830 O  O     . ALA A 1 618 ? 12.669 77.120 21.868  1.00 36.32  ? 618  ALA A O     1 
ATOM   4831 C  CB    . ALA A 1 618 ? 13.405 79.422 20.128  1.00 25.51  ? 618  ALA A CB    1 
ATOM   4832 N  N     . SER A 1 619 ? 12.344 76.065 19.920  1.00 33.28  ? 619  SER A N     1 
ATOM   4833 C  CA    . SER A 1 619 ? 11.331 75.167 20.475  1.00 35.41  ? 619  SER A CA    1 
ATOM   4834 C  C     . SER A 1 619 ? 11.272 73.778 19.906  1.00 32.09  ? 619  SER A C     1 
ATOM   4835 O  O     . SER A 1 619 ? 11.691 73.507 18.755  1.00 42.45  ? 619  SER A O     1 
ATOM   4836 C  CB    . SER A 1 619 ? 9.860  75.555 20.200  1.00 49.52  ? 619  SER A CB    1 
ATOM   4837 O  OG    . SER A 1 619 ? 9.643  76.834 20.710  1.00 45.95  ? 619  SER A OG    1 
ATOM   4838 N  N     . ARG A 1 620 ? 10.592 72.961 20.747  1.00 27.34  ? 620  ARG A N     1 
ATOM   4839 C  CA    . ARG A 1 620 ? 10.365 71.559 20.502  1.00 33.63  ? 620  ARG A CA    1 
ATOM   4840 C  C     . ARG A 1 620 ? 9.322  71.177 19.447  1.00 29.21  ? 620  ARG A C     1 
ATOM   4841 O  O     . ARG A 1 620 ? 9.569  70.283 18.636  1.00 98.35  ? 620  ARG A O     1 
ATOM   4842 C  CB    . ARG A 1 620 ? 10.106 70.747 21.778  1.00 29.30  ? 620  ARG A CB    1 
ATOM   4843 C  CG    . ARG A 1 620 ? 11.415 70.510 22.550  1.00 31.48  ? 620  ARG A CG    1 
ATOM   4844 C  CD    . ARG A 1 620 ? 11.430 69.584 23.786  1.00 17.30  ? 620  ARG A CD    1 
ATOM   4845 N  NE    . ARG A 1 620 ? 10.343 69.854 24.683  1.00 23.44  ? 620  ARG A NE    1 
ATOM   4846 C  CZ    . ARG A 1 620 ? 10.424 70.736 25.690  1.00 24.77  ? 620  ARG A CZ    1 
ATOM   4847 N  NH1   . ARG A 1 620 ? 11.565 71.315 26.046  1.00 23.49  ? 620  ARG A NH1   1 
ATOM   4848 N  NH2   . ARG A 1 620 ? 9.376  70.872 26.451  1.00 22.34  ? 620  ARG A NH2   1 
ATOM   4849 N  N     . ALA A 1 621 ? 8.121  71.735 19.524  1.00 69.82  ? 621  ALA A N     1 
ATOM   4850 C  CA    . ALA A 1 621 ? 7.113  71.258 18.586  1.00 46.92  ? 621  ALA A CA    1 
ATOM   4851 C  C     . ALA A 1 621 ? 7.154  71.607 17.079  1.00 100.00 ? 621  ALA A C     1 
ATOM   4852 O  O     . ALA A 1 621 ? 7.407  72.715 16.584  1.00 85.86  ? 621  ALA A O     1 
ATOM   4853 C  CB    . ALA A 1 621 ? 5.752  71.224 19.259  1.00 34.98  ? 621  ALA A CB    1 
ATOM   4854 N  N     . PHE A 1 627 ? 3.448  72.549 23.326  1.00 44.28  ? 627  PHE A N     1 
ATOM   4855 C  CA    . PHE A 1 627 ? 4.716  71.936 22.943  1.00 100.00 ? 627  PHE A CA    1 
ATOM   4856 C  C     . PHE A 1 627 ? 4.828  70.509 23.505  1.00 48.74  ? 627  PHE A C     1 
ATOM   4857 O  O     . PHE A 1 627 ? 4.239  70.166 24.533  1.00 60.20  ? 627  PHE A O     1 
ATOM   4858 C  CB    . PHE A 1 627 ? 6.052  72.832 22.883  1.00 67.21  ? 627  PHE A CB    1 
ATOM   4859 C  CG    . PHE A 1 627 ? 6.041  74.395 22.634  1.00 100.00 ? 627  PHE A CG    1 
ATOM   4860 C  CD1   . PHE A 1 627 ? 5.519  75.316 23.579  1.00 100.00 ? 627  PHE A CD1   1 
ATOM   4861 C  CD2   . PHE A 1 627 ? 6.621  74.978 21.508  1.00 100.00 ? 627  PHE A CD2   1 
ATOM   4862 C  CE1   . PHE A 1 627 ? 5.574  76.709 23.377  1.00 100.00 ? 627  PHE A CE1   1 
ATOM   4863 C  CE2   . PHE A 1 627 ? 6.681  76.362 21.266  1.00 100.00 ? 627  PHE A CE2   1 
ATOM   4864 C  CZ    . PHE A 1 627 ? 6.112  77.246 22.234  1.00 100.00 ? 627  PHE A CZ    1 
ATOM   4865 N  N     . LEU A 1 628 ? 5.537  69.659 22.777  1.00 38.94  ? 628  LEU A N     1 
ATOM   4866 C  CA    . LEU A 1 628 ? 5.776  68.287 23.170  1.00 34.63  ? 628  LEU A CA    1 
ATOM   4867 C  C     . LEU A 1 628 ? 6.895  68.236 24.231  1.00 26.46  ? 628  LEU A C     1 
ATOM   4868 O  O     . LEU A 1 628 ? 7.729  69.161 24.304  1.00 20.38  ? 628  LEU A O     1 
ATOM   4869 C  CB    . LEU A 1 628 ? 5.851  67.268 21.934  1.00 29.36  ? 628  LEU A CB    1 
ATOM   4870 C  CG    . LEU A 1 628 ? 7.237  66.978 21.473  1.00 33.25  ? 628  LEU A CG    1 
ATOM   4871 C  CD1   . LEU A 1 628 ? 7.144  66.132 20.236  1.00 52.33  ? 628  LEU A CD1   1 
ATOM   4872 C  CD2   . LEU A 1 628 ? 7.807  68.312 21.107  1.00 33.94  ? 628  LEU A CD2   1 
ATOM   4873 N  N     . THR A 1 629 ? 6.914  67.195 25.054  1.00 18.61  ? 629  THR A N     1 
ATOM   4874 C  CA    . THR A 1 629 ? 7.945  67.091 26.039  1.00 17.89  ? 629  THR A CA    1 
ATOM   4875 C  C     . THR A 1 629 ? 9.246  66.557 25.438  1.00 18.22  ? 629  THR A C     1 
ATOM   4876 O  O     . THR A 1 629 ? 9.327  66.141 24.279  1.00 18.04  ? 629  THR A O     1 
ATOM   4877 C  CB    . THR A 1 629 ? 7.499  66.024 27.013  1.00 20.65  ? 629  THR A CB    1 
ATOM   4878 O  OG1   . THR A 1 629 ? 7.237  64.854 26.281  1.00 19.44  ? 629  THR A OG1   1 
ATOM   4879 C  CG2   . THR A 1 629 ? 6.197  66.498 27.632  1.00 28.95  ? 629  THR A CG2   1 
ATOM   4880 N  N     . VAL A 1 630 ? 10.278 66.551 26.267  1.00 23.74  ? 630  VAL A N     1 
ATOM   4881 C  CA    . VAL A 1 630 ? 11.569 66.040 25.865  1.00 23.91  ? 630  VAL A CA    1 
ATOM   4882 C  C     . VAL A 1 630 ? 11.459 64.552 25.494  1.00 23.24  ? 630  VAL A C     1 
ATOM   4883 O  O     . VAL A 1 630 ? 11.999 64.035 24.484  1.00 19.42  ? 630  VAL A O     1 
ATOM   4884 C  CB    . VAL A 1 630 ? 12.600 66.385 26.952  1.00 22.17  ? 630  VAL A CB    1 
ATOM   4885 C  CG1   . VAL A 1 630 ? 13.881 65.672 26.520  1.00 24.96  ? 630  VAL A CG1   1 
ATOM   4886 C  CG2   . VAL A 1 630 ? 12.832 67.918 27.082  1.00 16.00  ? 630  VAL A CG2   1 
ATOM   4887 N  N     . ALA A 1 631 ? 10.683 63.822 26.276  1.00 15.66  ? 631  ALA A N     1 
ATOM   4888 C  CA    . ALA A 1 631 ? 10.475 62.395 26.016  1.00 15.98  ? 631  ALA A CA    1 
ATOM   4889 C  C     . ALA A 1 631 ? 9.759  62.135 24.724  1.00 22.02  ? 631  ALA A C     1 
ATOM   4890 O  O     . ALA A 1 631 ? 10.112 61.203 23.991  1.00 19.74  ? 631  ALA A O     1 
ATOM   4891 C  CB    . ALA A 1 631 ? 9.671  61.629 27.086  1.00 14.16  ? 631  ALA A CB    1 
ATOM   4892 N  N     . ALA A 1 632 ? 8.730  62.929 24.472  1.00 19.05  ? 632  ALA A N     1 
ATOM   4893 C  CA    . ALA A 1 632 ? 7.952  62.770 23.242  1.00 18.22  ? 632  ALA A CA    1 
ATOM   4894 C  C     . ALA A 1 632 ? 8.834  63.110 22.035  1.00 14.12  ? 632  ALA A C     1 
ATOM   4895 O  O     . ALA A 1 632 ? 8.756  62.478 20.998  1.00 20.53  ? 632  ALA A O     1 
ATOM   4896 C  CB    . ALA A 1 632 ? 6.747  63.734 23.284  1.00 15.84  ? 632  ALA A CB    1 
ATOM   4897 N  N     . GLN A 1 633 ? 9.655  64.125 22.132  1.00 17.54  ? 633  GLN A N     1 
ATOM   4898 C  CA    . GLN A 1 633 ? 10.494 64.424 20.989  1.00 15.21  ? 633  GLN A CA    1 
ATOM   4899 C  C     . GLN A 1 633 ? 11.521 63.333 20.797  1.00 20.94  ? 633  GLN A C     1 
ATOM   4900 O  O     . GLN A 1 633 ? 11.893 62.985 19.693  1.00 21.91  ? 633  GLN A O     1 
ATOM   4901 C  CB    . GLN A 1 633 ? 11.150 65.784 21.177  1.00 22.37  ? 633  GLN A CB    1 
ATOM   4902 C  CG    . GLN A 1 633 ? 12.438 66.026 20.340  1.00 31.34  ? 633  GLN A CG    1 
ATOM   4903 C  CD    . GLN A 1 633 ? 13.194 67.283 20.819  1.00 47.67  ? 633  GLN A CD    1 
ATOM   4904 O  OE1   . GLN A 1 633 ? 13.166 68.323 20.108  1.00 41.48  ? 633  GLN A OE1   1 
ATOM   4905 N  NE2   . GLN A 1 633 ? 13.843 67.283 22.050  1.00 29.28  ? 633  GLN A NE2   1 
ATOM   4906 N  N     . TYR A 1 634 ? 11.992 62.749 21.887  1.00 17.33  ? 634  TYR A N     1 
ATOM   4907 C  CA    . TYR A 1 634 ? 12.993 61.722 21.752  1.00 10.64  ? 634  TYR A CA    1 
ATOM   4908 C  C     . TYR A 1 634 ? 12.405 60.548 21.062  1.00 19.82  ? 634  TYR A C     1 
ATOM   4909 O  O     . TYR A 1 634 ? 13.022 59.927 20.194  1.00 17.00  ? 634  TYR A O     1 
ATOM   4910 C  CB    . TYR A 1 634 ? 13.665 61.293 23.131  1.00 14.19  ? 634  TYR A CB    1 
ATOM   4911 C  CG    . TYR A 1 634 ? 14.844 60.333 22.957  1.00 12.51  ? 634  TYR A CG    1 
ATOM   4912 C  CD1   . TYR A 1 634 ? 14.690 58.962 22.775  1.00 11.35  ? 634  TYR A CD1   1 
ATOM   4913 C  CD2   . TYR A 1 634 ? 16.146 60.845 22.986  1.00 18.19  ? 634  TYR A CD2   1 
ATOM   4914 C  CE1   . TYR A 1 634 ? 15.834 58.186 22.568  1.00 21.71  ? 634  TYR A CE1   1 
ATOM   4915 C  CE2   . TYR A 1 634 ? 17.307 60.104 22.821  1.00 16.71  ? 634  TYR A CE2   1 
ATOM   4916 C  CZ    . TYR A 1 634 ? 17.112 58.753 22.597  1.00 12.98  ? 634  TYR A CZ    1 
ATOM   4917 O  OH    . TYR A 1 634 ? 18.209 57.951 22.580  1.00 15.93  ? 634  TYR A OH    1 
ATOM   4918 N  N     . LYS A 1 635 ? 11.182 60.221 21.467  1.00 15.07  ? 635  LYS A N     1 
ATOM   4919 C  CA    . LYS A 1 635 ? 10.551 59.067 20.884  1.00 15.98  ? 635  LYS A CA    1 
ATOM   4920 C  C     . LYS A 1 635 ? 10.311 59.267 19.366  1.00 13.07  ? 635  LYS A C     1 
ATOM   4921 O  O     . LYS A 1 635 ? 10.442 58.378 18.527  1.00 19.09  ? 635  LYS A O     1 
ATOM   4922 C  CB    . LYS A 1 635 ? 9.222  58.940 21.638  1.00 14.63  ? 635  LYS A CB    1 
ATOM   4923 C  CG    . LYS A 1 635 ? 8.333  57.890 21.041  1.00 23.26  ? 635  LYS A CG    1 
ATOM   4924 C  CD    . LYS A 1 635 ? 7.273  57.433 22.054  1.00 24.00  ? 635  LYS A CD    1 
ATOM   4925 C  CE    . LYS A 1 635 ? 6.215  56.607 21.355  1.00 32.74  ? 635  LYS A CE    1 
ATOM   4926 N  NZ    . LYS A 1 635 ? 4.989  56.381 22.160  1.00 41.09  ? 635  LYS A NZ    1 
ATOM   4927 N  N     . GLU A 1 636 ? 9.969  60.469 19.053  1.00 14.42  ? 636  GLU A N     1 
ATOM   4928 C  CA    . GLU A 1 636 ? 9.650  60.767 17.693  1.00 15.58  ? 636  GLU A CA    1 
ATOM   4929 C  C     . GLU A 1 636 ? 10.847 60.723 16.840  1.00 17.04  ? 636  GLU A C     1 
ATOM   4930 O  O     . GLU A 1 636 ? 10.832 60.180 15.751  1.00 19.55  ? 636  GLU A O     1 
ATOM   4931 C  CB    . GLU A 1 636 ? 9.160  62.164 17.782  1.00 18.01  ? 636  GLU A CB    1 
ATOM   4932 C  CG    . GLU A 1 636 ? 8.557  62.645 16.459  1.00 44.47  ? 636  GLU A CG    1 
ATOM   4933 C  CD    . GLU A 1 636 ? 8.082  64.084 16.661  1.00 100.00 ? 636  GLU A CD    1 
ATOM   4934 O  OE1   . GLU A 1 636 ? 9.086  64.949 16.878  1.00 100.00 ? 636  GLU A OE1   1 
ATOM   4935 O  OE2   . GLU A 1 636 ? 6.884  64.409 16.667  1.00 100.00 ? 636  GLU A OE2   1 
ATOM   4936 N  N     . GLN A 1 637 ? 11.883 61.351 17.323  1.00 16.15  ? 637  GLN A N     1 
ATOM   4937 C  CA    . GLN A 1 637 ? 13.137 61.328 16.585  1.00 19.12  ? 637  GLN A CA    1 
ATOM   4938 C  C     . GLN A 1 637 ? 13.706 59.924 16.437  1.00 23.81  ? 637  GLN A C     1 
ATOM   4939 O  O     . GLN A 1 637 ? 14.379 59.591 15.462  1.00 17.84  ? 637  GLN A O     1 
ATOM   4940 C  CB    . GLN A 1 637 ? 14.158 62.275 17.180  1.00 18.17  ? 637  GLN A CB    1 
ATOM   4941 C  CG    . GLN A 1 637 ? 13.710 63.740 17.004  1.00 23.11  ? 637  GLN A CG    1 
ATOM   4942 C  CD    . GLN A 1 637 ? 14.716 64.802 17.555  1.00 39.01  ? 637  GLN A CD    1 
ATOM   4943 O  OE1   . GLN A 1 637 ? 15.676 64.509 18.296  1.00 28.83  ? 637  GLN A OE1   1 
ATOM   4944 N  NE2   . GLN A 1 637 ? 14.470 66.075 17.203  1.00 25.46  ? 637  GLN A NE2   1 
ATOM   4945 N  N     . LEU A 1 638 ? 13.494 59.075 17.427  1.00 17.13  ? 638  LEU A N     1 
ATOM   4946 C  CA    . LEU A 1 638 ? 14.008 57.756 17.310  1.00 11.97  ? 638  LEU A CA    1 
ATOM   4947 C  C     . LEU A 1 638 ? 13.177 57.023 16.255  1.00 23.07  ? 638  LEU A C     1 
ATOM   4948 O  O     . LEU A 1 638 ? 13.685 56.195 15.464  1.00 15.83  ? 638  LEU A O     1 
ATOM   4949 C  CB    . LEU A 1 638 ? 14.025 56.978 18.734  1.00 14.12  ? 638  LEU A CB    1 
ATOM   4950 C  CG    . LEU A 1 638 ? 14.222 55.429 18.668  1.00 15.73  ? 638  LEU A CG    1 
ATOM   4951 C  CD1   . LEU A 1 638 ? 15.501 54.936 17.977  1.00 15.25  ? 638  LEU A CD1   1 
ATOM   4952 C  CD2   . LEU A 1 638 ? 14.094 54.738 20.008  1.00 14.85  ? 638  LEU A CD2   1 
ATOM   4953 N  N     . ALA A 1 639 ? 11.859 57.325 16.253  1.00 16.12  ? 639  ALA A N     1 
ATOM   4954 C  CA    . ALA A 1 639 ? 11.042 56.621 15.272  1.00 21.57  ? 639  ALA A CA    1 
ATOM   4955 C  C     . ALA A 1 639 ? 11.416 57.013 13.826  1.00 13.29  ? 639  ALA A C     1 
ATOM   4956 O  O     . ALA A 1 639 ? 11.438 56.178 12.909  1.00 15.76  ? 639  ALA A O     1 
ATOM   4957 C  CB    . ALA A 1 639 ? 9.597  56.908 15.506  1.00 20.33  ? 639  ALA A CB    1 
ATOM   4958 N  N     . SER A 1 640 ? 11.721 58.282 13.646  1.00 12.16  ? 640  SER A N     1 
ATOM   4959 C  CA    . SER A 1 640 ? 12.105 58.680 12.285  1.00 18.96  ? 640  SER A CA    1 
ATOM   4960 C  C     . SER A 1 640 ? 13.419 58.035 11.868  1.00 21.22  ? 640  SER A C     1 
ATOM   4961 O  O     . SER A 1 640 ? 13.568 57.610 10.732  1.00 15.92  ? 640  SER A O     1 
ATOM   4962 C  CB    . SER A 1 640 ? 12.281 60.173 12.072  1.00 18.16  ? 640  SER A CB    1 
ATOM   4963 O  OG    . SER A 1 640 ? 11.411 60.791 12.973  1.00 52.62  ? 640  SER A OG    1 
ATOM   4964 N  N     . LEU A 1 641 ? 14.369 57.997 12.812  1.00 17.00  ? 641  LEU A N     1 
ATOM   4965 C  CA    . LEU A 1 641 ? 15.630 57.361 12.546  1.00 14.94  ? 641  LEU A CA    1 
ATOM   4966 C  C     . LEU A 1 641 ? 15.394 55.928 12.180  1.00 16.84  ? 641  LEU A C     1 
ATOM   4967 O  O     . LEU A 1 641 ? 15.961 55.433 11.237  1.00 16.34  ? 641  LEU A O     1 
ATOM   4968 C  CB    . LEU A 1 641 ? 16.543 57.409 13.825  1.00 14.30  ? 641  LEU A CB    1 
ATOM   4969 C  CG    . LEU A 1 641 ? 17.767 56.470 13.769  1.00 15.14  ? 641  LEU A CG    1 
ATOM   4970 C  CD1   . LEU A 1 641 ? 18.615 56.925 12.635  1.00 13.06  ? 641  LEU A CD1   1 
ATOM   4971 C  CD2   . LEU A 1 641 ? 18.625 56.721 15.022  1.00 15.43  ? 641  LEU A CD2   1 
ATOM   4972 N  N     . MET A 1 642 ? 14.628 55.181 12.972  1.00 16.30  ? 642  MET A N     1 
ATOM   4973 C  CA    . MET A 1 642 ? 14.469 53.808 12.611  1.00 9.51   ? 642  MET A CA    1 
ATOM   4974 C  C     . MET A 1 642 ? 13.808 53.625 11.225  1.00 19.94  ? 642  MET A C     1 
ATOM   4975 O  O     . MET A 1 642 ? 14.060 52.627 10.505  1.00 15.33  ? 642  MET A O     1 
ATOM   4976 C  CB    . MET A 1 642 ? 13.559 53.098 13.637  1.00 14.54  ? 642  MET A CB    1 
ATOM   4977 C  CG    . MET A 1 642 ? 14.172 53.103 15.027  1.00 21.73  ? 642  MET A CG    1 
ATOM   4978 S  SD    . MET A 1 642 ? 15.853 52.297 15.078  1.00 22.15  ? 642  MET A SD    1 
ATOM   4979 C  CE    . MET A 1 642 ? 15.677 50.724 14.268  1.00 12.08  ? 642  MET A CE    1 
ATOM   4980 N  N     . ALA A 1 643 ? 12.870 54.541 10.932  1.00 20.50  ? 643  ALA A N     1 
ATOM   4981 C  CA    . ALA A 1 643 ? 12.151 54.509 9.679   1.00 23.34  ? 643  ALA A CA    1 
ATOM   4982 C  C     . ALA A 1 643 ? 13.144 54.552 8.526   1.00 25.68  ? 643  ALA A C     1 
ATOM   4983 O  O     . ALA A 1 643 ? 13.094 53.750 7.592   1.00 25.92  ? 643  ALA A O     1 
ATOM   4984 C  CB    . ALA A 1 643 ? 11.112 55.638 9.532   1.00 16.36  ? 643  ALA A CB    1 
ATOM   4985 N  N     . THR A 1 644 ? 14.049 55.511 8.643   1.00 18.24  ? 644  THR A N     1 
ATOM   4986 C  CA    . THR A 1 644 ? 15.120 55.714 7.695   1.00 13.26  ? 644  THR A CA    1 
ATOM   4987 C  C     . THR A 1 644 ? 15.938 54.465 7.568   1.00 17.92  ? 644  THR A C     1 
ATOM   4988 O  O     . THR A 1 644 ? 16.113 53.892 6.507   1.00 22.79  ? 644  THR A O     1 
ATOM   4989 C  CB    . THR A 1 644 ? 15.992 56.896 8.043   1.00 23.60  ? 644  THR A CB    1 
ATOM   4990 O  OG1   . THR A 1 644 ? 15.210 58.099 8.045   1.00 19.31  ? 644  THR A OG1   1 
ATOM   4991 C  CG2   . THR A 1 644 ? 17.239 56.990 7.139   1.00 18.26  ? 644  THR A CG2   1 
ATOM   4992 N  N     . LEU A 1 645 ? 16.387 53.957 8.699   1.00 15.72  ? 645  LEU A N     1 
ATOM   4993 C  CA    . LEU A 1 645 ? 17.200 52.752 8.674   1.00 11.18  ? 645  LEU A CA    1 
ATOM   4994 C  C     . LEU A 1 645 ? 16.534 51.604 7.944   1.00 17.44  ? 645  LEU A C     1 
ATOM   4995 O  O     . LEU A 1 645 ? 17.174 50.765 7.342   1.00 13.44  ? 645  LEU A O     1 
ATOM   4996 C  CB    . LEU A 1 645 ? 17.581 52.285 10.136  1.00 15.51  ? 645  LEU A CB    1 
ATOM   4997 C  CG    . LEU A 1 645 ? 18.552 53.326 10.814  1.00 23.79  ? 645  LEU A CG    1 
ATOM   4998 C  CD1   . LEU A 1 645 ? 18.928 52.987 12.303  1.00 22.94  ? 645  LEU A CD1   1 
ATOM   4999 C  CD2   . LEU A 1 645 ? 19.911 53.432 10.029  1.00 14.34  ? 645  LEU A CD2   1 
ATOM   5000 N  N     . GLU A 1 646 ? 15.222 51.534 8.137   1.00 17.20  ? 646  GLU A N     1 
ATOM   5001 C  CA    . GLU A 1 646 ? 14.429 50.470 7.624   1.00 17.27  ? 646  GLU A CA    1 
ATOM   5002 C  C     . GLU A 1 646 ? 14.474 50.423 6.118   1.00 15.17  ? 646  GLU A C     1 
ATOM   5003 O  O     . GLU A 1 646 ? 14.230 49.340 5.509   1.00 24.58  ? 646  GLU A O     1 
ATOM   5004 C  CB    . GLU A 1 646 ? 12.990 50.826 7.998   1.00 27.48  ? 646  GLU A CB    1 
ATOM   5005 C  CG    . GLU A 1 646 ? 12.767 50.544 9.468   1.00 100.00 ? 646  GLU A CG    1 
ATOM   5006 C  CD    . GLU A 1 646 ? 13.013 49.089 9.699   1.00 48.72  ? 646  GLU A CD    1 
ATOM   5007 O  OE1   . GLU A 1 646 ? 13.163 48.281 8.777   1.00 87.69  ? 646  GLU A OE1   1 
ATOM   5008 O  OE2   . GLU A 1 646 ? 13.055 48.762 10.986  1.00 58.16  ? 646  GLU A OE2   1 
ATOM   5009 N  N     . THR A 1 647 ? 14.714 51.610 5.597   1.00 18.31  ? 647  THR A N     1 
ATOM   5010 C  CA    . THR A 1 647 ? 14.794 51.736 4.187   1.00 27.95  ? 647  THR A CA    1 
ATOM   5011 C  C     . THR A 1 647 ? 16.187 51.431 3.689   1.00 51.28  ? 647  THR A C     1 
ATOM   5012 O  O     . THR A 1 647 ? 16.403 51.536 2.497   1.00 30.71  ? 647  THR A O     1 
ATOM   5013 C  CB    . THR A 1 647 ? 14.505 53.155 3.729   1.00 21.97  ? 647  THR A CB    1 
ATOM   5014 O  OG1   . THR A 1 647 ? 15.590 53.986 3.905   1.00 25.44  ? 647  THR A OG1   1 
ATOM   5015 C  CG2   . THR A 1 647 ? 13.160 53.800 4.181   1.00 18.25  ? 647  THR A CG2   1 
ATOM   5016 N  N     . THR A 1 648 ? 17.140 51.104 4.556   1.00 26.84  ? 648  THR A N     1 
ATOM   5017 C  CA    . THR A 1 648 ? 18.500 50.894 4.037   1.00 20.19  ? 648  THR A CA    1 
ATOM   5018 C  C     . THR A 1 648 ? 18.946 49.462 4.124   1.00 20.86  ? 648  THR A C     1 
ATOM   5019 O  O     . THR A 1 648 ? 18.302 48.629 4.769   1.00 16.34  ? 648  THR A O     1 
ATOM   5020 C  CB    . THR A 1 648 ? 19.534 51.668 4.907   1.00 15.25  ? 648  THR A CB    1 
ATOM   5021 O  OG1   . THR A 1 648 ? 19.616 51.102 6.171   1.00 16.82  ? 648  THR A OG1   1 
ATOM   5022 C  CG2   . THR A 1 648 ? 19.073 53.081 5.009   1.00 13.07  ? 648  THR A CG2   1 
ATOM   5023 N  N     . ASN A 1 649 ? 20.095 49.182 3.495   1.00 15.23  ? 649  ASN A N     1 
ATOM   5024 C  CA    . ASN A 1 649 ? 20.739 47.907 3.637   1.00 15.64  ? 649  ASN A CA    1 
ATOM   5025 C  C     . ASN A 1 649 ? 21.794 48.178 4.741   1.00 16.21  ? 649  ASN A C     1 
ATOM   5026 O  O     . ASN A 1 649 ? 22.640 49.034 4.534   1.00 16.08  ? 649  ASN A O     1 
ATOM   5027 C  CB    . ASN A 1 649 ? 21.453 47.360 2.395   1.00 16.07  ? 649  ASN A CB    1 
ATOM   5028 C  CG    . ASN A 1 649 ? 22.275 46.114 2.745   1.00 18.65  ? 649  ASN A CG    1 
ATOM   5029 O  OD1   . ASN A 1 649 ? 21.879 45.129 3.450   1.00 21.20  ? 649  ASN A OD1   1 
ATOM   5030 N  ND2   . ASN A 1 649 ? 23.474 46.045 2.154   1.00 23.20  ? 649  ASN A ND2   1 
ATOM   5031 N  N     . PRO A 1 650 ? 21.678 47.568 5.946   1.00 16.65  ? 650  PRO A N     1 
ATOM   5032 C  CA    . PRO A 1 650 ? 22.549 47.979 7.023   1.00 18.54  ? 650  PRO A CA    1 
ATOM   5033 C  C     . PRO A 1 650 ? 23.781 47.105 7.221   1.00 15.48  ? 650  PRO A C     1 
ATOM   5034 O  O     . PRO A 1 650 ? 23.781 45.940 6.852   1.00 14.35  ? 650  PRO A O     1 
ATOM   5035 C  CB    . PRO A 1 650 ? 21.681 47.973 8.247   1.00 17.00  ? 650  PRO A CB    1 
ATOM   5036 C  CG    . PRO A 1 650 ? 20.889 46.672 8.007   1.00 21.72  ? 650  PRO A CG    1 
ATOM   5037 C  CD    . PRO A 1 650 ? 20.736 46.587 6.512   1.00 19.75  ? 650  PRO A CD    1 
ATOM   5038 N  N     . HIS A 1 651 ? 24.772 47.717 7.902   1.00 15.05  ? 651  HIS A N     1 
ATOM   5039 C  CA    . HIS A 1 651 ? 26.054 47.111 8.198   1.00 15.02  ? 651  HIS A CA    1 
ATOM   5040 C  C     . HIS A 1 651 ? 26.345 47.497 9.627   1.00 12.33  ? 651  HIS A C     1 
ATOM   5041 O  O     . HIS A 1 651 ? 26.104 48.625 9.999   1.00 18.09  ? 651  HIS A O     1 
ATOM   5042 C  CB    . HIS A 1 651 ? 27.140 47.742 7.296   1.00 16.50  ? 651  HIS A CB    1 
ATOM   5043 C  CG    . HIS A 1 651 ? 26.717 47.633 5.857   1.00 23.85  ? 651  HIS A CG    1 
ATOM   5044 N  ND1   . HIS A 1 651 ? 26.990 46.490 5.065   1.00 27.26  ? 651  HIS A ND1   1 
ATOM   5045 C  CD2   . HIS A 1 651 ? 25.972 48.511 5.074   1.00 20.69  ? 651  HIS A CD2   1 
ATOM   5046 C  CE1   . HIS A 1 651 ? 26.500 46.687 3.819   1.00 16.91  ? 651  HIS A CE1   1 
ATOM   5047 N  NE2   . HIS A 1 651 ? 25.887 47.894 3.817   1.00 21.52  ? 651  HIS A NE2   1 
ATOM   5048 N  N     . PHE A 1 652 ? 26.791 46.524 10.386  1.00 11.81  ? 652  PHE A N     1 
ATOM   5049 C  CA    . PHE A 1 652 ? 26.984 46.734 11.813  1.00 18.08  ? 652  PHE A CA    1 
ATOM   5050 C  C     . PHE A 1 652 ? 28.429 46.599 12.284  1.00 15.25  ? 652  PHE A C     1 
ATOM   5051 O  O     . PHE A 1 652 ? 29.045 45.549 12.137  1.00 19.67  ? 652  PHE A O     1 
ATOM   5052 C  CB    . PHE A 1 652 ? 26.197 45.631 12.574  1.00 13.85  ? 652  PHE A CB    1 
ATOM   5053 C  CG    . PHE A 1 652 ? 24.685 45.715 12.236  1.00 20.74  ? 652  PHE A CG    1 
ATOM   5054 C  CD1   . PHE A 1 652 ? 23.846 46.599 12.923  1.00 15.31  ? 652  PHE A CD1   1 
ATOM   5055 C  CD2   . PHE A 1 652 ? 24.154 44.959 11.173  1.00 34.97  ? 652  PHE A CD2   1 
ATOM   5056 C  CE1   . PHE A 1 652 ? 22.490 46.654 12.579  1.00 25.96  ? 652  PHE A CE1   1 
ATOM   5057 C  CE2   . PHE A 1 652 ? 22.794 45.017 10.825  1.00 22.32  ? 652  PHE A CE2   1 
ATOM   5058 C  CZ    . PHE A 1 652 ? 21.970 45.863 11.547  1.00 15.66  ? 652  PHE A CZ    1 
ATOM   5059 N  N     . VAL A 1 653 ? 28.890 47.662 12.938  1.00 19.39  ? 653  VAL A N     1 
ATOM   5060 C  CA    . VAL A 1 653 ? 30.222 47.684 13.524  1.00 17.52  ? 653  VAL A CA    1 
ATOM   5061 C  C     . VAL A 1 653 ? 30.062 47.786 15.060  1.00 15.08  ? 653  VAL A C     1 
ATOM   5062 O  O     . VAL A 1 653 ? 29.407 48.656 15.608  1.00 13.26  ? 653  VAL A O     1 
ATOM   5063 C  CB    . VAL A 1 653 ? 30.987 48.876 12.936  1.00 26.15  ? 653  VAL A CB    1 
ATOM   5064 C  CG1   . VAL A 1 653 ? 32.413 48.896 13.455  1.00 15.77  ? 653  VAL A CG1   1 
ATOM   5065 C  CG2   . VAL A 1 653 ? 30.958 48.916 11.383  1.00 16.72  ? 653  VAL A CG2   1 
ATOM   5066 N  N     . ARG A 1 654 ? 30.659 46.852 15.744  1.00 15.29  ? 654  ARG A N     1 
ATOM   5067 C  CA    . ARG A 1 654 ? 30.666 46.820 17.195  1.00 11.69  ? 654  ARG A CA    1 
ATOM   5068 C  C     . ARG A 1 654 ? 32.104 47.132 17.642  1.00 10.62  ? 654  ARG A C     1 
ATOM   5069 O  O     . ARG A 1 654 ? 33.035 46.321 17.589  1.00 16.56  ? 654  ARG A O     1 
ATOM   5070 C  CB    . ARG A 1 654 ? 30.401 45.389 17.651  1.00 10.96  ? 654  ARG A CB    1 
ATOM   5071 C  CG    . ARG A 1 654 ? 29.049 44.844 17.220  1.00 15.10  ? 654  ARG A CG    1 
ATOM   5072 C  CD    . ARG A 1 654 ? 28.118 45.989 17.448  1.00 24.09  ? 654  ARG A CD    1 
ATOM   5073 N  NE    . ARG A 1 654 ? 26.779 45.572 17.594  1.00 55.41  ? 654  ARG A NE    1 
ATOM   5074 C  CZ    . ARG A 1 654 ? 25.855 46.293 17.022  1.00 98.20  ? 654  ARG A CZ    1 
ATOM   5075 N  NH1   . ARG A 1 654 ? 26.169 47.432 16.304  1.00 49.10  ? 654  ARG A NH1   1 
ATOM   5076 N  NH2   . ARG A 1 654 ? 24.630 45.793 17.249  1.00 50.69  ? 654  ARG A NH2   1 
ATOM   5077 N  N     . CYS A 1 655 ? 32.243 48.321 18.162  1.00 14.91  ? 655  CYS A N     1 
ATOM   5078 C  CA    . CYS A 1 655 ? 33.509 48.843 18.724  1.00 19.71  ? 655  CYS A CA    1 
ATOM   5079 C  C     . CYS A 1 655 ? 33.602 48.386 20.156  1.00 26.95  ? 655  CYS A C     1 
ATOM   5080 O  O     . CYS A 1 655 ? 32.622 48.567 20.902  1.00 18.15  ? 655  CYS A O     1 
ATOM   5081 C  CB    . CYS A 1 655 ? 33.571 50.391 18.704  1.00 9.56   ? 655  CYS A CB    1 
ATOM   5082 S  SG    . CYS A 1 655 ? 33.684 51.023 16.967  1.00 18.03  ? 655  CYS A SG    1 
ATOM   5083 N  N     . ILE A 1 656 ? 34.755 47.804 20.521  1.00 23.11  ? 656  ILE A N     1 
ATOM   5084 C  CA    . ILE A 1 656 ? 35.040 47.232 21.858  1.00 16.08  ? 656  ILE A CA    1 
ATOM   5085 C  C     . ILE A 1 656 ? 36.219 47.928 22.521  1.00 21.77  ? 656  ILE A C     1 
ATOM   5086 O  O     . ILE A 1 656 ? 37.231 48.200 21.906  1.00 12.92  ? 656  ILE A O     1 
ATOM   5087 C  CB    . ILE A 1 656 ? 35.247 45.750 21.660  1.00 11.28  ? 656  ILE A CB    1 
ATOM   5088 C  CG1   . ILE A 1 656 ? 33.850 45.078 21.442  1.00 20.85  ? 656  ILE A CG1   1 
ATOM   5089 C  CG2   . ILE A 1 656 ? 35.789 45.178 22.952  1.00 14.04  ? 656  ILE A CG2   1 
ATOM   5090 C  CD1   . ILE A 1 656 ? 33.679 44.552 20.033  1.00 45.73  ? 656  ILE A CD1   1 
ATOM   5091 N  N     . ILE A 1 657 ? 36.043 48.346 23.752  1.00 14.97  ? 657  ILE A N     1 
ATOM   5092 C  CA    . ILE A 1 657 ? 37.113 48.939 24.546  1.00 14.22  ? 657  ILE A CA    1 
ATOM   5093 C  C     . ILE A 1 657 ? 37.880 47.754 25.178  1.00 11.61  ? 657  ILE A C     1 
ATOM   5094 O  O     . ILE A 1 657 ? 37.267 46.769 25.674  1.00 14.50  ? 657  ILE A O     1 
ATOM   5095 C  CB    . ILE A 1 657 ? 36.520 50.028 25.506  1.00 18.09  ? 657  ILE A CB    1 
ATOM   5096 C  CG1   . ILE A 1 657 ? 37.537 51.133 25.798  1.00 15.96  ? 657  ILE A CG1   1 
ATOM   5097 C  CG2   . ILE A 1 657 ? 35.927 49.453 26.810  1.00 18.02  ? 657  ILE A CG2   1 
ATOM   5098 C  CD1   . ILE A 1 657 ? 37.043 52.291 26.681  1.00 23.26  ? 657  ILE A CD1   1 
ATOM   5099 N  N     . PRO A 1 658 ? 39.242 47.713 25.073  1.00 17.08  ? 658  PRO A N     1 
ATOM   5100 C  CA    . PRO A 1 658 ? 39.953 46.526 25.581  1.00 14.76  ? 658  PRO A CA    1 
ATOM   5101 C  C     . PRO A 1 658 ? 40.084 46.461 27.136  1.00 12.72  ? 658  PRO A C     1 
ATOM   5102 O  O     . PRO A 1 658 ? 40.332 45.386 27.683  1.00 15.62  ? 658  PRO A O     1 
ATOM   5103 C  CB    . PRO A 1 658 ? 41.356 46.626 24.971  1.00 16.39  ? 658  PRO A CB    1 
ATOM   5104 C  CG    . PRO A 1 658 ? 41.561 48.079 24.647  1.00 12.29  ? 658  PRO A CG    1 
ATOM   5105 C  CD    . PRO A 1 658 ? 40.165 48.631 24.353  1.00 16.85  ? 658  PRO A CD    1 
ATOM   5106 N  N     . ASN A 1 659 ? 39.970 47.629 27.821  1.00 15.63  ? 659  ASN A N     1 
ATOM   5107 C  CA    . ASN A 1 659 ? 40.109 47.734 29.257  1.00 30.73  ? 659  ASN A CA    1 
ATOM   5108 C  C     . ASN A 1 659 ? 39.560 49.051 29.647  1.00 32.52  ? 659  ASN A C     1 
ATOM   5109 O  O     . ASN A 1 659 ? 39.114 49.796 28.772  1.00 18.18  ? 659  ASN A O     1 
ATOM   5110 C  CB    . ASN A 1 659 ? 41.627 47.713 29.662  1.00 12.11  ? 659  ASN A CB    1 
ATOM   5111 C  CG    . ASN A 1 659 ? 42.469 48.736 28.945  1.00 13.54  ? 659  ASN A CG    1 
ATOM   5112 O  OD1   . ASN A 1 659 ? 42.448 49.970 29.198  1.00 22.11  ? 659  ASN A OD1   1 
ATOM   5113 N  ND2   . ASN A 1 659 ? 43.335 48.224 28.036  1.00 16.85  ? 659  ASN A ND2   1 
ATOM   5114 N  N     . ASN A 1 660 ? 39.659 49.372 30.945  1.00 26.10  ? 660  ASN A N     1 
ATOM   5115 C  CA    . ASN A 1 660 ? 39.155 50.679 31.431  1.00 20.78  ? 660  ASN A CA    1 
ATOM   5116 C  C     . ASN A 1 660 ? 40.237 51.704 31.720  1.00 28.94  ? 660  ASN A C     1 
ATOM   5117 O  O     . ASN A 1 660 ? 40.002 52.751 32.341  1.00 29.18  ? 660  ASN A O     1 
ATOM   5118 C  CB    . ASN A 1 660 ? 38.144 50.480 32.592  1.00 19.39  ? 660  ASN A CB    1 
ATOM   5119 C  CG    . ASN A 1 660 ? 36.938 49.693 32.088  1.00 24.79  ? 660  ASN A CG    1 
ATOM   5120 O  OD1   . ASN A 1 660 ? 36.352 50.111 31.117  1.00 27.72  ? 660  ASN A OD1   1 
ATOM   5121 N  ND2   . ASN A 1 660 ? 36.599 48.587 32.696  1.00 23.46  ? 660  ASN A ND2   1 
ATOM   5122 N  N     . LYS A 1 661 ? 41.438 51.432 31.242  1.00 23.00  ? 661  LYS A N     1 
ATOM   5123 C  CA    . LYS A 1 661 ? 42.505 52.343 31.558  1.00 18.69  ? 661  LYS A CA    1 
ATOM   5124 C  C     . LYS A 1 661 ? 43.073 53.078 30.385  1.00 23.53  ? 661  LYS A C     1 
ATOM   5125 O  O     . LYS A 1 661 ? 44.114 53.694 30.566  1.00 21.71  ? 661  LYS A O     1 
ATOM   5126 C  CB    . LYS A 1 661 ? 43.629 51.547 32.165  1.00 41.93  ? 661  LYS A CB    1 
ATOM   5127 C  CG    . LYS A 1 661 ? 43.126 50.564 33.195  1.00 32.72  ? 661  LYS A CG    1 
ATOM   5128 C  CD    . LYS A 1 661 ? 43.892 49.254 33.214  1.00 100.00 ? 661  LYS A CD    1 
ATOM   5129 C  CE    . LYS A 1 661 ? 43.972 48.715 34.637  1.00 100.00 ? 661  LYS A CE    1 
ATOM   5130 N  NZ    . LYS A 1 661 ? 42.941 47.708 34.927  1.00 100.00 ? 661  LYS A NZ    1 
ATOM   5131 N  N     . GLN A 1 662 ? 42.475 52.959 29.208  1.00 20.32  ? 662  GLN A N     1 
ATOM   5132 C  CA    . GLN A 1 662 ? 43.053 53.667 28.071  1.00 20.44  ? 662  GLN A CA    1 
ATOM   5133 C  C     . GLN A 1 662 ? 44.478 53.244 27.693  1.00 18.61  ? 662  GLN A C     1 
ATOM   5134 O  O     . GLN A 1 662 ? 45.239 54.043 27.110  1.00 23.04  ? 662  GLN A O     1 
ATOM   5135 C  CB    . GLN A 1 662 ? 43.021 55.218 28.087  1.00 17.57  ? 662  GLN A CB    1 
ATOM   5136 C  CG    . GLN A 1 662 ? 41.566 55.745 28.259  1.00 19.19  ? 662  GLN A CG    1 
ATOM   5137 C  CD    . GLN A 1 662 ? 41.362 57.212 28.581  1.00 26.84  ? 662  GLN A CD    1 
ATOM   5138 O  OE1   . GLN A 1 662 ? 40.677 57.543 29.543  1.00 29.57  ? 662  GLN A OE1   1 
ATOM   5139 N  NE2   . GLN A 1 662 ? 41.886 58.101 27.769  1.00 24.28  ? 662  GLN A NE2   1 
ATOM   5140 N  N     . LEU A 1 663 ? 44.780 51.973 27.924  1.00 19.79  ? 663  LEU A N     1 
ATOM   5141 C  CA    . LEU A 1 663 ? 46.093 51.378 27.632  1.00 15.70  ? 663  LEU A CA    1 
ATOM   5142 C  C     . LEU A 1 663 ? 46.053 50.355 26.475  1.00 9.87   ? 663  LEU A C     1 
ATOM   5143 O  O     . LEU A 1 663 ? 45.096 49.540 26.302  1.00 20.48  ? 663  LEU A O     1 
ATOM   5144 C  CB    . LEU A 1 663 ? 46.572 50.552 28.862  1.00 18.18  ? 663  LEU A CB    1 
ATOM   5145 C  CG    . LEU A 1 663 ? 46.650 51.382 30.138  1.00 31.53  ? 663  LEU A CG    1 
ATOM   5146 C  CD1   . LEU A 1 663 ? 46.985 50.501 31.367  1.00 32.62  ? 663  LEU A CD1   1 
ATOM   5147 C  CD2   . LEU A 1 663 ? 47.674 52.473 29.927  1.00 28.77  ? 663  LEU A CD2   1 
ATOM   5148 N  N     . PRO A 1 664 ? 47.175 50.388 25.690  1.00 26.65  ? 664  PRO A N     1 
ATOM   5149 C  CA    . PRO A 1 664 ? 47.421 49.449 24.623  1.00 17.57  ? 664  PRO A CA    1 
ATOM   5150 C  C     . PRO A 1 664 ? 47.973 48.169 25.253  1.00 18.78  ? 664  PRO A C     1 
ATOM   5151 O  O     . PRO A 1 664 ? 48.341 48.157 26.444  1.00 22.89  ? 664  PRO A O     1 
ATOM   5152 C  CB    . PRO A 1 664 ? 48.558 50.078 23.786  1.00 17.33  ? 664  PRO A CB    1 
ATOM   5153 C  CG    . PRO A 1 664 ? 49.272 50.853 24.799  1.00 16.29  ? 664  PRO A CG    1 
ATOM   5154 C  CD    . PRO A 1 664 ? 48.166 51.453 25.602  1.00 19.65  ? 664  PRO A CD    1 
ATOM   5155 N  N     . ALA A 1 665 ? 47.920 47.106 24.477  1.00 18.81  ? 665  ALA A N     1 
ATOM   5156 C  CA    . ALA A 1 665 ? 48.435 45.775 24.832  1.00 19.33  ? 665  ALA A CA    1 
ATOM   5157 C  C     . ALA A 1 665 ? 47.858 45.249 26.137  1.00 27.33  ? 665  ALA A C     1 
ATOM   5158 O  O     . ALA A 1 665 ? 48.509 44.518 26.882  1.00 23.44  ? 665  ALA A O     1 
ATOM   5159 C  CB    . ALA A 1 665 ? 49.991 45.870 24.869  1.00 17.05  ? 665  ALA A CB    1 
ATOM   5160 N  N     . LYS A 1 666 ? 46.598 45.621 26.423  1.00 23.97  ? 666  LYS A N     1 
ATOM   5161 C  CA    . LYS A 1 666 ? 45.954 45.212 27.668  1.00 24.96  ? 666  LYS A CA    1 
ATOM   5162 C  C     . LYS A 1 666 ? 44.459 44.859 27.497  1.00 15.72  ? 666  LYS A C     1 
ATOM   5163 O  O     . LYS A 1 666 ? 43.570 45.616 27.882  1.00 23.37  ? 666  LYS A O     1 
ATOM   5164 C  CB    . LYS A 1 666 ? 46.204 46.267 28.775  1.00 37.08  ? 666  LYS A CB    1 
ATOM   5165 C  CG    . LYS A 1 666 ? 47.102 45.869 29.927  1.00 47.33  ? 666  LYS A CG    1 
ATOM   5166 C  CD    . LYS A 1 666 ? 46.329 45.391 31.178  1.00 100.00 ? 666  LYS A CD    1 
ATOM   5167 C  CE    . LYS A 1 666 ? 46.734 44.014 31.753  1.00 100.00 ? 666  LYS A CE    1 
ATOM   5168 N  NZ    . LYS A 1 666 ? 45.895 43.467 32.848  1.00 72.93  ? 666  LYS A NZ    1 
ATOM   5169 N  N     . LEU A 1 667 ? 44.225 43.699 26.861  1.00 18.78  ? 667  LEU A N     1 
ATOM   5170 C  CA    . LEU A 1 667 ? 42.924 43.144 26.568  1.00 17.08  ? 667  LEU A CA    1 
ATOM   5171 C  C     . LEU A 1 667 ? 42.461 42.264 27.762  1.00 20.58  ? 667  LEU A C     1 
ATOM   5172 O  O     . LEU A 1 667 ? 42.910 41.154 27.991  1.00 27.86  ? 667  LEU A O     1 
ATOM   5173 C  CB    . LEU A 1 667 ? 43.025 42.338 25.254  1.00 11.81  ? 667  LEU A CB    1 
ATOM   5174 C  CG    . LEU A 1 667 ? 41.630 41.999 24.660  1.00 16.27  ? 667  LEU A CG    1 
ATOM   5175 C  CD1   . LEU A 1 667 ? 41.095 43.165 23.853  1.00 15.61  ? 667  LEU A CD1   1 
ATOM   5176 C  CD2   . LEU A 1 667 ? 41.743 40.682 23.878  1.00 17.67  ? 667  LEU A CD2   1 
ATOM   5177 N  N     . GLU A 1 668 ? 41.516 42.801 28.523  1.00 23.31  ? 668  GLU A N     1 
ATOM   5178 C  CA    . GLU A 1 668 ? 40.947 42.202 29.717  1.00 24.06  ? 668  GLU A CA    1 
ATOM   5179 C  C     . GLU A 1 668 ? 39.710 41.412 29.369  1.00 25.96  ? 668  GLU A C     1 
ATOM   5180 O  O     . GLU A 1 668 ? 38.723 41.940 28.868  1.00 22.34  ? 668  GLU A O     1 
ATOM   5181 C  CB    . GLU A 1 668 ? 40.685 43.397 30.620  1.00 17.33  ? 668  GLU A CB    1 
ATOM   5182 C  CG    . GLU A 1 668 ? 42.072 43.808 31.124  1.00 23.08  ? 668  GLU A CG    1 
ATOM   5183 C  CD    . GLU A 1 668 ? 42.030 45.019 32.010  1.00 100.00 ? 668  GLU A CD    1 
ATOM   5184 O  OE1   . GLU A 1 668 ? 40.950 45.475 32.405  1.00 56.84  ? 668  GLU A OE1   1 
ATOM   5185 O  OE2   . GLU A 1 668 ? 43.262 45.499 32.342  1.00 47.70  ? 668  GLU A OE2   1 
ATOM   5186 N  N     . ASP A 1 669 ? 39.806 40.110 29.592  1.00 21.61  ? 669  ASP A N     1 
ATOM   5187 C  CA    . ASP A 1 669 ? 38.756 39.207 29.312  1.00 22.02  ? 669  ASP A CA    1 
ATOM   5188 C  C     . ASP A 1 669 ? 37.389 39.647 29.822  1.00 25.35  ? 669  ASP A C     1 
ATOM   5189 O  O     . ASP A 1 669 ? 36.382 39.549 29.132  1.00 26.20  ? 669  ASP A O     1 
ATOM   5190 C  CB    . ASP A 1 669 ? 39.065 37.846 29.926  1.00 30.25  ? 669  ASP A CB    1 
ATOM   5191 C  CG    . ASP A 1 669 ? 39.845 37.793 31.239  1.00 33.17  ? 669  ASP A CG    1 
ATOM   5192 O  OD1   . ASP A 1 669 ? 39.627 38.789 32.043  1.00 73.50  ? 669  ASP A OD1   1 
ATOM   5193 O  OD2   . ASP A 1 669 ? 40.635 36.894 31.499  1.00 87.49  ? 669  ASP A OD2   1 
ATOM   5194 N  N     . LYS A 1 670 ? 37.351 40.072 31.074  1.00 25.94  ? 670  LYS A N     1 
ATOM   5195 C  CA    . LYS A 1 670 ? 36.117 40.476 31.733  1.00 31.31  ? 670  LYS A CA    1 
ATOM   5196 C  C     . LYS A 1 670 ? 35.535 41.704 31.077  1.00 20.42  ? 670  LYS A C     1 
ATOM   5197 O  O     . LYS A 1 670 ? 34.337 41.723 30.818  1.00 28.81  ? 670  LYS A O     1 
ATOM   5198 C  CB    . LYS A 1 670 ? 36.233 40.634 33.254  1.00 27.25  ? 670  LYS A CB    1 
ATOM   5199 N  N     . VAL A 1 671 ? 36.375 42.707 30.836  1.00 18.36  ? 671  VAL A N     1 
ATOM   5200 C  CA    . VAL A 1 671 ? 35.948 43.960 30.213  1.00 25.49  ? 671  VAL A CA    1 
ATOM   5201 C  C     . VAL A 1 671 ? 35.361 43.675 28.841  1.00 25.71  ? 671  VAL A C     1 
ATOM   5202 O  O     . VAL A 1 671 ? 34.295 44.174 28.443  1.00 21.07  ? 671  VAL A O     1 
ATOM   5203 C  CB    . VAL A 1 671 ? 37.081 44.998 30.079  1.00 18.46  ? 671  VAL A CB    1 
ATOM   5204 C  CG1   . VAL A 1 671 ? 36.624 46.161 29.239  1.00 15.42  ? 671  VAL A CG1   1 
ATOM   5205 C  CG2   . VAL A 1 671 ? 37.477 45.577 31.447  1.00 25.41  ? 671  VAL A CG2   1 
ATOM   5206 N  N     . VAL A 1 672 ? 36.080 42.830 28.132  1.00 17.86  ? 672  VAL A N     1 
ATOM   5207 C  CA    . VAL A 1 672 ? 35.720 42.477 26.788  1.00 14.19  ? 672  VAL A CA    1 
ATOM   5208 C  C     . VAL A 1 672 ? 34.450 41.650 26.690  1.00 12.23  ? 672  VAL A C     1 
ATOM   5209 O  O     . VAL A 1 672 ? 33.531 41.937 25.927  1.00 18.19  ? 672  VAL A O     1 
ATOM   5210 C  CB    . VAL A 1 672 ? 36.960 41.952 26.009  1.00 23.73  ? 672  VAL A CB    1 
ATOM   5211 C  CG1   . VAL A 1 672 ? 36.478 41.432 24.613  1.00 24.03  ? 672  VAL A CG1   1 
ATOM   5212 C  CG2   . VAL A 1 672 ? 38.043 43.053 25.841  1.00 9.06   ? 672  VAL A CG2   1 
ATOM   5213 N  N     . LEU A 1 673 ? 34.411 40.569 27.427  1.00 14.03  ? 673  LEU A N     1 
ATOM   5214 C  CA    . LEU A 1 673 ? 33.293 39.651 27.379  1.00 16.27  ? 673  LEU A CA    1 
ATOM   5215 C  C     . LEU A 1 673 ? 31.992 40.256 27.728  1.00 26.06  ? 673  LEU A C     1 
ATOM   5216 O  O     . LEU A 1 673 ? 30.971 39.971 27.140  1.00 25.91  ? 673  LEU A O     1 
ATOM   5217 C  CB    . LEU A 1 673 ? 33.513 38.389 28.166  1.00 18.99  ? 673  LEU A CB    1 
ATOM   5218 C  CG    . LEU A 1 673 ? 34.414 37.470 27.280  1.00 27.61  ? 673  LEU A CG    1 
ATOM   5219 C  CD1   . LEU A 1 673 ? 35.332 36.632 28.094  1.00 29.25  ? 673  LEU A CD1   1 
ATOM   5220 C  CD2   . LEU A 1 673 ? 33.548 36.651 26.297  1.00 20.14  ? 673  LEU A CD2   1 
ATOM   5221 N  N     . ASP A 1 674 ? 32.067 41.138 28.671  1.00 18.74  ? 674  ASP A N     1 
ATOM   5222 C  CA    . ASP A 1 674 ? 30.850 41.835 29.097  1.00 25.67  ? 674  ASP A CA    1 
ATOM   5223 C  C     . ASP A 1 674 ? 30.294 42.614 27.912  1.00 22.92  ? 674  ASP A C     1 
ATOM   5224 O  O     . ASP A 1 674 ? 29.061 42.672 27.674  1.00 20.14  ? 674  ASP A O     1 
ATOM   5225 C  CB    . ASP A 1 674 ? 31.124 42.584 30.422  1.00 20.25  ? 674  ASP A CB    1 
ATOM   5226 C  CG    . ASP A 1 674 ? 30.136 43.671 30.608  1.00 100.00 ? 674  ASP A CG    1 
ATOM   5227 O  OD1   . ASP A 1 674 ? 28.926 43.267 30.265  1.00 100.00 ? 674  ASP A OD1   1 
ATOM   5228 O  OD2   . ASP A 1 674 ? 30.433 44.810 30.972  1.00 100.00 ? 674  ASP A OD2   1 
ATOM   5229 N  N     . GLN A 1 675 ? 31.218 43.218 27.146  1.00 17.56  ? 675  GLN A N     1 
ATOM   5230 C  CA    . GLN A 1 675 ? 30.816 43.959 25.967  1.00 18.63  ? 675  GLN A CA    1 
ATOM   5231 C  C     . GLN A 1 675 ? 30.191 43.078 24.904  1.00 26.63  ? 675  GLN A C     1 
ATOM   5232 O  O     . GLN A 1 675 ? 29.199 43.464 24.280  1.00 23.02  ? 675  GLN A O     1 
ATOM   5233 C  CB    . GLN A 1 675 ? 31.855 44.861 25.326  1.00 23.04  ? 675  GLN A CB    1 
ATOM   5234 C  CG    . GLN A 1 675 ? 32.288 45.980 26.323  1.00 21.24  ? 675  GLN A CG    1 
ATOM   5235 C  CD    . GLN A 1 675 ? 33.611 46.568 25.803  1.00 17.17  ? 675  GLN A CD    1 
ATOM   5236 O  OE1   . GLN A 1 675 ? 33.574 47.491 24.949  1.00 14.21  ? 675  GLN A OE1   1 
ATOM   5237 N  NE2   . GLN A 1 675 ? 34.728 46.154 26.435  1.00 13.49  ? 675  GLN A NE2   1 
ATOM   5238 N  N     . LEU A 1 676 ? 30.755 41.901 24.747  1.00 16.49  ? 676  LEU A N     1 
ATOM   5239 C  CA    . LEU A 1 676 ? 30.272 40.928 23.759  1.00 24.74  ? 676  LEU A CA    1 
ATOM   5240 C  C     . LEU A 1 676 ? 28.890 40.394 24.099  1.00 25.40  ? 676  LEU A C     1 
ATOM   5241 O  O     . LEU A 1 676 ? 28.070 40.002 23.235  1.00 21.84  ? 676  LEU A O     1 
ATOM   5242 C  CB    . LEU A 1 676 ? 31.316 39.808 23.437  1.00 19.86  ? 676  LEU A CB    1 
ATOM   5243 C  CG    . LEU A 1 676 ? 32.682 40.394 23.037  1.00 22.79  ? 676  LEU A CG    1 
ATOM   5244 C  CD1   . LEU A 1 676 ? 33.692 39.293 23.119  1.00 27.58  ? 676  LEU A CD1   1 
ATOM   5245 C  CD2   . LEU A 1 676 ? 32.569 41.004 21.653  1.00 19.18  ? 676  LEU A CD2   1 
ATOM   5246 N  N     . ARG A 1 677 ? 28.665 40.362 25.399  1.00 22.14  ? 677  ARG A N     1 
ATOM   5247 C  CA    . ARG A 1 677 ? 27.370 39.920 25.899  1.00 38.59  ? 677  ARG A CA    1 
ATOM   5248 C  C     . ARG A 1 677 ? 26.297 41.005 25.599  1.00 30.71  ? 677  ARG A C     1 
ATOM   5249 O  O     . ARG A 1 677 ? 25.218 40.772 25.021  1.00 38.48  ? 677  ARG A O     1 
ATOM   5250 C  CB    . ARG A 1 677 ? 27.499 39.713 27.433  1.00 32.50  ? 677  ARG A CB    1 
ATOM   5251 C  CG    . ARG A 1 677 ? 27.670 38.299 27.983  1.00 38.42  ? 677  ARG A CG    1 
ATOM   5252 C  CD    . ARG A 1 677 ? 28.164 38.232 29.471  1.00 19.97  ? 677  ARG A CD    1 
ATOM   5253 N  NE    . ARG A 1 677 ? 29.111 37.175 29.720  1.00 29.59  ? 677  ARG A NE    1 
ATOM   5254 C  CZ    . ARG A 1 677 ? 30.331 37.368 30.251  1.00 54.27  ? 677  ARG A CZ    1 
ATOM   5255 N  NH1   . ARG A 1 677 ? 30.729 38.544 30.675  1.00 36.14  ? 677  ARG A NH1   1 
ATOM   5256 N  NH2   . ARG A 1 677 ? 31.194 36.347 30.399  1.00 38.33  ? 677  ARG A NH2   1 
ATOM   5257 N  N     . CYS A 1 678 ? 26.620 42.250 25.983  1.00 34.00  ? 678  CYS A N     1 
ATOM   5258 C  CA    . CYS A 1 678 ? 25.668 43.322 25.809  1.00 28.00  ? 678  CYS A CA    1 
ATOM   5259 C  C     . CYS A 1 678 ? 25.376 43.776 24.407  1.00 48.78  ? 678  CYS A C     1 
ATOM   5260 O  O     . CYS A 1 678 ? 24.319 44.366 24.219  1.00 33.83  ? 678  CYS A O     1 
ATOM   5261 C  CB    . CYS A 1 678 ? 26.079 44.584 26.581  1.00 26.70  ? 678  CYS A CB    1 
ATOM   5262 S  SG    . CYS A 1 678 ? 26.219 44.099 28.300  1.00 50.58  ? 678  CYS A SG    1 
ATOM   5263 N  N     . ASN A 1 679 ? 26.334 43.611 23.492  1.00 25.41  ? 679  ASN A N     1 
ATOM   5264 C  CA    . ASN A 1 679 ? 26.288 44.174 22.167  1.00 19.96  ? 679  ASN A CA    1 
ATOM   5265 C  C     . ASN A 1 679 ? 25.711 43.288 21.087  1.00 19.24  ? 679  ASN A C     1 
ATOM   5266 O  O     . ASN A 1 679 ? 25.604 43.716 19.918  1.00 21.59  ? 679  ASN A O     1 
ATOM   5267 C  CB    . ASN A 1 679 ? 27.613 44.848 21.805  1.00 17.78  ? 679  ASN A CB    1 
ATOM   5268 C  CG    . ASN A 1 679 ? 28.688 43.836 21.334  1.00 24.20  ? 679  ASN A CG    1 
ATOM   5269 O  OD1   . ASN A 1 679 ? 28.462 42.606 21.288  1.00 26.42  ? 679  ASN A OD1   1 
ATOM   5270 N  ND2   . ASN A 1 679 ? 29.876 44.367 20.993  1.00 28.63  ? 679  ASN A ND2   1 
ATOM   5271 N  N     . GLY A 1 680 ? 25.340 42.098 21.520  1.00 19.16  ? 680  GLY A N     1 
ATOM   5272 C  CA    . GLY A 1 680 ? 24.721 41.166 20.583  1.00 25.22  ? 680  GLY A CA    1 
ATOM   5273 C  C     . GLY A 1 680 ? 25.664 40.218 19.873  1.00 31.31  ? 680  GLY A C     1 
ATOM   5274 O  O     . GLY A 1 680 ? 25.196 39.320 19.222  1.00 20.08  ? 680  GLY A O     1 
ATOM   5275 N  N     . VAL A 1 681 ? 26.980 40.398 20.043  1.00 19.82  ? 681  VAL A N     1 
ATOM   5276 C  CA    . VAL A 1 681 ? 27.890 39.500 19.390  1.00 22.84  ? 681  VAL A CA    1 
ATOM   5277 C  C     . VAL A 1 681 ? 27.756 38.053 19.842  1.00 21.86  ? 681  VAL A C     1 
ATOM   5278 O  O     . VAL A 1 681 ? 27.695 37.121 19.042  1.00 20.94  ? 681  VAL A O     1 
ATOM   5279 C  CB    . VAL A 1 681 ? 29.288 40.058 19.562  1.00 18.45  ? 681  VAL A CB    1 
ATOM   5280 C  CG1   . VAL A 1 681 ? 30.228 38.964 19.084  1.00 22.05  ? 681  VAL A CG1   1 
ATOM   5281 C  CG2   . VAL A 1 681 ? 29.400 41.331 18.721  1.00 16.28  ? 681  VAL A CG2   1 
ATOM   5282 N  N     . LEU A 1 682 ? 27.762 37.816 21.141  1.00 25.43  ? 682  LEU A N     1 
ATOM   5283 C  CA    . LEU A 1 682 ? 27.655 36.432 21.597  1.00 19.70  ? 682  LEU A CA    1 
ATOM   5284 C  C     . LEU A 1 682 ? 26.287 35.826 21.297  1.00 21.89  ? 682  LEU A C     1 
ATOM   5285 O  O     . LEU A 1 682 ? 26.178 34.655 20.971  1.00 24.68  ? 682  LEU A O     1 
ATOM   5286 C  CB    . LEU A 1 682 ? 27.837 36.315 23.145  1.00 34.30  ? 682  LEU A CB    1 
ATOM   5287 C  CG    . LEU A 1 682 ? 29.236 36.803 23.597  1.00 46.98  ? 682  LEU A CG    1 
ATOM   5288 C  CD1   . LEU A 1 682 ? 29.430 36.612 25.124  1.00 16.46  ? 682  LEU A CD1   1 
ATOM   5289 C  CD2   . LEU A 1 682 ? 30.290 36.046 22.764  1.00 22.35  ? 682  LEU A CD2   1 
ATOM   5290 N  N     . GLU A 1 683 ? 25.227 36.617 21.437  1.00 28.03  ? 683  GLU A N     1 
ATOM   5291 C  CA    . GLU A 1 683 ? 23.899 36.080 21.186  1.00 19.97  ? 683  GLU A CA    1 
ATOM   5292 C  C     . GLU A 1 683 ? 23.824 35.600 19.752  1.00 21.23  ? 683  GLU A C     1 
ATOM   5293 O  O     . GLU A 1 683 ? 23.342 34.515 19.431  1.00 31.91  ? 683  GLU A O     1 
ATOM   5294 C  CB    . GLU A 1 683 ? 22.736 37.082 21.491  1.00 30.90  ? 683  GLU A CB    1 
ATOM   5295 C  CG    . GLU A 1 683 ? 21.254 36.522 21.314  1.00 52.84  ? 683  GLU A CG    1 
ATOM   5296 C  CD    . GLU A 1 683 ? 20.047 37.454 20.889  1.00 100.00 ? 683  GLU A CD    1 
ATOM   5297 O  OE1   . GLU A 1 683 ? 20.350 38.578 20.315  1.00 90.43  ? 683  GLU A OE1   1 
ATOM   5298 O  OE2   . GLU A 1 683 ? 18.849 37.176 21.050  1.00 55.34  ? 683  GLU A OE2   1 
ATOM   5299 N  N     . GLY A 1 684 ? 24.352 36.444 18.889  1.00 26.44  ? 684  GLY A N     1 
ATOM   5300 C  CA    . GLY A 1 684 ? 24.371 36.183 17.495  1.00 19.28  ? 684  GLY A CA    1 
ATOM   5301 C  C     . GLY A 1 684 ? 25.010 34.843 17.241  1.00 31.10  ? 684  GLY A C     1 
ATOM   5302 O  O     . GLY A 1 684 ? 24.575 34.022 16.433  1.00 31.73  ? 684  GLY A O     1 
ATOM   5303 N  N     . ILE A 1 685 ? 26.121 34.631 17.902  1.00 22.79  ? 685  ILE A N     1 
ATOM   5304 C  CA    . ILE A 1 685 ? 26.854 33.385 17.741  1.00 28.39  ? 685  ILE A CA    1 
ATOM   5305 C  C     . ILE A 1 685 ? 26.105 32.223 18.359  1.00 34.84  ? 685  ILE A C     1 
ATOM   5306 O  O     . ILE A 1 685 ? 26.025 31.155 17.797  1.00 30.65  ? 685  ILE A O     1 
ATOM   5307 C  CB    . ILE A 1 685 ? 28.179 33.552 18.482  1.00 41.63  ? 685  ILE A CB    1 
ATOM   5308 C  CG1   . ILE A 1 685 ? 29.062 34.431 17.614  1.00 20.97  ? 685  ILE A CG1   1 
ATOM   5309 C  CG2   . ILE A 1 685 ? 28.766 32.173 18.719  1.00 29.62  ? 685  ILE A CG2   1 
ATOM   5310 C  CD1   . ILE A 1 685 ? 30.277 34.922 18.297  1.00 27.58  ? 685  ILE A CD1   1 
ATOM   5311 N  N     . ARG A 1 686 ? 25.540 32.429 19.533  1.00 28.75  ? 686  ARG A N     1 
ATOM   5312 C  CA    . ARG A 1 686 ? 24.791 31.358 20.127  1.00 40.49  ? 686  ARG A CA    1 
ATOM   5313 C  C     . ARG A 1 686 ? 23.807 30.840 19.104  1.00 53.48  ? 686  ARG A C     1 
ATOM   5314 O  O     . ARG A 1 686 ? 23.779 29.648 18.770  1.00 43.06  ? 686  ARG A O     1 
ATOM   5315 C  CB    . ARG A 1 686 ? 23.979 31.799 21.333  1.00 51.28  ? 686  ARG A CB    1 
ATOM   5316 C  CG    . ARG A 1 686 ? 24.802 32.261 22.528  1.00 100.00 ? 686  ARG A CG    1 
ATOM   5317 C  CD    . ARG A 1 686 ? 23.907 32.904 23.589  1.00 89.25  ? 686  ARG A CD    1 
ATOM   5318 N  NE    . ARG A 1 686 ? 24.535 34.028 24.304  1.00 100.00 ? 686  ARG A NE    1 
ATOM   5319 C  CZ    . ARG A 1 686 ? 23.984 35.257 24.544  1.00 100.00 ? 686  ARG A CZ    1 
ATOM   5320 N  NH1   . ARG A 1 686 ? 22.745 35.584 24.080  1.00 100.00 ? 686  ARG A NH1   1 
ATOM   5321 N  NH2   . ARG A 1 686 ? 24.693 36.209 25.249  1.00 48.28  ? 686  ARG A NH2   1 
ATOM   5322 N  N     . ILE A 1 687 ? 23.030 31.785 18.585  1.00 30.17  ? 687  ILE A N     1 
ATOM   5323 C  CA    . ILE A 1 687 ? 22.043 31.495 17.563  1.00 41.99  ? 687  ILE A CA    1 
ATOM   5324 C  C     . ILE A 1 687 ? 22.600 30.741 16.352  1.00 31.33  ? 687  ILE A C     1 
ATOM   5325 O  O     . ILE A 1 687 ? 22.132 29.690 15.934  1.00 43.05  ? 687  ILE A O     1 
ATOM   5326 C  CB    . ILE A 1 687 ? 21.438 32.789 17.060  1.00 63.19  ? 687  ILE A CB    1 
ATOM   5327 C  CG1   . ILE A 1 687 ? 20.392 33.296 18.042  1.00 33.36  ? 687  ILE A CG1   1 
ATOM   5328 C  CG2   . ILE A 1 687 ? 20.833 32.473 15.717  1.00 34.54  ? 687  ILE A CG2   1 
ATOM   5329 C  CD1   . ILE A 1 687 ? 20.308 34.805 18.057  1.00 41.94  ? 687  ILE A CD1   1 
ATOM   5330 N  N     . THR A 1 688 ? 23.608 31.341 15.778  1.00 44.97  ? 688  THR A N     1 
ATOM   5331 C  CA    . THR A 1 688 ? 24.303 30.811 14.638  1.00 87.26  ? 688  THR A CA    1 
ATOM   5332 C  C     . THR A 1 688 ? 24.741 29.363 14.910  1.00 66.66  ? 688  THR A C     1 
ATOM   5333 O  O     . THR A 1 688 ? 24.371 28.406 14.217  1.00 39.04  ? 688  THR A O     1 
ATOM   5334 C  CB    . THR A 1 688 ? 25.407 31.896 14.501  1.00 38.88  ? 688  THR A CB    1 
ATOM   5335 O  OG1   . THR A 1 688 ? 24.881 32.983 13.713  1.00 58.98  ? 688  THR A OG1   1 
ATOM   5336 C  CG2   . THR A 1 688 ? 26.819 31.459 14.097  1.00 100.00 ? 688  THR A CG2   1 
ATOM   5337 N  N     . ARG A 1 689 ? 25.515 29.205 15.975  1.00 67.59  ? 689  ARG A N     1 
ATOM   5338 C  CA    . ARG A 1 689 ? 26.015 27.906 16.390  1.00 43.08  ? 689  ARG A CA    1 
ATOM   5339 C  C     . ARG A 1 689 ? 24.895 26.880 16.490  1.00 100.00 ? 689  ARG A C     1 
ATOM   5340 O  O     . ARG A 1 689 ? 25.108 25.668 16.466  1.00 79.67  ? 689  ARG A O     1 
ATOM   5341 C  CB    . ARG A 1 689 ? 26.809 27.992 17.691  1.00 33.84  ? 689  ARG A CB    1 
ATOM   5342 C  CG    . ARG A 1 689 ? 26.739 26.827 18.677  1.00 96.60  ? 689  ARG A CG    1 
ATOM   5343 C  CD    . ARG A 1 689 ? 27.962 26.742 19.613  1.00 100.00 ? 689  ARG A CD    1 
ATOM   5344 N  NE    . ARG A 1 689 ? 27.789 27.278 20.979  1.00 100.00 ? 689  ARG A NE    1 
ATOM   5345 C  CZ    . ARG A 1 689 ? 27.168 28.437 21.312  1.00 100.00 ? 689  ARG A CZ    1 
ATOM   5346 N  NH1   . ARG A 1 689 ? 26.607 29.221 20.367  1.00 100.00 ? 689  ARG A NH1   1 
ATOM   5347 N  NH2   . ARG A 1 689 ? 27.131 28.828 22.617  1.00 90.02  ? 689  ARG A NH2   1 
ATOM   5348 N  N     . LYS A 1 690 ? 23.662 27.338 16.629  1.00 75.50  ? 690  LYS A N     1 
ATOM   5349 C  CA    . LYS A 1 690 ? 22.614 26.358 16.736  1.00 44.19  ? 690  LYS A CA    1 
ATOM   5350 C  C     . LYS A 1 690 ? 22.340 25.621 15.427  1.00 100.00 ? 690  LYS A C     1 
ATOM   5351 O  O     . LYS A 1 690 ? 21.933 24.459 15.416  1.00 49.43  ? 690  LYS A O     1 
ATOM   5352 C  CB    . LYS A 1 690 ? 21.385 26.910 17.414  1.00 56.84  ? 690  LYS A CB    1 
ATOM   5353 C  CG    . LYS A 1 690 ? 21.578 26.862 18.940  1.00 64.85  ? 690  LYS A CG    1 
ATOM   5354 C  CD    . LYS A 1 690 ? 20.339 27.296 19.680  1.00 80.11  ? 690  LYS A CD    1 
ATOM   5355 C  CE    . LYS A 1 690 ? 19.348 27.924 18.673  1.00 100.00 ? 690  LYS A CE    1 
ATOM   5356 N  NZ    . LYS A 1 690 ? 18.458 28.914 19.264  1.00 100.00 ? 690  LYS A NZ    1 
ATOM   5357 N  N     . GLY A 1 691 ? 22.610 26.279 14.294  1.00 52.31  ? 691  GLY A N     1 
ATOM   5358 C  CA    . GLY A 1 691 ? 22.352 25.647 13.006  1.00 100.00 ? 691  GLY A CA    1 
ATOM   5359 C  C     . GLY A 1 691 ? 23.568 25.058 12.292  1.00 61.92  ? 691  GLY A C     1 
ATOM   5360 O  O     . GLY A 1 691 ? 24.099 23.988 12.627  1.00 45.62  ? 691  GLY A O     1 
ATOM   5361 N  N     . PHE A 1 692 ? 23.971 25.740 11.251  1.00 34.65  ? 692  PHE A N     1 
ATOM   5362 C  CA    . PHE A 1 692 ? 25.110 25.267 10.501  1.00 45.21  ? 692  PHE A CA    1 
ATOM   5363 C  C     . PHE A 1 692 ? 26.021 26.450 10.306  1.00 44.01  ? 692  PHE A C     1 
ATOM   5364 O  O     . PHE A 1 692 ? 26.023 27.061 9.232   1.00 50.09  ? 692  PHE A O     1 
ATOM   5365 C  CB    . PHE A 1 692 ? 24.794 24.576 9.120   1.00 39.91  ? 692  PHE A CB    1 
ATOM   5366 C  CG    . PHE A 1 692 ? 24.089 23.235 9.162   1.00 36.78  ? 692  PHE A CG    1 
ATOM   5367 C  CD1   . PHE A 1 692 ? 22.709 23.123 9.419   1.00 97.60  ? 692  PHE A CD1   1 
ATOM   5368 C  CD2   . PHE A 1 692 ? 24.812 22.054 9.045   1.00 25.46  ? 692  PHE A CD2   1 
ATOM   5369 C  CE1   . PHE A 1 692 ? 22.092 21.877 9.498   1.00 43.40  ? 692  PHE A CE1   1 
ATOM   5370 C  CE2   . PHE A 1 692 ? 24.243 20.791 9.133   1.00 30.68  ? 692  PHE A CE2   1 
ATOM   5371 C  CZ    . PHE A 1 692 ? 22.860 20.726 9.410   1.00 100.00 ? 692  PHE A CZ    1 
ATOM   5372 N  N     . PRO A 1 693 ? 26.776 26.724 11.396  1.00 60.15  ? 693  PRO A N     1 
ATOM   5373 C  CA    . PRO A 1 693 ? 27.748 27.805 11.557  1.00 100.00 ? 693  PRO A CA    1 
ATOM   5374 C  C     . PRO A 1 693 ? 28.821 27.838 10.471  1.00 100.00 ? 693  PRO A C     1 
ATOM   5375 O  O     . PRO A 1 693 ? 29.131 28.899 9.921   1.00 42.97  ? 693  PRO A O     1 
ATOM   5376 C  CB    . PRO A 1 693 ? 28.387 27.706 13.003  1.00 31.92  ? 693  PRO A CB    1 
ATOM   5377 C  CG    . PRO A 1 693 ? 28.033 26.319 13.478  1.00 83.34  ? 693  PRO A CG    1 
ATOM   5378 C  CD    . PRO A 1 693 ? 26.952 25.764 12.526  1.00 43.08  ? 693  PRO A CD    1 
ATOM   5379 N  N     . ASN A 1 694 ? 29.383 26.669 10.158  1.00 44.08  ? 694  ASN A N     1 
ATOM   5380 C  CA    . ASN A 1 694 ? 30.404 26.562 9.147   1.00 47.08  ? 694  ASN A CA    1 
ATOM   5381 C  C     . ASN A 1 694 ? 29.804 26.242 7.799   1.00 34.13  ? 694  ASN A C     1 
ATOM   5382 O  O     . ASN A 1 694 ? 28.972 25.373 7.656   1.00 34.98  ? 694  ASN A O     1 
ATOM   5383 C  CB    . ASN A 1 694 ? 31.608 25.734 9.595   1.00 45.26  ? 694  ASN A CB    1 
ATOM   5384 C  CG    . ASN A 1 694 ? 31.950 25.996 11.072  1.00 48.97  ? 694  ASN A CG    1 
ATOM   5385 O  OD1   . ASN A 1 694 ? 31.918 25.084 11.906  1.00 33.81  ? 694  ASN A OD1   1 
ATOM   5386 N  ND2   . ASN A 1 694 ? 32.196 27.264 11.384  1.00 33.48  ? 694  ASN A ND2   1 
ATOM   5387 N  N     . ARG A 1 695 ? 30.174 27.076 6.865   1.00 38.72  ? 695  ARG A N     1 
ATOM   5388 C  CA    . ARG A 1 695 ? 29.703 26.998 5.499   1.00 30.10  ? 695  ARG A CA    1 
ATOM   5389 C  C     . ARG A 1 695 ? 30.893 27.220 4.612   1.00 67.19  ? 695  ARG A C     1 
ATOM   5390 O  O     . ARG A 1 695 ? 31.465 28.304 4.548   1.00 44.74  ? 695  ARG A O     1 
ATOM   5391 C  CB    . ARG A 1 695 ? 28.597 28.000 5.322   1.00 27.95  ? 695  ARG A CB    1 
ATOM   5392 C  CG    . ARG A 1 695 ? 27.659 27.875 6.523   1.00 34.07  ? 695  ARG A CG    1 
ATOM   5393 C  CD    . ARG A 1 695 ? 26.723 29.054 6.669   1.00 30.47  ? 695  ARG A CD    1 
ATOM   5394 N  NE    . ARG A 1 695 ? 25.755 28.893 7.700   1.00 37.31  ? 695  ARG A NE    1 
ATOM   5395 C  CZ    . ARG A 1 695 ? 24.924 29.861 8.033   1.00 42.72  ? 695  ARG A CZ    1 
ATOM   5396 N  NH1   . ARG A 1 695 ? 24.937 31.014 7.324   1.00 50.70  ? 695  ARG A NH1   1 
ATOM   5397 N  NH2   . ARG A 1 695 ? 24.063 29.642 9.046   1.00 58.71  ? 695  ARG A NH2   1 
ATOM   5398 N  N     . ILE A 1 696 ? 31.301 26.127 4.003   1.00 51.87  ? 696  ILE A N     1 
ATOM   5399 C  CA    . ILE A 1 696 ? 32.498 26.150 3.190   1.00 36.89  ? 696  ILE A CA    1 
ATOM   5400 C  C     . ILE A 1 696 ? 32.254 25.869 1.711   1.00 100.00 ? 696  ILE A C     1 
ATOM   5401 O  O     . ILE A 1 696 ? 31.419 25.034 1.326   1.00 39.21  ? 696  ILE A O     1 
ATOM   5402 C  CB    . ILE A 1 696 ? 33.585 25.227 3.818   1.00 100.00 ? 696  ILE A CB    1 
ATOM   5403 C  CG1   . ILE A 1 696 ? 33.932 25.536 5.305   1.00 26.78  ? 696  ILE A CG1   1 
ATOM   5404 C  CG2   . ILE A 1 696 ? 34.870 25.303 2.963   1.00 33.55  ? 696  ILE A CG2   1 
ATOM   5405 C  CD1   . ILE A 1 696 ? 32.722 25.567 6.257   1.00 100.00 ? 696  ILE A CD1   1 
ATOM   5406 N  N     . ILE A 1 697 ? 33.006 26.603 0.887   1.00 36.05  ? 697  ILE A N     1 
ATOM   5407 C  CA    . ILE A 1 697 ? 32.955 26.432 -0.551  1.00 58.01  ? 697  ILE A CA    1 
ATOM   5408 C  C     . ILE A 1 697 ? 33.640 25.095 -0.862  1.00 50.23  ? 697  ILE A C     1 
ATOM   5409 O  O     . ILE A 1 697 ? 34.729 24.799 -0.339  1.00 54.83  ? 697  ILE A O     1 
ATOM   5410 C  CB    . ILE A 1 697 ? 33.576 27.632 -1.334  1.00 63.41  ? 697  ILE A CB    1 
ATOM   5411 C  CG1   . ILE A 1 697 ? 32.772 28.940 -1.310  1.00 41.73  ? 697  ILE A CG1   1 
ATOM   5412 C  CG2   . ILE A 1 697 ? 33.930 27.286 -2.780  1.00 45.09  ? 697  ILE A CG2   1 
ATOM   5413 C  CD1   . ILE A 1 697 ? 31.398 28.881 -1.957  1.00 71.74  ? 697  ILE A CD1   1 
ATOM   5414 N  N     . TYR A 1 698 ? 32.974 24.280 -1.681  1.00 62.10  ? 698  TYR A N     1 
ATOM   5415 C  CA    . TYR A 1 698 ? 33.446 22.960 -2.070  1.00 41.75  ? 698  TYR A CA    1 
ATOM   5416 C  C     . TYR A 1 698 ? 34.942 22.901 -2.378  1.00 100.00 ? 698  TYR A C     1 
ATOM   5417 O  O     . TYR A 1 698 ? 35.703 22.181 -1.736  1.00 51.83  ? 698  TYR A O     1 
ATOM   5418 C  CB    . TYR A 1 698 ? 32.547 22.274 -3.140  1.00 100.00 ? 698  TYR A CB    1 
ATOM   5419 C  CG    . TYR A 1 698 ? 31.145 21.933 -2.645  1.00 29.01  ? 698  TYR A CG    1 
ATOM   5420 C  CD1   . TYR A 1 698 ? 30.957 20.917 -1.711  1.00 33.09  ? 698  TYR A CD1   1 
ATOM   5421 C  CD2   . TYR A 1 698 ? 30.033 22.670 -3.056  1.00 45.52  ? 698  TYR A CD2   1 
ATOM   5422 C  CE1   . TYR A 1 698 ? 29.681 20.609 -1.234  1.00 48.98  ? 698  TYR A CE1   1 
ATOM   5423 C  CE2   . TYR A 1 698 ? 28.749 22.395 -2.567  1.00 41.18  ? 698  TYR A CE2   1 
ATOM   5424 C  CZ    . TYR A 1 698 ? 28.576 21.346 -1.661  1.00 38.97  ? 698  TYR A CZ    1 
ATOM   5425 O  OH    . TYR A 1 698 ? 27.327 21.036 -1.118  1.00 37.28  ? 698  TYR A OH    1 
ATOM   5426 N  N     . ALA A 1 699 ? 35.377 23.672 -3.371  1.00 64.94  ? 699  ALA A N     1 
ATOM   5427 C  CA    . ALA A 1 699 ? 36.766 23.658 -3.737  1.00 33.42  ? 699  ALA A CA    1 
ATOM   5428 C  C     . ALA A 1 699 ? 37.691 23.926 -2.550  1.00 75.81  ? 699  ALA A C     1 
ATOM   5429 O  O     . ALA A 1 699 ? 38.713 23.263 -2.393  1.00 52.86  ? 699  ALA A O     1 
ATOM   5430 C  CB    . ALA A 1 699 ? 36.890 24.533 -4.959  1.00 47.56  ? 699  ALA A CB    1 
ATOM   5431 N  N     . ASP A 1 700 ? 37.300 24.884 -1.691  1.00 56.85  ? 700  ASP A N     1 
ATOM   5432 C  CA    . ASP A 1 700 ? 38.074 25.263 -0.507  1.00 52.76  ? 700  ASP A CA    1 
ATOM   5433 C  C     . ASP A 1 700 ? 38.242 24.093 0.472   1.00 48.97  ? 700  ASP A C     1 
ATOM   5434 O  O     . ASP A 1 700 ? 39.312 23.836 1.067   1.00 39.76  ? 700  ASP A O     1 
ATOM   5435 C  CB    . ASP A 1 700 ? 37.493 26.509 0.232   1.00 57.05  ? 700  ASP A CB    1 
ATOM   5436 C  CG    . ASP A 1 700 ? 37.057 27.678 -0.628  1.00 100.00 ? 700  ASP A CG    1 
ATOM   5437 O  OD1   . ASP A 1 700 ? 37.835 27.905 -1.655  1.00 75.28  ? 700  ASP A OD1   1 
ATOM   5438 O  OD2   . ASP A 1 700 ? 36.082 28.353 -0.355  1.00 100.00 ? 700  ASP A OD2   1 
ATOM   5439 N  N     . PHE A 1 701 ? 37.158 23.356 0.646   1.00 36.42  ? 701  PHE A N     1 
ATOM   5440 C  CA    . PHE A 1 701 ? 37.192 22.226 1.551   1.00 44.13  ? 701  PHE A CA    1 
ATOM   5441 C  C     . PHE A 1 701 ? 38.226 21.187 1.118   1.00 46.76  ? 701  PHE A C     1 
ATOM   5442 O  O     . PHE A 1 701 ? 39.127 20.821 1.872   1.00 47.09  ? 701  PHE A O     1 
ATOM   5443 C  CB    . PHE A 1 701 ? 35.749 21.683 1.708   1.00 47.87  ? 701  PHE A CB    1 
ATOM   5444 C  CG    . PHE A 1 701 ? 35.790 20.473 2.593   1.00 76.37  ? 701  PHE A CG    1 
ATOM   5445 C  CD1   . PHE A 1 701 ? 35.932 20.633 3.977   1.00 42.95  ? 701  PHE A CD1   1 
ATOM   5446 C  CD2   . PHE A 1 701 ? 35.807 19.177 2.064   1.00 55.96  ? 701  PHE A CD2   1 
ATOM   5447 C  CE1   . PHE A 1 701 ? 36.149 19.514 4.816   1.00 97.27  ? 701  PHE A CE1   1 
ATOM   5448 C  CE2   . PHE A 1 701 ? 35.847 18.056 2.890   1.00 54.79  ? 701  PHE A CE2   1 
ATOM   5449 C  CZ    . PHE A 1 701 ? 36.042 18.220 4.281   1.00 43.59  ? 701  PHE A CZ    1 
ATOM   5450 N  N     . VAL A 1 702 ? 38.056 20.751 -0.129  1.00 49.29  ? 702  VAL A N     1 
ATOM   5451 C  CA    . VAL A 1 702 ? 38.872 19.744 -0.782  1.00 39.96  ? 702  VAL A CA    1 
ATOM   5452 C  C     . VAL A 1 702 ? 40.312 20.180 -0.797  1.00 36.77  ? 702  VAL A C     1 
ATOM   5453 O  O     . VAL A 1 702 ? 41.230 19.378 -0.591  1.00 40.89  ? 702  VAL A O     1 
ATOM   5454 C  CB    . VAL A 1 702 ? 38.411 19.452 -2.249  1.00 96.66  ? 702  VAL A CB    1 
ATOM   5455 C  CG1   . VAL A 1 702 ? 39.368 18.460 -2.977  1.00 40.38  ? 702  VAL A CG1   1 
ATOM   5456 C  CG2   . VAL A 1 702 ? 36.923 19.055 -2.418  1.00 22.00  ? 702  VAL A CG2   1 
ATOM   5457 N  N     . LYS A 1 703 ? 40.517 21.470 -1.064  1.00 32.82  ? 703  LYS A N     1 
ATOM   5458 C  CA    . LYS A 1 703 ? 41.879 21.940 -1.141  1.00 100.00 ? 703  LYS A CA    1 
ATOM   5459 C  C     . LYS A 1 703 ? 42.671 21.607 0.121   1.00 55.30  ? 703  LYS A C     1 
ATOM   5460 O  O     . LYS A 1 703 ? 43.826 21.202 0.073   1.00 100.00 ? 703  LYS A O     1 
ATOM   5461 C  CB    . LYS A 1 703 ? 42.001 23.357 -1.664  1.00 40.71  ? 703  LYS A CB    1 
ATOM   5462 C  CG    . LYS A 1 703 ? 43.088 24.180 -0.941  1.00 100.00 ? 703  LYS A CG    1 
ATOM   5463 C  CD    . LYS A 1 703 ? 44.235 24.689 -1.850  1.00 100.00 ? 703  LYS A CD    1 
ATOM   5464 C  CE    . LYS A 1 703 ? 44.834 26.056 -1.463  1.00 100.00 ? 703  LYS A CE    1 
ATOM   5465 N  NZ    . LYS A 1 703 ? 45.243 26.914 -2.613  1.00 100.00 ? 703  LYS A NZ    1 
ATOM   5466 N  N     . ARG A 1 704 ? 42.033 21.746 1.271   1.00 46.34  ? 704  ARG A N     1 
ATOM   5467 C  CA    . ARG A 1 704 ? 42.727 21.485 2.512   1.00 100.00 ? 704  ARG A CA    1 
ATOM   5468 C  C     . ARG A 1 704 ? 42.652 20.057 2.972   1.00 67.31  ? 704  ARG A C     1 
ATOM   5469 O  O     . ARG A 1 704 ? 43.563 19.597 3.621   1.00 53.77  ? 704  ARG A O     1 
ATOM   5470 C  CB    . ARG A 1 704 ? 42.145 22.285 3.667   1.00 59.40  ? 704  ARG A CB    1 
ATOM   5471 C  CG    . ARG A 1 704 ? 42.919 22.068 4.968   1.00 56.52  ? 704  ARG A CG    1 
ATOM   5472 C  CD    . ARG A 1 704 ? 43.073 23.298 5.893   1.00 58.30  ? 704  ARG A CD    1 
ATOM   5473 N  NE    . ARG A 1 704 ? 43.720 22.951 7.173   1.00 43.40  ? 704  ARG A NE    1 
ATOM   5474 C  CZ    . ARG A 1 704 ? 45.015 23.140 7.434   1.00 59.21  ? 704  ARG A CZ    1 
ATOM   5475 N  NH1   . ARG A 1 704 ? 45.868 23.765 6.579   1.00 46.17  ? 704  ARG A NH1   1 
ATOM   5476 N  NH2   . ARG A 1 704 ? 45.449 22.715 8.594   1.00 43.21  ? 704  ARG A NH2   1 
ATOM   5477 N  N     . TYR A 1 705 ? 41.551 19.391 2.668   1.00 38.82  ? 705  TYR A N     1 
ATOM   5478 C  CA    . TYR A 1 705 ? 41.373 18.059 3.213   1.00 55.99  ? 705  TYR A CA    1 
ATOM   5479 C  C     . TYR A 1 705 ? 41.476 16.879 2.283   1.00 54.02  ? 705  TYR A C     1 
ATOM   5480 O  O     . TYR A 1 705 ? 41.233 15.743 2.708   1.00 59.25  ? 705  TYR A O     1 
ATOM   5481 C  CB    . TYR A 1 705 ? 39.968 18.065 3.752   1.00 43.36  ? 705  TYR A CB    1 
ATOM   5482 C  CG    . TYR A 1 705 ? 39.881 19.100 4.833   1.00 100.00 ? 705  TYR A CG    1 
ATOM   5483 C  CD1   . TYR A 1 705 ? 40.631 18.918 6.005   1.00 49.23  ? 705  TYR A CD1   1 
ATOM   5484 C  CD2   . TYR A 1 705 ? 39.098 20.245 4.637   1.00 49.44  ? 705  TYR A CD2   1 
ATOM   5485 C  CE1   . TYR A 1 705 ? 40.513 19.840 7.051   1.00 39.96  ? 705  TYR A CE1   1 
ATOM   5486 C  CE2   . TYR A 1 705 ? 38.946 21.149 5.690   1.00 94.59  ? 705  TYR A CE2   1 
ATOM   5487 C  CZ    . TYR A 1 705 ? 39.666 20.937 6.877   1.00 100.00 ? 705  TYR A CZ    1 
ATOM   5488 O  OH    . TYR A 1 705 ? 39.602 21.845 7.913   1.00 63.31  ? 705  TYR A OH    1 
ATOM   5489 N  N     . TYR A 1 706 ? 41.804 17.139 1.034   1.00 83.44  ? 706  TYR A N     1 
ATOM   5490 C  CA    . TYR A 1 706 ? 41.917 16.086 0.051   1.00 89.98  ? 706  TYR A CA    1 
ATOM   5491 C  C     . TYR A 1 706 ? 42.707 14.863 0.532   1.00 41.57  ? 706  TYR A C     1 
ATOM   5492 O  O     . TYR A 1 706 ? 42.276 13.718 0.376   1.00 95.90  ? 706  TYR A O     1 
ATOM   5493 C  CB    . TYR A 1 706 ? 42.422 16.677 -1.278  1.00 49.17  ? 706  TYR A CB    1 
ATOM   5494 C  CG    . TYR A 1 706 ? 43.915 16.973 -1.263  1.00 44.97  ? 706  TYR A CG    1 
ATOM   5495 C  CD1   . TYR A 1 706 ? 44.427 18.084 -0.598  1.00 29.50  ? 706  TYR A CD1   1 
ATOM   5496 C  CD2   . TYR A 1 706 ? 44.795 16.173 -1.997  1.00 53.61  ? 706  TYR A CD2   1 
ATOM   5497 C  CE1   . TYR A 1 706 ? 45.796 18.346 -0.574  1.00 47.47  ? 706  TYR A CE1   1 
ATOM   5498 C  CE2   . TYR A 1 706 ? 46.166 16.425 -2.006  1.00 100.00 ? 706  TYR A CE2   1 
ATOM   5499 C  CZ    . TYR A 1 706 ? 46.655 17.539 -1.326  1.00 39.44  ? 706  TYR A CZ    1 
ATOM   5500 O  OH    . TYR A 1 706 ? 48.006 17.782 -1.337  1.00 71.08  ? 706  TYR A OH    1 
ATOM   5501 N  N     . ASP A 1 707 ? 43.879 15.122 1.108   1.00 100.00 ? 707  ASP A N     1 
ATOM   5502 C  CA    . ASP A 1 707 ? 44.795 14.105 1.597   1.00 53.62  ? 707  ASP A CA    1 
ATOM   5503 C  C     . ASP A 1 707 ? 44.219 13.231 2.713   1.00 65.35  ? 707  ASP A C     1 
ATOM   5504 O  O     . ASP A 1 707 ? 44.873 12.282 3.159   1.00 50.91  ? 707  ASP A O     1 
ATOM   5505 C  CB    . ASP A 1 707 ? 45.972 14.893 2.163   1.00 74.33  ? 707  ASP A CB    1 
ATOM   5506 C  CG    . ASP A 1 707 ? 45.342 16.055 2.891   1.00 100.00 ? 707  ASP A CG    1 
ATOM   5507 O  OD1   . ASP A 1 707 ? 44.894 17.029 2.310   1.00 100.00 ? 707  ASP A OD1   1 
ATOM   5508 O  OD2   . ASP A 1 707 ? 45.236 15.825 4.200   1.00 100.00 ? 707  ASP A OD2   1 
ATOM   5509 N  N     . LEU A 1 708 ? 43.016 13.559 3.231   1.00 39.11  ? 708  LEU A N     1 
ATOM   5510 C  CA    . LEU A 1 708 ? 42.401 12.769 4.305   1.00 63.47  ? 708  LEU A CA    1 
ATOM   5511 C  C     . LEU A 1 708 ? 41.597 11.592 3.771   1.00 65.98  ? 708  LEU A C     1 
ATOM   5512 O  O     . LEU A 1 708 ? 41.006 10.803 4.482   1.00 52.60  ? 708  LEU A O     1 
ATOM   5513 C  CB    . LEU A 1 708 ? 41.427 13.534 5.226   1.00 83.69  ? 708  LEU A CB    1 
ATOM   5514 C  CG    . LEU A 1 708 ? 41.911 14.786 5.983   1.00 84.66  ? 708  LEU A CG    1 
ATOM   5515 C  CD1   . LEU A 1 708 ? 40.839 15.230 6.959   1.00 44.91  ? 708  LEU A CD1   1 
ATOM   5516 C  CD2   . LEU A 1 708 ? 43.240 14.592 6.714   1.00 36.43  ? 708  LEU A CD2   1 
ATOM   5517 N  N     . ALA A 1 709 ? 41.525 11.501 2.472   1.00 100.00 ? 709  ALA A N     1 
ATOM   5518 C  CA    . ALA A 1 709 ? 40.769 10.428 1.887   1.00 58.42  ? 709  ALA A CA    1 
ATOM   5519 C  C     . ALA A 1 709 ? 41.523 9.821  0.730   1.00 74.58  ? 709  ALA A C     1 
ATOM   5520 O  O     . ALA A 1 709 ? 41.887 10.521 -0.212  1.00 82.12  ? 709  ALA A O     1 
ATOM   5521 C  CB    . ALA A 1 709 ? 39.431 10.967 1.429   1.00 31.92  ? 709  ALA A CB    1 
ATOM   5522 N  N     . PRO A 1 710 ? 41.791 8.523  0.844   1.00 100.00 ? 710  PRO A N     1 
ATOM   5523 C  CA    . PRO A 1 710 ? 42.483 7.798  -0.196  1.00 100.00 ? 710  PRO A CA    1 
ATOM   5524 C  C     . PRO A 1 710 ? 41.576 7.830  -1.407  1.00 100.00 ? 710  PRO A C     1 
ATOM   5525 O  O     . PRO A 1 710 ? 40.714 6.957  -1.562  1.00 100.00 ? 710  PRO A O     1 
ATOM   5526 C  CB    . PRO A 1 710 ? 42.481 6.339  0.284   1.00 100.00 ? 710  PRO A CB    1 
ATOM   5527 C  CG    . PRO A 1 710 ? 41.255 6.200  1.180   1.00 100.00 ? 710  PRO A CG    1 
ATOM   5528 C  CD    . PRO A 1 710 ? 40.845 7.620  1.547   1.00 100.00 ? 710  PRO A CD    1 
ATOM   5529 N  N     . ASN A 1 711 ? 41.738 8.861  -2.239  1.00 100.00 ? 711  ASN A N     1 
ATOM   5530 C  CA    . ASN A 1 711 ? 40.846 8.991  -3.376  1.00 54.92  ? 711  ASN A CA    1 
ATOM   5531 C  C     . ASN A 1 711 ? 41.080 10.296 -4.174  1.00 100.00 ? 711  ASN A C     1 
ATOM   5532 O  O     . ASN A 1 711 ? 41.257 10.268 -5.370  1.00 100.00 ? 711  ASN A O     1 
ATOM   5533 C  CB    . ASN A 1 711 ? 39.388 9.095  -2.790  1.00 100.00 ? 711  ASN A CB    1 
ATOM   5534 C  CG    . ASN A 1 711 ? 38.415 7.896  -2.752  1.00 100.00 ? 711  ASN A CG    1 
ATOM   5535 O  OD1   . ASN A 1 711 ? 37.941 7.393  -3.816  1.00 100.00 ? 711  ASN A OD1   1 
ATOM   5536 N  ND2   . ASN A 1 711 ? 38.056 7.475  -1.507  1.00 99.92  ? 711  ASN A ND2   1 
ATOM   5537 N  N     . VAL A 1 712 ? 40.813 11.429 -3.449  1.00 100.00 ? 712  VAL A N     1 
ATOM   5538 C  CA    . VAL A 1 712 ? 40.807 12.817 -3.927  1.00 59.90  ? 712  VAL A CA    1 
ATOM   5539 C  C     . VAL A 1 712 ? 42.127 13.564 -4.035  1.00 100.00 ? 712  VAL A C     1 
ATOM   5540 O  O     . VAL A 1 712 ? 43.016 13.400 -3.190  1.00 97.26  ? 712  VAL A O     1 
ATOM   5541 C  CB    . VAL A 1 712 ? 39.922 13.683 -3.015  1.00 47.05  ? 712  VAL A CB    1 
ATOM   5542 C  CG1   . VAL A 1 712 ? 40.167 15.179 -3.261  1.00 100.00 ? 712  VAL A CG1   1 
ATOM   5543 C  CG2   . VAL A 1 712 ? 38.434 13.349 -3.188  1.00 100.00 ? 712  VAL A CG2   1 
ATOM   5544 N  N     . PRO A 1 713 ? 42.197 14.416 -5.076  1.00 61.92  ? 713  PRO A N     1 
ATOM   5545 C  CA    . PRO A 1 713 ? 43.324 15.289 -5.366  1.00 65.76  ? 713  PRO A CA    1 
ATOM   5546 C  C     . PRO A 1 713 ? 42.915 16.732 -5.123  1.00 95.12  ? 713  PRO A C     1 
ATOM   5547 O  O     . PRO A 1 713 ? 41.767 17.126 -5.437  1.00 43.27  ? 713  PRO A O     1 
ATOM   5548 C  CB    . PRO A 1 713 ? 43.934 15.130 -6.753  1.00 100.00 ? 713  PRO A CB    1 
ATOM   5549 N  N     . ARG A 1 714 ? 43.877 17.479 -4.554  1.00 99.53  ? 714  ARG A N     1 
ATOM   5550 C  CA    . ARG A 1 714 ? 43.731 18.884 -4.168  1.00 63.80  ? 714  ARG A CA    1 
ATOM   5551 C  C     . ARG A 1 714 ? 42.749 19.665 -5.017  1.00 100.00 ? 714  ARG A C     1 
ATOM   5552 O  O     . ARG A 1 714 ? 41.688 20.033 -4.526  1.00 59.29  ? 714  ARG A O     1 
ATOM   5553 C  CB    . ARG A 1 714 ? 45.020 19.653 -3.874  1.00 87.98  ? 714  ARG A CB    1 
ATOM   5554 N  N     . ASP A 1 715 ? 43.124 19.912 -6.281  1.00 100.00 ? 715  ASP A N     1 
ATOM   5555 C  CA    . ASP A 1 715 ? 42.264 20.622 -7.216  1.00 100.00 ? 715  ASP A CA    1 
ATOM   5556 C  C     . ASP A 1 715 ? 41.521 19.653 -8.123  1.00 67.73  ? 715  ASP A C     1 
ATOM   5557 O  O     . ASP A 1 715 ? 42.091 19.139 -9.074  1.00 100.00 ? 715  ASP A O     1 
ATOM   5558 C  CB    . ASP A 1 715 ? 42.888 21.774 -8.003  1.00 42.00  ? 715  ASP A CB    1 
ATOM   5559 N  N     . ALA A 1 716 ? 40.253 19.401 -7.776  1.00 100.00 ? 716  ALA A N     1 
ATOM   5560 C  CA    . ALA A 1 716 ? 39.341 18.529 -8.499  1.00 100.00 ? 716  ALA A CA    1 
ATOM   5561 C  C     . ALA A 1 716 ? 38.204 19.363 -9.081  1.00 72.93  ? 716  ALA A C     1 
ATOM   5562 O  O     . ALA A 1 716 ? 37.855 20.424 -8.553  1.00 88.78  ? 716  ALA A O     1 
ATOM   5563 C  CB    . ALA A 1 716 ? 38.804 17.404 -7.573  1.00 42.87  ? 716  ALA A CB    1 
ATOM   5564 N  N     . GLU A 1 717 ? 37.628 18.919 -10.193 1.00 100.00 ? 717  GLU A N     1 
ATOM   5565 C  CA    . GLU A 1 717 ? 36.545 19.688 -10.794 1.00 100.00 ? 717  GLU A CA    1 
ATOM   5566 C  C     . GLU A 1 717 ? 35.248 19.476 -10.034 1.00 38.76  ? 717  GLU A C     1 
ATOM   5567 O  O     . GLU A 1 717 ? 34.507 20.408 -9.718  1.00 76.86  ? 717  GLU A O     1 
ATOM   5568 C  CB    . GLU A 1 717 ? 36.349 19.467 -12.318 1.00 100.00 ? 717  GLU A CB    1 
ATOM   5569 C  CG    . GLU A 1 717 ? 37.308 18.435 -12.970 1.00 100.00 ? 717  GLU A CG    1 
ATOM   5570 C  CD    . GLU A 1 717 ? 36.657 17.598 -14.061 1.00 100.00 ? 717  GLU A CD    1 
ATOM   5571 O  OE1   . GLU A 1 717 ? 35.657 18.239 -14.654 1.00 100.00 ? 717  GLU A OE1   1 
ATOM   5572 O  OE2   . GLU A 1 717 ? 37.036 16.434 -14.311 1.00 100.00 ? 717  GLU A OE2   1 
ATOM   5573 N  N     . ASP A 1 718 ? 34.994 18.209 -9.765  1.00 63.86  ? 718  ASP A N     1 
ATOM   5574 C  CA    . ASP A 1 718 ? 33.812 17.878 -9.036  1.00 57.90  ? 718  ASP A CA    1 
ATOM   5575 C  C     . ASP A 1 718 ? 34.097 18.037 -7.577  1.00 84.61  ? 718  ASP A C     1 
ATOM   5576 O  O     . ASP A 1 718 ? 34.325 17.039 -6.891  1.00 42.74  ? 718  ASP A O     1 
ATOM   5577 C  CB    . ASP A 1 718 ? 33.402 16.451 -9.255  1.00 95.84  ? 718  ASP A CB    1 
ATOM   5578 C  CG    . ASP A 1 718 ? 31.959 16.561 -8.925  1.00 100.00 ? 718  ASP A CG    1 
ATOM   5579 O  OD1   . ASP A 1 718 ? 31.537 17.398 -8.038  1.00 50.35  ? 718  ASP A OD1   1 
ATOM   5580 O  OD2   . ASP A 1 718 ? 31.237 15.767 -9.733  1.00 100.00 ? 718  ASP A OD2   1 
ATOM   5581 N  N     . SER A 1 719 ? 34.103 19.289 -7.147  1.00 46.66  ? 719  SER A N     1 
ATOM   5582 C  CA    . SER A 1 719 ? 34.439 19.612 -5.779  1.00 50.88  ? 719  SER A CA    1 
ATOM   5583 C  C     . SER A 1 719 ? 33.424 19.119 -4.775  1.00 65.84  ? 719  SER A C     1 
ATOM   5584 O  O     . SER A 1 719 ? 33.767 18.689 -3.671  1.00 44.51  ? 719  SER A O     1 
ATOM   5585 C  CB    . SER A 1 719 ? 34.807 21.052 -5.617  1.00 74.90  ? 719  SER A CB    1 
ATOM   5586 O  OG    . SER A 1 719 ? 35.969 21.268 -6.372  1.00 68.56  ? 719  SER A OG    1 
ATOM   5587 N  N     . GLN A 1 720 ? 32.165 19.107 -5.165  1.00 42.26  ? 720  GLN A N     1 
ATOM   5588 C  CA    . GLN A 1 720 ? 31.117 18.662 -4.285  1.00 36.31  ? 720  GLN A CA    1 
ATOM   5589 C  C     . GLN A 1 720 ? 31.233 17.160 -4.088  1.00 100.00 ? 720  GLN A C     1 
ATOM   5590 O  O     . GLN A 1 720 ? 31.068 16.625 -2.983  1.00 42.47  ? 720  GLN A O     1 
ATOM   5591 C  CB    . GLN A 1 720 ? 29.727 19.144 -4.842  1.00 35.81  ? 720  GLN A CB    1 
ATOM   5592 C  CG    . GLN A 1 720 ? 28.416 18.752 -4.051  1.00 46.06  ? 720  GLN A CG    1 
ATOM   5593 C  CD    . GLN A 1 720 ? 27.229 19.662 -4.461  1.00 44.95  ? 720  GLN A CD    1 
ATOM   5594 O  OE1   . GLN A 1 720 ? 26.029 19.427 -4.146  1.00 69.36  ? 720  GLN A OE1   1 
ATOM   5595 N  NE2   . GLN A 1 720 ? 27.546 20.743 -5.188  1.00 74.64  ? 720  GLN A NE2   1 
ATOM   5596 N  N     . LYS A 1 721 ? 31.533 16.488 -5.202  1.00 60.54  ? 721  LYS A N     1 
ATOM   5597 C  CA    . LYS A 1 721 ? 31.741 15.049 -5.224  1.00 73.04  ? 721  LYS A CA    1 
ATOM   5598 C  C     . LYS A 1 721 ? 32.935 14.743 -4.346  1.00 58.17  ? 721  LYS A C     1 
ATOM   5599 O  O     . LYS A 1 721 ? 32.905 13.895 -3.447  1.00 51.54  ? 721  LYS A O     1 
ATOM   5600 C  CB    . LYS A 1 721 ? 32.101 14.582 -6.644  1.00 63.00  ? 721  LYS A CB    1 
ATOM   5601 C  CG    . LYS A 1 721 ? 31.898 13.086 -6.932  1.00 52.87  ? 721  LYS A CG    1 
ATOM   5602 C  CD    . LYS A 1 721 ? 31.810 12.733 -8.420  1.00 98.17  ? 721  LYS A CD    1 
ATOM   5603 C  CE    . LYS A 1 721 ? 33.005 11.953 -8.949  1.00 88.87  ? 721  LYS A CE    1 
ATOM   5604 N  NZ    . LYS A 1 721 ? 33.025 11.832 -10.427 1.00 100.00 ? 721  LYS A NZ    1 
ATOM   5605 N  N     . ALA A 1 722 ? 34.011 15.469 -4.649  1.00 37.97  ? 722  ALA A N     1 
ATOM   5606 C  CA    . ALA A 1 722 ? 35.240 15.375 -3.915  1.00 40.34  ? 722  ALA A CA    1 
ATOM   5607 C  C     . ALA A 1 722 ? 34.985 15.538 -2.405  1.00 93.89  ? 722  ALA A C     1 
ATOM   5608 O  O     . ALA A 1 722 ? 35.519 14.808 -1.587  1.00 46.15  ? 722  ALA A O     1 
ATOM   5609 C  CB    . ALA A 1 722 ? 36.118 16.487 -4.444  1.00 88.59  ? 722  ALA A CB    1 
ATOM   5610 N  N     . THR A 1 723 ? 34.131 16.489 -2.019  1.00 78.38  ? 723  THR A N     1 
ATOM   5611 C  CA    . THR A 1 723 ? 33.810 16.726 -0.615  1.00 44.60  ? 723  THR A CA    1 
ATOM   5612 C  C     . THR A 1 723 ? 33.198 15.498 0.057   1.00 84.60  ? 723  THR A C     1 
ATOM   5613 O  O     . THR A 1 723 ? 33.666 15.010 1.087   1.00 52.04  ? 723  THR A O     1 
ATOM   5614 C  CB    . THR A 1 723 ? 32.961 18.007 -0.509  1.00 53.49  ? 723  THR A CB    1 
ATOM   5615 O  OG1   . THR A 1 723 ? 33.883 19.084 -0.528  1.00 55.63  ? 723  THR A OG1   1 
ATOM   5616 C  CG2   . THR A 1 723 ? 32.061 18.059 0.736   1.00 31.39  ? 723  THR A CG2   1 
ATOM   5617 N  N     . ASP A 1 724 ? 32.146 14.984 -0.558  1.00 64.69  ? 724  ASP A N     1 
ATOM   5618 C  CA    . ASP A 1 724 ? 31.432 13.781 -0.131  1.00 45.53  ? 724  ASP A CA    1 
ATOM   5619 C  C     . ASP A 1 724 ? 32.348 12.580 0.019   1.00 49.69  ? 724  ASP A C     1 
ATOM   5620 O  O     . ASP A 1 724 ? 32.050 11.667 0.787   1.00 53.15  ? 724  ASP A O     1 
ATOM   5621 C  CB    . ASP A 1 724 ? 30.514 13.341 -1.301  1.00 62.78  ? 724  ASP A CB    1 
ATOM   5622 C  CG    . ASP A 1 724 ? 29.399 12.405 -0.916  1.00 49.41  ? 724  ASP A CG    1 
ATOM   5623 O  OD1   . ASP A 1 724 ? 29.245 12.208 0.394   1.00 70.72  ? 724  ASP A OD1   1 
ATOM   5624 O  OD2   . ASP A 1 724 ? 28.656 11.915 -1.772  1.00 100.00 ? 724  ASP A OD2   1 
ATOM   5625 N  N     . ALA A 1 725 ? 33.425 12.576 -0.780  1.00 79.13  ? 725  ALA A N     1 
ATOM   5626 C  CA    . ALA A 1 725 ? 34.442 11.525 -0.786  1.00 94.50  ? 725  ALA A CA    1 
ATOM   5627 C  C     . ALA A 1 725 ? 35.202 11.492 0.524   1.00 60.24  ? 725  ALA A C     1 
ATOM   5628 O  O     . ALA A 1 725 ? 35.318 10.443 1.169   1.00 55.81  ? 725  ALA A O     1 
ATOM   5629 C  CB    . ALA A 1 725 ? 35.477 11.718 -1.874  1.00 100.00 ? 725  ALA A CB    1 
ATOM   5630 N  N     . VAL A 1 726 ? 35.706 12.668 0.917   1.00 44.95  ? 726  VAL A N     1 
ATOM   5631 C  CA    . VAL A 1 726 ? 36.417 12.803 2.171   1.00 43.06  ? 726  VAL A CA    1 
ATOM   5632 C  C     . VAL A 1 726 ? 35.479 12.429 3.327   1.00 45.46  ? 726  VAL A C     1 
ATOM   5633 O  O     . VAL A 1 726 ? 35.783 11.567 4.169   1.00 41.49  ? 726  VAL A O     1 
ATOM   5634 C  CB    . VAL A 1 726 ? 36.965 14.239 2.321   1.00 53.27  ? 726  VAL A CB    1 
ATOM   5635 C  CG1   . VAL A 1 726 ? 37.659 14.341 3.656   1.00 45.59  ? 726  VAL A CG1   1 
ATOM   5636 C  CG2   . VAL A 1 726 ? 37.937 14.754 1.211   1.00 50.60  ? 726  VAL A CG2   1 
ATOM   5637 N  N     . LEU A 1 727 ? 34.306 13.095 3.322   1.00 39.06  ? 727  LEU A N     1 
ATOM   5638 C  CA    . LEU A 1 727 ? 33.276 12.916 4.346   1.00 45.57  ? 727  LEU A CA    1 
ATOM   5639 C  C     . LEU A 1 727 ? 32.971 11.453 4.492   1.00 50.11  ? 727  LEU A C     1 
ATOM   5640 O  O     . LEU A 1 727 ? 33.102 10.857 5.551   1.00 51.32  ? 727  LEU A O     1 
ATOM   5641 C  CB    . LEU A 1 727 ? 31.974 13.681 4.029   1.00 56.25  ? 727  LEU A CB    1 
ATOM   5642 C  CG    . LEU A 1 727 ? 31.937 15.047 4.697   1.00 50.96  ? 727  LEU A CG    1 
ATOM   5643 C  CD1   . LEU A 1 727 ? 33.298 15.685 4.547   1.00 65.72  ? 727  LEU A CD1   1 
ATOM   5644 C  CD2   . LEU A 1 727 ? 30.932 15.933 3.963   1.00 35.75  ? 727  LEU A CD2   1 
ATOM   5645 N  N     . LYS A 1 728 ? 32.594 10.883 3.364   1.00 53.14  ? 728  LYS A N     1 
ATOM   5646 C  CA    . LYS A 1 728 ? 32.342 9.476  3.282   1.00 100.00 ? 728  LYS A CA    1 
ATOM   5647 C  C     . LYS A 1 728 ? 33.533 8.702  3.846   1.00 100.00 ? 728  LYS A C     1 
ATOM   5648 O  O     . LYS A 1 728 ? 33.365 7.861  4.737   1.00 72.29  ? 728  LYS A O     1 
ATOM   5649 C  CB    . LYS A 1 728 ? 32.100 9.137  1.824   1.00 100.00 ? 728  LYS A CB    1 
ATOM   5650 C  CG    . LYS A 1 728 ? 30.749 8.470  1.566   1.00 100.00 ? 728  LYS A CG    1 
ATOM   5651 C  CD    . LYS A 1 728 ? 29.810 9.268  0.677   1.00 100.00 ? 728  LYS A CD    1 
ATOM   5652 C  CE    . LYS A 1 728 ? 28.341 8.868  0.873   1.00 100.00 ? 728  LYS A CE    1 
ATOM   5653 N  NZ    . LYS A 1 728 ? 27.926 8.637  2.285   1.00 100.00 ? 728  LYS A NZ    1 
ATOM   5654 N  N     . HIS A 1 729 ? 34.734 8.995  3.330   1.00 49.08  ? 729  HIS A N     1 
ATOM   5655 C  CA    . HIS A 1 729 ? 35.922 8.330  3.799   1.00 29.29  ? 729  HIS A CA    1 
ATOM   5656 C  C     . HIS A 1 729 ? 35.969 8.335  5.333   1.00 100.00 ? 729  HIS A C     1 
ATOM   5657 O  O     . HIS A 1 729 ? 36.015 7.303  6.031   1.00 52.69  ? 729  HIS A O     1 
ATOM   5658 C  CB    . HIS A 1 729 ? 37.150 9.023  3.227   1.00 34.42  ? 729  HIS A CB    1 
ATOM   5659 C  CG    . HIS A 1 729 ? 38.213 8.216  3.792   1.00 87.95  ? 729  HIS A CG    1 
ATOM   5660 N  ND1   . HIS A 1 729 ? 38.506 7.005  3.197   1.00 83.75  ? 729  HIS A ND1   1 
ATOM   5661 C  CD2   . HIS A 1 729 ? 38.854 8.316  4.997   1.00 100.00 ? 729  HIS A CD2   1 
ATOM   5662 C  CE1   . HIS A 1 729 ? 39.396 6.422  4.013   1.00 100.00 ? 729  HIS A CE1   1 
ATOM   5663 N  NE2   . HIS A 1 729 ? 39.612 7.171  5.115   1.00 94.80  ? 729  HIS A NE2   1 
ATOM   5664 N  N     . LEU A 1 730 ? 35.914 9.562  5.827   1.00 59.05  ? 730  LEU A N     1 
ATOM   5665 C  CA    . LEU A 1 730 ? 35.940 9.852  7.235   1.00 54.30  ? 730  LEU A CA    1 
ATOM   5666 C  C     . LEU A 1 730 ? 34.791 9.191  7.954   1.00 61.47  ? 730  LEU A C     1 
ATOM   5667 O  O     . LEU A 1 730 ? 34.852 8.971  9.156   1.00 59.80  ? 730  LEU A O     1 
ATOM   5668 C  CB    . LEU A 1 730 ? 35.753 11.358 7.343   1.00 42.44  ? 730  LEU A CB    1 
ATOM   5669 C  CG    . LEU A 1 730 ? 36.959 12.038 6.697   1.00 100.00 ? 730  LEU A CG    1 
ATOM   5670 C  CD1   . LEU A 1 730 ? 36.836 13.556 6.944   1.00 100.00 ? 730  LEU A CD1   1 
ATOM   5671 C  CD2   . LEU A 1 730 ? 38.257 11.484 7.364   1.00 54.84  ? 730  LEU A CD2   1 
ATOM   5672 N  N     . ASN A 1 731 ? 33.724 8.925  7.194   1.00 65.17  ? 731  ASN A N     1 
ATOM   5673 C  CA    . ASN A 1 731 ? 32.511 8.334  7.726   1.00 100.00 ? 731  ASN A CA    1 
ATOM   5674 C  C     . ASN A 1 731 ? 31.896 9.305  8.732   1.00 100.00 ? 731  ASN A C     1 
ATOM   5675 O  O     . ASN A 1 731 ? 31.664 9.004  9.895   1.00 48.02  ? 731  ASN A O     1 
ATOM   5676 C  CB    . ASN A 1 731 ? 32.683 6.843  8.196   1.00 100.00 ? 731  ASN A CB    1 
ATOM   5677 C  CG    . ASN A 1 731 ? 31.438 6.025  8.658   1.00 100.00 ? 731  ASN A CG    1 
ATOM   5678 O  OD1   . ASN A 1 731 ? 31.451 5.475  9.787   1.00 98.16  ? 731  ASN A OD1   1 
ATOM   5679 N  ND2   . ASN A 1 731 ? 30.370 5.868  7.817   1.00 79.20  ? 731  ASN A ND2   1 
ATOM   5680 N  N     . ILE A 1 732 ? 31.668 10.521 8.285   1.00 60.18  ? 732  ILE A N     1 
ATOM   5681 C  CA    . ILE A 1 732 ? 31.114 11.537 9.161   1.00 93.38  ? 732  ILE A CA    1 
ATOM   5682 C  C     . ILE A 1 732 ? 29.611 11.359 9.297   1.00 100.00 ? 732  ILE A C     1 
ATOM   5683 O  O     . ILE A 1 732 ? 28.983 10.855 8.383   1.00 59.16  ? 732  ILE A O     1 
ATOM   5684 C  CB    . ILE A 1 732 ? 31.487 12.910 8.588   1.00 61.62  ? 732  ILE A CB    1 
ATOM   5685 C  CG1   . ILE A 1 732 ? 33.020 13.134 8.481   1.00 44.62  ? 732  ILE A CG1   1 
ATOM   5686 C  CG2   . ILE A 1 732 ? 30.767 14.064 9.251   1.00 29.69  ? 732  ILE A CG2   1 
ATOM   5687 C  CD1   . ILE A 1 732 ? 33.853 12.825 9.722   1.00 42.99  ? 732  ILE A CD1   1 
ATOM   5688 N  N     . ASP A 1 733 ? 29.056 11.755 10.446  1.00 53.73  ? 733  ASP A N     1 
ATOM   5689 C  CA    . ASP A 1 733 ? 27.623 11.667 10.660  1.00 51.13  ? 733  ASP A CA    1 
ATOM   5690 C  C     . ASP A 1 733 ? 26.871 12.634 9.743   1.00 41.94  ? 733  ASP A C     1 
ATOM   5691 O  O     . ASP A 1 733 ? 27.003 13.864 9.830   1.00 59.48  ? 733  ASP A O     1 
ATOM   5692 C  CB    . ASP A 1 733 ? 27.166 11.750 12.158  1.00 34.50  ? 733  ASP A CB    1 
ATOM   5693 C  CG    . ASP A 1 733 ? 25.671 11.947 12.438  1.00 60.21  ? 733  ASP A CG    1 
ATOM   5694 O  OD1   . ASP A 1 733 ? 24.860 11.659 11.440  1.00 48.02  ? 733  ASP A OD1   1 
ATOM   5695 O  OD2   . ASP A 1 733 ? 25.234 12.364 13.522  1.00 100.00 ? 733  ASP A OD2   1 
ATOM   5696 N  N     . PRO A 1 734 ? 26.083 12.036 8.847   1.00 57.92  ? 734  PRO A N     1 
ATOM   5697 C  CA    . PRO A 1 734 ? 25.254 12.767 7.923   1.00 72.78  ? 734  PRO A CA    1 
ATOM   5698 C  C     . PRO A 1 734 ? 24.529 13.921 8.536   1.00 70.22  ? 734  PRO A C     1 
ATOM   5699 O  O     . PRO A 1 734 ? 24.593 14.997 8.001   1.00 49.94  ? 734  PRO A O     1 
ATOM   5700 C  CB    . PRO A 1 734 ? 24.170 11.823 7.415   1.00 100.00 ? 734  PRO A CB    1 
ATOM   5701 C  CG    . PRO A 1 734 ? 24.172 10.652 8.371   1.00 100.00 ? 734  PRO A CG    1 
ATOM   5702 C  CD    . PRO A 1 734 ? 25.548 10.663 9.021   1.00 100.00 ? 734  PRO A CD    1 
ATOM   5703 N  N     . GLU A 1 735 ? 23.726 13.750 9.635   1.00 41.47  ? 735  GLU A N     1 
ATOM   5704 C  CA    . GLU A 1 735 ? 23.056 14.927 10.102  1.00 61.38  ? 735  GLU A CA    1 
ATOM   5705 C  C     . GLU A 1 735 ? 23.958 16.020 10.607  1.00 40.49  ? 735  GLU A C     1 
ATOM   5706 O  O     . GLU A 1 735 ? 23.468 17.090 10.936  1.00 60.16  ? 735  GLU A O     1 
ATOM   5707 C  CB    . GLU A 1 735 ? 21.568 15.035 10.497  1.00 85.24  ? 735  GLU A CB    1 
ATOM   5708 C  CG    . GLU A 1 735 ? 21.138 13.661 11.067  1.00 100.00 ? 735  GLU A CG    1 
ATOM   5709 C  CD    . GLU A 1 735 ? 21.703 13.408 12.453  1.00 100.00 ? 735  GLU A CD    1 
ATOM   5710 O  OE1   . GLU A 1 735 ? 22.892 13.880 12.669  1.00 100.00 ? 735  GLU A OE1   1 
ATOM   5711 O  OE2   . GLU A 1 735 ? 21.033 12.702 13.316  1.00 100.00 ? 735  GLU A OE2   1 
ATOM   5712 N  N     . GLN A 1 736 ? 25.262 15.728 10.620  1.00 35.52  ? 736  GLN A N     1 
ATOM   5713 C  CA    . GLN A 1 736 ? 26.269 16.705 11.022  1.00 44.17  ? 736  GLN A CA    1 
ATOM   5714 C  C     . GLN A 1 736 ? 26.672 17.657 9.907   1.00 73.25  ? 736  GLN A C     1 
ATOM   5715 O  O     . GLN A 1 736 ? 27.376 18.655 10.104  1.00 38.54  ? 736  GLN A O     1 
ATOM   5716 C  CB    . GLN A 1 736 ? 27.613 16.103 11.417  1.00 34.43  ? 736  GLN A CB    1 
ATOM   5717 C  CG    . GLN A 1 736 ? 27.519 15.528 12.854  1.00 43.36  ? 736  GLN A CG    1 
ATOM   5718 C  CD    . GLN A 1 736 ? 26.677 16.392 13.791  1.00 100.00 ? 736  GLN A CD    1 
ATOM   5719 O  OE1   . GLN A 1 736 ? 25.441 16.115 13.974  1.00 100.00 ? 736  GLN A OE1   1 
ATOM   5720 N  NE2   . GLN A 1 736 ? 27.367 17.415 14.405  1.00 100.00 ? 736  GLN A NE2   1 
ATOM   5721 N  N     . PHE A 1 737 ? 26.254 17.349 8.702   1.00 31.95  ? 737  PHE A N     1 
ATOM   5722 C  CA    . PHE A 1 737 ? 26.648 18.189 7.599   1.00 96.81  ? 737  PHE A CA    1 
ATOM   5723 C  C     . PHE A 1 737 ? 25.541 18.387 6.587   1.00 100.00 ? 737  PHE A C     1 
ATOM   5724 O  O     . PHE A 1 737 ? 24.569 17.616 6.574   1.00 49.78  ? 737  PHE A O     1 
ATOM   5725 C  CB    . PHE A 1 737 ? 27.981 17.712 7.008   1.00 36.92  ? 737  PHE A CB    1 
ATOM   5726 C  CG    . PHE A 1 737 ? 27.941 16.328 6.389   1.00 100.00 ? 737  PHE A CG    1 
ATOM   5727 C  CD1   . PHE A 1 737 ? 27.308 16.083 5.167   1.00 97.46  ? 737  PHE A CD1   1 
ATOM   5728 C  CD2   . PHE A 1 737 ? 28.587 15.260 7.010   1.00 82.83  ? 737  PHE A CD2   1 
ATOM   5729 C  CE1   . PHE A 1 737 ? 27.289 14.813 4.585   1.00 85.93  ? 737  PHE A CE1   1 
ATOM   5730 C  CE2   . PHE A 1 737 ? 28.571 13.987 6.431   1.00 92.05  ? 737  PHE A CE2   1 
ATOM   5731 C  CZ    . PHE A 1 737 ? 27.910 13.738 5.226   1.00 36.24  ? 737  PHE A CZ    1 
ATOM   5732 N  N     . ARG A 1 738 ? 25.663 19.435 5.752   1.00 40.80  ? 738  ARG A N     1 
ATOM   5733 C  CA    . ARG A 1 738 ? 24.623 19.697 4.801   1.00 45.07  ? 738  ARG A CA    1 
ATOM   5734 C  C     . ARG A 1 738 ? 25.113 20.182 3.458   1.00 75.05  ? 738  ARG A C     1 
ATOM   5735 O  O     . ARG A 1 738 ? 25.688 21.259 3.388   1.00 54.46  ? 738  ARG A O     1 
ATOM   5736 C  CB    . ARG A 1 738 ? 23.433 20.471 5.368   1.00 43.59  ? 738  ARG A CB    1 
ATOM   5737 C  CG    . ARG A 1 738 ? 22.064 19.906 4.928   1.00 100.00 ? 738  ARG A CG    1 
ATOM   5738 C  CD    . ARG A 1 738 ? 21.211 19.131 5.961   1.00 100.00 ? 738  ARG A CD    1 
ATOM   5739 N  NE    . ARG A 1 738 ? 21.908 18.064 6.683   1.00 67.19  ? 738  ARG A NE    1 
ATOM   5740 C  CZ    . ARG A 1 738 ? 21.556 17.481 7.835   1.00 48.21  ? 738  ARG A CZ    1 
ATOM   5741 N  NH1   . ARG A 1 738 ? 20.451 17.720 8.539   1.00 55.78  ? 738  ARG A NH1   1 
ATOM   5742 N  NH2   . ARG A 1 738 ? 22.376 16.563 8.299   1.00 100.00 ? 738  ARG A NH2   1 
ATOM   5743 N  N     . PHE A 1 739 ? 24.862 19.364 2.425   1.00 33.65  ? 739  PHE A N     1 
ATOM   5744 C  CA    . PHE A 1 739 ? 25.182 19.666 1.038   1.00 49.14  ? 739  PHE A CA    1 
ATOM   5745 C  C     . PHE A 1 739 ? 24.396 20.901 0.529   1.00 100.00 ? 739  PHE A C     1 
ATOM   5746 O  O     . PHE A 1 739 ? 23.152 20.968 0.429   1.00 45.93  ? 739  PHE A O     1 
ATOM   5747 C  CB    . PHE A 1 739 ? 25.196 18.397 0.085   1.00 43.19  ? 739  PHE A CB    1 
ATOM   5748 C  CG    . PHE A 1 739 ? 26.464 17.548 0.148   1.00 56.42  ? 739  PHE A CG    1 
ATOM   5749 C  CD1   . PHE A 1 739 ? 27.642 18.052 -0.416  1.00 34.88  ? 739  PHE A CD1   1 
ATOM   5750 C  CD2   . PHE A 1 739 ? 26.511 16.298 0.773   1.00 78.35  ? 739  PHE A CD2   1 
ATOM   5751 C  CE1   . PHE A 1 739 ? 28.858 17.380 -0.330  1.00 54.79  ? 739  PHE A CE1   1 
ATOM   5752 C  CE2   . PHE A 1 739 ? 27.723 15.601 0.880   1.00 51.17  ? 739  PHE A CE2   1 
ATOM   5753 C  CZ    . PHE A 1 739 ? 28.882 16.150 0.320   1.00 100.00 ? 739  PHE A CZ    1 
ATOM   5754 N  N     . GLY A 1 740 ? 25.140 21.945 0.202   1.00 48.12  ? 740  GLY A N     1 
ATOM   5755 C  CA    . GLY A 1 740 ? 24.506 23.130 -0.319  1.00 42.47  ? 740  GLY A CA    1 
ATOM   5756 C  C     . GLY A 1 740 ? 24.891 23.220 -1.780  1.00 53.98  ? 740  GLY A C     1 
ATOM   5757 O  O     . GLY A 1 740 ? 25.872 22.614 -2.203  1.00 40.32  ? 740  GLY A O     1 
ATOM   5758 N  N     . ILE A 1 741 ? 24.118 23.957 -2.563  1.00 43.18  ? 741  ILE A N     1 
ATOM   5759 C  CA    . ILE A 1 741 ? 24.389 24.163 -3.970  1.00 73.37  ? 741  ILE A CA    1 
ATOM   5760 C  C     . ILE A 1 741 ? 25.859 24.489 -4.262  1.00 65.84  ? 741  ILE A C     1 
ATOM   5761 O  O     . ILE A 1 741 ? 26.421 24.115 -5.296  1.00 77.12  ? 741  ILE A O     1 
ATOM   5762 C  CB    . ILE A 1 741 ? 23.451 25.286 -4.438  1.00 47.26  ? 741  ILE A CB    1 
ATOM   5763 C  CG1   . ILE A 1 741 ? 22.038 24.789 -4.758  1.00 60.93  ? 741  ILE A CG1   1 
ATOM   5764 C  CG2   . ILE A 1 741 ? 24.045 26.201 -5.491  1.00 65.73  ? 741  ILE A CG2   1 
ATOM   5765 C  CD1   . ILE A 1 741 ? 20.964 25.875 -4.648  1.00 70.61  ? 741  ILE A CD1   1 
ATOM   5766 N  N     . THR A 1 742 ? 26.509 25.197 -3.349  1.00 72.77  ? 742  THR A N     1 
ATOM   5767 C  CA    . THR A 1 742 ? 27.890 25.574 -3.575  1.00 59.85  ? 742  THR A CA    1 
ATOM   5768 C  C     . THR A 1 742 ? 28.772 25.486 -2.350  1.00 53.35  ? 742  THR A C     1 
ATOM   5769 O  O     . THR A 1 742 ? 29.974 25.688 -2.491  1.00 41.69  ? 742  THR A O     1 
ATOM   5770 C  CB    . THR A 1 742 ? 27.974 27.022 -4.072  1.00 63.91  ? 742  THR A CB    1 
ATOM   5771 O  OG1   . THR A 1 742 ? 28.093 27.927 -2.986  1.00 53.36  ? 742  THR A OG1   1 
ATOM   5772 C  CG2   . THR A 1 742 ? 26.694 27.355 -4.804  1.00 46.66  ? 742  THR A CG2   1 
ATOM   5773 N  N     . LYS A 1 743 ? 28.180 25.260 -1.179  1.00 50.20  ? 743  LYS A N     1 
ATOM   5774 C  CA    . LYS A 1 743 ? 28.951 25.165 0.047   1.00 37.55  ? 743  LYS A CA    1 
ATOM   5775 C  C     . LYS A 1 743 ? 28.496 23.984 0.846   1.00 59.78  ? 743  LYS A C     1 
ATOM   5776 O  O     . LYS A 1 743 ? 27.368 23.480 0.728   1.00 31.72  ? 743  LYS A O     1 
ATOM   5777 C  CB    . LYS A 1 743 ? 28.729 26.256 1.081   1.00 42.93  ? 743  LYS A CB    1 
ATOM   5778 C  CG    . LYS A 1 743 ? 29.183 27.651 0.734   1.00 49.22  ? 743  LYS A CG    1 
ATOM   5779 C  CD    . LYS A 1 743 ? 28.520 28.652 1.651   1.00 100.00 ? 743  LYS A CD    1 
ATOM   5780 C  CE    . LYS A 1 743 ? 27.820 29.796 0.920   1.00 100.00 ? 743  LYS A CE    1 
ATOM   5781 N  NZ    . LYS A 1 743 ? 28.474 31.095 1.158   1.00 70.06  ? 743  LYS A NZ    1 
ATOM   5782 N  N     . ILE A 1 744 ? 29.416 23.578 1.686   1.00 52.99  ? 744  ILE A N     1 
ATOM   5783 C  CA    . ILE A 1 744 ? 29.157 22.506 2.618   1.00 87.14  ? 744  ILE A CA    1 
ATOM   5784 C  C     . ILE A 1 744 ? 28.869 23.173 3.938   1.00 37.42  ? 744  ILE A C     1 
ATOM   5785 O  O     . ILE A 1 744 ? 29.642 23.997 4.423   1.00 32.03  ? 744  ILE A O     1 
ATOM   5786 C  CB    . ILE A 1 744 ? 30.222 21.383 2.674   1.00 100.00 ? 744  ILE A CB    1 
ATOM   5787 C  CG1   . ILE A 1 744 ? 29.875 20.064 3.410   1.00 36.47  ? 744  ILE A CG1   1 
ATOM   5788 C  CG2   . ILE A 1 744 ? 31.644 21.896 2.980   1.00 54.59  ? 744  ILE A CG2   1 
ATOM   5789 C  CD1   . ILE A 1 744 ? 28.424 19.759 3.678   1.00 49.02  ? 744  ILE A CD1   1 
ATOM   5790 N  N     . PHE A 1 745 ? 27.689 22.893 4.444   1.00 52.05  ? 745  PHE A N     1 
ATOM   5791 C  CA    . PHE A 1 745 ? 27.277 23.443 5.699   1.00 38.79  ? 745  PHE A CA    1 
ATOM   5792 C  C     . PHE A 1 745 ? 27.615 22.435 6.777   1.00 100.00 ? 745  PHE A C     1 
ATOM   5793 O  O     . PHE A 1 745 ? 27.309 21.254 6.645   1.00 35.54  ? 745  PHE A O     1 
ATOM   5794 C  CB    . PHE A 1 745 ? 25.769 23.626 5.613   1.00 28.85  ? 745  PHE A CB    1 
ATOM   5795 C  CG    . PHE A 1 745 ? 25.441 24.961 5.090   1.00 28.66  ? 745  PHE A CG    1 
ATOM   5796 C  CD1   . PHE A 1 745 ? 25.903 25.368 3.836   1.00 52.74  ? 745  PHE A CD1   1 
ATOM   5797 C  CD2   . PHE A 1 745 ? 24.575 25.769 5.820   1.00 47.92  ? 745  PHE A CD2   1 
ATOM   5798 C  CE1   . PHE A 1 745 ? 25.518 26.605 3.326   1.00 67.65  ? 745  PHE A CE1   1 
ATOM   5799 C  CE2   . PHE A 1 745 ? 24.180 27.014 5.344   1.00 77.32  ? 745  PHE A CE2   1 
ATOM   5800 C  CZ    . PHE A 1 745 ? 24.646 27.397 4.090   1.00 35.81  ? 745  PHE A CZ    1 
ATOM   5801 N  N     . PHE A 1 746 ? 28.290 22.910 7.816   1.00 31.40  ? 746  PHE A N     1 
ATOM   5802 C  CA    . PHE A 1 746 ? 28.690 22.069 8.926   1.00 31.13  ? 746  PHE A CA    1 
ATOM   5803 C  C     . PHE A 1 746 ? 28.148 22.555 10.251  1.00 49.05  ? 746  PHE A C     1 
ATOM   5804 O  O     . PHE A 1 746 ? 28.208 23.736 10.564  1.00 60.72  ? 746  PHE A O     1 
ATOM   5805 C  CB    . PHE A 1 746 ? 30.187 22.072 9.139   1.00 35.96  ? 746  PHE A CB    1 
ATOM   5806 C  CG    . PHE A 1 746 ? 30.842 21.055 8.277   1.00 39.54  ? 746  PHE A CG    1 
ATOM   5807 C  CD1   . PHE A 1 746 ? 30.431 19.719 8.309   1.00 30.99  ? 746  PHE A CD1   1 
ATOM   5808 C  CD2   . PHE A 1 746 ? 31.861 21.435 7.402   1.00 33.66  ? 746  PHE A CD2   1 
ATOM   5809 C  CE1   . PHE A 1 746 ? 31.039 18.747 7.511   1.00 44.46  ? 746  PHE A CE1   1 
ATOM   5810 C  CE2   . PHE A 1 746 ? 32.454 20.484 6.574   1.00 46.42  ? 746  PHE A CE2   1 
ATOM   5811 C  CZ    . PHE A 1 746 ? 32.047 19.151 6.639   1.00 100.00 ? 746  PHE A CZ    1 
ATOM   5812 N  N     . ARG A 1 747 ? 27.640 21.609 11.029  1.00 44.38  ? 747  ARG A N     1 
ATOM   5813 C  CA    . ARG A 1 747 ? 27.179 21.908 12.355  1.00 35.30  ? 747  ARG A CA    1 
ATOM   5814 C  C     . ARG A 1 747 ? 28.400 22.144 13.211  1.00 100.00 ? 747  ARG A C     1 
ATOM   5815 O  O     . ARG A 1 747 ? 29.507 21.844 12.838  1.00 30.06  ? 747  ARG A O     1 
ATOM   5816 C  CB    . ARG A 1 747 ? 26.391 20.747 12.855  1.00 34.53  ? 747  ARG A CB    1 
ATOM   5817 C  CG    . ARG A 1 747 ? 25.140 20.807 12.051  1.00 36.82  ? 747  ARG A CG    1 
ATOM   5818 C  CD    . ARG A 1 747 ? 23.953 20.794 12.960  1.00 72.26  ? 747  ARG A CD    1 
ATOM   5819 N  NE    . ARG A 1 747 ? 23.204 19.619 12.622  1.00 78.89  ? 747  ARG A NE    1 
ATOM   5820 C  CZ    . ARG A 1 747 ? 21.928 19.716 12.419  1.00 47.57  ? 747  ARG A CZ    1 
ATOM   5821 N  NH1   . ARG A 1 747 ? 21.389 20.922 12.539  1.00 46.55  ? 747  ARG A NH1   1 
ATOM   5822 N  NH2   . ARG A 1 747 ? 21.229 18.607 12.041  1.00 91.49  ? 747  ARG A NH2   1 
ATOM   5823 N  N     . ALA A 1 748 ? 28.186 22.724 14.369  1.00 31.27  ? 748  ALA A N     1 
ATOM   5824 C  CA    . ALA A 1 748 ? 29.239 23.069 15.319  1.00 81.06  ? 748  ALA A CA    1 
ATOM   5825 C  C     . ALA A 1 748 ? 30.064 21.879 15.776  1.00 49.63  ? 748  ALA A C     1 
ATOM   5826 O  O     . ALA A 1 748 ? 29.513 20.834 16.156  1.00 100.00 ? 748  ALA A O     1 
ATOM   5827 C  CB    . ALA A 1 748 ? 28.692 23.819 16.528  1.00 31.96  ? 748  ALA A CB    1 
ATOM   5828 N  N     . GLY A 1 749 ? 31.398 22.076 15.740  1.00 34.05  ? 749  GLY A N     1 
ATOM   5829 C  CA    . GLY A 1 749 ? 32.390 21.086 16.147  1.00 33.65  ? 749  GLY A CA    1 
ATOM   5830 C  C     . GLY A 1 749 ? 32.780 20.052 15.081  1.00 36.60  ? 749  GLY A C     1 
ATOM   5831 O  O     . GLY A 1 749 ? 33.808 19.340 15.210  1.00 39.15  ? 749  GLY A O     1 
ATOM   5832 N  N     . GLN A 1 750 ? 31.920 19.930 14.069  1.00 42.72  ? 750  GLN A N     1 
ATOM   5833 C  CA    . GLN A 1 750 ? 32.168 18.989 13.008  1.00 47.77  ? 750  GLN A CA    1 
ATOM   5834 C  C     . GLN A 1 750 ? 33.532 19.247 12.354  1.00 39.28  ? 750  GLN A C     1 
ATOM   5835 O  O     . GLN A 1 750 ? 34.454 18.414 12.322  1.00 39.69  ? 750  GLN A O     1 
ATOM   5836 C  CB    . GLN A 1 750 ? 31.025 19.034 11.982  1.00 52.95  ? 750  GLN A CB    1 
ATOM   5837 C  CG    . GLN A 1 750 ? 31.220 17.838 11.013  1.00 61.93  ? 750  GLN A CG    1 
ATOM   5838 C  CD    . GLN A 1 750 ? 31.454 16.518 11.760  1.00 100.00 ? 750  GLN A CD    1 
ATOM   5839 O  OE1   . GLN A 1 750 ? 30.549 15.846 12.222  1.00 40.08  ? 750  GLN A OE1   1 
ATOM   5840 N  NE2   . GLN A 1 750 ? 32.695 16.098 11.871  1.00 33.31  ? 750  GLN A NE2   1 
ATOM   5841 N  N     . LEU A 1 751 ? 33.668 20.410 11.781  1.00 31.82  ? 751  LEU A N     1 
ATOM   5842 C  CA    . LEU A 1 751 ? 34.895 20.754 11.113  1.00 49.20  ? 751  LEU A CA    1 
ATOM   5843 C  C     . LEU A 1 751 ? 36.128 20.600 11.988  1.00 37.00  ? 751  LEU A C     1 
ATOM   5844 O  O     . LEU A 1 751 ? 37.207 20.339 11.499  1.00 28.32  ? 751  LEU A O     1 
ATOM   5845 C  CB    . LEU A 1 751 ? 34.772 22.252 10.781  1.00 33.27  ? 751  LEU A CB    1 
ATOM   5846 C  CG    . LEU A 1 751 ? 35.092 22.645 9.365   1.00 65.54  ? 751  LEU A CG    1 
ATOM   5847 C  CD1   . LEU A 1 751 ? 35.481 24.119 9.395   1.00 31.45  ? 751  LEU A CD1   1 
ATOM   5848 C  CD2   . LEU A 1 751 ? 36.095 21.680 8.684   1.00 51.04  ? 751  LEU A CD2   1 
ATOM   5849 N  N     . ALA A 1 752 ? 35.999 20.872 13.273  1.00 35.42  ? 752  ALA A N     1 
ATOM   5850 C  CA    . ALA A 1 752 ? 37.133 20.781 14.168  1.00 60.62  ? 752  ALA A CA    1 
ATOM   5851 C  C     . ALA A 1 752 ? 37.580 19.345 14.274  1.00 77.44  ? 752  ALA A C     1 
ATOM   5852 O  O     . ALA A 1 752 ? 38.774 19.036 14.343  1.00 38.98  ? 752  ALA A O     1 
ATOM   5853 C  CB    . ALA A 1 752 ? 36.855 21.302 15.574  1.00 37.95  ? 752  ALA A CB    1 
ATOM   5854 N  N     . ARG A 1 753 ? 36.590 18.464 14.284  1.00 41.73  ? 753  ARG A N     1 
ATOM   5855 C  CA    . ARG A 1 753 ? 36.891 17.053 14.371  1.00 50.88  ? 753  ARG A CA    1 
ATOM   5856 C  C     . ARG A 1 753 ? 37.621 16.609 13.122  1.00 57.60  ? 753  ARG A C     1 
ATOM   5857 O  O     . ARG A 1 753 ? 38.655 15.955 13.151  1.00 47.68  ? 753  ARG A O     1 
ATOM   5858 C  CB    . ARG A 1 753 ? 35.649 16.253 14.547  1.00 38.78  ? 753  ARG A CB    1 
ATOM   5859 C  CG    . ARG A 1 753 ? 35.241 16.345 16.027  1.00 75.10  ? 753  ARG A CG    1 
ATOM   5860 C  CD    . ARG A 1 753 ? 34.208 15.284 16.429  1.00 78.76  ? 753  ARG A CD    1 
ATOM   5861 N  NE    . ARG A 1 753 ? 32.863 15.542 15.884  1.00 100.00 ? 753  ARG A NE    1 
ATOM   5862 C  CZ    . ARG A 1 753 ? 32.111 16.627 16.157  1.00 100.00 ? 753  ARG A CZ    1 
ATOM   5863 N  NH1   . ARG A 1 753 ? 32.580 17.586 16.980  1.00 100.00 ? 753  ARG A NH1   1 
ATOM   5864 N  NH2   . ARG A 1 753 ? 30.866 16.795 15.580  1.00 74.91  ? 753  ARG A NH2   1 
ATOM   5865 N  N     . ILE A 1 754 ? 37.067 17.018 11.997  1.00 28.85  ? 754  ILE A N     1 
ATOM   5866 C  CA    . ILE A 1 754 ? 37.646 16.705 10.723  1.00 56.06  ? 754  ILE A CA    1 
ATOM   5867 C  C     . ILE A 1 754 ? 39.050 17.265 10.650  1.00 36.37  ? 754  ILE A C     1 
ATOM   5868 O  O     . ILE A 1 754 ? 39.988 16.697 10.109  1.00 47.55  ? 754  ILE A O     1 
ATOM   5869 C  CB    . ILE A 1 754 ? 36.866 17.424 9.656   1.00 46.07  ? 754  ILE A CB    1 
ATOM   5870 C  CG1   . ILE A 1 754 ? 35.669 16.556 9.304   1.00 32.12  ? 754  ILE A CG1   1 
ATOM   5871 C  CG2   . ILE A 1 754 ? 37.813 17.704 8.461   1.00 31.88  ? 754  ILE A CG2   1 
ATOM   5872 C  CD1   . ILE A 1 754 ? 34.571 17.342 8.605   1.00 39.17  ? 754  ILE A CD1   1 
ATOM   5873 N  N     . GLU A 1 755 ? 39.197 18.437 11.220  1.00 50.34  ? 755  GLU A N     1 
ATOM   5874 C  CA    . GLU A 1 755 ? 40.487 19.055 11.211  1.00 39.89  ? 755  GLU A CA    1 
ATOM   5875 C  C     . GLU A 1 755 ? 41.430 18.092 11.889  1.00 64.41  ? 755  GLU A C     1 
ATOM   5876 O  O     . GLU A 1 755 ? 42.540 17.861 11.430  1.00 56.49  ? 755  GLU A O     1 
ATOM   5877 C  CB    . GLU A 1 755 ? 40.457 20.498 11.793  1.00 39.52  ? 755  GLU A CB    1 
ATOM   5878 C  CG    . GLU A 1 755 ? 41.787 21.307 11.805  1.00 48.52  ? 755  GLU A CG    1 
ATOM   5879 C  CD    . GLU A 1 755 ? 42.596 21.581 10.527  1.00 97.39  ? 755  GLU A CD    1 
ATOM   5880 O  OE1   . GLU A 1 755 ? 41.960 21.558 9.384   1.00 47.43  ? 755  GLU A OE1   1 
ATOM   5881 O  OE2   . GLU A 1 755 ? 43.778 21.808 10.560  1.00 49.02  ? 755  GLU A OE2   1 
ATOM   5882 N  N     . GLU A 1 756 ? 40.882 17.494 12.946  1.00 100.00 ? 756  GLU A N     1 
ATOM   5883 C  CA    . GLU A 1 756 ? 41.538 16.529 13.814  1.00 70.37  ? 756  GLU A CA    1 
ATOM   5884 C  C     . GLU A 1 756 ? 41.788 15.160 13.181  1.00 66.46  ? 756  GLU A C     1 
ATOM   5885 O  O     . GLU A 1 756 ? 42.303 14.255 13.826  1.00 79.17  ? 756  GLU A O     1 
ATOM   5886 C  CB    . GLU A 1 756 ? 40.724 16.468 15.123  1.00 58.93  ? 756  GLU A CB    1 
ATOM   5887 C  CG    . GLU A 1 756 ? 41.072 17.659 16.040  1.00 42.45  ? 756  GLU A CG    1 
ATOM   5888 C  CD    . GLU A 1 756 ? 40.083 17.841 17.152  1.00 50.33  ? 756  GLU A CD    1 
ATOM   5889 O  OE1   . GLU A 1 756 ? 39.026 17.067 17.021  1.00 75.84  ? 756  GLU A OE1   1 
ATOM   5890 O  OE2   . GLU A 1 756 ? 40.267 18.660 18.036  1.00 84.88  ? 756  GLU A OE2   1 
ATOM   5891 N  N     . ALA A 1 757 ? 41.434 15.034 11.901  1.00 92.74  ? 757  ALA A N     1 
ATOM   5892 C  CA    . ALA A 1 757 ? 41.579 13.797 11.144  1.00 100.00 ? 757  ALA A CA    1 
ATOM   5893 C  C     . ALA A 1 757 ? 42.951 13.610 10.472  1.00 60.25  ? 757  ALA A C     1 
ATOM   5894 O  O     . ALA A 1 757 ? 43.449 14.520 9.806   1.00 100.00 ? 757  ALA A O     1 
ATOM   5895 C  CB    . ALA A 1 757 ? 40.425 13.706 10.150  1.00 64.32  ? 757  ALA A CB    1 
ATOM   5896 N  N     . ARG A 1 758 ? 43.529 12.394 10.655  1.00 100.00 ? 758  ARG A N     1 
ATOM   5897 C  CA    . ARG A 1 758 ? 44.843 11.954 10.141  1.00 100.00 ? 758  ARG A CA    1 
ATOM   5898 C  C     . ARG A 1 758 ? 44.963 11.918 8.618   1.00 100.00 ? 758  ARG A C     1 
ATOM   5899 O  O     . ARG A 1 758 ? 44.041 11.470 7.933   1.00 100.00 ? 758  ARG A O     1 
ATOM   5900 C  CB    . ARG A 1 758 ? 45.158 10.526 10.640  1.00 69.99  ? 758  ARG A CB    1 
ATOM   5901 N  N     . GLU A 1 759 ? 46.115 12.367 8.080   1.00 76.57  ? 759  GLU A N     1 
ATOM   5902 C  CA    . GLU A 1 759 ? 46.328 12.360 6.618   1.00 84.02  ? 759  GLU A CA    1 
ATOM   5903 C  C     . GLU A 1 759 ? 46.689 10.981 6.045   1.00 100.00 ? 759  GLU A C     1 
ATOM   5904 O  O     . GLU A 1 759 ? 45.919 10.359 5.284   1.00 100.00 ? 759  GLU A O     1 
ATOM   5905 C  CB    . GLU A 1 759 ? 47.209 13.498 6.090   1.00 74.60  ? 759  GLU A CB    1 
HETATM 5906 MG MG    . MG  B 2 .   ? 32.652 59.416 20.014  1.00 16.94  ? 998  MG  A MG    1 
HETATM 5907 P  PB    . MNT C 3 .   ? 34.085 56.626 21.018  1.00 14.62  ? 999  MNT A PB    1 
HETATM 5908 O  O1B   . MNT C 3 .   ? 33.559 55.258 20.899  1.00 13.37  ? 999  MNT A O1B   1 
HETATM 5909 O  O2B   . MNT C 3 .   ? 33.616 57.638 19.999  1.00 15.29  ? 999  MNT A O2B   1 
HETATM 5910 O  O3B   . MNT C 3 .   ? 33.726 57.173 22.452  1.00 17.04  ? 999  MNT A O3B   1 
HETATM 5911 P  PA    . MNT C 3 .   ? 36.746 57.388 20.062  1.00 16.85  ? 999  MNT A PA    1 
HETATM 5912 O  O1A   . MNT C 3 .   ? 36.534 56.961 18.651  1.00 14.95  ? 999  MNT A O1A   1 
HETATM 5913 O  O2A   . MNT C 3 .   ? 36.706 58.838 20.363  1.00 13.05  ? 999  MNT A O2A   1 
HETATM 5914 O  O3A   . MNT C 3 .   ? 35.765 56.689 21.043  1.00 15.98  ? 999  MNT A O3A   1 
HETATM 5915 O  "O5'" . MNT C 3 .   ? 38.151 56.692 20.464  1.00 16.61  ? 999  MNT A "O5'" 1 
HETATM 5916 C  C5B   . MNT C 3 .   ? 38.669 56.959 21.790  1.00 17.70  ? 999  MNT A C5B   1 
HETATM 5917 C  C4B   . MNT C 3 .   ? 40.159 57.242 21.711  1.00 14.51  ? 999  MNT A C4B   1 
HETATM 5918 O  "O4'" . MNT C 3 .   ? 40.771 56.052 21.279  1.00 20.80  ? 999  MNT A "O4'" 1 
HETATM 5919 C  C3B   . MNT C 3 .   ? 40.668 58.270 20.708  1.00 33.80  ? 999  MNT A C3B   1 
HETATM 5920 O  "O3'" . MNT C 3 .   ? 41.018 59.574 21.166  1.00 40.73  ? 999  MNT A "O3'" 1 
HETATM 5921 C  C2B   . MNT C 3 .   ? 41.403 57.698 19.776  1.00 29.84  ? 999  MNT A C2B   1 
HETATM 5922 C  C1B   . MNT C 3 .   ? 41.693 56.290 20.215  1.00 20.94  ? 999  MNT A C1B   1 
HETATM 5923 N  N9    . MNT C 3 .   ? 41.289 55.302 19.182  1.00 29.66  ? 999  MNT A N9    1 
HETATM 5924 C  C8    . MNT C 3 .   ? 40.070 54.748 18.813  1.00 23.92  ? 999  MNT A C8    1 
HETATM 5925 N  N7    . MNT C 3 .   ? 40.117 53.845 17.752  1.00 23.29  ? 999  MNT A N7    1 
HETATM 5926 C  C5    . MNT C 3 .   ? 41.480 53.847 17.487  1.00 34.93  ? 999  MNT A C5    1 
HETATM 5927 C  C6    . MNT C 3 .   ? 42.172 53.511 16.297  1.00 23.83  ? 999  MNT A C6    1 
HETATM 5928 N  N6    . MNT C 3 .   ? 41.945 52.492 15.488  1.00 16.44  ? 999  MNT A N6    1 
HETATM 5929 N  N1    . MNT C 3 .   ? 43.531 53.630 16.376  1.00 23.29  ? 999  MNT A N1    1 
HETATM 5930 C  C2    . MNT C 3 .   ? 44.077 54.313 17.454  1.00 33.75  ? 999  MNT A C2    1 
HETATM 5931 N  N3    . MNT C 3 .   ? 43.497 54.992 18.447  1.00 26.08  ? 999  MNT A N3    1 
HETATM 5932 C  C4    . MNT C 3 .   ? 42.177 54.709 18.378  1.00 29.60  ? 999  MNT A C4    1 
HETATM 5933 C  "C'"  . MNT C 3 .   ? 40.875 60.741 20.410  1.00 28.98  ? 999  MNT A "C'"  1 
HETATM 5934 O  "O1'" . MNT C 3 .   ? 40.685 60.531 19.232  1.00 100.00 ? 999  MNT A "O1'" 1 
HETATM 5935 C  "C1'" . MNT C 3 .   ? 41.757 61.945 20.758  1.00 100.00 ? 999  MNT A "C1'" 1 
HETATM 5936 C  "C2'" A MNT C 3 .   ? 41.444 62.962 19.761  0.50 100.00 ? 999  MNT A "C2'" 1 
HETATM 5937 C  "C2'" B MNT C 3 .   ? 42.216 62.343 22.073  0.50 36.67  ? 999  MNT A "C2'" 1 
HETATM 5938 N  "N2'" A MNT C 3 .   ? 41.397 62.820 18.406  0.50 19.93  ? 999  MNT A "N2'" 1 
HETATM 5939 N  "N2'" B MNT C 3 .   ? 43.060 61.637 22.868  0.50 43.39  ? 999  MNT A "N2'" 1 
HETATM 5940 C  "CM'" A MNT C 3 .   ? 41.217 63.950 17.532  0.50 18.38  ? 999  MNT A "CM'" 1 
HETATM 5941 C  "CM'" B MNT C 3 .   ? 44.186 62.249 23.513  0.50 12.89  ? 999  MNT A "CM'" 1 
HETATM 5942 C  "C3'" A MNT C 3 .   ? 41.494 64.334 20.208  0.50 100.00 ? 999  MNT A "C3'" 1 
HETATM 5943 C  "C3'" B MNT C 3 .   ? 42.208 63.712 22.466  0.50 44.01  ? 999  MNT A "C3'" 1 
HETATM 5944 C  "C4'" . MNT C 3 .   ? 41.801 64.725 21.529  1.00 37.44  ? 999  MNT A "C4'" 1 
HETATM 5945 C  "C5'" A MNT C 3 .   ? 42.208 63.712 22.466  0.50 44.01  ? 999  MNT A "C5'" 1 
HETATM 5946 C  "C5'" B MNT C 3 .   ? 41.494 64.334 20.208  0.50 100.00 ? 999  MNT A "C5'" 1 
HETATM 5947 C  "C6'" A MNT C 3 .   ? 42.216 62.343 22.073  0.50 36.67  ? 999  MNT A "C6'" 1 
HETATM 5948 C  "C6'" B MNT C 3 .   ? 41.444 62.962 19.761  0.50 100.00 ? 999  MNT A "C6'" 1 
HETATM 5949 BE BE    . BEF D 4 .   ? 32.595 58.188 22.992  1.00 13.31  ? 1000 BEF A BE    1 
HETATM 5950 F  F1    . BEF D 4 .   ? 31.324 57.364 23.232  1.00 17.89  ? 1000 BEF A F1    1 
HETATM 5951 F  F2    . BEF D 4 .   ? 33.110 58.885 24.291  1.00 19.48  ? 1000 BEF A F2    1 
HETATM 5952 F  F3    . BEF D 4 .   ? 32.321 59.297 21.951  1.00 14.53  ? 1000 BEF A F3    1 
HETATM 5953 O  O     . HOH E 5 .   ? 30.833 58.615 19.552  1.00 16.34  ? 996  HOH A O     1 
HETATM 5954 O  O     . HOH E 5 .   ? 34.595 60.388 20.321  1.00 16.93  ? 997  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  CYS 49  49  49  CYS CYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 HIS 154 154 154 HIS HIS A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ASN 206 206 ?   ?   ?   A . n 
A 1 207 GLY 207 207 ?   ?   ?   A . n 
A 1 208 SER 208 208 ?   ?   ?   A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 GLN 217 217 217 GLN GLN A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 PHE 247 247 247 PHE PHE A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 GLN 259 259 259 GLN GLN A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 THR 273 273 273 THR THR A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ASN 277 277 277 ASN ASN A . n 
A 1 278 TYR 278 278 278 TYR TYR A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLN 283 283 283 GLN GLN A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 ALA 290 290 290 ALA ALA A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 ASN 308 308 308 ASN ASN A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 CYS 312 312 312 CYS CYS A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 ASP 322 322 322 ASP ASP A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 MET 331 331 331 MET MET A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 PHE 336 336 336 PHE PHE A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 GLN 338 338 338 GLN GLN A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ILE 348 348 348 ILE ILE A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ASN 356 356 356 ASN ASN A . n 
A 1 357 ILE 357 357 357 ILE ILE A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 GLY 364 364 364 GLY GLY A . n 
A 1 365 GLU 365 365 365 GLU GLU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 ASN 376 376 376 ASN ASN A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 PHE 382 382 382 PHE PHE A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 VAL 384 384 384 VAL VAL A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 PRO 386 386 386 PRO PRO A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLU 390 390 390 GLU GLU A . n 
A 1 391 LYS 391 391 391 LYS LYS A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 MET 394 394 394 MET MET A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 PRO 396 396 396 PRO PRO A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 ILE 398 398 398 ILE ILE A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 GLY 401 401 401 GLY GLY A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 ASP 403 403 403 ASP ASP A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 ASN 410 410 410 ASN ASN A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 GLU 412 412 412 GLU GLU A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 ARG 418 418 418 ARG ARG A . n 
A 1 419 ASP 419 419 419 ASP ASP A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 ARG 428 428 428 ARG ARG A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 LEU 433 433 433 LEU LEU A . n 
A 1 434 VAL 434 434 434 VAL VAL A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 LYS 436 436 436 LYS LYS A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 ASN 438 438 438 ASN ASN A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 SER 443 443 443 SER SER A . n 
A 1 444 GLU 444 444 444 GLU GLU A . n 
A 1 445 ARG 445 445 445 ARG ARG A . n 
A 1 446 LYS 446 446 446 LYS LYS A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 TYR 448 448 448 TYR TYR A . n 
A 1 449 PHE 449 449 449 PHE PHE A . n 
A 1 450 ILE 450 450 450 ILE ILE A . n 
A 1 451 GLY 451 451 451 GLY GLY A . n 
A 1 452 VAL 452 452 452 VAL VAL A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 ILE 455 455 455 ILE ILE A . n 
A 1 456 SER 456 456 456 SER SER A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 PHE 458 458 458 PHE PHE A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ILE 460 460 460 ILE ILE A . n 
A 1 461 PHE 461 461 461 PHE PHE A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 PHE 466 466 466 PHE PHE A . n 
A 1 467 GLU 467 467 467 GLU GLU A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 CYS 470 470 470 CYS CYS A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 ASN 472 472 472 ASN ASN A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 THR 474 474 474 THR THR A . n 
A 1 475 ASN 475 475 475 ASN ASN A . n 
A 1 476 GLU 476 476 476 GLU GLU A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 GLN 479 479 479 GLN GLN A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 PHE 481 481 481 PHE PHE A . n 
A 1 482 PHE 482 482 482 PHE PHE A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 HIS 484 484 484 HIS HIS A . n 
A 1 485 HIS 485 485 485 HIS HIS A . n 
A 1 486 MET 486 486 486 MET MET A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 VAL 489 489 489 VAL VAL A . n 
A 1 490 GLU 490 490 490 GLU GLU A . n 
A 1 491 GLN 491 491 491 GLN GLN A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 ASN 500 500 500 ASN ASN A . n 
A 1 501 TRP 501 501 ?   ?   ?   A . n 
A 1 502 THR 502 502 ?   ?   ?   A . n 
A 1 503 PHE 503 503 ?   ?   ?   A . n 
A 1 504 ILE 504 504 ?   ?   ?   A . n 
A 1 505 ASP 505 505 ?   ?   ?   A . n 
A 1 506 PHE 506 506 ?   ?   ?   A . n 
A 1 507 GLY 507 507 ?   ?   ?   A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 SER 510 510 510 SER SER A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ILE 517 517 517 ILE ILE A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 GLY 519 519 519 GLY GLY A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 GLN 521 521 521 GLN GLN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ALA 527 527 527 ALA ALA A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 LEU 529 529 529 LEU LEU A . n 
A 1 530 ASP 530 530 530 ASP ASP A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 GLN 532 532 532 GLN GLN A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 PRO 536 536 536 PRO PRO A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 THR 539 539 539 THR THR A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 ASN 541 541 541 ASN ASN A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 LEU 543 543 543 LEU LEU A . n 
A 1 544 ILE 544 544 544 ILE ILE A . n 
A 1 545 THR 545 545 545 THR THR A . n 
A 1 546 LYS 546 546 546 LYS LYS A . n 
A 1 547 LEU 547 547 547 LEU LEU A . n 
A 1 548 HIS 548 548 548 HIS HIS A . n 
A 1 549 SER 549 549 549 SER SER A . n 
A 1 550 HIS 550 550 550 HIS HIS A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 LYS 553 553 553 LYS LYS A . n 
A 1 554 LYS 554 554 554 LYS LYS A . n 
A 1 555 ASN 555 555 555 ASN ASN A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LYS 557 557 557 LYS LYS A . n 
A 1 558 TYR 558 558 558 TYR TYR A . n 
A 1 559 GLU 559 559 559 GLU GLU A . n 
A 1 560 GLU 560 560 560 GLU GLU A . n 
A 1 561 PRO 561 561 561 PRO PRO A . n 
A 1 562 ARG 562 562 562 ARG ARG A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 SER 564 564 564 SER SER A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 THR 566 566 566 THR THR A . n 
A 1 567 GLU 567 567 567 GLU GLU A . n 
A 1 568 PHE 568 568 568 PHE PHE A . n 
A 1 569 GLY 569 569 569 GLY GLY A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 THR 571 571 571 THR THR A . n 
A 1 572 HIS 572 572 572 HIS HIS A . n 
A 1 573 TYR 573 573 573 TYR TYR A . n 
A 1 574 ALA 574 574 574 ALA ALA A . n 
A 1 575 GLY 575 575 575 GLY GLY A . n 
A 1 576 GLN 576 576 576 GLN GLN A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 MET 578 578 578 MET MET A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 GLU 580 580 580 GLU GLU A . n 
A 1 581 ILE 581 581 581 ILE ILE A . n 
A 1 582 GLN 582 582 582 GLN GLN A . n 
A 1 583 ASP 583 583 583 ASP ASP A . n 
A 1 584 TRP 584 584 584 TRP TRP A . n 
A 1 585 LEU 585 585 585 LEU LEU A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 LYS 587 587 587 LYS LYS A . n 
A 1 588 ASN 588 588 588 ASN ASN A . n 
A 1 589 LYS 589 589 589 LYS LYS A . n 
A 1 590 ASP 590 590 590 ASP ASP A . n 
A 1 591 PRO 591 591 591 PRO PRO A . n 
A 1 592 LEU 592 592 592 LEU LEU A . n 
A 1 593 GLN 593 593 593 GLN GLN A . n 
A 1 594 GLN 594 594 594 GLN GLN A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 GLU 597 597 597 GLU GLU A . n 
A 1 598 LEU 598 598 598 LEU LEU A . n 
A 1 599 CYS 599 599 599 CYS CYS A . n 
A 1 600 PHE 600 600 600 PHE PHE A . n 
A 1 601 LYS 601 601 601 LYS LYS A . n 
A 1 602 ASP 602 602 602 ASP ASP A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 SER 604 604 604 SER SER A . n 
A 1 605 ASP 605 605 605 ASP ASP A . n 
A 1 606 ASN 606 606 606 ASN ASN A . n 
A 1 607 VAL 607 607 607 VAL VAL A . n 
A 1 608 VAL 608 608 608 VAL VAL A . n 
A 1 609 THR 609 609 609 THR THR A . n 
A 1 610 LYS 610 610 610 LYS LYS A . n 
A 1 611 LEU 611 611 611 LEU LEU A . n 
A 1 612 PHE 612 612 612 PHE PHE A . n 
A 1 613 ASN 613 613 613 ASN ASN A . n 
A 1 614 ASP 614 614 614 ASP ASP A . n 
A 1 615 PRO 615 615 615 PRO PRO A . n 
A 1 616 ASN 616 616 616 ASN ASN A . n 
A 1 617 ILE 617 617 617 ILE ILE A . n 
A 1 618 ALA 618 618 618 ALA ALA A . n 
A 1 619 SER 619 619 619 SER SER A . n 
A 1 620 ARG 620 620 620 ARG ARG A . n 
A 1 621 ALA 621 621 621 ALA ALA A . n 
A 1 622 LYS 622 622 ?   ?   ?   A . n 
A 1 623 LYS 623 623 ?   ?   ?   A . n 
A 1 624 GLY 624 624 ?   ?   ?   A . n 
A 1 625 ALA 625 625 ?   ?   ?   A . n 
A 1 626 ASN 626 626 ?   ?   ?   A . n 
A 1 627 PHE 627 627 627 PHE PHE A . n 
A 1 628 LEU 628 628 628 LEU LEU A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 VAL 630 630 630 VAL VAL A . n 
A 1 631 ALA 631 631 631 ALA ALA A . n 
A 1 632 ALA 632 632 632 ALA ALA A . n 
A 1 633 GLN 633 633 633 GLN GLN A . n 
A 1 634 TYR 634 634 634 TYR TYR A . n 
A 1 635 LYS 635 635 635 LYS LYS A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 GLN 637 637 637 GLN GLN A . n 
A 1 638 LEU 638 638 638 LEU LEU A . n 
A 1 639 ALA 639 639 639 ALA ALA A . n 
A 1 640 SER 640 640 640 SER SER A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 MET 642 642 642 MET MET A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 LEU 645 645 645 LEU LEU A . n 
A 1 646 GLU 646 646 646 GLU GLU A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 THR 648 648 648 THR THR A . n 
A 1 649 ASN 649 649 649 ASN ASN A . n 
A 1 650 PRO 650 650 650 PRO PRO A . n 
A 1 651 HIS 651 651 651 HIS HIS A . n 
A 1 652 PHE 652 652 652 PHE PHE A . n 
A 1 653 VAL 653 653 653 VAL VAL A . n 
A 1 654 ARG 654 654 654 ARG ARG A . n 
A 1 655 CYS 655 655 655 CYS CYS A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ILE 657 657 657 ILE ILE A . n 
A 1 658 PRO 658 658 658 PRO PRO A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ASN 660 660 660 ASN ASN A . n 
A 1 661 LYS 661 661 661 LYS LYS A . n 
A 1 662 GLN 662 662 662 GLN GLN A . n 
A 1 663 LEU 663 663 663 LEU LEU A . n 
A 1 664 PRO 664 664 664 PRO PRO A . n 
A 1 665 ALA 665 665 665 ALA ALA A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 LEU 667 667 667 LEU LEU A . n 
A 1 668 GLU 668 668 668 GLU GLU A . n 
A 1 669 ASP 669 669 669 ASP ASP A . n 
A 1 670 LYS 670 670 670 LYS LYS A . n 
A 1 671 VAL 671 671 671 VAL VAL A . n 
A 1 672 VAL 672 672 672 VAL VAL A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 ASP 674 674 674 ASP ASP A . n 
A 1 675 GLN 675 675 675 GLN GLN A . n 
A 1 676 LEU 676 676 676 LEU LEU A . n 
A 1 677 ARG 677 677 677 ARG ARG A . n 
A 1 678 CYS 678 678 678 CYS CYS A . n 
A 1 679 ASN 679 679 679 ASN ASN A . n 
A 1 680 GLY 680 680 680 GLY GLY A . n 
A 1 681 VAL 681 681 681 VAL VAL A . n 
A 1 682 LEU 682 682 682 LEU LEU A . n 
A 1 683 GLU 683 683 683 GLU GLU A . n 
A 1 684 GLY 684 684 684 GLY GLY A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 ARG 686 686 686 ARG ARG A . n 
A 1 687 ILE 687 687 687 ILE ILE A . n 
A 1 688 THR 688 688 688 THR THR A . n 
A 1 689 ARG 689 689 689 ARG ARG A . n 
A 1 690 LYS 690 690 690 LYS LYS A . n 
A 1 691 GLY 691 691 691 GLY GLY A . n 
A 1 692 PHE 692 692 692 PHE PHE A . n 
A 1 693 PRO 693 693 693 PRO PRO A . n 
A 1 694 ASN 694 694 694 ASN ASN A . n 
A 1 695 ARG 695 695 695 ARG ARG A . n 
A 1 696 ILE 696 696 696 ILE ILE A . n 
A 1 697 ILE 697 697 697 ILE ILE A . n 
A 1 698 TYR 698 698 698 TYR TYR A . n 
A 1 699 ALA 699 699 699 ALA ALA A . n 
A 1 700 ASP 700 700 700 ASP ASP A . n 
A 1 701 PHE 701 701 701 PHE PHE A . n 
A 1 702 VAL 702 702 702 VAL VAL A . n 
A 1 703 LYS 703 703 703 LYS LYS A . n 
A 1 704 ARG 704 704 704 ARG ARG A . n 
A 1 705 TYR 705 705 705 TYR TYR A . n 
A 1 706 TYR 706 706 706 TYR TYR A . n 
A 1 707 ASP 707 707 707 ASP ASP A . n 
A 1 708 LEU 708 708 708 LEU LEU A . n 
A 1 709 ALA 709 709 709 ALA ALA A . n 
A 1 710 PRO 710 710 710 PRO PRO A . n 
A 1 711 ASN 711 711 711 ASN ASN A . n 
A 1 712 VAL 712 712 712 VAL VAL A . n 
A 1 713 PRO 713 713 713 PRO PRO A . n 
A 1 714 ARG 714 714 714 ARG ARG A . n 
A 1 715 ASP 715 715 715 ASP ASP A . n 
A 1 716 ALA 716 716 716 ALA ALA A . n 
A 1 717 GLU 717 717 717 GLU GLU A . n 
A 1 718 ASP 718 718 718 ASP ASP A . n 
A 1 719 SER 719 719 719 SER SER A . n 
A 1 720 GLN 720 720 720 GLN GLN A . n 
A 1 721 LYS 721 721 721 LYS LYS A . n 
A 1 722 ALA 722 722 722 ALA ALA A . n 
A 1 723 THR 723 723 723 THR THR A . n 
A 1 724 ASP 724 724 724 ASP ASP A . n 
A 1 725 ALA 725 725 725 ALA ALA A . n 
A 1 726 VAL 726 726 726 VAL VAL A . n 
A 1 727 LEU 727 727 727 LEU LEU A . n 
A 1 728 LYS 728 728 728 LYS LYS A . n 
A 1 729 HIS 729 729 729 HIS HIS A . n 
A 1 730 LEU 730 730 730 LEU LEU A . n 
A 1 731 ASN 731 731 731 ASN ASN A . n 
A 1 732 ILE 732 732 732 ILE ILE A . n 
A 1 733 ASP 733 733 733 ASP ASP A . n 
A 1 734 PRO 734 734 734 PRO PRO A . n 
A 1 735 GLU 735 735 735 GLU GLU A . n 
A 1 736 GLN 736 736 736 GLN GLN A . n 
A 1 737 PHE 737 737 737 PHE PHE A . n 
A 1 738 ARG 738 738 738 ARG ARG A . n 
A 1 739 PHE 739 739 739 PHE PHE A . n 
A 1 740 GLY 740 740 740 GLY GLY A . n 
A 1 741 ILE 741 741 741 ILE ILE A . n 
A 1 742 THR 742 742 742 THR THR A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 ILE 744 744 744 ILE ILE A . n 
A 1 745 PHE 745 745 745 PHE PHE A . n 
A 1 746 PHE 746 746 746 PHE PHE A . n 
A 1 747 ARG 747 747 747 ARG ARG A . n 
A 1 748 ALA 748 748 748 ALA ALA A . n 
A 1 749 GLY 749 749 749 GLY GLY A . n 
A 1 750 GLN 750 750 750 GLN GLN A . n 
A 1 751 LEU 751 751 751 LEU LEU A . n 
A 1 752 ALA 752 752 752 ALA ALA A . n 
A 1 753 ARG 753 753 753 ARG ARG A . n 
A 1 754 ILE 754 754 754 ILE ILE A . n 
A 1 755 GLU 755 755 755 GLU GLU A . n 
A 1 756 GLU 756 756 756 GLU GLU A . n 
A 1 757 ALA 757 757 757 ALA ALA A . n 
A 1 758 ARG 758 758 758 ARG ARG A . n 
A 1 759 GLU 759 759 759 GLU GLU A . n 
A 1 760 LEU 760 760 ?   ?   ?   A . n 
A 1 761 PRO 761 761 ?   ?   ?   A . n 
A 1 762 ASN 762 762 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1 998  998  MG  MG  A . 
C 3 MNT 1 999  999  MNT MNT A . 
D 4 BEF 1 1000 1000 BEF BEF A . 
E 5 HOH 1 996  996  HOH HOH A . 
E 5 HOH 2 997  997  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 84.5  ? 
2  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O2B ? C MNT .   ? A MNT 999  ? 1_555 91.7  ? 
3  OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O2B ? C MNT .   ? A MNT 999  ? 1_555 174.4 ? 
4  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 176.2 ? 
5  OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 91.8  ? 
6  O2B ? C MNT .   ? A MNT 999  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 92.0  ? 
7  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 996  ? 1_555 88.0  ? 
8  OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 996  ? 1_555 89.6  ? 
9  O2B ? C MNT .   ? A MNT 999  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 996  ? 1_555 94.5  ? 
10 F3  ? D BEF .   ? A BEF 1000 ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 996  ? 1_555 92.8  ? 
11 OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 997  ? 1_555 86.8  ? 
12 OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 997  ? 1_555 87.4  ? 
13 O2B ? C MNT .   ? A MNT 999  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 997  ? 1_555 88.2  ? 
14 F3  ? D BEF .   ? A BEF 1000 ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 997  ? 1_555 92.2  ? 
15 O   ? E HOH .   ? A HOH 996  ? 1_555 MG ? B MG  . ? A MG  998  ? 1_555 O   ? E HOH .   ? A HOH 997  ? 1_555 174.3 ? 
16 O3B ? C MNT .   ? A MNT 999  ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F1  ? D BEF .   ? A BEF 1000 ? 1_555 107.2 ? 
17 O3B ? C MNT .   ? A MNT 999  ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F2  ? D BEF .   ? A BEF 1000 ? 1_555 109.2 ? 
18 F1  ? D BEF .   ? A BEF 1000 ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F2  ? D BEF .   ? A BEF 1000 ? 1_555 112.5 ? 
19 O3B ? C MNT .   ? A MNT 999  ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 110.5 ? 
20 F1  ? D BEF .   ? A BEF 1000 ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 110.1 ? 
21 F2  ? D BEF .   ? A BEF 1000 ? 1_555 BE ? D BEF . ? A BEF 1000 ? 1_555 F3  ? D BEF .   ? A BEF 1000 ? 1_555 107.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CD A GLU 43  ? ? OE2 A GLU 43  ? ? 1.346 1.252 0.094  0.011 N 
2  1 CD A GLU 48  ? ? OE1 A GLU 48  ? ? 1.323 1.252 0.071  0.011 N 
3  1 CD A GLU 51  ? ? OE1 A GLU 51  ? ? 1.330 1.252 0.078  0.011 N 
4  1 CD A GLU 55  ? ? OE2 A GLU 55  ? ? 1.327 1.252 0.075  0.011 N 
5  1 NE A ARG 131 ? ? CZ  A ARG 131 ? ? 1.406 1.326 0.080  0.013 N 
6  1 CD A GLU 138 ? ? OE1 A GLU 138 ? ? 1.343 1.252 0.091  0.011 N 
7  1 CE A LYS 144 ? ? NZ  A LYS 144 ? ? 1.132 1.486 -0.354 0.025 N 
8  1 CD A GLU 180 ? ? OE1 A GLU 180 ? ? 1.367 1.252 0.115  0.011 N 
9  1 CD A GLU 187 ? ? OE1 A GLU 187 ? ? 1.323 1.252 0.071  0.011 N 
10 1 CZ A ARG 202 ? ? NH2 A ARG 202 ? ? 1.404 1.326 0.078  0.013 N 
11 1 CD A GLU 212 ? ? OE2 A GLU 212 ? ? 1.345 1.252 0.093  0.011 N 
12 1 CD A GLU 244 ? ? OE1 A GLU 244 ? ? 1.319 1.252 0.067  0.011 N 
13 1 CD A GLU 264 ? ? OE2 A GLU 264 ? ? 1.163 1.252 -0.089 0.011 N 
14 1 CD A GLU 291 ? ? OE2 A GLU 291 ? ? 1.332 1.252 0.080  0.011 N 
15 1 CD A GLU 339 ? ? OE1 A GLU 339 ? ? 1.340 1.252 0.088  0.011 N 
16 1 CD A GLU 340 ? ? OE1 A GLU 340 ? ? 1.360 1.252 0.108  0.011 N 
17 1 CD A GLU 360 ? ? OE2 A GLU 360 ? ? 1.355 1.252 0.103  0.011 N 
18 1 CD A GLU 390 ? ? OE1 A GLU 390 ? ? 1.326 1.252 0.074  0.011 N 
19 1 CD A GLU 395 ? ? OE2 A GLU 395 ? ? 1.324 1.252 0.072  0.011 N 
20 1 CD A GLU 412 ? ? OE1 A GLU 412 ? ? 1.330 1.252 0.078  0.011 N 
21 1 CD A GLU 444 ? ? OE1 A GLU 444 ? ? 1.320 1.252 0.068  0.011 N 
22 1 CD A GLU 490 ? ? OE2 A GLU 490 ? ? 1.325 1.252 0.073  0.011 N 
23 1 CD A GLU 492 ? ? OE1 A GLU 492 ? ? 1.349 1.252 0.097  0.011 N 
24 1 CB A SER 510 ? ? OG  A SER 510 ? ? 1.508 1.418 0.090  0.013 N 
25 1 CD A GLU 531 ? ? OE1 A GLU 531 ? ? 1.342 1.252 0.090  0.011 N 
26 1 CD A GLU 567 ? ? OE2 A GLU 567 ? ? 1.347 1.252 0.095  0.011 N 
27 1 CD A GLU 580 ? ? OE1 A GLU 580 ? ? 1.332 1.252 0.080  0.011 N 
28 1 CD A GLU 636 ? ? OE1 A GLU 636 ? ? 1.343 1.252 0.091  0.011 N 
29 1 CD A GLU 646 ? ? OE2 A GLU 646 ? ? 1.329 1.252 0.077  0.011 N 
30 1 CD A GLU 668 ? ? OE2 A GLU 668 ? ? 1.363 1.252 0.111  0.011 N 
31 1 CD A GLU 717 ? ? OE1 A GLU 717 ? ? 1.328 1.252 0.076  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A ASP 6   ? ? CG A ASP 6   ? ? OD2 A ASP 6   ? ? 112.63 118.30 -5.67  0.90 N 
2  1 NE  A ARG 7   ? ? CZ A ARG 7   ? ? NH1 A ARG 7   ? ? 124.20 120.30 3.90   0.50 N 
3  1 NE  A ARG 7   ? ? CZ A ARG 7   ? ? NH2 A ARG 7   ? ? 115.84 120.30 -4.46  0.50 N 
4  1 CB  A ASP 21  ? ? CG A ASP 21  ? ? OD1 A ASP 21  ? ? 111.49 118.30 -6.81  0.90 N 
5  1 NE  A ARG 33  ? ? CZ A ARG 33  ? ? NH2 A ARG 33  ? ? 117.07 120.30 -3.23  0.50 N 
6  1 CB  A ASP 40  ? ? CG A ASP 40  ? ? OD2 A ASP 40  ? ? 111.77 118.30 -6.53  0.90 N 
7  1 N   A PRO 41  ? ? CA A PRO 41  ? ? CB  A PRO 41  ? ? 113.15 103.30 9.85   1.20 N 
8  1 N   A ARG 44  ? ? CA A ARG 44  ? ? CB  A ARG 44  ? ? 122.33 110.60 11.73  1.80 N 
9  1 CD  A ARG 44  ? ? NE A ARG 44  ? ? CZ  A ARG 44  ? ? 132.89 123.60 9.29   1.40 N 
10 1 N   A SER 46  ? ? CA A SER 46  ? ? CB  A SER 46  ? ? 122.42 110.50 11.92  1.50 N 
11 1 N   A SER 57  ? ? CA A SER 57  ? ? CB  A SER 57  ? ? 99.84  110.50 -10.66 1.50 N 
12 1 CB  A ASP 58  ? ? CG A ASP 58  ? ? OD2 A ASP 58  ? ? 124.41 118.30 6.11   0.90 N 
13 1 CB  A ASP 66  ? ? CG A ASP 66  ? ? OD1 A ASP 66  ? ? 112.04 118.30 -6.26  0.90 N 
14 1 CB  A ASP 75  ? ? CG A ASP 75  ? ? OD2 A ASP 75  ? ? 111.60 118.30 -6.70  0.90 N 
15 1 CB  A ASP 76  ? ? CG A ASP 76  ? ? OD2 A ASP 76  ? ? 112.16 118.30 -6.14  0.90 N 
16 1 NE  A ARG 80  ? ? CZ A ARG 80  ? ? NH1 A ARG 80  ? ? 123.39 120.30 3.09   0.50 N 
17 1 CG  A ARG 107 ? ? CD A ARG 107 ? ? NE  A ARG 107 ? ? 98.30  111.80 -13.50 2.10 N 
18 1 CB  A ASP 113 ? ? CG A ASP 113 ? ? OD2 A ASP 113 ? ? 124.13 118.30 5.83   0.90 N 
19 1 NE  A ARG 131 ? ? CZ A ARG 131 ? ? NH2 A ARG 131 ? ? 123.74 120.30 3.44   0.50 N 
20 1 CB  A ASP 141 ? ? CG A ASP 141 ? ? OD1 A ASP 141 ? ? 112.33 118.30 -5.97  0.90 N 
21 1 CB  A ASP 141 ? ? CG A ASP 141 ? ? OD2 A ASP 141 ? ? 124.80 118.30 6.50   0.90 N 
22 1 NE  A ARG 148 ? ? CZ A ARG 148 ? ? NH2 A ARG 148 ? ? 114.32 120.30 -5.98  0.50 N 
23 1 CB  A ILE 158 ? ? CA A ILE 158 ? ? C   A ILE 158 ? ? 124.29 111.60 12.69  2.00 N 
24 1 CB  A ASP 168 ? ? CG A ASP 168 ? ? OD1 A ASP 168 ? ? 124.16 118.30 5.86   0.90 N 
25 1 CB  A ASP 168 ? ? CG A ASP 168 ? ? OD2 A ASP 168 ? ? 112.29 118.30 -6.01  0.90 N 
26 1 NE  A ARG 170 ? ? CZ A ARG 170 ? ? NH1 A ARG 170 ? ? 125.44 120.30 5.14   0.50 N 
27 1 CB  A ARG 202 ? ? CA A ARG 202 ? ? C   A ARG 202 ? ? 124.17 110.40 13.77  2.00 N 
28 1 NE  A ARG 232 ? ? CZ A ARG 232 ? ? NH1 A ARG 232 ? ? 123.42 120.30 3.12   0.50 N 
29 1 NE  A ARG 232 ? ? CZ A ARG 232 ? ? NH2 A ARG 232 ? ? 117.14 120.30 -3.16  0.50 N 
30 1 CD  A ARG 238 ? ? NE A ARG 238 ? ? CZ  A ARG 238 ? ? 132.19 123.60 8.59   1.40 N 
31 1 NE  A ARG 238 ? ? CZ A ARG 238 ? ? NH1 A ARG 238 ? ? 130.67 120.30 10.37  0.50 N 
32 1 NE  A ARG 238 ? ? CZ A ARG 238 ? ? NH2 A ARG 238 ? ? 114.19 120.30 -6.11  0.50 N 
33 1 CB  A TYR 261 ? ? CG A TYR 261 ? ? CD2 A TYR 261 ? ? 115.14 121.00 -5.86  0.60 N 
34 1 CB  A TYR 261 ? ? CG A TYR 261 ? ? CD1 A TYR 261 ? ? 125.49 121.00 4.49   0.60 N 
35 1 NE  A ARG 267 ? ? CZ A ARG 267 ? ? NH1 A ARG 267 ? ? 123.45 120.30 3.15   0.50 N 
36 1 NE  A ARG 267 ? ? CZ A ARG 267 ? ? NH2 A ARG 267 ? ? 116.78 120.30 -3.52  0.50 N 
37 1 CA  A THR 273 ? ? CB A THR 273 ? ? CG2 A THR 273 ? ? 103.66 112.40 -8.74  1.40 N 
38 1 CA  A ILE 280 ? ? CB A ILE 280 ? ? CG2 A ILE 280 ? ? 123.30 110.90 12.40  2.00 N 
39 1 CA  A HIS 297 ? ? CB A HIS 297 ? ? CG  A HIS 297 ? ? 103.38 113.60 -10.22 1.70 N 
40 1 CB  A ASP 314 ? ? CG A ASP 314 ? ? OD1 A ASP 314 ? ? 108.67 118.30 -9.63  0.90 N 
41 1 CA  A HIS 408 ? ? CB A HIS 408 ? ? CG  A HIS 408 ? ? 102.79 113.60 -10.81 1.70 N 
42 1 CB  A ASP 419 ? ? CG A ASP 419 ? ? OD1 A ASP 419 ? ? 123.84 118.30 5.54   0.90 N 
43 1 CB  A ASP 419 ? ? CG A ASP 419 ? ? OD2 A ASP 419 ? ? 112.00 118.30 -6.30  0.90 N 
44 1 NE  A ARG 428 ? ? CZ A ARG 428 ? ? NH2 A ARG 428 ? ? 115.33 120.30 -4.97  0.50 N 
45 1 CA  A ILE 455 ? ? CB A ILE 455 ? ? CG2 A ILE 455 ? ? 124.92 110.90 14.02  2.00 N 
46 1 CB  A LYS 462 ? ? CA A LYS 462 ? ? C   A LYS 462 ? ? 97.52  110.40 -12.88 2.00 N 
47 1 CG1 A ILE 471 ? ? CB A ILE 471 ? ? CG2 A ILE 471 ? ? 97.69  111.40 -13.71 2.20 N 
48 1 CB  A VAL 489 ? ? CA A VAL 489 ? ? C   A VAL 489 ? ? 123.96 111.40 12.56  1.90 N 
49 1 CB  A ASP 518 ? ? CG A ASP 518 ? ? OD1 A ASP 518 ? ? 125.84 118.30 7.54   0.90 N 
50 1 CB  A ASP 518 ? ? CG A ASP 518 ? ? OD2 A ASP 518 ? ? 111.40 118.30 -6.90  0.90 N 
51 1 CB  A ASP 530 ? ? CG A ASP 530 ? ? OD1 A ASP 530 ? ? 112.07 118.30 -6.23  0.90 N 
52 1 CB  A ASP 530 ? ? CG A ASP 530 ? ? OD2 A ASP 530 ? ? 124.94 118.30 6.64   0.90 N 
53 1 CA  A PHE 535 ? ? CB A PHE 535 ? ? CG  A PHE 535 ? ? 99.30  113.90 -14.60 2.40 N 
54 1 CB  A LYS 565 ? ? CA A LYS 565 ? ? C   A LYS 565 ? ? 98.21  110.40 -12.19 2.00 N 
55 1 CB  A ASP 583 ? ? CG A ASP 583 ? ? OD1 A ASP 583 ? ? 111.82 118.30 -6.48  0.90 N 
56 1 CB  A ASP 590 ? ? CG A ASP 590 ? ? OD1 A ASP 590 ? ? 110.71 118.30 -7.59  0.90 N 
57 1 CB  A ASP 590 ? ? CG A ASP 590 ? ? OD2 A ASP 590 ? ? 123.81 118.30 5.51   0.90 N 
58 1 CB  A ASP 605 ? ? CG A ASP 605 ? ? OD2 A ASP 605 ? ? 112.22 118.30 -6.08  0.90 N 
59 1 CB  A ASN 606 ? ? CA A ASN 606 ? ? C   A ASN 606 ? ? 123.86 110.40 13.46  2.00 N 
60 1 CB  A ASP 614 ? ? CG A ASP 614 ? ? OD1 A ASP 614 ? ? 123.71 118.30 5.41   0.90 N 
61 1 CB  A SER 619 ? ? CA A SER 619 ? ? C   A SER 619 ? ? 97.31  110.10 -12.79 1.90 N 
62 1 NH1 A ARG 654 ? ? CZ A ARG 654 ? ? NH2 A ARG 654 ? ? 127.01 119.40 7.61   1.10 N 
63 1 NE  A ARG 654 ? ? CZ A ARG 654 ? ? NH2 A ARG 654 ? ? 111.50 120.30 -8.80  0.50 N 
64 1 CB  A ASP 674 ? ? CG A ASP 674 ? ? OD1 A ASP 674 ? ? 110.74 118.30 -7.56  0.90 N 
65 1 CB  A ASP 674 ? ? CG A ASP 674 ? ? OD2 A ASP 674 ? ? 123.71 118.30 5.41   0.90 N 
66 1 NE  A ARG 704 ? ? CZ A ARG 704 ? ? NH1 A ARG 704 ? ? 123.42 120.30 3.12   0.50 N 
67 1 NE  A ARG 704 ? ? CZ A ARG 704 ? ? NH2 A ARG 704 ? ? 116.68 120.30 -3.62  0.50 N 
68 1 CB  A ASP 707 ? ? CG A ASP 707 ? ? OD2 A ASP 707 ? ? 111.96 118.30 -6.34  0.90 N 
69 1 N   A PRO 713 ? ? CA A PRO 713 ? ? CB  A PRO 713 ? ? 115.41 103.30 12.11  1.20 N 
70 1 CA  A ASP 718 ? ? CB A ASP 718 ? ? CG  A ASP 718 ? ? 99.36  113.40 -14.04 2.20 N 
71 1 CB  A ASP 718 ? ? CG A ASP 718 ? ? OD2 A ASP 718 ? ? 110.18 118.30 -8.12  0.90 N 
72 1 CA  A HIS 729 ? ? CB A HIS 729 ? ? CG  A HIS 729 ? ? 101.06 113.60 -12.54 1.70 N 
73 1 N   A GLU 735 ? ? CA A GLU 735 ? ? CB  A GLU 735 ? ? 126.29 110.60 15.69  1.80 N 
74 1 NE  A ARG 738 ? ? CZ A ARG 738 ? ? NH1 A ARG 738 ? ? 126.52 120.30 6.22   0.50 N 
75 1 NE  A ARG 738 ? ? CZ A ARG 738 ? ? NH2 A ARG 738 ? ? 116.34 120.30 -3.96  0.50 N 
76 1 NE  A ARG 747 ? ? CZ A ARG 747 ? ? NH1 A ARG 747 ? ? 117.01 120.30 -3.29  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 7   ? ? -57.49  0.79    
2  1 LEU A 24  ? ? -27.98  122.85  
3  1 THR A 28  ? ? -65.54  3.06    
4  1 PRO A 39  ? ? -63.22  14.78   
5  1 ASP A 40  ? ? 151.69  134.53  
6  1 GLU A 43  ? ? -101.38 -107.50 
7  1 ARG A 44  ? ? 125.11  -29.96  
8  1 SER A 54  ? ? 177.92  168.66  
9  1 LEU A 97  ? ? -115.18 52.61   
10 1 ASN A 203 ? ? -36.45  -128.99 
11 1 GLN A 204 ? ? 81.75   -82.12  
12 1 ARG A 238 ? ? -99.42  30.70   
13 1 SER A 274 ? ? 90.27   -24.99  
14 1 ALA A 299 ? ? -127.95 -155.66 
15 1 LYS A 361 ? ? -105.36 -111.19 
16 1 ALA A 363 ? ? -0.81   -52.51  
17 1 ALA A 400 ? ? -99.79  40.78   
18 1 ASN A 410 ? ? -64.87  -173.27 
19 1 ARG A 445 ? ? -111.61 58.27   
20 1 SER A 465 ? ? -120.07 -164.94 
21 1 LYS A 498 ? ? 82.51   61.80   
22 1 ILE A 499 ? ? -109.45 -135.93 
23 1 ASP A 509 ? ? 123.53  -26.96  
24 1 PRO A 710 ? ? -64.19  89.74   
25 1 ASN A 711 ? ? 175.04  -63.87  
26 1 ARG A 714 ? ? -29.40  -69.87  
27 1 THR A 742 ? ? -140.22 -8.94   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ASN 
_pdbx_validate_chiral.auth_seq_id     606 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 68  ? CG  ? A GLN 68  CG  
2  1 Y 1 A GLN 68  ? CD  ? A GLN 68  CD  
3  1 Y 1 A GLN 68  ? OE1 ? A GLN 68  OE1 
4  1 Y 1 A GLN 68  ? NE2 ? A GLN 68  NE2 
5  1 Y 1 A ASP 69  ? CG  ? A ASP 69  CG  
6  1 Y 1 A ASP 69  ? OD1 ? A ASP 69  OD1 
7  1 Y 1 A ASP 69  ? OD2 ? A ASP 69  OD2 
8  1 Y 1 A ARG 70  ? CG  ? A ARG 70  CG  
9  1 Y 1 A ARG 70  ? CD  ? A ARG 70  CD  
10 1 Y 1 A ARG 70  ? NE  ? A ARG 70  NE  
11 1 Y 1 A ARG 70  ? CZ  ? A ARG 70  CZ  
12 1 Y 1 A ARG 70  ? NH1 ? A ARG 70  NH1 
13 1 Y 1 A ARG 70  ? NH2 ? A ARG 70  NH2 
14 1 Y 1 A ASN 203 ? CG  ? A ASN 203 CG  
15 1 Y 1 A ASN 203 ? OD1 ? A ASN 203 OD1 
16 1 Y 1 A ASN 203 ? ND2 ? A ASN 203 ND2 
17 1 Y 1 A GLN 204 ? CG  ? A GLN 204 CG  
18 1 Y 1 A GLN 204 ? CD  ? A GLN 204 CD  
19 1 Y 1 A GLN 204 ? OE1 ? A GLN 204 OE1 
20 1 Y 1 A GLN 204 ? NE2 ? A GLN 204 NE2 
21 1 Y 1 A LYS 361 ? CG  ? A LYS 361 CG  
22 1 Y 1 A LYS 361 ? CD  ? A LYS 361 CD  
23 1 Y 1 A LYS 361 ? CE  ? A LYS 361 CE  
24 1 Y 1 A LYS 361 ? NZ  ? A LYS 361 NZ  
25 1 Y 1 A GLU 365 ? CG  ? A GLU 365 CG  
26 1 Y 1 A GLU 365 ? CD  ? A GLU 365 CD  
27 1 Y 1 A GLU 365 ? OE1 ? A GLU 365 OE1 
28 1 Y 1 A GLU 365 ? OE2 ? A GLU 365 OE2 
29 1 Y 1 A ARG 445 ? CG  ? A ARG 445 CG  
30 1 Y 1 A ARG 445 ? CD  ? A ARG 445 CD  
31 1 Y 1 A ARG 445 ? NE  ? A ARG 445 NE  
32 1 Y 1 A ARG 445 ? CZ  ? A ARG 445 CZ  
33 1 Y 1 A ARG 445 ? NH1 ? A ARG 445 NH1 
34 1 Y 1 A ARG 445 ? NH2 ? A ARG 445 NH2 
35 1 Y 1 A ASN 500 ? CG  ? A ASN 500 CG  
36 1 Y 1 A ASN 500 ? OD1 ? A ASN 500 OD1 
37 1 Y 1 A ASN 500 ? ND2 ? A ASN 500 ND2 
38 1 Y 1 A LYS 670 ? CG  ? A LYS 670 CG  
39 1 Y 1 A LYS 670 ? CD  ? A LYS 670 CD  
40 1 Y 1 A LYS 670 ? CE  ? A LYS 670 CE  
41 1 Y 1 A LYS 670 ? NZ  ? A LYS 670 NZ  
42 1 Y 1 A PRO 713 ? CG  ? A PRO 713 CG  
43 1 Y 1 A PRO 713 ? CD  ? A PRO 713 CD  
44 1 Y 1 A ARG 714 ? CG  ? A ARG 714 CG  
45 1 Y 1 A ARG 714 ? CD  ? A ARG 714 CD  
46 1 Y 1 A ARG 714 ? NE  ? A ARG 714 NE  
47 1 Y 1 A ARG 714 ? CZ  ? A ARG 714 CZ  
48 1 Y 1 A ARG 714 ? NH1 ? A ARG 714 NH1 
49 1 Y 1 A ARG 714 ? NH2 ? A ARG 714 NH2 
50 1 Y 1 A ASP 715 ? CG  ? A ASP 715 CG  
51 1 Y 1 A ASP 715 ? OD1 ? A ASP 715 OD1 
52 1 Y 1 A ASP 715 ? OD2 ? A ASP 715 OD2 
53 1 Y 1 A ARG 758 ? CG  ? A ARG 758 CG  
54 1 Y 1 A ARG 758 ? CD  ? A ARG 758 CD  
55 1 Y 1 A ARG 758 ? NE  ? A ARG 758 NE  
56 1 Y 1 A ARG 758 ? CZ  ? A ARG 758 CZ  
57 1 Y 1 A ARG 758 ? NH1 ? A ARG 758 NH1 
58 1 Y 1 A ARG 758 ? NH2 ? A ARG 758 NH2 
59 1 Y 1 A GLU 759 ? CG  ? A GLU 759 CG  
60 1 Y 1 A GLU 759 ? CD  ? A GLU 759 CD  
61 1 Y 1 A GLU 759 ? OE1 ? A GLU 759 OE1 
62 1 Y 1 A GLU 759 ? OE2 ? A GLU 759 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASN 206 ? A ASN 206 
3  1 Y 1 A GLY 207 ? A GLY 207 
4  1 Y 1 A SER 208 ? A SER 208 
5  1 Y 1 A TRP 501 ? A TRP 501 
6  1 Y 1 A THR 502 ? A THR 502 
7  1 Y 1 A PHE 503 ? A PHE 503 
8  1 Y 1 A ILE 504 ? A ILE 504 
9  1 Y 1 A ASP 505 ? A ASP 505 
10 1 Y 1 A PHE 506 ? A PHE 506 
11 1 Y 1 A GLY 507 ? A GLY 507 
12 1 Y 1 A LYS 622 ? A LYS 622 
13 1 Y 1 A LYS 623 ? A LYS 623 
14 1 Y 1 A GLY 624 ? A GLY 624 
15 1 Y 1 A ALA 625 ? A ALA 625 
16 1 Y 1 A ASN 626 ? A ASN 626 
17 1 Y 1 A LEU 760 ? A LEU 760 
18 1 Y 1 A PRO 761 ? A PRO 761 
19 1 Y 1 A ASN 762 ? A ASN 762 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                          MG  
3 "2'(3')-O-N-METHYLANTHRANILOYL-ADENOSINE-5'-DIPHOSPHATE" MNT 
4 'BERYLLIUM TRIFLUORIDE ION'                              BEF 
5 water                                                    HOH 
#