data_1LW0
# 
_entry.id   1LW0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LW0         
RCSB  RCSB016330   
WWPDB D_1000016330 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VRT '1VRT contains the same protein COMPLEXED WITH NEVIRAPINE'                                                             
unspecified 
PDB 1RTH '1RTH contains the same protein COMPLEXED WITH 1051U91'                                                                
unspecified 
PDB 1VRU '1VRU contains the same protein COMPLEXED WITH ALPHA-APA'                                                              
unspecified 
PDB 1RTI '1RTI contains the same protein COMPLEXED WITH HEPT'                                                                   
unspecified 
PDB 1RTJ '1RTJ contains the same protein'                                                                                       
unspecified 
PDB 1REV '1REV contains the same protein COMPLEXED WITH 9-CL-TIBO'                                                              
unspecified 
PDB 1RT1 '1RT1 contains the same protein COMPLEXED WITH MKC-442'                                                                
unspecified 
PDB 1RT2 '1RT2 contains the same protein COMPLEXED WITH TNK-651'                                                                
unspecified 
PDB 1KLM '1KLM contains the same protein COMPLEXED WITH BHAP (U-90152)'                                                         
unspecified 
PDB 1RT3 '1RT3 contains AZT DRUG RESISTANT HIV-1 RT MUTANT (RTMC) COMPLEXED WITH 1051U91'                                       
unspecified 
PDB 1RT4 '1RT4 contains the same protein COMPLEXED WITH UC-781'                                                                 
unspecified 
PDB 1RT5 '1RT5 contains the same protein COMPLEXED WITH UC-10'                                                                  
unspecified 
PDB 1RT6 '1RT6 contains the same protein COMPLEXED WITH UC-38'                                                                  
unspecified 
PDB 1RT7 '1RT7 contains the same protein COMPLEXED WITH UC-84'                                                                  
unspecified 
PDB 1C0T '1C0T contains the same protein COMPLEXED WITH BM+21.1326'                                                             
unspecified 
PDB 1C0U '1C0U contains the same protein COMPLEXED WITH BM+50.0934'                                                             
unspecified 
PDB 1C1B '1C1B contains the same protein COMPLEXED WITH GCA-186'                                                                
unspecified 
PDB 1C1C '1C1C contains the same protein COMPLEXED WITH TNK-6123'                                                               
unspecified 
PDB 1DTQ '1DTQ contains the same protein COMPLEXED WITH PETT-1'                                                                 
unspecified 
PDB 1DTT '1DTT contains the same protein COMPLEXED WITH PETT-2'                                                                 
unspecified 
PDB 1EP4 '1EP4 contains the same protein COMPLEXED WITH S-1153'                                                                 
unspecified 
PDB 1FK9 '1FK9 contains the same protein COMPLEXED WITH DMP-226 (EFAVIRENZ)'                                                    
unspecified 
PDB 1FKO '1FKO contains K103N MUTANT HIV-1 RT COMPLEXED WITH DMP-226 (EFAVIRENZ)'                                               
unspecified 
PDB 1FKP '1FKP contains K103N MUTANT HIV-1 RT COMPLEXED WITH NEVIRAPINE'                                                        
unspecified 
PDB 1JLA '1JLA contains Y181C MUTANT HIV-1 RT COMPLEXED TNK-651'                                                                
unspecified 
PDB 1JLB '1JLB contains Y181C MUTANT HIV-1 RT COMPLEXED WITH NEVIRAPINE'                                                        
unspecified 
PDB 1JLC '1JLC contains Y181C MUTANT HIV-1 RT COMPLEXED WITH PETT-2'                                                            
unspecified 
PDB 1JLE '1JLE contains Y188C MUTANT HIV-1 RT'                                                                                  
unspecified 
PDB 1JLF '1JLF contains Y188C MUTANT HIV-1 RT COMPLEXED WITH NEVIRAPINE'                                                        
unspecified 
PDB 1JLG '1JLG contains Y188C MUTANT HIV-1 RT COMPLEXED WITH UC-781'                                                            
unspecified 
PDB 1JKH '1JKH contains Y181C MUTANT HIV-1 RT COMPLEXED WITH DMP-226 (EFAVIRENZ)'                                               
unspecified 
PDB 1JLQ '1JLQ contains the same protein COMPLEXED WITH 739W94'                                                                 
unspecified 
PDB 1LW0 '1LW0 contains T215Y MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE'                                    
unspecified 
PDB 1LWC '1LWC contains M184V MUTANT HIV-1 REVERSE TRANSCRIPTAS IN COMPLEX WITH NEVIRAPINE'                                     
unspecified 
PDB 1LWE '1LWE contains M41L/T215Y MUTANT HIV-1 REVERSE TRANSCR (RTMN) IN COMPLEX WITH NEVIRAPINE'                              
unspecified 
PDB 1LWF '1LWF contains MUTANT HIV-1 REVERSE TRANSCRIPTASE (RTMQ+M184V: M41L/D67N/K70R/M184V/T215Y) IN COMPLEX WITH NEVIRAPINE' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LW0 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ren, J.'           1 
'Chamberlain, P.P.' 2 
'Nichols, C.E.'     3 
'Douglas, L.'       4 
'Stuart, D.I.'      5 
'Stammers, D.K.'    6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
;
J.Virol.                   76  10015 10019 2002 JOVIAM US 0022-538X 0825 ? 12208978 10.1128/JVI.76.19.10015-10019.2002 
1       
;Structural Mechanisms of Drug Resistance for Mutations at Codons 181 and 188 in HIV-1 Reverse Transcriptase and the Improved Resilience of Second Generation Non-Nucleoside Inhibitors
;
J.Mol.Biol.                312 795   805   2001 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.2001.4988             
2       '2-Amino-6-Arylsulfonylbenzonitriles as Non-Nucleoside reverse Transcriptase Inhibitors of HIV-1' J.Med.Chem. 44  1866  
1882  2001 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm0004906                  
3       'Structural Basis for the Resilience of Efavirenz (Dmp-266) to Drug Resistance Mutations in HIV-1 Reverse Transcriptase' 
Structure                  8   1089  1094  2000 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(00)00513-X'    
4       
;Binding of the Second Generation Non-Nucleoside Inhibitor S-1153 to HIV-1 Reverse Transcriptase Involves Extensive Main Chain Hydrogen Bonding
;
J.Biol.Chem.               275 14316 14320 2000 JBCHA3 US 0021-9258 0071 ? ?        10.1074/jbc.275.19.14316           
5       
;Phenethylthiazolylthiourea (Pett) Non-Nucleoside Inhibitors of HIV-1 and HIV-2 Reverse Transcriptases. Structural and Biochemical Analyses
;
J.Biol.Chem.               275 5633  5639  2000 JBCHA3 US 0021-9258 0071 ? ?        10.1074/jbc.275.8.5633             
6       
;Crystallographic Analysis of the Binding Modes of Thiazoloisoindolinone Non-Nucleoside Inhibitors to HIV-1 Reverse Transcriptase and Comparison with Modeling Studies
;
J.Med.Chem.                42  3845  3851  1999 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm990275t                  
7       'Design of Mkc-442 (Emivirine) Analogues with Improved Activity Against Drug-Resistant HIV Mutants' J.Med.Chem. 42  4500  
4505  1999 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm990192c                  
8       'Crystal Structures of HIV-1 Reverse Transcriptase in Complex with Carboxanilide Derivatives' Biochemistry               
37  14394 14403 1998 BICHAW US 0006-2960 0033 ? ?        10.1021/bi981309m                  
9       
;3'-Azido-3'-Deoxythymidine Drug Resistance Mutations in HIV-1 Reverse Transcriptase Can Induce Long Range Conformational Changes
;
Proc.Natl.Acad.Sci.USA     95  9518  9523  1998 PNASA6 US 0027-8424 0040 ? ?        10.1073/pnas.95.16.9518            
10      'Continuous and Discontinuous Changes in the Unit Cell of HIV-1 Reverse Transcriptase Crystals on Dehydration' 
'Acta Crystallogr.,Sect.D' 54  938   953   1998 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444998004284          
11      
;Unique Features in the Structure of the Complex between HIV-1 Reverse Transcriptase and the Bis(Heteroaryl)Piperazine (Bhap) U-90152 Explain Resistance Mutations for This Non-Nucleoside Inhibitor
;
Proc.Natl.Acad.Sci.USA     94  3984  3989  1997 PNASA6 US 0027-8424 0040 ? ?        10.1073/pnas.94.8.3984             
12      
;Complexes of HIV-1 Reverse Transcriptase with Inhibitors of the HEPT Series Reveal Conformational Changes Relevant to the Design of Potent Non-Nucleoside Inhibitors
;
J.Med.Chem.                39  1589  1600  1996 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm960056x                  
13      'The Structure of HIV-1 Reverse Transcriptase Complexed with 9-Chloro-TIBO: Lessons for Inhibitor Design' Structure 3   
915   926   1995 STRUE6 UK 0969-2126 2005 ? ?        ?                                  
14      'High Resolution Structures of HIV-1 RT from Four RT-Inhibitor Complexes' Nat.Struct.Biol.           2   293   302   1995 
NSBIEW US 1072-8368 2024 ? ?        ?                                  
15      'Mechanism of Inhibition of HIV-1 Reverse Transcriptase by Non-Nucleoside Inhibitors' Nat.Struct.Biol.           2   303   
308   1995 NSBIEW US 1072-8368 2024 ? ?        ?                                  
16      'Crystals of HIV-1 Reverse Transcriptase Diffracting to 2.2 A Resolution' J.Mol.Biol.                242 586   588   1994 
JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1994.1604             
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chamberlain, P.P.' 1   
primary 'Ren, J.'           2   
primary 'Nichols, C.E.'     3   
primary 'Douglas, L.'       4   
primary 'Lennerstrand, J.'  5   
primary 'Larder, B.A.'      6   
primary 'Stuart, D.I.'      7   
primary 'Stammers, D.K.'    8   
1       'Ren, J.'           9   
1       'Nichols, C.E.'     10  
1       'Bird, L.E.'        11  
1       'Chamberlain, P.'   12  
1       'Weaver, K.L.'      13  
1       'Short, S.A.'       14  
1       'Stuart, D.I.'      15  
1       'Stammers, D.K.'    16  
2       'Chan, J.H.'        17  
2       'Hong, J.S.'        18  
2       'Hunter III, R.N.'  19  
2       'Orr, G.F.'         20  
2       'Cowan, J.R.'       21  
2       'Sherman, D.B.'     22  
2       'Sparks, S.M.'      23  
2       'Reitter, B.E.'     24  
2       'Andrews III, C.W.' 25  
2       'Hazen, R.J.'       26  
2       'St Clair, M.'      27  
2       'Boone, L.R.'       28  
2       'Ferris, R.G.'      29  
2       'Creech, K.L.'      30  
2       'Roberts, G.B.'     31  
2       'Short, S.A.'       32  
2       'Weaver, K.L.'      33  
2       'Ott, R.J.'         34  
2       'Ren, J.'           35  
2       'Hopkins, A.L.'     36  
2       'Stuart, D.I.'      37  
2       'Stammers, D.K.'    38  
3       'Ren, J.'           39  
3       'Milton, J.'        40  
3       'Weaver, K.L.'      41  
3       'Short, S.A.'       42  
3       'Stuart, D.I.'      43  
3       'Stammers, D.K.'    44  
4       'Ren, J.'           45  
4       'Nichols, C.E.'     46  
4       'Bird, L.E.'        47  
4       'Fujiwara, T.'      48  
4       'Sugimoto, H.'      49  
4       'Stuart, D.I.'      50  
4       'Stammers, D.K.'    51  
5       'Ren, J.'           52  
5       'Diprose, J.'       53  
5       'Warren, J.'        54  
5       'Esnouf, R.M.'      55  
5       'Bird, L.E.'        56  
5       'Ikemizu, S.'       57  
5       'Slater, M.'        58  
5       'Milton, J.'        59  
5       'Balzarini, J.'     60  
5       'Stuart, D.I.'      61  
5       'Stammers, D.K.'    62  
6       'Ren, J.'           63  
6       'Esnouf, R.M.'      64  
6       'Hopkins, A.L.'     65  
6       'Stuart, D.I.'      66  
6       'Stammers, D.K.'    67  
7       'Hopkins, A.L.'     68  
7       'Ren, J.'           69  
7       'Tanaka, H.'        70  
7       'Baba, M.'          71  
7       'Okamato, M.'       72  
7       'Stuart, D.I.'      73  
7       'Stammers, D.K.'    74  
8       'Ren, J.'           75  
8       'Esnouf, R.M.'      76  
8       'Hopkins, A.L.'     77  
8       'Warren, J.'        78  
8       'Balzarini, J.'     79  
8       'Stuart, D.I.'      80  
8       'Stammers, D.K.'    81  
9       'Ren, J.'           82  
9       'Esnouf, R.M.'      83  
9       'Hopkins, A.L.'     84  
9       'Jones, E.Y.'       85  
9       'Kirby, I.'         86  
9       'Keeling, J.'       87  
9       'Ross, C.K.'        88  
9       'Larder, B.A.'      89  
9       'Stuart, D.I.'      90  
9       'Stammers, D.K.'    91  
10      'Esnouf, R.M.'      92  
10      'Ren, J.'           93  
10      'Garman, E.F.'      94  
10      'Somers, D.O.'      95  
10      'Ross, C.K.'        96  
10      'Jones, E.Y.'       97  
10      'Stammers, D.K.'    98  
10      'Stuart, D.I.'      99  
11      'Esnouf, R.M.'      100 
11      'Ren, J.'           101 
11      'Hopkins, A.L.'     102 
11      'Ross, C.K.'        103 
11      'Jones, E.Y.'       104 
11      'Stammers, D.K.'    105 
11      'Stuart, D.I.'      106 
12      'Hopkins, A.L.'     107 
12      'Ren, J.'           108 
12      'Esnouf, R.M.'      109 
12      'Willcox, B.E.'     110 
12      'Jones, E.Y.'       111 
12      'Ross, C.K.'        112 
12      'Miyasaka, T.'      113 
12      'Walker, R.T.'      114 
12      'Tanaka, H.'        115 
12      'Stammers, D.K.'    116 
12      'Stuart, D.I.'      117 
13      'Ren, J.'           118 
13      'Esnouf, R.M.'      119 
13      'Hopkins, A.L.'     120 
13      'Ross, C.K.'        121 
13      'Jones, E.Y.'       122 
13      'Stammers, D.K.'    123 
13      'Stuart, D.I.'      124 
14      'Ren, J.'           125 
14      'Esnouf, R.M.'      126 
14      'Garman, E.'        127 
14      'Somers, D.O.'      128 
14      'Ross, C.K.'        129 
14      'Kirby, I.'         130 
14      'Keeling, J.'       131 
14      'Darby, G.'         132 
14      'Jones, E.Y.'       133 
14      'Stuart, D.I.'      134 
14      'Stammers, D.K.'    135 
15      'Esnouf, R.M.'      136 
15      'Ren, J.'           137 
15      'Ross, C.K.'        138 
15      'Jones, E.Y.'       139 
15      'Stammers, D.K.'    140 
15      'Stuart, D.I.'      141 
16      'Stammers, D.K.'    142 
16      'Somers, D.O.'      143 
16      'Ross, C.K.'        144 
16      'Kirby, I.'         145 
16      'Ray, P.H.'         146 
16      'Wilson, J.E.'      147 
16      'Norman, M.'        148 
16      'Ren, J.'           149 
16      'Esnouf, R.M.'      150 
16      'Garman, E.'        151 
16      'Jones, E.Y.'       152 
16      'Stuart, D.I.'      153 
# 
_cell.entry_id           1LW0 
_cell.length_a           139.700 
_cell.length_b           115.000 
_cell.length_c           65.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LW0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE'                                                        64657.020 1 2.7.7.49 T215Y 
p66 ? 
2 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE'                                                        51461.117 1 2.7.7.49 T215Y 
p51 ? 
3 non-polymer syn 'PHOSPHATE ION'                                                                      94.971    2 ?        ?     
?   ? 
4 non-polymer syn "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 266.298   1 ?        ?     
?   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HIV-1 RT' 
2 'HIV-1 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQL(CSD)KLLRGTKALTEVIPLTEEAELELAENREILKEPVHG
VYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKE
TWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQK
TELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
RKVL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)' no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 TYR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 CSD n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 ARG n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 VAL n 
1 560 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 TYR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 CYS n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Lentivirus 'HIV-1 POL' ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? TG-1 ? ? ? ? ? ? ? plasmid ? ? ? pkk233-2 ? ? 
2 1 sample ? ? ? ? Lentivirus 'HIV-1 POL' ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? TG-1 ? ? ? ? ? ? ? plasmid ? ? ? pkk233-2 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1H2 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
156 P04585 ? 
2 UNP POL_HV1H2 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
156 P04585 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LW0 A 1 ? 560 ? P04585 156 ? 715 ? 1 560 
2 2 1LW0 B 1 ? 440 ? P04585 156 ? 595 ? 1 440 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LW0 TYR A 215 ? UNP P04585 THR 370 ENGINEERED         215 1 
1 1LW0 CSD A 280 ? UNP P04585 CYS 435 'MODIFIED RESIDUE' 280 2 
2 1LW0 TYR B 215 ? UNP P04585 THR 370 ENGINEERED         215 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                              ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                                             ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                           ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                      ? 'C4 H7 N O4'     
133.103 
CSD 'L-peptide linking' n 3-SULFINOALANINE                                                                     
'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S'   153.157 
CYS 'L-peptide linking' y CYSTEINE                                                                             ? 'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                            ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                      ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                                              ? 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                            ? 'C6 H10 N3 O2 1' 
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                           ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                              ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                                               ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                           ? 'C5 H11 N O2 S'  
149.211 
NVP non-polymer         . "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 
'NON-NUCLEOSIDE RT INHIBITOR NEVIRAPINE'     'C15 H14 N4 O'   266.298 
PHE 'L-peptide linking' y PHENYLALANINE                                                                        ? 'C9 H11 N O2'    
165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                                      ? 'O4 P -3'        
94.971  
PRO 'L-peptide linking' y PROLINE                                                                              ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                                               ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                                            ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                           ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                             ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                                               ? 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          1LW0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.76 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_details    'pH 5.00, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   1998-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9903 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID2 
_diffrn_source.pdbx_wavelength             0.9903 
_diffrn_source.pdbx_wavelength_list        0.9903 
# 
_reflns.entry_id                     1LW0 
_reflns.observed_criterion_sigma_I   -1.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   25400 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.0610000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.8 
_reflns.B_iso_Wilson_estimate        68.9 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   78.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LW0 
_refine.ls_number_reflns_obs                     25107 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1863893.73 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.ls_d_res_low                             29.85 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    93.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2190000 
_refine.ls_R_factor_R_free                       0.3010000 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1257 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               83.3 
_refine.aniso_B[1][1]                            -7.15 
_refine.aniso_B[2][2]                            -4.77 
_refine.aniso_B[3][3]                            11.92 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.299321 
_refine.solvent_model_param_bsol                 34.1635 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LW0 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.56 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7516 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7546 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        29.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.2  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.13  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             4.97  4.00  ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            8.23  8.00  ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             8.32  6.00  ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            12.68 12.00 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.90 
_refine_ls_shell.number_reflns_R_work             2167 
_refine_ls_shell.R_factor_R_work                  0.3440000 
_refine_ls_shell.percent_reflns_obs               87.2 
_refine_ls_shell.R_factor_R_free                  0.4090000 
_refine_ls_shell.R_factor_R_free_error            0.038 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LW0 
_struct.title                     'CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
_struct.pdbx_descriptor           'REVERSE TRANSCRIPTASE(E.C.2.7.7.49)/NEVIRAPINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LW0 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'HIV-1 REVERSE TRANSCRIPTASE, AIDS, AZT, 3TC, NRTI, NEVIRAPINE, DRUG RESISTANCE MUTATIONS, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'HIV-1 RT is a heterodimer consisting of a p66 and a p51 subunits, the p51 contains the first 440 residues of the p66.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 27  ? GLU A 44  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  2  PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  3  HIS A 96  ? LEU A 100 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  4  ALA A 114 ? VAL A 118 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  5  PHE A 124 ? ALA A 129 ? PHE A 124 ALA A 129 5 ? 6  
HELX_P HELX_P6  6  GLY A 155 ? ASN A 175 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  7  GLU A 194 ? ARG A 211 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P8  8  VAL A 254 ? GLN A 269 ? VAL A 254 GLN A 269 1 ? 16 
HELX_P HELX_P9  9  VAL A 276 ? LEU A 282 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P10 10 THR A 296 ? GLU A 312 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P11 11 ASN A 363 ? TRP A 383 ? ASN A 363 TRP A 383 1 ? 21 
HELX_P HELX_P12 12 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P13 13 THR A 473 ? SER A 489 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P14 14 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P15 15 SER A 515 ? LYS A 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P16 16 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P17 17 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P18 18 GLY B 99  ? LYS B 103 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P19 19 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P20 20 PHE B 124 ? ALA B 129 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P21 21 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P22 22 LYS B 154 ? ASN B 175 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P23 23 GLU B 194 ? TRP B 212 ? GLU B 194 TRP B 212 1 ? 19 
HELX_P HELX_P24 24 LEU B 228 ? GLY B 231 ? LEU B 228 GLY B 231 5 ? 4  
HELX_P HELX_P25 25 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P26 26 THR B 253 ? GLN B 269 ? THR B 253 GLN B 269 1 ? 17 
HELX_P HELX_P27 27 VAL B 276 ? LEU B 282 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P28 28 THR B 296 ? LEU B 310 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P29 29 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P30 30 GLN B 394 ? TRP B 406 ? GLN B 394 TRP B 406 1 ? 13 
HELX_P HELX_P31 31 PRO B 420 ? TRP B 426 ? PRO B 420 TRP B 426 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LEU 279 C ? ? ? 1_555 A CSD 280 N ? ? A LEU 279 A CSD 280 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2 covale ? ? A CSD 280 C ? ? ? 1_555 A LYS 281 N ? ? A CSD 280 A LYS 281 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 0.16 
2 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 0.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 2 ? 
F ? 5 ? 
G ? 2 ? 
H ? 5 ? 
I ? 3 ? 
J ? 2 ? 
K ? 4 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 47  ? LYS A 49  ? ILE A 47  LYS A 49  
A 2 ARG A 143 ? TYR A 146 ? ARG A 143 TYR A 146 
A 3 PHE A 130 ? THR A 131 ? PHE A 130 THR A 131 
B 1 VAL A 60  ? PHE A 61  ? VAL A 60  PHE A 61  
B 2 LEU A 74  ? VAL A 75  ? LEU A 74  VAL A 75  
C 1 SER A 105 ? VAL A 108 ? SER A 105 VAL A 108 
C 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
C 3 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
D 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
D 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
D 3 LYS A 238 ? THR A 240 ? LYS A 238 THR A 240 
D 4 GLY A 316 ? VAL A 317 ? GLY A 316 VAL A 317 
E 1 TRP A 252 ? THR A 253 ? TRP A 252 THR A 253 
E 2 VAL A 292 ? ILE A 293 ? VAL A 292 ILE A 293 
F 1 LYS A 347 ? TYR A 354 ? LYS A 347 TYR A 354 
F 2 GLN A 336 ? GLU A 344 ? GLN A 336 GLU A 344 
F 3 ILE A 326 ? GLY A 333 ? ILE A 326 GLY A 333 
F 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
F 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
G 1 HIS A 361 ? THR A 362 ? HIS A 361 THR A 362 
G 2 GLN A 512 ? SER A 513 ? GLN A 512 SER A 513 
H 1 GLN A 464 ? VAL A 466 ? GLN A 464 VAL A 466 
H 2 GLY A 456 ? THR A 459 ? GLY A 456 THR A 459 
H 3 THR A 439 ? VAL A 442 ? THR A 439 VAL A 442 
H 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
H 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
I 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
I 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
I 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
J 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
J 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
K 1 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
K 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
K 3 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
K 4 GLU B 233 ? LEU B 234 ? GLU B 233 LEU B 234 
L 1 LYS B 347 ? ALA B 355 ? LYS B 347 ALA B 355 
L 2 GLN B 336 ? GLU B 344 ? GLN B 336 GLU B 344 
L 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
L 4 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
L 5 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 48  ? N SER A 48  O GLN A 145 ? O GLN A 145 
A 2 3 O TYR A 144 ? O TYR A 144 N PHE A 130 ? N PHE A 130 
B 1 2 N PHE A 61  ? N PHE A 61  O LEU A 74  ? O LEU A 74  
C 1 2 N THR A 107 ? N THR A 107 O VAL A 189 ? O VAL A 189 
C 2 3 O TYR A 188 ? O TYR A 188 N TYR A 181 ? N TYR A 181 
D 1 2 N PHE A 227 ? N PHE A 227 O LEU A 234 ? O LEU A 234 
D 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
D 3 4 N TRP A 239 ? N TRP A 239 O GLY A 316 ? O GLY A 316 
E 1 2 N TRP A 252 ? N TRP A 252 O ILE A 293 ? O ILE A 293 
F 1 2 O LYS A 350 ? O LYS A 350 N ILE A 341 ? N ILE A 341 
F 2 3 O TYR A 342 ? O TYR A 342 N ILE A 326 ? N ILE A 326 
F 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
F 4 5 N PHE A 389 ? N PHE A 389 O GLU A 415 ? O GLU A 415 
G 1 2 O THR A 362 ? O THR A 362 N GLN A 512 ? N GLN A 512 
H 1 2 O LYS A 465 ? O LYS A 465 N TYR A 457 ? N TYR A 457 
H 2 3 O VAL A 458 ? O VAL A 458 N TYR A 441 ? N TYR A 441 
H 3 4 N PHE A 440 ? N PHE A 440 O VAL A 496 ? O VAL A 496 
H 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
I 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
I 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
J 1 2 N PHE B 61  ? N PHE B 61  O LEU B 74  ? O LEU B 74  
K 1 2 N TYR B 181 ? N TYR B 181 O TYR B 188 ? O TYR B 188 
K 2 3 O VAL B 189 ? O VAL B 189 N THR B 107 ? N THR B 107 
K 3 4 N VAL B 106 ? N VAL B 106 O LEU B 234 ? O LEU B 234 
L 1 2 O TYR B 354 ? O TYR B 354 N TRP B 337 ? N TRP B 337 
L 2 3 O TYR B 342 ? O TYR B 342 N ILE B 326 ? N ILE B 326 
L 3 4 N ALA B 327 ? N ALA B 327 O LYS B 390 ? O LYS B 390 
L 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 A 1300' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 A 1301' 
AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE NVP A 999'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 MET A 41  ? MET A 41  . ? 1_555 ? 
2  AC1 5 LYS A 73  ? LYS A 73  . ? 1_555 ? 
3  AC1 5 PHE A 116 ? PHE A 116 . ? 1_555 ? 
4  AC1 5 TYR A 146 ? TYR A 146 . ? 1_555 ? 
5  AC1 5 GLN A 151 ? GLN A 151 . ? 1_555 ? 
6  AC2 6 GLN A 197 ? GLN A 197 . ? 3_555 ? 
7  AC2 6 LYS A 201 ? LYS A 201 . ? 3_555 ? 
8  AC2 6 LYS A 275 ? LYS A 275 . ? 1_555 ? 
9  AC2 6 ARG A 277 ? ARG A 277 . ? 1_555 ? 
10 AC2 6 GLU A 302 ? GLU A 302 . ? 1_555 ? 
11 AC2 6 GLN A 332 ? GLN A 332 . ? 1_555 ? 
12 AC3 9 LYS A 101 ? LYS A 101 . ? 1_555 ? 
13 AC3 9 VAL A 106 ? VAL A 106 . ? 1_555 ? 
14 AC3 9 VAL A 179 ? VAL A 179 . ? 1_555 ? 
15 AC3 9 TYR A 181 ? TYR A 181 . ? 1_555 ? 
16 AC3 9 TYR A 188 ? TYR A 188 . ? 1_555 ? 
17 AC3 9 GLY A 190 ? GLY A 190 . ? 1_555 ? 
18 AC3 9 PHE A 227 ? PHE A 227 . ? 1_555 ? 
19 AC3 9 HIS A 235 ? HIS A 235 . ? 1_555 ? 
20 AC3 9 TYR A 318 ? TYR A 318 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LW0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LW0 
_atom_sites.fract_transf_matrix[1][1]   0.007158 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008696 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015244 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 4   ? 15.249  -58.714 35.460  1.00 132.09 ? 4    PRO A N   1 
ATOM   2    C CA  . PRO A 1 4   ? 14.357  -57.559 35.616  1.00 131.71 ? 4    PRO A CA  1 
ATOM   3    C C   . PRO A 1 4   ? 15.031  -56.604 34.657  1.00 136.14 ? 4    PRO A C   1 
ATOM   4    O O   . PRO A 1 4   ? 15.209  -56.921 33.481  1.00 140.80 ? 4    PRO A O   1 
ATOM   5    C CB  . PRO A 1 4   ? 14.533  -57.086 37.041  1.00 124.88 ? 4    PRO A CB  1 
ATOM   6    C CG  . PRO A 1 4   ? 16.062  -57.399 37.264  1.00 128.00 ? 4    PRO A CG  1 
ATOM   7    C CD  . PRO A 1 4   ? 16.491  -58.473 36.218  1.00 128.89 ? 4    PRO A CD  1 
ATOM   8    N N   . ILE A 1 5   ? 15.448  -55.455 35.172  1.00 131.98 ? 5    ILE A N   1 
ATOM   9    C CA  . ILE A 1 5   ? 16.145  -54.478 34.355  1.00 124.17 ? 5    ILE A CA  1 
ATOM   10   C C   . ILE A 1 5   ? 17.603  -54.395 34.779  1.00 115.88 ? 5    ILE A C   1 
ATOM   11   O O   . ILE A 1 5   ? 17.959  -54.683 35.921  1.00 112.76 ? 5    ILE A O   1 
ATOM   12   C CB  . ILE A 1 5   ? 15.481  -53.077 34.456  1.00 123.62 ? 5    ILE A CB  1 
ATOM   13   C CG1 . ILE A 1 5   ? 16.489  -51.980 34.067  1.00 127.88 ? 5    ILE A CG1 1 
ATOM   14   C CG2 . ILE A 1 5   ? 14.891  -52.879 35.852  1.00 112.35 ? 5    ILE A CG2 1 
ATOM   15   C CD1 . ILE A 1 5   ? 16.935  -51.998 32.602  1.00 123.80 ? 5    ILE A CD1 1 
ATOM   16   N N   . GLU A 1 6   ? 18.449  -54.021 33.834  1.00 110.60 ? 6    GLU A N   1 
ATOM   17   C CA  . GLU A 1 6   ? 19.860  -53.886 34.106  1.00 107.34 ? 6    GLU A CA  1 
ATOM   18   C C   . GLU A 1 6   ? 20.062  -52.914 35.266  1.00 96.91  ? 6    GLU A C   1 
ATOM   19   O O   . GLU A 1 6   ? 19.120  -52.254 35.712  1.00 92.91  ? 6    GLU A O   1 
ATOM   20   C CB  . GLU A 1 6   ? 20.574  -53.364 32.855  1.00 117.33 ? 6    GLU A CB  1 
ATOM   21   C CG  . GLU A 1 6   ? 22.083  -53.304 32.987  1.00 134.80 ? 6    GLU A CG  1 
ATOM   22   C CD  . GLU A 1 6   ? 22.662  -54.602 33.524  1.00 147.71 ? 6    GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 6   ? 22.476  -54.910 34.727  1.00 150.00 ? 6    GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 6   ? 23.298  -55.325 32.732  1.00 149.99 ? 6    GLU A OE2 1 
ATOM   25   N N   . THR A 1 7   ? 21.299  -52.837 35.752  1.00 88.67  ? 7    THR A N   1 
ATOM   26   C CA  . THR A 1 7   ? 21.655  -51.929 36.835  1.00 75.67  ? 7    THR A CA  1 
ATOM   27   C C   . THR A 1 7   ? 22.719  -50.915 36.353  1.00 67.38  ? 7    THR A C   1 
ATOM   28   O O   . THR A 1 7   ? 23.787  -51.276 35.826  1.00 55.34  ? 7    THR A O   1 
ATOM   29   C CB  . THR A 1 7   ? 22.089  -52.754 38.113  1.00 63.30  ? 7    THR A CB  1 
ATOM   30   O OG1 . THR A 1 7   ? 21.072  -52.599 39.115  1.00 56.73  ? 7    THR A OG1 1 
ATOM   31   C CG2 . THR A 1 7   ? 23.471  -52.328 38.672  1.00 26.78  ? 7    THR A CG2 1 
ATOM   32   N N   . VAL A 1 8   ? 22.372  -49.638 36.490  1.00 58.91  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? 23.245  -48.550 36.081  1.00 55.45  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? 24.302  -48.324 37.130  1.00 55.88  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? 23.987  -47.945 38.256  1.00 66.24  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? 22.482  -47.230 35.971  1.00 60.24  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? 23.304  -46.228 35.184  1.00 42.21  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? 21.115  -47.464 35.363  1.00 67.84  ? 8    VAL A CG2 1 
ATOM   39   N N   . PRO A 1 9   ? 25.570  -48.547 36.786  1.00 52.98  ? 9    PRO A N   1 
ATOM   40   C CA  . PRO A 1 9   ? 26.658  -48.345 37.751  1.00 59.84  ? 9    PRO A CA  1 
ATOM   41   C C   . PRO A 1 9   ? 26.814  -46.895 38.213  1.00 66.33  ? 9    PRO A C   1 
ATOM   42   O O   . PRO A 1 9   ? 27.076  -46.013 37.396  1.00 78.41  ? 9    PRO A O   1 
ATOM   43   C CB  . PRO A 1 9   ? 27.892  -48.838 36.992  1.00 51.38  ? 9    PRO A CB  1 
ATOM   44   C CG  . PRO A 1 9   ? 27.517  -48.667 35.572  1.00 47.05  ? 9    PRO A CG  1 
ATOM   45   C CD  . PRO A 1 9   ? 26.084  -49.135 35.545  1.00 54.40  ? 9    PRO A CD  1 
ATOM   46   N N   . VAL A 1 10  ? 26.674  -46.651 39.517  1.00 63.64  ? 10   VAL A N   1 
ATOM   47   C CA  . VAL A 1 10  ? 26.801  -45.301 40.048  1.00 57.25  ? 10   VAL A CA  1 
ATOM   48   C C   . VAL A 1 10  ? 28.128  -45.124 40.761  1.00 57.71  ? 10   VAL A C   1 
ATOM   49   O O   . VAL A 1 10  ? 28.793  -46.096 41.079  1.00 56.62  ? 10   VAL A O   1 
ATOM   50   C CB  . VAL A 1 10  ? 25.678  -44.991 41.043  1.00 48.36  ? 10   VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 10  ? 25.681  -43.523 41.383  1.00 46.76  ? 10   VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 10  ? 24.348  -45.382 40.457  1.00 54.21  ? 10   VAL A CG2 1 
ATOM   53   N N   . LYS A 1 11  ? 28.513  -43.878 40.998  1.00 56.36  ? 11   LYS A N   1 
ATOM   54   C CA  . LYS A 1 11  ? 29.743  -43.575 41.705  1.00 56.17  ? 11   LYS A CA  1 
ATOM   55   C C   . LYS A 1 11  ? 29.586  -42.231 42.393  1.00 58.86  ? 11   LYS A C   1 
ATOM   56   O O   . LYS A 1 11  ? 28.830  -41.368 41.937  1.00 57.50  ? 11   LYS A O   1 
ATOM   57   C CB  . LYS A 1 11  ? 30.915  -43.502 40.737  1.00 57.01  ? 11   LYS A CB  1 
ATOM   58   C CG  . LYS A 1 11  ? 31.504  -44.833 40.334  1.00 69.24  ? 11   LYS A CG  1 
ATOM   59   C CD  . LYS A 1 11  ? 32.702  -44.654 39.377  1.00 89.17  ? 11   LYS A CD  1 
ATOM   60   C CE  . LYS A 1 11  ? 33.821  -43.780 39.970  1.00 98.43  ? 11   LYS A CE  1 
ATOM   61   N NZ  . LYS A 1 11  ? 34.966  -43.541 39.029  1.00 89.70  ? 11   LYS A NZ  1 
ATOM   62   N N   . LEU A 1 12  ? 30.287  -42.052 43.500  1.00 57.23  ? 12   LEU A N   1 
ATOM   63   C CA  . LEU A 1 12  ? 30.224  -40.777 44.197  1.00 67.53  ? 12   LEU A CA  1 
ATOM   64   C C   . LEU A 1 12  ? 31.272  -39.935 43.527  1.00 71.03  ? 12   LEU A C   1 
ATOM   65   O O   . LEU A 1 12  ? 32.163  -40.483 42.878  1.00 78.87  ? 12   LEU A O   1 
ATOM   66   C CB  . LEU A 1 12  ? 30.616  -40.922 45.663  1.00 69.96  ? 12   LEU A CB  1 
ATOM   67   C CG  . LEU A 1 12  ? 29.781  -41.831 46.548  1.00 59.22  ? 12   LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 12  ? 30.519  -42.040 47.831  1.00 56.30  ? 12   LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 12  ? 28.423  -41.212 46.795  1.00 67.00  ? 12   LEU A CD2 1 
ATOM   70   N N   . LYS A 1 13  ? 31.184  -38.617 43.687  1.00 73.08  ? 13   LYS A N   1 
ATOM   71   C CA  . LYS A 1 13  ? 32.189  -37.737 43.100  1.00 81.25  ? 13   LYS A CA  1 
ATOM   72   C C   . LYS A 1 13  ? 33.549  -38.149 43.679  1.00 96.62  ? 13   LYS A C   1 
ATOM   73   O O   . LYS A 1 13  ? 33.638  -38.564 44.836  1.00 99.95  ? 13   LYS A O   1 
ATOM   74   C CB  . LYS A 1 13  ? 31.869  -36.259 43.398  1.00 69.58  ? 13   LYS A CB  1 
ATOM   75   C CG  . LYS A 1 13  ? 30.593  -35.775 42.692  1.00 52.52  ? 13   LYS A CG  1 
ATOM   76   C CD  . LYS A 1 13  ? 30.433  -34.260 42.671  1.00 50.79  ? 13   LYS A CD  1 
ATOM   77   C CE  . LYS A 1 13  ? 29.064  -33.909 42.087  1.00 52.22  ? 13   LYS A CE  1 
ATOM   78   N NZ  . LYS A 1 13  ? 28.633  -32.489 42.255  1.00 69.00  ? 13   LYS A NZ  1 
ATOM   79   N N   . PRO A 1 14  ? 34.623  -38.051 42.874  1.00 110.36 ? 14   PRO A N   1 
ATOM   80   C CA  . PRO A 1 14  ? 35.988  -38.419 43.280  1.00 118.60 ? 14   PRO A CA  1 
ATOM   81   C C   . PRO A 1 14  ? 36.475  -37.816 44.602  1.00 122.33 ? 14   PRO A C   1 
ATOM   82   O O   . PRO A 1 14  ? 36.178  -36.656 44.922  1.00 123.56 ? 14   PRO A O   1 
ATOM   83   C CB  . PRO A 1 14  ? 36.835  -37.967 42.089  1.00 120.92 ? 14   PRO A CB  1 
ATOM   84   C CG  . PRO A 1 14  ? 36.088  -36.762 41.606  1.00 121.87 ? 14   PRO A CG  1 
ATOM   85   C CD  . PRO A 1 14  ? 34.660  -37.277 41.619  1.00 117.18 ? 14   PRO A CD  1 
ATOM   86   N N   . GLY A 1 15  ? 37.232  -38.619 45.353  1.00 121.78 ? 15   GLY A N   1 
ATOM   87   C CA  . GLY A 1 15  ? 37.759  -38.179 46.632  1.00 117.53 ? 15   GLY A CA  1 
ATOM   88   C C   . GLY A 1 15  ? 36.643  -37.801 47.589  1.00 110.36 ? 15   GLY A C   1 
ATOM   89   O O   . GLY A 1 15  ? 36.791  -36.886 48.395  1.00 112.12 ? 15   GLY A O   1 
ATOM   90   N N   . MET A 1 16  ? 35.517  -38.500 47.497  1.00 99.59  ? 16   MET A N   1 
ATOM   91   C CA  . MET A 1 16  ? 34.396  -38.213 48.366  1.00 89.05  ? 16   MET A CA  1 
ATOM   92   C C   . MET A 1 16  ? 33.824  -39.478 48.935  1.00 91.14  ? 16   MET A C   1 
ATOM   93   O O   . MET A 1 16  ? 33.741  -40.519 48.258  1.00 85.10  ? 16   MET A O   1 
ATOM   94   C CB  . MET A 1 16  ? 33.311  -37.454 47.625  1.00 78.12  ? 16   MET A CB  1 
ATOM   95   C CG  . MET A 1 16  ? 33.124  -36.069 48.148  1.00 70.14  ? 16   MET A CG  1 
ATOM   96   S SD  . MET A 1 16  ? 32.312  -35.058 46.921  1.00 84.72  ? 16   MET A SD  1 
ATOM   97   C CE  . MET A 1 16  ? 31.378  -33.903 47.940  1.00 75.76  ? 16   MET A CE  1 
ATOM   98   N N   . ASP A 1 17  ? 33.422  -39.361 50.195  1.00 93.79  ? 17   ASP A N   1 
ATOM   99   C CA  . ASP A 1 17  ? 32.868  -40.470 50.945  1.00 90.17  ? 17   ASP A CA  1 
ATOM   100  C C   . ASP A 1 17  ? 31.370  -40.278 51.050  1.00 80.78  ? 17   ASP A C   1 
ATOM   101  O O   . ASP A 1 17  ? 30.869  -39.180 50.796  1.00 76.00  ? 17   ASP A O   1 
ATOM   102  C CB  . ASP A 1 17  ? 33.507  -40.495 52.338  1.00 97.65  ? 17   ASP A CB  1 
ATOM   103  C CG  . ASP A 1 17  ? 33.577  -41.888 52.922  1.00 97.03  ? 17   ASP A CG  1 
ATOM   104  O OD1 . ASP A 1 17  ? 33.361  -42.863 52.163  1.00 82.49  ? 17   ASP A OD1 1 
ATOM   105  O OD2 . ASP A 1 17  ? 33.861  -42.002 54.136  1.00 108.39 ? 17   ASP A OD2 1 
ATOM   106  N N   . GLY A 1 18  ? 30.667  -41.349 51.411  1.00 78.31  ? 18   GLY A N   1 
ATOM   107  C CA  . GLY A 1 18  ? 29.226  -41.280 51.561  1.00 83.03  ? 18   GLY A CA  1 
ATOM   108  C C   . GLY A 1 18  ? 28.797  -40.314 52.659  1.00 89.03  ? 18   GLY A C   1 
ATOM   109  O O   . GLY A 1 18  ? 29.630  -39.866 53.464  1.00 88.19  ? 18   GLY A O   1 
ATOM   110  N N   . PRO A 1 19  ? 27.490  -39.979 52.725  1.00 91.30  ? 19   PRO A N   1 
ATOM   111  C CA  . PRO A 1 19  ? 26.961  -39.056 53.736  1.00 89.33  ? 19   PRO A CA  1 
ATOM   112  C C   . PRO A 1 19  ? 26.914  -39.643 55.154  1.00 89.08  ? 19   PRO A C   1 
ATOM   113  O O   . PRO A 1 19  ? 26.324  -40.693 55.410  1.00 85.60  ? 19   PRO A O   1 
ATOM   114  C CB  . PRO A 1 19  ? 25.567  -38.727 53.199  1.00 85.77  ? 19   PRO A CB  1 
ATOM   115  C CG  . PRO A 1 19  ? 25.128  -40.048 52.625  1.00 82.44  ? 19   PRO A CG  1 
ATOM   116  C CD  . PRO A 1 19  ? 26.393  -40.513 51.885  1.00 88.20  ? 19   PRO A CD  1 
ATOM   117  N N   . LYS A 1 20  ? 27.537  -38.950 56.086  1.00 91.74  ? 20   LYS A N   1 
ATOM   118  C CA  . LYS A 1 20  ? 27.536  -39.417 57.453  1.00 91.69  ? 20   LYS A CA  1 
ATOM   119  C C   . LYS A 1 20  ? 26.770  -38.410 58.303  1.00 95.29  ? 20   LYS A C   1 
ATOM   120  O O   . LYS A 1 20  ? 27.372  -37.662 59.079  1.00 100.93 ? 20   LYS A O   1 
ATOM   121  C CB  . LYS A 1 20  ? 28.975  -39.544 57.939  1.00 87.18  ? 20   LYS A CB  1 
ATOM   122  C CG  . LYS A 1 20  ? 29.314  -40.942 58.370  1.00 86.37  ? 20   LYS A CG  1 
ATOM   123  C CD  . LYS A 1 20  ? 30.160  -41.690 57.356  1.00 86.14  ? 20   LYS A CD  1 
ATOM   124  C CE  . LYS A 1 20  ? 31.643  -41.343 57.496  1.00 84.88  ? 20   LYS A CE  1 
ATOM   125  N NZ  . LYS A 1 20  ? 32.543  -42.410 56.935  1.00 75.22  ? 20   LYS A NZ  1 
ATOM   126  N N   . VAL A 1 21  ? 25.445  -38.384 58.170  1.00 90.96  ? 21   VAL A N   1 
ATOM   127  C CA  . VAL A 1 21  ? 24.673  -37.412 58.933  1.00 89.41  ? 21   VAL A CA  1 
ATOM   128  C C   . VAL A 1 21  ? 23.621  -37.956 59.915  1.00 90.98  ? 21   VAL A C   1 
ATOM   129  O O   . VAL A 1 21  ? 22.822  -38.834 59.595  1.00 83.35  ? 21   VAL A O   1 
ATOM   130  C CB  . VAL A 1 21  ? 24.066  -36.303 57.968  1.00 79.97  ? 21   VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 21  ? 24.143  -36.749 56.517  1.00 76.42  ? 21   VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 21  ? 22.642  -35.988 58.335  1.00 73.27  ? 21   VAL A CG2 1 
ATOM   133  N N   . LYS A 1 22  ? 23.676  -37.397 61.124  1.00 97.54  ? 22   LYS A N   1 
ATOM   134  C CA  . LYS A 1 22  ? 22.819  -37.707 62.266  1.00 98.24  ? 22   LYS A CA  1 
ATOM   135  C C   . LYS A 1 22  ? 21.312  -37.548 62.048  1.00 98.01  ? 22   LYS A C   1 
ATOM   136  O O   . LYS A 1 22  ? 20.845  -36.497 61.593  1.00 96.43  ? 22   LYS A O   1 
ATOM   137  C CB  . LYS A 1 22  ? 23.237  -36.814 63.438  1.00 106.53 ? 22   LYS A CB  1 
ATOM   138  C CG  . LYS A 1 22  ? 22.288  -36.847 64.622  1.00 112.34 ? 22   LYS A CG  1 
ATOM   139  C CD  . LYS A 1 22  ? 22.132  -35.469 65.249  1.00 108.07 ? 22   LYS A CD  1 
ATOM   140  C CE  . LYS A 1 22  ? 21.487  -34.483 64.281  1.00 87.26  ? 22   LYS A CE  1 
ATOM   141  N NZ  . LYS A 1 22  ? 21.201  -33.200 64.973  1.00 80.25  ? 22   LYS A NZ  1 
ATOM   142  N N   . GLN A 1 23  ? 20.554  -38.580 62.417  1.00 97.24  ? 23   GLN A N   1 
ATOM   143  C CA  . GLN A 1 23  ? 19.100  -38.553 62.275  1.00 98.31  ? 23   GLN A CA  1 
ATOM   144  C C   . GLN A 1 23  ? 18.471  -37.641 63.314  1.00 101.45 ? 23   GLN A C   1 
ATOM   145  O O   . GLN A 1 23  ? 18.752  -37.752 64.510  1.00 91.26  ? 23   GLN A O   1 
ATOM   146  C CB  . GLN A 1 23  ? 18.508  -39.964 62.406  1.00 93.85  ? 23   GLN A CB  1 
ATOM   147  C CG  . GLN A 1 23  ? 16.977  -40.019 62.525  1.00 90.34  ? 23   GLN A CG  1 
ATOM   148  C CD  . GLN A 1 23  ? 16.243  -39.448 61.313  1.00 93.95  ? 23   GLN A CD  1 
ATOM   149  O OE1 . GLN A 1 23  ? 16.380  -39.954 60.195  1.00 97.13  ? 23   GLN A OE1 1 
ATOM   150  N NE2 . GLN A 1 23  ? 15.455  -38.393 61.534  1.00 81.70  ? 23   GLN A NE2 1 
ATOM   151  N N   . TRP A 1 24  ? 17.622  -36.736 62.840  1.00 109.09 ? 24   TRP A N   1 
ATOM   152  C CA  . TRP A 1 24  ? 16.939  -35.805 63.716  1.00 116.45 ? 24   TRP A CA  1 
ATOM   153  C C   . TRP A 1 24  ? 16.137  -36.600 64.709  1.00 123.51 ? 24   TRP A C   1 
ATOM   154  O O   . TRP A 1 24  ? 15.694  -37.713 64.419  1.00 123.66 ? 24   TRP A O   1 
ATOM   155  C CB  . TRP A 1 24  ? 15.960  -34.939 62.943  1.00 116.77 ? 24   TRP A CB  1 
ATOM   156  C CG  . TRP A 1 24  ? 16.506  -34.416 61.699  1.00 134.27 ? 24   TRP A CG  1 
ATOM   157  C CD1 . TRP A 1 24  ? 17.656  -33.706 61.554  1.00 147.80 ? 24   TRP A CD1 1 
ATOM   158  C CD2 . TRP A 1 24  ? 15.921  -34.518 60.391  1.00 143.34 ? 24   TRP A CD2 1 
ATOM   159  N NE1 . TRP A 1 24  ? 17.829  -33.352 60.232  1.00 149.97 ? 24   TRP A NE1 1 
ATOM   160  C CE2 . TRP A 1 24  ? 16.778  -33.836 59.495  1.00 150.00 ? 24   TRP A CE2 1 
ATOM   161  C CE3 . TRP A 1 24  ? 14.756  -35.116 59.889  1.00 139.46 ? 24   TRP A CE3 1 
ATOM   162  C CZ2 . TRP A 1 24  ? 16.507  -33.732 58.114  1.00 144.07 ? 24   TRP A CZ2 1 
ATOM   163  C CZ3 . TRP A 1 24  ? 14.487  -35.012 58.516  1.00 136.50 ? 24   TRP A CZ3 1 
ATOM   164  C CH2 . TRP A 1 24  ? 15.360  -34.324 57.648  1.00 138.35 ? 24   TRP A CH2 1 
ATOM   165  N N   . PRO A 1 25  ? 15.935  -36.037 65.902  1.00 129.08 ? 25   PRO A N   1 
ATOM   166  C CA  . PRO A 1 25  ? 15.159  -36.717 66.939  1.00 130.80 ? 25   PRO A CA  1 
ATOM   167  C C   . PRO A 1 25  ? 13.726  -36.813 66.412  1.00 127.70 ? 25   PRO A C   1 
ATOM   168  O O   . PRO A 1 25  ? 13.175  -35.818 65.950  1.00 123.74 ? 25   PRO A O   1 
ATOM   169  C CB  . PRO A 1 25  ? 15.273  -35.764 68.127  1.00 135.19 ? 25   PRO A CB  1 
ATOM   170  C CG  . PRO A 1 25  ? 16.589  -35.060 67.886  1.00 134.37 ? 25   PRO A CG  1 
ATOM   171  C CD  . PRO A 1 25  ? 16.536  -34.794 66.414  1.00 130.50 ? 25   PRO A CD  1 
ATOM   172  N N   . LEU A 1 26  ? 13.122  -37.994 66.459  1.00 127.20 ? 26   LEU A N   1 
ATOM   173  C CA  . LEU A 1 26  ? 11.758  -38.120 65.959  1.00 129.96 ? 26   LEU A CA  1 
ATOM   174  C C   . LEU A 1 26  ? 10.693  -38.071 67.049  1.00 135.03 ? 26   LEU A C   1 
ATOM   175  O O   . LEU A 1 26  ? 10.891  -37.440 68.078  1.00 143.66 ? 26   LEU A O   1 
ATOM   176  C CB  . LEU A 1 26  ? 11.616  -39.399 65.142  1.00 122.70 ? 26   LEU A CB  1 
ATOM   177  C CG  . LEU A 1 26  ? 12.317  -39.344 63.782  1.00 115.13 ? 26   LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 26  ? 11.977  -40.604 63.017  1.00 114.82 ? 26   LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 26  ? 11.874  -38.112 62.993  1.00 102.60 ? 26   LEU A CD2 1 
ATOM   180  N N   . THR A 1 27  ? 9.555   -38.713 66.806  1.00 134.23 ? 27   THR A N   1 
ATOM   181  C CA  . THR A 1 27  ? 8.451   -38.754 67.767  1.00 131.97 ? 27   THR A CA  1 
ATOM   182  C C   . THR A 1 27  ? 8.014   -40.207 67.810  1.00 135.41 ? 27   THR A C   1 
ATOM   183  O O   . THR A 1 27  ? 8.020   -40.873 66.782  1.00 137.66 ? 27   THR A O   1 
ATOM   184  C CB  . THR A 1 27  ? 7.234   -37.890 67.305  1.00 123.88 ? 27   THR A CB  1 
ATOM   185  O OG1 . THR A 1 27  ? 7.593   -36.504 67.275  1.00 123.24 ? 27   THR A OG1 1 
ATOM   186  C CG2 . THR A 1 27  ? 6.060   -38.072 68.246  1.00 110.35 ? 27   THR A CG2 1 
ATOM   187  N N   . GLU A 1 28  ? 7.645   -40.709 68.984  1.00 137.59 ? 28   GLU A N   1 
ATOM   188  C CA  . GLU A 1 28  ? 7.207   -42.100 69.080  1.00 139.08 ? 28   GLU A CA  1 
ATOM   189  C C   . GLU A 1 28  ? 6.042   -42.344 68.138  1.00 142.12 ? 28   GLU A C   1 
ATOM   190  O O   . GLU A 1 28  ? 5.827   -43.467 67.699  1.00 141.90 ? 28   GLU A O   1 
ATOM   191  C CB  . GLU A 1 28  ? 6.790   -42.461 70.511  1.00 132.35 ? 28   GLU A CB  1 
ATOM   192  C CG  . GLU A 1 28  ? 7.906   -42.299 71.519  1.00 128.47 ? 28   GLU A CG  1 
ATOM   193  C CD  . GLU A 1 28  ? 9.281   -42.469 70.888  1.00 122.82 ? 28   GLU A CD  1 
ATOM   194  O OE1 . GLU A 1 28  ? 9.519   -43.514 70.251  1.00 115.52 ? 28   GLU A OE1 1 
ATOM   195  O OE2 . GLU A 1 28  ? 10.125  -41.557 71.021  1.00 123.82 ? 28   GLU A OE2 1 
ATOM   196  N N   . GLU A 1 29  ? 5.296   -41.284 67.833  1.00 144.59 ? 29   GLU A N   1 
ATOM   197  C CA  . GLU A 1 29  ? 4.152   -41.369 66.931  1.00 142.03 ? 29   GLU A CA  1 
ATOM   198  C C   . GLU A 1 29  ? 4.684   -41.468 65.506  1.00 141.78 ? 29   GLU A C   1 
ATOM   199  O O   . GLU A 1 29  ? 4.152   -42.218 64.680  1.00 144.49 ? 29   GLU A O   1 
ATOM   200  C CB  . GLU A 1 29  ? 3.269   -40.119 67.063  1.00 140.52 ? 29   GLU A CB  1 
ATOM   201  C CG  . GLU A 1 29  ? 1.928   -40.215 66.337  1.00 144.07 ? 29   GLU A CG  1 
ATOM   202  C CD  . GLU A 1 29  ? 1.187   -38.883 66.274  1.00 148.01 ? 29   GLU A CD  1 
ATOM   203  O OE1 . GLU A 1 29  ? 1.696   -37.954 65.605  1.00 149.99 ? 29   GLU A OE1 1 
ATOM   204  O OE2 . GLU A 1 29  ? 0.101   -38.764 66.890  1.00 144.19 ? 29   GLU A OE2 1 
ATOM   205  N N   . LYS A 1 30  ? 5.738   -40.703 65.225  1.00 138.86 ? 30   LYS A N   1 
ATOM   206  C CA  . LYS A 1 30  ? 6.351   -40.702 63.900  1.00 131.73 ? 30   LYS A CA  1 
ATOM   207  C C   . LYS A 1 30  ? 7.256   -41.915 63.715  1.00 131.16 ? 30   LYS A C   1 
ATOM   208  O O   . LYS A 1 30  ? 7.444   -42.391 62.595  1.00 136.54 ? 30   LYS A O   1 
ATOM   209  C CB  . LYS A 1 30  ? 7.118   -39.393 63.667  1.00 120.20 ? 30   LYS A CB  1 
ATOM   210  C CG  . LYS A 1 30  ? 6.190   -38.200 63.439  1.00 107.60 ? 30   LYS A CG  1 
ATOM   211  C CD  . LYS A 1 30  ? 6.936   -36.903 63.199  1.00 97.60  ? 30   LYS A CD  1 
ATOM   212  C CE  . LYS A 1 30  ? 5.965   -35.786 62.841  1.00 91.63  ? 30   LYS A CE  1 
ATOM   213  N NZ  . LYS A 1 30  ? 6.644   -34.481 62.590  1.00 72.29  ? 30   LYS A NZ  1 
ATOM   214  N N   . ILE A 1 31  ? 7.808   -42.421 64.814  1.00 126.09 ? 31   ILE A N   1 
ATOM   215  C CA  . ILE A 1 31  ? 8.651   -43.607 64.749  1.00 123.01 ? 31   ILE A CA  1 
ATOM   216  C C   . ILE A 1 31  ? 7.743   -44.788 64.363  1.00 123.86 ? 31   ILE A C   1 
ATOM   217  O O   . ILE A 1 31  ? 8.099   -45.625 63.522  1.00 121.27 ? 31   ILE A O   1 
ATOM   218  C CB  . ILE A 1 31  ? 9.342   -43.877 66.121  1.00 120.28 ? 31   ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 31  ? 10.388  -42.783 66.393  1.00 121.75 ? 31   ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 31  ? 9.966   -45.282 66.143  1.00 110.88 ? 31   ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 31  ? 11.220  -42.998 67.653  1.00 123.62 ? 31   ILE A CD1 1 
ATOM   222  N N   . LYS A 1 32  ? 6.556   -44.822 64.969  1.00 127.33 ? 32   LYS A N   1 
ATOM   223  C CA  . LYS A 1 32  ? 5.562   -45.871 64.726  1.00 125.70 ? 32   LYS A CA  1 
ATOM   224  C C   . LYS A 1 32  ? 5.237   -46.002 63.236  1.00 118.25 ? 32   LYS A C   1 
ATOM   225  O O   . LYS A 1 32  ? 5.308   -47.094 62.674  1.00 119.79 ? 32   LYS A O   1 
ATOM   226  C CB  . LYS A 1 32  ? 4.271   -45.580 65.531  1.00 134.55 ? 32   LYS A CB  1 
ATOM   227  C CG  . LYS A 1 32  ? 4.426   -45.685 67.071  1.00 141.27 ? 32   LYS A CG  1 
ATOM   228  C CD  . LYS A 1 32  ? 3.277   -45.023 67.868  1.00 145.16 ? 32   LYS A CD  1 
ATOM   229  C CE  . LYS A 1 32  ? 2.079   -45.953 68.095  1.00 147.79 ? 32   LYS A CE  1 
ATOM   230  N NZ  . LYS A 1 32  ? 0.985   -45.320 68.909  1.00 147.80 ? 32   LYS A NZ  1 
ATOM   231  N N   . ALA A 1 33  ? 4.895   -44.883 62.604  1.00 110.80 ? 33   ALA A N   1 
ATOM   232  C CA  . ALA A 1 33  ? 4.548   -44.858 61.186  1.00 104.78 ? 33   ALA A CA  1 
ATOM   233  C C   . ALA A 1 33  ? 5.695   -45.274 60.259  1.00 100.88 ? 33   ALA A C   1 
ATOM   234  O O   . ALA A 1 33  ? 5.476   -45.987 59.285  1.00 90.90  ? 33   ALA A O   1 
ATOM   235  C CB  . ALA A 1 33  ? 4.054   -43.466 60.810  1.00 106.27 ? 33   ALA A CB  1 
ATOM   236  N N   . LEU A 1 34  ? 6.908   -44.817 60.563  1.00 103.59 ? 34   LEU A N   1 
ATOM   237  C CA  . LEU A 1 34  ? 8.089   -45.136 59.761  1.00 102.48 ? 34   LEU A CA  1 
ATOM   238  C C   . LEU A 1 34  ? 8.373   -46.622 59.732  1.00 100.89 ? 34   LEU A C   1 
ATOM   239  O O   . LEU A 1 34  ? 8.774   -47.175 58.709  1.00 104.54 ? 34   LEU A O   1 
ATOM   240  C CB  . LEU A 1 34  ? 9.341   -44.433 60.301  1.00 101.69 ? 34   LEU A CB  1 
ATOM   241  C CG  . LEU A 1 34  ? 9.515   -42.917 60.145  1.00 99.93  ? 34   LEU A CG  1 
ATOM   242  C CD1 . LEU A 1 34  ? 11.011  -42.560 60.299  1.00 90.94  ? 34   LEU A CD1 1 
ATOM   243  C CD2 . LEU A 1 34  ? 8.999   -42.470 58.776  1.00 103.73 ? 34   LEU A CD2 1 
ATOM   244  N N   . VAL A 1 35  ? 8.183   -47.274 60.865  1.00 97.12  ? 35   VAL A N   1 
ATOM   245  C CA  . VAL A 1 35  ? 8.439   -48.696 60.919  1.00 92.67  ? 35   VAL A CA  1 
ATOM   246  C C   . VAL A 1 35  ? 7.398   -49.518 60.162  1.00 91.74  ? 35   VAL A C   1 
ATOM   247  O O   . VAL A 1 35  ? 7.729   -50.553 59.601  1.00 85.41  ? 35   VAL A O   1 
ATOM   248  C CB  . VAL A 1 35  ? 8.543   -49.166 62.364  1.00 85.33  ? 35   VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 35  ? 8.698   -50.675 62.408  1.00 78.49  ? 35   VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 35  ? 9.739   -48.494 63.015  1.00 79.95  ? 35   VAL A CG2 1 
ATOM   251  N N   . GLU A 1 36  ? 6.147   -49.064 60.139  1.00 95.44  ? 36   GLU A N   1 
ATOM   252  C CA  . GLU A 1 36  ? 5.102   -49.783 59.411  1.00 98.74  ? 36   GLU A CA  1 
ATOM   253  C C   . GLU A 1 36  ? 5.379   -49.634 57.915  1.00 101.99 ? 36   GLU A C   1 
ATOM   254  O O   . GLU A 1 36  ? 5.137   -50.546 57.110  1.00 101.05 ? 36   GLU A O   1 
ATOM   255  C CB  . GLU A 1 36  ? 3.713   -49.203 59.726  1.00 103.88 ? 36   GLU A CB  1 
ATOM   256  C CG  . GLU A 1 36  ? 3.199   -49.502 61.127  1.00 118.62 ? 36   GLU A CG  1 
ATOM   257  C CD  . GLU A 1 36  ? 1.748   -49.081 61.337  1.00 124.44 ? 36   GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 36  ? 0.907   -49.376 60.457  1.00 115.66 ? 36   GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 36  ? 1.450   -48.471 62.391  1.00 129.84 ? 36   GLU A OE2 1 
ATOM   260  N N   . ILE A 1 37  ? 5.896   -48.463 57.559  1.00 100.09 ? 37   ILE A N   1 
ATOM   261  C CA  . ILE A 1 37  ? 6.208   -48.145 56.182  1.00 94.59  ? 37   ILE A CA  1 
ATOM   262  C C   . ILE A 1 37  ? 7.462   -48.876 55.730  1.00 92.46  ? 37   ILE A C   1 
ATOM   263  O O   . ILE A 1 37  ? 7.489   -49.442 54.640  1.00 90.42  ? 37   ILE A O   1 
ATOM   264  C CB  . ILE A 1 37  ? 6.379   -46.628 56.021  1.00 94.75  ? 37   ILE A CB  1 
ATOM   265  C CG1 . ILE A 1 37  ? 5.076   -45.925 56.432  1.00 90.10  ? 37   ILE A CG1 1 
ATOM   266  C CG2 . ILE A 1 37  ? 6.747   -46.299 54.589  1.00 99.70  ? 37   ILE A CG2 1 
ATOM   267  C CD1 . ILE A 1 37  ? 5.095   -44.412 56.309  1.00 73.26  ? 37   ILE A CD1 1 
ATOM   268  N N   . CYS A 1 38  ? 8.486   -48.875 56.582  1.00 94.77  ? 38   CYS A N   1 
ATOM   269  C CA  . CYS A 1 38  ? 9.757   -49.543 56.292  1.00 105.13 ? 38   CYS A CA  1 
ATOM   270  C C   . CYS A 1 38  ? 9.691   -51.058 56.332  1.00 113.94 ? 38   CYS A C   1 
ATOM   271  O O   . CYS A 1 38  ? 10.600  -51.742 55.864  1.00 117.14 ? 38   CYS A O   1 
ATOM   272  C CB  . CYS A 1 38  ? 10.830  -49.108 57.280  1.00 104.71 ? 38   CYS A CB  1 
ATOM   273  S SG  . CYS A 1 38  ? 11.463  -47.483 56.967  1.00 110.96 ? 38   CYS A SG  1 
ATOM   274  N N   . THR A 1 39  ? 8.631   -51.583 56.921  1.00 120.82 ? 39   THR A N   1 
ATOM   275  C CA  . THR A 1 39  ? 8.467   -53.022 57.008  1.00 124.66 ? 39   THR A CA  1 
ATOM   276  C C   . THR A 1 39  ? 7.658   -53.496 55.802  1.00 123.22 ? 39   THR A C   1 
ATOM   277  O O   . THR A 1 39  ? 7.916   -54.570 55.247  1.00 123.89 ? 39   THR A O   1 
ATOM   278  C CB  . THR A 1 39  ? 7.795   -53.387 58.339  1.00 132.82 ? 39   THR A CB  1 
ATOM   279  O OG1 . THR A 1 39  ? 8.783   -53.337 59.381  1.00 133.15 ? 39   THR A OG1 1 
ATOM   280  C CG2 . THR A 1 39  ? 7.148   -54.770 58.270  1.00 137.39 ? 39   THR A CG2 1 
ATOM   281  N N   . GLU A 1 40  ? 6.688   -52.681 55.397  1.00 119.25 ? 40   GLU A N   1 
ATOM   282  C CA  . GLU A 1 40  ? 5.871   -52.969 54.224  1.00 112.69 ? 40   GLU A CA  1 
ATOM   283  C C   . GLU A 1 40  ? 6.878   -53.064 53.082  1.00 104.46 ? 40   GLU A C   1 
ATOM   284  O O   . GLU A 1 40  ? 6.828   -53.973 52.246  1.00 98.01  ? 40   GLU A O   1 
ATOM   285  C CB  . GLU A 1 40  ? 4.909   -51.799 53.982  1.00 117.86 ? 40   GLU A CB  1 
ATOM   286  C CG  . GLU A 1 40  ? 4.378   -51.662 52.558  1.00 122.52 ? 40   GLU A CG  1 
ATOM   287  C CD  . GLU A 1 40  ? 3.176   -52.549 52.275  1.00 127.51 ? 40   GLU A CD  1 
ATOM   288  O OE1 . GLU A 1 40  ? 3.332   -53.790 52.244  1.00 128.98 ? 40   GLU A OE1 1 
ATOM   289  O OE2 . GLU A 1 40  ? 2.069   -51.996 52.084  1.00 128.09 ? 40   GLU A OE2 1 
ATOM   290  N N   . MET A 1 41  ? 7.812   -52.114 53.106  1.00 105.52 ? 41   MET A N   1 
ATOM   291  C CA  . MET A 1 41  ? 8.878   -51.972 52.120  1.00 106.78 ? 41   MET A CA  1 
ATOM   292  C C   . MET A 1 41  ? 9.932   -53.068 52.059  1.00 106.31 ? 41   MET A C   1 
ATOM   293  O O   . MET A 1 41  ? 10.354  -53.436 50.972  1.00 110.23 ? 41   MET A O   1 
ATOM   294  C CB  . MET A 1 41  ? 9.606   -50.637 52.312  1.00 111.47 ? 41   MET A CB  1 
ATOM   295  C CG  . MET A 1 41  ? 8.795   -49.387 51.983  1.00 109.36 ? 41   MET A CG  1 
ATOM   296  S SD  . MET A 1 41  ? 9.854   -47.906 51.886  1.00 96.59  ? 41   MET A SD  1 
ATOM   297  C CE  . MET A 1 41  ? 8.737   -46.775 51.015  1.00 95.55  ? 41   MET A CE  1 
ATOM   298  N N   . GLU A 1 42  ? 10.390  -53.568 53.203  1.00 103.64 ? 42   GLU A N   1 
ATOM   299  C CA  . GLU A 1 42  ? 11.411  -54.612 53.182  1.00 100.21 ? 42   GLU A CA  1 
ATOM   300  C C   . GLU A 1 42  ? 10.833  -55.952 52.760  1.00 102.43 ? 42   GLU A C   1 
ATOM   301  O O   . GLU A 1 42  ? 11.564  -56.833 52.302  1.00 99.48  ? 42   GLU A O   1 
ATOM   302  C CB  . GLU A 1 42  ? 12.075  -54.761 54.541  1.00 95.67  ? 42   GLU A CB  1 
ATOM   303  C CG  . GLU A 1 42  ? 13.079  -55.882 54.578  1.00 99.90  ? 42   GLU A CG  1 
ATOM   304  C CD  . GLU A 1 42  ? 13.723  -56.022 55.926  1.00 106.10 ? 42   GLU A CD  1 
ATOM   305  O OE1 . GLU A 1 42  ? 12.985  -56.074 56.929  1.00 112.46 ? 42   GLU A OE1 1 
ATOM   306  O OE2 . GLU A 1 42  ? 14.966  -56.082 55.985  1.00 106.19 ? 42   GLU A OE2 1 
ATOM   307  N N   . LYS A 1 43  ? 9.521   -56.105 52.920  1.00 107.03 ? 43   LYS A N   1 
ATOM   308  C CA  . LYS A 1 43  ? 8.854   -57.337 52.527  1.00 109.98 ? 43   LYS A CA  1 
ATOM   309  C C   . LYS A 1 43  ? 8.684   -57.304 51.012  1.00 110.95 ? 43   LYS A C   1 
ATOM   310  O O   . LYS A 1 43  ? 8.485   -58.332 50.364  1.00 115.71 ? 43   LYS A O   1 
ATOM   311  C CB  . LYS A 1 43  ? 7.488   -57.452 53.202  1.00 112.12 ? 43   LYS A CB  1 
ATOM   312  C CG  . LYS A 1 43  ? 7.305   -58.765 53.948  1.00 118.27 ? 43   LYS A CG  1 
ATOM   313  C CD  . LYS A 1 43  ? 5.852   -59.003 54.323  1.00 118.85 ? 43   LYS A CD  1 
ATOM   314  C CE  . LYS A 1 43  ? 5.682   -60.335 55.040  1.00 119.12 ? 43   LYS A CE  1 
ATOM   315  N NZ  . LYS A 1 43  ? 4.252   -60.629 55.328  1.00 119.18 ? 43   LYS A NZ  1 
ATOM   316  N N   . GLU A 1 44  ? 8.771   -56.106 50.451  1.00 107.97 ? 44   GLU A N   1 
ATOM   317  C CA  . GLU A 1 44  ? 8.648   -55.927 49.014  1.00 104.43 ? 44   GLU A CA  1 
ATOM   318  C C   . GLU A 1 44  ? 10.042  -55.831 48.359  1.00 104.09 ? 44   GLU A C   1 
ATOM   319  O O   . GLU A 1 44  ? 10.153  -55.680 47.138  1.00 104.56 ? 44   GLU A O   1 
ATOM   320  C CB  . GLU A 1 44  ? 7.831   -54.666 48.735  1.00 97.80  ? 44   GLU A CB  1 
ATOM   321  C CG  . GLU A 1 44  ? 6.473   -54.682 49.408  1.00 103.75 ? 44   GLU A CG  1 
ATOM   322  C CD  . GLU A 1 44  ? 5.731   -53.365 49.270  1.00 115.90 ? 44   GLU A CD  1 
ATOM   323  O OE1 . GLU A 1 44  ? 6.207   -52.347 49.824  1.00 125.37 ? 44   GLU A OE1 1 
ATOM   324  O OE2 . GLU A 1 44  ? 4.670   -53.345 48.609  1.00 119.97 ? 44   GLU A OE2 1 
ATOM   325  N N   . GLY A 1 45  ? 11.098  -55.918 49.178  1.00 96.07  ? 45   GLY A N   1 
ATOM   326  C CA  . GLY A 1 45  ? 12.472  -55.852 48.680  1.00 88.03  ? 45   GLY A CA  1 
ATOM   327  C C   . GLY A 1 45  ? 13.106  -54.482 48.401  1.00 85.31  ? 45   GLY A C   1 
ATOM   328  O O   . GLY A 1 45  ? 14.330  -54.374 48.245  1.00 76.49  ? 45   GLY A O   1 
ATOM   329  N N   . LYS A 1 46  ? 12.288  -53.432 48.334  1.00 86.32  ? 46   LYS A N   1 
ATOM   330  C CA  . LYS A 1 46  ? 12.769  -52.077 48.057  1.00 79.59  ? 46   LYS A CA  1 
ATOM   331  C C   . LYS A 1 46  ? 13.901  -51.650 48.976  1.00 83.09  ? 46   LYS A C   1 
ATOM   332  O O   . LYS A 1 46  ? 14.745  -50.834 48.592  1.00 77.66  ? 46   LYS A O   1 
ATOM   333  C CB  . LYS A 1 46  ? 11.610  -51.098 48.165  1.00 63.46  ? 46   LYS A CB  1 
ATOM   334  C CG  . LYS A 1 46  ? 10.435  -51.491 47.274  1.00 74.14  ? 46   LYS A CG  1 
ATOM   335  C CD  . LYS A 1 46  ? 9.379   -50.395 47.242  1.00 91.29  ? 46   LYS A CD  1 
ATOM   336  C CE  . LYS A 1 46  ? 8.519   -50.492 45.984  1.00 110.13 ? 46   LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 46  ? 7.638   -49.298 45.803  1.00 118.23 ? 46   LYS A NZ  1 
ATOM   338  N N   . ILE A 1 47  ? 13.905  -52.207 50.188  1.00 89.49  ? 47   ILE A N   1 
ATOM   339  C CA  . ILE A 1 47  ? 14.933  -51.922 51.188  1.00 89.12  ? 47   ILE A CA  1 
ATOM   340  C C   . ILE A 1 47  ? 15.299  -53.190 51.964  1.00 86.74  ? 47   ILE A C   1 
ATOM   341  O O   . ILE A 1 47  ? 14.644  -54.226 51.828  1.00 84.96  ? 47   ILE A O   1 
ATOM   342  C CB  . ILE A 1 47  ? 14.458  -50.863 52.205  1.00 89.74  ? 47   ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 47  ? 13.154  -51.325 52.851  1.00 93.14  ? 47   ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 47  ? 14.289  -49.506 51.526  1.00 73.20  ? 47   ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 47  ? 12.737  -50.465 54.007  1.00 100.01 ? 47   ILE A CD1 1 
ATOM   346  N N   . SER A 1 48  ? 16.339  -53.097 52.788  1.00 89.41  ? 48   SER A N   1 
ATOM   347  C CA  . SER A 1 48  ? 16.778  -54.238 53.578  1.00 94.67  ? 48   SER A CA  1 
ATOM   348  C C   . SER A 1 48  ? 17.688  -53.854 54.757  1.00 94.51  ? 48   SER A C   1 
ATOM   349  O O   . SER A 1 48  ? 18.647  -53.086 54.599  1.00 90.62  ? 48   SER A O   1 
ATOM   350  C CB  . SER A 1 48  ? 17.497  -55.250 52.668  1.00 101.39 ? 48   SER A CB  1 
ATOM   351  O OG  . SER A 1 48  ? 16.601  -55.856 51.745  1.00 90.61  ? 48   SER A OG  1 
ATOM   352  N N   . LYS A 1 49  ? 17.372  -54.401 55.935  1.00 93.14  ? 49   LYS A N   1 
ATOM   353  C CA  . LYS A 1 49  ? 18.143  -54.151 57.151  1.00 88.16  ? 49   LYS A CA  1 
ATOM   354  C C   . LYS A 1 49  ? 19.613  -54.400 56.910  1.00 84.82  ? 49   LYS A C   1 
ATOM   355  O O   . LYS A 1 49  ? 20.002  -55.367 56.260  1.00 81.58  ? 49   LYS A O   1 
ATOM   356  C CB  . LYS A 1 49  ? 17.701  -55.063 58.288  1.00 91.49  ? 49   LYS A CB  1 
ATOM   357  C CG  . LYS A 1 49  ? 16.341  -54.767 58.864  1.00 105.43 ? 49   LYS A CG  1 
ATOM   358  C CD  . LYS A 1 49  ? 16.130  -55.592 60.130  1.00 110.03 ? 49   LYS A CD  1 
ATOM   359  C CE  . LYS A 1 49  ? 14.735  -55.404 60.706  1.00 109.53 ? 49   LYS A CE  1 
ATOM   360  N NZ  . LYS A 1 49  ? 13.677  -55.849 59.760  1.00 95.38  ? 49   LYS A NZ  1 
ATOM   361  N N   . ILE A 1 50  ? 20.439  -53.536 57.463  1.00 85.00  ? 50   ILE A N   1 
ATOM   362  C CA  . ILE A 1 50  ? 21.856  -53.696 57.266  1.00 90.12  ? 50   ILE A CA  1 
ATOM   363  C C   . ILE A 1 50  ? 22.626  -53.864 58.549  1.00 90.38  ? 50   ILE A C   1 
ATOM   364  O O   . ILE A 1 50  ? 22.165  -53.529 59.644  1.00 84.14  ? 50   ILE A O   1 
ATOM   365  C CB  . ILE A 1 50  ? 22.449  -52.504 56.525  1.00 98.03  ? 50   ILE A CB  1 
ATOM   366  C CG1 . ILE A 1 50  ? 22.288  -51.237 57.372  1.00 105.90 ? 50   ILE A CG1 1 
ATOM   367  C CG2 . ILE A 1 50  ? 21.759  -52.346 55.187  1.00 101.37 ? 50   ILE A CG2 1 
ATOM   368  C CD1 . ILE A 1 50  ? 23.144  -50.076 56.917  1.00 104.33 ? 50   ILE A CD1 1 
ATOM   369  N N   . GLY A 1 51  ? 23.824  -54.394 58.389  1.00 95.71  ? 51   GLY A N   1 
ATOM   370  C CA  . GLY A 1 51  ? 24.670  -54.594 59.529  1.00 98.67  ? 51   GLY A CA  1 
ATOM   371  C C   . GLY A 1 51  ? 25.281  -53.260 59.854  1.00 103.75 ? 51   GLY A C   1 
ATOM   372  O O   . GLY A 1 51  ? 25.727  -52.539 58.965  1.00 102.37 ? 51   GLY A O   1 
ATOM   373  N N   . PRO A 1 52  ? 25.236  -52.868 61.123  1.00 109.62 ? 52   PRO A N   1 
ATOM   374  C CA  . PRO A 1 52  ? 25.822  -51.600 61.532  1.00 115.30 ? 52   PRO A CA  1 
ATOM   375  C C   . PRO A 1 52  ? 27.310  -51.552 61.168  1.00 125.44 ? 52   PRO A C   1 
ATOM   376  O O   . PRO A 1 52  ? 28.109  -50.897 61.835  1.00 130.82 ? 52   PRO A O   1 
ATOM   377  C CB  . PRO A 1 52  ? 25.553  -51.592 63.024  1.00 110.62 ? 52   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 52  ? 24.144  -52.108 63.047  1.00 107.87 ? 52   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 52  ? 24.197  -53.285 62.082  1.00 110.22 ? 52   PRO A CD  1 
ATOM   380  N N   . GLU A 1 53  ? 27.666  -52.282 60.111  1.00 130.99 ? 53   GLU A N   1 
ATOM   381  C CA  . GLU A 1 53  ? 29.025  -52.311 59.564  1.00 134.80 ? 53   GLU A CA  1 
ATOM   382  C C   . GLU A 1 53  ? 29.100  -51.013 58.752  1.00 134.52 ? 53   GLU A C   1 
ATOM   383  O O   . GLU A 1 53  ? 30.177  -50.440 58.527  1.00 135.76 ? 53   GLU A O   1 
ATOM   384  C CB  . GLU A 1 53  ? 29.187  -53.527 58.633  1.00 138.89 ? 53   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 53  ? 29.987  -53.292 57.331  1.00 144.41 ? 53   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 53  ? 31.501  -53.343 57.517  1.00 150.00 ? 53   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 53  ? 32.017  -54.395 57.960  1.00 150.00 ? 53   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 53  ? 32.177  -52.335 57.210  1.00 150.00 ? 53   GLU A OE2 1 
ATOM   389  N N   . ASN A 1 54  ? 27.916  -50.559 58.342  1.00 125.79 ? 54   ASN A N   1 
ATOM   390  C CA  . ASN A 1 54  ? 27.754  -49.358 57.547  1.00 110.36 ? 54   ASN A CA  1 
ATOM   391  C C   . ASN A 1 54  ? 27.738  -48.083 58.368  1.00 98.74  ? 54   ASN A C   1 
ATOM   392  O O   . ASN A 1 54  ? 26.836  -47.873 59.179  1.00 96.68  ? 54   ASN A O   1 
ATOM   393  C CB  . ASN A 1 54  ? 26.464  -49.441 56.763  1.00 111.30 ? 54   ASN A CB  1 
ATOM   394  C CG  . ASN A 1 54  ? 26.219  -48.206 55.958  1.00 123.76 ? 54   ASN A CG  1 
ATOM   395  O OD1 . ASN A 1 54  ? 26.933  -47.209 56.099  1.00 120.69 ? 54   ASN A OD1 1 
ATOM   396  N ND2 . ASN A 1 54  ? 25.203  -48.249 55.104  1.00 136.30 ? 54   ASN A ND2 1 
ATOM   397  N N   . PRO A 1 55  ? 28.728  -47.204 58.144  1.00 87.78  ? 55   PRO A N   1 
ATOM   398  C CA  . PRO A 1 55  ? 28.893  -45.919 58.832  1.00 88.63  ? 55   PRO A CA  1 
ATOM   399  C C   . PRO A 1 55  ? 28.219  -44.722 58.177  1.00 88.69  ? 55   PRO A C   1 
ATOM   400  O O   . PRO A 1 55  ? 28.382  -43.592 58.627  1.00 90.84  ? 55   PRO A O   1 
ATOM   401  C CB  . PRO A 1 55  ? 30.402  -45.750 58.858  1.00 86.63  ? 55   PRO A CB  1 
ATOM   402  C CG  . PRO A 1 55  ? 30.780  -46.282 57.524  1.00 76.78  ? 55   PRO A CG  1 
ATOM   403  C CD  . PRO A 1 55  ? 29.968  -47.560 57.433  1.00 74.21  ? 55   PRO A CD  1 
ATOM   404  N N   . TYR A 1 56  ? 27.460  -44.959 57.121  1.00 86.33  ? 56   TYR A N   1 
ATOM   405  C CA  . TYR A 1 56  ? 26.808  -43.857 56.429  1.00 85.22  ? 56   TYR A CA  1 
ATOM   406  C C   . TYR A 1 56  ? 25.393  -43.647 56.937  1.00 82.06  ? 56   TYR A C   1 
ATOM   407  O O   . TYR A 1 56  ? 24.783  -44.590 57.435  1.00 79.86  ? 56   TYR A O   1 
ATOM   408  C CB  . TYR A 1 56  ? 26.789  -44.147 54.923  1.00 90.32  ? 56   TYR A CB  1 
ATOM   409  C CG  . TYR A 1 56  ? 28.176  -44.300 54.316  1.00 77.21  ? 56   TYR A CG  1 
ATOM   410  C CD1 . TYR A 1 56  ? 29.047  -43.212 54.252  1.00 70.76  ? 56   TYR A CD1 1 
ATOM   411  C CD2 . TYR A 1 56  ? 28.625  -45.538 53.831  1.00 62.76  ? 56   TYR A CD2 1 
ATOM   412  C CE1 . TYR A 1 56  ? 30.342  -43.345 53.721  1.00 76.45  ? 56   TYR A CE1 1 
ATOM   413  C CE2 . TYR A 1 56  ? 29.919  -45.678 53.298  1.00 67.51  ? 56   TYR A CE2 1 
ATOM   414  C CZ  . TYR A 1 56  ? 30.774  -44.571 53.249  1.00 70.98  ? 56   TYR A CZ  1 
ATOM   415  O OH  . TYR A 1 56  ? 32.059  -44.674 52.752  1.00 71.02  ? 56   TYR A OH  1 
ATOM   416  N N   . ASN A 1 57  ? 24.879  -42.419 56.829  1.00 82.36  ? 57   ASN A N   1 
ATOM   417  C CA  . ASN A 1 57  ? 23.510  -42.151 57.265  1.00 83.43  ? 57   ASN A CA  1 
ATOM   418  C C   . ASN A 1 57  ? 22.847  -40.919 56.664  1.00 75.79  ? 57   ASN A C   1 
ATOM   419  O O   . ASN A 1 57  ? 23.427  -39.834 56.601  1.00 72.28  ? 57   ASN A O   1 
ATOM   420  C CB  . ASN A 1 57  ? 23.421  -42.064 58.788  1.00 89.86  ? 57   ASN A CB  1 
ATOM   421  C CG  . ASN A 1 57  ? 21.990  -42.210 59.285  1.00 86.09  ? 57   ASN A CG  1 
ATOM   422  O OD1 . ASN A 1 57  ? 21.387  -43.284 59.174  1.00 85.85  ? 57   ASN A OD1 1 
ATOM   423  N ND2 . ASN A 1 57  ? 21.431  -41.124 59.817  1.00 88.94  ? 57   ASN A ND2 1 
ATOM   424  N N   . THR A 1 58  ? 21.599  -41.113 56.259  1.00 70.43  ? 58   THR A N   1 
ATOM   425  C CA  . THR A 1 58  ? 20.805  -40.076 55.634  1.00 67.07  ? 58   THR A CA  1 
ATOM   426  C C   . THR A 1 58  ? 19.448  -39.901 56.317  1.00 71.16  ? 58   THR A C   1 
ATOM   427  O O   . THR A 1 58  ? 18.609  -40.804 56.306  1.00 66.36  ? 58   THR A O   1 
ATOM   428  C CB  . THR A 1 58  ? 20.597  -40.410 54.146  1.00 62.23  ? 58   THR A CB  1 
ATOM   429  O OG1 . THR A 1 58  ? 21.851  -40.292 53.458  1.00 67.04  ? 58   THR A OG1 1 
ATOM   430  C CG2 . THR A 1 58  ? 19.568  -39.491 53.524  1.00 51.00  ? 58   THR A CG2 1 
ATOM   431  N N   . PRO A 1 59  ? 19.222  -38.717 56.917  1.00 79.49  ? 59   PRO A N   1 
ATOM   432  C CA  . PRO A 1 59  ? 18.035  -38.253 57.646  1.00 79.57  ? 59   PRO A CA  1 
ATOM   433  C C   . PRO A 1 59  ? 16.692  -38.615 57.063  1.00 81.70  ? 59   PRO A C   1 
ATOM   434  O O   . PRO A 1 59  ? 16.439  -38.430 55.876  1.00 85.51  ? 59   PRO A O   1 
ATOM   435  C CB  . PRO A 1 59  ? 18.234  -36.748 57.686  1.00 75.72  ? 59   PRO A CB  1 
ATOM   436  C CG  . PRO A 1 59  ? 19.678  -36.650 57.914  1.00 73.73  ? 59   PRO A CG  1 
ATOM   437  C CD  . PRO A 1 59  ? 20.251  -37.661 56.924  1.00 82.70  ? 59   PRO A CD  1 
ATOM   438  N N   . VAL A 1 60  ? 15.816  -39.096 57.925  1.00 88.37  ? 60   VAL A N   1 
ATOM   439  C CA  . VAL A 1 60  ? 14.494  -39.485 57.494  1.00 102.75 ? 60   VAL A CA  1 
ATOM   440  C C   . VAL A 1 60  ? 13.487  -38.762 58.351  1.00 102.77 ? 60   VAL A C   1 
ATOM   441  O O   . VAL A 1 60  ? 13.772  -38.402 59.494  1.00 98.76  ? 60   VAL A O   1 
ATOM   442  C CB  . VAL A 1 60  ? 14.271  -40.993 57.680  1.00 115.95 ? 60   VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 60  ? 13.073  -41.442 56.867  1.00 114.92 ? 60   VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 60  ? 15.524  -41.757 57.291  1.00 129.54 ? 60   VAL A CG2 1 
ATOM   445  N N   . PHE A 1 61  ? 12.311  -38.545 57.784  1.00 105.51 ? 61   PHE A N   1 
ATOM   446  C CA  . PHE A 1 61  ? 11.225  -37.905 58.500  1.00 109.31 ? 61   PHE A CA  1 
ATOM   447  C C   . PHE A 1 61  ? 9.886   -38.246 57.866  1.00 109.71 ? 61   PHE A C   1 
ATOM   448  O O   . PHE A 1 61  ? 9.831   -38.751 56.739  1.00 110.24 ? 61   PHE A O   1 
ATOM   449  C CB  . PHE A 1 61  ? 11.418  -36.381 58.593  1.00 118.85 ? 61   PHE A CB  1 
ATOM   450  C CG  . PHE A 1 61  ? 11.679  -35.684 57.275  1.00 137.94 ? 61   PHE A CG  1 
ATOM   451  C CD1 . PHE A 1 61  ? 11.187  -34.393 57.065  1.00 146.20 ? 61   PHE A CD1 1 
ATOM   452  C CD2 . PHE A 1 61  ? 12.475  -36.260 56.288  1.00 144.81 ? 61   PHE A CD2 1 
ATOM   453  C CE1 . PHE A 1 61  ? 11.484  -33.683 55.901  1.00 147.53 ? 61   PHE A CE1 1 
ATOM   454  C CE2 . PHE A 1 61  ? 12.779  -35.556 55.119  1.00 148.40 ? 61   PHE A CE2 1 
ATOM   455  C CZ  . PHE A 1 61  ? 12.282  -34.265 54.928  1.00 148.26 ? 61   PHE A CZ  1 
ATOM   456  N N   . ALA A 1 62  ? 8.810   -37.987 58.603  1.00 108.54 ? 62   ALA A N   1 
ATOM   457  C CA  . ALA A 1 62  ? 7.463   -38.288 58.128  1.00 105.34 ? 62   ALA A CA  1 
ATOM   458  C C   . ALA A 1 62  ? 6.580   -37.045 57.939  1.00 99.84  ? 62   ALA A C   1 
ATOM   459  O O   . ALA A 1 62  ? 6.635   -36.087 58.717  1.00 94.96  ? 62   ALA A O   1 
ATOM   460  C CB  . ALA A 1 62  ? 6.795   -39.272 59.090  1.00 105.39 ? 62   ALA A CB  1 
ATOM   461  N N   . LYS A 1 73  ? 6.709   -40.901 54.189  1.00 108.38 ? 73   LYS A N   1 
ATOM   462  C CA  . LYS A 1 73  ? 8.126   -41.112 54.467  1.00 109.97 ? 73   LYS A CA  1 
ATOM   463  C C   . LYS A 1 73  ? 9.056   -40.334 53.547  1.00 106.43 ? 73   LYS A C   1 
ATOM   464  O O   . LYS A 1 73  ? 9.212   -40.668 52.370  1.00 106.37 ? 73   LYS A O   1 
ATOM   465  C CB  . LYS A 1 73  ? 8.477   -42.598 54.366  1.00 118.61 ? 73   LYS A CB  1 
ATOM   466  C CG  . LYS A 1 73  ? 9.976   -42.862 54.272  1.00 119.98 ? 73   LYS A CG  1 
ATOM   467  C CD  . LYS A 1 73  ? 10.291  -44.349 54.214  1.00 118.53 ? 73   LYS A CD  1 
ATOM   468  C CE  . LYS A 1 73  ? 11.761  -44.587 53.904  1.00 119.81 ? 73   LYS A CE  1 
ATOM   469  N NZ  . LYS A 1 73  ? 12.097  -44.058 52.557  1.00 117.61 ? 73   LYS A NZ  1 
ATOM   470  N N   . LEU A 1 74  ? 9.693   -39.312 54.106  1.00 102.36 ? 74   LEU A N   1 
ATOM   471  C CA  . LEU A 1 74  ? 10.621  -38.481 53.356  1.00 99.16  ? 74   LEU A CA  1 
ATOM   472  C C   . LEU A 1 74  ? 12.055  -38.738 53.760  1.00 95.46  ? 74   LEU A C   1 
ATOM   473  O O   . LEU A 1 74  ? 12.377  -38.814 54.945  1.00 93.17  ? 74   LEU A O   1 
ATOM   474  C CB  . LEU A 1 74  ? 10.342  -37.000 53.593  1.00 99.67  ? 74   LEU A CB  1 
ATOM   475  C CG  . LEU A 1 74  ? 9.789   -36.169 52.442  1.00 111.63 ? 74   LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 74  ? 8.323   -36.495 52.291  1.00 124.57 ? 74   LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 74  ? 9.970   -34.678 52.711  1.00 112.86 ? 74   LEU A CD2 1 
ATOM   478  N N   . VAL A 1 75  ? 12.922  -38.876 52.772  1.00 92.08  ? 75   VAL A N   1 
ATOM   479  C CA  . VAL A 1 75  ? 14.321  -39.059 53.076  1.00 89.42  ? 75   VAL A CA  1 
ATOM   480  C C   . VAL A 1 75  ? 15.053  -37.941 52.351  1.00 95.21  ? 75   VAL A C   1 
ATOM   481  O O   . VAL A 1 75  ? 14.950  -37.778 51.126  1.00 94.14  ? 75   VAL A O   1 
ATOM   482  C CB  . VAL A 1 75  ? 14.831  -40.417 52.628  1.00 87.69  ? 75   VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 75  ? 16.191  -40.682 53.250  1.00 80.45  ? 75   VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 75  ? 13.855  -41.485 53.042  1.00 81.76  ? 75   VAL A CG2 1 
ATOM   485  N N   . ASP A 1 76  ? 15.761  -37.151 53.147  1.00 100.48 ? 76   ASP A N   1 
ATOM   486  C CA  . ASP A 1 76  ? 16.515  -36.001 52.675  1.00 99.01  ? 76   ASP A CA  1 
ATOM   487  C C   . ASP A 1 76  ? 17.864  -36.428 52.082  1.00 89.48  ? 76   ASP A C   1 
ATOM   488  O O   . ASP A 1 76  ? 18.773  -36.837 52.812  1.00 87.09  ? 76   ASP A O   1 
ATOM   489  C CB  . ASP A 1 76  ? 16.731  -35.048 53.851  1.00 105.38 ? 76   ASP A CB  1 
ATOM   490  C CG  . ASP A 1 76  ? 17.308  -33.721 53.423  1.00 114.98 ? 76   ASP A CG  1 
ATOM   491  O OD1 . ASP A 1 76  ? 17.877  -33.023 54.298  1.00 117.82 ? 76   ASP A OD1 1 
ATOM   492  O OD2 . ASP A 1 76  ? 17.184  -33.379 52.221  1.00 115.43 ? 76   ASP A OD2 1 
ATOM   493  N N   . PHE A 1 77  ? 18.002  -36.317 50.764  1.00 77.92  ? 77   PHE A N   1 
ATOM   494  C CA  . PHE A 1 77  ? 19.239  -36.732 50.128  1.00 68.87  ? 77   PHE A CA  1 
ATOM   495  C C   . PHE A 1 77  ? 20.137  -35.630 49.651  1.00 68.97  ? 77   PHE A C   1 
ATOM   496  O O   . PHE A 1 77  ? 21.073  -35.867 48.885  1.00 68.63  ? 77   PHE A O   1 
ATOM   497  C CB  . PHE A 1 77  ? 18.940  -37.671 48.979  1.00 63.80  ? 77   PHE A CB  1 
ATOM   498  C CG  . PHE A 1 77  ? 18.505  -39.043 49.426  1.00 64.97  ? 77   PHE A CG  1 
ATOM   499  C CD1 . PHE A 1 77  ? 17.205  -39.504 49.162  1.00 64.62  ? 77   PHE A CD1 1 
ATOM   500  C CD2 . PHE A 1 77  ? 19.407  -39.893 50.090  1.00 49.43  ? 77   PHE A CD2 1 
ATOM   501  C CE1 . PHE A 1 77  ? 16.809  -40.800 49.546  1.00 54.83  ? 77   PHE A CE1 1 
ATOM   502  C CE2 . PHE A 1 77  ? 19.034  -41.193 50.484  1.00 42.90  ? 77   PHE A CE2 1 
ATOM   503  C CZ  . PHE A 1 77  ? 17.735  -41.652 50.213  1.00 49.42  ? 77   PHE A CZ  1 
ATOM   504  N N   . ARG A 1 78  ? 19.855  -34.424 50.110  1.00 69.56  ? 78   ARG A N   1 
ATOM   505  C CA  . ARG A 1 78  ? 20.670  -33.292 49.737  1.00 72.45  ? 78   ARG A CA  1 
ATOM   506  C C   . ARG A 1 78  ? 22.137  -33.711 49.741  1.00 70.82  ? 78   ARG A C   1 
ATOM   507  O O   . ARG A 1 78  ? 22.817  -33.664 48.717  1.00 73.68  ? 78   ARG A O   1 
ATOM   508  C CB  . ARG A 1 78  ? 20.505  -32.164 50.751  1.00 84.98  ? 78   ARG A CB  1 
ATOM   509  C CG  . ARG A 1 78  ? 19.131  -31.549 50.868  1.00 83.20  ? 78   ARG A CG  1 
ATOM   510  C CD  . ARG A 1 78  ? 19.192  -30.426 51.897  1.00 92.38  ? 78   ARG A CD  1 
ATOM   511  N NE  . ARG A 1 78  ? 17.927  -30.281 52.608  1.00 109.92 ? 78   ARG A NE  1 
ATOM   512  C CZ  . ARG A 1 78  ? 17.805  -29.772 53.831  1.00 116.93 ? 78   ARG A CZ  1 
ATOM   513  N NH1 . ARG A 1 78  ? 18.882  -29.354 54.485  1.00 118.56 ? 78   ARG A NH1 1 
ATOM   514  N NH2 . ARG A 1 78  ? 16.606  -29.691 54.407  1.00 116.99 ? 78   ARG A NH2 1 
ATOM   515  N N   . GLU A 1 79  ? 22.608  -34.135 50.906  1.00 65.68  ? 79   GLU A N   1 
ATOM   516  C CA  . GLU A 1 79  ? 24.002  -34.512 51.064  1.00 74.09  ? 79   GLU A CA  1 
ATOM   517  C C   . GLU A 1 79  ? 24.504  -35.589 50.113  1.00 66.46  ? 79   GLU A C   1 
ATOM   518  O O   . GLU A 1 79  ? 25.560  -35.456 49.482  1.00 57.61  ? 79   GLU A O   1 
ATOM   519  C CB  . GLU A 1 79  ? 24.262  -34.947 52.506  1.00 91.39  ? 79   GLU A CB  1 
ATOM   520  C CG  . GLU A 1 79  ? 25.677  -34.626 52.952  1.00 105.79 ? 79   GLU A CG  1 
ATOM   521  C CD  . GLU A 1 79  ? 26.030  -33.164 52.687  1.00 113.29 ? 79   GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 79  ? 25.278  -32.278 53.163  1.00 117.42 ? 79   GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 79  ? 27.048  -32.900 52.002  1.00 114.42 ? 79   GLU A OE2 1 
ATOM   524  N N   . LEU A 1 80  ? 23.762  -36.677 50.033  1.00 67.97  ? 80   LEU A N   1 
ATOM   525  C CA  . LEU A 1 80  ? 24.164  -37.739 49.148  1.00 65.35  ? 80   LEU A CA  1 
ATOM   526  C C   . LEU A 1 80  ? 24.254  -37.121 47.761  1.00 70.48  ? 80   LEU A C   1 
ATOM   527  O O   . LEU A 1 80  ? 25.268  -37.249 47.080  1.00 78.42  ? 80   LEU A O   1 
ATOM   528  C CB  . LEU A 1 80  ? 23.131  -38.864 49.171  1.00 58.55  ? 80   LEU A CB  1 
ATOM   529  C CG  . LEU A 1 80  ? 23.399  -40.058 48.242  1.00 51.98  ? 80   LEU A CG  1 
ATOM   530  C CD1 . LEU A 1 80  ? 24.817  -40.653 48.506  1.00 38.93  ? 80   LEU A CD1 1 
ATOM   531  C CD2 . LEU A 1 80  ? 22.309  -41.110 48.455  1.00 37.31  ? 80   LEU A CD2 1 
ATOM   532  N N   . ASN A 1 81  ? 23.200  -36.425 47.357  1.00 65.01  ? 81   ASN A N   1 
ATOM   533  C CA  . ASN A 1 81  ? 23.192  -35.809 46.046  1.00 61.09  ? 81   ASN A CA  1 
ATOM   534  C C   . ASN A 1 81  ? 24.410  -34.934 45.787  1.00 63.78  ? 81   ASN A C   1 
ATOM   535  O O   . ASN A 1 81  ? 25.004  -34.992 44.706  1.00 65.42  ? 81   ASN A O   1 
ATOM   536  C CB  . ASN A 1 81  ? 21.916  -35.004 45.871  1.00 58.77  ? 81   ASN A CB  1 
ATOM   537  C CG  . ASN A 1 81  ? 20.697  -35.870 45.942  1.00 52.65  ? 81   ASN A CG  1 
ATOM   538  O OD1 . ASN A 1 81  ? 20.751  -37.047 45.594  1.00 54.60  ? 81   ASN A OD1 1 
ATOM   539  N ND2 . ASN A 1 81  ? 19.584  -35.301 46.387  1.00 55.86  ? 81   ASN A ND2 1 
ATOM   540  N N   . LYS A 1 82  ? 24.777  -34.120 46.772  1.00 65.51  ? 82   LYS A N   1 
ATOM   541  C CA  . LYS A 1 82  ? 25.942  -33.250 46.630  1.00 68.65  ? 82   LYS A CA  1 
ATOM   542  C C   . LYS A 1 82  ? 27.198  -34.098 46.346  1.00 68.87  ? 82   LYS A C   1 
ATOM   543  O O   . LYS A 1 82  ? 28.139  -33.658 45.678  1.00 62.43  ? 82   LYS A O   1 
ATOM   544  C CB  . LYS A 1 82  ? 26.139  -32.416 47.912  1.00 66.80  ? 82   LYS A CB  1 
ATOM   545  C CG  . LYS A 1 82  ? 25.036  -31.374 48.184  1.00 79.47  ? 82   LYS A CG  1 
ATOM   546  C CD  . LYS A 1 82  ? 25.148  -30.719 49.575  1.00 90.38  ? 82   LYS A CD  1 
ATOM   547  C CE  . LYS A 1 82  ? 26.410  -29.867 49.745  1.00 105.86 ? 82   LYS A CE  1 
ATOM   548  N NZ  . LYS A 1 82  ? 26.509  -29.243 51.106  1.00 108.90 ? 82   LYS A NZ  1 
ATOM   549  N N   . ARG A 1 83  ? 27.191  -35.332 46.834  1.00 73.83  ? 83   ARG A N   1 
ATOM   550  C CA  . ARG A 1 83  ? 28.327  -36.228 46.654  1.00 78.71  ? 83   ARG A CA  1 
ATOM   551  C C   . ARG A 1 83  ? 28.228  -37.176 45.468  1.00 82.19  ? 83   ARG A C   1 
ATOM   552  O O   . ARG A 1 83  ? 29.212  -37.826 45.109  1.00 86.40  ? 83   ARG A O   1 
ATOM   553  C CB  . ARG A 1 83  ? 28.505  -37.078 47.897  1.00 80.74  ? 83   ARG A CB  1 
ATOM   554  C CG  . ARG A 1 83  ? 28.846  -36.332 49.132  1.00 73.44  ? 83   ARG A CG  1 
ATOM   555  C CD  . ARG A 1 83  ? 28.914  -37.326 50.252  1.00 82.95  ? 83   ARG A CD  1 
ATOM   556  N NE  . ARG A 1 83  ? 29.752  -36.853 51.339  1.00 92.03  ? 83   ARG A NE  1 
ATOM   557  C CZ  . ARG A 1 83  ? 29.519  -35.729 52.003  1.00 98.24  ? 83   ARG A CZ  1 
ATOM   558  N NH1 . ARG A 1 83  ? 28.476  -34.982 51.676  1.00 106.35 ? 83   ARG A NH1 1 
ATOM   559  N NH2 . ARG A 1 83  ? 30.320  -35.349 52.989  1.00 95.35  ? 83   ARG A NH2 1 
ATOM   560  N N   . THR A 1 84  ? 27.043  -37.274 44.874  1.00 82.96  ? 84   THR A N   1 
ATOM   561  C CA  . THR A 1 84  ? 26.838  -38.194 43.762  1.00 75.70  ? 84   THR A CA  1 
ATOM   562  C C   . THR A 1 84  ? 27.205  -37.652 42.395  1.00 73.68  ? 84   THR A C   1 
ATOM   563  O O   . THR A 1 84  ? 26.820  -36.541 42.034  1.00 79.28  ? 84   THR A O   1 
ATOM   564  C CB  . THR A 1 84  ? 25.382  -38.661 43.691  1.00 66.32  ? 84   THR A CB  1 
ATOM   565  O OG1 . THR A 1 84  ? 25.005  -39.262 44.938  1.00 69.05  ? 84   THR A OG1 1 
ATOM   566  C CG2 . THR A 1 84  ? 25.219  -39.682 42.565  1.00 58.56  ? 84   THR A CG2 1 
ATOM   567  N N   . GLN A 1 85  ? 27.934  -38.469 41.639  1.00 66.90  ? 85   GLN A N   1 
ATOM   568  C CA  . GLN A 1 85  ? 28.368  -38.140 40.286  1.00 63.29  ? 85   GLN A CA  1 
ATOM   569  C C   . GLN A 1 85  ? 27.253  -37.473 39.466  1.00 66.89  ? 85   GLN A C   1 
ATOM   570  O O   . GLN A 1 85  ? 26.071  -37.606 39.787  1.00 63.16  ? 85   GLN A O   1 
ATOM   571  C CB  . GLN A 1 85  ? 28.778  -39.421 39.581  1.00 54.61  ? 85   GLN A CB  1 
ATOM   572  C CG  . GLN A 1 85  ? 27.619  -40.394 39.451  1.00 55.19  ? 85   GLN A CG  1 
ATOM   573  C CD  . GLN A 1 85  ? 27.805  -41.372 38.316  1.00 62.00  ? 85   GLN A CD  1 
ATOM   574  O OE1 . GLN A 1 85  ? 28.385  -42.455 38.481  1.00 54.79  ? 85   GLN A OE1 1 
ATOM   575  N NE2 . GLN A 1 85  ? 27.322  -40.988 37.140  1.00 71.65  ? 85   GLN A NE2 1 
ATOM   576  N N   . ASP A 1 86  ? 27.633  -36.760 38.404  1.00 71.84  ? 86   ASP A N   1 
ATOM   577  C CA  . ASP A 1 86  ? 26.659  -36.103 37.525  1.00 66.84  ? 86   ASP A CA  1 
ATOM   578  C C   . ASP A 1 86  ? 26.183  -37.143 36.535  1.00 65.71  ? 86   ASP A C   1 
ATOM   579  O O   . ASP A 1 86  ? 26.916  -38.085 36.244  1.00 64.93  ? 86   ASP A O   1 
ATOM   580  C CB  . ASP A 1 86  ? 27.302  -34.969 36.741  1.00 61.50  ? 86   ASP A CB  1 
ATOM   581  C CG  . ASP A 1 86  ? 27.610  -33.789 37.599  1.00 69.92  ? 86   ASP A CG  1 
ATOM   582  O OD1 . ASP A 1 86  ? 28.805  -33.440 37.721  1.00 71.88  ? 86   ASP A OD1 1 
ATOM   583  O OD2 . ASP A 1 86  ? 26.646  -33.214 38.154  1.00 74.91  ? 86   ASP A OD2 1 
ATOM   584  N N   . PHE A 1 87  ? 24.966  -36.989 36.018  1.00 64.40  ? 87   PHE A N   1 
ATOM   585  C CA  . PHE A 1 87  ? 24.449  -37.949 35.039  1.00 66.35  ? 87   PHE A CA  1 
ATOM   586  C C   . PHE A 1 87  ? 24.122  -37.215 33.746  1.00 69.43  ? 87   PHE A C   1 
ATOM   587  O O   . PHE A 1 87  ? 24.161  -35.985 33.707  1.00 76.26  ? 87   PHE A O   1 
ATOM   588  C CB  . PHE A 1 87  ? 23.177  -38.633 35.544  1.00 69.53  ? 87   PHE A CB  1 
ATOM   589  C CG  . PHE A 1 87  ? 23.360  -39.395 36.817  1.00 66.20  ? 87   PHE A CG  1 
ATOM   590  C CD1 . PHE A 1 87  ? 23.329  -38.742 38.048  1.00 58.59  ? 87   PHE A CD1 1 
ATOM   591  C CD2 . PHE A 1 87  ? 23.568  -40.769 36.793  1.00 64.34  ? 87   PHE A CD2 1 
ATOM   592  C CE1 . PHE A 1 87  ? 23.500  -39.447 39.237  1.00 55.17  ? 87   PHE A CE1 1 
ATOM   593  C CE2 . PHE A 1 87  ? 23.742  -41.481 37.985  1.00 62.77  ? 87   PHE A CE2 1 
ATOM   594  C CZ  . PHE A 1 87  ? 23.706  -40.817 39.205  1.00 52.11  ? 87   PHE A CZ  1 
ATOM   595  N N   . TRP A 1 88  ? 23.801  -37.952 32.686  1.00 68.10  ? 88   TRP A N   1 
ATOM   596  C CA  . TRP A 1 88  ? 23.461  -37.273 31.455  1.00 72.27  ? 88   TRP A CA  1 
ATOM   597  C C   . TRP A 1 88  ? 22.126  -36.600 31.684  1.00 81.41  ? 88   TRP A C   1 
ATOM   598  O O   . TRP A 1 88  ? 21.196  -37.213 32.200  1.00 73.20  ? 88   TRP A O   1 
ATOM   599  C CB  . TRP A 1 88  ? 23.350  -38.230 30.274  1.00 72.55  ? 88   TRP A CB  1 
ATOM   600  C CG  . TRP A 1 88  ? 23.118  -37.469 28.999  1.00 68.48  ? 88   TRP A CG  1 
ATOM   601  C CD1 . TRP A 1 88  ? 22.070  -37.613 28.136  1.00 64.98  ? 88   TRP A CD1 1 
ATOM   602  C CD2 . TRP A 1 88  ? 23.905  -36.374 28.496  1.00 71.95  ? 88   TRP A CD2 1 
ATOM   603  N NE1 . TRP A 1 88  ? 22.148  -36.674 27.134  1.00 75.43  ? 88   TRP A NE1 1 
ATOM   604  C CE2 . TRP A 1 88  ? 23.263  -35.900 27.328  1.00 76.30  ? 88   TRP A CE2 1 
ATOM   605  C CE3 . TRP A 1 88  ? 25.088  -35.744 28.923  1.00 76.86  ? 88   TRP A CE3 1 
ATOM   606  C CZ2 . TRP A 1 88  ? 23.762  -34.819 26.575  1.00 77.29  ? 88   TRP A CZ2 1 
ATOM   607  C CZ3 . TRP A 1 88  ? 25.589  -34.661 28.173  1.00 71.51  ? 88   TRP A CZ3 1 
ATOM   608  C CH2 . TRP A 1 88  ? 24.921  -34.214 27.012  1.00 71.49  ? 88   TRP A CH2 1 
ATOM   609  N N   . GLU A 1 89  ? 22.049  -35.330 31.299  1.00 99.42  ? 89   GLU A N   1 
ATOM   610  C CA  . GLU A 1 89  ? 20.845  -34.520 31.458  1.00 111.07 ? 89   GLU A CA  1 
ATOM   611  C C   . GLU A 1 89  ? 19.532  -35.262 31.254  1.00 112.60 ? 89   GLU A C   1 
ATOM   612  O O   . GLU A 1 89  ? 19.335  -35.952 30.247  1.00 111.54 ? 89   GLU A O   1 
ATOM   613  C CB  . GLU A 1 89  ? 20.872  -33.328 30.493  1.00 113.68 ? 89   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 89  ? 20.853  -33.721 29.021  1.00 115.11 ? 89   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 89  ? 20.524  -32.558 28.109  1.00 116.83 ? 89   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 89  ? 19.329  -32.200 27.988  1.00 113.11 ? 89   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 89  ? 21.469  -31.994 27.521  1.00 120.90 ? 89   GLU A OE2 1 
ATOM   618  N N   . VAL A 1 90  ? 18.626  -35.101 32.211  1.00 113.14 ? 90   VAL A N   1 
ATOM   619  C CA  . VAL A 1 90  ? 17.317  -35.715 32.116  1.00 107.09 ? 90   VAL A CA  1 
ATOM   620  C C   . VAL A 1 90  ? 16.662  -34.936 30.964  1.00 108.41 ? 90   VAL A C   1 
ATOM   621  O O   . VAL A 1 90  ? 15.470  -34.654 30.969  1.00 111.46 ? 90   VAL A O   1 
ATOM   622  C CB  . VAL A 1 90  ? 16.529  -35.541 33.448  1.00 94.97  ? 90   VAL A CB  1 
ATOM   623  C CG1 . VAL A 1 90  ? 15.394  -36.559 33.522  1.00 93.83  ? 90   VAL A CG1 1 
ATOM   624  C CG2 . VAL A 1 90  ? 17.479  -35.703 34.644  1.00 69.36  ? 90   VAL A CG2 1 
ATOM   625  N N   . GLN A 1 91  ? 17.500  -34.575 29.994  1.00 108.28 ? 91   GLN A N   1 
ATOM   626  C CA  . GLN A 1 91  ? 17.130  -33.846 28.789  1.00 111.47 ? 91   GLN A CA  1 
ATOM   627  C C   . GLN A 1 91  ? 15.992  -32.848 28.991  1.00 106.07 ? 91   GLN A C   1 
ATOM   628  O O   . GLN A 1 91  ? 14.836  -33.230 29.166  1.00 98.14  ? 91   GLN A O   1 
ATOM   629  C CB  . GLN A 1 91  ? 16.786  -34.855 27.684  1.00 114.59 ? 91   GLN A CB  1 
ATOM   630  C CG  . GLN A 1 91  ? 17.381  -34.535 26.323  1.00 113.13 ? 91   GLN A CG  1 
ATOM   631  C CD  . GLN A 1 91  ? 16.601  -33.470 25.594  1.00 116.38 ? 91   GLN A CD  1 
ATOM   632  O OE1 . GLN A 1 91  ? 17.151  -32.449 25.182  1.00 124.21 ? 91   GLN A OE1 1 
ATOM   633  N NE2 . GLN A 1 91  ? 15.306  -33.704 25.427  1.00 102.88 ? 91   GLN A NE2 1 
ATOM   634  N N   . LEU A 1 92  ? 16.320  -31.562 28.966  1.00 102.79 ? 92   LEU A N   1 
ATOM   635  C CA  . LEU A 1 92  ? 15.291  -30.553 29.158  1.00 107.57 ? 92   LEU A CA  1 
ATOM   636  C C   . LEU A 1 92  ? 14.654  -30.059 27.875  1.00 106.04 ? 92   LEU A C   1 
ATOM   637  O O   . LEU A 1 92  ? 13.847  -29.128 27.903  1.00 108.97 ? 92   LEU A O   1 
ATOM   638  C CB  . LEU A 1 92  ? 15.829  -29.360 29.945  1.00 112.46 ? 92   LEU A CB  1 
ATOM   639  C CG  . LEU A 1 92  ? 15.901  -29.580 31.457  1.00 116.30 ? 92   LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 92  ? 16.161  -28.236 32.134  1.00 118.56 ? 92   LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 92  ? 14.591  -30.202 31.969  1.00 108.74 ? 92   LEU A CD2 1 
ATOM   642  N N   . GLY A 1 93  ? 15.018  -30.673 26.752  1.00 97.36  ? 93   GLY A N   1 
ATOM   643  C CA  . GLY A 1 93  ? 14.431  -30.281 25.480  1.00 78.90  ? 93   GLY A CA  1 
ATOM   644  C C   . GLY A 1 93  ? 13.104  -31.002 25.322  1.00 68.81  ? 93   GLY A C   1 
ATOM   645  O O   . GLY A 1 93  ? 13.027  -32.213 25.530  1.00 69.38  ? 93   GLY A O   1 
ATOM   646  N N   . ILE A 1 94  ? 12.046  -30.285 24.978  1.00 56.36  ? 94   ILE A N   1 
ATOM   647  C CA  . ILE A 1 94  ? 10.779  -30.960 24.828  1.00 52.93  ? 94   ILE A CA  1 
ATOM   648  C C   . ILE A 1 94  ? 10.117  -30.582 23.530  1.00 58.57  ? 94   ILE A C   1 
ATOM   649  O O   . ILE A 1 94  ? 10.388  -29.526 22.966  1.00 71.54  ? 94   ILE A O   1 
ATOM   650  C CB  . ILE A 1 94  ? 9.847   -30.631 25.964  1.00 53.19  ? 94   ILE A CB  1 
ATOM   651  C CG1 . ILE A 1 94  ? 9.465   -29.156 25.894  1.00 53.48  ? 94   ILE A CG1 1 
ATOM   652  C CG2 . ILE A 1 94  ? 10.513  -30.984 27.277  1.00 47.22  ? 94   ILE A CG2 1 
ATOM   653  C CD1 . ILE A 1 94  ? 8.378   -28.769 26.875  1.00 48.03  ? 94   ILE A CD1 1 
ATOM   654  N N   . PRO A 1 95  ? 9.216   -31.441 23.045  1.00 53.52  ? 95   PRO A N   1 
ATOM   655  C CA  . PRO A 1 95  ? 8.472   -31.266 21.798  1.00 43.64  ? 95   PRO A CA  1 
ATOM   656  C C   . PRO A 1 95  ? 7.597   -30.036 21.745  1.00 46.30  ? 95   PRO A C   1 
ATOM   657  O O   . PRO A 1 95  ? 7.097   -29.573 22.755  1.00 53.76  ? 95   PRO A O   1 
ATOM   658  C CB  . PRO A 1 95  ? 7.634   -32.526 21.724  1.00 38.21  ? 95   PRO A CB  1 
ATOM   659  C CG  . PRO A 1 95  ? 8.421   -33.525 22.528  1.00 41.42  ? 95   PRO A CG  1 
ATOM   660  C CD  . PRO A 1 95  ? 8.831   -32.700 23.697  1.00 50.12  ? 95   PRO A CD  1 
ATOM   661  N N   . HIS A 1 96  ? 7.445   -29.486 20.554  1.00 46.78  ? 96   HIS A N   1 
ATOM   662  C CA  . HIS A 1 96  ? 6.566   -28.356 20.389  1.00 44.43  ? 96   HIS A CA  1 
ATOM   663  C C   . HIS A 1 96  ? 5.428   -29.002 19.625  1.00 40.57  ? 96   HIS A C   1 
ATOM   664  O O   . HIS A 1 96  ? 5.665   -29.673 18.623  1.00 39.19  ? 96   HIS A O   1 
ATOM   665  C CB  . HIS A 1 96  ? 7.191   -27.251 19.550  1.00 46.85  ? 96   HIS A CB  1 
ATOM   666  C CG  . HIS A 1 96  ? 6.286   -26.068 19.381  1.00 57.95  ? 96   HIS A CG  1 
ATOM   667  N ND1 . HIS A 1 96  ? 5.069   -26.150 18.732  1.00 59.11  ? 96   HIS A ND1 1 
ATOM   668  C CD2 . HIS A 1 96  ? 6.388   -24.792 19.827  1.00 60.97  ? 96   HIS A CD2 1 
ATOM   669  C CE1 . HIS A 1 96  ? 4.465   -24.975 18.783  1.00 58.24  ? 96   HIS A CE1 1 
ATOM   670  N NE2 . HIS A 1 96  ? 5.243   -24.133 19.442  1.00 57.20  ? 96   HIS A NE2 1 
ATOM   671  N N   . PRO A 1 97  ? 4.182   -28.802 20.081  1.00 35.11  ? 97   PRO A N   1 
ATOM   672  C CA  . PRO A 1 97  ? 2.961   -29.356 19.487  1.00 32.87  ? 97   PRO A CA  1 
ATOM   673  C C   . PRO A 1 97  ? 2.893   -29.306 17.961  1.00 45.15  ? 97   PRO A C   1 
ATOM   674  O O   . PRO A 1 97  ? 2.304   -30.183 17.320  1.00 51.83  ? 97   PRO A O   1 
ATOM   675  C CB  . PRO A 1 97  ? 1.862   -28.521 20.129  1.00 35.35  ? 97   PRO A CB  1 
ATOM   676  C CG  . PRO A 1 97  ? 2.439   -28.141 21.433  1.00 32.74  ? 97   PRO A CG  1 
ATOM   677  C CD  . PRO A 1 97  ? 3.843   -27.765 21.070  1.00 34.92  ? 97   PRO A CD  1 
ATOM   678  N N   . ALA A 1 98  ? 3.484   -28.275 17.374  1.00 40.69  ? 98   ALA A N   1 
ATOM   679  C CA  . ALA A 1 98  ? 3.454   -28.142 15.929  1.00 38.71  ? 98   ALA A CA  1 
ATOM   680  C C   . ALA A 1 98  ? 4.284   -29.200 15.217  1.00 47.41  ? 98   ALA A C   1 
ATOM   681  O O   . ALA A 1 98  ? 4.036   -29.499 14.055  1.00 54.58  ? 98   ALA A O   1 
ATOM   682  C CB  . ALA A 1 98  ? 3.935   -26.771 15.540  1.00 48.52  ? 98   ALA A CB  1 
ATOM   683  N N   . GLY A 1 99  ? 5.280   -29.759 15.898  1.00 53.75  ? 99   GLY A N   1 
ATOM   684  C CA  . GLY A 1 99  ? 6.121   -30.777 15.276  1.00 58.11  ? 99   GLY A CA  1 
ATOM   685  C C   . GLY A 1 99  ? 5.530   -32.176 15.324  1.00 61.43  ? 99   GLY A C   1 
ATOM   686  O O   . GLY A 1 99  ? 6.182   -33.144 14.924  1.00 67.42  ? 99   GLY A O   1 
ATOM   687  N N   . LEU A 1 100 ? 4.289   -32.268 15.802  1.00 56.00  ? 100  LEU A N   1 
ATOM   688  C CA  . LEU A 1 100 ? 3.563   -33.528 15.929  1.00 53.11  ? 100  LEU A CA  1 
ATOM   689  C C   . LEU A 1 100 ? 2.727   -33.896 14.698  1.00 60.75  ? 100  LEU A C   1 
ATOM   690  O O   . LEU A 1 100 ? 2.248   -33.028 13.961  1.00 69.44  ? 100  LEU A O   1 
ATOM   691  C CB  . LEU A 1 100 ? 2.619   -33.457 17.134  1.00 49.51  ? 100  LEU A CB  1 
ATOM   692  C CG  . LEU A 1 100 ? 3.181   -33.042 18.499  1.00 39.66  ? 100  LEU A CG  1 
ATOM   693  C CD1 . LEU A 1 100 ? 2.092   -33.102 19.603  1.00 23.34  ? 100  LEU A CD1 1 
ATOM   694  C CD2 . LEU A 1 100 ? 4.336   -33.964 18.821  1.00 22.92  ? 100  LEU A CD2 1 
ATOM   695  N N   . LYS A 1 101 ? 2.532   -35.194 14.500  1.00 59.80  ? 101  LYS A N   1 
ATOM   696  C CA  . LYS A 1 101 ? 1.740   -35.683 13.382  1.00 60.43  ? 101  LYS A CA  1 
ATOM   697  C C   . LYS A 1 101 ? 0.494   -36.246 14.008  1.00 65.37  ? 101  LYS A C   1 
ATOM   698  O O   . LYS A 1 101 ? 0.560   -37.010 14.987  1.00 66.02  ? 101  LYS A O   1 
ATOM   699  C CB  . LYS A 1 101 ? 2.506   -36.760 12.653  1.00 47.97  ? 101  LYS A CB  1 
ATOM   700  C CG  . LYS A 1 101 ? 3.953   -36.374 12.601  1.00 65.29  ? 101  LYS A CG  1 
ATOM   701  C CD  . LYS A 1 101 ? 4.815   -37.356 11.858  1.00 81.53  ? 101  LYS A CD  1 
ATOM   702  C CE  . LYS A 1 101 ? 6.181   -36.739 11.575  1.00 84.24  ? 101  LYS A CE  1 
ATOM   703  N NZ  . LYS A 1 101 ? 7.014   -37.645 10.745  1.00 90.48  ? 101  LYS A NZ  1 
ATOM   704  N N   . LYS A 1 102 ? -0.646  -35.867 13.452  1.00 65.33  ? 102  LYS A N   1 
ATOM   705  C CA  . LYS A 1 102 ? -1.887  -36.326 14.021  1.00 62.66  ? 102  LYS A CA  1 
ATOM   706  C C   . LYS A 1 102 ? -2.031  -37.842 14.069  1.00 62.92  ? 102  LYS A C   1 
ATOM   707  O O   . LYS A 1 102 ? -1.551  -38.594 13.198  1.00 55.97  ? 102  LYS A O   1 
ATOM   708  C CB  . LYS A 1 102 ? -3.071  -35.717 13.293  1.00 55.85  ? 102  LYS A CB  1 
ATOM   709  C CG  . LYS A 1 102 ? -3.143  -36.160 11.880  1.00 66.82  ? 102  LYS A CG  1 
ATOM   710  C CD  . LYS A 1 102 ? -4.587  -36.364 11.459  1.00 73.99  ? 102  LYS A CD  1 
ATOM   711  C CE  . LYS A 1 102 ? -5.412  -35.080 11.523  1.00 83.37  ? 102  LYS A CE  1 
ATOM   712  N NZ  . LYS A 1 102 ? -6.804  -35.251 10.953  1.00 98.53  ? 102  LYS A NZ  1 
ATOM   713  N N   . LYS A 1 103 ? -2.704  -38.245 15.143  1.00 66.22  ? 103  LYS A N   1 
ATOM   714  C CA  . LYS A 1 103 ? -3.020  -39.623 15.483  1.00 65.89  ? 103  LYS A CA  1 
ATOM   715  C C   . LYS A 1 103 ? -4.534  -39.712 15.642  1.00 71.14  ? 103  LYS A C   1 
ATOM   716  O O   . LYS A 1 103 ? -5.205  -38.701 15.872  1.00 73.00  ? 103  LYS A O   1 
ATOM   717  C CB  . LYS A 1 103 ? -2.339  -39.986 16.811  1.00 45.75  ? 103  LYS A CB  1 
ATOM   718  C CG  . LYS A 1 103 ? -0.842  -39.939 16.686  1.00 36.42  ? 103  LYS A CG  1 
ATOM   719  C CD  . LYS A 1 103 ? -0.454  -40.831 15.531  1.00 36.48  ? 103  LYS A CD  1 
ATOM   720  C CE  . LYS A 1 103 ? 0.963   -40.607 15.085  1.00 42.99  ? 103  LYS A CE  1 
ATOM   721  N NZ  . LYS A 1 103 ? 1.277   -41.526 13.937  1.00 58.28  ? 103  LYS A NZ  1 
ATOM   722  N N   . LYS A 1 104 ? -5.086  -40.907 15.496  1.00 70.57  ? 104  LYS A N   1 
ATOM   723  C CA  . LYS A 1 104 ? -6.513  -41.033 15.687  1.00 66.79  ? 104  LYS A CA  1 
ATOM   724  C C   . LYS A 1 104 ? -6.727  -41.020 17.190  1.00 65.81  ? 104  LYS A C   1 
ATOM   725  O O   . LYS A 1 104 ? -7.386  -40.131 17.718  1.00 67.19  ? 104  LYS A O   1 
ATOM   726  C CB  . LYS A 1 104 ? -7.022  -42.324 15.060  1.00 75.14  ? 104  LYS A CB  1 
ATOM   727  C CG  . LYS A 1 104 ? -7.221  -42.200 13.546  1.00 84.75  ? 104  LYS A CG  1 
ATOM   728  C CD  . LYS A 1 104 ? -7.609  -43.521 12.876  1.00 89.71  ? 104  LYS A CD  1 
ATOM   729  C CE  . LYS A 1 104 ? -8.891  -44.099 13.457  1.00 99.90  ? 104  LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 104 ? -8.781  -44.383 14.928  1.00 104.72 ? 104  LYS A NZ  1 
ATOM   731  N N   . SER A 1 105 ? -6.132  -41.986 17.883  1.00 63.94  ? 105  SER A N   1 
ATOM   732  C CA  . SER A 1 105 ? -6.265  -42.060 19.327  1.00 58.83  ? 105  SER A CA  1 
ATOM   733  C C   . SER A 1 105 ? -4.926  -41.864 20.022  1.00 61.99  ? 105  SER A C   1 
ATOM   734  O O   . SER A 1 105 ? -3.870  -42.221 19.494  1.00 54.40  ? 105  SER A O   1 
ATOM   735  C CB  . SER A 1 105 ? -6.903  -43.399 19.733  1.00 52.70  ? 105  SER A CB  1 
ATOM   736  O OG  . SER A 1 105 ? -6.723  -44.391 18.733  1.00 56.09  ? 105  SER A OG  1 
ATOM   737  N N   . VAL A 1 106 ? -4.988  -41.255 21.201  1.00 65.43  ? 106  VAL A N   1 
ATOM   738  C CA  . VAL A 1 106 ? -3.803  -41.009 22.008  1.00 63.86  ? 106  VAL A CA  1 
ATOM   739  C C   . VAL A 1 106 ? -4.114  -41.245 23.479  1.00 65.50  ? 106  VAL A C   1 
ATOM   740  O O   . VAL A 1 106 ? -5.020  -40.635 24.050  1.00 63.62  ? 106  VAL A O   1 
ATOM   741  C CB  . VAL A 1 106 ? -3.280  -39.581 21.844  1.00 60.92  ? 106  VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 106 ? -2.084  -39.376 22.772  1.00 56.17  ? 106  VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 106 ? -2.858  -39.344 20.392  1.00 66.34  ? 106  VAL A CG2 1 
ATOM   744  N N   . THR A 1 107 ? -3.330  -42.128 24.085  1.00 64.38  ? 107  THR A N   1 
ATOM   745  C CA  . THR A 1 107 ? -3.509  -42.511 25.470  1.00 57.01  ? 107  THR A CA  1 
ATOM   746  C C   . THR A 1 107 ? -2.392  -42.100 26.382  1.00 53.77  ? 107  THR A C   1 
ATOM   747  O O   . THR A 1 107 ? -1.234  -42.447 26.155  1.00 50.70  ? 107  THR A O   1 
ATOM   748  C CB  . THR A 1 107 ? -3.598  -44.018 25.605  1.00 59.21  ? 107  THR A CB  1 
ATOM   749  O OG1 . THR A 1 107 ? -4.626  -44.515 24.744  1.00 57.34  ? 107  THR A OG1 1 
ATOM   750  C CG2 . THR A 1 107 ? -3.883  -44.396 27.042  1.00 51.26  ? 107  THR A CG2 1 
ATOM   751  N N   . VAL A 1 108 ? -2.756  -41.387 27.437  1.00 51.08  ? 108  VAL A N   1 
ATOM   752  C CA  . VAL A 1 108 ? -1.785  -40.970 28.444  1.00 59.80  ? 108  VAL A CA  1 
ATOM   753  C C   . VAL A 1 108 ? -1.653  -42.096 29.500  1.00 63.27  ? 108  VAL A C   1 
ATOM   754  O O   . VAL A 1 108 ? -2.624  -42.450 30.184  1.00 69.49  ? 108  VAL A O   1 
ATOM   755  C CB  . VAL A 1 108 ? -2.230  -39.656 29.157  1.00 65.20  ? 108  VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 108 ? -3.578  -39.873 29.871  1.00 72.11  ? 108  VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 108 ? -1.143  -39.195 30.159  1.00 63.79  ? 108  VAL A CG2 1 
ATOM   758  N N   . LEU A 1 109 ? -0.455  -42.660 29.628  1.00 63.73  ? 109  LEU A N   1 
ATOM   759  C CA  . LEU A 1 109 ? -0.215  -43.737 30.590  1.00 67.75  ? 109  LEU A CA  1 
ATOM   760  C C   . LEU A 1 109 ? 0.620   -43.259 31.767  1.00 68.05  ? 109  LEU A C   1 
ATOM   761  O O   . LEU A 1 109 ? 1.819   -42.988 31.625  1.00 73.63  ? 109  LEU A O   1 
ATOM   762  C CB  . LEU A 1 109 ? 0.472   -44.921 29.895  1.00 63.72  ? 109  LEU A CB  1 
ATOM   763  C CG  . LEU A 1 109 ? -0.452  -46.109 29.581  1.00 67.06  ? 109  LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 109 ? -1.847  -45.618 29.224  1.00 71.58  ? 109  LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 109 ? 0.139   -46.935 28.431  1.00 70.79  ? 109  LEU A CD2 1 
ATOM   766  N N   . ASP A 1 110 ? -0.017  -43.154 32.928  1.00 63.43  ? 110  ASP A N   1 
ATOM   767  C CA  . ASP A 1 110 ? 0.691   -42.703 34.113  1.00 70.07  ? 110  ASP A CA  1 
ATOM   768  C C   . ASP A 1 110 ? 1.439   -43.851 34.796  1.00 72.85  ? 110  ASP A C   1 
ATOM   769  O O   . ASP A 1 110 ? 1.016   -45.013 34.742  1.00 71.63  ? 110  ASP A O   1 
ATOM   770  C CB  . ASP A 1 110 ? -0.277  -42.037 35.083  1.00 81.08  ? 110  ASP A CB  1 
ATOM   771  C CG  . ASP A 1 110 ? 0.437   -41.346 36.212  1.00 101.80 ? 110  ASP A CG  1 
ATOM   772  O OD1 . ASP A 1 110 ? 0.697   -42.015 37.240  1.00 100.87 ? 110  ASP A OD1 1 
ATOM   773  O OD2 . ASP A 1 110 ? 0.755   -40.141 36.054  1.00 114.04 ? 110  ASP A OD2 1 
ATOM   774  N N   . VAL A 1 111 ? 2.553   -43.523 35.442  1.00 73.68  ? 111  VAL A N   1 
ATOM   775  C CA  . VAL A 1 111 ? 3.363   -44.549 36.076  1.00 78.83  ? 111  VAL A CA  1 
ATOM   776  C C   . VAL A 1 111 ? 3.542   -44.411 37.563  1.00 89.00  ? 111  VAL A C   1 
ATOM   777  O O   . VAL A 1 111 ? 4.174   -43.465 38.041  1.00 86.26  ? 111  VAL A O   1 
ATOM   778  C CB  . VAL A 1 111 ? 4.755   -44.583 35.483  1.00 74.90  ? 111  VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 111 ? 5.461   -45.884 35.898  1.00 66.68  ? 111  VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 111 ? 4.668   -44.400 33.975  1.00 54.52  ? 111  VAL A CG2 1 
ATOM   781  N N   . GLY A 1 112 ? 3.019   -45.393 38.288  1.00 98.38  ? 112  GLY A N   1 
ATOM   782  C CA  . GLY A 1 112 ? 3.130   -45.377 39.731  1.00 106.30 ? 112  GLY A CA  1 
ATOM   783  C C   . GLY A 1 112 ? 4.303   -46.206 40.209  1.00 111.49 ? 112  GLY A C   1 
ATOM   784  O O   . GLY A 1 112 ? 4.613   -47.255 39.621  1.00 105.33 ? 112  GLY A O   1 
ATOM   785  N N   . ASP A 1 113 ? 4.945   -45.726 41.278  1.00 119.39 ? 113  ASP A N   1 
ATOM   786  C CA  . ASP A 1 113 ? 6.105   -46.386 41.887  1.00 121.22 ? 113  ASP A CA  1 
ATOM   787  C C   . ASP A 1 113 ? 7.216   -46.463 40.862  1.00 115.30 ? 113  ASP A C   1 
ATOM   788  O O   . ASP A 1 113 ? 8.205   -47.180 41.033  1.00 108.77 ? 113  ASP A O   1 
ATOM   789  C CB  . ASP A 1 113 ? 5.734   -47.795 42.377  1.00 126.50 ? 113  ASP A CB  1 
ATOM   790  C CG  . ASP A 1 113 ? 4.966   -47.780 43.706  1.00 130.17 ? 113  ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 113 ? 3.860   -47.186 43.793  1.00 122.82 ? 113  ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 113 ? 5.479   -48.376 44.675  1.00 137.56 ? 113  ASP A OD2 1 
ATOM   793  N N   . ALA A 1 114 ? 7.018   -45.702 39.794  1.00 112.61 ? 114  ALA A N   1 
ATOM   794  C CA  . ALA A 1 114 ? 7.950   -45.640 38.699  1.00 106.49 ? 114  ALA A CA  1 
ATOM   795  C C   . ALA A 1 114 ? 9.350   -45.846 39.226  1.00 107.82 ? 114  ALA A C   1 
ATOM   796  O O   . ALA A 1 114 ? 9.985   -46.856 38.932  1.00 104.09 ? 114  ALA A O   1 
ATOM   797  C CB  . ALA A 1 114 ? 7.840   -44.308 38.026  1.00 94.32  ? 114  ALA A CB  1 
ATOM   798  N N   . TYR A 1 115 ? 9.816   -44.901 40.037  1.00 114.92 ? 115  TYR A N   1 
ATOM   799  C CA  . TYR A 1 115 ? 11.169  -44.973 40.584  1.00 121.89 ? 115  TYR A CA  1 
ATOM   800  C C   . TYR A 1 115 ? 11.459  -46.232 41.400  1.00 127.13 ? 115  TYR A C   1 
ATOM   801  O O   . TYR A 1 115 ? 12.515  -46.849 41.239  1.00 128.12 ? 115  TYR A O   1 
ATOM   802  C CB  . TYR A 1 115 ? 11.489  -43.735 41.452  1.00 120.10 ? 115  TYR A CB  1 
ATOM   803  C CG  . TYR A 1 115 ? 11.682  -42.416 40.700  1.00 117.30 ? 115  TYR A CG  1 
ATOM   804  C CD1 . TYR A 1 115 ? 12.407  -41.359 41.272  1.00 109.66 ? 115  TYR A CD1 1 
ATOM   805  C CD2 . TYR A 1 115 ? 11.121  -42.210 39.432  1.00 120.98 ? 115  TYR A CD2 1 
ATOM   806  C CE1 . TYR A 1 115 ? 12.569  -40.124 40.594  1.00 109.78 ? 115  TYR A CE1 1 
ATOM   807  C CE2 . TYR A 1 115 ? 11.276  -40.979 38.747  1.00 116.42 ? 115  TYR A CE2 1 
ATOM   808  C CZ  . TYR A 1 115 ? 11.999  -39.943 39.330  1.00 110.01 ? 115  TYR A CZ  1 
ATOM   809  O OH  . TYR A 1 115 ? 12.141  -38.747 38.642  1.00 95.21  ? 115  TYR A OH  1 
ATOM   810  N N   . PHE A 1 116 ? 10.526  -46.617 42.268  1.00 130.10 ? 116  PHE A N   1 
ATOM   811  C CA  . PHE A 1 116 ? 10.721  -47.786 43.127  1.00 128.95 ? 116  PHE A CA  1 
ATOM   812  C C   . PHE A 1 116 ? 10.821  -49.075 42.352  1.00 125.10 ? 116  PHE A C   1 
ATOM   813  O O   . PHE A 1 116 ? 11.388  -50.058 42.833  1.00 124.25 ? 116  PHE A O   1 
ATOM   814  C CB  . PHE A 1 116 ? 9.578   -47.900 44.123  1.00 131.38 ? 116  PHE A CB  1 
ATOM   815  C CG  . PHE A 1 116 ? 9.102   -46.589 44.620  1.00 138.68 ? 116  PHE A CG  1 
ATOM   816  C CD1 . PHE A 1 116 ? 10.011  -45.615 45.006  1.00 142.25 ? 116  PHE A CD1 1 
ATOM   817  C CD2 . PHE A 1 116 ? 7.748   -46.303 44.662  1.00 142.68 ? 116  PHE A CD2 1 
ATOM   818  C CE1 . PHE A 1 116 ? 9.578   -44.376 45.418  1.00 148.61 ? 116  PHE A CE1 1 
ATOM   819  C CE2 . PHE A 1 116 ? 7.300   -45.065 45.076  1.00 146.40 ? 116  PHE A CE2 1 
ATOM   820  C CZ  . PHE A 1 116 ? 8.216   -44.095 45.455  1.00 149.99 ? 116  PHE A CZ  1 
ATOM   821  N N   . SER A 1 117 ? 10.267  -49.059 41.147  1.00 119.57 ? 117  SER A N   1 
ATOM   822  C CA  . SER A 1 117 ? 10.261  -50.224 40.277  1.00 107.39 ? 117  SER A CA  1 
ATOM   823  C C   . SER A 1 117 ? 11.660  -50.641 39.757  1.00 96.63  ? 117  SER A C   1 
ATOM   824  O O   . SER A 1 117 ? 11.877  -51.797 39.385  1.00 94.96  ? 117  SER A O   1 
ATOM   825  C CB  . SER A 1 117 ? 9.308   -49.948 39.104  1.00 101.42 ? 117  SER A CB  1 
ATOM   826  O OG  . SER A 1 117 ? 8.081   -49.399 39.568  1.00 92.67  ? 117  SER A OG  1 
ATOM   827  N N   . VAL A 1 118 ? 12.618  -49.720 39.765  1.00 81.84  ? 118  VAL A N   1 
ATOM   828  C CA  . VAL A 1 118 ? 13.942  -50.024 39.241  1.00 67.51  ? 118  VAL A CA  1 
ATOM   829  C C   . VAL A 1 118 ? 15.027  -50.199 40.293  1.00 63.44  ? 118  VAL A C   1 
ATOM   830  O O   . VAL A 1 118 ? 15.070  -49.461 41.268  1.00 66.44  ? 118  VAL A O   1 
ATOM   831  C CB  . VAL A 1 118 ? 14.410  -48.909 38.292  1.00 59.99  ? 118  VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 118 ? 15.564  -49.389 37.464  1.00 56.58  ? 118  VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 118 ? 13.276  -48.459 37.407  1.00 48.36  ? 118  VAL A CG2 1 
ATOM   834  N N   . PRO A 1 119 ? 15.918  -51.190 40.108  1.00 62.13  ? 119  PRO A N   1 
ATOM   835  C CA  . PRO A 1 119 ? 17.025  -51.459 41.043  1.00 64.89  ? 119  PRO A CA  1 
ATOM   836  C C   . PRO A 1 119 ? 18.027  -50.311 41.173  1.00 68.30  ? 119  PRO A C   1 
ATOM   837  O O   . PRO A 1 119 ? 17.847  -49.250 40.578  1.00 79.77  ? 119  PRO A O   1 
ATOM   838  C CB  . PRO A 1 119 ? 17.682  -52.726 40.475  1.00 58.49  ? 119  PRO A CB  1 
ATOM   839  C CG  . PRO A 1 119 ? 17.130  -52.848 39.084  1.00 58.35  ? 119  PRO A CG  1 
ATOM   840  C CD  . PRO A 1 119 ? 15.727  -52.337 39.207  1.00 54.83  ? 119  PRO A CD  1 
ATOM   841  N N   . LEU A 1 120 ? 19.076  -50.530 41.961  1.00 61.15  ? 120  LEU A N   1 
ATOM   842  C CA  . LEU A 1 120 ? 20.107  -49.516 42.176  1.00 63.72  ? 120  LEU A CA  1 
ATOM   843  C C   . LEU A 1 120 ? 21.426  -50.237 42.198  1.00 66.11  ? 120  LEU A C   1 
ATOM   844  O O   . LEU A 1 120 ? 21.513  -51.357 42.702  1.00 60.68  ? 120  LEU A O   1 
ATOM   845  C CB  . LEU A 1 120 ? 19.919  -48.782 43.525  1.00 67.51  ? 120  LEU A CB  1 
ATOM   846  C CG  . LEU A 1 120 ? 21.044  -47.840 44.026  1.00 68.18  ? 120  LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 120 ? 21.121  -46.639 43.117  1.00 80.38  ? 120  LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 120 ? 20.784  -47.366 45.456  1.00 65.79  ? 120  LEU A CD2 1 
ATOM   849  N N   . ASP A 1 121 ? 22.458  -49.598 41.662  1.00 75.84  ? 121  ASP A N   1 
ATOM   850  C CA  . ASP A 1 121 ? 23.761  -50.228 41.647  1.00 78.58  ? 121  ASP A CA  1 
ATOM   851  C C   . ASP A 1 121 ? 24.065  -50.797 43.022  1.00 84.65  ? 121  ASP A C   1 
ATOM   852  O O   . ASP A 1 121 ? 24.115  -50.090 44.035  1.00 82.40  ? 121  ASP A O   1 
ATOM   853  C CB  . ASP A 1 121 ? 24.843  -49.242 41.222  1.00 77.39  ? 121  ASP A CB  1 
ATOM   854  C CG  . ASP A 1 121 ? 26.187  -49.912 41.031  1.00 74.65  ? 121  ASP A CG  1 
ATOM   855  O OD1 . ASP A 1 121 ? 26.218  -51.018 40.442  1.00 75.68  ? 121  ASP A OD1 1 
ATOM   856  O OD2 . ASP A 1 121 ? 27.206  -49.327 41.462  1.00 76.73  ? 121  ASP A OD2 1 
ATOM   857  N N   . GLU A 1 122 ? 24.227  -52.109 43.021  1.00 94.40  ? 122  GLU A N   1 
ATOM   858  C CA  . GLU A 1 122 ? 24.520  -52.883 44.204  1.00 104.78 ? 122  GLU A CA  1 
ATOM   859  C C   . GLU A 1 122 ? 25.635  -52.216 45.019  1.00 98.51  ? 122  GLU A C   1 
ATOM   860  O O   . GLU A 1 122 ? 25.510  -52.057 46.233  1.00 101.23 ? 122  GLU A O   1 
ATOM   861  C CB  . GLU A 1 122 ? 24.908  -54.300 43.751  1.00 123.19 ? 122  GLU A CB  1 
ATOM   862  C CG  . GLU A 1 122 ? 24.831  -55.385 44.811  1.00 140.06 ? 122  GLU A CG  1 
ATOM   863  C CD  . GLU A 1 122 ? 26.196  -55.759 45.350  1.00 150.00 ? 122  GLU A CD  1 
ATOM   864  O OE1 . GLU A 1 122 ? 26.260  -56.569 46.304  1.00 150.00 ? 122  GLU A OE1 1 
ATOM   865  O OE2 . GLU A 1 122 ? 27.204  -55.244 44.816  1.00 149.99 ? 122  GLU A OE2 1 
ATOM   866  N N   . ASP A 1 123 ? 26.706  -51.790 44.358  1.00 88.61  ? 123  ASP A N   1 
ATOM   867  C CA  . ASP A 1 123 ? 27.812  -51.163 45.074  1.00 90.21  ? 123  ASP A CA  1 
ATOM   868  C C   . ASP A 1 123 ? 27.482  -49.756 45.581  1.00 80.86  ? 123  ASP A C   1 
ATOM   869  O O   . ASP A 1 123 ? 28.300  -49.102 46.227  1.00 78.34  ? 123  ASP A O   1 
ATOM   870  C CB  . ASP A 1 123 ? 29.058  -51.091 44.179  1.00 110.69 ? 123  ASP A CB  1 
ATOM   871  C CG  . ASP A 1 123 ? 29.300  -52.376 43.398  1.00 128.57 ? 123  ASP A CG  1 
ATOM   872  O OD1 . ASP A 1 123 ? 28.861  -53.447 43.862  1.00 142.57 ? 123  ASP A OD1 1 
ATOM   873  O OD2 . ASP A 1 123 ? 29.940  -52.315 42.323  1.00 127.00 ? 123  ASP A OD2 1 
ATOM   874  N N   . PHE A 1 124 ? 26.274  -49.295 45.319  1.00 76.55  ? 124  PHE A N   1 
ATOM   875  C CA  . PHE A 1 124 ? 25.919  -47.950 45.727  1.00 71.27  ? 124  PHE A CA  1 
ATOM   876  C C   . PHE A 1 124 ? 24.937  -47.866 46.894  1.00 73.89  ? 124  PHE A C   1 
ATOM   877  O O   . PHE A 1 124 ? 24.916  -46.873 47.634  1.00 69.40  ? 124  PHE A O   1 
ATOM   878  C CB  . PHE A 1 124 ? 25.348  -47.213 44.524  1.00 58.08  ? 124  PHE A CB  1 
ATOM   879  C CG  . PHE A 1 124 ? 25.369  -45.737 44.677  1.00 44.08  ? 124  PHE A CG  1 
ATOM   880  C CD1 . PHE A 1 124 ? 26.573  -45.046 44.648  1.00 30.08  ? 124  PHE A CD1 1 
ATOM   881  C CD2 . PHE A 1 124 ? 24.186  -45.033 44.901  1.00 45.28  ? 124  PHE A CD2 1 
ATOM   882  C CE1 . PHE A 1 124 ? 26.599  -43.657 44.846  1.00 40.79  ? 124  PHE A CE1 1 
ATOM   883  C CE2 . PHE A 1 124 ? 24.193  -43.653 45.103  1.00 37.48  ? 124  PHE A CE2 1 
ATOM   884  C CZ  . PHE A 1 124 ? 25.393  -42.960 45.077  1.00 44.08  ? 124  PHE A CZ  1 
ATOM   885  N N   . ARG A 1 125 ? 24.121  -48.906 47.033  1.00 72.79  ? 125  ARG A N   1 
ATOM   886  C CA  . ARG A 1 125 ? 23.111  -49.008 48.081  1.00 66.99  ? 125  ARG A CA  1 
ATOM   887  C C   . ARG A 1 125 ? 23.624  -48.678 49.470  1.00 66.42  ? 125  ARG A C   1 
ATOM   888  O O   . ARG A 1 125 ? 22.889  -48.137 50.305  1.00 57.17  ? 125  ARG A O   1 
ATOM   889  C CB  . ARG A 1 125 ? 22.551  -50.415 48.087  1.00 58.23  ? 125  ARG A CB  1 
ATOM   890  C CG  . ARG A 1 125 ? 21.854  -50.737 46.822  1.00 62.46  ? 125  ARG A CG  1 
ATOM   891  C CD  . ARG A 1 125 ? 21.824  -52.207 46.554  1.00 78.43  ? 125  ARG A CD  1 
ATOM   892  N NE  . ARG A 1 125 ? 20.740  -52.504 45.630  1.00 95.19  ? 125  ARG A NE  1 
ATOM   893  C CZ  . ARG A 1 125 ? 20.478  -53.709 45.145  1.00 106.44 ? 125  ARG A CZ  1 
ATOM   894  N NH1 . ARG A 1 125 ? 21.233  -54.742 45.493  1.00 109.55 ? 125  ARG A NH1 1 
ATOM   895  N NH2 . ARG A 1 125 ? 19.451  -53.879 44.323  1.00 110.96 ? 125  ARG A NH2 1 
ATOM   896  N N   . LYS A 1 126 ? 24.882  -49.026 49.724  1.00 65.37  ? 126  LYS A N   1 
ATOM   897  C CA  . LYS A 1 126 ? 25.473  -48.752 51.019  1.00 66.64  ? 126  LYS A CA  1 
ATOM   898  C C   . LYS A 1 126 ? 25.289  -47.274 51.343  1.00 75.65  ? 126  LYS A C   1 
ATOM   899  O O   . LYS A 1 126 ? 24.889  -46.914 52.447  1.00 87.20  ? 126  LYS A O   1 
ATOM   900  C CB  . LYS A 1 126 ? 26.963  -49.115 51.029  1.00 52.36  ? 126  LYS A CB  1 
ATOM   901  C CG  . LYS A 1 126 ? 27.890  -48.130 50.363  1.00 53.11  ? 126  LYS A CG  1 
ATOM   902  C CD  . LYS A 1 126 ? 29.342  -48.444 50.719  1.00 57.35  ? 126  LYS A CD  1 
ATOM   903  C CE  . LYS A 1 126 ? 30.066  -49.243 49.631  1.00 83.73  ? 126  LYS A CE  1 
ATOM   904  N NZ  . LYS A 1 126 ? 30.406  -48.396 48.445  1.00 98.56  ? 126  LYS A NZ  1 
ATOM   905  N N   . TYR A 1 127 ? 25.551  -46.424 50.360  1.00 71.41  ? 127  TYR A N   1 
ATOM   906  C CA  . TYR A 1 127 ? 25.422  -44.989 50.537  1.00 63.61  ? 127  TYR A CA  1 
ATOM   907  C C   . TYR A 1 127 ? 24.009  -44.469 50.842  1.00 61.45  ? 127  TYR A C   1 
ATOM   908  O O   . TYR A 1 127 ? 23.868  -43.353 51.338  1.00 62.01  ? 127  TYR A O   1 
ATOM   909  C CB  . TYR A 1 127 ? 25.999  -44.305 49.299  1.00 60.49  ? 127  TYR A CB  1 
ATOM   910  C CG  . TYR A 1 127 ? 27.463  -44.615 49.134  1.00 67.24  ? 127  TYR A CG  1 
ATOM   911  C CD1 . TYR A 1 127 ? 28.388  -44.197 50.098  1.00 74.53  ? 127  TYR A CD1 1 
ATOM   912  C CD2 . TYR A 1 127 ? 27.929  -45.334 48.036  1.00 63.56  ? 127  TYR A CD2 1 
ATOM   913  C CE1 . TYR A 1 127 ? 29.750  -44.484 49.976  1.00 81.16  ? 127  TYR A CE1 1 
ATOM   914  C CE2 . TYR A 1 127 ? 29.294  -45.629 47.897  1.00 75.68  ? 127  TYR A CE2 1 
ATOM   915  C CZ  . TYR A 1 127 ? 30.202  -45.198 48.875  1.00 84.31  ? 127  TYR A CZ  1 
ATOM   916  O OH  . TYR A 1 127 ? 31.558  -45.458 48.765  1.00 78.39  ? 127  TYR A OH  1 
ATOM   917  N N   . THR A 1 128 ? 22.976  -45.268 50.573  1.00 56.47  ? 128  THR A N   1 
ATOM   918  C CA  . THR A 1 128 ? 21.593  -44.841 50.810  1.00 65.24  ? 128  THR A CA  1 
ATOM   919  C C   . THR A 1 128 ? 21.077  -45.169 52.202  1.00 75.20  ? 128  THR A C   1 
ATOM   920  O O   . THR A 1 128 ? 19.863  -45.151 52.434  1.00 75.06  ? 128  THR A O   1 
ATOM   921  C CB  . THR A 1 128 ? 20.605  -45.507 49.825  1.00 67.46  ? 128  THR A CB  1 
ATOM   922  O OG1 . THR A 1 128 ? 20.621  -46.929 50.019  1.00 57.93  ? 128  THR A OG1 1 
ATOM   923  C CG2 . THR A 1 128 ? 20.979  -45.199 48.397  1.00 69.59  ? 128  THR A CG2 1 
ATOM   924  N N   . ALA A 1 129 ? 21.986  -45.470 53.124  1.00 82.15  ? 129  ALA A N   1 
ATOM   925  C CA  . ALA A 1 129 ? 21.596  -45.839 54.484  1.00 87.78  ? 129  ALA A CA  1 
ATOM   926  C C   . ALA A 1 129 ? 20.948  -44.730 55.302  1.00 90.25  ? 129  ALA A C   1 
ATOM   927  O O   . ALA A 1 129 ? 21.302  -43.554 55.194  1.00 91.26  ? 129  ALA A O   1 
ATOM   928  C CB  . ALA A 1 129 ? 22.791  -46.394 55.231  1.00 88.07  ? 129  ALA A CB  1 
ATOM   929  N N   . PHE A 1 130 ? 20.001  -45.135 56.135  1.00 85.71  ? 130  PHE A N   1 
ATOM   930  C CA  . PHE A 1 130 ? 19.277  -44.218 56.987  1.00 83.59  ? 130  PHE A CA  1 
ATOM   931  C C   . PHE A 1 130 ? 18.902  -44.993 58.234  1.00 87.87  ? 130  PHE A C   1 
ATOM   932  O O   . PHE A 1 130 ? 19.030  -46.210 58.256  1.00 91.48  ? 130  PHE A O   1 
ATOM   933  C CB  . PHE A 1 130 ? 18.038  -43.747 56.262  1.00 77.50  ? 130  PHE A CB  1 
ATOM   934  C CG  . PHE A 1 130 ? 17.102  -44.859 55.871  1.00 77.32  ? 130  PHE A CG  1 
ATOM   935  C CD1 . PHE A 1 130 ? 15.948  -45.109 56.612  1.00 78.24  ? 130  PHE A CD1 1 
ATOM   936  C CD2 . PHE A 1 130 ? 17.328  -45.608 54.717  1.00 75.41  ? 130  PHE A CD2 1 
ATOM   937  C CE1 . PHE A 1 130 ? 15.021  -46.079 56.204  1.00 75.97  ? 130  PHE A CE1 1 
ATOM   938  C CE2 . PHE A 1 130 ? 16.401  -46.586 54.302  1.00 76.73  ? 130  PHE A CE2 1 
ATOM   939  C CZ  . PHE A 1 130 ? 15.246  -46.815 55.048  1.00 74.42  ? 130  PHE A CZ  1 
ATOM   940  N N   . THR A 1 131 ? 18.420  -44.311 59.266  1.00 90.34  ? 131  THR A N   1 
ATOM   941  C CA  . THR A 1 131 ? 18.088  -45.008 60.505  1.00 89.21  ? 131  THR A CA  1 
ATOM   942  C C   . THR A 1 131 ? 16.747  -44.636 61.133  1.00 90.63  ? 131  THR A C   1 
ATOM   943  O O   . THR A 1 131 ? 16.405  -43.455 61.209  1.00 91.92  ? 131  THR A O   1 
ATOM   944  C CB  . THR A 1 131 ? 19.166  -44.749 61.571  1.00 84.34  ? 131  THR A CB  1 
ATOM   945  O OG1 . THR A 1 131 ? 20.466  -44.989 61.025  1.00 74.92  ? 131  THR A OG1 1 
ATOM   946  C CG2 . THR A 1 131 ? 18.956  -45.654 62.747  1.00 96.00  ? 131  THR A CG2 1 
ATOM   947  N N   . ILE A 1 132 ? 16.002  -45.648 61.586  1.00 96.13  ? 132  ILE A N   1 
ATOM   948  C CA  . ILE A 1 132 ? 14.713  -45.443 62.263  1.00 105.86 ? 132  ILE A CA  1 
ATOM   949  C C   . ILE A 1 132 ? 15.031  -45.563 63.766  1.00 111.41 ? 132  ILE A C   1 
ATOM   950  O O   . ILE A 1 132 ? 15.292  -46.659 64.267  1.00 108.95 ? 132  ILE A O   1 
ATOM   951  C CB  . ILE A 1 132 ? 13.652  -46.538 61.898  1.00 107.20 ? 132  ILE A CB  1 
ATOM   952  C CG1 . ILE A 1 132 ? 13.544  -46.701 60.382  1.00 112.41 ? 132  ILE A CG1 1 
ATOM   953  C CG2 . ILE A 1 132 ? 12.272  -46.139 62.440  1.00 95.17  ? 132  ILE A CG2 1 
ATOM   954  C CD1 . ILE A 1 132 ? 13.020  -45.475 59.673  1.00 116.60 ? 132  ILE A CD1 1 
ATOM   955  N N   . PRO A 1 133 ? 15.008  -44.436 64.503  1.00 118.80 ? 133  PRO A N   1 
ATOM   956  C CA  . PRO A 1 133 ? 15.306  -44.435 65.939  1.00 120.28 ? 133  PRO A CA  1 
ATOM   957  C C   . PRO A 1 133 ? 14.406  -45.309 66.805  1.00 120.93 ? 133  PRO A C   1 
ATOM   958  O O   . PRO A 1 133 ? 13.241  -45.550 66.481  1.00 121.78 ? 133  PRO A O   1 
ATOM   959  C CB  . PRO A 1 133 ? 15.199  -42.957 66.305  1.00 121.39 ? 133  PRO A CB  1 
ATOM   960  C CG  . PRO A 1 133 ? 14.108  -42.475 65.401  1.00 120.08 ? 133  PRO A CG  1 
ATOM   961  C CD  . PRO A 1 133 ? 14.510  -43.112 64.081  1.00 124.33 ? 133  PRO A CD  1 
ATOM   962  N N   . SER A 1 134 ? 14.962  -45.778 67.914  1.00 116.58 ? 134  SER A N   1 
ATOM   963  C CA  . SER A 1 134 ? 14.211  -46.612 68.826  1.00 115.36 ? 134  SER A CA  1 
ATOM   964  C C   . SER A 1 134 ? 13.398  -45.742 69.767  1.00 116.66 ? 134  SER A C   1 
ATOM   965  O O   . SER A 1 134 ? 13.595  -44.528 69.843  1.00 113.06 ? 134  SER A O   1 
ATOM   966  C CB  . SER A 1 134 ? 15.152  -47.496 69.640  1.00 112.24 ? 134  SER A CB  1 
ATOM   967  O OG  . SER A 1 134 ? 14.418  -48.353 70.500  1.00 119.83 ? 134  SER A OG  1 
ATOM   968  N N   . ILE A 1 135 ? 12.479  -46.376 70.481  1.00 120.54 ? 135  ILE A N   1 
ATOM   969  C CA  . ILE A 1 135 ? 11.645  -45.667 71.427  1.00 123.36 ? 135  ILE A CA  1 
ATOM   970  C C   . ILE A 1 135 ? 12.317  -45.776 72.807  1.00 124.48 ? 135  ILE A C   1 
ATOM   971  O O   . ILE A 1 135 ? 12.449  -44.779 73.519  1.00 122.51 ? 135  ILE A O   1 
ATOM   972  C CB  . ILE A 1 135 ? 10.214  -46.268 71.451  1.00 123.46 ? 135  ILE A CB  1 
ATOM   973  C CG1 . ILE A 1 135 ? 9.716   -46.523 70.022  1.00 111.88 ? 135  ILE A CG1 1 
ATOM   974  C CG2 . ILE A 1 135 ? 9.259   -45.296 72.118  1.00 132.94 ? 135  ILE A CG2 1 
ATOM   975  C CD1 . ILE A 1 135 ? 8.284   -47.057 69.935  1.00 95.10  ? 135  ILE A CD1 1 
ATOM   976  N N   . ASN A 1 136 ? 12.759  -46.980 73.169  1.00 127.38 ? 136  ASN A N   1 
ATOM   977  C CA  . ASN A 1 136 ? 13.435  -47.190 74.449  1.00 135.38 ? 136  ASN A CA  1 
ATOM   978  C C   . ASN A 1 136 ? 14.934  -46.992 74.289  1.00 140.66 ? 136  ASN A C   1 
ATOM   979  O O   . ASN A 1 136 ? 15.529  -47.476 73.331  1.00 145.90 ? 136  ASN A O   1 
ATOM   980  C CB  . ASN A 1 136 ? 13.165  -48.589 74.987  1.00 141.76 ? 136  ASN A CB  1 
ATOM   981  C CG  . ASN A 1 136 ? 12.067  -48.611 76.007  1.00 150.00 ? 136  ASN A CG  1 
ATOM   982  O OD1 . ASN A 1 136 ? 10.896  -48.436 75.676  1.00 150.00 ? 136  ASN A OD1 1 
ATOM   983  N ND2 . ASN A 1 136 ? 12.435  -48.814 77.267  1.00 150.00 ? 136  ASN A ND2 1 
ATOM   984  N N   . ASN A 1 137 ? 15.531  -46.297 75.252  1.00 142.28 ? 137  ASN A N   1 
ATOM   985  C CA  . ASN A 1 137 ? 16.955  -45.944 75.267  1.00 144.01 ? 137  ASN A CA  1 
ATOM   986  C C   . ASN A 1 137 ? 18.030  -46.881 74.713  1.00 143.29 ? 137  ASN A C   1 
ATOM   987  O O   . ASN A 1 137 ? 18.701  -46.541 73.740  1.00 140.75 ? 137  ASN A O   1 
ATOM   988  C CB  . ASN A 1 137 ? 17.319  -45.521 76.680  1.00 148.08 ? 137  ASN A CB  1 
ATOM   989  C CG  . ASN A 1 137 ? 16.493  -44.339 77.146  1.00 150.00 ? 137  ASN A CG  1 
ATOM   990  O OD1 . ASN A 1 137 ? 16.560  -43.255 76.559  1.00 146.78 ? 137  ASN A OD1 1 
ATOM   991  N ND2 . ASN A 1 137 ? 15.696  -44.542 78.192  1.00 150.00 ? 137  ASN A ND2 1 
ATOM   992  N N   . GLU A 1 138 ? 18.226  -48.034 75.339  1.00 145.08 ? 138  GLU A N   1 
ATOM   993  C CA  . GLU A 1 138 ? 19.227  -48.983 74.855  1.00 148.91 ? 138  GLU A CA  1 
ATOM   994  C C   . GLU A 1 138 ? 18.561  -50.136 74.071  1.00 150.00 ? 138  GLU A C   1 
ATOM   995  O O   . GLU A 1 138 ? 19.044  -51.271 74.071  1.00 150.00 ? 138  GLU A O   1 
ATOM   996  C CB  . GLU A 1 138 ? 20.045  -49.523 76.044  1.00 149.61 ? 138  GLU A CB  1 
ATOM   997  C CG  . GLU A 1 138 ? 20.992  -50.700 75.735  1.00 150.00 ? 138  GLU A CG  1 
ATOM   998  C CD  . GLU A 1 138 ? 22.330  -50.289 75.129  1.00 150.00 ? 138  GLU A CD  1 
ATOM   999  O OE1 . GLU A 1 138 ? 22.764  -50.924 74.144  1.00 149.27 ? 138  GLU A OE1 1 
ATOM   1000 O OE2 . GLU A 1 138 ? 22.960  -49.346 75.647  1.00 150.00 ? 138  GLU A OE2 1 
ATOM   1001 N N   . THR A 1 139 ? 17.449  -49.841 73.398  1.00 150.00 ? 139  THR A N   1 
ATOM   1002 C CA  . THR A 1 139 ? 16.739  -50.857 72.618  1.00 150.00 ? 139  THR A CA  1 
ATOM   1003 C C   . THR A 1 139 ? 17.194  -50.730 71.147  1.00 150.00 ? 139  THR A C   1 
ATOM   1004 O O   . THR A 1 139 ? 18.311  -50.256 70.899  1.00 150.00 ? 139  THR A O   1 
ATOM   1005 C CB  . THR A 1 139 ? 15.200  -50.700 72.797  1.00 149.93 ? 139  THR A CB  1 
ATOM   1006 O OG1 . THR A 1 139 ? 14.946  -49.900 73.949  1.00 147.41 ? 139  THR A OG1 1 
ATOM   1007 C CG2 . THR A 1 139 ? 14.532  -52.062 73.040  1.00 148.66 ? 139  THR A CG2 1 
ATOM   1008 N N   . PRO A 1 140 ? 16.360  -51.127 70.153  1.00 150.00 ? 140  PRO A N   1 
ATOM   1009 C CA  . PRO A 1 140 ? 16.893  -50.978 68.793  1.00 150.00 ? 140  PRO A CA  1 
ATOM   1010 C C   . PRO A 1 140 ? 17.292  -49.588 68.274  1.00 149.67 ? 140  PRO A C   1 
ATOM   1011 O O   . PRO A 1 140 ? 17.619  -48.661 69.029  1.00 147.52 ? 140  PRO A O   1 
ATOM   1012 C CB  . PRO A 1 140 ? 15.808  -51.634 67.928  1.00 146.71 ? 140  PRO A CB  1 
ATOM   1013 C CG  . PRO A 1 140 ? 14.562  -51.358 68.692  1.00 147.82 ? 140  PRO A CG  1 
ATOM   1014 C CD  . PRO A 1 140 ? 14.996  -51.693 70.100  1.00 150.00 ? 140  PRO A CD  1 
ATOM   1015 N N   . GLY A 1 141 ? 17.275  -49.493 66.949  1.00 148.33 ? 141  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 141 ? 17.624  -48.285 66.228  1.00 143.34 ? 141  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 141 ? 17.857  -48.747 64.797  1.00 142.10 ? 141  GLY A C   1 
ATOM   1018 O O   . GLY A 1 141 ? 18.904  -48.472 64.217  1.00 144.93 ? 141  GLY A O   1 
ATOM   1019 N N   . ILE A 1 142 ? 16.871  -49.464 64.247  1.00 138.20 ? 142  ILE A N   1 
ATOM   1020 C CA  . ILE A 1 142 ? 16.891  -50.039 62.889  1.00 131.47 ? 142  ILE A CA  1 
ATOM   1021 C C   . ILE A 1 142 ? 17.605  -49.303 61.740  1.00 128.84 ? 142  ILE A C   1 
ATOM   1022 O O   . ILE A 1 142 ? 17.343  -48.128 61.460  1.00 129.25 ? 142  ILE A O   1 
ATOM   1023 C CB  . ILE A 1 142 ? 15.449  -50.383 62.396  1.00 124.42 ? 142  ILE A CB  1 
ATOM   1024 C CG1 . ILE A 1 142 ? 14.394  -49.647 63.229  1.00 122.16 ? 142  ILE A CG1 1 
ATOM   1025 C CG2 . ILE A 1 142 ? 15.237  -51.886 62.447  1.00 123.65 ? 142  ILE A CG2 1 
ATOM   1026 C CD1 . ILE A 1 142 ? 14.197  -50.192 64.650  1.00 129.56 ? 142  ILE A CD1 1 
ATOM   1027 N N   . ARG A 1 143 ? 18.492  -50.042 61.068  1.00 122.87 ? 143  ARG A N   1 
ATOM   1028 C CA  . ARG A 1 143 ? 19.288  -49.549 59.942  1.00 113.26 ? 143  ARG A CA  1 
ATOM   1029 C C   . ARG A 1 143 ? 18.921  -50.242 58.625  1.00 108.44 ? 143  ARG A C   1 
ATOM   1030 O O   . ARG A 1 143 ? 18.768  -51.465 58.564  1.00 110.34 ? 143  ARG A O   1 
ATOM   1031 C CB  . ARG A 1 143 ? 20.775  -49.771 60.222  1.00 111.76 ? 143  ARG A CB  1 
ATOM   1032 C CG  . ARG A 1 143 ? 21.344  -48.879 61.302  1.00 110.43 ? 143  ARG A CG  1 
ATOM   1033 C CD  . ARG A 1 143 ? 21.752  -47.544 60.727  1.00 106.59 ? 143  ARG A CD  1 
ATOM   1034 N NE  . ARG A 1 143 ? 22.984  -47.659 59.954  1.00 104.35 ? 143  ARG A NE  1 
ATOM   1035 C CZ  . ARG A 1 143 ? 23.479  -46.689 59.191  1.00 109.32 ? 143  ARG A CZ  1 
ATOM   1036 N NH1 . ARG A 1 143 ? 22.841  -45.525 59.091  1.00 109.06 ? 143  ARG A NH1 1 
ATOM   1037 N NH2 . ARG A 1 143 ? 24.619  -46.880 58.537  1.00 111.86 ? 143  ARG A NH2 1 
ATOM   1038 N N   . TYR A 1 144 ? 18.789  -49.451 57.570  1.00 101.49 ? 144  TYR A N   1 
ATOM   1039 C CA  . TYR A 1 144 ? 18.445  -49.984 56.261  1.00 95.87  ? 144  TYR A CA  1 
ATOM   1040 C C   . TYR A 1 144 ? 19.253  -49.315 55.152  1.00 96.97  ? 144  TYR A C   1 
ATOM   1041 O O   . TYR A 1 144 ? 20.062  -48.401 55.386  1.00 94.58  ? 144  TYR A O   1 
ATOM   1042 C CB  . TYR A 1 144 ? 16.972  -49.730 55.920  1.00 85.60  ? 144  TYR A CB  1 
ATOM   1043 C CG  . TYR A 1 144 ? 15.924  -50.453 56.723  1.00 89.04  ? 144  TYR A CG  1 
ATOM   1044 C CD1 . TYR A 1 144 ? 15.483  -49.950 57.949  1.00 89.58  ? 144  TYR A CD1 1 
ATOM   1045 C CD2 . TYR A 1 144 ? 15.290  -51.581 56.207  1.00 98.23  ? 144  TYR A CD2 1 
ATOM   1046 C CE1 . TYR A 1 144 ? 14.429  -50.541 58.634  1.00 89.21  ? 144  TYR A CE1 1 
ATOM   1047 C CE2 . TYR A 1 144 ? 14.239  -52.181 56.884  1.00 103.99 ? 144  TYR A CE2 1 
ATOM   1048 C CZ  . TYR A 1 144 ? 13.813  -51.650 58.096  1.00 98.78  ? 144  TYR A CZ  1 
ATOM   1049 O OH  . TYR A 1 144 ? 12.755  -52.207 58.766  1.00 98.45  ? 144  TYR A OH  1 
ATOM   1050 N N   . GLN A 1 145 ? 18.992  -49.786 53.934  1.00 95.57  ? 145  GLN A N   1 
ATOM   1051 C CA  . GLN A 1 145 ? 19.577  -49.247 52.712  1.00 85.25  ? 145  GLN A CA  1 
ATOM   1052 C C   . GLN A 1 145 ? 18.592  -49.578 51.604  1.00 85.36  ? 145  GLN A C   1 
ATOM   1053 O O   . GLN A 1 145 ? 17.840  -50.556 51.704  1.00 83.20  ? 145  GLN A O   1 
ATOM   1054 C CB  . GLN A 1 145 ? 20.909  -49.883 52.391  1.00 66.18  ? 145  GLN A CB  1 
ATOM   1055 C CG  . GLN A 1 145 ? 20.804  -51.314 52.035  1.00 60.76  ? 145  GLN A CG  1 
ATOM   1056 C CD  . GLN A 1 145 ? 22.141  -51.832 51.598  1.00 78.71  ? 145  GLN A CD  1 
ATOM   1057 O OE1 . GLN A 1 145 ? 23.190  -51.338 52.048  1.00 68.67  ? 145  GLN A OE1 1 
ATOM   1058 N NE2 . GLN A 1 145 ? 22.130  -52.835 50.725  1.00 89.04  ? 145  GLN A NE2 1 
ATOM   1059 N N   . TYR A 1 146 ? 18.593  -48.749 50.565  1.00 86.22  ? 146  TYR A N   1 
ATOM   1060 C CA  . TYR A 1 146 ? 17.715  -48.918 49.415  1.00 80.17  ? 146  TYR A CA  1 
ATOM   1061 C C   . TYR A 1 146 ? 18.309  -49.920 48.428  1.00 82.87  ? 146  TYR A C   1 
ATOM   1062 O O   . TYR A 1 146 ? 19.538  -50.037 48.299  1.00 81.40  ? 146  TYR A O   1 
ATOM   1063 C CB  . TYR A 1 146 ? 17.550  -47.580 48.709  1.00 79.88  ? 146  TYR A CB  1 
ATOM   1064 C CG  . TYR A 1 146 ? 16.427  -46.713 49.216  1.00 81.99  ? 146  TYR A CG  1 
ATOM   1065 C CD1 . TYR A 1 146 ? 15.145  -46.813 48.662  1.00 83.32  ? 146  TYR A CD1 1 
ATOM   1066 C CD2 . TYR A 1 146 ? 16.646  -45.751 50.212  1.00 82.33  ? 146  TYR A CD2 1 
ATOM   1067 C CE1 . TYR A 1 146 ? 14.096  -45.965 49.082  1.00 87.79  ? 146  TYR A CE1 1 
ATOM   1068 C CE2 . TYR A 1 146 ? 15.599  -44.895 50.645  1.00 85.77  ? 146  TYR A CE2 1 
ATOM   1069 C CZ  . TYR A 1 146 ? 14.332  -45.010 50.073  1.00 85.33  ? 146  TYR A CZ  1 
ATOM   1070 O OH  . TYR A 1 146 ? 13.316  -44.177 50.490  1.00 79.32  ? 146  TYR A OH  1 
ATOM   1071 N N   . ASN A 1 147 ? 17.436  -50.648 47.738  1.00 86.84  ? 147  ASN A N   1 
ATOM   1072 C CA  . ASN A 1 147 ? 17.880  -51.618 46.733  1.00 88.96  ? 147  ASN A CA  1 
ATOM   1073 C C   . ASN A 1 147 ? 17.289  -51.140 45.402  1.00 84.78  ? 147  ASN A C   1 
ATOM   1074 O O   . ASN A 1 147 ? 17.540  -51.731 44.348  1.00 86.85  ? 147  ASN A O   1 
ATOM   1075 C CB  . ASN A 1 147 ? 17.372  -53.053 47.034  1.00 86.36  ? 147  ASN A CB  1 
ATOM   1076 C CG  . ASN A 1 147 ? 17.878  -53.616 48.372  1.00 75.37  ? 147  ASN A CG  1 
ATOM   1077 O OD1 . ASN A 1 147 ? 19.073  -53.597 48.667  1.00 66.11  ? 147  ASN A OD1 1 
ATOM   1078 N ND2 . ASN A 1 147 ? 16.956  -54.136 49.177  1.00 73.83  ? 147  ASN A ND2 1 
ATOM   1079 N N   . VAL A 1 148 ? 16.504  -50.066 45.463  1.00 70.96  ? 148  VAL A N   1 
ATOM   1080 C CA  . VAL A 1 148 ? 15.881  -49.512 44.272  1.00 63.64  ? 148  VAL A CA  1 
ATOM   1081 C C   . VAL A 1 148 ? 16.277  -48.047 44.063  1.00 60.69  ? 148  VAL A C   1 
ATOM   1082 O O   . VAL A 1 148 ? 17.348  -47.623 44.492  1.00 58.50  ? 148  VAL A O   1 
ATOM   1083 C CB  . VAL A 1 148 ? 14.332  -49.650 44.351  1.00 62.55  ? 148  VAL A CB  1 
ATOM   1084 C CG1 . VAL A 1 148 ? 13.962  -51.100 44.383  1.00 50.26  ? 148  VAL A CG1 1 
ATOM   1085 C CG2 . VAL A 1 148 ? 13.780  -48.959 45.591  1.00 60.20  ? 148  VAL A CG2 1 
ATOM   1086 N N   . LEU A 1 149 ? 15.419  -47.287 43.384  1.00 61.88  ? 149  LEU A N   1 
ATOM   1087 C CA  . LEU A 1 149 ? 15.670  -45.864 43.131  1.00 64.01  ? 149  LEU A CA  1 
ATOM   1088 C C   . LEU A 1 149 ? 14.879  -44.956 44.105  1.00 63.98  ? 149  LEU A C   1 
ATOM   1089 O O   . LEU A 1 149 ? 13.650  -44.759 43.997  1.00 58.48  ? 149  LEU A O   1 
ATOM   1090 C CB  . LEU A 1 149 ? 15.343  -45.492 41.668  1.00 62.05  ? 149  LEU A CB  1 
ATOM   1091 C CG  . LEU A 1 149 ? 16.138  -46.127 40.505  1.00 52.47  ? 149  LEU A CG  1 
ATOM   1092 C CD1 . LEU A 1 149 ? 15.539  -45.618 39.206  1.00 56.80  ? 149  LEU A CD1 1 
ATOM   1093 C CD2 . LEU A 1 149 ? 17.644  -45.792 40.550  1.00 36.18  ? 149  LEU A CD2 1 
ATOM   1094 N N   . PRO A 1 150 ? 15.600  -44.380 45.075  1.00 64.04  ? 150  PRO A N   1 
ATOM   1095 C CA  . PRO A 1 150 ? 14.990  -43.504 46.070  1.00 64.28  ? 150  PRO A CA  1 
ATOM   1096 C C   . PRO A 1 150 ? 14.606  -42.245 45.370  1.00 68.31  ? 150  PRO A C   1 
ATOM   1097 O O   . PRO A 1 150 ? 15.387  -41.700 44.597  1.00 75.02  ? 150  PRO A O   1 
ATOM   1098 C CB  . PRO A 1 150 ? 16.120  -43.237 47.067  1.00 61.93  ? 150  PRO A CB  1 
ATOM   1099 C CG  . PRO A 1 150 ? 17.242  -44.246 46.683  1.00 65.23  ? 150  PRO A CG  1 
ATOM   1100 C CD  . PRO A 1 150 ? 17.069  -44.370 45.198  1.00 66.97  ? 150  PRO A CD  1 
ATOM   1101 N N   . GLN A 1 151 ? 13.396  -41.785 45.614  1.00 73.89  ? 151  GLN A N   1 
ATOM   1102 C CA  . GLN A 1 151 ? 12.999  -40.541 45.006  1.00 78.93  ? 151  GLN A CA  1 
ATOM   1103 C C   . GLN A 1 151 ? 13.793  -39.462 45.757  1.00 81.30  ? 151  GLN A C   1 
ATOM   1104 O O   . GLN A 1 151 ? 14.312  -39.698 46.867  1.00 79.31  ? 151  GLN A O   1 
ATOM   1105 C CB  . GLN A 1 151 ? 11.479  -40.403 45.091  1.00 75.31  ? 151  GLN A CB  1 
ATOM   1106 C CG  . GLN A 1 151 ? 10.858  -41.530 44.262  1.00 99.97  ? 151  GLN A CG  1 
ATOM   1107 C CD  . GLN A 1 151 ? 9.363   -41.453 44.114  1.00 115.03 ? 151  GLN A CD  1 
ATOM   1108 O OE1 . GLN A 1 151 ? 8.768   -42.167 43.297  1.00 111.26 ? 151  GLN A OE1 1 
ATOM   1109 N NE2 . GLN A 1 151 ? 8.738   -40.598 44.906  1.00 124.98 ? 151  GLN A NE2 1 
ATOM   1110 N N   . GLY A 1 152 ? 13.945  -38.300 45.135  1.00 77.70  ? 152  GLY A N   1 
ATOM   1111 C CA  . GLY A 1 152 ? 14.725  -37.263 45.772  1.00 75.82  ? 152  GLY A CA  1 
ATOM   1112 C C   . GLY A 1 152 ? 16.198  -37.509 45.490  1.00 73.62  ? 152  GLY A C   1 
ATOM   1113 O O   . GLY A 1 152 ? 17.062  -36.667 45.765  1.00 79.89  ? 152  GLY A O   1 
ATOM   1114 N N   . TRP A 1 153 ? 16.513  -38.670 44.938  1.00 64.06  ? 153  TRP A N   1 
ATOM   1115 C CA  . TRP A 1 153 ? 17.907  -38.914 44.642  1.00 59.73  ? 153  TRP A CA  1 
ATOM   1116 C C   . TRP A 1 153 ? 18.281  -38.279 43.320  1.00 61.10  ? 153  TRP A C   1 
ATOM   1117 O O   . TRP A 1 153 ? 17.455  -38.169 42.406  1.00 64.88  ? 153  TRP A O   1 
ATOM   1118 C CB  . TRP A 1 153 ? 18.229  -40.401 44.572  1.00 52.62  ? 153  TRP A CB  1 
ATOM   1119 C CG  . TRP A 1 153 ? 19.695  -40.611 44.360  1.00 51.08  ? 153  TRP A CG  1 
ATOM   1120 C CD1 . TRP A 1 153 ? 20.724  -40.064 45.104  1.00 56.36  ? 153  TRP A CD1 1 
ATOM   1121 C CD2 . TRP A 1 153 ? 20.316  -41.436 43.365  1.00 61.25  ? 153  TRP A CD2 1 
ATOM   1122 N NE1 . TRP A 1 153 ? 21.945  -40.509 44.634  1.00 54.36  ? 153  TRP A NE1 1 
ATOM   1123 C CE2 . TRP A 1 153 ? 21.728  -41.350 43.569  1.00 56.21  ? 153  TRP A CE2 1 
ATOM   1124 C CE3 . TRP A 1 153 ? 19.826  -42.242 42.324  1.00 52.58  ? 153  TRP A CE3 1 
ATOM   1125 C CZ2 . TRP A 1 153 ? 22.646  -42.042 42.768  1.00 39.38  ? 153  TRP A CZ2 1 
ATOM   1126 C CZ3 . TRP A 1 153 ? 20.744  -42.930 41.525  1.00 48.63  ? 153  TRP A CZ3 1 
ATOM   1127 C CH2 . TRP A 1 153 ? 22.141  -42.823 41.756  1.00 49.04  ? 153  TRP A CH2 1 
ATOM   1128 N N   . LYS A 1 154 ? 19.537  -37.863 43.235  1.00 53.01  ? 154  LYS A N   1 
ATOM   1129 C CA  . LYS A 1 154 ? 20.067  -37.258 42.029  1.00 54.61  ? 154  LYS A CA  1 
ATOM   1130 C C   . LYS A 1 154 ? 19.748  -38.106 40.792  1.00 62.22  ? 154  LYS A C   1 
ATOM   1131 O O   . LYS A 1 154 ? 18.904  -37.733 39.970  1.00 68.54  ? 154  LYS A O   1 
ATOM   1132 C CB  . LYS A 1 154 ? 21.586  -37.112 42.167  1.00 57.32  ? 154  LYS A CB  1 
ATOM   1133 C CG  . LYS A 1 154 ? 22.235  -36.185 41.144  1.00 59.62  ? 154  LYS A CG  1 
ATOM   1134 C CD  . LYS A 1 154 ? 23.720  -35.954 41.442  1.00 54.77  ? 154  LYS A CD  1 
ATOM   1135 C CE  . LYS A 1 154 ? 24.236  -34.730 40.709  1.00 57.75  ? 154  LYS A CE  1 
ATOM   1136 N NZ  . LYS A 1 154 ? 25.708  -34.689 40.713  1.00 52.24  ? 154  LYS A NZ  1 
ATOM   1137 N N   . GLY A 1 155 ? 20.414  -39.259 40.688  1.00 62.78  ? 155  GLY A N   1 
ATOM   1138 C CA  . GLY A 1 155 ? 20.255  -40.141 39.539  1.00 62.83  ? 155  GLY A CA  1 
ATOM   1139 C C   . GLY A 1 155 ? 18.951  -40.867 39.228  1.00 58.17  ? 155  GLY A C   1 
ATOM   1140 O O   . GLY A 1 155 ? 18.838  -41.556 38.207  1.00 54.61  ? 155  GLY A O   1 
ATOM   1141 N N   . SER A 1 156 ? 17.938  -40.732 40.059  1.00 55.49  ? 156  SER A N   1 
ATOM   1142 C CA  . SER A 1 156 ? 16.747  -41.475 39.725  1.00 52.81  ? 156  SER A CA  1 
ATOM   1143 C C   . SER A 1 156 ? 16.154  -41.176 38.346  1.00 51.32  ? 156  SER A C   1 
ATOM   1144 O O   . SER A 1 156 ? 16.154  -42.052 37.477  1.00 53.61  ? 156  SER A O   1 
ATOM   1145 C CB  . SER A 1 156 ? 15.710  -41.318 40.832  1.00 46.56  ? 156  SER A CB  1 
ATOM   1146 O OG  . SER A 1 156 ? 16.097  -42.104 41.950  1.00 49.79  ? 156  SER A OG  1 
ATOM   1147 N N   . PRO A 1 157 ? 15.711  -39.926 38.104  1.00 53.20  ? 157  PRO A N   1 
ATOM   1148 C CA  . PRO A 1 157 ? 15.096  -39.481 36.843  1.00 56.23  ? 157  PRO A CA  1 
ATOM   1149 C C   . PRO A 1 157 ? 15.762  -39.984 35.579  1.00 59.70  ? 157  PRO A C   1 
ATOM   1150 O O   . PRO A 1 157 ? 15.088  -40.364 34.612  1.00 56.32  ? 157  PRO A O   1 
ATOM   1151 C CB  . PRO A 1 157 ? 15.154  -37.963 36.946  1.00 52.90  ? 157  PRO A CB  1 
ATOM   1152 C CG  . PRO A 1 157 ? 15.119  -37.731 38.404  1.00 54.63  ? 157  PRO A CG  1 
ATOM   1153 C CD  . PRO A 1 157 ? 16.092  -38.753 38.904  1.00 50.23  ? 157  PRO A CD  1 
ATOM   1154 N N   . ALA A 1 158 ? 17.088  -39.976 35.602  1.00 53.21  ? 158  ALA A N   1 
ATOM   1155 C CA  . ALA A 1 158 ? 17.878  -40.409 34.470  1.00 49.87  ? 158  ALA A CA  1 
ATOM   1156 C C   . ALA A 1 158 ? 17.848  -41.918 34.304  1.00 52.30  ? 158  ALA A C   1 
ATOM   1157 O O   . ALA A 1 158 ? 17.431  -42.439 33.269  1.00 53.19  ? 158  ALA A O   1 
ATOM   1158 C CB  . ALA A 1 158 ? 19.306  -39.938 34.648  1.00 45.04  ? 158  ALA A CB  1 
ATOM   1159 N N   . ILE A 1 159 ? 18.314  -42.619 35.328  1.00 50.19  ? 159  ILE A N   1 
ATOM   1160 C CA  . ILE A 1 159 ? 18.344  -44.070 35.291  1.00 49.16  ? 159  ILE A CA  1 
ATOM   1161 C C   . ILE A 1 159 ? 16.955  -44.553 34.907  1.00 53.06  ? 159  ILE A C   1 
ATOM   1162 O O   . ILE A 1 159 ? 16.779  -45.447 34.086  1.00 60.01  ? 159  ILE A O   1 
ATOM   1163 C CB  . ILE A 1 159 ? 18.749  -44.636 36.665  1.00 46.40  ? 159  ILE A CB  1 
ATOM   1164 C CG1 . ILE A 1 159 ? 20.239  -44.378 36.892  1.00 46.29  ? 159  ILE A CG1 1 
ATOM   1165 C CG2 . ILE A 1 159 ? 18.440  -46.135 36.749  1.00 40.78  ? 159  ILE A CG2 1 
ATOM   1166 C CD1 . ILE A 1 159 ? 20.657  -44.507 38.336  1.00 52.01  ? 159  ILE A CD1 1 
ATOM   1167 N N   . PHE A 1 160 ? 15.957  -43.933 35.496  1.00 53.13  ? 160  PHE A N   1 
ATOM   1168 C CA  . PHE A 1 160 ? 14.606  -44.308 35.188  1.00 51.56  ? 160  PHE A CA  1 
ATOM   1169 C C   . PHE A 1 160 ? 14.370  -44.105 33.709  1.00 50.08  ? 160  PHE A C   1 
ATOM   1170 O O   . PHE A 1 160 ? 14.245  -45.071 32.971  1.00 45.06  ? 160  PHE A O   1 
ATOM   1171 C CB  . PHE A 1 160 ? 13.675  -43.443 36.003  1.00 57.34  ? 160  PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 160 ? 12.241  -43.548 35.610  1.00 74.52  ? 160  PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 160 ? 11.338  -42.543 35.988  1.00 87.44  ? 160  PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 160 ? 11.767  -44.646 34.896  1.00 82.74  ? 160  PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 160 ? 9.978   -42.628 35.666  1.00 85.25  ? 160  PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 160 ? 10.407  -44.748 34.564  1.00 84.69  ? 160  PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 160 ? 9.512   -43.735 34.953  1.00 83.35  ? 160  PHE A CZ  1 
ATOM   1178 N N   . GLN A 1 161 ? 14.316  -42.849 33.278  1.00 53.69  ? 161  GLN A N   1 
ATOM   1179 C CA  . GLN A 1 161 ? 14.076  -42.564 31.870  1.00 50.76  ? 161  GLN A CA  1 
ATOM   1180 C C   . GLN A 1 161 ? 14.836  -43.590 31.093  1.00 37.20  ? 161  GLN A C   1 
ATOM   1181 O O   . GLN A 1 161 ? 14.259  -44.437 30.432  1.00 38.75  ? 161  GLN A O   1 
ATOM   1182 C CB  . GLN A 1 161 ? 14.583  -41.183 31.473  1.00 61.79  ? 161  GLN A CB  1 
ATOM   1183 C CG  . GLN A 1 161 ? 13.675  -40.445 30.484  1.00 81.58  ? 161  GLN A CG  1 
ATOM   1184 C CD  . GLN A 1 161 ? 12.481  -39.765 31.178  1.00 106.69 ? 161  GLN A CD  1 
ATOM   1185 O OE1 . GLN A 1 161 ? 11.807  -40.370 32.018  1.00 108.84 ? 161  GLN A OE1 1 
ATOM   1186 N NE2 . GLN A 1 161 ? 12.218  -38.505 30.821  1.00 110.69 ? 161  GLN A NE2 1 
ATOM   1187 N N   . SER A 1 162 ? 16.147  -43.519 31.212  1.00 30.17  ? 162  SER A N   1 
ATOM   1188 C CA  . SER A 1 162 ? 17.022  -44.451 30.534  1.00 43.38  ? 162  SER A CA  1 
ATOM   1189 C C   . SER A 1 162 ? 16.455  -45.855 30.475  1.00 48.38  ? 162  SER A C   1 
ATOM   1190 O O   . SER A 1 162 ? 16.245  -46.413 29.403  1.00 54.19  ? 162  SER A O   1 
ATOM   1191 C CB  . SER A 1 162 ? 18.359  -44.531 31.242  1.00 44.87  ? 162  SER A CB  1 
ATOM   1192 O OG  . SER A 1 162 ? 18.845  -45.860 31.167  1.00 57.99  ? 162  SER A OG  1 
ATOM   1193 N N   . SER A 1 163 ? 16.217  -46.428 31.643  1.00 50.24  ? 163  SER A N   1 
ATOM   1194 C CA  . SER A 1 163 ? 15.696  -47.787 31.742  1.00 54.19  ? 163  SER A CA  1 
ATOM   1195 C C   . SER A 1 163 ? 14.350  -47.931 31.047  1.00 50.18  ? 163  SER A C   1 
ATOM   1196 O O   . SER A 1 163 ? 14.115  -48.851 30.263  1.00 48.88  ? 163  SER A O   1 
ATOM   1197 C CB  . SER A 1 163 ? 15.585  -48.172 33.220  1.00 64.02  ? 163  SER A CB  1 
ATOM   1198 O OG  . SER A 1 163 ? 16.868  -48.150 33.844  1.00 81.09  ? 163  SER A OG  1 
ATOM   1199 N N   . MET A 1 164 ? 13.463  -47.007 31.354  1.00 47.76  ? 164  MET A N   1 
ATOM   1200 C CA  . MET A 1 164 ? 12.163  -47.023 30.745  1.00 49.27  ? 164  MET A CA  1 
ATOM   1201 C C   . MET A 1 164 ? 12.400  -47.194 29.275  1.00 46.14  ? 164  MET A C   1 
ATOM   1202 O O   . MET A 1 164 ? 12.037  -48.182 28.675  1.00 42.80  ? 164  MET A O   1 
ATOM   1203 C CB  . MET A 1 164 ? 11.476  -45.694 30.979  1.00 61.05  ? 164  MET A CB  1 
ATOM   1204 C CG  . MET A 1 164 ? 10.230  -45.548 30.149  1.00 79.53  ? 164  MET A CG  1 
ATOM   1205 S SD  . MET A 1 164 ? 9.166   -46.985 30.336  1.00 81.92  ? 164  MET A SD  1 
ATOM   1206 C CE  . MET A 1 164 ? 8.518   -46.676 31.944  1.00 78.73  ? 164  MET A CE  1 
ATOM   1207 N N   . THR A 1 165 ? 13.035  -46.192 28.705  1.00 49.41  ? 165  THR A N   1 
ATOM   1208 C CA  . THR A 1 165 ? 13.342  -46.205 27.302  1.00 47.76  ? 165  THR A CA  1 
ATOM   1209 C C   . THR A 1 165 ? 13.694  -47.607 26.857  1.00 48.93  ? 165  THR A C   1 
ATOM   1210 O O   . THR A 1 165 ? 13.080  -48.158 25.949  1.00 53.08  ? 165  THR A O   1 
ATOM   1211 C CB  . THR A 1 165 ? 14.528  -45.315 27.014  1.00 46.57  ? 165  THR A CB  1 
ATOM   1212 O OG1 . THR A 1 165 ? 14.266  -43.995 27.509  1.00 52.48  ? 165  THR A OG1 1 
ATOM   1213 C CG2 . THR A 1 165 ? 14.789  -45.282 25.522  1.00 48.28  ? 165  THR A CG2 1 
ATOM   1214 N N   . LYS A 1 166 ? 14.687  -48.182 27.519  1.00 53.45  ? 166  LYS A N   1 
ATOM   1215 C CA  . LYS A 1 166 ? 15.152  -49.524 27.177  1.00 69.16  ? 166  LYS A CA  1 
ATOM   1216 C C   . LYS A 1 166 ? 14.020  -50.545 26.996  1.00 76.29  ? 166  LYS A C   1 
ATOM   1217 O O   . LYS A 1 166 ? 14.054  -51.399 26.104  1.00 77.87  ? 166  LYS A O   1 
ATOM   1218 C CB  . LYS A 1 166 ? 16.159  -50.036 28.237  1.00 77.35  ? 166  LYS A CB  1 
ATOM   1219 C CG  . LYS A 1 166 ? 17.644  -49.650 27.944  1.00 97.73  ? 166  LYS A CG  1 
ATOM   1220 C CD  . LYS A 1 166 ? 18.706  -50.366 28.830  1.00 102.72 ? 166  LYS A CD  1 
ATOM   1221 C CE  . LYS A 1 166 ? 18.996  -49.622 30.159  1.00 108.08 ? 166  LYS A CE  1 
ATOM   1222 N NZ  . LYS A 1 166 ? 20.026  -50.288 31.033  1.00 98.91  ? 166  LYS A NZ  1 
ATOM   1223 N N   . ILE A 1 167 ? 13.009  -50.439 27.841  1.00 78.78  ? 167  ILE A N   1 
ATOM   1224 C CA  . ILE A 1 167 ? 11.879  -51.358 27.805  1.00 73.15  ? 167  ILE A CA  1 
ATOM   1225 C C   . ILE A 1 167 ? 10.940  -51.174 26.609  1.00 76.56  ? 167  ILE A C   1 
ATOM   1226 O O   . ILE A 1 167 ? 10.558  -52.136 25.941  1.00 80.27  ? 167  ILE A O   1 
ATOM   1227 C CB  . ILE A 1 167 ? 11.067  -51.211 29.103  1.00 65.56  ? 167  ILE A CB  1 
ATOM   1228 C CG1 . ILE A 1 167 ? 12.004  -51.408 30.297  1.00 52.76  ? 167  ILE A CG1 1 
ATOM   1229 C CG2 . ILE A 1 167 ? 9.887   -52.179 29.110  1.00 49.27  ? 167  ILE A CG2 1 
ATOM   1230 C CD1 . ILE A 1 167 ? 11.368  -51.045 31.594  1.00 58.46  ? 167  ILE A CD1 1 
ATOM   1231 N N   . LEU A 1 168 ? 10.556  -49.938 26.344  1.00 74.16  ? 168  LEU A N   1 
ATOM   1232 C CA  . LEU A 1 168 ? 9.647   -49.693 25.252  1.00 71.16  ? 168  LEU A CA  1 
ATOM   1233 C C   . LEU A 1 168 ? 10.270  -50.087 23.919  1.00 76.12  ? 168  LEU A C   1 
ATOM   1234 O O   . LEU A 1 168 ? 9.566   -50.604 23.047  1.00 81.40  ? 168  LEU A O   1 
ATOM   1235 C CB  . LEU A 1 168 ? 9.234   -48.220 25.234  1.00 67.43  ? 168  LEU A CB  1 
ATOM   1236 C CG  . LEU A 1 168 ? 8.618   -47.678 26.527  1.00 57.78  ? 168  LEU A CG  1 
ATOM   1237 C CD1 . LEU A 1 168 ? 7.292   -48.324 26.808  1.00 47.64  ? 168  LEU A CD1 1 
ATOM   1238 C CD2 . LEU A 1 168 ? 9.564   -47.936 27.654  1.00 60.17  ? 168  LEU A CD2 1 
ATOM   1239 N N   . GLU A 1 169 ? 11.580  -49.860 23.770  1.00 79.00  ? 169  GLU A N   1 
ATOM   1240 C CA  . GLU A 1 169 ? 12.293  -50.166 22.523  1.00 81.76  ? 169  GLU A CA  1 
ATOM   1241 C C   . GLU A 1 169 ? 11.770  -51.425 21.832  1.00 79.29  ? 169  GLU A C   1 
ATOM   1242 O O   . GLU A 1 169 ? 11.436  -51.406 20.644  1.00 75.56  ? 169  GLU A O   1 
ATOM   1243 C CB  . GLU A 1 169 ? 13.782  -50.313 22.784  1.00 86.50  ? 169  GLU A CB  1 
ATOM   1244 C CG  . GLU A 1 169 ? 14.581  -50.483 21.517  1.00 110.42 ? 169  GLU A CG  1 
ATOM   1245 C CD  . GLU A 1 169 ? 15.954  -51.072 21.774  1.00 131.11 ? 169  GLU A CD  1 
ATOM   1246 O OE1 . GLU A 1 169 ? 16.778  -51.099 20.831  1.00 145.66 ? 169  GLU A OE1 1 
ATOM   1247 O OE2 . GLU A 1 169 ? 16.208  -51.516 22.916  1.00 136.54 ? 169  GLU A OE2 1 
ATOM   1248 N N   . PRO A 1 170 ? 11.707  -52.545 22.570  1.00 78.96  ? 170  PRO A N   1 
ATOM   1249 C CA  . PRO A 1 170 ? 11.215  -53.830 22.053  1.00 77.71  ? 170  PRO A CA  1 
ATOM   1250 C C   . PRO A 1 170 ? 9.840   -53.620 21.431  1.00 73.61  ? 170  PRO A C   1 
ATOM   1251 O O   . PRO A 1 170 ? 9.675   -53.589 20.204  1.00 62.61  ? 170  PRO A O   1 
ATOM   1252 C CB  . PRO A 1 170 ? 11.124  -54.691 23.317  1.00 75.20  ? 170  PRO A CB  1 
ATOM   1253 C CG  . PRO A 1 170 ? 12.273  -54.211 24.126  1.00 76.56  ? 170  PRO A CG  1 
ATOM   1254 C CD  . PRO A 1 170 ? 12.216  -52.698 23.947  1.00 80.30  ? 170  PRO A CD  1 
ATOM   1255 N N   . PHE A 1 171 ? 8.869   -53.489 22.335  1.00 71.03  ? 171  PHE A N   1 
ATOM   1256 C CA  . PHE A 1 171 ? 7.466   -53.244 22.026  1.00 65.99  ? 171  PHE A CA  1 
ATOM   1257 C C   . PHE A 1 171 ? 7.405   -52.290 20.845  1.00 62.64  ? 171  PHE A C   1 
ATOM   1258 O O   . PHE A 1 171 ? 6.621   -52.473 19.912  1.00 64.39  ? 171  PHE A O   1 
ATOM   1259 C CB  . PHE A 1 171 ? 6.812   -52.590 23.238  1.00 62.07  ? 171  PHE A CB  1 
ATOM   1260 C CG  . PHE A 1 171 ? 5.328   -52.382 23.109  1.00 75.86  ? 171  PHE A CG  1 
ATOM   1261 C CD1 . PHE A 1 171 ? 4.436   -53.190 23.823  1.00 90.62  ? 171  PHE A CD1 1 
ATOM   1262 C CD2 . PHE A 1 171 ? 4.815   -51.347 22.326  1.00 83.19  ? 171  PHE A CD2 1 
ATOM   1263 C CE1 . PHE A 1 171 ? 3.040   -52.969 23.765  1.00 95.80  ? 171  PHE A CE1 1 
ATOM   1264 C CE2 . PHE A 1 171 ? 3.424   -51.113 22.257  1.00 91.50  ? 171  PHE A CE2 1 
ATOM   1265 C CZ  . PHE A 1 171 ? 2.534   -51.927 22.981  1.00 92.96  ? 171  PHE A CZ  1 
ATOM   1266 N N   . ARG A 1 172 ? 8.250   -51.271 20.906  1.00 59.69  ? 172  ARG A N   1 
ATOM   1267 C CA  . ARG A 1 172 ? 8.313   -50.276 19.864  1.00 60.30  ? 172  ARG A CA  1 
ATOM   1268 C C   . ARG A 1 172 ? 8.615   -50.857 18.489  1.00 66.78  ? 172  ARG A C   1 
ATOM   1269 O O   . ARG A 1 172 ? 8.036   -50.420 17.484  1.00 67.14  ? 172  ARG A O   1 
ATOM   1270 C CB  . ARG A 1 172 ? 9.355   -49.224 20.207  1.00 51.78  ? 172  ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 172 ? 8.952   -48.285 21.320  1.00 48.82  ? 172  ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 172 ? 9.583   -46.918 21.077  1.00 55.86  ? 172  ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 172 ? 9.973   -46.252 22.314  1.00 68.62  ? 172  ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 172 ? 9.719   -44.976 22.588  1.00 80.25  ? 172  ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 172 ? 9.062   -44.220 21.706  1.00 77.11  ? 172  ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 172 ? 10.134  -44.457 23.745  1.00 83.98  ? 172  ARG A NH2 1 
ATOM   1277 N N   . LYS A 1 173 ? 9.510   -51.840 18.431  1.00 67.97  ? 173  LYS A N   1 
ATOM   1278 C CA  . LYS A 1 173 ? 9.853   -52.428 17.142  1.00 72.92  ? 173  LYS A CA  1 
ATOM   1279 C C   . LYS A 1 173 ? 8.828   -53.437 16.630  1.00 64.43  ? 173  LYS A C   1 
ATOM   1280 O O   . LYS A 1 173 ? 8.767   -53.710 15.435  1.00 59.72  ? 173  LYS A O   1 
ATOM   1281 C CB  . LYS A 1 173 ? 11.264  -53.024 17.195  1.00 82.53  ? 173  LYS A CB  1 
ATOM   1282 C CG  . LYS A 1 173 ? 12.329  -51.937 17.434  1.00 86.61  ? 173  LYS A CG  1 
ATOM   1283 C CD  . LYS A 1 173 ? 13.761  -52.450 17.299  1.00 101.34 ? 173  LYS A CD  1 
ATOM   1284 C CE  . LYS A 1 173 ? 14.766  -51.305 17.475  1.00 106.68 ? 173  LYS A CE  1 
ATOM   1285 N NZ  . LYS A 1 173 ? 16.190  -51.711 17.240  1.00 109.72 ? 173  LYS A NZ  1 
ATOM   1286 N N   . GLN A 1 174 ? 8.005   -53.961 17.527  1.00 53.00  ? 174  GLN A N   1 
ATOM   1287 C CA  . GLN A 1 174 ? 6.977   -54.901 17.129  1.00 59.06  ? 174  GLN A CA  1 
ATOM   1288 C C   . GLN A 1 174 ? 5.750   -54.092 16.764  1.00 64.96  ? 174  GLN A C   1 
ATOM   1289 O O   . GLN A 1 174 ? 4.770   -54.633 16.253  1.00 67.64  ? 174  GLN A O   1 
ATOM   1290 C CB  . GLN A 1 174 ? 6.641   -55.834 18.284  1.00 63.25  ? 174  GLN A CB  1 
ATOM   1291 C CG  . GLN A 1 174 ? 7.848   -56.580 18.807  1.00 85.15  ? 174  GLN A CG  1 
ATOM   1292 C CD  . GLN A 1 174 ? 7.606   -57.252 20.150  1.00 97.92  ? 174  GLN A CD  1 
ATOM   1293 O OE1 . GLN A 1 174 ? 7.309   -56.590 21.149  1.00 87.37  ? 174  GLN A OE1 1 
ATOM   1294 N NE2 . GLN A 1 174 ? 7.745   -58.573 20.182  1.00 118.33 ? 174  GLN A NE2 1 
ATOM   1295 N N   . ASN A 1 175 ? 5.819   -52.788 17.029  1.00 68.74  ? 175  ASN A N   1 
ATOM   1296 C CA  . ASN A 1 175 ? 4.712   -51.860 16.768  1.00 69.31  ? 175  ASN A CA  1 
ATOM   1297 C C   . ASN A 1 175 ? 5.176   -50.503 16.245  1.00 64.32  ? 175  ASN A C   1 
ATOM   1298 O O   . ASN A 1 175 ? 4.971   -49.478 16.879  1.00 64.23  ? 175  ASN A O   1 
ATOM   1299 C CB  . ASN A 1 175 ? 3.912   -51.639 18.051  1.00 69.47  ? 175  ASN A CB  1 
ATOM   1300 C CG  . ASN A 1 175 ? 3.252   -52.907 18.551  1.00 81.51  ? 175  ASN A CG  1 
ATOM   1301 O OD1 . ASN A 1 175 ? 2.085   -53.187 18.240  1.00 91.79  ? 175  ASN A OD1 1 
ATOM   1302 N ND2 . ASN A 1 175 ? 3.999   -53.693 19.321  1.00 76.20  ? 175  ASN A ND2 1 
ATOM   1303 N N   . PRO A 1 176 ? 5.777   -50.482 15.061  1.00 62.16  ? 176  PRO A N   1 
ATOM   1304 C CA  . PRO A 1 176 ? 6.277   -49.252 14.445  1.00 64.57  ? 176  PRO A CA  1 
ATOM   1305 C C   . PRO A 1 176 ? 5.168   -48.271 14.093  1.00 65.44  ? 176  PRO A C   1 
ATOM   1306 O O   . PRO A 1 176 ? 5.412   -47.177 13.614  1.00 68.33  ? 176  PRO A O   1 
ATOM   1307 C CB  . PRO A 1 176 ? 6.976   -49.769 13.209  1.00 65.58  ? 176  PRO A CB  1 
ATOM   1308 C CG  . PRO A 1 176 ? 6.044   -50.892 12.802  1.00 72.31  ? 176  PRO A CG  1 
ATOM   1309 C CD  . PRO A 1 176 ? 5.801   -51.602 14.106  1.00 56.65  ? 176  PRO A CD  1 
ATOM   1310 N N   . ASP A 1 177 ? 3.940   -48.677 14.324  1.00 70.77  ? 177  ASP A N   1 
ATOM   1311 C CA  . ASP A 1 177 ? 2.792   -47.844 14.018  1.00 82.04  ? 177  ASP A CA  1 
ATOM   1312 C C   . ASP A 1 177 ? 2.465   -47.016 15.238  1.00 78.55  ? 177  ASP A C   1 
ATOM   1313 O O   . ASP A 1 177 ? 1.982   -45.890 15.151  1.00 80.05  ? 177  ASP A O   1 
ATOM   1314 C CB  . ASP A 1 177 ? 1.623   -48.754 13.682  1.00 102.00 ? 177  ASP A CB  1 
ATOM   1315 C CG  . ASP A 1 177 ? 1.666   -50.060 14.471  1.00 117.32 ? 177  ASP A CG  1 
ATOM   1316 O OD1 . ASP A 1 177 ? 2.711   -50.754 14.429  1.00 125.59 ? 177  ASP A OD1 1 
ATOM   1317 O OD2 . ASP A 1 177 ? 0.661   -50.396 15.132  1.00 123.58 ? 177  ASP A OD2 1 
ATOM   1318 N N   . ILE A 1 178 ? 2.737   -47.610 16.387  1.00 73.14  ? 178  ILE A N   1 
ATOM   1319 C CA  . ILE A 1 178 ? 2.484   -46.984 17.666  1.00 69.22  ? 178  ILE A CA  1 
ATOM   1320 C C   . ILE A 1 178 ? 3.578   -45.973 17.980  1.00 61.31  ? 178  ILE A C   1 
ATOM   1321 O O   . ILE A 1 178 ? 4.756   -46.293 17.948  1.00 59.14  ? 178  ILE A O   1 
ATOM   1322 C CB  . ILE A 1 178 ? 2.486   -48.034 18.793  1.00 76.89  ? 178  ILE A CB  1 
ATOM   1323 C CG1 . ILE A 1 178 ? 1.688   -49.268 18.365  1.00 73.10  ? 178  ILE A CG1 1 
ATOM   1324 C CG2 . ILE A 1 178 ? 1.944   -47.418 20.079  1.00 72.32  ? 178  ILE A CG2 1 
ATOM   1325 C CD1 . ILE A 1 178 ? 0.256   -48.990 18.028  1.00 71.52  ? 178  ILE A CD1 1 
ATOM   1326 N N   . VAL A 1 179 ? 3.182   -44.753 18.300  1.00 61.33  ? 179  VAL A N   1 
ATOM   1327 C CA  . VAL A 1 179 ? 4.141   -43.704 18.641  1.00 53.94  ? 179  VAL A CA  1 
ATOM   1328 C C   . VAL A 1 179 ? 4.091   -43.437 20.125  1.00 51.11  ? 179  VAL A C   1 
ATOM   1329 O O   . VAL A 1 179 ? 3.015   -43.173 20.688  1.00 49.24  ? 179  VAL A O   1 
ATOM   1330 C CB  . VAL A 1 179 ? 3.799   -42.384 17.966  1.00 49.06  ? 179  VAL A CB  1 
ATOM   1331 C CG1 . VAL A 1 179 ? 4.497   -41.269 18.683  1.00 27.31  ? 179  VAL A CG1 1 
ATOM   1332 C CG2 . VAL A 1 179 ? 4.193   -42.425 16.499  1.00 42.17  ? 179  VAL A CG2 1 
ATOM   1333 N N   . ILE A 1 180 ? 5.252   -43.467 20.759  1.00 48.83  ? 180  ILE A N   1 
ATOM   1334 C CA  . ILE A 1 180 ? 5.269   -43.236 22.186  1.00 53.87  ? 180  ILE A CA  1 
ATOM   1335 C C   . ILE A 1 180 ? 6.236   -42.179 22.645  1.00 58.50  ? 180  ILE A C   1 
ATOM   1336 O O   . ILE A 1 180 ? 7.423   -42.209 22.293  1.00 64.92  ? 180  ILE A O   1 
ATOM   1337 C CB  . ILE A 1 180 ? 5.622   -44.499 22.947  1.00 56.02  ? 180  ILE A CB  1 
ATOM   1338 C CG1 . ILE A 1 180 ? 4.786   -45.662 22.429  1.00 60.90  ? 180  ILE A CG1 1 
ATOM   1339 C CG2 . ILE A 1 180 ? 5.383   -44.274 24.442  1.00 48.69  ? 180  ILE A CG2 1 
ATOM   1340 C CD1 . ILE A 1 180 ? 5.231   -46.988 22.976  1.00 58.84  ? 180  ILE A CD1 1 
ATOM   1341 N N   . TYR A 1 181 ? 5.722   -41.251 23.448  1.00 55.82  ? 181  TYR A N   1 
ATOM   1342 C CA  . TYR A 1 181 ? 6.552   -40.200 24.011  1.00 48.94  ? 181  TYR A CA  1 
ATOM   1343 C C   . TYR A 1 181 ? 6.655   -40.443 25.511  1.00 54.50  ? 181  TYR A C   1 
ATOM   1344 O O   . TYR A 1 181 ? 5.657   -40.724 26.193  1.00 53.44  ? 181  TYR A O   1 
ATOM   1345 C CB  . TYR A 1 181 ? 5.951   -38.830 23.741  1.00 33.26  ? 181  TYR A CB  1 
ATOM   1346 C CG  . TYR A 1 181 ? 6.707   -37.713 24.410  1.00 40.45  ? 181  TYR A CG  1 
ATOM   1347 C CD1 . TYR A 1 181 ? 6.143   -37.020 25.492  1.00 57.34  ? 181  TYR A CD1 1 
ATOM   1348 C CD2 . TYR A 1 181 ? 7.975   -37.328 23.970  1.00 32.44  ? 181  TYR A CD2 1 
ATOM   1349 C CE1 . TYR A 1 181 ? 6.815   -35.957 26.130  1.00 39.63  ? 181  TYR A CE1 1 
ATOM   1350 C CE2 . TYR A 1 181 ? 8.670   -36.257 24.600  1.00 48.93  ? 181  TYR A CE2 1 
ATOM   1351 C CZ  . TYR A 1 181 ? 8.071   -35.577 25.687  1.00 42.34  ? 181  TYR A CZ  1 
ATOM   1352 O OH  . TYR A 1 181 ? 8.716   -34.524 26.327  1.00 36.81  ? 181  TYR A OH  1 
ATOM   1353 N N   . GLN A 1 182 ? 7.872   -40.352 26.023  1.00 61.64  ? 182  GLN A N   1 
ATOM   1354 C CA  . GLN A 1 182 ? 8.099   -40.572 27.441  1.00 59.34  ? 182  GLN A CA  1 
ATOM   1355 C C   . GLN A 1 182 ? 8.393   -39.243 28.134  1.00 56.20  ? 182  GLN A C   1 
ATOM   1356 O O   . GLN A 1 182 ? 9.386   -38.593 27.820  1.00 55.38  ? 182  GLN A O   1 
ATOM   1357 C CB  . GLN A 1 182 ? 9.278   -41.527 27.609  1.00 62.77  ? 182  GLN A CB  1 
ATOM   1358 C CG  . GLN A 1 182 ? 9.494   -42.021 29.027  1.00 80.99  ? 182  GLN A CG  1 
ATOM   1359 C CD  . GLN A 1 182 ? 10.903  -42.562 29.229  1.00 93.30  ? 182  GLN A CD  1 
ATOM   1360 O OE1 . GLN A 1 182 ? 11.571  -42.986 28.265  1.00 88.76  ? 182  GLN A OE1 1 
ATOM   1361 N NE2 . GLN A 1 182 ? 11.362  -42.562 30.486  1.00 94.39  ? 182  GLN A NE2 1 
ATOM   1362 N N   . TYR A 1 183 ? 7.536   -38.835 29.068  1.00 63.21  ? 183  TYR A N   1 
ATOM   1363 C CA  . TYR A 1 183 ? 7.746   -37.570 29.789  1.00 73.20  ? 183  TYR A CA  1 
ATOM   1364 C C   . TYR A 1 183 ? 7.557   -37.686 31.308  1.00 78.13  ? 183  TYR A C   1 
ATOM   1365 O O   . TYR A 1 183 ? 6.430   -37.625 31.831  1.00 74.27  ? 183  TYR A O   1 
ATOM   1366 C CB  . TYR A 1 183 ? 6.818   -36.490 29.246  1.00 77.96  ? 183  TYR A CB  1 
ATOM   1367 C CG  . TYR A 1 183 ? 7.011   -35.165 29.929  1.00 84.86  ? 183  TYR A CG  1 
ATOM   1368 C CD1 . TYR A 1 183 ? 6.010   -34.621 30.733  1.00 89.80  ? 183  TYR A CD1 1 
ATOM   1369 C CD2 . TYR A 1 183 ? 8.214   -34.471 29.807  1.00 91.31  ? 183  TYR A CD2 1 
ATOM   1370 C CE1 . TYR A 1 183 ? 6.202   -33.412 31.404  1.00 87.83  ? 183  TYR A CE1 1 
ATOM   1371 C CE2 . TYR A 1 183 ? 8.421   -33.264 30.474  1.00 92.05  ? 183  TYR A CE2 1 
ATOM   1372 C CZ  . TYR A 1 183 ? 7.412   -32.741 31.274  1.00 87.40  ? 183  TYR A CZ  1 
ATOM   1373 O OH  . TYR A 1 183 ? 7.628   -31.566 31.959  1.00 87.90  ? 183  TYR A OH  1 
ATOM   1374 N N   . MET A 1 184 ? 8.677   -37.818 32.011  1.00 82.10  ? 184  MET A N   1 
ATOM   1375 C CA  . MET A 1 184 ? 8.647   -37.992 33.451  1.00 80.80  ? 184  MET A CA  1 
ATOM   1376 C C   . MET A 1 184 ? 7.831   -39.241 33.807  1.00 80.52  ? 184  MET A C   1 
ATOM   1377 O O   . MET A 1 184 ? 8.098   -40.313 33.253  1.00 80.88  ? 184  MET A O   1 
ATOM   1378 C CB  . MET A 1 184 ? 8.099   -36.741 34.130  1.00 74.09  ? 184  MET A CB  1 
ATOM   1379 C CG  . MET A 1 184 ? 9.219   -35.933 34.760  1.00 83.24  ? 184  MET A CG  1 
ATOM   1380 S SD  . MET A 1 184 ? 8.662   -34.404 35.476  1.00 97.06  ? 184  MET A SD  1 
ATOM   1381 C CE  . MET A 1 184 ? 8.901   -33.295 34.078  1.00 82.93  ? 184  MET A CE  1 
ATOM   1382 N N   . ASP A 1 185 ? 6.851   -39.128 34.705  1.00 77.96  ? 185  ASP A N   1 
ATOM   1383 C CA  . ASP A 1 185 ? 6.068   -40.305 35.085  1.00 82.16  ? 185  ASP A CA  1 
ATOM   1384 C C   . ASP A 1 185 ? 4.873   -40.571 34.175  1.00 80.10  ? 185  ASP A C   1 
ATOM   1385 O O   . ASP A 1 185 ? 4.114   -41.525 34.391  1.00 74.48  ? 185  ASP A O   1 
ATOM   1386 C CB  . ASP A 1 185 ? 5.607   -40.221 36.549  1.00 94.69  ? 185  ASP A CB  1 
ATOM   1387 C CG  . ASP A 1 185 ? 6.155   -41.366 37.397  1.00 108.65 ? 185  ASP A CG  1 
ATOM   1388 O OD1 . ASP A 1 185 ? 5.685   -41.572 38.532  1.00 119.75 ? 185  ASP A OD1 1 
ATOM   1389 O OD2 . ASP A 1 185 ? 7.068   -42.065 36.929  1.00 113.20 ? 185  ASP A OD2 1 
ATOM   1390 N N   . ASP A 1 186 ? 4.704   -39.729 33.160  1.00 78.77  ? 186  ASP A N   1 
ATOM   1391 C CA  . ASP A 1 186 ? 3.622   -39.930 32.209  1.00 73.17  ? 186  ASP A CA  1 
ATOM   1392 C C   . ASP A 1 186 ? 4.153   -40.641 30.973  1.00 68.21  ? 186  ASP A C   1 
ATOM   1393 O O   . ASP A 1 186 ? 5.359   -40.870 30.833  1.00 67.44  ? 186  ASP A O   1 
ATOM   1394 C CB  . ASP A 1 186 ? 2.980   -38.604 31.816  1.00 68.22  ? 186  ASP A CB  1 
ATOM   1395 C CG  . ASP A 1 186 ? 2.015   -38.103 32.863  1.00 79.41  ? 186  ASP A CG  1 
ATOM   1396 O OD1 . ASP A 1 186 ? 0.940   -37.611 32.460  1.00 82.90  ? 186  ASP A OD1 1 
ATOM   1397 O OD2 . ASP A 1 186 ? 2.329   -38.201 34.078  1.00 75.10  ? 186  ASP A OD2 1 
ATOM   1398 N N   . LEU A 1 187 ? 3.247   -40.996 30.074  1.00 63.76  ? 187  LEU A N   1 
ATOM   1399 C CA  . LEU A 1 187 ? 3.642   -41.691 28.866  1.00 53.00  ? 187  LEU A CA  1 
ATOM   1400 C C   . LEU A 1 187 ? 2.567   -41.557 27.815  1.00 52.01  ? 187  LEU A C   1 
ATOM   1401 O O   . LEU A 1 187 ? 1.538   -42.207 27.896  1.00 63.50  ? 187  LEU A O   1 
ATOM   1402 C CB  . LEU A 1 187 ? 3.857   -43.157 29.182  1.00 51.03  ? 187  LEU A CB  1 
ATOM   1403 C CG  . LEU A 1 187 ? 5.007   -43.729 28.377  1.00 55.39  ? 187  LEU A CG  1 
ATOM   1404 C CD1 . LEU A 1 187 ? 6.260   -42.897 28.638  1.00 55.24  ? 187  LEU A CD1 1 
ATOM   1405 C CD2 . LEU A 1 187 ? 5.219   -45.181 28.778  1.00 55.76  ? 187  LEU A CD2 1 
ATOM   1406 N N   . TYR A 1 188 ? 2.806   -40.726 26.816  1.00 53.93  ? 188  TYR A N   1 
ATOM   1407 C CA  . TYR A 1 188 ? 1.820   -40.512 25.767  1.00 58.97  ? 188  TYR A CA  1 
ATOM   1408 C C   . TYR A 1 188 ? 1.945   -41.528 24.646  1.00 58.93  ? 188  TYR A C   1 
ATOM   1409 O O   . TYR A 1 188 ? 3.035   -41.733 24.106  1.00 59.70  ? 188  TYR A O   1 
ATOM   1410 C CB  . TYR A 1 188 ? 1.964   -39.092 25.232  1.00 61.43  ? 188  TYR A CB  1 
ATOM   1411 C CG  . TYR A 1 188 ? 1.777   -38.062 26.326  1.00 61.32  ? 188  TYR A CG  1 
ATOM   1412 C CD1 . TYR A 1 188 ? 2.645   -38.001 27.418  1.00 59.46  ? 188  TYR A CD1 1 
ATOM   1413 C CD2 . TYR A 1 188 ? 0.696   -37.193 26.305  1.00 55.82  ? 188  TYR A CD2 1 
ATOM   1414 C CE1 . TYR A 1 188 ? 2.430   -37.103 28.463  1.00 59.30  ? 188  TYR A CE1 1 
ATOM   1415 C CE2 . TYR A 1 188 ? 0.473   -36.294 27.341  1.00 58.40  ? 188  TYR A CE2 1 
ATOM   1416 C CZ  . TYR A 1 188 ? 1.336   -36.251 28.417  1.00 61.10  ? 188  TYR A CZ  1 
ATOM   1417 O OH  . TYR A 1 188 ? 1.073   -35.367 29.447  1.00 68.29  ? 188  TYR A OH  1 
ATOM   1418 N N   . VAL A 1 189 ? 0.826   -42.168 24.309  1.00 55.52  ? 189  VAL A N   1 
ATOM   1419 C CA  . VAL A 1 189 ? 0.818   -43.184 23.256  1.00 55.83  ? 189  VAL A CA  1 
ATOM   1420 C C   . VAL A 1 189 ? -0.333  -42.973 22.270  1.00 56.37  ? 189  VAL A C   1 
ATOM   1421 O O   . VAL A 1 189 ? -1.509  -43.098 22.613  1.00 60.42  ? 189  VAL A O   1 
ATOM   1422 C CB  . VAL A 1 189 ? 0.711   -44.616 23.844  1.00 49.66  ? 189  VAL A CB  1 
ATOM   1423 C CG1 . VAL A 1 189 ? 1.460   -45.568 22.964  1.00 38.13  ? 189  VAL A CG1 1 
ATOM   1424 C CG2 . VAL A 1 189 ? 1.255   -44.661 25.267  1.00 40.21  ? 189  VAL A CG2 1 
ATOM   1425 N N   . GLY A 1 190 ? 0.015   -42.654 21.035  1.00 54.45  ? 190  GLY A N   1 
ATOM   1426 C CA  . GLY A 1 190 ? -1.003  -42.426 20.033  1.00 56.80  ? 190  GLY A CA  1 
ATOM   1427 C C   . GLY A 1 190 ? -0.848  -43.430 18.913  1.00 67.20  ? 190  GLY A C   1 
ATOM   1428 O O   . GLY A 1 190 ? 0.165   -44.134 18.804  1.00 69.46  ? 190  GLY A O   1 
ATOM   1429 N N   . SER A 1 191 ? -1.855  -43.498 18.059  1.00 66.75  ? 191  SER A N   1 
ATOM   1430 C CA  . SER A 1 191 ? -1.810  -44.437 16.962  1.00 53.99  ? 191  SER A CA  1 
ATOM   1431 C C   . SER A 1 191 ? -2.847  -44.004 15.985  1.00 53.96  ? 191  SER A C   1 
ATOM   1432 O O   . SER A 1 191 ? -3.690  -43.156 16.279  1.00 44.35  ? 191  SER A O   1 
ATOM   1433 C CB  . SER A 1 191 ? -2.209  -45.815 17.439  1.00 50.89  ? 191  SER A CB  1 
ATOM   1434 O OG  . SER A 1 191 ? -3.606  -45.831 17.712  1.00 49.30  ? 191  SER A OG  1 
ATOM   1435 N N   . ASP A 1 192 ? -2.793  -44.616 14.816  1.00 63.87  ? 192  ASP A N   1 
ATOM   1436 C CA  . ASP A 1 192 ? -3.782  -44.337 13.802  1.00 80.25  ? 192  ASP A CA  1 
ATOM   1437 C C   . ASP A 1 192 ? -4.746  -45.546 13.684  1.00 90.17  ? 192  ASP A C   1 
ATOM   1438 O O   . ASP A 1 192 ? -5.450  -45.716 12.680  1.00 103.00 ? 192  ASP A O   1 
ATOM   1439 C CB  . ASP A 1 192 ? -3.085  -44.018 12.481  1.00 77.39  ? 192  ASP A CB  1 
ATOM   1440 C CG  . ASP A 1 192 ? -2.395  -42.671 12.512  1.00 85.86  ? 192  ASP A CG  1 
ATOM   1441 O OD1 . ASP A 1 192 ? -2.970  -41.731 13.106  1.00 85.49  ? 192  ASP A OD1 1 
ATOM   1442 O OD2 . ASP A 1 192 ? -1.291  -42.542 11.942  1.00 99.92  ? 192  ASP A OD2 1 
ATOM   1443 N N   . LEU A 1 193 ? -4.789  -46.374 14.729  1.00 83.25  ? 193  LEU A N   1 
ATOM   1444 C CA  . LEU A 1 193 ? -5.653  -47.544 14.737  1.00 78.48  ? 193  LEU A CA  1 
ATOM   1445 C C   . LEU A 1 193 ? -7.052  -47.131 15.118  1.00 84.32  ? 193  LEU A C   1 
ATOM   1446 O O   . LEU A 1 193 ? -7.250  -46.078 15.742  1.00 80.31  ? 193  LEU A O   1 
ATOM   1447 C CB  . LEU A 1 193 ? -5.197  -48.562 15.780  1.00 72.86  ? 193  LEU A CB  1 
ATOM   1448 C CG  . LEU A 1 193 ? -3.740  -48.984 15.803  1.00 64.54  ? 193  LEU A CG  1 
ATOM   1449 C CD1 . LEU A 1 193 ? -3.509  -49.941 16.983  1.00 47.78  ? 193  LEU A CD1 1 
ATOM   1450 C CD2 . LEU A 1 193 ? -3.387  -49.611 14.461  1.00 50.52  ? 193  LEU A CD2 1 
ATOM   1451 N N   . GLU A 1 194 ? -8.008  -47.987 14.751  1.00 87.27  ? 194  GLU A N   1 
ATOM   1452 C CA  . GLU A 1 194 ? -9.410  -47.795 15.086  1.00 85.61  ? 194  GLU A CA  1 
ATOM   1453 C C   . GLU A 1 194 ? -9.447  -47.905 16.607  1.00 80.10  ? 194  GLU A C   1 
ATOM   1454 O O   . GLU A 1 194 ? -8.769  -48.755 17.196  1.00 82.34  ? 194  GLU A O   1 
ATOM   1455 C CB  . GLU A 1 194 ? -10.260 -48.918 14.494  1.00 98.77  ? 194  GLU A CB  1 
ATOM   1456 C CG  . GLU A 1 194 ? -9.790  -50.314 14.947  1.00 119.67 ? 194  GLU A CG  1 
ATOM   1457 C CD  . GLU A 1 194 ? -10.937 -51.289 15.209  1.00 130.33 ? 194  GLU A CD  1 
ATOM   1458 O OE1 . GLU A 1 194 ? -11.839 -50.946 16.007  1.00 133.16 ? 194  GLU A OE1 1 
ATOM   1459 O OE2 . GLU A 1 194 ? -10.932 -52.399 14.625  1.00 132.65 ? 194  GLU A OE2 1 
ATOM   1460 N N   . ILE A 1 195 ? -10.221 -47.030 17.230  1.00 77.50  ? 195  ILE A N   1 
ATOM   1461 C CA  . ILE A 1 195 ? -10.386 -46.996 18.681  1.00 80.15  ? 195  ILE A CA  1 
ATOM   1462 C C   . ILE A 1 195 ? -10.200 -48.349 19.362  1.00 82.92  ? 195  ILE A C   1 
ATOM   1463 O O   . ILE A 1 195 ? -9.531  -48.456 20.398  1.00 83.33  ? 195  ILE A O   1 
ATOM   1464 C CB  . ILE A 1 195 ? -11.787 -46.465 19.046  1.00 78.18  ? 195  ILE A CB  1 
ATOM   1465 C CG1 . ILE A 1 195 ? -12.832 -47.031 18.070  1.00 100.48 ? 195  ILE A CG1 1 
ATOM   1466 C CG2 . ILE A 1 195 ? -11.804 -44.959 18.978  1.00 77.87  ? 195  ILE A CG2 1 
ATOM   1467 C CD1 . ILE A 1 195 ? -12.755 -46.480 16.615  1.00 107.39 ? 195  ILE A CD1 1 
ATOM   1468 N N   . GLY A 1 196 ? -10.799 -49.375 18.764  1.00 84.15  ? 196  GLY A N   1 
ATOM   1469 C CA  . GLY A 1 196 ? -10.718 -50.720 19.304  1.00 80.87  ? 196  GLY A CA  1 
ATOM   1470 C C   . GLY A 1 196 ? -9.321  -51.286 19.269  1.00 80.58  ? 196  GLY A C   1 
ATOM   1471 O O   . GLY A 1 196 ? -8.730  -51.550 20.314  1.00 86.54  ? 196  GLY A O   1 
ATOM   1472 N N   . GLN A 1 197 ? -8.776  -51.482 18.076  1.00 75.92  ? 197  GLN A N   1 
ATOM   1473 C CA  . GLN A 1 197 ? -7.443  -52.019 18.019  1.00 74.89  ? 197  GLN A CA  1 
ATOM   1474 C C   . GLN A 1 197 ? -6.546  -51.083 18.827  1.00 72.07  ? 197  GLN A C   1 
ATOM   1475 O O   . GLN A 1 197 ? -5.622  -51.543 19.494  1.00 75.56  ? 197  GLN A O   1 
ATOM   1476 C CB  . GLN A 1 197 ? -6.963  -52.158 16.574  1.00 83.73  ? 197  GLN A CB  1 
ATOM   1477 C CG  . GLN A 1 197 ? -5.686  -53.000 16.456  1.00 97.07  ? 197  GLN A CG  1 
ATOM   1478 C CD  . GLN A 1 197 ? -5.810  -54.389 17.081  1.00 102.14 ? 197  GLN A CD  1 
ATOM   1479 O OE1 . GLN A 1 197 ? -4.809  -55.007 17.457  1.00 98.11  ? 197  GLN A OE1 1 
ATOM   1480 N NE2 . GLN A 1 197 ? -7.037  -54.887 17.182  1.00 107.64 ? 197  GLN A NE2 1 
ATOM   1481 N N   . HIS A 1 198 ? -6.823  -49.780 18.806  1.00 65.35  ? 198  HIS A N   1 
ATOM   1482 C CA  . HIS A 1 198 ? -5.994  -48.872 19.593  1.00 61.71  ? 198  HIS A CA  1 
ATOM   1483 C C   . HIS A 1 198 ? -6.058  -49.258 21.067  1.00 61.91  ? 198  HIS A C   1 
ATOM   1484 O O   . HIS A 1 198 ? -5.032  -49.512 21.708  1.00 59.03  ? 198  HIS A O   1 
ATOM   1485 C CB  . HIS A 1 198 ? -6.431  -47.407 19.474  1.00 57.63  ? 198  HIS A CB  1 
ATOM   1486 C CG  . HIS A 1 198 ? -5.647  -46.485 20.367  1.00 61.62  ? 198  HIS A CG  1 
ATOM   1487 N ND1 . HIS A 1 198 ? -4.330  -46.152 20.123  1.00 59.30  ? 198  HIS A ND1 1 
ATOM   1488 C CD2 . HIS A 1 198 ? -5.964  -45.903 21.549  1.00 57.65  ? 198  HIS A CD2 1 
ATOM   1489 C CE1 . HIS A 1 198 ? -3.866  -45.411 21.116  1.00 42.82  ? 198  HIS A CE1 1 
ATOM   1490 N NE2 . HIS A 1 198 ? -4.837  -45.246 21.995  1.00 50.43  ? 198  HIS A NE2 1 
ATOM   1491 N N   . ARG A 1 199 ? -7.262  -49.285 21.618  1.00 63.45  ? 199  ARG A N   1 
ATOM   1492 C CA  . ARG A 1 199 ? -7.417  -49.643 23.022  1.00 62.14  ? 199  ARG A CA  1 
ATOM   1493 C C   . ARG A 1 199 ? -6.773  -50.977 23.332  1.00 58.37  ? 199  ARG A C   1 
ATOM   1494 O O   . ARG A 1 199 ? -6.341  -51.225 24.459  1.00 52.10  ? 199  ARG A O   1 
ATOM   1495 C CB  . ARG A 1 199 ? -8.890  -49.700 23.386  1.00 64.85  ? 199  ARG A CB  1 
ATOM   1496 C CG  . ARG A 1 199 ? -9.188  -50.382 24.709  1.00 68.24  ? 199  ARG A CG  1 
ATOM   1497 C CD  . ARG A 1 199 ? -10.531 -49.905 25.237  1.00 75.74  ? 199  ARG A CD  1 
ATOM   1498 N NE  . ARG A 1 199 ? -11.465 -49.587 24.153  1.00 89.09  ? 199  ARG A NE  1 
ATOM   1499 C CZ  . ARG A 1 199 ? -12.373 -50.426 23.656  1.00 87.67  ? 199  ARG A CZ  1 
ATOM   1500 N NH1 . ARG A 1 199 ? -12.483 -51.655 24.152  1.00 82.71  ? 199  ARG A NH1 1 
ATOM   1501 N NH2 . ARG A 1 199 ? -13.164 -50.036 22.653  1.00 70.27  ? 199  ARG A NH2 1 
ATOM   1502 N N   . THR A 1 200 ? -6.724  -51.834 22.322  1.00 60.02  ? 200  THR A N   1 
ATOM   1503 C CA  . THR A 1 200 ? -6.132  -53.154 22.462  1.00 64.35  ? 200  THR A CA  1 
ATOM   1504 C C   . THR A 1 200 ? -4.631  -53.013 22.728  1.00 62.53  ? 200  THR A C   1 
ATOM   1505 O O   . THR A 1 200 ? -4.135  -53.408 23.786  1.00 58.89  ? 200  THR A O   1 
ATOM   1506 C CB  . THR A 1 200 ? -6.368  -53.997 21.177  1.00 70.12  ? 200  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 200 ? -7.777  -54.183 20.981  1.00 66.75  ? 200  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 200 ? -5.691  -55.367 21.285  1.00 66.01  ? 200  THR A CG2 1 
ATOM   1509 N N   . LYS A 1 201 ? -3.910  -52.450 21.767  1.00 57.39  ? 201  LYS A N   1 
ATOM   1510 C CA  . LYS A 1 201 ? -2.487  -52.266 21.939  1.00 52.33  ? 201  LYS A CA  1 
ATOM   1511 C C   . LYS A 1 201 ? -2.176  -51.648 23.293  1.00 53.32  ? 201  LYS A C   1 
ATOM   1512 O O   . LYS A 1 201 ? -1.267  -52.112 23.971  1.00 55.67  ? 201  LYS A O   1 
ATOM   1513 C CB  . LYS A 1 201 ? -1.937  -51.391 20.833  1.00 40.95  ? 201  LYS A CB  1 
ATOM   1514 C CG  . LYS A 1 201 ? -2.014  -52.043 19.490  1.00 56.17  ? 201  LYS A CG  1 
ATOM   1515 C CD  . LYS A 1 201 ? -1.117  -53.273 19.419  1.00 65.75  ? 201  LYS A CD  1 
ATOM   1516 C CE  . LYS A 1 201 ? -1.169  -53.903 18.026  1.00 73.41  ? 201  LYS A CE  1 
ATOM   1517 N NZ  . LYS A 1 201 ? -0.302  -55.113 17.872  1.00 83.19  ? 201  LYS A NZ  1 
ATOM   1518 N N   . ILE A 1 202 ? -2.929  -50.625 23.703  1.00 50.24  ? 202  ILE A N   1 
ATOM   1519 C CA  . ILE A 1 202 ? -2.668  -49.975 24.996  1.00 47.31  ? 202  ILE A CA  1 
ATOM   1520 C C   . ILE A 1 202 ? -2.579  -50.987 26.139  1.00 53.47  ? 202  ILE A C   1 
ATOM   1521 O O   . ILE A 1 202 ? -1.777  -50.828 27.061  1.00 51.98  ? 202  ILE A O   1 
ATOM   1522 C CB  . ILE A 1 202 ? -3.737  -48.912 25.338  1.00 45.13  ? 202  ILE A CB  1 
ATOM   1523 C CG1 . ILE A 1 202 ? -3.723  -47.794 24.284  1.00 45.20  ? 202  ILE A CG1 1 
ATOM   1524 C CG2 . ILE A 1 202 ? -3.452  -48.302 26.722  1.00 50.55  ? 202  ILE A CG2 1 
ATOM   1525 C CD1 . ILE A 1 202 ? -2.535  -46.834 24.393  1.00 43.35  ? 202  ILE A CD1 1 
ATOM   1526 N N   . GLU A 1 203 ? -3.401  -52.031 26.087  1.00 64.49  ? 203  GLU A N   1 
ATOM   1527 C CA  . GLU A 1 203 ? -3.331  -53.069 27.112  1.00 66.87  ? 203  GLU A CA  1 
ATOM   1528 C C   . GLU A 1 203 ? -2.105  -53.919 26.777  1.00 69.10  ? 203  GLU A C   1 
ATOM   1529 O O   . GLU A 1 203 ? -1.359  -54.307 27.673  1.00 74.73  ? 203  GLU A O   1 
ATOM   1530 C CB  . GLU A 1 203 ? -4.604  -53.920 27.118  1.00 62.64  ? 203  GLU A CB  1 
ATOM   1531 C CG  . GLU A 1 203 ? -5.853  -53.076 27.360  1.00 80.49  ? 203  GLU A CG  1 
ATOM   1532 C CD  . GLU A 1 203 ? -5.872  -52.409 28.744  1.00 88.04  ? 203  GLU A CD  1 
ATOM   1533 O OE1 . GLU A 1 203 ? -6.423  -51.278 28.862  1.00 83.91  ? 203  GLU A OE1 1 
ATOM   1534 O OE2 . GLU A 1 203 ? -5.349  -53.025 29.710  1.00 84.28  ? 203  GLU A OE2 1 
ATOM   1535 N N   . GLU A 1 204 ? -1.881  -54.186 25.487  1.00 64.89  ? 204  GLU A N   1 
ATOM   1536 C CA  . GLU A 1 204 ? -0.711  -54.964 25.076  1.00 65.92  ? 204  GLU A CA  1 
ATOM   1537 C C   . GLU A 1 204 ? 0.488   -54.311 25.718  1.00 67.43  ? 204  GLU A C   1 
ATOM   1538 O O   . GLU A 1 204 ? 1.444   -54.959 26.131  1.00 70.32  ? 204  GLU A O   1 
ATOM   1539 C CB  . GLU A 1 204 ? -0.509  -54.919 23.564  1.00 70.41  ? 204  GLU A CB  1 
ATOM   1540 C CG  . GLU A 1 204 ? -1.599  -55.573 22.747  1.00 83.54  ? 204  GLU A CG  1 
ATOM   1541 C CD  . GLU A 1 204 ? -1.123  -55.914 21.350  1.00 90.09  ? 204  GLU A CD  1 
ATOM   1542 O OE1 . GLU A 1 204 ? -1.929  -56.457 20.555  1.00 94.70  ? 204  GLU A OE1 1 
ATOM   1543 O OE2 . GLU A 1 204 ? 0.064   -55.635 21.060  1.00 91.01  ? 204  GLU A OE2 1 
ATOM   1544 N N   . LEU A 1 205 ? 0.408   -52.996 25.795  1.00 67.25  ? 205  LEU A N   1 
ATOM   1545 C CA  . LEU A 1 205 ? 1.465   -52.208 26.365  1.00 62.21  ? 205  LEU A CA  1 
ATOM   1546 C C   . LEU A 1 205 ? 1.490   -52.328 27.873  1.00 62.22  ? 205  LEU A C   1 
ATOM   1547 O O   . LEU A 1 205 ? 2.481   -52.787 28.435  1.00 64.03  ? 205  LEU A O   1 
ATOM   1548 C CB  . LEU A 1 205 ? 1.282   -50.756 25.969  1.00 57.19  ? 205  LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 205 ? 2.539   -49.894 25.941  1.00 50.26  ? 205  LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 205 ? 2.177   -48.556 26.599  1.00 59.29  ? 205  LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 205 ? 3.727   -50.592 26.665  1.00 39.53  ? 205  LEU A CD2 1 
ATOM   1552 N N   . ARG A 1 206 ? 0.412   -51.911 28.530  1.00 55.80  ? 206  ARG A N   1 
ATOM   1553 C CA  . ARG A 1 206 ? 0.360   -51.987 29.986  1.00 58.34  ? 206  ARG A CA  1 
ATOM   1554 C C   . ARG A 1 206 ? 0.894   -53.333 30.452  1.00 69.85  ? 206  ARG A C   1 
ATOM   1555 O O   . ARG A 1 206 ? 1.400   -53.450 31.573  1.00 72.83  ? 206  ARG A O   1 
ATOM   1556 C CB  . ARG A 1 206 ? -1.072  -51.808 30.498  1.00 54.12  ? 206  ARG A CB  1 
ATOM   1557 C CG  . ARG A 1 206 ? -1.645  -50.407 30.334  1.00 65.74  ? 206  ARG A CG  1 
ATOM   1558 C CD  . ARG A 1 206 ? -3.074  -50.330 30.849  1.00 64.86  ? 206  ARG A CD  1 
ATOM   1559 N NE  . ARG A 1 206 ? -3.158  -50.684 32.263  1.00 75.63  ? 206  ARG A NE  1 
ATOM   1560 C CZ  . ARG A 1 206 ? -4.249  -51.167 32.854  1.00 81.18  ? 206  ARG A CZ  1 
ATOM   1561 N NH1 . ARG A 1 206 ? -5.369  -51.364 32.155  1.00 90.85  ? 206  ARG A NH1 1 
ATOM   1562 N NH2 . ARG A 1 206 ? -4.220  -51.453 34.152  1.00 72.01  ? 206  ARG A NH2 1 
ATOM   1563 N N   . GLN A 1 207 ? 0.777   -54.345 29.588  1.00 76.97  ? 207  GLN A N   1 
ATOM   1564 C CA  . GLN A 1 207 ? 1.252   -55.692 29.903  1.00 82.57  ? 207  GLN A CA  1 
ATOM   1565 C C   . GLN A 1 207 ? 2.751   -55.738 29.850  1.00 82.58  ? 207  GLN A C   1 
ATOM   1566 O O   . GLN A 1 207 ? 3.410   -56.151 30.802  1.00 80.83  ? 207  GLN A O   1 
ATOM   1567 C CB  . GLN A 1 207 ? 0.698   -56.727 28.917  1.00 91.03  ? 207  GLN A CB  1 
ATOM   1568 C CG  . GLN A 1 207 ? -0.616  -57.331 29.364  1.00 104.95 ? 207  GLN A CG  1 
ATOM   1569 C CD  . GLN A 1 207 ? -0.596  -57.714 30.840  1.00 115.91 ? 207  GLN A CD  1 
ATOM   1570 O OE1 . GLN A 1 207 ? -1.646  -57.878 31.458  1.00 122.35 ? 207  GLN A OE1 1 
ATOM   1571 N NE2 . GLN A 1 207 ? 0.603   -57.858 31.410  1.00 116.10 ? 207  GLN A NE2 1 
ATOM   1572 N N   . HIS A 1 208 ? 3.273   -55.314 28.708  1.00 87.17  ? 208  HIS A N   1 
ATOM   1573 C CA  . HIS A 1 208 ? 4.702   -55.270 28.476  1.00 89.30  ? 208  HIS A CA  1 
ATOM   1574 C C   . HIS A 1 208 ? 5.339   -54.574 29.669  1.00 83.41  ? 208  HIS A C   1 
ATOM   1575 O O   . HIS A 1 208 ? 6.391   -54.977 30.125  1.00 80.72  ? 208  HIS A O   1 
ATOM   1576 C CB  . HIS A 1 208 ? 4.990   -54.482 27.199  1.00 95.92  ? 208  HIS A CB  1 
ATOM   1577 C CG  . HIS A 1 208 ? 6.388   -54.644 26.682  1.00 105.91 ? 208  HIS A CG  1 
ATOM   1578 N ND1 . HIS A 1 208 ? 6.811   -55.776 26.018  1.00 114.24 ? 208  HIS A ND1 1 
ATOM   1579 C CD2 . HIS A 1 208 ? 7.450   -53.802 26.700  1.00 110.04 ? 208  HIS A CD2 1 
ATOM   1580 C CE1 . HIS A 1 208 ? 8.070   -55.622 25.646  1.00 116.79 ? 208  HIS A CE1 1 
ATOM   1581 N NE2 . HIS A 1 208 ? 8.482   -54.433 26.047  1.00 110.64 ? 208  HIS A NE2 1 
ATOM   1582 N N   . LEU A 1 209 ? 4.680   -53.534 30.170  1.00 78.62  ? 209  LEU A N   1 
ATOM   1583 C CA  . LEU A 1 209 ? 5.173   -52.767 31.312  1.00 74.28  ? 209  LEU A CA  1 
ATOM   1584 C C   . LEU A 1 209 ? 4.937   -53.517 32.601  1.00 76.01  ? 209  LEU A C   1 
ATOM   1585 O O   . LEU A 1 209 ? 5.626   -53.301 33.594  1.00 79.79  ? 209  LEU A O   1 
ATOM   1586 C CB  . LEU A 1 209 ? 4.453   -51.425 31.402  1.00 73.52  ? 209  LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 209 ? 4.624   -50.522 30.188  1.00 64.57  ? 209  LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 209 ? 3.611   -49.383 30.217  1.00 59.58  ? 209  LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 209 ? 6.045   -50.006 30.180  1.00 56.84  ? 209  LEU A CD2 1 
ATOM   1590 N N   . LEU A 1 210 ? 3.946   -54.394 32.588  1.00 77.15  ? 210  LEU A N   1 
ATOM   1591 C CA  . LEU A 1 210 ? 3.640   -55.149 33.777  1.00 81.60  ? 210  LEU A CA  1 
ATOM   1592 C C   . LEU A 1 210 ? 4.625   -56.288 33.963  1.00 85.38  ? 210  LEU A C   1 
ATOM   1593 O O   . LEU A 1 210 ? 4.939   -56.665 35.090  1.00 81.89  ? 210  LEU A O   1 
ATOM   1594 C CB  . LEU A 1 210 ? 2.216   -55.674 33.716  1.00 81.50  ? 210  LEU A CB  1 
ATOM   1595 C CG  . LEU A 1 210 ? 1.671   -55.724 35.145  1.00 92.11  ? 210  LEU A CG  1 
ATOM   1596 C CD1 . LEU A 1 210 ? 1.905   -54.374 35.857  1.00 84.85  ? 210  LEU A CD1 1 
ATOM   1597 C CD2 . LEU A 1 210 ? 0.197   -56.074 35.103  1.00 97.83  ? 210  LEU A CD2 1 
ATOM   1598 N N   . ARG A 1 211 ? 5.122   -56.829 32.854  1.00 92.36  ? 211  ARG A N   1 
ATOM   1599 C CA  . ARG A 1 211 ? 6.096   -57.915 32.916  1.00 98.92  ? 211  ARG A CA  1 
ATOM   1600 C C   . ARG A 1 211 ? 7.327   -57.421 33.676  1.00 96.75  ? 211  ARG A C   1 
ATOM   1601 O O   . ARG A 1 211 ? 8.188   -58.205 34.084  1.00 98.25  ? 211  ARG A O   1 
ATOM   1602 C CB  . ARG A 1 211 ? 6.501   -58.380 31.503  1.00 111.10 ? 211  ARG A CB  1 
ATOM   1603 C CG  . ARG A 1 211 ? 5.365   -59.006 30.680  1.00 124.45 ? 211  ARG A CG  1 
ATOM   1604 C CD  . ARG A 1 211 ? 5.853   -59.569 29.336  1.00 134.93 ? 211  ARG A CD  1 
ATOM   1605 N NE  . ARG A 1 211 ? 6.692   -60.765 29.480  1.00 147.39 ? 211  ARG A NE  1 
ATOM   1606 C CZ  . ARG A 1 211 ? 7.233   -61.437 28.460  1.00 149.99 ? 211  ARG A CZ  1 
ATOM   1607 N NH1 . ARG A 1 211 ? 7.033   -61.039 27.209  1.00 149.99 ? 211  ARG A NH1 1 
ATOM   1608 N NH2 . ARG A 1 211 ? 7.982   -62.511 28.688  1.00 149.99 ? 211  ARG A NH2 1 
ATOM   1609 N N   . TRP A 1 212 ? 7.416   -56.111 33.856  1.00 91.70  ? 212  TRP A N   1 
ATOM   1610 C CA  . TRP A 1 212 ? 8.530   -55.550 34.593  1.00 87.64  ? 212  TRP A CA  1 
ATOM   1611 C C   . TRP A 1 212 ? 7.932   -54.851 35.790  1.00 88.78  ? 212  TRP A C   1 
ATOM   1612 O O   . TRP A 1 212 ? 8.507   -53.909 36.333  1.00 86.46  ? 212  TRP A O   1 
ATOM   1613 C CB  . TRP A 1 212 ? 9.301   -54.559 33.742  1.00 79.24  ? 212  TRP A CB  1 
ATOM   1614 C CG  . TRP A 1 212 ? 9.483   -55.001 32.330  1.00 80.13  ? 212  TRP A CG  1 
ATOM   1615 C CD1 . TRP A 1 212 ? 8.577   -54.890 31.322  1.00 84.17  ? 212  TRP A CD1 1 
ATOM   1616 C CD2 . TRP A 1 212 ? 10.672  -55.553 31.742  1.00 77.27  ? 212  TRP A CD2 1 
ATOM   1617 N NE1 . TRP A 1 212 ? 9.121   -55.324 30.127  1.00 79.96  ? 212  TRP A NE1 1 
ATOM   1618 C CE2 . TRP A 1 212 ? 10.407  -55.737 30.356  1.00 75.48  ? 212  TRP A CE2 1 
ATOM   1619 C CE3 . TRP A 1 212 ? 11.937  -55.906 32.247  1.00 69.57  ? 212  TRP A CE3 1 
ATOM   1620 C CZ2 . TRP A 1 212 ? 11.363  -56.255 29.466  1.00 69.79  ? 212  TRP A CZ2 1 
ATOM   1621 C CZ3 . TRP A 1 212 ? 12.892  -56.423 31.360  1.00 76.98  ? 212  TRP A CZ3 1 
ATOM   1622 C CH2 . TRP A 1 212 ? 12.595  -56.590 29.983  1.00 76.68  ? 212  TRP A CH2 1 
ATOM   1623 N N   . GLY A 1 213 ? 6.756   -55.329 36.183  1.00 90.49  ? 213  GLY A N   1 
ATOM   1624 C CA  . GLY A 1 213 ? 6.057   -54.779 37.327  1.00 96.73  ? 213  GLY A CA  1 
ATOM   1625 C C   . GLY A 1 213 ? 5.903   -53.272 37.318  1.00 100.48 ? 213  GLY A C   1 
ATOM   1626 O O   . GLY A 1 213 ? 6.185   -52.605 38.315  1.00 101.28 ? 213  GLY A O   1 
ATOM   1627 N N   . LEU A 1 214 ? 5.460   -52.722 36.195  1.00 103.64 ? 214  LEU A N   1 
ATOM   1628 C CA  . LEU A 1 214 ? 5.269   -51.283 36.103  1.00 104.13 ? 214  LEU A CA  1 
ATOM   1629 C C   . LEU A 1 214 ? 3.793   -50.971 35.986  1.00 98.86  ? 214  LEU A C   1 
ATOM   1630 O O   . LEU A 1 214 ? 3.181   -51.169 34.932  1.00 95.11  ? 214  LEU A O   1 
ATOM   1631 C CB  . LEU A 1 214 ? 6.050   -50.711 34.915  1.00 107.31 ? 214  LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 214 ? 7.537   -50.442 35.221  1.00 105.23 ? 214  LEU A CG  1 
ATOM   1633 C CD1 . LEU A 1 214 ? 8.291   -50.180 33.919  1.00 93.41  ? 214  LEU A CD1 1 
ATOM   1634 C CD2 . LEU A 1 214 ? 7.673   -49.252 36.207  1.00 103.53 ? 214  LEU A CD2 1 
ATOM   1635 N N   . TYR A 1 215 ? 3.223   -50.481 37.082  1.00 95.20  ? 215  TYR A N   1 
ATOM   1636 C CA  . TYR A 1 215 ? 1.813   -50.182 37.083  1.00 94.64  ? 215  TYR A CA  1 
ATOM   1637 C C   . TYR A 1 215 ? 1.376   -48.890 36.403  1.00 90.87  ? 215  TYR A C   1 
ATOM   1638 O O   . TYR A 1 215 ? 1.864   -47.786 36.686  1.00 90.79  ? 215  TYR A O   1 
ATOM   1639 C CB  . TYR A 1 215 ? 1.238   -50.235 38.501  1.00 99.77  ? 215  TYR A CB  1 
ATOM   1640 C CG  . TYR A 1 215 ? -0.249  -49.951 38.489  1.00 107.22 ? 215  TYR A CG  1 
ATOM   1641 C CD1 . TYR A 1 215 ? -0.736  -48.650 38.676  1.00 107.72 ? 215  TYR A CD1 1 
ATOM   1642 C CD2 . TYR A 1 215 ? -1.167  -50.953 38.153  1.00 107.93 ? 215  TYR A CD2 1 
ATOM   1643 C CE1 . TYR A 1 215 ? -2.104  -48.349 38.517  1.00 101.74 ? 215  TYR A CE1 1 
ATOM   1644 C CE2 . TYR A 1 215 ? -2.537  -50.664 37.989  1.00 103.04 ? 215  TYR A CE2 1 
ATOM   1645 C CZ  . TYR A 1 215 ? -2.999  -49.359 38.170  1.00 98.33  ? 215  TYR A CZ  1 
ATOM   1646 O OH  . TYR A 1 215 ? -4.341  -49.056 37.985  1.00 82.97  ? 215  TYR A OH  1 
ATOM   1647 N N   . THR A 1 216 ? 0.425   -49.086 35.498  1.00 86.07  ? 216  THR A N   1 
ATOM   1648 C CA  . THR A 1 216 ? -0.209  -48.051 34.708  1.00 84.42  ? 216  THR A CA  1 
ATOM   1649 C C   . THR A 1 216 ? -1.701  -48.274 34.934  1.00 83.31  ? 216  THR A C   1 
ATOM   1650 O O   . THR A 1 216 ? -2.163  -49.413 34.960  1.00 82.35  ? 216  THR A O   1 
ATOM   1651 C CB  . THR A 1 216 ? 0.096   -48.239 33.204  1.00 88.53  ? 216  THR A CB  1 
ATOM   1652 O OG1 . THR A 1 216 ? 0.147   -49.642 32.899  1.00 77.74  ? 216  THR A OG1 1 
ATOM   1653 C CG2 . THR A 1 216 ? 1.419   -47.586 32.833  1.00 92.09  ? 216  THR A CG2 1 
ATOM   1654 N N   . PRO A 1 217 ? -2.477  -47.195 35.104  1.00 79.95  ? 217  PRO A N   1 
ATOM   1655 C CA  . PRO A 1 217 ? -3.912  -47.371 35.324  1.00 78.68  ? 217  PRO A CA  1 
ATOM   1656 C C   . PRO A 1 217 ? -4.645  -47.905 34.091  1.00 83.91  ? 217  PRO A C   1 
ATOM   1657 O O   . PRO A 1 217 ? -4.174  -47.782 32.950  1.00 75.75  ? 217  PRO A O   1 
ATOM   1658 C CB  . PRO A 1 217 ? -4.369  -45.974 35.712  1.00 70.77  ? 217  PRO A CB  1 
ATOM   1659 C CG  . PRO A 1 217 ? -3.494  -45.109 34.861  1.00 65.73  ? 217  PRO A CG  1 
ATOM   1660 C CD  . PRO A 1 217 ? -2.132  -45.765 35.017  1.00 75.47  ? 217  PRO A CD  1 
ATOM   1661 N N   . ASP A 1 218 ? -5.808  -48.496 34.346  1.00 95.63  ? 218  ASP A N   1 
ATOM   1662 C CA  . ASP A 1 218 ? -6.667  -49.082 33.313  1.00 99.53  ? 218  ASP A CA  1 
ATOM   1663 C C   . ASP A 1 218 ? -7.540  -48.015 32.661  1.00 96.82  ? 218  ASP A C   1 
ATOM   1664 O O   . ASP A 1 218 ? -7.712  -46.913 33.209  1.00 94.25  ? 218  ASP A O   1 
ATOM   1665 C CB  . ASP A 1 218 ? -7.554  -50.154 33.943  1.00 102.57 ? 218  ASP A CB  1 
ATOM   1666 C CG  . ASP A 1 218 ? -8.300  -49.634 35.167  1.00 109.02 ? 218  ASP A CG  1 
ATOM   1667 O OD1 . ASP A 1 218 ? -7.644  -49.000 36.030  1.00 103.04 ? 218  ASP A OD1 1 
ATOM   1668 O OD2 . ASP A 1 218 ? -9.531  -49.855 35.268  1.00 115.66 ? 218  ASP A OD2 1 
ATOM   1669 N N   . LYS A 1 219 ? -8.111  -48.353 31.508  1.00 91.94  ? 219  LYS A N   1 
ATOM   1670 C CA  . LYS A 1 219 ? -8.937  -47.397 30.786  1.00 94.21  ? 219  LYS A CA  1 
ATOM   1671 C C   . LYS A 1 219 ? -10.000 -46.662 31.599  1.00 98.21  ? 219  LYS A C   1 
ATOM   1672 O O   . LYS A 1 219 ? -10.282 -45.488 31.337  1.00 96.61  ? 219  LYS A O   1 
ATOM   1673 C CB  . LYS A 1 219 ? -9.613  -48.055 29.596  1.00 90.65  ? 219  LYS A CB  1 
ATOM   1674 C CG  . LYS A 1 219 ? -10.542 -47.088 28.858  1.00 91.40  ? 219  LYS A CG  1 
ATOM   1675 C CD  . LYS A 1 219 ? -9.774  -45.869 28.351  1.00 94.81  ? 219  LYS A CD  1 
ATOM   1676 C CE  . LYS A 1 219 ? -10.686 -44.728 27.891  1.00 86.99  ? 219  LYS A CE  1 
ATOM   1677 N NZ  . LYS A 1 219 ? -11.549 -45.064 26.724  1.00 76.20  ? 219  LYS A NZ  1 
ATOM   1678 N N   . LYS A 1 220 ? -10.611 -47.340 32.565  1.00 106.36 ? 220  LYS A N   1 
ATOM   1679 C CA  . LYS A 1 220 ? -11.639 -46.688 33.380  1.00 114.95 ? 220  LYS A CA  1 
ATOM   1680 C C   . LYS A 1 220 ? -11.126 -45.367 33.965  1.00 111.07 ? 220  LYS A C   1 
ATOM   1681 O O   . LYS A 1 220 ? -11.797 -44.329 33.881  1.00 103.14 ? 220  LYS A O   1 
ATOM   1682 C CB  . LYS A 1 220 ? -12.081 -47.599 34.545  1.00 125.18 ? 220  LYS A CB  1 
ATOM   1683 C CG  . LYS A 1 220 ? -13.097 -48.705 34.210  1.00 129.14 ? 220  LYS A CG  1 
ATOM   1684 C CD  . LYS A 1 220 ? -14.537 -48.182 33.985  1.00 125.69 ? 220  LYS A CD  1 
ATOM   1685 C CE  . LYS A 1 220 ? -15.204 -47.565 35.236  1.00 118.49 ? 220  LYS A CE  1 
ATOM   1686 N NZ  . LYS A 1 220 ? -14.629 -46.250 35.653  1.00 103.43 ? 220  LYS A NZ  1 
ATOM   1687 N N   . HIS A 1 221 ? -9.914  -45.427 34.519  1.00 111.30 ? 221  HIS A N   1 
ATOM   1688 C CA  . HIS A 1 221 ? -9.275  -44.305 35.204  1.00 106.81 ? 221  HIS A CA  1 
ATOM   1689 C C   . HIS A 1 221 ? -8.314  -43.427 34.418  1.00 95.46  ? 221  HIS A C   1 
ATOM   1690 O O   . HIS A 1 221 ? -8.079  -42.282 34.807  1.00 88.88  ? 221  HIS A O   1 
ATOM   1691 C CB  . HIS A 1 221 ? -8.584  -44.853 36.447  1.00 116.10 ? 221  HIS A CB  1 
ATOM   1692 C CG  . HIS A 1 221 ? -9.458  -45.773 37.248  1.00 123.10 ? 221  HIS A CG  1 
ATOM   1693 N ND1 . HIS A 1 221 ? -9.019  -46.988 37.736  1.00 119.54 ? 221  HIS A ND1 1 
ATOM   1694 C CD2 . HIS A 1 221 ? -10.760 -45.669 37.616  1.00 123.23 ? 221  HIS A CD2 1 
ATOM   1695 C CE1 . HIS A 1 221 ? -10.013 -47.593 38.366  1.00 116.96 ? 221  HIS A CE1 1 
ATOM   1696 N NE2 . HIS A 1 221 ? -11.081 -46.815 38.307  1.00 122.35 ? 221  HIS A NE2 1 
ATOM   1697 N N   . GLN A 1 222 ? -7.753  -43.959 33.335  1.00 89.68  ? 222  GLN A N   1 
ATOM   1698 C CA  . GLN A 1 222 ? -6.844  -43.187 32.484  1.00 87.49  ? 222  GLN A CA  1 
ATOM   1699 C C   . GLN A 1 222 ? -7.450  -41.799 32.199  1.00 90.83  ? 222  GLN A C   1 
ATOM   1700 O O   . GLN A 1 222 ? -8.671  -41.624 32.259  1.00 93.43  ? 222  GLN A O   1 
ATOM   1701 C CB  . GLN A 1 222 ? -6.625  -43.912 31.153  1.00 70.28  ? 222  GLN A CB  1 
ATOM   1702 C CG  . GLN A 1 222 ? -5.952  -45.266 31.266  1.00 68.43  ? 222  GLN A CG  1 
ATOM   1703 C CD  . GLN A 1 222 ? -5.889  -45.977 29.926  1.00 65.49  ? 222  GLN A CD  1 
ATOM   1704 O OE1 . GLN A 1 222 ? -5.328  -47.083 29.799  1.00 63.91  ? 222  GLN A OE1 1 
ATOM   1705 N NE2 . GLN A 1 222 ? -6.469  -45.343 28.912  1.00 65.33  ? 222  GLN A NE2 1 
ATOM   1706 N N   . LYS A 1 223 ? -6.609  -40.813 31.894  1.00 87.00  ? 223  LYS A N   1 
ATOM   1707 C CA  . LYS A 1 223 ? -7.123  -39.478 31.605  1.00 82.30  ? 223  LYS A CA  1 
ATOM   1708 C C   . LYS A 1 223 ? -7.531  -39.348 30.138  1.00 83.54  ? 223  LYS A C   1 
ATOM   1709 O O   . LYS A 1 223 ? -6.906  -39.927 29.239  1.00 78.47  ? 223  LYS A O   1 
ATOM   1710 C CB  . LYS A 1 223 ? -6.086  -38.413 31.942  1.00 77.17  ? 223  LYS A CB  1 
ATOM   1711 C CG  . LYS A 1 223 ? -5.769  -38.263 33.418  1.00 75.01  ? 223  LYS A CG  1 
ATOM   1712 C CD  . LYS A 1 223 ? -4.750  -37.141 33.624  1.00 75.15  ? 223  LYS A CD  1 
ATOM   1713 C CE  . LYS A 1 223 ? -3.483  -37.430 32.830  1.00 91.92  ? 223  LYS A CE  1 
ATOM   1714 N NZ  . LYS A 1 223 ? -2.548  -36.284 32.782  1.00 103.59 ? 223  LYS A NZ  1 
ATOM   1715 N N   . GLU A 1 224 ? -8.580  -38.570 29.903  1.00 84.17  ? 224  GLU A N   1 
ATOM   1716 C CA  . GLU A 1 224 ? -9.090  -38.383 28.557  1.00 86.39  ? 224  GLU A CA  1 
ATOM   1717 C C   . GLU A 1 224 ? -8.740  -37.029 27.948  1.00 83.38  ? 224  GLU A C   1 
ATOM   1718 O O   . GLU A 1 224 ? -8.557  -36.047 28.675  1.00 83.47  ? 224  GLU A O   1 
ATOM   1719 C CB  . GLU A 1 224 ? -10.613 -38.572 28.551  1.00 94.72  ? 224  GLU A CB  1 
ATOM   1720 C CG  . GLU A 1 224 ? -11.065 -40.034 28.634  1.00 113.62 ? 224  GLU A CG  1 
ATOM   1721 C CD  . GLU A 1 224 ? -11.008 -40.767 27.291  1.00 122.38 ? 224  GLU A CD  1 
ATOM   1722 O OE1 . GLU A 1 224 ? -10.568 -41.939 27.275  1.00 119.21 ? 224  GLU A OE1 1 
ATOM   1723 O OE2 . GLU A 1 224 ? -11.414 -40.185 26.258  1.00 120.83 ? 224  GLU A OE2 1 
ATOM   1724 N N   . PRO A 1 225 ? -8.629  -36.976 26.595  1.00 80.76  ? 225  PRO A N   1 
ATOM   1725 C CA  . PRO A 1 225 ? -8.315  -35.810 25.747  1.00 75.42  ? 225  PRO A CA  1 
ATOM   1726 C C   . PRO A 1 225 ? -9.375  -34.718 25.924  1.00 74.72  ? 225  PRO A C   1 
ATOM   1727 O O   . PRO A 1 225 ? -10.511 -35.019 26.280  1.00 75.96  ? 225  PRO A O   1 
ATOM   1728 C CB  . PRO A 1 225 ? -8.355  -36.389 24.327  1.00 71.74  ? 225  PRO A CB  1 
ATOM   1729 C CG  . PRO A 1 225 ? -7.930  -37.816 24.525  1.00 73.00  ? 225  PRO A CG  1 
ATOM   1730 C CD  . PRO A 1 225 ? -8.690  -38.206 25.776  1.00 81.89  ? 225  PRO A CD  1 
ATOM   1731 N N   . PRO A 1 226 ? -9.034  -33.445 25.641  1.00 72.84  ? 226  PRO A N   1 
ATOM   1732 C CA  . PRO A 1 226 ? -7.728  -32.998 25.170  1.00 72.42  ? 226  PRO A CA  1 
ATOM   1733 C C   . PRO A 1 226 ? -6.736  -33.171 26.287  1.00 70.49  ? 226  PRO A C   1 
ATOM   1734 O O   . PRO A 1 226 ? -7.111  -33.428 27.419  1.00 72.06  ? 226  PRO A O   1 
ATOM   1735 C CB  . PRO A 1 226 ? -7.972  -31.538 24.840  1.00 69.30  ? 226  PRO A CB  1 
ATOM   1736 C CG  . PRO A 1 226 ? -8.882  -31.135 25.945  1.00 67.42  ? 226  PRO A CG  1 
ATOM   1737 C CD  . PRO A 1 226 ? -9.883  -32.279 25.944  1.00 75.35  ? 226  PRO A CD  1 
ATOM   1738 N N   . PHE A 1 227 ? -5.467  -33.032 25.959  1.00 73.85  ? 227  PHE A N   1 
ATOM   1739 C CA  . PHE A 1 227 ? -4.428  -33.190 26.943  1.00 75.39  ? 227  PHE A CA  1 
ATOM   1740 C C   . PHE A 1 227 ? -3.771  -31.854 27.202  1.00 81.45  ? 227  PHE A C   1 
ATOM   1741 O O   . PHE A 1 227 ? -3.168  -31.252 26.313  1.00 84.65  ? 227  PHE A O   1 
ATOM   1742 C CB  . PHE A 1 227 ? -3.423  -34.211 26.445  1.00 73.12  ? 227  PHE A CB  1 
ATOM   1743 C CG  . PHE A 1 227 ? -3.937  -35.627 26.476  1.00 80.91  ? 227  PHE A CG  1 
ATOM   1744 C CD1 . PHE A 1 227 ? -4.276  -36.229 27.694  1.00 82.14  ? 227  PHE A CD1 1 
ATOM   1745 C CD2 . PHE A 1 227 ? -4.033  -36.381 25.301  1.00 91.65  ? 227  PHE A CD2 1 
ATOM   1746 C CE1 . PHE A 1 227 ? -4.696  -37.570 27.751  1.00 86.15  ? 227  PHE A CE1 1 
ATOM   1747 C CE2 . PHE A 1 227 ? -4.452  -37.729 25.340  1.00 101.16 ? 227  PHE A CE2 1 
ATOM   1748 C CZ  . PHE A 1 227 ? -4.782  -38.325 26.571  1.00 98.71  ? 227  PHE A CZ  1 
ATOM   1749 N N   . LEU A 1 228 ? -3.915  -31.380 28.430  1.00 86.50  ? 228  LEU A N   1 
ATOM   1750 C CA  . LEU A 1 228 ? -3.341  -30.106 28.813  1.00 93.89  ? 228  LEU A CA  1 
ATOM   1751 C C   . LEU A 1 228 ? -1.919  -30.340 29.260  1.00 94.91  ? 228  LEU A C   1 
ATOM   1752 O O   . LEU A 1 228 ? -1.650  -30.720 30.404  1.00 96.18  ? 228  LEU A O   1 
ATOM   1753 C CB  . LEU A 1 228 ? -4.199  -29.488 29.900  1.00 98.63  ? 228  LEU A CB  1 
ATOM   1754 C CG  . LEU A 1 228 ? -5.552  -29.264 29.212  1.00 107.54 ? 228  LEU A CG  1 
ATOM   1755 C CD1 . LEU A 1 228 ? -6.668  -29.179 30.225  1.00 106.81 ? 228  LEU A CD1 1 
ATOM   1756 C CD2 . LEU A 1 228 ? -5.467  -28.007 28.342  1.00 107.31 ? 228  LEU A CD2 1 
ATOM   1757 N N   . TRP A 1 229 ? -1.013  -30.120 28.315  1.00 91.04  ? 229  TRP A N   1 
ATOM   1758 C CA  . TRP A 1 229 ? 0.394   -30.337 28.544  1.00 86.66  ? 229  TRP A CA  1 
ATOM   1759 C C   . TRP A 1 229 ? 1.206   -29.065 28.414  1.00 85.04  ? 229  TRP A C   1 
ATOM   1760 O O   . TRP A 1 229 ? 1.075   -28.329 27.419  1.00 77.10  ? 229  TRP A O   1 
ATOM   1761 C CB  . TRP A 1 229 ? 0.907   -31.392 27.558  1.00 89.56  ? 229  TRP A CB  1 
ATOM   1762 C CG  . TRP A 1 229 ? 2.367   -31.763 27.731  1.00 86.24  ? 229  TRP A CG  1 
ATOM   1763 C CD1 . TRP A 1 229 ? 2.943   -32.417 28.796  1.00 80.19  ? 229  TRP A CD1 1 
ATOM   1764 C CD2 . TRP A 1 229 ? 3.435   -31.462 26.826  1.00 76.01  ? 229  TRP A CD2 1 
ATOM   1765 N NE1 . TRP A 1 229 ? 4.302   -32.533 28.605  1.00 68.85  ? 229  TRP A NE1 1 
ATOM   1766 C CE2 . TRP A 1 229 ? 4.631   -31.955 27.407  1.00 76.69  ? 229  TRP A CE2 1 
ATOM   1767 C CE3 . TRP A 1 229 ? 3.498   -30.819 25.579  1.00 67.15  ? 229  TRP A CE3 1 
ATOM   1768 C CZ2 . TRP A 1 229 ? 5.881   -31.825 26.779  1.00 83.96  ? 229  TRP A CZ2 1 
ATOM   1769 C CZ3 . TRP A 1 229 ? 4.740   -30.689 24.951  1.00 63.75  ? 229  TRP A CZ3 1 
ATOM   1770 C CH2 . TRP A 1 229 ? 5.917   -31.190 25.554  1.00 75.18  ? 229  TRP A CH2 1 
ATOM   1771 N N   . MET A 1 230 ? 2.034   -28.834 29.439  1.00 82.46  ? 230  MET A N   1 
ATOM   1772 C CA  . MET A 1 230 ? 2.929   -27.689 29.515  1.00 82.41  ? 230  MET A CA  1 
ATOM   1773 C C   . MET A 1 230 ? 2.343   -26.442 28.873  1.00 87.05  ? 230  MET A C   1 
ATOM   1774 O O   . MET A 1 230 ? 2.968   -25.838 28.003  1.00 94.80  ? 230  MET A O   1 
ATOM   1775 C CB  . MET A 1 230 ? 4.250   -28.019 28.818  1.00 86.74  ? 230  MET A CB  1 
ATOM   1776 C CG  . MET A 1 230 ? 5.068   -29.132 29.458  1.00 92.64  ? 230  MET A CG  1 
ATOM   1777 S SD  . MET A 1 230 ? 6.252   -28.534 30.683  1.00 92.16  ? 230  MET A SD  1 
ATOM   1778 C CE  . MET A 1 230 ? 7.379   -27.583 29.632  1.00 78.73  ? 230  MET A CE  1 
ATOM   1779 N N   . GLY A 1 231 ? 1.142   -26.057 29.284  1.00 83.36  ? 231  GLY A N   1 
ATOM   1780 C CA  . GLY A 1 231 ? 0.539   -24.865 28.713  1.00 77.91  ? 231  GLY A CA  1 
ATOM   1781 C C   . GLY A 1 231 ? -0.050  -25.056 27.329  1.00 69.83  ? 231  GLY A C   1 
ATOM   1782 O O   . GLY A 1 231 ? -0.168  -24.116 26.560  1.00 63.07  ? 231  GLY A O   1 
ATOM   1783 N N   . TYR A 1 232 ? -0.431  -26.274 27.002  1.00 67.50  ? 232  TYR A N   1 
ATOM   1784 C CA  . TYR A 1 232 ? -1.005  -26.506 25.710  1.00 67.36  ? 232  TYR A CA  1 
ATOM   1785 C C   . TYR A 1 232 ? -2.237  -27.322 25.943  1.00 78.67  ? 232  TYR A C   1 
ATOM   1786 O O   . TYR A 1 232 ? -2.453  -27.810 27.051  1.00 83.96  ? 232  TYR A O   1 
ATOM   1787 C CB  . TYR A 1 232 ? -0.033  -27.280 24.856  1.00 65.37  ? 232  TYR A CB  1 
ATOM   1788 C CG  . TYR A 1 232 ? 1.209   -26.508 24.480  1.00 77.50  ? 232  TYR A CG  1 
ATOM   1789 C CD1 . TYR A 1 232 ? 2.477   -26.929 24.914  1.00 80.94  ? 232  TYR A CD1 1 
ATOM   1790 C CD2 . TYR A 1 232 ? 1.141   -25.429 23.589  1.00 71.18  ? 232  TYR A CD2 1 
ATOM   1791 C CE1 . TYR A 1 232 ? 3.665   -26.303 24.448  1.00 73.02  ? 232  TYR A CE1 1 
ATOM   1792 C CE2 . TYR A 1 232 ? 2.315   -24.791 23.119  1.00 75.19  ? 232  TYR A CE2 1 
ATOM   1793 C CZ  . TYR A 1 232 ? 3.574   -25.241 23.546  1.00 75.44  ? 232  TYR A CZ  1 
ATOM   1794 O OH  . TYR A 1 232 ? 4.726   -24.679 23.026  1.00 60.79  ? 232  TYR A OH  1 
ATOM   1795 N N   . GLU A 1 233 ? -3.049  -27.458 24.900  1.00 81.47  ? 233  GLU A N   1 
ATOM   1796 C CA  . GLU A 1 233 ? -4.281  -28.245 24.952  1.00 79.92  ? 233  GLU A CA  1 
ATOM   1797 C C   . GLU A 1 233 ? -4.196  -29.163 23.732  1.00 75.11  ? 233  GLU A C   1 
ATOM   1798 O O   . GLU A 1 233 ? -4.500  -28.775 22.601  1.00 76.38  ? 233  GLU A O   1 
ATOM   1799 C CB  . GLU A 1 233 ? -5.499  -27.315 24.887  1.00 90.50  ? 233  GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 233 ? -6.816  -27.965 25.320  1.00 104.84 ? 233  GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 233 ? -7.913  -26.952 25.649  1.00 108.10 ? 233  GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 233 ? -7.826  -26.295 26.716  1.00 105.96 ? 233  GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 233 ? -8.859  -26.815 24.834  1.00 107.07 ? 233  GLU A OE2 1 
ATOM   1804 N N   . LEU A 1 234 ? -3.787  -30.399 23.988  1.00 77.15  ? 234  LEU A N   1 
ATOM   1805 C CA  . LEU A 1 234 ? -3.548  -31.381 22.936  1.00 76.40  ? 234  LEU A CA  1 
ATOM   1806 C C   . LEU A 1 234 ? -4.569  -32.442 22.581  1.00 72.18  ? 234  LEU A C   1 
ATOM   1807 O O   . LEU A 1 234 ? -4.843  -33.365 23.351  1.00 57.09  ? 234  LEU A O   1 
ATOM   1808 C CB  . LEU A 1 234 ? -2.222  -32.082 23.235  1.00 75.21  ? 234  LEU A CB  1 
ATOM   1809 C CG  . LEU A 1 234 ? -1.140  -31.027 23.465  1.00 76.01  ? 234  LEU A CG  1 
ATOM   1810 C CD1 . LEU A 1 234 ? -0.030  -31.537 24.372  1.00 69.64  ? 234  LEU A CD1 1 
ATOM   1811 C CD2 . LEU A 1 234 ? -0.629  -30.587 22.099  1.00 83.93  ? 234  LEU A CD2 1 
ATOM   1812 N N   . HIS A 1 235 ? -5.111  -32.328 21.381  1.00 77.44  ? 235  HIS A N   1 
ATOM   1813 C CA  . HIS A 1 235 ? -6.040  -33.331 20.915  1.00 78.28  ? 235  HIS A CA  1 
ATOM   1814 C C   . HIS A 1 235 ? -5.154  -34.200 20.048  1.00 75.01  ? 235  HIS A C   1 
ATOM   1815 O O   . HIS A 1 235 ? -3.932  -34.064 20.082  1.00 75.77  ? 235  HIS A O   1 
ATOM   1816 C CB  . HIS A 1 235 ? -7.131  -32.669 20.094  1.00 80.46  ? 235  HIS A CB  1 
ATOM   1817 C CG  . HIS A 1 235 ? -8.059  -31.831 20.912  1.00 84.70  ? 235  HIS A CG  1 
ATOM   1818 N ND1 . HIS A 1 235 ? -9.199  -32.341 21.496  1.00 79.45  ? 235  HIS A ND1 1 
ATOM   1819 C CD2 . HIS A 1 235 ? -8.005  -30.523 21.262  1.00 87.91  ? 235  HIS A CD2 1 
ATOM   1820 C CE1 . HIS A 1 235 ? -9.810  -31.381 22.168  1.00 87.25  ? 235  HIS A CE1 1 
ATOM   1821 N NE2 . HIS A 1 235 ? -9.106  -30.268 22.042  1.00 90.51  ? 235  HIS A NE2 1 
ATOM   1822 N N   . PRO A 1 236 ? -5.742  -35.124 19.285  1.00 71.76  ? 236  PRO A N   1 
ATOM   1823 C CA  . PRO A 1 236 ? -4.880  -35.958 18.437  1.00 68.04  ? 236  PRO A CA  1 
ATOM   1824 C C   . PRO A 1 236 ? -4.900  -35.452 16.985  1.00 70.68  ? 236  PRO A C   1 
ATOM   1825 O O   . PRO A 1 236 ? -4.239  -36.011 16.109  1.00 69.57  ? 236  PRO A O   1 
ATOM   1826 C CB  . PRO A 1 236 ? -5.508  -37.353 18.559  1.00 64.94  ? 236  PRO A CB  1 
ATOM   1827 C CG  . PRO A 1 236 ? -6.536  -37.228 19.696  1.00 61.54  ? 236  PRO A CG  1 
ATOM   1828 C CD  . PRO A 1 236 ? -7.008  -35.815 19.561  1.00 66.56  ? 236  PRO A CD  1 
ATOM   1829 N N   . ASP A 1 237 ? -5.668  -34.390 16.744  1.00 74.76  ? 237  ASP A N   1 
ATOM   1830 C CA  . ASP A 1 237 ? -5.816  -33.818 15.403  1.00 75.20  ? 237  ASP A CA  1 
ATOM   1831 C C   . ASP A 1 237 ? -5.676  -32.306 15.386  1.00 77.05  ? 237  ASP A C   1 
ATOM   1832 O O   . ASP A 1 237 ? -5.562  -31.706 14.321  1.00 78.29  ? 237  ASP A O   1 
ATOM   1833 C CB  . ASP A 1 237 ? -7.189  -34.173 14.834  1.00 79.67  ? 237  ASP A CB  1 
ATOM   1834 C CG  . ASP A 1 237 ? -8.337  -33.669 15.713  1.00 82.42  ? 237  ASP A CG  1 
ATOM   1835 O OD1 . ASP A 1 237 ? -9.506  -33.739 15.273  1.00 93.60  ? 237  ASP A OD1 1 
ATOM   1836 O OD2 . ASP A 1 237 ? -8.079  -33.209 16.846  1.00 74.11  ? 237  ASP A OD2 1 
ATOM   1837 N N   . LYS A 1 238 ? -5.714  -31.689 16.562  1.00 77.37  ? 238  LYS A N   1 
ATOM   1838 C CA  . LYS A 1 238 ? -5.593  -30.242 16.660  1.00 76.01  ? 238  LYS A CA  1 
ATOM   1839 C C   . LYS A 1 238 ? -4.911  -29.837 17.964  1.00 76.54  ? 238  LYS A C   1 
ATOM   1840 O O   . LYS A 1 238 ? -4.839  -30.610 18.931  1.00 73.19  ? 238  LYS A O   1 
ATOM   1841 C CB  . LYS A 1 238 ? -6.976  -29.569 16.543  1.00 81.30  ? 238  LYS A CB  1 
ATOM   1842 C CG  . LYS A 1 238 ? -7.923  -29.781 17.741  1.00 97.45  ? 238  LYS A CG  1 
ATOM   1843 C CD  . LYS A 1 238 ? -9.377  -29.299 17.474  1.00 96.59  ? 238  LYS A CD  1 
ATOM   1844 C CE  . LYS A 1 238 ? -10.309 -29.614 18.665  1.00 95.55  ? 238  LYS A CE  1 
ATOM   1845 N NZ  . LYS A 1 238 ? -11.767 -29.412 18.400  1.00 95.51  ? 238  LYS A NZ  1 
ATOM   1846 N N   . TRP A 1 239 ? -4.412  -28.611 17.979  1.00 81.64  ? 239  TRP A N   1 
ATOM   1847 C CA  . TRP A 1 239 ? -3.718  -28.106 19.146  1.00 88.80  ? 239  TRP A CA  1 
ATOM   1848 C C   . TRP A 1 239 ? -3.877  -26.596 19.365  1.00 93.24  ? 239  TRP A C   1 
ATOM   1849 O O   . TRP A 1 239 ? -4.080  -25.830 18.417  1.00 93.64  ? 239  TRP A O   1 
ATOM   1850 C CB  . TRP A 1 239 ? -2.213  -28.437 19.042  1.00 97.63  ? 239  TRP A CB  1 
ATOM   1851 C CG  . TRP A 1 239 ? -1.337  -27.374 18.307  1.00 98.75  ? 239  TRP A CG  1 
ATOM   1852 C CD1 . TRP A 1 239 ? -1.102  -27.283 16.958  1.00 87.10  ? 239  TRP A CD1 1 
ATOM   1853 C CD2 . TRP A 1 239 ? -0.610  -26.276 18.912  1.00 95.06  ? 239  TRP A CD2 1 
ATOM   1854 N NE1 . TRP A 1 239 ? -0.281  -26.208 16.687  1.00 87.72  ? 239  TRP A NE1 1 
ATOM   1855 C CE2 . TRP A 1 239 ? 0.038   -25.573 17.862  1.00 91.14  ? 239  TRP A CE2 1 
ATOM   1856 C CE3 . TRP A 1 239 ? -0.445  -25.819 20.243  1.00 81.17  ? 239  TRP A CE3 1 
ATOM   1857 C CZ2 . TRP A 1 239 ? 0.843   -24.432 18.099  1.00 81.91  ? 239  TRP A CZ2 1 
ATOM   1858 C CZ3 . TRP A 1 239 ? 0.355   -24.683 20.486  1.00 51.20  ? 239  TRP A CZ3 1 
ATOM   1859 C CH2 . TRP A 1 239 ? 0.989   -24.005 19.413  1.00 70.54  ? 239  TRP A CH2 1 
ATOM   1860 N N   . THR A 1 240 ? -3.774  -26.191 20.632  1.00 95.49  ? 240  THR A N   1 
ATOM   1861 C CA  . THR A 1 240 ? -3.825  -24.788 21.047  1.00 92.67  ? 240  THR A CA  1 
ATOM   1862 C C   . THR A 1 240 ? -3.069  -24.718 22.386  1.00 95.79  ? 240  THR A C   1 
ATOM   1863 O O   . THR A 1 240 ? -2.428  -25.685 22.831  1.00 87.59  ? 240  THR A O   1 
ATOM   1864 C CB  . THR A 1 240 ? -5.320  -24.248 21.205  1.00 87.53  ? 240  THR A CB  1 
ATOM   1865 O OG1 . THR A 1 240 ? -5.319  -22.827 21.445  1.00 80.75  ? 240  THR A OG1 1 
ATOM   1866 C CG2 . THR A 1 240 ? -6.045  -24.948 22.354  1.00 91.35  ? 240  THR A CG2 1 
ATOM   1867 N N   . VAL A 1 241 ? -3.108  -23.552 23.004  1.00 106.65 ? 241  VAL A N   1 
ATOM   1868 C CA  . VAL A 1 241 ? -2.480  -23.365 24.295  1.00 117.62 ? 241  VAL A CA  1 
ATOM   1869 C C   . VAL A 1 241 ? -3.715  -23.259 25.158  1.00 122.94 ? 241  VAL A C   1 
ATOM   1870 O O   . VAL A 1 241 ? -4.717  -22.672 24.731  1.00 121.67 ? 241  VAL A O   1 
ATOM   1871 C CB  . VAL A 1 241 ? -1.691  -22.032 24.366  1.00 125.40 ? 241  VAL A CB  1 
ATOM   1872 C CG1 . VAL A 1 241 ? -0.464  -22.087 23.446  1.00 129.93 ? 241  VAL A CG1 1 
ATOM   1873 C CG2 . VAL A 1 241 ? -2.599  -20.866 23.964  1.00 128.69 ? 241  VAL A CG2 1 
ATOM   1874 N N   . GLN A 1 242 ? -3.674  -23.843 26.347  1.00 129.66 ? 242  GLN A N   1 
ATOM   1875 C CA  . GLN A 1 242 ? -4.835  -23.772 27.220  1.00 137.57 ? 242  GLN A CA  1 
ATOM   1876 C C   . GLN A 1 242 ? -5.350  -22.334 27.261  1.00 143.89 ? 242  GLN A C   1 
ATOM   1877 O O   . GLN A 1 242 ? -4.636  -21.425 27.703  1.00 146.32 ? 242  GLN A O   1 
ATOM   1878 C CB  . GLN A 1 242 ? -4.464  -24.261 28.614  1.00 136.62 ? 242  GLN A CB  1 
ATOM   1879 C CG  . GLN A 1 242 ? -3.152  -23.722 29.134  1.00 126.75 ? 242  GLN A CG  1 
ATOM   1880 C CD  . GLN A 1 242 ? -2.599  -24.591 30.240  1.00 123.23 ? 242  GLN A CD  1 
ATOM   1881 O OE1 . GLN A 1 242 ? -2.239  -25.755 30.014  1.00 117.03 ? 242  GLN A OE1 1 
ATOM   1882 N NE2 . GLN A 1 242 ? -2.539  -24.041 31.449  1.00 127.19 ? 242  GLN A NE2 1 
ATOM   1883 N N   . PRO A 1 243 ? -6.597  -22.112 26.781  1.00 147.17 ? 243  PRO A N   1 
ATOM   1884 C CA  . PRO A 1 243 ? -7.265  -20.800 26.728  1.00 145.03 ? 243  PRO A CA  1 
ATOM   1885 C C   . PRO A 1 243 ? -6.908  -19.801 27.849  1.00 137.39 ? 243  PRO A C   1 
ATOM   1886 O O   . PRO A 1 243 ? -6.624  -20.182 28.993  1.00 137.47 ? 243  PRO A O   1 
ATOM   1887 C CB  . PRO A 1 243 ? -8.742  -21.185 26.679  1.00 146.86 ? 243  PRO A CB  1 
ATOM   1888 C CG  . PRO A 1 243 ? -8.702  -22.401 25.772  1.00 139.26 ? 243  PRO A CG  1 
ATOM   1889 C CD  . PRO A 1 243 ? -7.520  -23.181 26.338  1.00 144.58 ? 243  PRO A CD  1 
ATOM   1890 N N   . ILE A 1 244 ? -6.935  -18.517 27.511  1.00 124.85 ? 244  ILE A N   1 
ATOM   1891 C CA  . ILE A 1 244 ? -6.555  -17.490 28.462  1.00 112.08 ? 244  ILE A CA  1 
ATOM   1892 C C   . ILE A 1 244 ? -7.566  -16.379 28.661  1.00 109.71 ? 244  ILE A C   1 
ATOM   1893 O O   . ILE A 1 244 ? -8.129  -15.836 27.698  1.00 101.59 ? 244  ILE A O   1 
ATOM   1894 C CB  . ILE A 1 244 ? -5.229  -16.890 28.036  1.00 97.98  ? 244  ILE A CB  1 
ATOM   1895 C CG1 . ILE A 1 244 ? -4.940  -15.615 28.819  1.00 96.18  ? 244  ILE A CG1 1 
ATOM   1896 C CG2 . ILE A 1 244 ? -5.284  -16.589 26.552  1.00 96.59  ? 244  ILE A CG2 1 
ATOM   1897 C CD1 . ILE A 1 244 ? -5.518  -14.341 28.173  1.00 92.68  ? 244  ILE A CD1 1 
ATOM   1898 N N   . VAL A 1 245 ? -7.746  -16.025 29.930  1.00 109.36 ? 245  VAL A N   1 
ATOM   1899 C CA  . VAL A 1 245 ? -8.693  -14.999 30.322  1.00 110.04 ? 245  VAL A CA  1 
ATOM   1900 C C   . VAL A 1 245 ? -8.059  -13.652 30.618  1.00 112.34 ? 245  VAL A C   1 
ATOM   1901 O O   . VAL A 1 245 ? -7.249  -13.523 31.543  1.00 109.33 ? 245  VAL A O   1 
ATOM   1902 C CB  . VAL A 1 245 ? -9.461  -15.426 31.570  1.00 105.18 ? 245  VAL A CB  1 
ATOM   1903 C CG1 . VAL A 1 245 ? -8.483  -15.632 32.738  1.00 99.45  ? 245  VAL A CG1 1 
ATOM   1904 C CG2 . VAL A 1 245 ? -10.524 -14.384 31.895  1.00 97.32  ? 245  VAL A CG2 1 
ATOM   1905 N N   . LEU A 1 246 ? -8.441  -12.648 29.836  1.00 110.17 ? 246  LEU A N   1 
ATOM   1906 C CA  . LEU A 1 246 ? -7.925  -11.305 30.044  1.00 106.51 ? 246  LEU A CA  1 
ATOM   1907 C C   . LEU A 1 246 ? -8.735  -10.589 31.103  1.00 108.70 ? 246  LEU A C   1 
ATOM   1908 O O   . LEU A 1 246 ? -9.937  -10.388 30.943  1.00 108.65 ? 246  LEU A O   1 
ATOM   1909 C CB  . LEU A 1 246 ? -7.988  -10.482 28.763  1.00 98.59  ? 246  LEU A CB  1 
ATOM   1910 C CG  . LEU A 1 246 ? -6.885  -10.720 27.748  1.00 94.06  ? 246  LEU A CG  1 
ATOM   1911 C CD1 . LEU A 1 246 ? -6.721  -9.462  26.891  1.00 94.73  ? 246  LEU A CD1 1 
ATOM   1912 C CD2 . LEU A 1 246 ? -5.592  -11.032 28.472  1.00 87.99  ? 246  LEU A CD2 1 
ATOM   1913 N N   . PRO A 1 247 ? -8.086  -10.191 32.204  1.00 108.89 ? 247  PRO A N   1 
ATOM   1914 C CA  . PRO A 1 247 ? -8.755  -9.484  33.299  1.00 108.68 ? 247  PRO A CA  1 
ATOM   1915 C C   . PRO A 1 247 ? -9.518  -8.265  32.812  1.00 110.79 ? 247  PRO A C   1 
ATOM   1916 O O   . PRO A 1 247 ? -9.282  -7.760  31.708  1.00 109.73 ? 247  PRO A O   1 
ATOM   1917 C CB  . PRO A 1 247 ? -7.599  -9.092  34.210  1.00 105.61 ? 247  PRO A CB  1 
ATOM   1918 C CG  . PRO A 1 247 ? -6.675  -10.249 34.061  1.00 106.15 ? 247  PRO A CG  1 
ATOM   1919 C CD  . PRO A 1 247 ? -6.687  -10.483 32.553  1.00 108.05 ? 247  PRO A CD  1 
ATOM   1920 N N   . GLU A 1 248 ? -10.443 -7.801  33.639  1.00 112.20 ? 248  GLU A N   1 
ATOM   1921 C CA  . GLU A 1 248 ? -11.205 -6.624  33.296  1.00 114.18 ? 248  GLU A CA  1 
ATOM   1922 C C   . GLU A 1 248 ? -11.047 -5.616  34.430  1.00 117.27 ? 248  GLU A C   1 
ATOM   1923 O O   . GLU A 1 248 ? -11.990 -4.905  34.751  1.00 128.00 ? 248  GLU A O   1 
ATOM   1924 C CB  . GLU A 1 248 ? -12.681 -6.978  33.090  1.00 112.07 ? 248  GLU A CB  1 
ATOM   1925 C CG  . GLU A 1 248 ? -13.498 -5.838  32.489  1.00 124.45 ? 248  GLU A CG  1 
ATOM   1926 C CD  . GLU A 1 248 ? -13.019 -5.440  31.100  1.00 132.94 ? 248  GLU A CD  1 
ATOM   1927 O OE1 . GLU A 1 248 ? -13.264 -6.205  30.144  1.00 149.92 ? 248  GLU A OE1 1 
ATOM   1928 O OE2 . GLU A 1 248 ? -12.389 -4.371  30.960  1.00 120.91 ? 248  GLU A OE2 1 
ATOM   1929 N N   . LYS A 1 249 ? -9.861  -5.561  35.042  1.00 114.27 ? 249  LYS A N   1 
ATOM   1930 C CA  . LYS A 1 249 ? -9.599  -4.615  36.138  1.00 111.22 ? 249  LYS A CA  1 
ATOM   1931 C C   . LYS A 1 249 ? -9.695  -3.174  35.651  1.00 116.67 ? 249  LYS A C   1 
ATOM   1932 O O   . LYS A 1 249 ? -9.759  -2.906  34.445  1.00 116.93 ? 249  LYS A O   1 
ATOM   1933 C CB  . LYS A 1 249 ? -8.185  -4.748  36.702  1.00 103.50 ? 249  LYS A CB  1 
ATOM   1934 C CG  . LYS A 1 249 ? -7.678  -6.113  37.049  1.00 93.52  ? 249  LYS A CG  1 
ATOM   1935 C CD  . LYS A 1 249 ? -6.377  -5.929  37.824  1.00 84.83  ? 249  LYS A CD  1 
ATOM   1936 C CE  . LYS A 1 249 ? -5.685  -7.238  38.132  1.00 87.04  ? 249  LYS A CE  1 
ATOM   1937 N NZ  . LYS A 1 249 ? -4.910  -7.738  36.969  1.00 91.27  ? 249  LYS A NZ  1 
ATOM   1938 N N   . ASP A 1 250 ? -9.666  -2.250  36.606  1.00 118.64 ? 250  ASP A N   1 
ATOM   1939 C CA  . ASP A 1 250 ? -9.707  -0.821  36.307  1.00 124.97 ? 250  ASP A CA  1 
ATOM   1940 C C   . ASP A 1 250 ? -8.454  -0.171  36.902  1.00 122.76 ? 250  ASP A C   1 
ATOM   1941 O O   . ASP A 1 250 ? -8.095  0.953   36.554  1.00 126.32 ? 250  ASP A O   1 
ATOM   1942 C CB  . ASP A 1 250 ? -10.997 -0.175  36.860  1.00 138.45 ? 250  ASP A CB  1 
ATOM   1943 C CG  . ASP A 1 250 ? -11.451 -0.783  38.184  1.00 150.00 ? 250  ASP A CG  1 
ATOM   1944 O OD1 . ASP A 1 250 ? -12.595 -0.481  38.612  1.00 149.99 ? 250  ASP A OD1 1 
ATOM   1945 O OD2 . ASP A 1 250 ? -10.666 -1.559  38.789  1.00 149.98 ? 250  ASP A OD2 1 
ATOM   1946 N N   . SER A 1 251 ? -7.785  -0.911  37.785  1.00 119.52 ? 251  SER A N   1 
ATOM   1947 C CA  . SER A 1 251 ? -6.555  -0.470  38.450  1.00 108.78 ? 251  SER A CA  1 
ATOM   1948 C C   . SER A 1 251 ? -5.467  -1.485  38.109  1.00 106.00 ? 251  SER A C   1 
ATOM   1949 O O   . SER A 1 251 ? -5.599  -2.673  38.436  1.00 104.38 ? 251  SER A O   1 
ATOM   1950 C CB  . SER A 1 251 ? -6.764  -0.443  39.970  1.00 97.58  ? 251  SER A CB  1 
ATOM   1951 O OG  . SER A 1 251 ? -5.562  -0.165  40.666  1.00 82.04  ? 251  SER A OG  1 
ATOM   1952 N N   . TRP A 1 252 ? -4.396  -1.040  37.457  1.00 99.23  ? 252  TRP A N   1 
ATOM   1953 C CA  . TRP A 1 252 ? -3.340  -1.983  37.115  1.00 90.29  ? 252  TRP A CA  1 
ATOM   1954 C C   . TRP A 1 252 ? -1.994  -1.758  37.797  1.00 86.62  ? 252  TRP A C   1 
ATOM   1955 O O   . TRP A 1 252 ? -1.422  -0.661  37.763  1.00 87.99  ? 252  TRP A O   1 
ATOM   1956 C CB  . TRP A 1 252 ? -3.153  -2.027  35.612  1.00 84.46  ? 252  TRP A CB  1 
ATOM   1957 C CG  . TRP A 1 252 ? -4.367  -2.510  34.890  1.00 98.28  ? 252  TRP A CG  1 
ATOM   1958 C CD1 . TRP A 1 252 ? -5.467  -1.773  34.548  1.00 104.39 ? 252  TRP A CD1 1 
ATOM   1959 C CD2 . TRP A 1 252 ? -4.592  -3.834  34.368  1.00 102.56 ? 252  TRP A CD2 1 
ATOM   1960 N NE1 . TRP A 1 252 ? -6.360  -2.551  33.837  1.00 107.48 ? 252  TRP A NE1 1 
ATOM   1961 C CE2 . TRP A 1 252 ? -5.850  -3.818  33.712  1.00 100.50 ? 252  TRP A CE2 1 
ATOM   1962 C CE3 . TRP A 1 252 ? -3.851  -5.028  34.385  1.00 100.57 ? 252  TRP A CE3 1 
ATOM   1963 C CZ2 . TRP A 1 252 ? -6.383  -4.952  33.076  1.00 94.98  ? 252  TRP A CZ2 1 
ATOM   1964 C CZ3 . TRP A 1 252 ? -4.383  -6.158  33.749  1.00 97.41  ? 252  TRP A CZ3 1 
ATOM   1965 C CH2 . TRP A 1 252 ? -5.640  -6.106  33.104  1.00 96.01  ? 252  TRP A CH2 1 
ATOM   1966 N N   . THR A 1 253 ? -1.500  -2.823  38.426  1.00 78.70  ? 253  THR A N   1 
ATOM   1967 C CA  . THR A 1 253 ? -0.230  -2.792  39.127  1.00 70.78  ? 253  THR A CA  1 
ATOM   1968 C C   . THR A 1 253 ? 0.899   -3.165  38.179  1.00 73.05  ? 253  THR A C   1 
ATOM   1969 O O   . THR A 1 253 ? 0.706   -3.900  37.206  1.00 73.52  ? 253  THR A O   1 
ATOM   1970 C CB  . THR A 1 253 ? -0.263  -3.755  40.346  1.00 57.30  ? 253  THR A CB  1 
ATOM   1971 O OG1 . THR A 1 253 ? -0.262  -2.979  41.545  1.00 58.90  ? 253  THR A OG1 1 
ATOM   1972 C CG2 . THR A 1 253 ? 0.926   -4.705  40.357  1.00 39.65  ? 253  THR A CG2 1 
ATOM   1973 N N   . VAL A 1 254 ? 2.080   -2.638  38.459  1.00 71.48  ? 254  VAL A N   1 
ATOM   1974 C CA  . VAL A 1 254 ? 3.238   -2.928  37.638  1.00 66.89  ? 254  VAL A CA  1 
ATOM   1975 C C   . VAL A 1 254 ? 3.357   -4.431  37.428  1.00 66.74  ? 254  VAL A C   1 
ATOM   1976 O O   . VAL A 1 254 ? 3.631   -4.915  36.324  1.00 67.79  ? 254  VAL A O   1 
ATOM   1977 C CB  . VAL A 1 254 ? 4.496   -2.411  38.321  1.00 58.60  ? 254  VAL A CB  1 
ATOM   1978 C CG1 . VAL A 1 254 ? 5.730   -2.929  37.618  1.00 43.81  ? 254  VAL A CG1 1 
ATOM   1979 C CG2 . VAL A 1 254 ? 4.480   -0.900  38.313  1.00 58.72  ? 254  VAL A CG2 1 
ATOM   1980 N N   . ASN A 1 255 ? 3.127   -5.170  38.501  1.00 62.22  ? 255  ASN A N   1 
ATOM   1981 C CA  . ASN A 1 255 ? 3.226   -6.607  38.428  1.00 59.65  ? 255  ASN A CA  1 
ATOM   1982 C C   . ASN A 1 255 ? 2.139   -7.173  37.545  1.00 58.66  ? 255  ASN A C   1 
ATOM   1983 O O   . ASN A 1 255 ? 2.388   -8.065  36.740  1.00 56.47  ? 255  ASN A O   1 
ATOM   1984 C CB  . ASN A 1 255 ? 3.145   -7.210  39.822  1.00 66.24  ? 255  ASN A CB  1 
ATOM   1985 C CG  . ASN A 1 255 ? 3.725   -8.602  39.867  1.00 80.40  ? 255  ASN A CG  1 
ATOM   1986 O OD1 . ASN A 1 255 ? 3.031   -9.590  39.615  1.00 90.64  ? 255  ASN A OD1 1 
ATOM   1987 N ND2 . ASN A 1 255 ? 5.021   -8.689  40.154  1.00 87.19  ? 255  ASN A ND2 1 
ATOM   1988 N N   . ASP A 1 256 ? 0.929   -6.653  37.700  1.00 60.20  ? 256  ASP A N   1 
ATOM   1989 C CA  . ASP A 1 256 ? -0.179  -7.116  36.887  1.00 68.97  ? 256  ASP A CA  1 
ATOM   1990 C C   . ASP A 1 256 ? 0.211   -7.039  35.411  1.00 69.30  ? 256  ASP A C   1 
ATOM   1991 O O   . ASP A 1 256 ? -0.020  -7.976  34.634  1.00 66.10  ? 256  ASP A O   1 
ATOM   1992 C CB  . ASP A 1 256 ? -1.423  -6.244  37.112  1.00 80.84  ? 256  ASP A CB  1 
ATOM   1993 C CG  . ASP A 1 256 ? -2.115  -6.530  38.424  1.00 82.42  ? 256  ASP A CG  1 
ATOM   1994 O OD1 . ASP A 1 256 ? -2.456  -7.703  38.672  1.00 80.37  ? 256  ASP A OD1 1 
ATOM   1995 O OD2 . ASP A 1 256 ? -2.328  -5.580  39.204  1.00 86.40  ? 256  ASP A OD2 1 
ATOM   1996 N N   . ILE A 1 257 ? 0.801   -5.908  35.033  1.00 67.06  ? 257  ILE A N   1 
ATOM   1997 C CA  . ILE A 1 257 ? 1.197   -5.683  33.653  1.00 67.95  ? 257  ILE A CA  1 
ATOM   1998 C C   . ILE A 1 257 ? 2.260   -6.657  33.213  1.00 69.77  ? 257  ILE A C   1 
ATOM   1999 O O   . ILE A 1 257 ? 2.207   -7.200  32.109  1.00 68.58  ? 257  ILE A O   1 
ATOM   2000 C CB  . ILE A 1 257 ? 1.722   -4.267  33.465  1.00 64.35  ? 257  ILE A CB  1 
ATOM   2001 C CG1 . ILE A 1 257 ? 0.640   -3.288  33.911  1.00 61.58  ? 257  ILE A CG1 1 
ATOM   2002 C CG2 . ILE A 1 257 ? 2.097   -4.032  31.993  1.00 64.00  ? 257  ILE A CG2 1 
ATOM   2003 C CD1 . ILE A 1 257 ? 1.053   -1.829  33.891  1.00 58.48  ? 257  ILE A CD1 1 
ATOM   2004 N N   . GLN A 1 258 ? 3.238   -6.876  34.075  1.00 67.55  ? 258  GLN A N   1 
ATOM   2005 C CA  . GLN A 1 258 ? 4.284   -7.800  33.726  1.00 69.48  ? 258  GLN A CA  1 
ATOM   2006 C C   . GLN A 1 258 ? 3.665   -9.142  33.420  1.00 71.36  ? 258  GLN A C   1 
ATOM   2007 O O   . GLN A 1 258 ? 3.915   -9.734  32.366  1.00 76.20  ? 258  GLN A O   1 
ATOM   2008 C CB  . GLN A 1 258 ? 5.267   -7.935  34.871  1.00 74.91  ? 258  GLN A CB  1 
ATOM   2009 C CG  . GLN A 1 258 ? 6.040   -6.682  35.113  1.00 70.17  ? 258  GLN A CG  1 
ATOM   2010 C CD  . GLN A 1 258 ? 7.276   -6.954  35.920  1.00 74.91  ? 258  GLN A CD  1 
ATOM   2011 O OE1 . GLN A 1 258 ? 7.197   -7.393  37.073  1.00 80.27  ? 258  GLN A OE1 1 
ATOM   2012 N NE2 . GLN A 1 258 ? 8.438   -6.710  35.319  1.00 69.80  ? 258  GLN A NE2 1 
ATOM   2013 N N   . LYS A 1 259 ? 2.846   -9.623  34.346  1.00 71.91  ? 259  LYS A N   1 
ATOM   2014 C CA  . LYS A 1 259 ? 2.209   -10.909 34.156  1.00 73.15  ? 259  LYS A CA  1 
ATOM   2015 C C   . LYS A 1 259 ? 1.419   -10.934 32.848  1.00 71.89  ? 259  LYS A C   1 
ATOM   2016 O O   . LYS A 1 259 ? 1.565   -11.866 32.050  1.00 69.37  ? 259  LYS A O   1 
ATOM   2017 C CB  . LYS A 1 259 ? 1.307   -11.226 35.343  1.00 79.50  ? 259  LYS A CB  1 
ATOM   2018 C CG  . LYS A 1 259 ? 2.036   -11.824 36.537  1.00 99.19  ? 259  LYS A CG  1 
ATOM   2019 C CD  . LYS A 1 259 ? 1.022   -12.324 37.562  1.00 121.62 ? 259  LYS A CD  1 
ATOM   2020 C CE  . LYS A 1 259 ? 1.484   -13.587 38.289  1.00 130.99 ? 259  LYS A CE  1 
ATOM   2021 N NZ  . LYS A 1 259 ? 0.403   -14.179 39.149  1.00 133.23 ? 259  LYS A NZ  1 
ATOM   2022 N N   . LEU A 1 260 ? 0.603   -9.904  32.618  1.00 73.35  ? 260  LEU A N   1 
ATOM   2023 C CA  . LEU A 1 260 ? -0.193  -9.822  31.390  1.00 77.30  ? 260  LEU A CA  1 
ATOM   2024 C C   . LEU A 1 260 ? 0.700   -9.945  30.149  1.00 75.63  ? 260  LEU A C   1 
ATOM   2025 O O   . LEU A 1 260 ? 0.529   -10.847 29.321  1.00 72.49  ? 260  LEU A O   1 
ATOM   2026 C CB  . LEU A 1 260 ? -0.963  -8.498  31.323  1.00 77.32  ? 260  LEU A CB  1 
ATOM   2027 C CG  . LEU A 1 260 ? -1.795  -8.369  30.031  1.00 80.11  ? 260  LEU A CG  1 
ATOM   2028 C CD1 . LEU A 1 260 ? -2.885  -9.446  30.019  1.00 83.66  ? 260  LEU A CD1 1 
ATOM   2029 C CD2 . LEU A 1 260 ? -2.422  -6.986  29.927  1.00 83.76  ? 260  LEU A CD2 1 
ATOM   2030 N N   . VAL A 1 261 ? 1.649   -9.027  30.024  1.00 69.89  ? 261  VAL A N   1 
ATOM   2031 C CA  . VAL A 1 261 ? 2.563   -9.067  28.908  1.00 63.18  ? 261  VAL A CA  1 
ATOM   2032 C C   . VAL A 1 261 ? 3.013   -10.512 28.749  1.00 63.56  ? 261  VAL A C   1 
ATOM   2033 O O   . VAL A 1 261 ? 2.863   -11.105 27.673  1.00 53.80  ? 261  VAL A O   1 
ATOM   2034 C CB  . VAL A 1 261 ? 3.765   -8.159  29.180  1.00 57.35  ? 261  VAL A CB  1 
ATOM   2035 C CG1 . VAL A 1 261 ? 4.920   -8.546  28.289  1.00 62.94  ? 261  VAL A CG1 1 
ATOM   2036 C CG2 . VAL A 1 261 ? 3.366   -6.707  28.924  1.00 57.04  ? 261  VAL A CG2 1 
ATOM   2037 N N   . GLY A 1 262 ? 3.537   -11.071 29.841  1.00 62.90  ? 262  GLY A N   1 
ATOM   2038 C CA  . GLY A 1 262 ? 3.999   -12.446 29.830  1.00 61.80  ? 262  GLY A CA  1 
ATOM   2039 C C   . GLY A 1 262 ? 2.999   -13.327 29.114  1.00 65.52  ? 262  GLY A C   1 
ATOM   2040 O O   . GLY A 1 262 ? 3.255   -13.829 28.014  1.00 61.65  ? 262  GLY A O   1 
ATOM   2041 N N   . LYS A 1 263 ? 1.842   -13.505 29.741  1.00 66.64  ? 263  LYS A N   1 
ATOM   2042 C CA  . LYS A 1 263 ? 0.782   -14.322 29.165  1.00 62.72  ? 263  LYS A CA  1 
ATOM   2043 C C   . LYS A 1 263 ? 0.576   -14.005 27.685  1.00 57.09  ? 263  LYS A C   1 
ATOM   2044 O O   . LYS A 1 263 ? 0.570   -14.901 26.849  1.00 55.60  ? 263  LYS A O   1 
ATOM   2045 C CB  . LYS A 1 263 ? -0.528  -14.094 29.916  1.00 55.36  ? 263  LYS A CB  1 
ATOM   2046 C CG  . LYS A 1 263 ? -0.785  -15.008 31.112  1.00 61.66  ? 263  LYS A CG  1 
ATOM   2047 C CD  . LYS A 1 263 ? -2.248  -14.819 31.542  1.00 90.83  ? 263  LYS A CD  1 
ATOM   2048 C CE  . LYS A 1 263 ? -2.754  -15.809 32.595  1.00 113.93 ? 263  LYS A CE  1 
ATOM   2049 N NZ  . LYS A 1 263 ? -4.234  -15.614 32.869  1.00 122.48 ? 263  LYS A NZ  1 
ATOM   2050 N N   . LEU A 1 264 ? 0.422   -12.725 27.365  1.00 59.85  ? 264  LEU A N   1 
ATOM   2051 C CA  . LEU A 1 264 ? 0.205   -12.295 25.980  1.00 64.55  ? 264  LEU A CA  1 
ATOM   2052 C C   . LEU A 1 264 ? 1.215   -12.926 25.013  1.00 62.37  ? 264  LEU A C   1 
ATOM   2053 O O   . LEU A 1 264 ? 0.852   -13.405 23.931  1.00 51.53  ? 264  LEU A O   1 
ATOM   2054 C CB  . LEU A 1 264 ? 0.254   -10.754 25.897  1.00 75.62  ? 264  LEU A CB  1 
ATOM   2055 C CG  . LEU A 1 264 ? -1.001  -9.935  25.494  1.00 77.96  ? 264  LEU A CG  1 
ATOM   2056 C CD1 . LEU A 1 264 ? -2.277  -10.776 25.492  1.00 67.37  ? 264  LEU A CD1 1 
ATOM   2057 C CD2 . LEU A 1 264 ? -1.141  -8.757  26.454  1.00 79.94  ? 264  LEU A CD2 1 
ATOM   2058 N N   . ASN A 1 265 ? 2.485   -12.930 25.406  1.00 68.10  ? 265  ASN A N   1 
ATOM   2059 C CA  . ASN A 1 265 ? 3.515   -13.529 24.569  1.00 65.37  ? 265  ASN A CA  1 
ATOM   2060 C C   . ASN A 1 265 ? 3.133   -14.950 24.205  1.00 55.85  ? 265  ASN A C   1 
ATOM   2061 O O   . ASN A 1 265 ? 2.878   -15.291 23.039  1.00 54.68  ? 265  ASN A O   1 
ATOM   2062 C CB  . ASN A 1 265 ? 4.837   -13.555 25.313  1.00 75.87  ? 265  ASN A CB  1 
ATOM   2063 C CG  . ASN A 1 265 ? 5.626   -12.313 25.094  1.00 89.05  ? 265  ASN A CG  1 
ATOM   2064 O OD1 . ASN A 1 265 ? 5.127   -11.204 25.309  1.00 76.82  ? 265  ASN A OD1 1 
ATOM   2065 N ND2 . ASN A 1 265 ? 6.874   -12.478 24.654  1.00 103.14 ? 265  ASN A ND2 1 
ATOM   2066 N N   . TRP A 1 266 ? 3.103   -15.777 25.231  1.00 45.71  ? 266  TRP A N   1 
ATOM   2067 C CA  . TRP A 1 266 ? 2.769   -17.155 25.043  1.00 57.43  ? 266  TRP A CA  1 
ATOM   2068 C C   . TRP A 1 266 ? 1.763   -17.371 23.918  1.00 59.83  ? 266  TRP A C   1 
ATOM   2069 O O   . TRP A 1 266 ? 1.839   -18.351 23.167  1.00 66.87  ? 266  TRP A O   1 
ATOM   2070 C CB  . TRP A 1 266 ? 2.210   -17.705 26.331  1.00 60.02  ? 266  TRP A CB  1 
ATOM   2071 C CG  . TRP A 1 266 ? 1.815   -19.110 26.193  1.00 56.92  ? 266  TRP A CG  1 
ATOM   2072 C CD1 . TRP A 1 266 ? 0.548   -19.599 26.171  1.00 49.87  ? 266  TRP A CD1 1 
ATOM   2073 C CD2 . TRP A 1 266 ? 2.697   -20.246 26.136  1.00 62.19  ? 266  TRP A CD2 1 
ATOM   2074 N NE1 . TRP A 1 266 ? 0.578   -20.974 26.123  1.00 66.82  ? 266  TRP A NE1 1 
ATOM   2075 C CE2 . TRP A 1 266 ? 1.882   -21.401 26.103  1.00 65.52  ? 266  TRP A CE2 1 
ATOM   2076 C CE3 . TRP A 1 266 ? 4.104   -20.400 26.119  1.00 55.81  ? 266  TRP A CE3 1 
ATOM   2077 C CZ2 . TRP A 1 266 ? 2.421   -22.713 26.060  1.00 65.50  ? 266  TRP A CZ2 1 
ATOM   2078 C CZ3 . TRP A 1 266 ? 4.650   -21.711 26.075  1.00 51.80  ? 266  TRP A CZ3 1 
ATOM   2079 C CH2 . TRP A 1 266 ? 3.800   -22.845 26.048  1.00 60.19  ? 266  TRP A CH2 1 
ATOM   2080 N N   . ALA A 1 267 ? 0.826   -16.446 23.798  1.00 59.28  ? 267  ALA A N   1 
ATOM   2081 C CA  . ALA A 1 267 ? -0.219  -16.545 22.782  1.00 67.29  ? 267  ALA A CA  1 
ATOM   2082 C C   . ALA A 1 267 ? 0.286   -16.518 21.358  1.00 63.14  ? 267  ALA A C   1 
ATOM   2083 O O   . ALA A 1 267 ? -0.130  -17.309 20.494  1.00 57.53  ? 267  ALA A O   1 
ATOM   2084 C CB  . ALA A 1 267 ? -1.190  -15.419 22.969  1.00 78.15  ? 267  ALA A CB  1 
ATOM   2085 N N   . SER A 1 268 ? 1.170   -15.563 21.141  1.00 52.37  ? 268  SER A N   1 
ATOM   2086 C CA  . SER A 1 268 ? 1.764   -15.314 19.867  1.00 51.07  ? 268  SER A CA  1 
ATOM   2087 C C   . SER A 1 268 ? 2.207   -16.506 19.058  1.00 58.06  ? 268  SER A C   1 
ATOM   2088 O O   . SER A 1 268 ? 2.242   -16.437 17.833  1.00 57.72  ? 268  SER A O   1 
ATOM   2089 C CB  . SER A 1 268 ? 2.893   -14.375 20.109  1.00 47.28  ? 268  SER A CB  1 
ATOM   2090 O OG  . SER A 1 268 ? 2.359   -13.339 20.914  1.00 52.04  ? 268  SER A OG  1 
ATOM   2091 N N   . GLN A 1 269 ? 2.527   -17.612 19.709  1.00 64.07  ? 269  GLN A N   1 
ATOM   2092 C CA  . GLN A 1 269 ? 2.952   -18.766 18.933  1.00 73.28  ? 269  GLN A CA  1 
ATOM   2093 C C   . GLN A 1 269 ? 1.801   -19.360 18.119  1.00 78.22  ? 269  GLN A C   1 
ATOM   2094 O O   . GLN A 1 269 ? 2.007   -20.228 17.250  1.00 75.59  ? 269  GLN A O   1 
ATOM   2095 C CB  . GLN A 1 269 ? 3.589   -19.820 19.836  1.00 73.15  ? 269  GLN A CB  1 
ATOM   2096 C CG  . GLN A 1 269 ? 2.650   -20.601 20.698  1.00 74.96  ? 269  GLN A CG  1 
ATOM   2097 C CD  . GLN A 1 269 ? 3.415   -21.426 21.705  1.00 73.57  ? 269  GLN A CD  1 
ATOM   2098 O OE1 . GLN A 1 269 ? 4.375   -22.133 21.364  1.00 68.99  ? 269  GLN A OE1 1 
ATOM   2099 N NE2 . GLN A 1 269 ? 3.004   -21.336 22.959  1.00 66.44  ? 269  GLN A NE2 1 
ATOM   2100 N N   . ILE A 1 270 ? 0.589   -18.884 18.394  1.00 82.28  ? 270  ILE A N   1 
ATOM   2101 C CA  . ILE A 1 270 ? -0.577  -19.349 17.650  1.00 81.64  ? 270  ILE A CA  1 
ATOM   2102 C C   . ILE A 1 270 ? -1.544  -18.228 17.300  1.00 78.18  ? 270  ILE A C   1 
ATOM   2103 O O   . ILE A 1 270 ? -1.989  -18.136 16.150  1.00 73.88  ? 270  ILE A O   1 
ATOM   2104 C CB  . ILE A 1 270 ? -1.361  -20.444 18.399  1.00 81.87  ? 270  ILE A CB  1 
ATOM   2105 C CG1 . ILE A 1 270 ? -2.267  -21.175 17.400  1.00 89.76  ? 270  ILE A CG1 1 
ATOM   2106 C CG2 . ILE A 1 270 ? -2.200  -19.840 19.527  1.00 53.64  ? 270  ILE A CG2 1 
ATOM   2107 C CD1 . ILE A 1 270 ? -1.505  -21.845 16.237  1.00 81.57  ? 270  ILE A CD1 1 
ATOM   2108 N N   . TYR A 1 271 ? -1.874  -17.389 18.286  1.00 74.12  ? 271  TYR A N   1 
ATOM   2109 C CA  . TYR A 1 271 ? -2.784  -16.276 18.054  1.00 69.44  ? 271  TYR A CA  1 
ATOM   2110 C C   . TYR A 1 271 ? -2.046  -15.166 17.338  1.00 73.85  ? 271  TYR A C   1 
ATOM   2111 O O   . TYR A 1 271 ? -1.147  -14.536 17.901  1.00 69.50  ? 271  TYR A O   1 
ATOM   2112 C CB  . TYR A 1 271 ? -3.361  -15.750 19.361  1.00 63.57  ? 271  TYR A CB  1 
ATOM   2113 C CG  . TYR A 1 271 ? -4.507  -16.577 19.906  1.00 70.14  ? 271  TYR A CG  1 
ATOM   2114 C CD1 . TYR A 1 271 ? -5.817  -16.377 19.470  1.00 66.50  ? 271  TYR A CD1 1 
ATOM   2115 C CD2 . TYR A 1 271 ? -4.278  -17.570 20.852  1.00 75.82  ? 271  TYR A CD2 1 
ATOM   2116 C CE1 . TYR A 1 271 ? -6.862  -17.150 19.969  1.00 65.72  ? 271  TYR A CE1 1 
ATOM   2117 C CE2 . TYR A 1 271 ? -5.311  -18.344 21.350  1.00 67.36  ? 271  TYR A CE2 1 
ATOM   2118 C CZ  . TYR A 1 271 ? -6.592  -18.132 20.906  1.00 66.05  ? 271  TYR A CZ  1 
ATOM   2119 O OH  . TYR A 1 271 ? -7.582  -18.945 21.387  1.00 75.76  ? 271  TYR A OH  1 
ATOM   2120 N N   . PRO A 1 272 ? -2.413  -14.927 16.066  1.00 78.85  ? 272  PRO A N   1 
ATOM   2121 C CA  . PRO A 1 272 ? -1.834  -13.906 15.195  1.00 73.43  ? 272  PRO A CA  1 
ATOM   2122 C C   . PRO A 1 272 ? -2.436  -12.557 15.557  1.00 66.49  ? 272  PRO A C   1 
ATOM   2123 O O   . PRO A 1 272 ? -3.629  -12.476 15.837  1.00 71.50  ? 272  PRO A O   1 
ATOM   2124 C CB  . PRO A 1 272 ? -2.293  -14.334 13.795  1.00 77.75  ? 272  PRO A CB  1 
ATOM   2125 C CG  . PRO A 1 272 ? -3.005  -15.674 13.983  1.00 70.11  ? 272  PRO A CG  1 
ATOM   2126 C CD  . PRO A 1 272 ? -3.516  -15.611 15.369  1.00 78.31  ? 272  PRO A CD  1 
ATOM   2127 N N   . GLY A 1 273 ? -1.623  -11.505 15.559  1.00 65.45  ? 273  GLY A N   1 
ATOM   2128 C CA  . GLY A 1 273 ? -2.147  -10.176 15.847  1.00 67.07  ? 273  GLY A CA  1 
ATOM   2129 C C   . GLY A 1 273 ? -1.962  -9.629  17.248  1.00 70.16  ? 273  GLY A C   1 
ATOM   2130 O O   . GLY A 1 273 ? -2.293  -8.475  17.519  1.00 69.34  ? 273  GLY A O   1 
ATOM   2131 N N   . ILE A 1 274 ? -1.447  -10.447 18.151  1.00 71.70  ? 274  ILE A N   1 
ATOM   2132 C CA  . ILE A 1 274 ? -1.218  -9.983  19.505  1.00 69.84  ? 274  ILE A CA  1 
ATOM   2133 C C   . ILE A 1 274 ? -0.103  -8.940  19.534  1.00 63.73  ? 274  ILE A C   1 
ATOM   2134 O O   . ILE A 1 274 ? 1.002   -9.169  19.024  1.00 67.50  ? 274  ILE A O   1 
ATOM   2135 C CB  . ILE A 1 274 ? -0.824  -11.144 20.412  1.00 78.05  ? 274  ILE A CB  1 
ATOM   2136 C CG1 . ILE A 1 274 ? -1.995  -12.115 20.525  1.00 86.83  ? 274  ILE A CG1 1 
ATOM   2137 C CG2 . ILE A 1 274 ? -0.391  -10.620 21.770  1.00 74.26  ? 274  ILE A CG2 1 
ATOM   2138 C CD1 . ILE A 1 274 ? -3.219  -11.534 21.232  1.00 97.55  ? 274  ILE A CD1 1 
ATOM   2139 N N   . LYS A 1 275 ? -0.402  -7.790  20.122  1.00 60.01  ? 275  LYS A N   1 
ATOM   2140 C CA  . LYS A 1 275 ? 0.577   -6.714  20.235  1.00 63.31  ? 275  LYS A CA  1 
ATOM   2141 C C   . LYS A 1 275 ? 0.684   -6.332  21.696  1.00 66.37  ? 275  LYS A C   1 
ATOM   2142 O O   . LYS A 1 275 ? -0.280  -6.459  22.441  1.00 66.47  ? 275  LYS A O   1 
ATOM   2143 C CB  . LYS A 1 275 ? 0.148   -5.506  19.407  1.00 60.95  ? 275  LYS A CB  1 
ATOM   2144 C CG  . LYS A 1 275 ? 0.279   -5.742  17.922  1.00 66.33  ? 275  LYS A CG  1 
ATOM   2145 C CD  . LYS A 1 275 ? -0.192  -4.545  17.094  1.00 78.96  ? 275  LYS A CD  1 
ATOM   2146 C CE  . LYS A 1 275 ? -1.550  -4.810  16.434  1.00 82.40  ? 275  LYS A CE  1 
ATOM   2147 N NZ  . LYS A 1 275 ? -1.989  -3.706  15.529  1.00 77.21  ? 275  LYS A NZ  1 
ATOM   2148 N N   . VAL A 1 276 ? 1.850   -5.872  22.122  1.00 70.96  ? 276  VAL A N   1 
ATOM   2149 C CA  . VAL A 1 276 ? 2.009   -5.500  23.527  1.00 77.50  ? 276  VAL A CA  1 
ATOM   2150 C C   . VAL A 1 276 ? 2.867   -4.254  23.691  1.00 77.08  ? 276  VAL A C   1 
ATOM   2151 O O   . VAL A 1 276 ? 3.152   -3.827  24.815  1.00 75.47  ? 276  VAL A O   1 
ATOM   2152 C CB  . VAL A 1 276 ? 2.639   -6.654  24.348  1.00 84.70  ? 276  VAL A CB  1 
ATOM   2153 C CG1 . VAL A 1 276 ? 1.670   -7.828  24.441  1.00 88.98  ? 276  VAL A CG1 1 
ATOM   2154 C CG2 . VAL A 1 276 ? 3.933   -7.109  23.693  1.00 96.41  ? 276  VAL A CG2 1 
ATOM   2155 N N   . ARG A 1 277 ? 3.263   -3.670  22.562  1.00 79.04  ? 277  ARG A N   1 
ATOM   2156 C CA  . ARG A 1 277 ? 4.092   -2.474  22.574  1.00 84.62  ? 277  ARG A CA  1 
ATOM   2157 C C   . ARG A 1 277 ? 3.565   -1.456  23.589  1.00 83.18  ? 277  ARG A C   1 
ATOM   2158 O O   . ARG A 1 277 ? 4.294   -1.024  24.488  1.00 82.70  ? 277  ARG A O   1 
ATOM   2159 C CB  . ARG A 1 277 ? 4.145   -1.862  21.158  1.00 97.64  ? 277  ARG A CB  1 
ATOM   2160 C CG  . ARG A 1 277 ? 5.083   -0.648  21.006  1.00 107.98 ? 277  ARG A CG  1 
ATOM   2161 C CD  . ARG A 1 277 ? 5.467   -0.376  19.535  1.00 119.77 ? 277  ARG A CD  1 
ATOM   2162 N NE  . ARG A 1 277 ? 5.140   0.977   19.078  1.00 125.78 ? 277  ARG A NE  1 
ATOM   2163 C CZ  . ARG A 1 277 ? 3.930   1.353   18.685  1.00 126.74 ? 277  ARG A CZ  1 
ATOM   2164 N NH1 . ARG A 1 277 ? 2.945   0.474   18.697  1.00 127.70 ? 277  ARG A NH1 1 
ATOM   2165 N NH2 . ARG A 1 277 ? 3.701   2.598   18.291  1.00 122.67 ? 277  ARG A NH2 1 
ATOM   2166 N N   . GLN A 1 278 ? 2.286   -1.111  23.451  1.00 84.36  ? 278  GLN A N   1 
ATOM   2167 C CA  . GLN A 1 278 ? 1.625   -0.133  24.313  1.00 76.26  ? 278  GLN A CA  1 
ATOM   2168 C C   . GLN A 1 278 ? 1.523   -0.556  25.779  1.00 69.65  ? 278  GLN A C   1 
ATOM   2169 O O   . GLN A 1 278 ? 1.657   0.264   26.686  1.00 66.63  ? 278  GLN A O   1 
ATOM   2170 C CB  . GLN A 1 278 ? 0.234   0.172   23.753  1.00 70.71  ? 278  GLN A CB  1 
ATOM   2171 C CG  . GLN A 1 278 ? 0.248   0.659   22.308  1.00 72.09  ? 278  GLN A CG  1 
ATOM   2172 C CD  . GLN A 1 278 ? 0.892   2.025   22.166  1.00 80.19  ? 278  GLN A CD  1 
ATOM   2173 O OE1 . GLN A 1 278 ? 1.219   2.669   23.167  1.00 81.65  ? 278  GLN A OE1 1 
ATOM   2174 N NE2 . GLN A 1 278 ? 1.069   2.482   20.921  1.00 74.23  ? 278  GLN A NE2 1 
ATOM   2175 N N   . LEU A 1 279 ? 1.275   -1.833  26.017  1.00 62.99  ? 279  LEU A N   1 
ATOM   2176 C CA  . LEU A 1 279 ? 1.184   -2.316  27.384  1.00 67.86  ? 279  LEU A CA  1 
ATOM   2177 C C   . LEU A 1 279 ? 2.561   -2.266  28.010  1.00 68.25  ? 279  LEU A C   1 
ATOM   2178 O O   . LEU A 1 279 ? 2.730   -1.904  29.174  1.00 65.60  ? 279  LEU A O   1 
ATOM   2179 C CB  . LEU A 1 279 ? 0.698   -3.748  27.376  1.00 76.45  ? 279  LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 279 ? -0.746  -3.843  26.915  1.00 76.56  ? 279  LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 279 ? -1.061  -5.225  26.352  1.00 77.42  ? 279  LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 279 ? -1.612  -3.505  28.105  1.00 75.83  ? 279  LEU A CD2 1 
HETATM 2183 N N   . CSD A 1 280 ? 3.543   -2.652  27.210  1.00 69.81  ? 280  CSD A N   1 
HETATM 2184 C CA  . CSD A 1 280 ? 4.930   -2.679  27.633  1.00 76.43  ? 280  CSD A CA  1 
HETATM 2185 C CB  . CSD A 1 280 ? 5.804   -3.198  26.491  1.00 89.14  ? 280  CSD A CB  1 
HETATM 2186 S SG  . CSD A 1 280 ? 7.059   -4.436  26.887  1.00 99.60  ? 280  CSD A SG  1 
HETATM 2187 C C   . CSD A 1 280 ? 5.397   -1.281  28.011  1.00 76.19  ? 280  CSD A C   1 
HETATM 2188 O O   . CSD A 1 280 ? 6.105   -1.086  29.008  1.00 72.99  ? 280  CSD A O   1 
HETATM 2189 O OD1 . CSD A 1 280 ? 8.115   -4.724  25.853  1.00 105.36 ? 280  CSD A OD1 1 
HETATM 2190 O OD2 . CSD A 1 280 ? 7.356   -4.351  28.341  1.00 94.74  ? 280  CSD A OD2 1 
ATOM   2191 N N   . LYS A 1 281 ? 5.001   -0.311  27.193  1.00 71.22  ? 281  LYS A N   1 
ATOM   2192 C CA  . LYS A 1 281 ? 5.381   1.077   27.415  1.00 66.56  ? 281  LYS A CA  1 
ATOM   2193 C C   . LYS A 1 281 ? 5.034   1.505   28.853  1.00 63.45  ? 281  LYS A C   1 
ATOM   2194 O O   . LYS A 1 281 ? 5.764   2.279   29.483  1.00 59.52  ? 281  LYS A O   1 
ATOM   2195 C CB  . LYS A 1 281 ? 4.672   1.958   26.370  1.00 63.02  ? 281  LYS A CB  1 
ATOM   2196 C CG  . LYS A 1 281 ? 5.338   3.307   26.062  1.00 72.01  ? 281  LYS A CG  1 
ATOM   2197 C CD  . LYS A 1 281 ? 4.835   3.919   24.733  1.00 81.91  ? 281  LYS A CD  1 
ATOM   2198 C CE  . LYS A 1 281 ? 5.433   5.314   24.438  1.00 99.09  ? 281  LYS A CE  1 
ATOM   2199 N NZ  . LYS A 1 281 ? 5.006   6.379   25.409  1.00 119.50 ? 281  LYS A NZ  1 
ATOM   2200 N N   . LEU A 1 282 ? 3.938   0.963   29.376  1.00 63.07  ? 282  LEU A N   1 
ATOM   2201 C CA  . LEU A 1 282 ? 3.463   1.276   30.726  1.00 66.94  ? 282  LEU A CA  1 
ATOM   2202 C C   . LEU A 1 282 ? 4.486   1.085   31.849  1.00 69.20  ? 282  LEU A C   1 
ATOM   2203 O O   . LEU A 1 282 ? 4.368   1.666   32.932  1.00 68.73  ? 282  LEU A O   1 
ATOM   2204 C CB  . LEU A 1 282 ? 2.229   0.425   31.036  1.00 76.92  ? 282  LEU A CB  1 
ATOM   2205 C CG  . LEU A 1 282 ? 0.992   0.586   30.142  1.00 81.13  ? 282  LEU A CG  1 
ATOM   2206 C CD1 . LEU A 1 282 ? 0.000   -0.528  30.445  1.00 74.15  ? 282  LEU A CD1 1 
ATOM   2207 C CD2 . LEU A 1 282 ? 0.353   1.960   30.366  1.00 67.46  ? 282  LEU A CD2 1 
ATOM   2208 N N   . LEU A 1 283 ? 5.496   0.276   31.584  1.00 72.69  ? 283  LEU A N   1 
ATOM   2209 C CA  . LEU A 1 283 ? 6.514   -0.015  32.582  1.00 78.75  ? 283  LEU A CA  1 
ATOM   2210 C C   . LEU A 1 283 ? 7.605   1.070   32.762  1.00 77.90  ? 283  LEU A C   1 
ATOM   2211 O O   . LEU A 1 283 ? 8.305   1.123   33.788  1.00 70.98  ? 283  LEU A O   1 
ATOM   2212 C CB  . LEU A 1 283 ? 7.142   -1.360  32.214  1.00 84.77  ? 283  LEU A CB  1 
ATOM   2213 C CG  . LEU A 1 283 ? 6.155   -2.524  32.006  1.00 74.19  ? 283  LEU A CG  1 
ATOM   2214 C CD1 . LEU A 1 283 ? 6.880   -3.697  31.345  1.00 69.46  ? 283  LEU A CD1 1 
ATOM   2215 C CD2 . LEU A 1 283 ? 5.548   -2.947  33.362  1.00 74.74  ? 283  LEU A CD2 1 
ATOM   2216 N N   . ARG A 1 284 ? 7.743   1.932   31.762  1.00 74.00  ? 284  ARG A N   1 
ATOM   2217 C CA  . ARG A 1 284 ? 8.737   2.988   31.816  1.00 66.09  ? 284  ARG A CA  1 
ATOM   2218 C C   . ARG A 1 284 ? 8.758   3.722   33.157  1.00 69.66  ? 284  ARG A C   1 
ATOM   2219 O O   . ARG A 1 284 ? 7.730   4.198   33.646  1.00 73.97  ? 284  ARG A O   1 
ATOM   2220 C CB  . ARG A 1 284 ? 8.496   3.989   30.682  1.00 53.68  ? 284  ARG A CB  1 
ATOM   2221 C CG  . ARG A 1 284 ? 8.705   3.413   29.286  1.00 50.99  ? 284  ARG A CG  1 
ATOM   2222 C CD  . ARG A 1 284 ? 8.454   4.462   28.188  1.00 57.92  ? 284  ARG A CD  1 
ATOM   2223 N NE  . ARG A 1 284 ? 8.747   3.970   26.832  1.00 73.20  ? 284  ARG A NE  1 
ATOM   2224 C CZ  . ARG A 1 284 ? 8.800   4.735   25.734  1.00 81.85  ? 284  ARG A CZ  1 
ATOM   2225 N NH1 . ARG A 1 284 ? 8.583   6.043   25.812  1.00 86.03  ? 284  ARG A NH1 1 
ATOM   2226 N NH2 . ARG A 1 284 ? 9.069   4.192   24.549  1.00 83.04  ? 284  ARG A NH2 1 
ATOM   2227 N N   . GLY A 1 285 ? 9.945   3.770   33.751  1.00 72.20  ? 285  GLY A N   1 
ATOM   2228 C CA  . GLY A 1 285 ? 10.160  4.484   35.000  1.00 74.46  ? 285  GLY A CA  1 
ATOM   2229 C C   . GLY A 1 285 ? 9.500   4.010   36.276  1.00 76.28  ? 285  GLY A C   1 
ATOM   2230 O O   . GLY A 1 285 ? 9.752   4.568   37.351  1.00 75.70  ? 285  GLY A O   1 
ATOM   2231 N N   . THR A 1 286 ? 8.663   2.988   36.179  1.00 75.69  ? 286  THR A N   1 
ATOM   2232 C CA  . THR A 1 286 ? 7.974   2.477   37.361  1.00 80.25  ? 286  THR A CA  1 
ATOM   2233 C C   . THR A 1 286 ? 8.926   2.160   38.520  1.00 78.96  ? 286  THR A C   1 
ATOM   2234 O O   . THR A 1 286 ? 10.007  1.593   38.324  1.00 77.46  ? 286  THR A O   1 
ATOM   2235 C CB  . THR A 1 286 ? 7.184   1.251   36.998  1.00 77.89  ? 286  THR A CB  1 
ATOM   2236 O OG1 . THR A 1 286 ? 8.076   0.281   36.444  1.00 76.48  ? 286  THR A OG1 1 
ATOM   2237 C CG2 . THR A 1 286 ? 6.125   1.610   35.959  1.00 75.80  ? 286  THR A CG2 1 
ATOM   2238 N N   . LYS A 1 287 ? 8.486   2.500   39.729  1.00 74.93  ? 287  LYS A N   1 
ATOM   2239 C CA  . LYS A 1 287 ? 9.292   2.340   40.931  1.00 73.12  ? 287  LYS A CA  1 
ATOM   2240 C C   . LYS A 1 287 ? 9.018   1.207   41.933  1.00 77.70  ? 287  LYS A C   1 
ATOM   2241 O O   . LYS A 1 287 ? 9.766   1.048   42.894  1.00 85.69  ? 287  LYS A O   1 
ATOM   2242 C CB  . LYS A 1 287 ? 9.291   3.681   41.658  1.00 67.36  ? 287  LYS A CB  1 
ATOM   2243 C CG  . LYS A 1 287 ? 7.920   4.333   41.712  1.00 70.85  ? 287  LYS A CG  1 
ATOM   2244 C CD  . LYS A 1 287 ? 7.067   3.730   42.811  1.00 67.63  ? 287  LYS A CD  1 
ATOM   2245 C CE  . LYS A 1 287 ? 7.075   4.619   44.052  1.00 70.48  ? 287  LYS A CE  1 
ATOM   2246 N NZ  . LYS A 1 287 ? 6.434   5.961   43.825  1.00 67.11  ? 287  LYS A NZ  1 
ATOM   2247 N N   . ALA A 1 288 ? 7.967   0.423   41.745  1.00 76.60  ? 288  ALA A N   1 
ATOM   2248 C CA  . ALA A 1 288 ? 7.706   -0.675  42.681  1.00 74.37  ? 288  ALA A CA  1 
ATOM   2249 C C   . ALA A 1 288 ? 6.723   -1.678  42.091  1.00 75.56  ? 288  ALA A C   1 
ATOM   2250 O O   . ALA A 1 288 ? 5.798   -1.302  41.373  1.00 81.81  ? 288  ALA A O   1 
ATOM   2251 C CB  . ALA A 1 288 ? 7.184   -0.131  43.992  1.00 73.54  ? 288  ALA A CB  1 
ATOM   2252 N N   . LEU A 1 289 ? 6.912   -2.955  42.396  1.00 72.87  ? 289  LEU A N   1 
ATOM   2253 C CA  . LEU A 1 289 ? 6.034   -3.984  41.842  1.00 80.11  ? 289  LEU A CA  1 
ATOM   2254 C C   . LEU A 1 289 ? 4.537   -3.800  42.099  1.00 81.91  ? 289  LEU A C   1 
ATOM   2255 O O   . LEU A 1 289 ? 3.700   -4.431  41.444  1.00 76.40  ? 289  LEU A O   1 
ATOM   2256 C CB  . LEU A 1 289 ? 6.481   -5.358  42.343  1.00 84.07  ? 289  LEU A CB  1 
ATOM   2257 C CG  . LEU A 1 289 ? 7.315   -6.186  41.354  1.00 88.94  ? 289  LEU A CG  1 
ATOM   2258 C CD1 . LEU A 1 289 ? 8.462   -5.364  40.795  1.00 91.91  ? 289  LEU A CD1 1 
ATOM   2259 C CD2 . LEU A 1 289 ? 7.834   -7.424  42.061  1.00 84.89  ? 289  LEU A CD2 1 
ATOM   2260 N N   . THR A 1 290 ? 4.207   -2.918  43.037  1.00 86.23  ? 290  THR A N   1 
ATOM   2261 C CA  . THR A 1 290 ? 2.819   -2.662  43.411  1.00 78.18  ? 290  THR A CA  1 
ATOM   2262 C C   . THR A 1 290 ? 2.311   -1.284  43.030  1.00 75.08  ? 290  THR A C   1 
ATOM   2263 O O   . THR A 1 290 ? 1.230   -0.868  43.436  1.00 72.15  ? 290  THR A O   1 
ATOM   2264 C CB  . THR A 1 290 ? 2.656   -2.853  44.899  1.00 65.73  ? 290  THR A CB  1 
ATOM   2265 O OG1 . THR A 1 290 ? 3.883   -2.486  45.543  1.00 57.92  ? 290  THR A OG1 1 
ATOM   2266 C CG2 . THR A 1 290 ? 2.316   -4.309  45.203  1.00 57.48  ? 290  THR A CG2 1 
ATOM   2267 N N   . GLU A 1 291 ? 3.105   -0.580  42.240  1.00 76.28  ? 291  GLU A N   1 
ATOM   2268 C CA  . GLU A 1 291 ? 2.723   0.740   41.796  1.00 77.63  ? 291  GLU A CA  1 
ATOM   2269 C C   . GLU A 1 291 ? 1.609   0.577   40.779  1.00 76.34  ? 291  GLU A C   1 
ATOM   2270 O O   . GLU A 1 291 ? 1.625   -0.342  39.958  1.00 75.40  ? 291  GLU A O   1 
ATOM   2271 C CB  . GLU A 1 291 ? 3.919   1.452   41.159  1.00 80.94  ? 291  GLU A CB  1 
ATOM   2272 C CG  . GLU A 1 291 ? 3.593   2.821   40.593  1.00 92.65  ? 291  GLU A CG  1 
ATOM   2273 C CD  . GLU A 1 291 ? 4.748   3.442   39.828  1.00 100.99 ? 291  GLU A CD  1 
ATOM   2274 O OE1 . GLU A 1 291 ? 4.580   4.573   39.324  1.00 101.86 ? 291  GLU A OE1 1 
ATOM   2275 O OE2 . GLU A 1 291 ? 5.818   2.803   39.727  1.00 105.68 ? 291  GLU A OE2 1 
ATOM   2276 N N   . VAL A 1 292 ? 0.630   1.465   40.845  1.00 77.22  ? 292  VAL A N   1 
ATOM   2277 C CA  . VAL A 1 292 ? -0.466  1.398   39.906  1.00 79.88  ? 292  VAL A CA  1 
ATOM   2278 C C   . VAL A 1 292 ? -0.291  2.401   38.787  1.00 82.21  ? 292  VAL A C   1 
ATOM   2279 O O   . VAL A 1 292 ? -0.108  3.593   39.038  1.00 81.48  ? 292  VAL A O   1 
ATOM   2280 C CB  . VAL A 1 292 ? -1.792  1.690   40.574  1.00 77.93  ? 292  VAL A CB  1 
ATOM   2281 C CG1 . VAL A 1 292 ? -2.909  1.612   39.529  1.00 66.77  ? 292  VAL A CG1 1 
ATOM   2282 C CG2 . VAL A 1 292 ? -2.015  0.711   41.707  1.00 77.64  ? 292  VAL A CG2 1 
ATOM   2283 N N   . ILE A 1 293 ? -0.356  1.911   37.551  1.00 89.05  ? 293  ILE A N   1 
ATOM   2284 C CA  . ILE A 1 293 ? -0.223  2.762   36.369  1.00 91.35  ? 293  ILE A CA  1 
ATOM   2285 C C   . ILE A 1 293 ? -1.560  2.865   35.650  1.00 85.06  ? 293  ILE A C   1 
ATOM   2286 O O   . ILE A 1 293 ? -2.242  1.866   35.424  1.00 80.14  ? 293  ILE A O   1 
ATOM   2287 C CB  . ILE A 1 293 ? 0.820   2.210   35.344  1.00 97.42  ? 293  ILE A CB  1 
ATOM   2288 C CG1 . ILE A 1 293 ? 2.256   2.332   35.893  1.00 102.37 ? 293  ILE A CG1 1 
ATOM   2289 C CG2 . ILE A 1 293 ? 0.677   2.967   34.018  1.00 95.60  ? 293  ILE A CG2 1 
ATOM   2290 C CD1 . ILE A 1 293 ? 2.560   1.463   37.116  1.00 95.70  ? 293  ILE A CD1 1 
ATOM   2291 N N   . PRO A 1 294 ? -1.963  4.084   35.296  1.00 84.06  ? 294  PRO A N   1 
ATOM   2292 C CA  . PRO A 1 294 ? -3.242  4.200   34.599  1.00 86.59  ? 294  PRO A CA  1 
ATOM   2293 C C   . PRO A 1 294 ? -3.016  3.862   33.129  1.00 90.92  ? 294  PRO A C   1 
ATOM   2294 O O   . PRO A 1 294 ? -1.931  4.114   32.584  1.00 92.89  ? 294  PRO A O   1 
ATOM   2295 C CB  . PRO A 1 294 ? -3.608  5.662   34.814  1.00 82.83  ? 294  PRO A CB  1 
ATOM   2296 C CG  . PRO A 1 294 ? -2.255  6.328   34.744  1.00 77.61  ? 294  PRO A CG  1 
ATOM   2297 C CD  . PRO A 1 294 ? -1.393  5.411   35.593  1.00 78.09  ? 294  PRO A CD  1 
ATOM   2298 N N   . LEU A 1 295 ? -4.029  3.288   32.491  1.00 88.37  ? 295  LEU A N   1 
ATOM   2299 C CA  . LEU A 1 295 ? -3.900  2.938   31.090  1.00 89.43  ? 295  LEU A CA  1 
ATOM   2300 C C   . LEU A 1 295 ? -4.033  4.138   30.189  1.00 92.44  ? 295  LEU A C   1 
ATOM   2301 O O   . LEU A 1 295 ? -4.758  5.083   30.508  1.00 88.17  ? 295  LEU A O   1 
ATOM   2302 C CB  . LEU A 1 295 ? -4.947  1.910   30.672  1.00 94.23  ? 295  LEU A CB  1 
ATOM   2303 C CG  . LEU A 1 295 ? -4.738  0.447   31.067  1.00 100.26 ? 295  LEU A CG  1 
ATOM   2304 C CD1 . LEU A 1 295 ? -5.470  -0.450  30.073  1.00 99.36  ? 295  LEU A CD1 1 
ATOM   2305 C CD2 . LEU A 1 295 ? -3.262  0.111   31.035  1.00 107.30 ? 295  LEU A CD2 1 
ATOM   2306 N N   . THR A 1 296 ? -3.324  4.074   29.059  1.00 103.90 ? 296  THR A N   1 
ATOM   2307 C CA  . THR A 1 296 ? -3.341  5.123   28.040  1.00 107.89 ? 296  THR A CA  1 
ATOM   2308 C C   . THR A 1 296 ? -4.405  4.741   27.011  1.00 104.94 ? 296  THR A C   1 
ATOM   2309 O O   . THR A 1 296 ? -4.885  3.589   26.963  1.00 96.52  ? 296  THR A O   1 
ATOM   2310 C CB  . THR A 1 296 ? -1.977  5.257   27.268  1.00 113.89 ? 296  THR A CB  1 
ATOM   2311 O OG1 . THR A 1 296 ? -0.873  5.119   28.176  1.00 107.74 ? 296  THR A OG1 1 
ATOM   2312 C CG2 . THR A 1 296 ? -1.892  6.638   26.562  1.00 113.70 ? 296  THR A CG2 1 
ATOM   2313 N N   . GLU A 1 297 ? -4.763  5.714   26.183  1.00 102.82 ? 297  GLU A N   1 
ATOM   2314 C CA  . GLU A 1 297 ? -5.757  5.490   25.153  1.00 100.18 ? 297  GLU A CA  1 
ATOM   2315 C C   . GLU A 1 297 ? -5.296  4.356   24.244  1.00 94.74  ? 297  GLU A C   1 
ATOM   2316 O O   . GLU A 1 297 ? -6.062  3.451   23.912  1.00 89.65  ? 297  GLU A O   1 
ATOM   2317 C CB  . GLU A 1 297 ? -5.938  6.763   24.339  1.00 106.20 ? 297  GLU A CB  1 
ATOM   2318 C CG  . GLU A 1 297 ? -7.311  6.897   23.738  1.00 110.21 ? 297  GLU A CG  1 
ATOM   2319 C CD  . GLU A 1 297 ? -7.823  8.311   23.853  1.00 114.97 ? 297  GLU A CD  1 
ATOM   2320 O OE1 . GLU A 1 297 ? -7.728  9.059   22.848  1.00 108.37 ? 297  GLU A OE1 1 
ATOM   2321 O OE2 . GLU A 1 297 ? -8.300  8.666   24.963  1.00 120.25 ? 297  GLU A OE2 1 
ATOM   2322 N N   . GLU A 1 298 ? -4.028  4.417   23.851  1.00 92.77  ? 298  GLU A N   1 
ATOM   2323 C CA  . GLU A 1 298 ? -3.444  3.409   22.983  1.00 83.21  ? 298  GLU A CA  1 
ATOM   2324 C C   . GLU A 1 298 ? -3.361  2.065   23.701  1.00 76.85  ? 298  GLU A C   1 
ATOM   2325 O O   . GLU A 1 298 ? -3.618  1.021   23.097  1.00 63.66  ? 298  GLU A O   1 
ATOM   2326 C CB  . GLU A 1 298 ? -2.044  3.844   22.528  1.00 87.43  ? 298  GLU A CB  1 
ATOM   2327 C CG  . GLU A 1 298 ? -2.003  5.109   21.665  1.00 97.36  ? 298  GLU A CG  1 
ATOM   2328 C CD  . GLU A 1 298 ? -2.117  6.411   22.471  1.00 116.32 ? 298  GLU A CD  1 
ATOM   2329 O OE1 . GLU A 1 298 ? -3.042  7.205   22.181  1.00 120.88 ? 298  GLU A OE1 1 
ATOM   2330 O OE2 . GLU A 1 298 ? -1.283  6.650   23.381  1.00 123.42 ? 298  GLU A OE2 1 
ATOM   2331 N N   . ALA A 1 299 ? -3.010  2.101   24.988  1.00 75.84  ? 299  ALA A N   1 
ATOM   2332 C CA  . ALA A 1 299 ? -2.886  0.892   25.800  1.00 66.71  ? 299  ALA A CA  1 
ATOM   2333 C C   . ALA A 1 299 ? -4.202  0.120   25.941  1.00 66.90  ? 299  ALA A C   1 
ATOM   2334 O O   . ALA A 1 299 ? -4.249  -1.101  25.755  1.00 59.11  ? 299  ALA A O   1 
ATOM   2335 C CB  . ALA A 1 299 ? -2.341  1.250   27.170  1.00 60.18  ? 299  ALA A CB  1 
ATOM   2336 N N   . GLU A 1 300 ? -5.279  0.820   26.266  1.00 70.32  ? 300  GLU A N   1 
ATOM   2337 C CA  . GLU A 1 300 ? -6.546  0.127   26.404  1.00 72.11  ? 300  GLU A CA  1 
ATOM   2338 C C   . GLU A 1 300 ? -7.078  -0.354  25.066  1.00 75.76  ? 300  GLU A C   1 
ATOM   2339 O O   . GLU A 1 300 ? -7.780  -1.362  24.990  1.00 74.55  ? 300  GLU A O   1 
ATOM   2340 C CB  . GLU A 1 300 ? -7.571  1.030   27.039  1.00 70.43  ? 300  GLU A CB  1 
ATOM   2341 C CG  . GLU A 1 300 ? -8.421  0.279   28.022  1.00 91.41  ? 300  GLU A CG  1 
ATOM   2342 C CD  . GLU A 1 300 ? -8.227  0.794   29.434  1.00 111.10 ? 300  GLU A CD  1 
ATOM   2343 O OE1 . GLU A 1 300 ? -8.795  0.187   30.368  1.00 119.30 ? 300  GLU A OE1 1 
ATOM   2344 O OE2 . GLU A 1 300 ? -7.508  1.812   29.604  1.00 115.35 ? 300  GLU A OE2 1 
ATOM   2345 N N   . LEU A 1 301 ? -6.760  0.400   24.020  1.00 82.82  ? 301  LEU A N   1 
ATOM   2346 C CA  . LEU A 1 301 ? -7.172  0.076   22.661  1.00 84.24  ? 301  LEU A CA  1 
ATOM   2347 C C   . LEU A 1 301 ? -6.549  -1.264  22.324  1.00 86.74  ? 301  LEU A C   1 
ATOM   2348 O O   . LEU A 1 301 ? -7.201  -2.152  21.769  1.00 89.52  ? 301  LEU A O   1 
ATOM   2349 C CB  . LEU A 1 301 ? -6.621  1.110   21.685  1.00 93.40  ? 301  LEU A CB  1 
ATOM   2350 C CG  . LEU A 1 301 ? -7.568  1.864   20.762  1.00 106.36 ? 301  LEU A CG  1 
ATOM   2351 C CD1 . LEU A 1 301 ? -8.303  2.914   21.581  1.00 117.36 ? 301  LEU A CD1 1 
ATOM   2352 C CD2 . LEU A 1 301 ? -6.780  2.538   19.631  1.00 103.26 ? 301  LEU A CD2 1 
ATOM   2353 N N   . GLU A 1 302 ? -5.264  -1.378  22.661  1.00 82.31  ? 302  GLU A N   1 
ATOM   2354 C CA  . GLU A 1 302 ? -4.475  -2.581  22.413  1.00 74.72  ? 302  GLU A CA  1 
ATOM   2355 C C   . GLU A 1 302 ? -5.047  -3.707  23.261  1.00 68.87  ? 302  GLU A C   1 
ATOM   2356 O O   . GLU A 1 302 ? -5.331  -4.801  22.760  1.00 62.58  ? 302  GLU A O   1 
ATOM   2357 C CB  . GLU A 1 302 ? -2.998  -2.327  22.780  1.00 76.90  ? 302  GLU A CB  1 
ATOM   2358 C CG  . GLU A 1 302 ? -1.974  -3.360  22.244  1.00 77.96  ? 302  GLU A CG  1 
ATOM   2359 C CD  . GLU A 1 302 ? -0.512  -2.957  22.499  1.00 84.83  ? 302  GLU A CD  1 
ATOM   2360 O OE1 . GLU A 1 302 ? -0.067  -3.041  23.674  1.00 78.62  ? 302  GLU A OE1 1 
ATOM   2361 O OE2 . GLU A 1 302 ? 0.179   -2.553  21.522  1.00 85.81  ? 302  GLU A OE2 1 
ATOM   2362 N N   . LEU A 1 303 ? -5.232  -3.429  24.548  1.00 63.27  ? 303  LEU A N   1 
ATOM   2363 C CA  . LEU A 1 303 ? -5.773  -4.432  25.451  1.00 63.31  ? 303  LEU A CA  1 
ATOM   2364 C C   . LEU A 1 303 ? -7.100  -5.014  24.934  1.00 64.71  ? 303  LEU A C   1 
ATOM   2365 O O   . LEU A 1 303 ? -7.331  -6.243  24.953  1.00 61.88  ? 303  LEU A O   1 
ATOM   2366 C CB  . LEU A 1 303 ? -5.969  -3.823  26.840  1.00 65.57  ? 303  LEU A CB  1 
ATOM   2367 C CG  . LEU A 1 303 ? -6.731  -4.704  27.843  1.00 67.60  ? 303  LEU A CG  1 
ATOM   2368 C CD1 . LEU A 1 303 ? -6.098  -6.086  27.966  1.00 52.62  ? 303  LEU A CD1 1 
ATOM   2369 C CD2 . LEU A 1 303 ? -6.750  -4.003  29.186  1.00 70.82  ? 303  LEU A CD2 1 
ATOM   2370 N N   . ALA A 1 304 ? -7.971  -4.125  24.470  1.00 63.27  ? 304  ALA A N   1 
ATOM   2371 C CA  . ALA A 1 304 ? -9.260  -4.536  23.951  1.00 59.14  ? 304  ALA A CA  1 
ATOM   2372 C C   . ALA A 1 304 ? -9.081  -5.367  22.675  1.00 63.32  ? 304  ALA A C   1 
ATOM   2373 O O   . ALA A 1 304 ? -9.691  -6.427  22.531  1.00 59.69  ? 304  ALA A O   1 
ATOM   2374 C CB  . ALA A 1 304 ? -10.089 -3.321  23.672  1.00 56.09  ? 304  ALA A CB  1 
ATOM   2375 N N   . GLU A 1 305 ? -8.234  -4.888  21.763  1.00 68.06  ? 305  GLU A N   1 
ATOM   2376 C CA  . GLU A 1 305 ? -7.989  -5.580  20.507  1.00 71.40  ? 305  GLU A CA  1 
ATOM   2377 C C   . GLU A 1 305 ? -7.475  -6.983  20.783  1.00 68.76  ? 305  GLU A C   1 
ATOM   2378 O O   . GLU A 1 305 ? -7.792  -7.933  20.067  1.00 67.52  ? 305  GLU A O   1 
ATOM   2379 C CB  . GLU A 1 305 ? -6.971  -4.809  19.658  1.00 89.30  ? 305  GLU A CB  1 
ATOM   2380 C CG  . GLU A 1 305 ? -6.965  -5.226  18.181  1.00 120.50 ? 305  GLU A CG  1 
ATOM   2381 C CD  . GLU A 1 305 ? -5.919  -4.490  17.341  1.00 136.68 ? 305  GLU A CD  1 
ATOM   2382 O OE1 . GLU A 1 305 ? -5.851  -3.240  17.410  1.00 144.61 ? 305  GLU A OE1 1 
ATOM   2383 O OE2 . GLU A 1 305 ? -5.172  -5.168  16.599  1.00 135.84 ? 305  GLU A OE2 1 
ATOM   2384 N N   . ASN A 1 306 ? -6.669  -7.121  21.824  1.00 73.91  ? 306  ASN A N   1 
ATOM   2385 C CA  . ASN A 1 306 ? -6.151  -8.437  22.151  1.00 75.98  ? 306  ASN A CA  1 
ATOM   2386 C C   . ASN A 1 306 ? -7.272  -9.252  22.725  1.00 68.37  ? 306  ASN A C   1 
ATOM   2387 O O   . ASN A 1 306 ? -7.513  -10.387 22.309  1.00 63.57  ? 306  ASN A O   1 
ATOM   2388 C CB  . ASN A 1 306 ? -5.026  -8.350  23.175  1.00 82.37  ? 306  ASN A CB  1 
ATOM   2389 C CG  . ASN A 1 306 ? -3.701  -7.993  22.545  1.00 79.27  ? 306  ASN A CG  1 
ATOM   2390 O OD1 . ASN A 1 306 ? -3.267  -8.620  21.571  1.00 70.13  ? 306  ASN A OD1 1 
ATOM   2391 N ND2 . ASN A 1 306 ? -3.044  -6.985  23.098  1.00 89.09  ? 306  ASN A ND2 1 
ATOM   2392 N N   . ARG A 1 307 ? -7.952  -8.654  23.694  1.00 64.60  ? 307  ARG A N   1 
ATOM   2393 C CA  . ARG A 1 307 ? -9.069  -9.304  24.349  1.00 64.95  ? 307  ARG A CA  1 
ATOM   2394 C C   . ARG A 1 307 ? -9.971  -9.937  23.288  1.00 62.23  ? 307  ARG A C   1 
ATOM   2395 O O   . ARG A 1 307 ? -10.378 -11.097 23.408  1.00 53.88  ? 307  ARG A O   1 
ATOM   2396 C CB  . ARG A 1 307 ? -9.831  -8.271  25.155  1.00 67.34  ? 307  ARG A CB  1 
ATOM   2397 C CG  . ARG A 1 307 ? -10.711 -8.866  26.204  1.00 71.27  ? 307  ARG A CG  1 
ATOM   2398 C CD  . ARG A 1 307 ? -11.537 -7.764  26.819  1.00 79.67  ? 307  ARG A CD  1 
ATOM   2399 N NE  . ARG A 1 307 ? -10.744 -6.857  27.645  1.00 87.33  ? 307  ARG A NE  1 
ATOM   2400 C CZ  . ARG A 1 307 ? -10.174 -7.201  28.802  1.00 84.35  ? 307  ARG A CZ  1 
ATOM   2401 N NH1 . ARG A 1 307 ? -10.297 -8.438  29.278  1.00 63.10  ? 307  ARG A NH1 1 
ATOM   2402 N NH2 . ARG A 1 307 ? -9.497  -6.298  29.503  1.00 79.78  ? 307  ARG A NH2 1 
ATOM   2403 N N   . GLU A 1 308 ? -10.249 -9.157  22.247  1.00 63.41  ? 308  GLU A N   1 
ATOM   2404 C CA  . GLU A 1 308 ? -11.074 -9.573  21.123  1.00 70.32  ? 308  GLU A CA  1 
ATOM   2405 C C   . GLU A 1 308 ? -10.460 -10.744 20.387  1.00 74.30  ? 308  GLU A C   1 
ATOM   2406 O O   . GLU A 1 308 ? -11.086 -11.789 20.195  1.00 71.57  ? 308  GLU A O   1 
ATOM   2407 C CB  . GLU A 1 308 ? -11.238 -8.409  20.155  1.00 75.68  ? 308  GLU A CB  1 
ATOM   2408 C CG  . GLU A 1 308 ? -12.513 -7.641  20.359  1.00 95.44  ? 308  GLU A CG  1 
ATOM   2409 C CD  . GLU A 1 308 ? -13.710 -8.410  19.845  1.00 115.26 ? 308  GLU A CD  1 
ATOM   2410 O OE1 . GLU A 1 308 ? -13.841 -8.533  18.608  1.00 127.60 ? 308  GLU A OE1 1 
ATOM   2411 O OE2 . GLU A 1 308 ? -14.508 -8.903  20.673  1.00 119.54 ? 308  GLU A OE2 1 
ATOM   2412 N N   . ILE A 1 309 ? -9.227  -10.551 19.953  1.00 76.68  ? 309  ILE A N   1 
ATOM   2413 C CA  . ILE A 1 309 ? -8.529  -11.598 19.251  1.00 79.98  ? 309  ILE A CA  1 
ATOM   2414 C C   . ILE A 1 309 ? -8.630  -12.897 20.056  1.00 82.59  ? 309  ILE A C   1 
ATOM   2415 O O   . ILE A 1 309 ? -8.922  -13.957 19.499  1.00 88.26  ? 309  ILE A O   1 
ATOM   2416 C CB  . ILE A 1 309 ? -7.069  -11.196 19.051  1.00 79.67  ? 309  ILE A CB  1 
ATOM   2417 C CG1 . ILE A 1 309 ? -7.005  -10.026 18.073  1.00 67.38  ? 309  ILE A CG1 1 
ATOM   2418 C CG2 . ILE A 1 309 ? -6.264  -12.374 18.550  1.00 86.48  ? 309  ILE A CG2 1 
ATOM   2419 C CD1 . ILE A 1 309 ? -5.623  -9.535  17.812  1.00 65.77  ? 309  ILE A CD1 1 
ATOM   2420 N N   . LEU A 1 310 ? -8.417  -12.798 21.371  1.00 79.28  ? 310  LEU A N   1 
ATOM   2421 C CA  . LEU A 1 310 ? -8.474  -13.953 22.260  1.00 68.77  ? 310  LEU A CA  1 
ATOM   2422 C C   . LEU A 1 310 ? -9.821  -14.615 22.326  1.00 75.12  ? 310  LEU A C   1 
ATOM   2423 O O   . LEU A 1 310 ? -9.895  -15.834 22.280  1.00 80.90  ? 310  LEU A O   1 
ATOM   2424 C CB  . LEU A 1 310 ? -8.021  -13.568 23.662  1.00 56.94  ? 310  LEU A CB  1 
ATOM   2425 C CG  . LEU A 1 310 ? -6.512  -13.356 23.544  1.00 61.92  ? 310  LEU A CG  1 
ATOM   2426 C CD1 . LEU A 1 310 ? -5.893  -12.914 24.845  1.00 51.48  ? 310  LEU A CD1 1 
ATOM   2427 C CD2 . LEU A 1 310 ? -5.897  -14.673 23.072  1.00 64.18  ? 310  LEU A CD2 1 
ATOM   2428 N N   . LYS A 1 311 ? -10.885 -13.828 22.427  1.00 77.25  ? 311  LYS A N   1 
ATOM   2429 C CA  . LYS A 1 311 ? -12.232 -14.390 22.490  1.00 80.31  ? 311  LYS A CA  1 
ATOM   2430 C C   . LYS A 1 311 ? -12.423 -15.575 21.549  1.00 80.27  ? 311  LYS A C   1 
ATOM   2431 O O   . LYS A 1 311 ? -12.944 -16.606 21.947  1.00 78.52  ? 311  LYS A O   1 
ATOM   2432 C CB  . LYS A 1 311 ? -13.268 -13.323 22.156  1.00 91.65  ? 311  LYS A CB  1 
ATOM   2433 C CG  . LYS A 1 311 ? -13.606 -12.383 23.302  1.00 109.08 ? 311  LYS A CG  1 
ATOM   2434 C CD  . LYS A 1 311 ? -14.802 -11.491 22.937  1.00 110.45 ? 311  LYS A CD  1 
ATOM   2435 C CE  . LYS A 1 311 ? -15.213 -10.571 24.085  1.00 109.54 ? 311  LYS A CE  1 
ATOM   2436 N NZ  . LYS A 1 311 ? -14.173 -9.550  24.413  1.00 103.78 ? 311  LYS A NZ  1 
ATOM   2437 N N   . GLU A 1 312 ? -12.010 -15.412 20.297  1.00 83.38  ? 312  GLU A N   1 
ATOM   2438 C CA  . GLU A 1 312 ? -12.116 -16.464 19.287  1.00 89.84  ? 312  GLU A CA  1 
ATOM   2439 C C   . GLU A 1 312 ? -10.975 -17.466 19.451  1.00 94.76  ? 312  GLU A C   1 
ATOM   2440 O O   . GLU A 1 312 ? -9.801  -17.101 19.318  1.00 99.73  ? 312  GLU A O   1 
ATOM   2441 C CB  . GLU A 1 312 ? -11.991 -15.876 17.889  1.00 99.52  ? 312  GLU A CB  1 
ATOM   2442 C CG  . GLU A 1 312 ? -13.100 -14.963 17.451  1.00 124.36 ? 312  GLU A CG  1 
ATOM   2443 C CD  . GLU A 1 312 ? -12.719 -14.189 16.195  1.00 145.49 ? 312  GLU A CD  1 
ATOM   2444 O OE1 . GLU A 1 312 ? -13.479 -14.227 15.201  1.00 150.00 ? 312  GLU A OE1 1 
ATOM   2445 O OE2 . GLU A 1 312 ? -11.651 -13.537 16.204  1.00 150.00 ? 312  GLU A OE2 1 
ATOM   2446 N N   . PRO A 1 313 ? -11.297 -18.740 19.735  1.00 90.95  ? 313  PRO A N   1 
ATOM   2447 C CA  . PRO A 1 313 ? -10.258 -19.769 19.903  1.00 89.36  ? 313  PRO A CA  1 
ATOM   2448 C C   . PRO A 1 313 ? -9.717  -20.287 18.571  1.00 86.95  ? 313  PRO A C   1 
ATOM   2449 O O   . PRO A 1 313 ? -10.480 -20.713 17.697  1.00 89.24  ? 313  PRO A O   1 
ATOM   2450 C CB  . PRO A 1 313 ? -10.975 -20.874 20.685  1.00 83.90  ? 313  PRO A CB  1 
ATOM   2451 C CG  . PRO A 1 313 ? -12.048 -20.129 21.425  1.00 80.65  ? 313  PRO A CG  1 
ATOM   2452 C CD  . PRO A 1 313 ? -12.555 -19.177 20.359  1.00 86.81  ? 313  PRO A CD  1 
ATOM   2453 N N   . VAL A 1 314 ? -8.406  -20.228 18.401  1.00 76.57  ? 314  VAL A N   1 
ATOM   2454 C CA  . VAL A 1 314 ? -7.842  -20.733 17.176  1.00 73.23  ? 314  VAL A CA  1 
ATOM   2455 C C   . VAL A 1 314 ? -7.102  -21.936 17.633  1.00 78.71  ? 314  VAL A C   1 
ATOM   2456 O O   . VAL A 1 314 ? -6.600  -21.975 18.759  1.00 75.55  ? 314  VAL A O   1 
ATOM   2457 C CB  . VAL A 1 314 ? -6.846  -19.784 16.548  1.00 66.08  ? 314  VAL A CB  1 
ATOM   2458 C CG1 . VAL A 1 314 ? -7.480  -18.432 16.370  1.00 71.83  ? 314  VAL A CG1 1 
ATOM   2459 C CG2 . VAL A 1 314 ? -5.609  -19.701 17.406  1.00 62.98  ? 314  VAL A CG2 1 
ATOM   2460 N N   . HIS A 1 315 ? -7.055  -22.928 16.765  1.00 87.30  ? 315  HIS A N   1 
ATOM   2461 C CA  . HIS A 1 315 ? -6.352  -24.144 17.083  1.00 97.56  ? 315  HIS A CA  1 
ATOM   2462 C C   . HIS A 1 315 ? -5.369  -24.413 15.960  1.00 95.13  ? 315  HIS A C   1 
ATOM   2463 O O   . HIS A 1 315 ? -5.683  -24.190 14.792  1.00 92.46  ? 315  HIS A O   1 
ATOM   2464 C CB  . HIS A 1 315 ? -7.345  -25.303 17.262  1.00 114.72 ? 315  HIS A CB  1 
ATOM   2465 C CG  . HIS A 1 315 ? -7.875  -25.434 18.663  1.00 141.79 ? 315  HIS A CG  1 
ATOM   2466 N ND1 . HIS A 1 315 ? -8.614  -24.445 19.281  1.00 149.99 ? 315  HIS A ND1 1 
ATOM   2467 C CD2 . HIS A 1 315 ? -7.747  -26.430 19.577  1.00 148.09 ? 315  HIS A CD2 1 
ATOM   2468 C CE1 . HIS A 1 315 ? -8.916  -24.826 20.511  1.00 149.99 ? 315  HIS A CE1 1 
ATOM   2469 N NE2 . HIS A 1 315 ? -8.402  -26.027 20.716  1.00 147.09 ? 315  HIS A NE2 1 
ATOM   2470 N N   . GLY A 1 316 ? -4.163  -24.843 16.333  1.00 93.36  ? 316  GLY A N   1 
ATOM   2471 C CA  . GLY A 1 316 ? -3.130  -25.149 15.359  1.00 87.80  ? 316  GLY A CA  1 
ATOM   2472 C C   . GLY A 1 316 ? -3.245  -26.574 14.835  1.00 83.76  ? 316  GLY A C   1 
ATOM   2473 O O   . GLY A 1 316 ? -3.680  -27.483 15.551  1.00 83.43  ? 316  GLY A O   1 
ATOM   2474 N N   . VAL A 1 317 ? -2.852  -26.763 13.577  1.00 75.04  ? 317  VAL A N   1 
ATOM   2475 C CA  . VAL A 1 317 ? -2.890  -28.066 12.909  1.00 63.43  ? 317  VAL A CA  1 
ATOM   2476 C C   . VAL A 1 317 ? -1.581  -28.842 13.176  1.00 58.32  ? 317  VAL A C   1 
ATOM   2477 O O   . VAL A 1 317 ? -0.579  -28.238 13.538  1.00 57.83  ? 317  VAL A O   1 
ATOM   2478 C CB  . VAL A 1 317 ? -3.062  -27.854 11.388  1.00 56.74  ? 317  VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 317 ? -1.759  -28.171 10.648  1.00 52.33  ? 317  VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 317 ? -4.215  -28.695 10.874  1.00 61.98  ? 317  VAL A CG2 1 
ATOM   2481 N N   . TYR A 1 318 ? -1.579  -30.164 13.011  1.00 56.44  ? 318  TYR A N   1 
ATOM   2482 C CA  . TYR A 1 318 ? -0.345  -30.928 13.230  1.00 58.35  ? 318  TYR A CA  1 
ATOM   2483 C C   . TYR A 1 318 ? 0.458   -31.124 11.921  1.00 55.56  ? 318  TYR A C   1 
ATOM   2484 O O   . TYR A 1 318 ? -0.031  -30.890 10.806  1.00 57.44  ? 318  TYR A O   1 
ATOM   2485 C CB  . TYR A 1 318 ? -0.639  -32.288 13.900  1.00 60.90  ? 318  TYR A CB  1 
ATOM   2486 C CG  . TYR A 1 318 ? -1.054  -32.215 15.369  1.00 59.93  ? 318  TYR A CG  1 
ATOM   2487 C CD1 . TYR A 1 318 ? -0.196  -31.691 16.343  1.00 51.85  ? 318  TYR A CD1 1 
ATOM   2488 C CD2 . TYR A 1 318 ? -2.301  -32.705 15.789  1.00 64.99  ? 318  TYR A CD2 1 
ATOM   2489 C CE1 . TYR A 1 318 ? -0.570  -31.661 17.701  1.00 56.53  ? 318  TYR A CE1 1 
ATOM   2490 C CE2 . TYR A 1 318 ? -2.684  -32.678 17.140  1.00 62.19  ? 318  TYR A CE2 1 
ATOM   2491 C CZ  . TYR A 1 318 ? -1.815  -32.158 18.087  1.00 66.45  ? 318  TYR A CZ  1 
ATOM   2492 O OH  . TYR A 1 318 ? -2.190  -32.150 19.414  1.00 62.71  ? 318  TYR A OH  1 
ATOM   2493 N N   . TYR A 1 319 ? 1.697   -31.557 12.081  1.00 46.64  ? 319  TYR A N   1 
ATOM   2494 C CA  . TYR A 1 319 ? 2.624   -31.740 10.979  1.00 48.78  ? 319  TYR A CA  1 
ATOM   2495 C C   . TYR A 1 319 ? 2.331   -32.872 10.020  1.00 57.04  ? 319  TYR A C   1 
ATOM   2496 O O   . TYR A 1 319 ? 2.118   -34.004 10.448  1.00 56.97  ? 319  TYR A O   1 
ATOM   2497 C CB  . TYR A 1 319 ? 4.003   -31.961 11.554  1.00 46.48  ? 319  TYR A CB  1 
ATOM   2498 C CG  . TYR A 1 319 ? 5.098   -32.092 10.537  1.00 45.33  ? 319  TYR A CG  1 
ATOM   2499 C CD1 . TYR A 1 319 ? 6.156   -32.981 10.748  1.00 49.61  ? 319  TYR A CD1 1 
ATOM   2500 C CD2 . TYR A 1 319 ? 5.129   -31.284 9.399   1.00 46.64  ? 319  TYR A CD2 1 
ATOM   2501 C CE1 . TYR A 1 319 ? 7.220   -33.063 9.857   1.00 52.74  ? 319  TYR A CE1 1 
ATOM   2502 C CE2 . TYR A 1 319 ? 6.209   -31.352 8.493   1.00 48.67  ? 319  TYR A CE2 1 
ATOM   2503 C CZ  . TYR A 1 319 ? 7.247   -32.250 8.733   1.00 48.31  ? 319  TYR A CZ  1 
ATOM   2504 O OH  . TYR A 1 319 ? 8.301   -32.360 7.848   1.00 56.87  ? 319  TYR A OH  1 
ATOM   2505 N N   . ASP A 1 320 ? 2.347   -32.571 8.723   1.00 61.10  ? 320  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 320 ? 2.124   -33.593 7.709   1.00 68.44  ? 320  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 320 ? 3.359   -33.657 6.803   1.00 65.61  ? 320  ASP A C   1 
ATOM   2508 O O   . ASP A 1 320 ? 3.359   -33.136 5.691   1.00 73.93  ? 320  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 320 ? 0.884   -33.280 6.877   1.00 80.70  ? 320  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 320 ? 0.585   -34.370 5.871   1.00 89.23  ? 320  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 320 ? -0.346  -34.207 5.056   1.00 86.96  ? 320  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 320 ? 1.291   -35.399 5.906   1.00 98.28  ? 320  ASP A OD2 1 
ATOM   2513 N N   . PRO A 1 321 ? 4.414   -34.343 7.264   1.00 63.82  ? 321  PRO A N   1 
ATOM   2514 C CA  . PRO A 1 321 ? 5.725   -34.562 6.630   1.00 62.84  ? 321  PRO A CA  1 
ATOM   2515 C C   . PRO A 1 321 ? 5.687   -34.756 5.153   1.00 71.81  ? 321  PRO A C   1 
ATOM   2516 O O   . PRO A 1 321 ? 6.668   -34.485 4.459   1.00 69.71  ? 321  PRO A O   1 
ATOM   2517 C CB  . PRO A 1 321 ? 6.250   -35.799 7.323   1.00 52.22  ? 321  PRO A CB  1 
ATOM   2518 C CG  . PRO A 1 321 ? 5.000   -36.530 7.641   1.00 63.55  ? 321  PRO A CG  1 
ATOM   2519 C CD  . PRO A 1 321 ? 4.145   -35.428 8.214   1.00 64.03  ? 321  PRO A CD  1 
ATOM   2520 N N   . SER A 1 322 ? 4.556   -35.253 4.676   1.00 81.04  ? 322  SER A N   1 
ATOM   2521 C CA  . SER A 1 322 ? 4.394   -35.473 3.256   1.00 86.67  ? 322  SER A CA  1 
ATOM   2522 C C   . SER A 1 322 ? 4.397   -34.137 2.505   1.00 84.86  ? 322  SER A C   1 
ATOM   2523 O O   . SER A 1 322 ? 4.912   -34.056 1.396   1.00 87.38  ? 322  SER A O   1 
ATOM   2524 C CB  . SER A 1 322 ? 3.098   -36.247 3.001   1.00 89.10  ? 322  SER A CB  1 
ATOM   2525 O OG  . SER A 1 322 ? 2.027   -35.696 3.750   1.00 90.81  ? 322  SER A OG  1 
ATOM   2526 N N   . LYS A 1 323 ? 3.863   -33.086 3.128   1.00 79.45  ? 323  LYS A N   1 
ATOM   2527 C CA  . LYS A 1 323 ? 3.790   -31.774 2.486   1.00 74.45  ? 323  LYS A CA  1 
ATOM   2528 C C   . LYS A 1 323 ? 4.874   -30.771 2.864   1.00 77.86  ? 323  LYS A C   1 
ATOM   2529 O O   . LYS A 1 323 ? 5.568   -30.917 3.872   1.00 79.04  ? 323  LYS A O   1 
ATOM   2530 C CB  . LYS A 1 323 ? 2.434   -31.139 2.764   1.00 65.03  ? 323  LYS A CB  1 
ATOM   2531 C CG  . LYS A 1 323 ? 1.265   -32.108 2.679   1.00 58.13  ? 323  LYS A CG  1 
ATOM   2532 C CD  . LYS A 1 323 ? -0.025  -31.370 2.312   1.00 64.73  ? 323  LYS A CD  1 
ATOM   2533 C CE  . LYS A 1 323 ? -1.236  -31.999 2.973   1.00 80.53  ? 323  LYS A CE  1 
ATOM   2534 N NZ  . LYS A 1 323 ? -1.180  -31.816 4.458   1.00 85.31  ? 323  LYS A NZ  1 
ATOM   2535 N N   . ASP A 1 324 ? 4.995   -29.735 2.046   1.00 75.67  ? 324  ASP A N   1 
ATOM   2536 C CA  . ASP A 1 324 ? 5.977   -28.693 2.276   1.00 74.61  ? 324  ASP A CA  1 
ATOM   2537 C C   . ASP A 1 324 ? 5.637   -27.828 3.453   1.00 74.33  ? 324  ASP A C   1 
ATOM   2538 O O   . ASP A 1 324 ? 4.509   -27.807 3.947   1.00 77.75  ? 324  ASP A O   1 
ATOM   2539 C CB  . ASP A 1 324 ? 6.100   -27.763 1.075   1.00 88.77  ? 324  ASP A CB  1 
ATOM   2540 C CG  . ASP A 1 324 ? 7.083   -28.256 0.058   1.00 98.53  ? 324  ASP A CG  1 
ATOM   2541 O OD1 . ASP A 1 324 ? 8.104   -28.832 0.477   1.00 99.52  ? 324  ASP A OD1 1 
ATOM   2542 O OD2 . ASP A 1 324 ? 6.845   -28.050 -1.155  1.00 107.88 ? 324  ASP A OD2 1 
ATOM   2543 N N   . LEU A 1 325 ? 6.640   -27.071 3.861   1.00 69.59  ? 325  LEU A N   1 
ATOM   2544 C CA  . LEU A 1 325 ? 6.521   -26.150 4.967   1.00 61.88  ? 325  LEU A CA  1 
ATOM   2545 C C   . LEU A 1 325 ? 6.662   -24.756 4.423   1.00 57.36  ? 325  LEU A C   1 
ATOM   2546 O O   . LEU A 1 325 ? 7.660   -24.429 3.791   1.00 55.88  ? 325  LEU A O   1 
ATOM   2547 C CB  . LEU A 1 325 ? 7.638   -26.394 5.971   1.00 51.95  ? 325  LEU A CB  1 
ATOM   2548 C CG  . LEU A 1 325 ? 7.207   -27.127 7.228   1.00 50.02  ? 325  LEU A CG  1 
ATOM   2549 C CD1 . LEU A 1 325 ? 8.386   -27.347 8.143   1.00 59.64  ? 325  LEU A CD1 1 
ATOM   2550 C CD2 . LEU A 1 325 ? 6.156   -26.303 7.931   1.00 55.28  ? 325  LEU A CD2 1 
ATOM   2551 N N   . ILE A 1 326 ? 5.669   -23.922 4.651   1.00 54.86  ? 326  ILE A N   1 
ATOM   2552 C CA  . ILE A 1 326 ? 5.803   -22.580 4.150   1.00 54.25  ? 326  ILE A CA  1 
ATOM   2553 C C   . ILE A 1 326 ? 5.823   -21.620 5.328   1.00 52.51  ? 326  ILE A C   1 
ATOM   2554 O O   . ILE A 1 326 ? 5.050   -21.732 6.289   1.00 46.83  ? 326  ILE A O   1 
ATOM   2555 C CB  . ILE A 1 326 ? 4.662   -22.206 3.167   1.00 56.96  ? 326  ILE A CB  1 
ATOM   2556 C CG1 . ILE A 1 326 ? 4.373   -23.352 2.188   1.00 46.77  ? 326  ILE A CG1 1 
ATOM   2557 C CG2 . ILE A 1 326 ? 5.070   -20.984 2.383   1.00 56.31  ? 326  ILE A CG2 1 
ATOM   2558 C CD1 . ILE A 1 326 ? 5.554   -23.732 1.337   1.00 53.21  ? 326  ILE A CD1 1 
ATOM   2559 N N   . ALA A 1 327 ? 6.750   -20.686 5.250   1.00 48.95  ? 327  ALA A N   1 
ATOM   2560 C CA  . ALA A 1 327 ? 6.886   -19.704 6.279   1.00 42.01  ? 327  ALA A CA  1 
ATOM   2561 C C   . ALA A 1 327 ? 6.647   -18.409 5.568   1.00 44.88  ? 327  ALA A C   1 
ATOM   2562 O O   . ALA A 1 327 ? 7.165   -18.184 4.471   1.00 38.95  ? 327  ALA A O   1 
ATOM   2563 C CB  . ALA A 1 327 ? 8.267   -19.744 6.832   1.00 37.47  ? 327  ALA A CB  1 
ATOM   2564 N N   . GLU A 1 328 ? 5.834   -17.571 6.189   1.00 45.84  ? 328  GLU A N   1 
ATOM   2565 C CA  . GLU A 1 328 ? 5.530   -16.277 5.627   1.00 45.30  ? 328  GLU A CA  1 
ATOM   2566 C C   . GLU A 1 328 ? 5.715   -15.196 6.679   1.00 48.14  ? 328  GLU A C   1 
ATOM   2567 O O   . GLU A 1 328 ? 5.224   -15.326 7.811   1.00 43.76  ? 328  GLU A O   1 
ATOM   2568 C CB  . GLU A 1 328 ? 4.113   -16.247 5.132   1.00 45.38  ? 328  GLU A CB  1 
ATOM   2569 C CG  . GLU A 1 328 ? 3.939   -15.188 4.108   1.00 74.70  ? 328  GLU A CG  1 
ATOM   2570 C CD  . GLU A 1 328 ? 2.532   -15.103 3.622   1.00 88.23  ? 328  GLU A CD  1 
ATOM   2571 O OE1 . GLU A 1 328 ? 1.899   -16.176 3.481   1.00 96.05  ? 328  GLU A OE1 1 
ATOM   2572 O OE2 . GLU A 1 328 ? 2.071   -13.967 3.369   1.00 95.05  ? 328  GLU A OE2 1 
ATOM   2573 N N   . ILE A 1 329 ? 6.400   -14.120 6.289   1.00 45.52  ? 329  ILE A N   1 
ATOM   2574 C CA  . ILE A 1 329 ? 6.701   -13.027 7.205   1.00 44.34  ? 329  ILE A CA  1 
ATOM   2575 C C   . ILE A 1 329 ? 6.111   -11.664 6.878   1.00 47.38  ? 329  ILE A C   1 
ATOM   2576 O O   . ILE A 1 329 ? 5.992   -11.290 5.713   1.00 54.08  ? 329  ILE A O   1 
ATOM   2577 C CB  . ILE A 1 329 ? 8.196   -12.827 7.295   1.00 43.73  ? 329  ILE A CB  1 
ATOM   2578 C CG1 . ILE A 1 329 ? 8.866   -14.189 7.398   1.00 43.06  ? 329  ILE A CG1 1 
ATOM   2579 C CG2 . ILE A 1 329 ? 8.532   -11.928 8.478   1.00 38.21  ? 329  ILE A CG2 1 
ATOM   2580 C CD1 . ILE A 1 329 ? 10.347  -14.127 7.611   1.00 40.26  ? 329  ILE A CD1 1 
ATOM   2581 N N   . GLN A 1 330 ? 5.778   -10.914 7.928   1.00 43.55  ? 330  GLN A N   1 
ATOM   2582 C CA  . GLN A 1 330 ? 5.230   -9.578  7.773   1.00 47.32  ? 330  GLN A CA  1 
ATOM   2583 C C   . GLN A 1 330 ? 5.798   -8.587  8.775   1.00 54.56  ? 330  GLN A C   1 
ATOM   2584 O O   . GLN A 1 330 ? 6.164   -8.942  9.913   1.00 48.68  ? 330  GLN A O   1 
ATOM   2585 C CB  . GLN A 1 330 ? 3.719   -9.577  7.953   1.00 55.89  ? 330  GLN A CB  1 
ATOM   2586 C CG  . GLN A 1 330 ? 2.950   -10.524 7.057   1.00 69.40  ? 330  GLN A CG  1 
ATOM   2587 C CD  . GLN A 1 330 ? 2.712   -11.867 7.715   1.00 68.56  ? 330  GLN A CD  1 
ATOM   2588 O OE1 . GLN A 1 330 ? 2.639   -11.963 8.954   1.00 43.81  ? 330  GLN A OE1 1 
ATOM   2589 N NE2 . GLN A 1 330 ? 2.569   -12.915 6.890   1.00 70.90  ? 330  GLN A NE2 1 
ATOM   2590 N N   . LYS A 1 331 ? 5.854   -7.330  8.340   1.00 60.20  ? 331  LYS A N   1 
ATOM   2591 C CA  . LYS A 1 331 ? 6.319   -6.246  9.195   1.00 60.99  ? 331  LYS A CA  1 
ATOM   2592 C C   . LYS A 1 331 ? 5.048   -5.782  9.897   1.00 65.19  ? 331  LYS A C   1 
ATOM   2593 O O   . LYS A 1 331 ? 4.058   -5.452  9.244   1.00 65.85  ? 331  LYS A O   1 
ATOM   2594 C CB  . LYS A 1 331 ? 6.895   -5.103  8.364   1.00 57.31  ? 331  LYS A CB  1 
ATOM   2595 C CG  . LYS A 1 331 ? 7.563   -4.050  9.226   1.00 67.73  ? 331  LYS A CG  1 
ATOM   2596 C CD  . LYS A 1 331 ? 8.079   -2.852  8.426   1.00 74.90  ? 331  LYS A CD  1 
ATOM   2597 C CE  . LYS A 1 331 ? 8.750   -1.832  9.368   1.00 82.34  ? 331  LYS A CE  1 
ATOM   2598 N NZ  . LYS A 1 331 ? 8.909   -0.457  8.804   1.00 89.98  ? 331  LYS A NZ  1 
ATOM   2599 N N   . GLN A 1 332 ? 5.068   -5.766  11.219  1.00 63.82  ? 332  GLN A N   1 
ATOM   2600 C CA  . GLN A 1 332 ? 3.883   -5.388  11.963  1.00 67.63  ? 332  GLN A CA  1 
ATOM   2601 C C   . GLN A 1 332 ? 4.046   -4.040  12.624  1.00 74.73  ? 332  GLN A C   1 
ATOM   2602 O O   . GLN A 1 332 ? 3.108   -3.490  13.201  1.00 83.53  ? 332  GLN A O   1 
ATOM   2603 C CB  . GLN A 1 332 ? 3.608   -6.438  13.022  1.00 69.70  ? 332  GLN A CB  1 
ATOM   2604 C CG  . GLN A 1 332 ? 2.336   -6.242  13.809  1.00 75.73  ? 332  GLN A CG  1 
ATOM   2605 C CD  . GLN A 1 332 ? 2.370   -6.985  15.143  1.00 89.59  ? 332  GLN A CD  1 
ATOM   2606 O OE1 . GLN A 1 332 ? 3.142   -6.638  16.040  1.00 98.41  ? 332  GLN A OE1 1 
ATOM   2607 N NE2 . GLN A 1 332 ? 1.539   -8.012  15.276  1.00 90.43  ? 332  GLN A NE2 1 
ATOM   2608 N N   . GLY A 1 333 ? 5.249   -3.507  12.552  1.00 73.41  ? 333  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 333 ? 5.497   -2.216  13.158  1.00 77.29  ? 333  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 333 ? 6.950   -1.894  12.920  1.00 77.02  ? 333  GLY A C   1 
ATOM   2611 O O   . GLY A 1 333 ? 7.644   -2.697  12.292  1.00 73.64  ? 333  GLY A O   1 
ATOM   2612 N N   . GLN A 1 334 ? 7.416   -0.731  13.370  1.00 78.88  ? 334  GLN A N   1 
ATOM   2613 C CA  . GLN A 1 334 ? 8.825   -0.423  13.185  1.00 79.60  ? 334  GLN A CA  1 
ATOM   2614 C C   . GLN A 1 334 ? 9.420   -1.393  14.190  1.00 82.78  ? 334  GLN A C   1 
ATOM   2615 O O   . GLN A 1 334 ? 9.014   -1.392  15.365  1.00 80.96  ? 334  GLN A O   1 
ATOM   2616 C CB  . GLN A 1 334 ? 9.165   1.023   13.576  1.00 68.87  ? 334  GLN A CB  1 
ATOM   2617 C CG  . GLN A 1 334 ? 10.636  1.357   13.365  1.00 62.36  ? 334  GLN A CG  1 
ATOM   2618 C CD  . GLN A 1 334 ? 11.130  2.500   14.253  1.00 81.56  ? 334  GLN A CD  1 
ATOM   2619 O OE1 . GLN A 1 334 ? 10.632  2.697   15.367  1.00 91.77  ? 334  GLN A OE1 1 
ATOM   2620 N NE2 . GLN A 1 334 ? 12.136  3.244   13.773  1.00 76.37  ? 334  GLN A NE2 1 
ATOM   2621 N N   . GLY A 1 335 ? 10.329  -2.249  13.716  1.00 78.08  ? 335  GLY A N   1 
ATOM   2622 C CA  . GLY A 1 335 ? 10.962  -3.238  14.579  1.00 71.78  ? 335  GLY A CA  1 
ATOM   2623 C C   . GLY A 1 335 ? 10.183  -4.515  14.901  1.00 70.84  ? 335  GLY A C   1 
ATOM   2624 O O   . GLY A 1 335 ? 10.706  -5.379  15.611  1.00 66.77  ? 335  GLY A O   1 
ATOM   2625 N N   . GLN A 1 336 ? 8.947   -4.637  14.399  1.00 73.31  ? 336  GLN A N   1 
ATOM   2626 C CA  . GLN A 1 336 ? 8.112   -5.823  14.632  1.00 68.41  ? 336  GLN A CA  1 
ATOM   2627 C C   . GLN A 1 336 ? 7.797   -6.636  13.400  1.00 66.64  ? 336  GLN A C   1 
ATOM   2628 O O   . GLN A 1 336 ? 7.385   -6.132  12.349  1.00 66.85  ? 336  GLN A O   1 
ATOM   2629 C CB  . GLN A 1 336 ? 6.787   -5.464  15.282  1.00 78.99  ? 336  GLN A CB  1 
ATOM   2630 C CG  . GLN A 1 336 ? 6.715   -5.868  16.731  1.00 90.77  ? 336  GLN A CG  1 
ATOM   2631 C CD  . GLN A 1 336 ? 6.878   -4.682  17.637  1.00 99.09  ? 336  GLN A CD  1 
ATOM   2632 O OE1 . GLN A 1 336 ? 7.590   -4.758  18.639  1.00 98.52  ? 336  GLN A OE1 1 
ATOM   2633 N NE2 . GLN A 1 336 ? 6.213   -3.567  17.294  1.00 105.09 ? 336  GLN A NE2 1 
ATOM   2634 N N   . TRP A 1 337 ? 7.949   -7.930  13.569  1.00 61.42  ? 337  TRP A N   1 
ATOM   2635 C CA  . TRP A 1 337 ? 7.723   -8.834  12.487  1.00 53.86  ? 337  TRP A CA  1 
ATOM   2636 C C   . TRP A 1 337 ? 6.842   -9.940  12.986  1.00 56.72  ? 337  TRP A C   1 
ATOM   2637 O O   . TRP A 1 337 ? 6.898   -10.331 14.153  1.00 59.56  ? 337  TRP A O   1 
ATOM   2638 C CB  . TRP A 1 337 ? 9.061   -9.382  12.037  1.00 45.44  ? 337  TRP A CB  1 
ATOM   2639 C CG  . TRP A 1 337 ? 9.990   -8.303  11.605  1.00 53.32  ? 337  TRP A CG  1 
ATOM   2640 C CD1 . TRP A 1 337 ? 10.817  -7.536  12.394  1.00 46.51  ? 337  TRP A CD1 1 
ATOM   2641 C CD2 . TRP A 1 337 ? 10.145  -7.821  10.274  1.00 54.41  ? 337  TRP A CD2 1 
ATOM   2642 N NE1 . TRP A 1 337 ? 11.474  -6.604  11.623  1.00 33.83  ? 337  TRP A NE1 1 
ATOM   2643 C CE2 . TRP A 1 337 ? 11.080  -6.758  10.318  1.00 44.69  ? 337  TRP A CE2 1 
ATOM   2644 C CE3 . TRP A 1 337 ? 9.581   -8.184  9.040   1.00 48.64  ? 337  TRP A CE3 1 
ATOM   2645 C CZ2 . TRP A 1 337 ? 11.459  -6.056  9.172   1.00 46.91  ? 337  TRP A CZ2 1 
ATOM   2646 C CZ3 . TRP A 1 337 ? 9.956   -7.486  7.901   1.00 47.74  ? 337  TRP A CZ3 1 
ATOM   2647 C CH2 . TRP A 1 337 ? 10.888  -6.430  7.975   1.00 48.77  ? 337  TRP A CH2 1 
ATOM   2648 N N   . THR A 1 338 ? 6.012   -10.446 12.100  1.00 51.89  ? 338  THR A N   1 
ATOM   2649 C CA  . THR A 1 338 ? 5.135   -11.515 12.483  1.00 46.11  ? 338  THR A CA  1 
ATOM   2650 C C   . THR A 1 338 ? 5.301   -12.558 11.433  1.00 49.52  ? 338  THR A C   1 
ATOM   2651 O O   . THR A 1 338 ? 5.612   -12.239 10.283  1.00 41.87  ? 338  THR A O   1 
ATOM   2652 C CB  . THR A 1 338 ? 3.711   -11.049 12.491  1.00 35.67  ? 338  THR A CB  1 
ATOM   2653 O OG1 . THR A 1 338 ? 3.439   -10.370 11.259  1.00 36.55  ? 338  THR A OG1 1 
ATOM   2654 C CG2 . THR A 1 338 ? 3.493   -10.105 13.644  1.00 37.93  ? 338  THR A CG2 1 
ATOM   2655 N N   . TYR A 1 339 ? 5.092   -13.807 11.824  1.00 47.47  ? 339  TYR A N   1 
ATOM   2656 C CA  . TYR A 1 339 ? 5.233   -14.880 10.876  1.00 44.54  ? 339  TYR A CA  1 
ATOM   2657 C C   . TYR A 1 339 ? 4.337   -16.029 11.223  1.00 47.28  ? 339  TYR A C   1 
ATOM   2658 O O   . TYR A 1 339 ? 3.819   -16.130 12.336  1.00 49.34  ? 339  TYR A O   1 
ATOM   2659 C CB  . TYR A 1 339 ? 6.663   -15.355 10.866  1.00 44.22  ? 339  TYR A CB  1 
ATOM   2660 C CG  . TYR A 1 339 ? 7.006   -16.186 12.064  1.00 48.58  ? 339  TYR A CG  1 
ATOM   2661 C CD1 . TYR A 1 339 ? 6.771   -17.566 12.066  1.00 52.64  ? 339  TYR A CD1 1 
ATOM   2662 C CD2 . TYR A 1 339 ? 7.588   -15.611 13.196  1.00 49.90  ? 339  TYR A CD2 1 
ATOM   2663 C CE1 . TYR A 1 339 ? 7.118   -18.364 13.170  1.00 51.21  ? 339  TYR A CE1 1 
ATOM   2664 C CE2 . TYR A 1 339 ? 7.940   -16.398 14.309  1.00 48.23  ? 339  TYR A CE2 1 
ATOM   2665 C CZ  . TYR A 1 339 ? 7.700   -17.773 14.282  1.00 48.50  ? 339  TYR A CZ  1 
ATOM   2666 O OH  . TYR A 1 339 ? 8.023   -18.561 15.349  1.00 58.89  ? 339  TYR A OH  1 
ATOM   2667 N N   . GLN A 1 340 ? 4.152   -16.884 10.232  1.00 47.08  ? 340  GLN A N   1 
ATOM   2668 C CA  . GLN A 1 340 ? 3.350   -18.077 10.373  1.00 51.34  ? 340  GLN A CA  1 
ATOM   2669 C C   . GLN A 1 340 ? 3.966   -19.089 9.442   1.00 54.68  ? 340  GLN A C   1 
ATOM   2670 O O   . GLN A 1 340 ? 4.475   -18.752 8.356   1.00 47.11  ? 340  GLN A O   1 
ATOM   2671 C CB  . GLN A 1 340 ? 1.903   -17.842 9.968   1.00 50.66  ? 340  GLN A CB  1 
ATOM   2672 C CG  . GLN A 1 340 ? 1.749   -16.900 8.809   1.00 61.32  ? 340  GLN A CG  1 
ATOM   2673 C CD  . GLN A 1 340 ? 1.668   -15.456 9.280   1.00 70.85  ? 340  GLN A CD  1 
ATOM   2674 O OE1 . GLN A 1 340 ? 1.692   -14.531 8.466   1.00 73.40  ? 340  GLN A OE1 1 
ATOM   2675 N NE2 . GLN A 1 340 ? 1.557   -15.254 10.607  1.00 66.74  ? 340  GLN A NE2 1 
ATOM   2676 N N   . ILE A 1 341 ? 3.929   -20.333 9.895   1.00 55.52  ? 341  ILE A N   1 
ATOM   2677 C CA  . ILE A 1 341 ? 4.473   -21.441 9.146   1.00 55.46  ? 341  ILE A CA  1 
ATOM   2678 C C   . ILE A 1 341 ? 3.339   -22.417 8.949   1.00 58.98  ? 341  ILE A C   1 
ATOM   2679 O O   . ILE A 1 341 ? 2.676   -22.821 9.913   1.00 51.65  ? 341  ILE A O   1 
ATOM   2680 C CB  . ILE A 1 341 ? 5.592   -22.100 9.930   1.00 45.90  ? 341  ILE A CB  1 
ATOM   2681 C CG1 . ILE A 1 341 ? 6.642   -21.052 10.248  1.00 48.93  ? 341  ILE A CG1 1 
ATOM   2682 C CG2 . ILE A 1 341 ? 6.217   -23.205 9.127   1.00 34.24  ? 341  ILE A CG2 1 
ATOM   2683 C CD1 . ILE A 1 341 ? 7.789   -21.585 10.992  1.00 42.52  ? 341  ILE A CD1 1 
ATOM   2684 N N   . TYR A 1 342 ? 3.121   -22.794 7.697   1.00 60.00  ? 342  TYR A N   1 
ATOM   2685 C CA  . TYR A 1 342 ? 2.038   -23.702 7.378   1.00 63.79  ? 342  TYR A CA  1 
ATOM   2686 C C   . TYR A 1 342 ? 2.363   -24.634 6.214   1.00 68.55  ? 342  TYR A C   1 
ATOM   2687 O O   . TYR A 1 342 ? 3.375   -24.460 5.521   1.00 69.10  ? 342  TYR A O   1 
ATOM   2688 C CB  . TYR A 1 342 ? 0.805   -22.872 7.052   1.00 65.45  ? 342  TYR A CB  1 
ATOM   2689 C CG  . TYR A 1 342 ? 1.034   -21.890 5.925   1.00 73.10  ? 342  TYR A CG  1 
ATOM   2690 C CD1 . TYR A 1 342 ? 1.146   -22.333 4.598   1.00 74.26  ? 342  TYR A CD1 1 
ATOM   2691 C CD2 . TYR A 1 342 ? 1.145   -20.513 6.177   1.00 82.26  ? 342  TYR A CD2 1 
ATOM   2692 C CE1 . TYR A 1 342 ? 1.367   -21.426 3.538   1.00 74.03  ? 342  TYR A CE1 1 
ATOM   2693 C CE2 . TYR A 1 342 ? 1.362   -19.588 5.129   1.00 80.66  ? 342  TYR A CE2 1 
ATOM   2694 C CZ  . TYR A 1 342 ? 1.474   -20.048 3.812   1.00 75.38  ? 342  TYR A CZ  1 
ATOM   2695 O OH  . TYR A 1 342 ? 1.701   -19.142 2.785   1.00 61.64  ? 342  TYR A OH  1 
ATOM   2696 N N   . GLN A 1 343 ? 1.508   -25.634 6.010   1.00 69.14  ? 343  GLN A N   1 
ATOM   2697 C CA  . GLN A 1 343 ? 1.695   -26.566 4.904   1.00 72.70  ? 343  GLN A CA  1 
ATOM   2698 C C   . GLN A 1 343 ? 0.573   -26.327 3.896   1.00 74.96  ? 343  GLN A C   1 
ATOM   2699 O O   . GLN A 1 343 ? 0.757   -26.476 2.697   1.00 71.99  ? 343  GLN A O   1 
ATOM   2700 C CB  . GLN A 1 343 ? 1.703   -28.013 5.410   1.00 71.08  ? 343  GLN A CB  1 
ATOM   2701 C CG  . GLN A 1 343 ? 2.961   -28.355 6.199   1.00 57.58  ? 343  GLN A CG  1 
ATOM   2702 C CD  . GLN A 1 343 ? 2.990   -29.784 6.730   1.00 64.21  ? 343  GLN A CD  1 
ATOM   2703 O OE1 . GLN A 1 343 ? 2.234   -30.145 7.646   1.00 62.64  ? 343  GLN A OE1 1 
ATOM   2704 N NE2 . GLN A 1 343 ? 3.872   -30.604 6.158   1.00 52.34  ? 343  GLN A NE2 1 
ATOM   2705 N N   . GLU A 1 344 ? -0.595  -25.948 4.394   1.00 82.28  ? 344  GLU A N   1 
ATOM   2706 C CA  . GLU A 1 344 ? -1.735  -25.640 3.539   1.00 84.28  ? 344  GLU A CA  1 
ATOM   2707 C C   . GLU A 1 344 ? -2.088  -24.231 3.941   1.00 86.53  ? 344  GLU A C   1 
ATOM   2708 O O   . GLU A 1 344 ? -2.018  -23.882 5.114   1.00 91.61  ? 344  GLU A O   1 
ATOM   2709 C CB  . GLU A 1 344 ? -2.923  -26.547 3.836   1.00 91.91  ? 344  GLU A CB  1 
ATOM   2710 C CG  . GLU A 1 344 ? -2.956  -27.858 3.076   1.00 105.57 ? 344  GLU A CG  1 
ATOM   2711 C CD  . GLU A 1 344 ? -3.903  -28.877 3.713   1.00 116.50 ? 344  GLU A CD  1 
ATOM   2712 O OE1 . GLU A 1 344 ? -3.461  -29.600 4.636   1.00 118.61 ? 344  GLU A OE1 1 
ATOM   2713 O OE2 . GLU A 1 344 ? -5.087  -28.945 3.305   1.00 115.66 ? 344  GLU A OE2 1 
ATOM   2714 N N   . PRO A 1 345 ? -2.480  -23.404 2.977   1.00 87.26  ? 345  PRO A N   1 
ATOM   2715 C CA  . PRO A 1 345 ? -2.860  -21.994 3.164   1.00 86.93  ? 345  PRO A CA  1 
ATOM   2716 C C   . PRO A 1 345 ? -3.633  -21.728 4.441   1.00 88.38  ? 345  PRO A C   1 
ATOM   2717 O O   . PRO A 1 345 ? -4.649  -22.358 4.691   1.00 89.69  ? 345  PRO A O   1 
ATOM   2718 C CB  . PRO A 1 345 ? -3.687  -21.693 1.928   1.00 87.28  ? 345  PRO A CB  1 
ATOM   2719 C CG  . PRO A 1 345 ? -3.013  -22.547 0.888   1.00 96.98  ? 345  PRO A CG  1 
ATOM   2720 C CD  . PRO A 1 345 ? -2.751  -23.856 1.604   1.00 88.03  ? 345  PRO A CD  1 
ATOM   2721 N N   . PHE A 1 346 ? -3.139  -20.791 5.246   1.00 93.98  ? 346  PHE A N   1 
ATOM   2722 C CA  . PHE A 1 346 ? -3.774  -20.421 6.512   1.00 100.22 ? 346  PHE A CA  1 
ATOM   2723 C C   . PHE A 1 346 ? -3.922  -21.588 7.487   1.00 101.61 ? 346  PHE A C   1 
ATOM   2724 O O   . PHE A 1 346 ? -4.376  -21.396 8.620   1.00 105.53 ? 346  PHE A O   1 
ATOM   2725 C CB  . PHE A 1 346 ? -5.142  -19.793 6.248   1.00 110.89 ? 346  PHE A CB  1 
ATOM   2726 C CG  . PHE A 1 346 ? -5.121  -18.743 5.177   1.00 118.35 ? 346  PHE A CG  1 
ATOM   2727 C CD1 . PHE A 1 346 ? -4.804  -19.087 3.859   1.00 113.58 ? 346  PHE A CD1 1 
ATOM   2728 C CD2 . PHE A 1 346 ? -5.380  -17.408 5.488   1.00 116.31 ? 346  PHE A CD2 1 
ATOM   2729 C CE1 . PHE A 1 346 ? -4.740  -18.131 2.874   1.00 108.57 ? 346  PHE A CE1 1 
ATOM   2730 C CE2 . PHE A 1 346 ? -5.320  -16.435 4.502   1.00 115.06 ? 346  PHE A CE2 1 
ATOM   2731 C CZ  . PHE A 1 346 ? -4.997  -16.800 3.194   1.00 110.98 ? 346  PHE A CZ  1 
ATOM   2732 N N   . LYS A 1 347 ? -3.538  -22.788 7.045   1.00 96.45  ? 347  LYS A N   1 
ATOM   2733 C CA  . LYS A 1 347 ? -3.613  -23.989 7.878   1.00 90.26  ? 347  LYS A CA  1 
ATOM   2734 C C   . LYS A 1 347 ? -2.354  -24.061 8.748   1.00 87.48  ? 347  LYS A C   1 
ATOM   2735 O O   . LYS A 1 347 ? -1.498  -24.962 8.599   1.00 80.42  ? 347  LYS A O   1 
ATOM   2736 C CB  . LYS A 1 347 ? -3.740  -25.247 7.005   1.00 94.02  ? 347  LYS A CB  1 
ATOM   2737 C CG  . LYS A 1 347 ? -4.946  -26.144 7.367   1.00 94.84  ? 347  LYS A CG  1 
ATOM   2738 C CD  . LYS A 1 347 ? -4.919  -27.488 6.627   1.00 87.73  ? 347  LYS A CD  1 
ATOM   2739 C CE  . LYS A 1 347 ? -6.051  -28.407 7.070   1.00 79.93  ? 347  LYS A CE  1 
ATOM   2740 N NZ  . LYS A 1 347 ? -5.850  -29.780 6.522   1.00 84.66  ? 347  LYS A NZ  1 
ATOM   2741 N N   . ASN A 1 348 ? -2.280  -23.085 9.656   1.00 87.05  ? 348  ASN A N   1 
ATOM   2742 C CA  . ASN A 1 348 ? -1.176  -22.892 10.596  1.00 82.19  ? 348  ASN A CA  1 
ATOM   2743 C C   . ASN A 1 348 ? -0.727  -24.122 11.363  1.00 76.70  ? 348  ASN A C   1 
ATOM   2744 O O   . ASN A 1 348 ? -1.542  -24.954 11.779  1.00 81.04  ? 348  ASN A O   1 
ATOM   2745 C CB  . ASN A 1 348 ? -1.529  -21.814 11.642  1.00 81.17  ? 348  ASN A CB  1 
ATOM   2746 C CG  . ASN A 1 348 ? -1.451  -20.388 11.096  1.00 80.42  ? 348  ASN A CG  1 
ATOM   2747 O OD1 . ASN A 1 348 ? -0.914  -20.143 10.009  1.00 81.12  ? 348  ASN A OD1 1 
ATOM   2748 N ND2 . ASN A 1 348 ? -1.973  -19.435 11.871  1.00 66.83  ? 348  ASN A ND2 1 
ATOM   2749 N N   . LEU A 1 349 ? 0.584   -24.227 11.539  1.00 65.24  ? 349  LEU A N   1 
ATOM   2750 C CA  . LEU A 1 349 ? 1.143   -25.293 12.337  1.00 53.79  ? 349  LEU A CA  1 
ATOM   2751 C C   . LEU A 1 349 ? 1.575   -24.441 13.496  1.00 59.50  ? 349  LEU A C   1 
ATOM   2752 O O   . LEU A 1 349 ? 1.342   -24.766 14.661  1.00 70.39  ? 349  LEU A O   1 
ATOM   2753 C CB  . LEU A 1 349 ? 2.369   -25.897 11.695  1.00 49.21  ? 349  LEU A CB  1 
ATOM   2754 C CG  . LEU A 1 349 ? 2.262   -26.424 10.268  1.00 56.23  ? 349  LEU A CG  1 
ATOM   2755 C CD1 . LEU A 1 349 ? 3.595   -27.099 9.956   1.00 54.46  ? 349  LEU A CD1 1 
ATOM   2756 C CD2 . LEU A 1 349 ? 1.113   -27.417 10.101  1.00 60.18  ? 349  LEU A CD2 1 
ATOM   2757 N N   . LYS A 1 350 ? 2.166   -23.304 13.159  1.00 52.27  ? 350  LYS A N   1 
ATOM   2758 C CA  . LYS A 1 350 ? 2.628   -22.412 14.189  1.00 51.39  ? 350  LYS A CA  1 
ATOM   2759 C C   . LYS A 1 350 ? 2.807   -21.013 13.625  1.00 57.46  ? 350  LYS A C   1 
ATOM   2760 O O   . LYS A 1 350 ? 3.067   -20.845 12.416  1.00 60.12  ? 350  LYS A O   1 
ATOM   2761 C CB  . LYS A 1 350 ? 3.955   -22.943 14.735  1.00 50.24  ? 350  LYS A CB  1 
ATOM   2762 C CG  . LYS A 1 350 ? 4.536   -22.132 15.871  1.00 60.91  ? 350  LYS A CG  1 
ATOM   2763 C CD  . LYS A 1 350 ? 5.994   -22.499 16.097  1.00 60.53  ? 350  LYS A CD  1 
ATOM   2764 C CE  . LYS A 1 350 ? 6.578   -21.755 17.302  1.00 75.45  ? 350  LYS A CE  1 
ATOM   2765 N NZ  . LYS A 1 350 ? 6.718   -20.279 17.105  1.00 81.99  ? 350  LYS A NZ  1 
ATOM   2766 N N   . THR A 1 351 ? 2.652   -20.018 14.505  1.00 58.15  ? 351  THR A N   1 
ATOM   2767 C CA  . THR A 1 351 ? 2.835   -18.606 14.145  1.00 56.33  ? 351  THR A CA  1 
ATOM   2768 C C   . THR A 1 351 ? 3.882   -18.019 15.095  1.00 50.27  ? 351  THR A C   1 
ATOM   2769 O O   . THR A 1 351 ? 4.459   -18.746 15.893  1.00 45.65  ? 351  THR A O   1 
ATOM   2770 C CB  . THR A 1 351 ? 1.529   -17.800 14.285  1.00 56.24  ? 351  THR A CB  1 
ATOM   2771 O OG1 . THR A 1 351 ? 1.059   -17.886 15.635  1.00 63.17  ? 351  THR A OG1 1 
ATOM   2772 C CG2 . THR A 1 351 ? 0.465   -18.343 13.344  1.00 46.05  ? 351  THR A CG2 1 
ATOM   2773 N N   . GLY A 1 352 ? 4.139   -16.718 15.012  1.00 46.66  ? 352  GLY A N   1 
ATOM   2774 C CA  . GLY A 1 352 ? 5.128   -16.138 15.898  1.00 42.53  ? 352  GLY A CA  1 
ATOM   2775 C C   . GLY A 1 352 ? 5.484   -14.709 15.554  1.00 56.07  ? 352  GLY A C   1 
ATOM   2776 O O   . GLY A 1 352 ? 5.154   -14.210 14.466  1.00 54.01  ? 352  GLY A O   1 
ATOM   2777 N N   . LYS A 1 353 ? 6.150   -14.056 16.510  1.00 62.16  ? 353  LYS A N   1 
ATOM   2778 C CA  . LYS A 1 353 ? 6.597   -12.665 16.382  1.00 62.28  ? 353  LYS A CA  1 
ATOM   2779 C C   . LYS A 1 353 ? 8.106   -12.603 16.525  1.00 60.85  ? 353  LYS A C   1 
ATOM   2780 O O   . LYS A 1 353 ? 8.720   -13.569 16.949  1.00 62.08  ? 353  LYS A O   1 
ATOM   2781 C CB  . LYS A 1 353 ? 6.004   -11.791 17.486  1.00 60.19  ? 353  LYS A CB  1 
ATOM   2782 C CG  . LYS A 1 353 ? 4.616   -11.246 17.243  1.00 60.80  ? 353  LYS A CG  1 
ATOM   2783 C CD  . LYS A 1 353 ? 4.209   -10.341 18.405  1.00 72.67  ? 353  LYS A CD  1 
ATOM   2784 C CE  . LYS A 1 353 ? 4.436   -11.063 19.740  1.00 83.71  ? 353  LYS A CE  1 
ATOM   2785 N NZ  . LYS A 1 353 ? 3.973   -10.345 20.970  1.00 81.61  ? 353  LYS A NZ  1 
ATOM   2786 N N   . TYR A 1 354 ? 8.689   -11.455 16.185  1.00 65.05  ? 354  TYR A N   1 
ATOM   2787 C CA  . TYR A 1 354 ? 10.133  -11.224 16.290  1.00 66.62  ? 354  TYR A CA  1 
ATOM   2788 C C   . TYR A 1 354 ? 10.375  -9.724  16.438  1.00 69.56  ? 354  TYR A C   1 
ATOM   2789 O O   . TYR A 1 354 ? 10.085  -8.956  15.520  1.00 73.46  ? 354  TYR A O   1 
ATOM   2790 C CB  . TYR A 1 354 ? 10.858  -11.754 15.041  1.00 60.89  ? 354  TYR A CB  1 
ATOM   2791 C CG  . TYR A 1 354 ? 12.355  -11.466 14.983  1.00 70.63  ? 354  TYR A CG  1 
ATOM   2792 C CD1 . TYR A 1 354 ? 12.833  -10.179 14.731  1.00 79.72  ? 354  TYR A CD1 1 
ATOM   2793 C CD2 . TYR A 1 354 ? 13.295  -12.482 15.195  1.00 76.03  ? 354  TYR A CD2 1 
ATOM   2794 C CE1 . TYR A 1 354 ? 14.213  -9.903  14.693  1.00 83.24  ? 354  TYR A CE1 1 
ATOM   2795 C CE2 . TYR A 1 354 ? 14.682  -12.217 15.158  1.00 77.10  ? 354  TYR A CE2 1 
ATOM   2796 C CZ  . TYR A 1 354 ? 15.130  -10.919 14.906  1.00 82.49  ? 354  TYR A CZ  1 
ATOM   2797 O OH  . TYR A 1 354 ? 16.481  -10.619 14.866  1.00 90.73  ? 354  TYR A OH  1 
ATOM   2798 N N   . ALA A 1 355 ? 10.896  -9.311  17.593  1.00 77.13  ? 355  ALA A N   1 
ATOM   2799 C CA  . ALA A 1 355 ? 11.172  -7.894  17.850  1.00 85.29  ? 355  ALA A CA  1 
ATOM   2800 C C   . ALA A 1 355 ? 12.656  -7.633  18.117  1.00 93.13  ? 355  ALA A C   1 
ATOM   2801 O O   . ALA A 1 355 ? 13.090  -6.479  18.208  1.00 91.04  ? 355  ALA A O   1 
ATOM   2802 C CB  . ALA A 1 355 ? 10.336  -7.405  19.034  1.00 75.37  ? 355  ALA A CB  1 
ATOM   2803 N N   . ARG A 1 356 ? 13.421  -8.718  18.226  1.00 102.16 ? 356  ARG A N   1 
ATOM   2804 C CA  . ARG A 1 356 ? 14.856  -8.659  18.496  1.00 110.23 ? 356  ARG A CA  1 
ATOM   2805 C C   . ARG A 1 356 ? 15.596  -7.664  17.617  1.00 111.61 ? 356  ARG A C   1 
ATOM   2806 O O   . ARG A 1 356 ? 15.600  -7.782  16.391  1.00 107.16 ? 356  ARG A O   1 
ATOM   2807 C CB  . ARG A 1 356 ? 15.491  -10.045 18.304  1.00 117.54 ? 356  ARG A CB  1 
ATOM   2808 C CG  . ARG A 1 356 ? 16.510  -10.476 19.383  1.00 126.14 ? 356  ARG A CG  1 
ATOM   2809 C CD  . ARG A 1 356 ? 17.972  -10.029 19.160  1.00 130.15 ? 356  ARG A CD  1 
ATOM   2810 N NE  . ARG A 1 356 ? 18.894  -11.174 19.179  1.00 138.89 ? 356  ARG A NE  1 
ATOM   2811 C CZ  . ARG A 1 356 ? 20.150  -11.141 19.623  1.00 143.77 ? 356  ARG A CZ  1 
ATOM   2812 N NH1 . ARG A 1 356 ? 20.659  -10.012 20.097  1.00 146.70 ? 356  ARG A NH1 1 
ATOM   2813 N NH2 . ARG A 1 356 ? 20.899  -12.243 19.600  1.00 141.12 ? 356  ARG A NH2 1 
ATOM   2814 N N   . MET A 1 357 ? 16.218  -6.681  18.256  1.00 115.93 ? 357  MET A N   1 
ATOM   2815 C CA  . MET A 1 357 ? 17.006  -5.700  17.535  1.00 118.95 ? 357  MET A CA  1 
ATOM   2816 C C   . MET A 1 357 ? 18.461  -5.998  17.909  1.00 120.71 ? 357  MET A C   1 
ATOM   2817 O O   . MET A 1 357 ? 18.852  -5.888  19.080  1.00 119.07 ? 357  MET A O   1 
ATOM   2818 C CB  . MET A 1 357 ? 16.615  -4.272  17.939  1.00 120.93 ? 357  MET A CB  1 
ATOM   2819 C CG  . MET A 1 357 ? 17.066  -3.221  16.927  1.00 121.87 ? 357  MET A CG  1 
ATOM   2820 S SD  . MET A 1 357 ? 16.444  -1.566  17.250  1.00 123.92 ? 357  MET A SD  1 
ATOM   2821 C CE  . MET A 1 357 ? 17.962  -0.661  17.392  1.00 114.83 ? 357  MET A CE  1 
ATOM   2822 N N   . ARG A 1 358 ? 19.237  -6.415  16.908  1.00 120.27 ? 358  ARG A N   1 
ATOM   2823 C CA  . ARG A 1 358 ? 20.654  -6.749  17.081  1.00 116.47 ? 358  ARG A CA  1 
ATOM   2824 C C   . ARG A 1 358 ? 21.499  -5.576  16.583  1.00 113.63 ? 358  ARG A C   1 
ATOM   2825 O O   . ARG A 1 358 ? 21.823  -5.494  15.396  1.00 113.36 ? 358  ARG A O   1 
ATOM   2826 C CB  . ARG A 1 358 ? 20.994  -8.019  16.287  1.00 111.37 ? 358  ARG A CB  1 
ATOM   2827 C CG  . ARG A 1 358 ? 20.105  -9.202  16.643  1.00 113.00 ? 358  ARG A CG  1 
ATOM   2828 C CD  . ARG A 1 358 ? 20.388  -10.442 15.815  1.00 113.66 ? 358  ARG A CD  1 
ATOM   2829 N NE  . ARG A 1 358 ? 21.735  -10.969 16.015  1.00 122.44 ? 358  ARG A NE  1 
ATOM   2830 C CZ  . ARG A 1 358 ? 22.051  -12.258 15.910  1.00 131.57 ? 358  ARG A CZ  1 
ATOM   2831 N NH1 . ARG A 1 358 ? 21.108  -13.146 15.614  1.00 141.63 ? 358  ARG A NH1 1 
ATOM   2832 N NH2 . ARG A 1 358 ? 23.306  -12.659 16.088  1.00 129.01 ? 358  ARG A NH2 1 
ATOM   2833 N N   . GLY A 1 359 ? 21.853  -4.676  17.498  1.00 106.64 ? 359  GLY A N   1 
ATOM   2834 C CA  . GLY A 1 359 ? 22.630  -3.503  17.137  1.00 95.04  ? 359  GLY A CA  1 
ATOM   2835 C C   . GLY A 1 359 ? 21.792  -2.281  17.448  1.00 90.32  ? 359  GLY A C   1 
ATOM   2836 O O   . GLY A 1 359 ? 20.561  -2.344  17.431  1.00 87.11  ? 359  GLY A O   1 
ATOM   2837 N N   . ALA A 1 360 ? 22.438  -1.159  17.726  1.00 88.56  ? 360  ALA A N   1 
ATOM   2838 C CA  . ALA A 1 360 ? 21.682  0.037   18.069  1.00 90.42  ? 360  ALA A CA  1 
ATOM   2839 C C   . ALA A 1 360 ? 20.992  0.617   16.848  1.00 86.76  ? 360  ALA A C   1 
ATOM   2840 O O   . ALA A 1 360 ? 20.065  1.435   16.960  1.00 88.35  ? 360  ALA A O   1 
ATOM   2841 C CB  . ALA A 1 360 ? 22.608  1.077   18.694  1.00 96.11  ? 360  ALA A CB  1 
ATOM   2842 N N   . HIS A 1 361 ? 21.430  0.166   15.680  1.00 76.25  ? 361  HIS A N   1 
ATOM   2843 C CA  . HIS A 1 361 ? 20.898  0.684   14.437  1.00 65.73  ? 361  HIS A CA  1 
ATOM   2844 C C   . HIS A 1 361 ? 20.774  -0.443  13.450  1.00 57.10  ? 361  HIS A C   1 
ATOM   2845 O O   . HIS A 1 361 ? 21.652  -1.287  13.376  1.00 57.40  ? 361  HIS A O   1 
ATOM   2846 C CB  . HIS A 1 361 ? 21.876  1.718   13.893  1.00 77.63  ? 361  HIS A CB  1 
ATOM   2847 C CG  . HIS A 1 361 ? 22.628  2.471   14.960  1.00 92.63  ? 361  HIS A CG  1 
ATOM   2848 N ND1 . HIS A 1 361 ? 22.025  3.399   15.789  1.00 94.57  ? 361  HIS A ND1 1 
ATOM   2849 C CD2 . HIS A 1 361 ? 23.938  2.448   15.315  1.00 87.48  ? 361  HIS A CD2 1 
ATOM   2850 C CE1 . HIS A 1 361 ? 22.930  3.917   16.603  1.00 89.10  ? 361  HIS A CE1 1 
ATOM   2851 N NE2 . HIS A 1 361 ? 24.099  3.358   16.336  1.00 93.80  ? 361  HIS A NE2 1 
ATOM   2852 N N   . THR A 1 362 ? 19.691  -0.472  12.689  1.00 57.37  ? 362  THR A N   1 
ATOM   2853 C CA  . THR A 1 362 ? 19.518  -1.521  11.686  1.00 58.32  ? 362  THR A CA  1 
ATOM   2854 C C   . THR A 1 362 ? 18.650  -1.006  10.583  1.00 56.49  ? 362  THR A C   1 
ATOM   2855 O O   . THR A 1 362 ? 18.278  0.161   10.546  1.00 60.03  ? 362  THR A O   1 
ATOM   2856 C CB  . THR A 1 362 ? 18.758  -2.750  12.219  1.00 59.58  ? 362  THR A CB  1 
ATOM   2857 O OG1 . THR A 1 362 ? 17.952  -2.368  13.340  1.00 66.71  ? 362  THR A OG1 1 
ATOM   2858 C CG2 . THR A 1 362 ? 19.708  -3.864  12.578  1.00 56.36  ? 362  THR A CG2 1 
ATOM   2859 N N   . ASN A 1 363 ? 18.355  -1.896  9.657   1.00 54.87  ? 363  ASN A N   1 
ATOM   2860 C CA  . ASN A 1 363 ? 17.416  -1.566  8.623   1.00 57.64  ? 363  ASN A CA  1 
ATOM   2861 C C   . ASN A 1 363 ? 16.555  -2.797  8.509   1.00 52.34  ? 363  ASN A C   1 
ATOM   2862 O O   . ASN A 1 363 ? 16.865  -3.864  9.055   1.00 49.17  ? 363  ASN A O   1 
ATOM   2863 C CB  . ASN A 1 363 ? 18.069  -1.192  7.290   1.00 63.39  ? 363  ASN A CB  1 
ATOM   2864 C CG  . ASN A 1 363 ? 18.908  -2.271  6.728   1.00 61.35  ? 363  ASN A CG  1 
ATOM   2865 O OD1 . ASN A 1 363 ? 18.470  -3.411  6.558   1.00 68.20  ? 363  ASN A OD1 1 
ATOM   2866 N ND2 . ASN A 1 363 ? 20.136  -1.922  6.412   1.00 45.87  ? 363  ASN A ND2 1 
ATOM   2867 N N   . ASP A 1 364 ? 15.450  -2.639  7.821   1.00 47.26  ? 364  ASP A N   1 
ATOM   2868 C CA  . ASP A 1 364 ? 14.526  -3.729  7.687   1.00 48.28  ? 364  ASP A CA  1 
ATOM   2869 C C   . ASP A 1 364 ? 15.145  -4.920  7.032   1.00 51.80  ? 364  ASP A C   1 
ATOM   2870 O O   . ASP A 1 364 ? 14.817  -6.059  7.356   1.00 54.65  ? 364  ASP A O   1 
ATOM   2871 C CB  . ASP A 1 364 ? 13.319  -3.265  6.901   1.00 56.00  ? 364  ASP A CB  1 
ATOM   2872 C CG  . ASP A 1 364 ? 12.500  -2.237  7.662   1.00 69.80  ? 364  ASP A CG  1 
ATOM   2873 O OD1 . ASP A 1 364 ? 11.724  -1.517  6.989   1.00 82.84  ? 364  ASP A OD1 1 
ATOM   2874 O OD2 . ASP A 1 364 ? 12.629  -2.159  8.920   1.00 64.69  ? 364  ASP A OD2 1 
ATOM   2875 N N   . VAL A 1 365 ? 16.051  -4.660  6.108   1.00 54.41  ? 365  VAL A N   1 
ATOM   2876 C CA  . VAL A 1 365 ? 16.693  -5.755  5.406   1.00 59.52  ? 365  VAL A CA  1 
ATOM   2877 C C   . VAL A 1 365 ? 17.474  -6.635  6.376   1.00 53.21  ? 365  VAL A C   1 
ATOM   2878 O O   . VAL A 1 365 ? 17.373  -7.867  6.348   1.00 37.28  ? 365  VAL A O   1 
ATOM   2879 C CB  . VAL A 1 365 ? 17.643  -5.230  4.320   1.00 60.12  ? 365  VAL A CB  1 
ATOM   2880 C CG1 . VAL A 1 365 ? 18.105  -6.393  3.437   1.00 49.97  ? 365  VAL A CG1 1 
ATOM   2881 C CG2 . VAL A 1 365 ? 16.936  -4.152  3.488   1.00 72.28  ? 365  VAL A CG2 1 
ATOM   2882 N N   . LYS A 1 366 ? 18.255  -5.992  7.233   1.00 53.37  ? 366  LYS A N   1 
ATOM   2883 C CA  . LYS A 1 366 ? 19.037  -6.724  8.205   1.00 47.79  ? 366  LYS A CA  1 
ATOM   2884 C C   . LYS A 1 366 ? 18.059  -7.439  9.140   1.00 45.28  ? 366  LYS A C   1 
ATOM   2885 O O   . LYS A 1 366 ? 18.118  -8.648  9.360   1.00 47.69  ? 366  LYS A O   1 
ATOM   2886 C CB  . LYS A 1 366 ? 19.919  -5.745  8.974   1.00 39.55  ? 366  LYS A CB  1 
ATOM   2887 C CG  . LYS A 1 366 ? 20.959  -6.418  9.829   1.00 47.16  ? 366  LYS A CG  1 
ATOM   2888 C CD  . LYS A 1 366 ? 22.115  -5.480  10.162  1.00 64.15  ? 366  LYS A CD  1 
ATOM   2889 C CE  . LYS A 1 366 ? 23.190  -6.181  11.025  1.00 75.52  ? 366  LYS A CE  1 
ATOM   2890 N NZ  . LYS A 1 366 ? 22.723  -6.519  12.416  1.00 69.21  ? 366  LYS A NZ  1 
ATOM   2891 N N   . GLN A 1 367 ? 17.118  -6.674  9.646   1.00 37.12  ? 367  GLN A N   1 
ATOM   2892 C CA  . GLN A 1 367 ? 16.140  -7.210  10.552  1.00 36.81  ? 367  GLN A CA  1 
ATOM   2893 C C   . GLN A 1 367 ? 15.329  -8.364  9.980   1.00 39.55  ? 367  GLN A C   1 
ATOM   2894 O O   . GLN A 1 367 ? 15.089  -9.362  10.641  1.00 45.06  ? 367  GLN A O   1 
ATOM   2895 C CB  . GLN A 1 367 ? 15.219  -6.084  10.955  1.00 37.35  ? 367  GLN A CB  1 
ATOM   2896 C CG  . GLN A 1 367 ? 14.798  -6.155  12.374  1.00 59.91  ? 367  GLN A CG  1 
ATOM   2897 C CD  . GLN A 1 367 ? 14.254  -4.837  12.834  1.00 72.11  ? 367  GLN A CD  1 
ATOM   2898 O OE1 . GLN A 1 367 ? 13.265  -4.349  12.285  1.00 78.40  ? 367  GLN A OE1 1 
ATOM   2899 N NE2 . GLN A 1 367 ? 14.900  -4.233  13.836  1.00 69.33  ? 367  GLN A NE2 1 
ATOM   2900 N N   . LEU A 1 368 ? 14.883  -8.219  8.751   1.00 44.30  ? 368  LEU A N   1 
ATOM   2901 C CA  . LEU A 1 368 ? 14.087  -9.258  8.134   1.00 45.65  ? 368  LEU A CA  1 
ATOM   2902 C C   . LEU A 1 368 ? 14.932  -10.490 7.965   1.00 48.35  ? 368  LEU A C   1 
ATOM   2903 O O   . LEU A 1 368 ? 14.458  -11.604 8.157   1.00 43.13  ? 368  LEU A O   1 
ATOM   2904 C CB  . LEU A 1 368 ? 13.599  -8.788  6.772   1.00 44.84  ? 368  LEU A CB  1 
ATOM   2905 C CG  . LEU A 1 368 ? 13.283  -9.856  5.731   1.00 36.03  ? 368  LEU A CG  1 
ATOM   2906 C CD1 . LEU A 1 368 ? 12.011  -10.570 6.068   1.00 33.87  ? 368  LEU A CD1 1 
ATOM   2907 C CD2 . LEU A 1 368 ? 13.139  -9.183  4.393   1.00 53.99  ? 368  LEU A CD2 1 
ATOM   2908 N N   . THR A 1 369 ? 16.189  -10.277 7.593   1.00 55.52  ? 369  THR A N   1 
ATOM   2909 C CA  . THR A 1 369 ? 17.097  -11.386 7.373   1.00 64.12  ? 369  THR A CA  1 
ATOM   2910 C C   . THR A 1 369 ? 17.277  -12.093 8.690   1.00 68.77  ? 369  THR A C   1 
ATOM   2911 O O   . THR A 1 369 ? 17.184  -13.309 8.774   1.00 78.97  ? 369  THR A O   1 
ATOM   2912 C CB  . THR A 1 369 ? 18.487  -10.921 6.836   1.00 63.47  ? 369  THR A CB  1 
ATOM   2913 O OG1 . THR A 1 369 ? 18.369  -10.487 5.474   1.00 54.38  ? 369  THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 369 ? 19.470  -12.062 6.870   1.00 71.49  ? 369  THR A CG2 1 
ATOM   2915 N N   . GLU A 1 370 ? 17.515  -11.333 9.739   1.00 64.31  ? 370  GLU A N   1 
ATOM   2916 C CA  . GLU A 1 370 ? 17.698  -11.968 11.024  1.00 60.30  ? 370  GLU A CA  1 
ATOM   2917 C C   . GLU A 1 370 ? 16.456  -12.737 11.427  1.00 57.09  ? 370  GLU A C   1 
ATOM   2918 O O   . GLU A 1 370 ? 16.525  -13.799 12.065  1.00 65.73  ? 370  GLU A O   1 
ATOM   2919 C CB  . GLU A 1 370 ? 18.045  -10.919 12.072  1.00 67.98  ? 370  GLU A CB  1 
ATOM   2920 C CG  . GLU A 1 370 ? 19.460  -10.396 11.921  1.00 72.45  ? 370  GLU A CG  1 
ATOM   2921 C CD  . GLU A 1 370 ? 19.699  -9.140  12.718  1.00 85.89  ? 370  GLU A CD  1 
ATOM   2922 O OE1 . GLU A 1 370 ? 20.854  -8.655  12.707  1.00 84.96  ? 370  GLU A OE1 1 
ATOM   2923 O OE2 . GLU A 1 370 ? 18.733  -8.637  13.350  1.00 94.03  ? 370  GLU A OE2 1 
ATOM   2924 N N   . ALA A 1 371 ? 15.309  -12.207 11.044  1.00 49.14  ? 371  ALA A N   1 
ATOM   2925 C CA  . ALA A 1 371 ? 14.066  -12.864 11.390  1.00 47.94  ? 371  ALA A CA  1 
ATOM   2926 C C   . ALA A 1 371 ? 14.037  -14.235 10.714  1.00 41.78  ? 371  ALA A C   1 
ATOM   2927 O O   . ALA A 1 371 ? 13.565  -15.228 11.270  1.00 43.26  ? 371  ALA A O   1 
ATOM   2928 C CB  . ALA A 1 371 ? 12.896  -11.997 10.949  1.00 46.78  ? 371  ALA A CB  1 
ATOM   2929 N N   . VAL A 1 372 ? 14.575  -14.291 9.513   1.00 41.87  ? 372  VAL A N   1 
ATOM   2930 C CA  . VAL A 1 372 ? 14.599  -15.542 8.785   1.00 48.02  ? 372  VAL A CA  1 
ATOM   2931 C C   . VAL A 1 372 ? 15.449  -16.590 9.506   1.00 45.08  ? 372  VAL A C   1 
ATOM   2932 O O   . VAL A 1 372 ? 15.086  -17.761 9.583   1.00 47.16  ? 372  VAL A O   1 
ATOM   2933 C CB  . VAL A 1 372 ? 15.155  -15.317 7.357   1.00 50.25  ? 372  VAL A CB  1 
ATOM   2934 C CG1 . VAL A 1 372 ? 15.313  -16.642 6.640   1.00 48.96  ? 372  VAL A CG1 1 
ATOM   2935 C CG2 . VAL A 1 372 ? 14.224  -14.390 6.579   1.00 36.75  ? 372  VAL A CG2 1 
ATOM   2936 N N   . GLN A 1 373 ? 16.570  -16.163 10.063  1.00 41.94  ? 373  GLN A N   1 
ATOM   2937 C CA  . GLN A 1 373 ? 17.439  -17.117 10.713  1.00 44.50  ? 373  GLN A CA  1 
ATOM   2938 C C   . GLN A 1 373 ? 16.726  -17.711 11.872  1.00 43.75  ? 373  GLN A C   1 
ATOM   2939 O O   . GLN A 1 373 ? 16.689  -18.930 12.041  1.00 47.04  ? 373  GLN A O   1 
ATOM   2940 C CB  . GLN A 1 373 ? 18.733  -16.465 11.208  1.00 52.54  ? 373  GLN A CB  1 
ATOM   2941 C CG  . GLN A 1 373 ? 19.800  -17.479 11.624  1.00 66.98  ? 373  GLN A CG  1 
ATOM   2942 C CD  . GLN A 1 373 ? 20.045  -18.545 10.550  1.00 77.16  ? 373  GLN A CD  1 
ATOM   2943 O OE1 . GLN A 1 373 ? 20.327  -18.231 9.382   1.00 63.19  ? 373  GLN A OE1 1 
ATOM   2944 N NE2 . GLN A 1 373 ? 19.936  -19.812 10.946  1.00 72.94  ? 373  GLN A NE2 1 
ATOM   2945 N N   . LYS A 1 374 ? 16.147  -16.848 12.682  1.00 40.02  ? 374  LYS A N   1 
ATOM   2946 C CA  . LYS A 1 374 ? 15.468  -17.360 13.844  1.00 45.14  ? 374  LYS A CA  1 
ATOM   2947 C C   . LYS A 1 374 ? 14.497  -18.446 13.416  1.00 45.55  ? 374  LYS A C   1 
ATOM   2948 O O   . LYS A 1 374 ? 14.471  -19.549 13.962  1.00 50.16  ? 374  LYS A O   1 
ATOM   2949 C CB  . LYS A 1 374 ? 14.729  -16.233 14.570  1.00 46.05  ? 374  LYS A CB  1 
ATOM   2950 C CG  . LYS A 1 374 ? 13.737  -16.725 15.636  1.00 63.99  ? 374  LYS A CG  1 
ATOM   2951 C CD  . LYS A 1 374 ? 12.295  -16.347 15.256  1.00 85.82  ? 374  LYS A CD  1 
ATOM   2952 C CE  . LYS A 1 374 ? 11.208  -17.113 16.038  1.00 98.21  ? 374  LYS A CE  1 
ATOM   2953 N NZ  . LYS A 1 374 ? 10.775  -16.473 17.321  1.00 100.69 ? 374  LYS A NZ  1 
ATOM   2954 N N   . ILE A 1 375 ? 13.717  -18.137 12.402  1.00 43.06  ? 375  ILE A N   1 
ATOM   2955 C CA  . ILE A 1 375 ? 12.735  -19.079 11.948  1.00 38.11  ? 375  ILE A CA  1 
ATOM   2956 C C   . ILE A 1 375 ? 13.400  -20.328 11.483  1.00 39.40  ? 375  ILE A C   1 
ATOM   2957 O O   . ILE A 1 375 ? 13.043  -21.428 11.885  1.00 50.30  ? 375  ILE A O   1 
ATOM   2958 C CB  . ILE A 1 375 ? 11.910  -18.456 10.858  1.00 36.40  ? 375  ILE A CB  1 
ATOM   2959 C CG1 . ILE A 1 375 ? 11.129  -17.287 11.478  1.00 35.16  ? 375  ILE A CG1 1 
ATOM   2960 C CG2 . ILE A 1 375 ? 11.014  -19.490 10.226  1.00 32.56  ? 375  ILE A CG2 1 
ATOM   2961 C CD1 . ILE A 1 375 ? 10.017  -16.723 10.621  1.00 45.23  ? 375  ILE A CD1 1 
ATOM   2962 N N   . THR A 1 376 ? 14.410  -20.168 10.663  1.00 37.05  ? 376  THR A N   1 
ATOM   2963 C CA  . THR A 1 376 ? 15.090  -21.337 10.175  1.00 39.78  ? 376  THR A CA  1 
ATOM   2964 C C   . THR A 1 376 ? 15.514  -22.238 11.302  1.00 38.70  ? 376  THR A C   1 
ATOM   2965 O O   . THR A 1 376 ? 15.198  -23.421 11.320  1.00 40.97  ? 376  THR A O   1 
ATOM   2966 C CB  . THR A 1 376 ? 16.315  -20.964 9.420   1.00 48.54  ? 376  THR A CB  1 
ATOM   2967 O OG1 . THR A 1 376 ? 15.951  -20.113 8.317   1.00 39.71  ? 376  THR A OG1 1 
ATOM   2968 C CG2 . THR A 1 376 ? 17.010  -22.234 8.940   1.00 53.31  ? 376  THR A CG2 1 
ATOM   2969 N N   . THR A 1 377 ? 16.242  -21.666 12.242  1.00 41.12  ? 377  THR A N   1 
ATOM   2970 C CA  . THR A 1 377 ? 16.707  -22.431 13.377  1.00 40.00  ? 377  THR A CA  1 
ATOM   2971 C C   . THR A 1 377 ? 15.555  -23.203 14.009  1.00 32.80  ? 377  THR A C   1 
ATOM   2972 O O   . THR A 1 377 ? 15.612  -24.414 14.169  1.00 41.95  ? 377  THR A O   1 
ATOM   2973 C CB  . THR A 1 377 ? 17.328  -21.504 14.426  1.00 43.25  ? 377  THR A CB  1 
ATOM   2974 O OG1 . THR A 1 377 ? 18.468  -20.817 13.865  1.00 32.86  ? 377  THR A OG1 1 
ATOM   2975 C CG2 . THR A 1 377 ? 17.735  -22.315 15.643  1.00 50.89  ? 377  THR A CG2 1 
ATOM   2976 N N   . GLU A 1 378 ? 14.498  -22.482 14.339  1.00 23.24  ? 378  GLU A N   1 
ATOM   2977 C CA  . GLU A 1 378 ? 13.309  -23.045 14.960  1.00 39.74  ? 378  GLU A CA  1 
ATOM   2978 C C   . GLU A 1 378 ? 12.739  -24.273 14.244  1.00 40.36  ? 378  GLU A C   1 
ATOM   2979 O O   . GLU A 1 378 ? 12.257  -25.220 14.868  1.00 41.78  ? 378  GLU A O   1 
ATOM   2980 C CB  . GLU A 1 378 ? 12.263  -21.948 15.014  1.00 52.62  ? 378  GLU A CB  1 
ATOM   2981 C CG  . GLU A 1 378 ? 11.221  -22.113 16.071  1.00 69.56  ? 378  GLU A CG  1 
ATOM   2982 C CD  . GLU A 1 378 ? 10.333  -20.875 16.206  1.00 81.93  ? 378  GLU A CD  1 
ATOM   2983 O OE1 . GLU A 1 378 ? 9.586   -20.539 15.252  1.00 86.90  ? 378  GLU A OE1 1 
ATOM   2984 O OE2 . GLU A 1 378 ? 10.383  -20.230 17.276  1.00 93.03  ? 378  GLU A OE2 1 
ATOM   2985 N N   . SER A 1 379 ? 12.799  -24.254 12.924  1.00 40.09  ? 379  SER A N   1 
ATOM   2986 C CA  . SER A 1 379 ? 12.268  -25.350 12.129  1.00 46.22  ? 379  SER A CA  1 
ATOM   2987 C C   . SER A 1 379 ? 13.114  -26.603 12.170  1.00 43.08  ? 379  SER A C   1 
ATOM   2988 O O   . SER A 1 379 ? 12.603  -27.728 12.284  1.00 42.73  ? 379  SER A O   1 
ATOM   2989 C CB  . SER A 1 379 ? 12.137  -24.915 10.687  1.00 51.00  ? 379  SER A CB  1 
ATOM   2990 O OG  . SER A 1 379 ? 11.341  -23.762 10.627  1.00 47.88  ? 379  SER A OG  1 
ATOM   2991 N N   . ILE A 1 380 ? 14.416  -26.414 12.034  1.00 37.71  ? 380  ILE A N   1 
ATOM   2992 C CA  . ILE A 1 380 ? 15.298  -27.549 12.064  1.00 39.52  ? 380  ILE A CA  1 
ATOM   2993 C C   . ILE A 1 380 ? 15.025  -28.226 13.375  1.00 35.52  ? 380  ILE A C   1 
ATOM   2994 O O   . ILE A 1 380 ? 15.226  -29.429 13.530  1.00 44.44  ? 380  ILE A O   1 
ATOM   2995 C CB  . ILE A 1 380 ? 16.765  -27.104 11.959  1.00 34.34  ? 380  ILE A CB  1 
ATOM   2996 C CG1 . ILE A 1 380 ? 16.976  -26.538 10.571  1.00 25.07  ? 380  ILE A CG1 1 
ATOM   2997 C CG2 . ILE A 1 380 ? 17.762  -28.291 12.121  1.00 24.36  ? 380  ILE A CG2 1 
ATOM   2998 C CD1 . ILE A 1 380 ? 18.294  -25.856 10.438  1.00 56.90  ? 380  ILE A CD1 1 
ATOM   2999 N N   . VAL A 1 381 ? 14.507  -27.474 14.321  1.00 33.10  ? 381  VAL A N   1 
ATOM   3000 C CA  . VAL A 1 381 ? 14.251  -28.100 15.583  1.00 35.47  ? 381  VAL A CA  1 
ATOM   3001 C C   . VAL A 1 381 ? 12.896  -28.764 15.707  1.00 37.05  ? 381  VAL A C   1 
ATOM   3002 O O   . VAL A 1 381 ? 12.765  -29.817 16.334  1.00 39.52  ? 381  VAL A O   1 
ATOM   3003 C CB  . VAL A 1 381 ? 14.444  -27.109 16.689  1.00 33.48  ? 381  VAL A CB  1 
ATOM   3004 C CG1 . VAL A 1 381 ? 13.902  -27.655 17.944  1.00 36.33  ? 381  VAL A CG1 1 
ATOM   3005 C CG2 . VAL A 1 381 ? 15.913  -26.859 16.870  1.00 37.08  ? 381  VAL A CG2 1 
ATOM   3006 N N   . ILE A 1 382 ? 11.876  -28.172 15.111  1.00 38.36  ? 382  ILE A N   1 
ATOM   3007 C CA  . ILE A 1 382 ? 10.564  -28.780 15.232  1.00 36.05  ? 382  ILE A CA  1 
ATOM   3008 C C   . ILE A 1 382 ? 10.283  -29.788 14.153  1.00 36.58  ? 382  ILE A C   1 
ATOM   3009 O O   . ILE A 1 382 ? 9.568   -30.773 14.381  1.00 40.13  ? 382  ILE A O   1 
ATOM   3010 C CB  . ILE A 1 382 ? 9.471   -27.731 15.205  1.00 41.55  ? 382  ILE A CB  1 
ATOM   3011 C CG1 . ILE A 1 382 ? 9.711   -26.751 16.353  1.00 39.99  ? 382  ILE A CG1 1 
ATOM   3012 C CG2 . ILE A 1 382 ? 8.118   -28.387 15.317  1.00 27.52  ? 382  ILE A CG2 1 
ATOM   3013 C CD1 . ILE A 1 382 ? 8.611   -25.748 16.546  1.00 39.46  ? 382  ILE A CD1 1 
ATOM   3014 N N   . TRP A 1 383 ? 10.865  -29.559 12.982  1.00 39.33  ? 383  TRP A N   1 
ATOM   3015 C CA  . TRP A 1 383 ? 10.629  -30.445 11.858  1.00 33.67  ? 383  TRP A CA  1 
ATOM   3016 C C   . TRP A 1 383 ? 11.882  -31.011 11.239  1.00 30.05  ? 383  TRP A C   1 
ATOM   3017 O O   . TRP A 1 383 ? 11.825  -31.885 10.382  1.00 39.72  ? 383  TRP A O   1 
ATOM   3018 C CB  . TRP A 1 383 ? 9.824   -29.702 10.810  1.00 42.18  ? 383  TRP A CB  1 
ATOM   3019 C CG  . TRP A 1 383 ? 8.568   -29.094 11.367  1.00 46.41  ? 383  TRP A CG  1 
ATOM   3020 C CD1 . TRP A 1 383 ? 7.428   -29.753 11.735  1.00 55.04  ? 383  TRP A CD1 1 
ATOM   3021 C CD2 . TRP A 1 383 ? 8.339   -27.706 11.643  1.00 50.42  ? 383  TRP A CD2 1 
ATOM   3022 N NE1 . TRP A 1 383 ? 6.504   -28.857 12.225  1.00 53.84  ? 383  TRP A NE1 1 
ATOM   3023 C CE2 . TRP A 1 383 ? 7.039   -27.595 12.179  1.00 50.03  ? 383  TRP A CE2 1 
ATOM   3024 C CE3 . TRP A 1 383 ? 9.108   -26.547 11.487  1.00 60.99  ? 383  TRP A CE3 1 
ATOM   3025 C CZ2 . TRP A 1 383 ? 6.491   -26.373 12.562  1.00 49.39  ? 383  TRP A CZ2 1 
ATOM   3026 C CZ3 . TRP A 1 383 ? 8.560   -25.332 11.866  1.00 57.93  ? 383  TRP A CZ3 1 
ATOM   3027 C CH2 . TRP A 1 383 ? 7.264   -25.255 12.399  1.00 49.39  ? 383  TRP A CH2 1 
ATOM   3028 N N   . GLY A 1 384 ? 13.024  -30.503 11.641  1.00 27.33  ? 384  GLY A N   1 
ATOM   3029 C CA  . GLY A 1 384 ? 14.228  -31.069 11.098  1.00 36.74  ? 384  GLY A CA  1 
ATOM   3030 C C   . GLY A 1 384 ? 14.476  -30.716 9.655   1.00 46.16  ? 384  GLY A C   1 
ATOM   3031 O O   . GLY A 1 384 ? 15.295  -31.368 8.981   1.00 52.36  ? 384  GLY A O   1 
ATOM   3032 N N   . LYS A 1 385 ? 13.755  -29.707 9.172   1.00 51.82  ? 385  LYS A N   1 
ATOM   3033 C CA  . LYS A 1 385 ? 13.934  -29.203 7.805   1.00 54.74  ? 385  LYS A CA  1 
ATOM   3034 C C   . LYS A 1 385 ? 13.635  -27.710 7.786   1.00 59.93  ? 385  LYS A C   1 
ATOM   3035 O O   . LYS A 1 385 ? 13.015  -27.183 8.723   1.00 58.79  ? 385  LYS A O   1 
ATOM   3036 C CB  . LYS A 1 385 ? 13.043  -29.945 6.792   1.00 43.14  ? 385  LYS A CB  1 
ATOM   3037 C CG  . LYS A 1 385 ? 11.609  -30.142 7.198   1.00 48.23  ? 385  LYS A CG  1 
ATOM   3038 C CD  . LYS A 1 385 ? 10.922  -31.158 6.267   1.00 67.17  ? 385  LYS A CD  1 
ATOM   3039 C CE  . LYS A 1 385 ? 10.580  -30.593 4.876   1.00 65.30  ? 385  LYS A CE  1 
ATOM   3040 N NZ  . LYS A 1 385 ? 9.109   -30.236 4.717   1.00 77.57  ? 385  LYS A NZ  1 
ATOM   3041 N N   . THR A 1 386 ? 14.103  -27.012 6.753   1.00 65.29  ? 386  THR A N   1 
ATOM   3042 C CA  . THR A 1 386 ? 13.841  -25.575 6.668   1.00 68.42  ? 386  THR A CA  1 
ATOM   3043 C C   . THR A 1 386 ? 12.689  -25.320 5.724   1.00 61.67  ? 386  THR A C   1 
ATOM   3044 O O   . THR A 1 386 ? 12.497  -26.043 4.743   1.00 61.32  ? 386  THR A O   1 
ATOM   3045 C CB  . THR A 1 386 ? 15.042  -24.773 6.141   1.00 73.41  ? 386  THR A CB  1 
ATOM   3046 O OG1 . THR A 1 386 ? 15.098  -24.876 4.712   1.00 90.67  ? 386  THR A OG1 1 
ATOM   3047 C CG2 . THR A 1 386 ? 16.341  -25.294 6.753   1.00 66.98  ? 386  THR A CG2 1 
ATOM   3048 N N   . PRO A 1 387 ? 11.900  -24.284 6.009   1.00 55.02  ? 387  PRO A N   1 
ATOM   3049 C CA  . PRO A 1 387 ? 10.775  -23.990 5.135   1.00 53.32  ? 387  PRO A CA  1 
ATOM   3050 C C   . PRO A 1 387 ? 11.133  -23.119 3.941   1.00 50.53  ? 387  PRO A C   1 
ATOM   3051 O O   . PRO A 1 387 ? 12.233  -22.556 3.836   1.00 42.98  ? 387  PRO A O   1 
ATOM   3052 C CB  . PRO A 1 387 ? 9.794   -23.299 6.075   1.00 52.32  ? 387  PRO A CB  1 
ATOM   3053 C CG  . PRO A 1 387 ? 10.706  -22.533 6.971   1.00 28.93  ? 387  PRO A CG  1 
ATOM   3054 C CD  . PRO A 1 387 ? 11.807  -23.526 7.268   1.00 43.06  ? 387  PRO A CD  1 
ATOM   3055 N N   . LYS A 1 388 ? 10.173  -23.039 3.033   1.00 55.31  ? 388  LYS A N   1 
ATOM   3056 C CA  . LYS A 1 388 ? 10.278  -22.215 1.847   1.00 54.41  ? 388  LYS A CA  1 
ATOM   3057 C C   . LYS A 1 388 ? 9.604   -20.912 2.322   1.00 56.27  ? 388  LYS A C   1 
ATOM   3058 O O   . LYS A 1 388 ? 8.459   -20.911 2.803   1.00 54.27  ? 388  LYS A O   1 
ATOM   3059 C CB  . LYS A 1 388 ? 9.503   -22.877 0.699   1.00 58.68  ? 388  LYS A CB  1 
ATOM   3060 C CG  . LYS A 1 388 ? 9.934   -24.335 0.398   1.00 73.37  ? 388  LYS A CG  1 
ATOM   3061 C CD  . LYS A 1 388 ? 8.787   -25.184 -0.213  1.00 95.64  ? 388  LYS A CD  1 
ATOM   3062 C CE  . LYS A 1 388 ? 8.911   -25.416 -1.727  1.00 106.20 ? 388  LYS A CE  1 
ATOM   3063 N NZ  . LYS A 1 388 ? 8.597   -24.219 -2.563  1.00 117.46 ? 388  LYS A NZ  1 
ATOM   3064 N N   . PHE A 1 389 ? 10.334  -19.809 2.218   1.00 60.19  ? 389  PHE A N   1 
ATOM   3065 C CA  . PHE A 1 389 ? 9.823   -18.523 2.675   1.00 54.17  ? 389  PHE A CA  1 
ATOM   3066 C C   . PHE A 1 389 ? 9.123   -17.670 1.649   1.00 48.21  ? 389  PHE A C   1 
ATOM   3067 O O   . PHE A 1 389 ? 9.458   -17.676 0.460   1.00 44.98  ? 389  PHE A O   1 
ATOM   3068 C CB  . PHE A 1 389 ? 10.951  -17.668 3.269   1.00 53.12  ? 389  PHE A CB  1 
ATOM   3069 C CG  . PHE A 1 389 ? 11.539  -18.214 4.547   1.00 60.88  ? 389  PHE A CG  1 
ATOM   3070 C CD1 . PHE A 1 389 ? 12.526  -19.200 4.517   1.00 53.64  ? 389  PHE A CD1 1 
ATOM   3071 C CD2 . PHE A 1 389 ? 11.130  -17.710 5.787   1.00 59.12  ? 389  PHE A CD2 1 
ATOM   3072 C CE1 . PHE A 1 389 ? 13.099  -19.667 5.705   1.00 52.45  ? 389  PHE A CE1 1 
ATOM   3073 C CE2 . PHE A 1 389 ? 11.695  -18.169 6.980   1.00 42.28  ? 389  PHE A CE2 1 
ATOM   3074 C CZ  . PHE A 1 389 ? 12.680  -19.145 6.940   1.00 46.53  ? 389  PHE A CZ  1 
ATOM   3075 N N   . LYS A 1 390 ? 8.161   -16.907 2.155   1.00 53.68  ? 390  LYS A N   1 
ATOM   3076 C CA  . LYS A 1 390 ? 7.385   -15.952 1.368   1.00 58.93  ? 390  LYS A CA  1 
ATOM   3077 C C   . LYS A 1 390 ? 7.720   -14.622 2.053   1.00 55.97  ? 390  LYS A C   1 
ATOM   3078 O O   . LYS A 1 390 ? 7.349   -14.404 3.220   1.00 50.93  ? 390  LYS A O   1 
ATOM   3079 C CB  . LYS A 1 390 ? 5.891   -16.263 1.490   1.00 65.31  ? 390  LYS A CB  1 
ATOM   3080 C CG  . LYS A 1 390 ? 5.546   -17.712 1.198   1.00 68.20  ? 390  LYS A CG  1 
ATOM   3081 C CD  . LYS A 1 390 ? 5.091   -17.916 -0.228  1.00 79.59  ? 390  LYS A CD  1 
ATOM   3082 C CE  . LYS A 1 390 ? 3.655   -17.440 -0.388  1.00 91.20  ? 390  LYS A CE  1 
ATOM   3083 N NZ  . LYS A 1 390 ? 3.096   -17.809 -1.719  1.00 90.19  ? 390  LYS A NZ  1 
ATOM   3084 N N   . LEU A 1 391 ? 8.436   -13.751 1.337   1.00 59.07  ? 391  LEU A N   1 
ATOM   3085 C CA  . LEU A 1 391 ? 8.870   -12.460 1.899   1.00 57.96  ? 391  LEU A CA  1 
ATOM   3086 C C   . LEU A 1 391 ? 8.503   -11.200 1.141   1.00 54.28  ? 391  LEU A C   1 
ATOM   3087 O O   . LEU A 1 391 ? 8.523   -11.146 -0.093  1.00 54.88  ? 391  LEU A O   1 
ATOM   3088 C CB  . LEU A 1 391 ? 10.386  -12.431 2.077   1.00 53.79  ? 391  LEU A CB  1 
ATOM   3089 C CG  . LEU A 1 391 ? 11.029  -13.716 2.603   1.00 46.03  ? 391  LEU A CG  1 
ATOM   3090 C CD1 . LEU A 1 391 ? 12.556  -13.567 2.502   1.00 40.53  ? 391  LEU A CD1 1 
ATOM   3091 C CD2 . LEU A 1 391 ? 10.549  -13.997 4.038   1.00 42.56  ? 391  LEU A CD2 1 
ATOM   3092 N N   . PRO A 1 392 ? 8.216   -10.143 1.895   1.00 53.82  ? 392  PRO A N   1 
ATOM   3093 C CA  . PRO A 1 392 ? 7.835   -8.826  1.390   1.00 60.26  ? 392  PRO A CA  1 
ATOM   3094 C C   . PRO A 1 392 ? 9.040   -7.992  0.979   1.00 61.05  ? 392  PRO A C   1 
ATOM   3095 O O   . PRO A 1 392 ? 9.268   -6.908  1.506   1.00 61.00  ? 392  PRO A O   1 
ATOM   3096 C CB  . PRO A 1 392 ? 7.104   -8.217  2.577   1.00 66.84  ? 392  PRO A CB  1 
ATOM   3097 C CG  . PRO A 1 392 ? 7.927   -8.720  3.736   1.00 59.74  ? 392  PRO A CG  1 
ATOM   3098 C CD  . PRO A 1 392 ? 8.130   -10.184 3.368   1.00 54.85  ? 392  PRO A CD  1 
ATOM   3099 N N   . ILE A 1 393 ? 9.818   -8.500  0.042   1.00 63.67  ? 393  ILE A N   1 
ATOM   3100 C CA  . ILE A 1 393 ? 10.991  -7.772  -0.409  1.00 62.77  ? 393  ILE A CA  1 
ATOM   3101 C C   . ILE A 1 393 ? 11.407  -8.416  -1.710  1.00 68.83  ? 393  ILE A C   1 
ATOM   3102 O O   . ILE A 1 393 ? 11.225  -9.621  -1.885  1.00 72.39  ? 393  ILE A O   1 
ATOM   3103 C CB  . ILE A 1 393 ? 12.162  -7.907  0.588   1.00 56.88  ? 393  ILE A CB  1 
ATOM   3104 C CG1 . ILE A 1 393 ? 13.375  -7.149  0.045   1.00 56.61  ? 393  ILE A CG1 1 
ATOM   3105 C CG2 . ILE A 1 393 ? 12.527  -9.382  0.781   1.00 40.14  ? 393  ILE A CG2 1 
ATOM   3106 C CD1 . ILE A 1 393 ? 14.599  -7.235  0.914   1.00 39.56  ? 393  ILE A CD1 1 
ATOM   3107 N N   . GLN A 1 394 ? 11.944  -7.634  -2.636  1.00 68.05  ? 394  GLN A N   1 
ATOM   3108 C CA  . GLN A 1 394 ? 12.368  -8.247  -3.877  1.00 71.23  ? 394  GLN A CA  1 
ATOM   3109 C C   . GLN A 1 394 ? 13.855  -8.448  -3.910  1.00 72.21  ? 394  GLN A C   1 
ATOM   3110 O O   . GLN A 1 394 ? 14.635  -7.661  -3.364  1.00 70.91  ? 394  GLN A O   1 
ATOM   3111 C CB  . GLN A 1 394 ? 11.914  -7.454  -5.095  1.00 82.85  ? 394  GLN A CB  1 
ATOM   3112 C CG  . GLN A 1 394 ? 11.945  -5.966  -4.939  1.00 87.63  ? 394  GLN A CG  1 
ATOM   3113 C CD  . GLN A 1 394 ? 10.602  -5.364  -5.268  1.00 85.83  ? 394  GLN A CD  1 
ATOM   3114 O OE1 . GLN A 1 394 ? 9.905   -5.817  -6.193  1.00 79.90  ? 394  GLN A OE1 1 
ATOM   3115 N NE2 . GLN A 1 394 ? 10.223  -4.335  -4.516  1.00 88.98  ? 394  GLN A NE2 1 
ATOM   3116 N N   . LYS A 1 395 ? 14.220  -9.541  -4.562  1.00 77.22  ? 395  LYS A N   1 
ATOM   3117 C CA  . LYS A 1 395 ? 15.594  -9.984  -4.705  1.00 77.78  ? 395  LYS A CA  1 
ATOM   3118 C C   . LYS A 1 395 ? 16.537  -8.849  -5.033  1.00 73.62  ? 395  LYS A C   1 
ATOM   3119 O O   . LYS A 1 395 ? 17.630  -8.775  -4.491  1.00 72.84  ? 395  LYS A O   1 
ATOM   3120 C CB  . LYS A 1 395 ? 15.657  -11.069 -5.776  1.00 78.58  ? 395  LYS A CB  1 
ATOM   3121 C CG  . LYS A 1 395 ? 14.351  -11.860 -5.906  1.00 88.84  ? 395  LYS A CG  1 
ATOM   3122 C CD  . LYS A 1 395 ? 13.290  -10.986 -6.572  1.00 106.90 ? 395  LYS A CD  1 
ATOM   3123 C CE  . LYS A 1 395 ? 11.917  -11.615 -6.520  1.00 114.39 ? 395  LYS A CE  1 
ATOM   3124 N NZ  . LYS A 1 395 ? 10.904  -10.629 -6.985  1.00 118.04 ? 395  LYS A NZ  1 
ATOM   3125 N N   . GLU A 1 396 ? 16.114  -7.966  -5.921  1.00 73.38  ? 396  GLU A N   1 
ATOM   3126 C CA  . GLU A 1 396 ? 16.944  -6.840  -6.280  1.00 69.45  ? 396  GLU A CA  1 
ATOM   3127 C C   . GLU A 1 396 ? 17.265  -6.024  -5.024  1.00 62.27  ? 396  GLU A C   1 
ATOM   3128 O O   . GLU A 1 396 ? 18.415  -5.672  -4.792  1.00 59.72  ? 396  GLU A O   1 
ATOM   3129 C CB  . GLU A 1 396 ? 16.220  -5.967  -7.305  1.00 83.19  ? 396  GLU A CB  1 
ATOM   3130 C CG  . GLU A 1 396 ? 17.033  -4.768  -7.810  1.00 106.55 ? 396  GLU A CG  1 
ATOM   3131 C CD  . GLU A 1 396 ? 16.390  -3.409  -7.502  1.00 117.94 ? 396  GLU A CD  1 
ATOM   3132 O OE1 . GLU A 1 396 ? 16.415  -2.976  -6.323  1.00 124.20 ? 396  GLU A OE1 1 
ATOM   3133 O OE2 . GLU A 1 396 ? 15.857  -2.776  -8.448  1.00 117.14 ? 396  GLU A OE2 1 
ATOM   3134 N N   . THR A 1 397 ? 16.259  -5.720  -4.211  1.00 59.55  ? 397  THR A N   1 
ATOM   3135 C CA  . THR A 1 397 ? 16.509  -4.938  -3.008  1.00 57.73  ? 397  THR A CA  1 
ATOM   3136 C C   . THR A 1 397 ? 17.475  -5.687  -2.127  1.00 59.97  ? 397  THR A C   1 
ATOM   3137 O O   . THR A 1 397 ? 18.473  -5.130  -1.666  1.00 48.07  ? 397  THR A O   1 
ATOM   3138 C CB  . THR A 1 397 ? 15.255  -4.727  -2.199  1.00 53.10  ? 397  THR A CB  1 
ATOM   3139 O OG1 . THR A 1 397 ? 14.242  -4.175  -3.030  1.00 63.24  ? 397  THR A OG1 1 
ATOM   3140 C CG2 . THR A 1 397 ? 15.531  -3.769  -1.074  1.00 54.56  ? 397  THR A CG2 1 
ATOM   3141 N N   . TRP A 1 398 ? 17.153  -6.960  -1.898  1.00 68.47  ? 398  TRP A N   1 
ATOM   3142 C CA  . TRP A 1 398 ? 17.967  -7.838  -1.062  1.00 69.68  ? 398  TRP A CA  1 
ATOM   3143 C C   . TRP A 1 398 ? 19.398  -7.847  -1.572  1.00 67.22  ? 398  TRP A C   1 
ATOM   3144 O O   . TRP A 1 398 ? 20.303  -7.282  -0.952  1.00 67.28  ? 398  TRP A O   1 
ATOM   3145 C CB  . TRP A 1 398 ? 17.422  -9.277  -1.076  1.00 76.33  ? 398  TRP A CB  1 
ATOM   3146 C CG  . TRP A 1 398 ? 17.884  -10.066 0.144   1.00 92.96  ? 398  TRP A CG  1 
ATOM   3147 C CD1 . TRP A 1 398 ? 17.432  -9.925  1.435   1.00 89.71  ? 398  TRP A CD1 1 
ATOM   3148 C CD2 . TRP A 1 398 ? 18.950  -11.026 0.206   1.00 102.87 ? 398  TRP A CD2 1 
ATOM   3149 N NE1 . TRP A 1 398 ? 18.151  -10.726 2.290   1.00 80.18  ? 398  TRP A NE1 1 
ATOM   3150 C CE2 . TRP A 1 398 ? 19.089  -11.412 1.567   1.00 95.71  ? 398  TRP A CE2 1 
ATOM   3151 C CE3 . TRP A 1 398 ? 19.804  -11.594 -0.749  1.00 107.96 ? 398  TRP A CE3 1 
ATOM   3152 C CZ2 . TRP A 1 398 ? 20.047  -12.339 1.991   1.00 96.14  ? 398  TRP A CZ2 1 
ATOM   3153 C CZ3 . TRP A 1 398 ? 20.757  -12.520 -0.321  1.00 109.82 ? 398  TRP A CZ3 1 
ATOM   3154 C CH2 . TRP A 1 398 ? 20.868  -12.881 1.039   1.00 102.91 ? 398  TRP A CH2 1 
ATOM   3155 N N   . GLU A 1 399 ? 19.578  -8.509  -2.710  1.00 67.85  ? 399  GLU A N   1 
ATOM   3156 C CA  . GLU A 1 399 ? 20.865  -8.615  -3.360  1.00 72.18  ? 399  GLU A CA  1 
ATOM   3157 C C   . GLU A 1 399 ? 21.640  -7.313  -3.189  1.00 73.92  ? 399  GLU A C   1 
ATOM   3158 O O   . GLU A 1 399 ? 22.776  -7.322  -2.735  1.00 74.33  ? 399  GLU A O   1 
ATOM   3159 C CB  . GLU A 1 399 ? 20.658  -8.930  -4.844  1.00 81.85  ? 399  GLU A CB  1 
ATOM   3160 C CG  . GLU A 1 399 ? 21.898  -9.431  -5.560  1.00 99.51  ? 399  GLU A CG  1 
ATOM   3161 C CD  . GLU A 1 399 ? 21.572  -10.181 -6.845  1.00 114.20 ? 399  GLU A CD  1 
ATOM   3162 O OE1 . GLU A 1 399 ? 22.431  -10.975 -7.301  1.00 123.59 ? 399  GLU A OE1 1 
ATOM   3163 O OE2 . GLU A 1 399 ? 20.464  -9.976  -7.398  1.00 113.23 ? 399  GLU A OE2 1 
ATOM   3164 N N   . THR A 1 400 ? 21.021  -6.192  -3.534  1.00 76.75  ? 400  THR A N   1 
ATOM   3165 C CA  . THR A 1 400 ? 21.685  -4.904  -3.400  1.00 76.68  ? 400  THR A CA  1 
ATOM   3166 C C   . THR A 1 400 ? 22.352  -4.794  -2.056  1.00 75.66  ? 400  THR A C   1 
ATOM   3167 O O   . THR A 1 400 ? 23.553  -4.572  -1.963  1.00 84.67  ? 400  THR A O   1 
ATOM   3168 C CB  . THR A 1 400 ? 20.703  -3.742  -3.504  1.00 84.50  ? 400  THR A CB  1 
ATOM   3169 O OG1 . THR A 1 400 ? 20.342  -3.549  -4.877  1.00 94.72  ? 400  THR A OG1 1 
ATOM   3170 C CG2 . THR A 1 400 ? 21.329  -2.462  -2.939  1.00 78.09  ? 400  THR A CG2 1 
ATOM   3171 N N   . TRP A 1 401 ? 21.558  -4.942  -1.011  1.00 71.42  ? 401  TRP A N   1 
ATOM   3172 C CA  . TRP A 1 401 ? 22.073  -4.849  0.333   1.00 77.16  ? 401  TRP A CA  1 
ATOM   3173 C C   . TRP A 1 401 ? 23.136  -5.881  0.625   1.00 84.58  ? 401  TRP A C   1 
ATOM   3174 O O   . TRP A 1 401 ? 24.262  -5.537  0.990   1.00 84.37  ? 401  TRP A O   1 
ATOM   3175 C CB  . TRP A 1 401 ? 20.957  -5.033  1.320   1.00 79.99  ? 401  TRP A CB  1 
ATOM   3176 C CG  . TRP A 1 401 ? 21.478  -5.200  2.664   1.00 79.85  ? 401  TRP A CG  1 
ATOM   3177 C CD1 . TRP A 1 401 ? 21.711  -6.378  3.319   1.00 62.25  ? 401  TRP A CD1 1 
ATOM   3178 C CD2 . TRP A 1 401 ? 21.850  -4.151  3.552   1.00 87.40  ? 401  TRP A CD2 1 
ATOM   3179 N NE1 . TRP A 1 401 ? 22.203  -6.119  4.573   1.00 84.72  ? 401  TRP A NE1 1 
ATOM   3180 C CE2 . TRP A 1 401 ? 22.298  -4.759  4.745   1.00 91.17  ? 401  TRP A CE2 1 
ATOM   3181 C CE3 . TRP A 1 401 ? 21.848  -2.748  3.457   1.00 92.94  ? 401  TRP A CE3 1 
ATOM   3182 C CZ2 . TRP A 1 401 ? 22.740  -4.013  5.844   1.00 96.62  ? 401  TRP A CZ2 1 
ATOM   3183 C CZ3 . TRP A 1 401 ? 22.287  -2.004  4.544   1.00 100.79 ? 401  TRP A CZ3 1 
ATOM   3184 C CH2 . TRP A 1 401 ? 22.728  -2.641  5.726   1.00 107.08 ? 401  TRP A CH2 1 
ATOM   3185 N N   . TRP A 1 402 ? 22.747  -7.149  0.515   1.00 93.47  ? 402  TRP A N   1 
ATOM   3186 C CA  . TRP A 1 402 ? 23.668  -8.261  0.739   1.00 108.44 ? 402  TRP A CA  1 
ATOM   3187 C C   . TRP A 1 402 ? 24.999  -7.873  0.108   1.00 110.57 ? 402  TRP A C   1 
ATOM   3188 O O   . TRP A 1 402 ? 25.963  -7.501  0.790   1.00 110.47 ? 402  TRP A O   1 
ATOM   3189 C CB  . TRP A 1 402 ? 23.090  -9.556  0.096   1.00 123.56 ? 402  TRP A CB  1 
ATOM   3190 C CG  . TRP A 1 402 ? 24.060  -10.500 -0.699  1.00 142.86 ? 402  TRP A CG  1 
ATOM   3191 C CD1 . TRP A 1 402 ? 25.335  -10.885 -0.343  1.00 150.00 ? 402  TRP A CD1 1 
ATOM   3192 C CD2 . TRP A 1 402 ? 23.770  -11.206 -1.932  1.00 148.04 ? 402  TRP A CD2 1 
ATOM   3193 N NE1 . TRP A 1 402 ? 25.847  -11.776 -1.270  1.00 150.00 ? 402  TRP A NE1 1 
ATOM   3194 C CE2 . TRP A 1 402 ? 24.912  -11.991 -2.250  1.00 150.00 ? 402  TRP A CE2 1 
ATOM   3195 C CE3 . TRP A 1 402 ? 22.658  -11.253 -2.792  1.00 141.85 ? 402  TRP A CE3 1 
ATOM   3196 C CZ2 . TRP A 1 402 ? 24.971  -12.812 -3.395  1.00 146.86 ? 402  TRP A CZ2 1 
ATOM   3197 C CZ3 . TRP A 1 402 ? 22.718  -12.074 -3.931  1.00 137.33 ? 402  TRP A CZ3 1 
ATOM   3198 C CH2 . TRP A 1 402 ? 23.868  -12.839 -4.218  1.00 141.82 ? 402  TRP A CH2 1 
ATOM   3199 N N   . THR A 1 403 ? 25.009  -7.946  -1.212  1.00 112.42 ? 403  THR A N   1 
ATOM   3200 C CA  . THR A 1 403 ? 26.150  -7.622  -2.043  1.00 114.18 ? 403  THR A CA  1 
ATOM   3201 C C   . THR A 1 403 ? 27.104  -6.551  -1.475  1.00 110.83 ? 403  THR A C   1 
ATOM   3202 O O   . THR A 1 403 ? 28.324  -6.638  -1.637  1.00 115.00 ? 403  THR A O   1 
ATOM   3203 C CB  . THR A 1 403 ? 25.610  -7.215  -3.445  1.00 120.14 ? 403  THR A CB  1 
ATOM   3204 O OG1 . THR A 1 403 ? 25.302  -8.404  -4.192  1.00 120.01 ? 403  THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 403 ? 26.598  -6.327  -4.198  1.00 121.31 ? 403  THR A CG2 1 
ATOM   3206 N N   . GLU A 1 404 ? 26.562  -5.564  -0.780  1.00 102.97 ? 404  GLU A N   1 
ATOM   3207 C CA  . GLU A 1 404 ? 27.397  -4.501  -0.259  1.00 98.97  ? 404  GLU A CA  1 
ATOM   3208 C C   . GLU A 1 404 ? 27.557  -4.475  1.256   1.00 91.18  ? 404  GLU A C   1 
ATOM   3209 O O   . GLU A 1 404 ? 28.069  -3.496  1.797   1.00 85.08  ? 404  GLU A O   1 
ATOM   3210 C CB  . GLU A 1 404 ? 26.826  -3.170  -0.704  1.00 113.26 ? 404  GLU A CB  1 
ATOM   3211 C CG  . GLU A 1 404 ? 25.507  -2.859  -0.006  1.00 133.89 ? 404  GLU A CG  1 
ATOM   3212 C CD  . GLU A 1 404 ? 24.895  -1.544  -0.452  1.00 148.99 ? 404  GLU A CD  1 
ATOM   3213 O OE1 . GLU A 1 404 ? 25.656  -0.563  -0.611  1.00 150.00 ? 404  GLU A OE1 1 
ATOM   3214 O OE2 . GLU A 1 404 ? 23.655  -1.485  -0.630  1.00 150.00 ? 404  GLU A OE2 1 
ATOM   3215 N N   . TYR A 1 405 ? 27.101  -5.512  1.953   1.00 85.43  ? 405  TYR A N   1 
ATOM   3216 C CA  . TYR A 1 405 ? 27.258  -5.531  3.404   1.00 77.18  ? 405  TYR A CA  1 
ATOM   3217 C C   . TYR A 1 405 ? 28.550  -6.259  3.754   1.00 82.90  ? 405  TYR A C   1 
ATOM   3218 O O   . TYR A 1 405 ? 28.893  -7.262  3.116   1.00 80.71  ? 405  TYR A O   1 
ATOM   3219 C CB  . TYR A 1 405 ? 26.083  -6.225  4.069   1.00 59.86  ? 405  TYR A CB  1 
ATOM   3220 C CG  . TYR A 1 405 ? 26.054  -6.009  5.565   1.00 55.61  ? 405  TYR A CG  1 
ATOM   3221 C CD1 . TYR A 1 405 ? 26.442  -4.789  6.119   1.00 54.11  ? 405  TYR A CD1 1 
ATOM   3222 C CD2 . TYR A 1 405 ? 25.585  -7.000  6.422   1.00 62.91  ? 405  TYR A CD2 1 
ATOM   3223 C CE1 . TYR A 1 405 ? 26.354  -4.562  7.495   1.00 68.44  ? 405  TYR A CE1 1 
ATOM   3224 C CE2 . TYR A 1 405 ? 25.495  -6.784  7.802   1.00 71.30  ? 405  TYR A CE2 1 
ATOM   3225 C CZ  . TYR A 1 405 ? 25.879  -5.566  8.330   1.00 71.44  ? 405  TYR A CZ  1 
ATOM   3226 O OH  . TYR A 1 405 ? 25.787  -5.363  9.690   1.00 66.69  ? 405  TYR A OH  1 
ATOM   3227 N N   . TRP A 1 406 ? 29.267  -5.771  4.765   1.00 87.35  ? 406  TRP A N   1 
ATOM   3228 C CA  . TRP A 1 406 ? 30.543  -6.388  5.132   1.00 92.62  ? 406  TRP A CA  1 
ATOM   3229 C C   . TRP A 1 406 ? 30.459  -7.800  5.731   1.00 90.50  ? 406  TRP A C   1 
ATOM   3230 O O   . TRP A 1 406 ? 31.455  -8.548  5.721   1.00 88.04  ? 406  TRP A O   1 
ATOM   3231 C CB  . TRP A 1 406 ? 31.306  -5.487  6.102   1.00 94.32  ? 406  TRP A CB  1 
ATOM   3232 C CG  . TRP A 1 406 ? 30.595  -5.302  7.401   1.00 107.38 ? 406  TRP A CG  1 
ATOM   3233 C CD1 . TRP A 1 406 ? 29.850  -4.224  7.774   1.00 116.27 ? 406  TRP A CD1 1 
ATOM   3234 C CD2 . TRP A 1 406 ? 30.570  -6.215  8.517   1.00 110.28 ? 406  TRP A CD2 1 
ATOM   3235 N NE1 . TRP A 1 406 ? 29.365  -4.399  9.056   1.00 118.99 ? 406  TRP A NE1 1 
ATOM   3236 C CE2 . TRP A 1 406 ? 29.791  -5.610  9.536   1.00 112.14 ? 406  TRP A CE2 1 
ATOM   3237 C CE3 . TRP A 1 406 ? 31.128  -7.482  8.754   1.00 102.77 ? 406  TRP A CE3 1 
ATOM   3238 C CZ2 . TRP A 1 406 ? 29.557  -6.227  10.778  1.00 98.30  ? 406  TRP A CZ2 1 
ATOM   3239 C CZ3 . TRP A 1 406 ? 30.893  -8.096  9.986   1.00 100.80 ? 406  TRP A CZ3 1 
ATOM   3240 C CH2 . TRP A 1 406 ? 30.112  -7.462  10.982  1.00 98.84  ? 406  TRP A CH2 1 
ATOM   3241 N N   . GLN A 1 407 ? 29.287  -8.165  6.250   1.00 83.32  ? 407  GLN A N   1 
ATOM   3242 C CA  . GLN A 1 407 ? 29.124  -9.472  6.867   1.00 72.45  ? 407  GLN A CA  1 
ATOM   3243 C C   . GLN A 1 407 ? 28.545  -10.504 5.926   1.00 67.18  ? 407  GLN A C   1 
ATOM   3244 O O   . GLN A 1 407 ? 27.716  -10.189 5.086   1.00 68.45  ? 407  GLN A O   1 
ATOM   3245 C CB  . GLN A 1 407 ? 28.254  -9.353  8.105   1.00 61.81  ? 407  GLN A CB  1 
ATOM   3246 C CG  . GLN A 1 407 ? 28.581  -10.380 9.140   1.00 82.28  ? 407  GLN A CG  1 
ATOM   3247 C CD  . GLN A 1 407 ? 27.943  -10.068 10.471  1.00 108.69 ? 407  GLN A CD  1 
ATOM   3248 O OE1 . GLN A 1 407 ? 26.724  -9.946  10.567  1.00 118.14 ? 407  GLN A OE1 1 
ATOM   3249 N NE2 . GLN A 1 407 ? 28.765  -9.936  11.512  1.00 116.67 ? 407  GLN A NE2 1 
ATOM   3250 N N   . ALA A 1 408 ? 29.001  -11.741 6.062   1.00 68.47  ? 408  ALA A N   1 
ATOM   3251 C CA  . ALA A 1 408 ? 28.527  -12.814 5.206   1.00 66.95  ? 408  ALA A CA  1 
ATOM   3252 C C   . ALA A 1 408 ? 27.131  -13.133 5.639   1.00 68.32  ? 408  ALA A C   1 
ATOM   3253 O O   . ALA A 1 408 ? 26.840  -13.156 6.827   1.00 59.18  ? 408  ALA A O   1 
ATOM   3254 C CB  . ALA A 1 408 ? 29.393  -14.038 5.353   1.00 66.24  ? 408  ALA A CB  1 
ATOM   3255 N N   . THR A 1 409 ? 26.262  -13.377 4.673   1.00 77.58  ? 409  THR A N   1 
ATOM   3256 C CA  . THR A 1 409 ? 24.881  -13.698 4.991   1.00 85.07  ? 409  THR A CA  1 
ATOM   3257 C C   . THR A 1 409 ? 24.229  -14.604 3.954   1.00 90.17  ? 409  THR A C   1 
ATOM   3258 O O   . THR A 1 409 ? 24.636  -14.626 2.787   1.00 92.52  ? 409  THR A O   1 
ATOM   3259 C CB  . THR A 1 409 ? 24.031  -12.430 5.147   1.00 88.81  ? 409  THR A CB  1 
ATOM   3260 O OG1 . THR A 1 409 ? 22.668  -12.817 5.358   1.00 96.51  ? 409  THR A OG1 1 
ATOM   3261 C CG2 . THR A 1 409 ? 24.131  -11.537 3.902   1.00 81.37  ? 409  THR A CG2 1 
ATOM   3262 N N   . TRP A 1 410 ? 23.202  -15.334 4.385   1.00 90.64  ? 410  TRP A N   1 
ATOM   3263 C CA  . TRP A 1 410 ? 22.530  -16.276 3.509   1.00 97.05  ? 410  TRP A CA  1 
ATOM   3264 C C   . TRP A 1 410 ? 21.073  -16.518 3.823   1.00 106.10 ? 410  TRP A C   1 
ATOM   3265 O O   . TRP A 1 410 ? 20.698  -16.814 4.961   1.00 108.82 ? 410  TRP A O   1 
ATOM   3266 C CB  . TRP A 1 410 ? 23.261  -17.610 3.565   1.00 96.83  ? 410  TRP A CB  1 
ATOM   3267 C CG  . TRP A 1 410 ? 22.566  -18.744 2.890   1.00 100.27 ? 410  TRP A CG  1 
ATOM   3268 C CD1 . TRP A 1 410 ? 22.241  -19.954 3.445   1.00 100.88 ? 410  TRP A CD1 1 
ATOM   3269 C CD2 . TRP A 1 410 ? 22.202  -18.823 1.511   1.00 100.37 ? 410  TRP A CD2 1 
ATOM   3270 N NE1 . TRP A 1 410 ? 21.708  -20.786 2.493   1.00 98.63  ? 410  TRP A NE1 1 
ATOM   3271 C CE2 . TRP A 1 410 ? 21.671  -20.119 1.295   1.00 103.29 ? 410  TRP A CE2 1 
ATOM   3272 C CE3 . TRP A 1 410 ? 22.274  -17.927 0.432   1.00 91.44  ? 410  TRP A CE3 1 
ATOM   3273 C CZ2 . TRP A 1 410 ? 21.216  -20.543 0.039   1.00 101.98 ? 410  TRP A CZ2 1 
ATOM   3274 C CZ3 . TRP A 1 410 ? 21.821  -18.347 -0.819  1.00 93.37  ? 410  TRP A CZ3 1 
ATOM   3275 C CH2 . TRP A 1 410 ? 21.299  -19.646 -1.003  1.00 99.05  ? 410  TRP A CH2 1 
ATOM   3276 N N   . ILE A 1 411 ? 20.257  -16.408 2.784   1.00 110.60 ? 411  ILE A N   1 
ATOM   3277 C CA  . ILE A 1 411 ? 18.837  -16.646 2.908   1.00 110.72 ? 411  ILE A CA  1 
ATOM   3278 C C   . ILE A 1 411 ? 18.498  -17.802 1.979   1.00 108.39 ? 411  ILE A C   1 
ATOM   3279 O O   . ILE A 1 411 ? 18.841  -17.782 0.794   1.00 106.40 ? 411  ILE A O   1 
ATOM   3280 C CB  . ILE A 1 411 ? 17.995  -15.403 2.513   1.00 115.65 ? 411  ILE A CB  1 
ATOM   3281 C CG1 . ILE A 1 411 ? 18.020  -14.355 3.637   1.00 119.34 ? 411  ILE A CG1 1 
ATOM   3282 C CG2 . ILE A 1 411 ? 16.565  -15.825 2.234   1.00 118.37 ? 411  ILE A CG2 1 
ATOM   3283 C CD1 . ILE A 1 411 ? 17.074  -13.170 3.419   1.00 119.79 ? 411  ILE A CD1 1 
ATOM   3284 N N   . PRO A 1 412 ? 17.836  -18.837 2.521   1.00 109.23 ? 412  PRO A N   1 
ATOM   3285 C CA  . PRO A 1 412 ? 17.402  -20.053 1.826   1.00 109.03 ? 412  PRO A CA  1 
ATOM   3286 C C   . PRO A 1 412 ? 16.531  -19.738 0.621   1.00 107.14 ? 412  PRO A C   1 
ATOM   3287 O O   . PRO A 1 412 ? 16.627  -18.669 0.016   1.00 106.24 ? 412  PRO A O   1 
ATOM   3288 C CB  . PRO A 1 412 ? 16.597  -20.797 2.894   1.00 106.21 ? 412  PRO A CB  1 
ATOM   3289 C CG  . PRO A 1 412 ? 17.251  -20.389 4.146   1.00 108.35 ? 412  PRO A CG  1 
ATOM   3290 C CD  . PRO A 1 412 ? 17.493  -18.913 3.951   1.00 111.08 ? 412  PRO A CD  1 
ATOM   3291 N N   . GLU A 1 413 ? 15.671  -20.692 0.288   1.00 105.07 ? 413  GLU A N   1 
ATOM   3292 C CA  . GLU A 1 413 ? 14.743  -20.549 -0.823  1.00 103.49 ? 413  GLU A CA  1 
ATOM   3293 C C   . GLU A 1 413 ? 13.620  -19.571 -0.436  1.00 99.76  ? 413  GLU A C   1 
ATOM   3294 O O   . GLU A 1 413 ? 12.858  -19.850 0.505   1.00 104.00 ? 413  GLU A O   1 
ATOM   3295 C CB  . GLU A 1 413 ? 14.103  -21.910 -1.154  1.00 110.62 ? 413  GLU A CB  1 
ATOM   3296 C CG  . GLU A 1 413 ? 14.810  -22.787 -2.193  1.00 119.74 ? 413  GLU A CG  1 
ATOM   3297 C CD  . GLU A 1 413 ? 13.820  -23.476 -3.149  1.00 130.46 ? 413  GLU A CD  1 
ATOM   3298 O OE1 . GLU A 1 413 ? 12.887  -24.169 -2.669  1.00 127.62 ? 413  GLU A OE1 1 
ATOM   3299 O OE2 . GLU A 1 413 ? 13.978  -23.320 -4.384  1.00 137.16 ? 413  GLU A OE2 1 
ATOM   3300 N N   . TRP A 1 414 ? 13.509  -18.432 -1.127  1.00 88.68  ? 414  TRP A N   1 
ATOM   3301 C CA  . TRP A 1 414 ? 12.413  -17.509 -0.816  1.00 82.14  ? 414  TRP A CA  1 
ATOM   3302 C C   . TRP A 1 414 ? 11.758  -16.899 -2.027  1.00 77.86  ? 414  TRP A C   1 
ATOM   3303 O O   . TRP A 1 414 ? 12.396  -16.570 -3.025  1.00 77.14  ? 414  TRP A O   1 
ATOM   3304 C CB  . TRP A 1 414 ? 12.833  -16.382 0.109   1.00 80.38  ? 414  TRP A CB  1 
ATOM   3305 C CG  . TRP A 1 414 ? 13.720  -15.408 -0.530  1.00 84.29  ? 414  TRP A CG  1 
ATOM   3306 C CD1 . TRP A 1 414 ? 15.055  -15.555 -0.779  1.00 92.05  ? 414  TRP A CD1 1 
ATOM   3307 C CD2 . TRP A 1 414 ? 13.365  -14.102 -0.985  1.00 89.05  ? 414  TRP A CD2 1 
ATOM   3308 N NE1 . TRP A 1 414 ? 15.560  -14.410 -1.353  1.00 91.99  ? 414  TRP A NE1 1 
ATOM   3309 C CE2 . TRP A 1 414 ? 14.545  -13.502 -1.495  1.00 90.16  ? 414  TRP A CE2 1 
ATOM   3310 C CE3 . TRP A 1 414 ? 12.165  -13.376 -1.011  1.00 90.57  ? 414  TRP A CE3 1 
ATOM   3311 C CZ2 . TRP A 1 414 ? 14.562  -12.209 -2.025  1.00 85.50  ? 414  TRP A CZ2 1 
ATOM   3312 C CZ3 . TRP A 1 414 ? 12.180  -12.092 -1.536  1.00 88.73  ? 414  TRP A CZ3 1 
ATOM   3313 C CH2 . TRP A 1 414 ? 13.375  -11.520 -2.038  1.00 90.85  ? 414  TRP A CH2 1 
ATOM   3314 N N   . GLU A 1 415 ? 10.457  -16.727 -1.891  1.00 77.07  ? 415  GLU A N   1 
ATOM   3315 C CA  . GLU A 1 415 ? 9.624   -16.204 -2.938  1.00 76.85  ? 415  GLU A CA  1 
ATOM   3316 C C   . GLU A 1 415 ? 9.157   -14.823 -2.539  1.00 74.11  ? 415  GLU A C   1 
ATOM   3317 O O   . GLU A 1 415 ? 8.699   -14.621 -1.412  1.00 74.94  ? 415  GLU A O   1 
ATOM   3318 C CB  . GLU A 1 415 ? 8.447   -17.172 -3.096  1.00 89.77  ? 415  GLU A CB  1 
ATOM   3319 C CG  . GLU A 1 415 ? 7.327   -16.765 -4.026  1.00 106.90 ? 415  GLU A CG  1 
ATOM   3320 C CD  . GLU A 1 415 ? 6.408   -17.936 -4.324  1.00 112.41 ? 415  GLU A CD  1 
ATOM   3321 O OE1 . GLU A 1 415 ? 6.787   -18.809 -5.144  1.00 111.66 ? 415  GLU A OE1 1 
ATOM   3322 O OE2 . GLU A 1 415 ? 5.317   -17.990 -3.719  1.00 115.64 ? 415  GLU A OE2 1 
ATOM   3323 N N   . PHE A 1 416 ? 9.304   -13.860 -3.439  1.00 69.28  ? 416  PHE A N   1 
ATOM   3324 C CA  . PHE A 1 416 ? 8.824   -12.527 -3.126  1.00 69.84  ? 416  PHE A CA  1 
ATOM   3325 C C   . PHE A 1 416 ? 7.300   -12.603 -3.074  1.00 64.39  ? 416  PHE A C   1 
ATOM   3326 O O   . PHE A 1 416 ? 6.662   -13.262 -3.904  1.00 63.56  ? 416  PHE A O   1 
ATOM   3327 C CB  . PHE A 1 416 ? 9.237   -11.515 -4.200  1.00 77.09  ? 416  PHE A CB  1 
ATOM   3328 C CG  . PHE A 1 416 ? 8.486   -10.200 -4.121  1.00 85.48  ? 416  PHE A CG  1 
ATOM   3329 C CD1 . PHE A 1 416 ? 8.655   -9.347  -3.039  1.00 90.66  ? 416  PHE A CD1 1 
ATOM   3330 C CD2 . PHE A 1 416 ? 7.580   -9.835  -5.117  1.00 92.67  ? 416  PHE A CD2 1 
ATOM   3331 C CE1 . PHE A 1 416 ? 7.932   -8.151  -2.948  1.00 85.72  ? 416  PHE A CE1 1 
ATOM   3332 C CE2 . PHE A 1 416 ? 6.854   -8.646  -5.035  1.00 87.95  ? 416  PHE A CE2 1 
ATOM   3333 C CZ  . PHE A 1 416 ? 7.030   -7.805  -3.950  1.00 82.31  ? 416  PHE A CZ  1 
ATOM   3334 N N   . VAL A 1 417 ? 6.718   -11.949 -2.084  1.00 62.34  ? 417  VAL A N   1 
ATOM   3335 C CA  . VAL A 1 417 ? 5.274   -11.933 -1.968  1.00 71.31  ? 417  VAL A CA  1 
ATOM   3336 C C   . VAL A 1 417 ? 4.909   -10.472 -1.882  1.00 68.20  ? 417  VAL A C   1 
ATOM   3337 O O   . VAL A 1 417 ? 5.455   -9.743  -1.057  1.00 64.25  ? 417  VAL A O   1 
ATOM   3338 C CB  . VAL A 1 417 ? 4.770   -12.667 -0.696  1.00 83.56  ? 417  VAL A CB  1 
ATOM   3339 C CG1 . VAL A 1 417 ? 5.129   -11.891 0.570   1.00 85.99  ? 417  VAL A CG1 1 
ATOM   3340 C CG2 . VAL A 1 417 ? 3.278   -12.843 -0.783  1.00 88.90  ? 417  VAL A CG2 1 
ATOM   3341 N N   . ASN A 1 418 ? 4.009   -10.027 -2.743  1.00 70.05  ? 418  ASN A N   1 
ATOM   3342 C CA  . ASN A 1 418 ? 3.635   -8.632  -2.686  1.00 77.54  ? 418  ASN A CA  1 
ATOM   3343 C C   . ASN A 1 418 ? 2.537   -8.381  -1.665  1.00 75.61  ? 418  ASN A C   1 
ATOM   3344 O O   . ASN A 1 418 ? 1.350   -8.387  -1.975  1.00 77.93  ? 418  ASN A O   1 
ATOM   3345 C CB  . ASN A 1 418 ? 3.211   -8.122  -4.055  1.00 90.93  ? 418  ASN A CB  1 
ATOM   3346 C CG  . ASN A 1 418 ? 2.901   -6.632  -4.041  1.00 106.74 ? 418  ASN A CG  1 
ATOM   3347 O OD1 . ASN A 1 418 ? 3.311   -5.900  -3.123  1.00 105.76 ? 418  ASN A OD1 1 
ATOM   3348 N ND2 . ASN A 1 418 ? 2.184   -6.168  -5.068  1.00 116.32 ? 418  ASN A ND2 1 
ATOM   3349 N N   . THR A 1 419 ? 2.964   -8.165  -0.432  1.00 76.98  ? 419  THR A N   1 
ATOM   3350 C CA  . THR A 1 419 ? 2.065   -7.902  0.675   1.00 76.64  ? 419  THR A CA  1 
ATOM   3351 C C   . THR A 1 419 ? 2.601   -6.654  1.317   1.00 68.79  ? 419  THR A C   1 
ATOM   3352 O O   . THR A 1 419 ? 3.598   -6.692  2.022   1.00 68.08  ? 419  THR A O   1 
ATOM   3353 C CB  . THR A 1 419 ? 2.138   -9.010  1.706   1.00 87.00  ? 419  THR A CB  1 
ATOM   3354 O OG1 . THR A 1 419 ? 1.748   -10.250 1.096   1.00 87.53  ? 419  THR A OG1 1 
ATOM   3355 C CG2 . THR A 1 419 ? 1.253   -8.665  2.922   1.00 96.85  ? 419  THR A CG2 1 
ATOM   3356 N N   . PRO A 1 420 ? 1.965   -5.522  1.080   1.00 65.09  ? 420  PRO A N   1 
ATOM   3357 C CA  . PRO A 1 420 ? 2.635   -4.434  1.779   1.00 57.81  ? 420  PRO A CA  1 
ATOM   3358 C C   . PRO A 1 420 ? 2.505   -4.603  3.290   1.00 57.54  ? 420  PRO A C   1 
ATOM   3359 O O   . PRO A 1 420 ? 1.671   -5.361  3.782   1.00 51.73  ? 420  PRO A O   1 
ATOM   3360 C CB  . PRO A 1 420 ? 1.933   -3.208  1.228   1.00 62.99  ? 420  PRO A CB  1 
ATOM   3361 C CG  . PRO A 1 420 ? 1.616   -3.642  -0.203  1.00 71.70  ? 420  PRO A CG  1 
ATOM   3362 C CD  . PRO A 1 420 ? 1.066   -5.025  0.029   1.00 70.27  ? 420  PRO A CD  1 
ATOM   3363 N N   . PRO A 1 421 ? 3.355   -3.914  4.047   1.00 64.11  ? 421  PRO A N   1 
ATOM   3364 C CA  . PRO A 1 421 ? 4.389   -3.017  3.532   1.00 71.20  ? 421  PRO A CA  1 
ATOM   3365 C C   . PRO A 1 421 ? 5.605   -3.787  3.037   1.00 76.68  ? 421  PRO A C   1 
ATOM   3366 O O   . PRO A 1 421 ? 6.077   -4.692  3.725   1.00 86.65  ? 421  PRO A O   1 
ATOM   3367 C CB  . PRO A 1 421 ? 4.715   -2.163  4.745   1.00 71.25  ? 421  PRO A CB  1 
ATOM   3368 C CG  . PRO A 1 421 ? 4.618   -3.166  5.854   1.00 68.33  ? 421  PRO A CG  1 
ATOM   3369 C CD  . PRO A 1 421 ? 3.350   -3.924  5.519   1.00 64.72  ? 421  PRO A CD  1 
ATOM   3370 N N   . LEU A 1 422 ? 6.109   -3.444  1.852   1.00 73.89  ? 422  LEU A N   1 
ATOM   3371 C CA  . LEU A 1 422 ? 7.297   -4.125  1.333   1.00 68.62  ? 422  LEU A CA  1 
ATOM   3372 C C   . LEU A 1 422 ? 8.519   -3.500  2.006   1.00 63.76  ? 422  LEU A C   1 
ATOM   3373 O O   . LEU A 1 422 ? 8.459   -2.365  2.491   1.00 65.37  ? 422  LEU A O   1 
ATOM   3374 C CB  . LEU A 1 422 ? 7.397   -3.999  -0.202  1.00 64.15  ? 422  LEU A CB  1 
ATOM   3375 C CG  . LEU A 1 422 ? 6.184   -4.536  -0.984  1.00 75.94  ? 422  LEU A CG  1 
ATOM   3376 C CD1 . LEU A 1 422 ? 6.497   -4.535  -2.473  1.00 77.51  ? 422  LEU A CD1 1 
ATOM   3377 C CD2 . LEU A 1 422 ? 5.839   -5.950  -0.524  1.00 81.63  ? 422  LEU A CD2 1 
ATOM   3378 N N   . VAL A 1 423 ? 9.618   -4.246  2.068   1.00 60.91  ? 423  VAL A N   1 
ATOM   3379 C CA  . VAL A 1 423 ? 10.812  -3.712  2.694   1.00 59.51  ? 423  VAL A CA  1 
ATOM   3380 C C   . VAL A 1 423 ? 11.726  -3.199  1.596   1.00 60.80  ? 423  VAL A C   1 
ATOM   3381 O O   . VAL A 1 423 ? 11.962  -3.883  0.590   1.00 65.63  ? 423  VAL A O   1 
ATOM   3382 C CB  . VAL A 1 423 ? 11.536  -4.784  3.581   1.00 60.93  ? 423  VAL A CB  1 
ATOM   3383 C CG1 . VAL A 1 423 ? 10.557  -5.888  3.988   1.00 59.52  ? 423  VAL A CG1 1 
ATOM   3384 C CG2 . VAL A 1 423 ? 12.724  -5.359  2.867   1.00 70.57  ? 423  VAL A CG2 1 
ATOM   3385 N N   . LYS A 1 424 ? 12.206  -1.976  1.784   1.00 62.20  ? 424  LYS A N   1 
ATOM   3386 C CA  . LYS A 1 424 ? 13.082  -1.344  0.818   1.00 66.12  ? 424  LYS A CA  1 
ATOM   3387 C C   . LYS A 1 424 ? 14.154  -0.543  1.519   1.00 67.50  ? 424  LYS A C   1 
ATOM   3388 O O   . LYS A 1 424 ? 14.115  -0.345  2.736   1.00 66.36  ? 424  LYS A O   1 
ATOM   3389 C CB  . LYS A 1 424 ? 12.271  -0.434  -0.120  1.00 66.27  ? 424  LYS A CB  1 
ATOM   3390 C CG  . LYS A 1 424 ? 11.202  0.415   0.564   1.00 77.85  ? 424  LYS A CG  1 
ATOM   3391 C CD  . LYS A 1 424 ? 11.608  1.886   0.670   1.00 91.75  ? 424  LYS A CD  1 
ATOM   3392 C CE  . LYS A 1 424 ? 10.528  2.718   1.365   1.00 87.45  ? 424  LYS A CE  1 
ATOM   3393 N NZ  . LYS A 1 424 ? 10.920  4.150   1.453   1.00 77.48  ? 424  LYS A NZ  1 
ATOM   3394 N N   . LEU A 1 425 ? 15.129  -0.106  0.737   1.00 65.09  ? 425  LEU A N   1 
ATOM   3395 C CA  . LEU A 1 425 ? 16.202  0.696   1.264   1.00 59.75  ? 425  LEU A CA  1 
ATOM   3396 C C   . LEU A 1 425 ? 15.768  2.113   0.998   1.00 57.57  ? 425  LEU A C   1 
ATOM   3397 O O   . LEU A 1 425 ? 15.588  2.525   -0.150  1.00 51.58  ? 425  LEU A O   1 
ATOM   3398 C CB  . LEU A 1 425 ? 17.502  0.366   0.542   1.00 58.72  ? 425  LEU A CB  1 
ATOM   3399 C CG  . LEU A 1 425 ? 18.028  -1.022  0.921   1.00 56.13  ? 425  LEU A CG  1 
ATOM   3400 C CD1 . LEU A 1 425 ? 18.990  -1.503  -0.167  1.00 57.51  ? 425  LEU A CD1 1 
ATOM   3401 C CD2 . LEU A 1 425 ? 18.696  -0.975  2.324   1.00 46.81  ? 425  LEU A CD2 1 
ATOM   3402 N N   . TRP A 1 426 ? 15.581  2.854   2.073   1.00 61.25  ? 426  TRP A N   1 
ATOM   3403 C CA  . TRP A 1 426 ? 15.137  4.225   1.949   1.00 72.48  ? 426  TRP A CA  1 
ATOM   3404 C C   . TRP A 1 426 ? 16.144  5.206   1.360   1.00 67.97  ? 426  TRP A C   1 
ATOM   3405 O O   . TRP A 1 426 ? 15.788  6.331   1.020   1.00 68.92  ? 426  TRP A O   1 
ATOM   3406 C CB  . TRP A 1 426 ? 14.693  4.725   3.303   1.00 90.82  ? 426  TRP A CB  1 
ATOM   3407 C CG  . TRP A 1 426 ? 13.482  4.041   3.800   1.00 99.42  ? 426  TRP A CG  1 
ATOM   3408 C CD1 . TRP A 1 426 ? 13.376  2.743   4.194   1.00 97.05  ? 426  TRP A CD1 1 
ATOM   3409 C CD2 . TRP A 1 426 ? 12.196  4.638   4.010   1.00 106.93 ? 426  TRP A CD2 1 
ATOM   3410 N NE1 . TRP A 1 426 ? 12.101  2.495   4.645   1.00 103.43 ? 426  TRP A NE1 1 
ATOM   3411 C CE2 . TRP A 1 426 ? 11.356  3.642   4.544   1.00 106.48 ? 426  TRP A CE2 1 
ATOM   3412 C CE3 . TRP A 1 426 ? 11.673  5.924   3.801   1.00 110.90 ? 426  TRP A CE3 1 
ATOM   3413 C CZ2 . TRP A 1 426 ? 10.010  3.890   4.878   1.00 103.60 ? 426  TRP A CZ2 1 
ATOM   3414 C CZ3 . TRP A 1 426 ? 10.333  6.173   4.134   1.00 103.82 ? 426  TRP A CZ3 1 
ATOM   3415 C CH2 . TRP A 1 426 ? 9.522   5.160   4.667   1.00 101.54 ? 426  TRP A CH2 1 
ATOM   3416 N N   . TYR A 1 427 ? 17.403  4.802   1.254   1.00 65.68  ? 427  TYR A N   1 
ATOM   3417 C CA  . TYR A 1 427 ? 18.417  5.684   0.687   1.00 55.92  ? 427  TYR A CA  1 
ATOM   3418 C C   . TYR A 1 427 ? 19.693  4.879   0.482   1.00 59.76  ? 427  TYR A C   1 
ATOM   3419 O O   . TYR A 1 427 ? 19.882  3.846   1.128   1.00 63.90  ? 427  TYR A O   1 
ATOM   3420 C CB  . TYR A 1 427 ? 18.688  6.867   1.616   1.00 45.67  ? 427  TYR A CB  1 
ATOM   3421 C CG  . TYR A 1 427 ? 19.371  6.462   2.901   1.00 52.43  ? 427  TYR A CG  1 
ATOM   3422 C CD1 . TYR A 1 427 ? 18.635  6.166   4.051   1.00 53.76  ? 427  TYR A CD1 1 
ATOM   3423 C CD2 . TYR A 1 427 ? 20.769  6.336   2.962   1.00 46.05  ? 427  TYR A CD2 1 
ATOM   3424 C CE1 . TYR A 1 427 ? 19.281  5.750   5.239   1.00 53.52  ? 427  TYR A CE1 1 
ATOM   3425 C CE2 . TYR A 1 427 ? 21.425  5.921   4.142   1.00 51.93  ? 427  TYR A CE2 1 
ATOM   3426 C CZ  . TYR A 1 427 ? 20.675  5.628   5.273   1.00 56.82  ? 427  TYR A CZ  1 
ATOM   3427 O OH  . TYR A 1 427 ? 21.319  5.183   6.410   1.00 44.69  ? 427  TYR A OH  1 
ATOM   3428 N N   . GLN A 1 428 ? 20.557  5.358   -0.417  1.00 65.79  ? 428  GLN A N   1 
ATOM   3429 C CA  . GLN A 1 428 ? 21.834  4.707   -0.760  1.00 67.48  ? 428  GLN A CA  1 
ATOM   3430 C C   . GLN A 1 428 ? 22.923  5.752   -0.928  1.00 64.52  ? 428  GLN A C   1 
ATOM   3431 O O   . GLN A 1 428 ? 22.743  6.720   -1.663  1.00 74.18  ? 428  GLN A O   1 
ATOM   3432 C CB  . GLN A 1 428 ? 21.706  3.938   -2.087  1.00 81.20  ? 428  GLN A CB  1 
ATOM   3433 C CG  . GLN A 1 428 ? 21.336  2.454   -1.957  1.00 106.12 ? 428  GLN A CG  1 
ATOM   3434 C CD  . GLN A 1 428 ? 20.304  1.996   -2.990  1.00 120.57 ? 428  GLN A CD  1 
ATOM   3435 O OE1 . GLN A 1 428 ? 19.090  2.064   -2.748  1.00 119.04 ? 428  GLN A OE1 1 
ATOM   3436 N NE2 . GLN A 1 428 ? 20.783  1.539   -4.151  1.00 127.35 ? 428  GLN A NE2 1 
ATOM   3437 N N   . LEU A 1 429 ? 24.055  5.569   -0.268  1.00 60.82  ? 429  LEU A N   1 
ATOM   3438 C CA  . LEU A 1 429 ? 25.136  6.538   -0.415  1.00 60.94  ? 429  LEU A CA  1 
ATOM   3439 C C   . LEU A 1 429 ? 25.756  6.427   -1.809  1.00 64.83  ? 429  LEU A C   1 
ATOM   3440 O O   . LEU A 1 429 ? 25.885  5.330   -2.362  1.00 54.72  ? 429  LEU A O   1 
ATOM   3441 C CB  . LEU A 1 429 ? 26.213  6.277   0.624   1.00 52.41  ? 429  LEU A CB  1 
ATOM   3442 C CG  . LEU A 1 429 ? 25.666  6.205   2.036   1.00 58.71  ? 429  LEU A CG  1 
ATOM   3443 C CD1 . LEU A 1 429 ? 26.661  5.566   2.994   1.00 66.94  ? 429  LEU A CD1 1 
ATOM   3444 C CD2 . LEU A 1 429 ? 25.340  7.605   2.451   1.00 60.64  ? 429  LEU A CD2 1 
ATOM   3445 N N   . GLU A 1 430 ? 26.132  7.560   -2.389  1.00 73.14  ? 430  GLU A N   1 
ATOM   3446 C CA  . GLU A 1 430 ? 26.767  7.520   -3.699  1.00 76.98  ? 430  GLU A CA  1 
ATOM   3447 C C   . GLU A 1 430 ? 28.034  6.706   -3.534  1.00 80.00  ? 430  GLU A C   1 
ATOM   3448 O O   . GLU A 1 430 ? 28.645  6.718   -2.467  1.00 88.01  ? 430  GLU A O   1 
ATOM   3449 C CB  . GLU A 1 430 ? 27.127  8.929   -4.182  1.00 71.70  ? 430  GLU A CB  1 
ATOM   3450 C CG  . GLU A 1 430 ? 25.959  9.658   -4.773  1.00 74.57  ? 430  GLU A CG  1 
ATOM   3451 C CD  . GLU A 1 430 ? 25.187  8.766   -5.714  1.00 83.73  ? 430  GLU A CD  1 
ATOM   3452 O OE1 . GLU A 1 430 ? 25.771  8.324   -6.728  1.00 89.32  ? 430  GLU A OE1 1 
ATOM   3453 O OE2 . GLU A 1 430 ? 24.001  8.496   -5.429  1.00 91.03  ? 430  GLU A OE2 1 
ATOM   3454 N N   . LYS A 1 431 ? 28.427  5.988   -4.573  1.00 80.19  ? 431  LYS A N   1 
ATOM   3455 C CA  . LYS A 1 431 ? 29.644  5.205   -4.482  1.00 83.19  ? 431  LYS A CA  1 
ATOM   3456 C C   . LYS A 1 431 ? 30.862  6.071   -4.830  1.00 79.96  ? 431  LYS A C   1 
ATOM   3457 O O   . LYS A 1 431 ? 32.000  5.682   -4.600  1.00 79.30  ? 431  LYS A O   1 
ATOM   3458 C CB  . LYS A 1 431 ? 29.547  3.983   -5.403  1.00 92.04  ? 431  LYS A CB  1 
ATOM   3459 C CG  . LYS A 1 431 ? 28.982  2.737   -4.708  1.00 102.06 ? 431  LYS A CG  1 
ATOM   3460 C CD  . LYS A 1 431 ? 28.058  1.900   -5.613  1.00 104.43 ? 431  LYS A CD  1 
ATOM   3461 C CE  . LYS A 1 431 ? 26.719  2.612   -5.878  1.00 105.65 ? 431  LYS A CE  1 
ATOM   3462 N NZ  . LYS A 1 431 ? 25.742  1.820   -6.696  1.00 100.40 ? 431  LYS A NZ  1 
ATOM   3463 N N   . GLU A 1 432 ? 30.622  7.263   -5.360  1.00 76.56  ? 432  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 432 ? 31.717  8.150   -5.735  1.00 73.28  ? 432  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 432 ? 31.328  9.578   -5.459  1.00 61.20  ? 432  GLU A C   1 
ATOM   3466 O O   . GLU A 1 432 ? 30.153  9.924   -5.443  1.00 62.26  ? 432  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 432 ? 32.001  8.025   -7.217  1.00 90.95  ? 432  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 432 ? 30.792  8.430   -8.019  1.00 121.78 ? 432  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 432 ? 30.683  7.695   -9.330  1.00 145.09 ? 432  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 432 ? 31.437  8.041   -10.268 1.00 149.99 ? 432  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 432 ? 29.844  6.766   -9.412  1.00 150.00 ? 432  GLU A OE2 1 
ATOM   3472 N N   . PRO A 1 433 ? 32.317  10.435  -5.251  1.00 49.81  ? 433  PRO A N   1 
ATOM   3473 C CA  . PRO A 1 433 ? 31.992  11.831  -4.984  1.00 56.14  ? 433  PRO A CA  1 
ATOM   3474 C C   . PRO A 1 433 ? 31.063  12.326  -6.042  1.00 62.19  ? 433  PRO A C   1 
ATOM   3475 O O   . PRO A 1 433 ? 31.057  11.827  -7.167  1.00 65.48  ? 433  PRO A O   1 
ATOM   3476 C CB  . PRO A 1 433 ? 33.339  12.529  -5.046  1.00 55.79  ? 433  PRO A CB  1 
ATOM   3477 C CG  . PRO A 1 433 ? 34.136  11.636  -5.960  1.00 65.02  ? 433  PRO A CG  1 
ATOM   3478 C CD  . PRO A 1 433 ? 33.753  10.265  -5.491  1.00 47.29  ? 433  PRO A CD  1 
ATOM   3479 N N   . ILE A 1 434 ? 30.280  13.318  -5.669  1.00 64.08  ? 434  ILE A N   1 
ATOM   3480 C CA  . ILE A 1 434 ? 29.309  13.894  -6.576  1.00 75.37  ? 434  ILE A CA  1 
ATOM   3481 C C   . ILE A 1 434 ? 29.894  15.140  -7.229  1.00 83.28  ? 434  ILE A C   1 
ATOM   3482 O O   . ILE A 1 434 ? 30.370  16.049  -6.543  1.00 85.58  ? 434  ILE A O   1 
ATOM   3483 C CB  . ILE A 1 434 ? 28.043  14.267  -5.812  1.00 77.71  ? 434  ILE A CB  1 
ATOM   3484 C CG1 . ILE A 1 434 ? 27.615  13.091  -4.926  1.00 80.61  ? 434  ILE A CG1 1 
ATOM   3485 C CG2 . ILE A 1 434 ? 26.946  14.638  -6.791  1.00 91.90  ? 434  ILE A CG2 1 
ATOM   3486 C CD1 . ILE A 1 434 ? 26.553  13.444  -3.904  1.00 74.23  ? 434  ILE A CD1 1 
ATOM   3487 N N   . VAL A 1 435 ? 29.854  15.190  -8.555  1.00 89.94  ? 435  VAL A N   1 
ATOM   3488 C CA  . VAL A 1 435 ? 30.413  16.332  -9.268  1.00 91.51  ? 435  VAL A CA  1 
ATOM   3489 C C   . VAL A 1 435 ? 29.603  17.622  -9.133  1.00 91.69  ? 435  VAL A C   1 
ATOM   3490 O O   . VAL A 1 435 ? 28.405  17.661  -9.445  1.00 92.01  ? 435  VAL A O   1 
ATOM   3491 C CB  . VAL A 1 435 ? 30.567  16.045  -10.773 1.00 92.48  ? 435  VAL A CB  1 
ATOM   3492 C CG1 . VAL A 1 435 ? 31.646  16.949  -11.344 1.00 91.14  ? 435  VAL A CG1 1 
ATOM   3493 C CG2 . VAL A 1 435 ? 30.893  14.577  -11.014 1.00 99.92  ? 435  VAL A CG2 1 
ATOM   3494 N N   . GLY A 1 436 ? 30.265  18.678  -8.668  1.00 91.34  ? 436  GLY A N   1 
ATOM   3495 C CA  . GLY A 1 436 ? 29.605  19.964  -8.542  1.00 89.72  ? 436  GLY A CA  1 
ATOM   3496 C C   . GLY A 1 436 ? 28.624  20.072  -7.400  1.00 88.93  ? 436  GLY A C   1 
ATOM   3497 O O   . GLY A 1 436 ? 27.724  20.916  -7.420  1.00 89.98  ? 436  GLY A O   1 
ATOM   3498 N N   . ALA A 1 437 ? 28.787  19.192  -6.416  1.00 89.32  ? 437  ALA A N   1 
ATOM   3499 C CA  . ALA A 1 437 ? 27.971  19.194  -5.199  1.00 83.67  ? 437  ALA A CA  1 
ATOM   3500 C C   . ALA A 1 437 ? 28.874  19.779  -4.096  1.00 88.94  ? 437  ALA A C   1 
ATOM   3501 O O   . ALA A 1 437 ? 30.054  19.406  -3.970  1.00 96.85  ? 437  ALA A O   1 
ATOM   3502 C CB  . ALA A 1 437 ? 27.555  17.788  -4.841  1.00 67.78  ? 437  ALA A CB  1 
ATOM   3503 N N   . GLU A 1 438 ? 28.338  20.698  -3.300  1.00 87.96  ? 438  GLU A N   1 
ATOM   3504 C CA  . GLU A 1 438 ? 29.157  21.309  -2.267  1.00 83.74  ? 438  GLU A CA  1 
ATOM   3505 C C   . GLU A 1 438 ? 29.847  20.250  -1.402  1.00 79.29  ? 438  GLU A C   1 
ATOM   3506 O O   . GLU A 1 438 ? 29.320  19.140  -1.150  1.00 77.83  ? 438  GLU A O   1 
ATOM   3507 C CB  . GLU A 1 438 ? 28.316  22.264  -1.406  1.00 92.98  ? 438  GLU A CB  1 
ATOM   3508 C CG  . GLU A 1 438 ? 29.148  23.256  -0.574  1.00 86.62  ? 438  GLU A CG  1 
ATOM   3509 C CD  . GLU A 1 438 ? 28.295  24.331  0.098   1.00 85.68  ? 438  GLU A CD  1 
ATOM   3510 O OE1 . GLU A 1 438 ? 28.870  25.165  0.825   1.00 76.05  ? 438  GLU A OE1 1 
ATOM   3511 O OE2 . GLU A 1 438 ? 27.055  24.345  -0.103  1.00 84.84  ? 438  GLU A OE2 1 
ATOM   3512 N N   . THR A 1 439 ? 31.047  20.611  -0.966  1.00 76.59  ? 439  THR A N   1 
ATOM   3513 C CA  . THR A 1 439 ? 31.863  19.741  -0.140  1.00 76.90  ? 439  THR A CA  1 
ATOM   3514 C C   . THR A 1 439 ? 31.991  20.289  1.278   1.00 67.87  ? 439  THR A C   1 
ATOM   3515 O O   . THR A 1 439 ? 32.590  21.353  1.509   1.00 61.56  ? 439  THR A O   1 
ATOM   3516 C CB  . THR A 1 439 ? 33.272  19.576  -0.758  1.00 79.82  ? 439  THR A CB  1 
ATOM   3517 O OG1 . THR A 1 439 ? 33.136  19.084  -2.098  1.00 93.26  ? 439  THR A OG1 1 
ATOM   3518 C CG2 . THR A 1 439 ? 34.130  18.598  0.068   1.00 74.12  ? 439  THR A CG2 1 
ATOM   3519 N N   . PHE A 1 440 ? 31.417  19.555  2.222   1.00 64.00  ? 440  PHE A N   1 
ATOM   3520 C CA  . PHE A 1 440 ? 31.471  19.953  3.614   1.00 63.00  ? 440  PHE A CA  1 
ATOM   3521 C C   . PHE A 1 440 ? 32.543  19.151  4.340   1.00 64.00  ? 440  PHE A C   1 
ATOM   3522 O O   . PHE A 1 440 ? 32.607  17.909  4.219   1.00 56.39  ? 440  PHE A O   1 
ATOM   3523 C CB  . PHE A 1 440 ? 30.130  19.694  4.310   1.00 63.63  ? 440  PHE A CB  1 
ATOM   3524 C CG  . PHE A 1 440 ? 28.975  20.516  3.776   1.00 64.27  ? 440  PHE A CG  1 
ATOM   3525 C CD1 . PHE A 1 440 ? 28.523  20.372  2.455   1.00 63.17  ? 440  PHE A CD1 1 
ATOM   3526 C CD2 . PHE A 1 440 ? 28.309  21.412  4.615   1.00 57.93  ? 440  PHE A CD2 1 
ATOM   3527 C CE1 . PHE A 1 440 ? 27.419  21.111  1.984   1.00 62.01  ? 440  PHE A CE1 1 
ATOM   3528 C CE2 . PHE A 1 440 ? 27.211  22.151  4.154   1.00 69.72  ? 440  PHE A CE2 1 
ATOM   3529 C CZ  . PHE A 1 440 ? 26.766  21.998  2.834   1.00 70.68  ? 440  PHE A CZ  1 
ATOM   3530 N N   . TYR A 1 441 ? 33.393  19.872  5.072   1.00 70.75  ? 441  TYR A N   1 
ATOM   3531 C CA  . TYR A 1 441 ? 34.437  19.254  5.890   1.00 79.18  ? 441  TYR A CA  1 
ATOM   3532 C C   . TYR A 1 441 ? 33.975  19.469  7.340   1.00 82.80  ? 441  TYR A C   1 
ATOM   3533 O O   . TYR A 1 441 ? 33.748  20.610  7.782   1.00 82.12  ? 441  TYR A O   1 
ATOM   3534 C CB  . TYR A 1 441 ? 35.804  19.906  5.649   1.00 81.16  ? 441  TYR A CB  1 
ATOM   3535 C CG  . TYR A 1 441 ? 36.400  19.589  4.289   1.00 77.05  ? 441  TYR A CG  1 
ATOM   3536 C CD1 . TYR A 1 441 ? 35.883  20.167  3.126   1.00 83.09  ? 441  TYR A CD1 1 
ATOM   3537 C CD2 . TYR A 1 441 ? 37.459  18.688  4.157   1.00 64.98  ? 441  TYR A CD2 1 
ATOM   3538 C CE1 . TYR A 1 441 ? 36.402  19.855  1.854   1.00 82.18  ? 441  TYR A CE1 1 
ATOM   3539 C CE2 . TYR A 1 441 ? 37.990  18.368  2.883   1.00 79.66  ? 441  TYR A CE2 1 
ATOM   3540 C CZ  . TYR A 1 441 ? 37.451  18.956  1.733   1.00 76.55  ? 441  TYR A CZ  1 
ATOM   3541 O OH  . TYR A 1 441 ? 37.926  18.639  0.468   1.00 61.94  ? 441  TYR A OH  1 
ATOM   3542 N N   . VAL A 1 442 ? 33.804  18.359  8.059   1.00 83.96  ? 442  VAL A N   1 
ATOM   3543 C CA  . VAL A 1 442 ? 33.322  18.383  9.439   1.00 88.10  ? 442  VAL A CA  1 
ATOM   3544 C C   . VAL A 1 442 ? 34.347  17.807  10.423  1.00 94.42  ? 442  VAL A C   1 
ATOM   3545 O O   . VAL A 1 442 ? 35.121  16.905  10.079  1.00 97.36  ? 442  VAL A O   1 
ATOM   3546 C CB  . VAL A 1 442 ? 32.009  17.561  9.573   1.00 88.74  ? 442  VAL A CB  1 
ATOM   3547 C CG1 . VAL A 1 442 ? 31.089  17.826  8.372   1.00 81.40  ? 442  VAL A CG1 1 
ATOM   3548 C CG2 . VAL A 1 442 ? 32.330  16.067  9.684   1.00 93.04  ? 442  VAL A CG2 1 
ATOM   3549 N N   . ASP A 1 443 ? 34.342  18.321  11.651  1.00 96.68  ? 443  ASP A N   1 
ATOM   3550 C CA  . ASP A 1 443 ? 35.273  17.843  12.674  1.00 96.11  ? 443  ASP A CA  1 
ATOM   3551 C C   . ASP A 1 443 ? 34.653  17.897  14.077  1.00 93.98  ? 443  ASP A C   1 
ATOM   3552 O O   . ASP A 1 443 ? 33.430  18.011  14.237  1.00 85.25  ? 443  ASP A O   1 
ATOM   3553 C CB  . ASP A 1 443 ? 36.578  18.666  12.641  1.00 92.71  ? 443  ASP A CB  1 
ATOM   3554 C CG  . ASP A 1 443 ? 37.509  18.285  11.475  1.00 95.52  ? 443  ASP A CG  1 
ATOM   3555 O OD1 . ASP A 1 443 ? 37.326  18.754  10.322  1.00 102.67 ? 443  ASP A OD1 1 
ATOM   3556 O OD2 . ASP A 1 443 ? 38.445  17.502  11.724  1.00 93.02  ? 443  ASP A OD2 1 
ATOM   3557 N N   . ALA A 1 455 ? 31.949  20.327  16.726  1.00 142.31 ? 455  ALA A N   1 
ATOM   3558 C CA  . ALA A 1 455 ? 30.639  20.477  16.104  1.00 141.37 ? 455  ALA A CA  1 
ATOM   3559 C C   . ALA A 1 455 ? 30.633  21.705  15.195  1.00 137.52 ? 455  ALA A C   1 
ATOM   3560 O O   . ALA A 1 455 ? 30.348  22.820  15.653  1.00 138.41 ? 455  ALA A O   1 
ATOM   3561 C CB  . ALA A 1 455 ? 29.554  20.606  17.183  1.00 140.03 ? 455  ALA A CB  1 
ATOM   3562 N N   . GLY A 1 456 ? 30.952  21.487  13.914  1.00 130.20 ? 456  GLY A N   1 
ATOM   3563 C CA  . GLY A 1 456 ? 30.987  22.562  12.932  1.00 118.96 ? 456  GLY A CA  1 
ATOM   3564 C C   . GLY A 1 456 ? 31.528  22.087  11.593  1.00 111.33 ? 456  GLY A C   1 
ATOM   3565 O O   . GLY A 1 456 ? 32.171  21.036  11.510  1.00 109.52 ? 456  GLY A O   1 
ATOM   3566 N N   . TYR A 1 457 ? 31.278  22.863  10.543  1.00 107.61 ? 457  TYR A N   1 
ATOM   3567 C CA  . TYR A 1 457 ? 31.738  22.498  9.208   1.00 103.36 ? 457  TYR A CA  1 
ATOM   3568 C C   . TYR A 1 457 ? 32.344  23.667  8.438   1.00 105.10 ? 457  TYR A C   1 
ATOM   3569 O O   . TYR A 1 457 ? 32.335  24.813  8.896   1.00 109.82 ? 457  TYR A O   1 
ATOM   3570 C CB  . TYR A 1 457 ? 30.569  21.924  8.407   1.00 95.74  ? 457  TYR A CB  1 
ATOM   3571 C CG  . TYR A 1 457 ? 29.434  22.905  8.152   1.00 88.30  ? 457  TYR A CG  1 
ATOM   3572 C CD1 . TYR A 1 457 ? 29.538  23.891  7.158   1.00 95.84  ? 457  TYR A CD1 1 
ATOM   3573 C CD2 . TYR A 1 457 ? 28.251  22.841  8.894   1.00 88.40  ? 457  TYR A CD2 1 
ATOM   3574 C CE1 . TYR A 1 457 ? 28.485  24.793  6.908   1.00 100.60 ? 457  TYR A CE1 1 
ATOM   3575 C CE2 . TYR A 1 457 ? 27.190  23.734  8.657   1.00 99.65  ? 457  TYR A CE2 1 
ATOM   3576 C CZ  . TYR A 1 457 ? 27.313  24.708  7.663   1.00 100.13 ? 457  TYR A CZ  1 
ATOM   3577 O OH  . TYR A 1 457 ? 26.270  25.588  7.425   1.00 101.07 ? 457  TYR A OH  1 
ATOM   3578 N N   . VAL A 1 458 ? 32.868  23.360  7.259   1.00 99.01  ? 458  VAL A N   1 
ATOM   3579 C CA  . VAL A 1 458 ? 33.461  24.358  6.384   1.00 91.32  ? 458  VAL A CA  1 
ATOM   3580 C C   . VAL A 1 458 ? 33.273  23.775  5.015   1.00 85.64  ? 458  VAL A C   1 
ATOM   3581 O O   . VAL A 1 458 ? 33.581  22.605  4.798   1.00 91.06  ? 458  VAL A O   1 
ATOM   3582 C CB  . VAL A 1 458 ? 34.969  24.499  6.596   1.00 90.90  ? 458  VAL A CB  1 
ATOM   3583 C CG1 . VAL A 1 458 ? 35.474  25.714  5.838   1.00 94.65  ? 458  VAL A CG1 1 
ATOM   3584 C CG2 . VAL A 1 458 ? 35.286  24.590  8.067   1.00 91.26  ? 458  VAL A CG2 1 
ATOM   3585 N N   . THR A 1 459 ? 32.776  24.564  4.081   1.00 75.82  ? 459  THR A N   1 
ATOM   3586 C CA  . THR A 1 459 ? 32.587  24.023  2.750   1.00 71.53  ? 459  THR A CA  1 
ATOM   3587 C C   . THR A 1 459 ? 33.565  24.637  1.777   1.00 66.86  ? 459  THR A C   1 
ATOM   3588 O O   . THR A 1 459 ? 34.251  25.598  2.097   1.00 64.99  ? 459  THR A O   1 
ATOM   3589 C CB  . THR A 1 459 ? 31.180  24.293  2.252   1.00 71.62  ? 459  THR A CB  1 
ATOM   3590 O OG1 . THR A 1 459 ? 31.150  25.564  1.591   1.00 72.41  ? 459  THR A OG1 1 
ATOM   3591 C CG2 . THR A 1 459 ? 30.201  24.309  3.436   1.00 73.15  ? 459  THR A CG2 1 
ATOM   3592 N N   . ASN A 1 460 ? 33.635  24.071  0.583   1.00 67.52  ? 460  ASN A N   1 
ATOM   3593 C CA  . ASN A 1 460 ? 34.524  24.605  -0.424  1.00 67.88  ? 460  ASN A CA  1 
ATOM   3594 C C   . ASN A 1 460 ? 33.978  25.970  -0.845  1.00 70.84  ? 460  ASN A C   1 
ATOM   3595 O O   . ASN A 1 460 ? 34.737  26.841  -1.259  1.00 76.96  ? 460  ASN A O   1 
ATOM   3596 C CB  . ASN A 1 460 ? 34.584  23.652  -1.616  1.00 70.32  ? 460  ASN A CB  1 
ATOM   3597 C CG  . ASN A 1 460 ? 33.216  23.314  -2.152  1.00 70.58  ? 460  ASN A CG  1 
ATOM   3598 O OD1 . ASN A 1 460 ? 32.302  23.021  -1.394  1.00 71.17  ? 460  ASN A OD1 1 
ATOM   3599 N ND2 . ASN A 1 460 ? 33.069  23.349  -3.464  1.00 80.57  ? 460  ASN A ND2 1 
ATOM   3600 N N   . ARG A 1 461 ? 32.664  26.158  -0.715  1.00 66.02  ? 461  ARG A N   1 
ATOM   3601 C CA  . ARG A 1 461 ? 32.024  27.417  -1.092  1.00 57.95  ? 461  ARG A CA  1 
ATOM   3602 C C   . ARG A 1 461 ? 32.117  28.493  -0.048  1.00 59.41  ? 461  ARG A C   1 
ATOM   3603 O O   . ARG A 1 461 ? 31.392  29.490  -0.118  1.00 62.81  ? 461  ARG A O   1 
ATOM   3604 C CB  . ARG A 1 461 ? 30.566  27.185  -1.435  1.00 45.81  ? 461  ARG A CB  1 
ATOM   3605 C CG  . ARG A 1 461 ? 30.468  26.209  -2.559  1.00 61.37  ? 461  ARG A CG  1 
ATOM   3606 C CD  . ARG A 1 461 ? 29.061  25.912  -2.968  1.00 66.63  ? 461  ARG A CD  1 
ATOM   3607 N NE  . ARG A 1 461 ? 29.085  24.975  -4.080  1.00 90.92  ? 461  ARG A NE  1 
ATOM   3608 C CZ  . ARG A 1 461 ? 28.020  24.333  -4.558  1.00 101.28 ? 461  ARG A CZ  1 
ATOM   3609 N NH1 . ARG A 1 461 ? 26.814  24.520  -4.019  1.00 91.80  ? 461  ARG A NH1 1 
ATOM   3610 N NH2 . ARG A 1 461 ? 28.169  23.493  -5.580  1.00 113.17 ? 461  ARG A NH2 1 
ATOM   3611 N N   . GLY A 1 462 ? 33.000  28.277  0.925   1.00 65.38  ? 462  GLY A N   1 
ATOM   3612 C CA  . GLY A 1 462 ? 33.219  29.252  1.985   1.00 70.02  ? 462  GLY A CA  1 
ATOM   3613 C C   . GLY A 1 462 ? 32.338  29.215  3.227   1.00 71.39  ? 462  GLY A C   1 
ATOM   3614 O O   . GLY A 1 462 ? 32.713  29.749  4.278   1.00 70.42  ? 462  GLY A O   1 
ATOM   3615 N N   . ARG A 1 463 ? 31.179  28.576  3.123   1.00 72.10  ? 463  ARG A N   1 
ATOM   3616 C CA  . ARG A 1 463 ? 30.242  28.509  4.233   1.00 69.83  ? 463  ARG A CA  1 
ATOM   3617 C C   . ARG A 1 463 ? 30.729  27.730  5.431   1.00 75.60  ? 463  ARG A C   1 
ATOM   3618 O O   . ARG A 1 463 ? 31.482  26.756  5.298   1.00 71.03  ? 463  ARG A O   1 
ATOM   3619 C CB  . ARG A 1 463 ? 28.941  27.907  3.749   1.00 72.16  ? 463  ARG A CB  1 
ATOM   3620 C CG  . ARG A 1 463 ? 28.587  28.382  2.359   1.00 86.67  ? 463  ARG A CG  1 
ATOM   3621 C CD  . ARG A 1 463 ? 27.107  28.242  2.121   1.00 100.29 ? 463  ARG A CD  1 
ATOM   3622 N NE  . ARG A 1 463 ? 26.645  26.866  2.263   1.00 97.32  ? 463  ARG A NE  1 
ATOM   3623 C CZ  . ARG A 1 463 ? 25.539  26.522  2.914   1.00 98.67  ? 463  ARG A CZ  1 
ATOM   3624 N NH1 . ARG A 1 463 ? 24.781  27.448  3.490   1.00 97.67  ? 463  ARG A NH1 1 
ATOM   3625 N NH2 . ARG A 1 463 ? 25.184  25.249  2.981   1.00 104.66 ? 463  ARG A NH2 1 
ATOM   3626 N N   . GLN A 1 464 ? 30.276  28.172  6.607   1.00 86.51  ? 464  GLN A N   1 
ATOM   3627 C CA  . GLN A 1 464 ? 30.620  27.531  7.881   1.00 86.09  ? 464  GLN A CA  1 
ATOM   3628 C C   . GLN A 1 464 ? 29.669  27.858  9.044   1.00 82.04  ? 464  GLN A C   1 
ATOM   3629 O O   . GLN A 1 464 ? 28.928  28.850  9.027   1.00 79.73  ? 464  GLN A O   1 
ATOM   3630 C CB  . GLN A 1 464 ? 32.070  27.864  8.281   1.00 86.29  ? 464  GLN A CB  1 
ATOM   3631 C CG  . GLN A 1 464 ? 32.366  29.347  8.437   1.00 97.64  ? 464  GLN A CG  1 
ATOM   3632 C CD  . GLN A 1 464 ? 33.856  29.641  8.572   1.00 105.10 ? 464  GLN A CD  1 
ATOM   3633 O OE1 . GLN A 1 464 ? 34.439  29.531  9.659   1.00 107.62 ? 464  GLN A OE1 1 
ATOM   3634 N NE2 . GLN A 1 464 ? 34.484  30.009  7.457   1.00 109.84 ? 464  GLN A NE2 1 
ATOM   3635 N N   . LYS A 1 465 ? 29.696  26.983  10.044  1.00 85.00  ? 465  LYS A N   1 
ATOM   3636 C CA  . LYS A 1 465 ? 28.885  27.115  11.245  1.00 90.83  ? 465  LYS A CA  1 
ATOM   3637 C C   . LYS A 1 465 ? 29.549  26.283  12.312  1.00 97.85  ? 465  LYS A C   1 
ATOM   3638 O O   . LYS A 1 465 ? 29.692  25.069  12.156  1.00 94.06  ? 465  LYS A O   1 
ATOM   3639 C CB  . LYS A 1 465 ? 27.480  26.539  11.059  1.00 96.65  ? 465  LYS A CB  1 
ATOM   3640 C CG  . LYS A 1 465 ? 26.569  27.259  10.089  1.00 102.31 ? 465  LYS A CG  1 
ATOM   3641 C CD  . LYS A 1 465 ? 25.241  26.512  9.983   1.00 96.09  ? 465  LYS A CD  1 
ATOM   3642 C CE  . LYS A 1 465 ? 24.488  26.500  11.304  1.00 89.06  ? 465  LYS A CE  1 
ATOM   3643 N NZ  . LYS A 1 465 ? 23.246  27.321  11.192  1.00 104.07 ? 465  LYS A NZ  1 
ATOM   3644 N N   . VAL A 1 466 ? 29.975  26.932  13.385  1.00 111.89 ? 466  VAL A N   1 
ATOM   3645 C CA  . VAL A 1 466 ? 30.566  26.210  14.505  1.00 125.02 ? 466  VAL A CA  1 
ATOM   3646 C C   . VAL A 1 466 ? 29.506  26.316  15.579  1.00 132.13 ? 466  VAL A C   1 
ATOM   3647 O O   . VAL A 1 466 ? 29.328  27.367  16.194  1.00 131.54 ? 466  VAL A O   1 
ATOM   3648 C CB  . VAL A 1 466 ? 31.866  26.849  15.020  1.00 124.63 ? 466  VAL A CB  1 
ATOM   3649 C CG1 . VAL A 1 466 ? 32.141  26.370  16.454  1.00 117.37 ? 466  VAL A CG1 1 
ATOM   3650 C CG2 . VAL A 1 466 ? 33.033  26.474  14.091  1.00 124.49 ? 466  VAL A CG2 1 
ATOM   3651 N N   . VAL A 1 467 ? 28.790  25.224  15.795  1.00 140.93 ? 467  VAL A N   1 
ATOM   3652 C CA  . VAL A 1 467 ? 27.718  25.247  16.762  1.00 147.67 ? 467  VAL A CA  1 
ATOM   3653 C C   . VAL A 1 467 ? 28.083  24.823  18.179  1.00 148.71 ? 467  VAL A C   1 
ATOM   3654 O O   . VAL A 1 467 ? 29.194  24.343  18.465  1.00 143.38 ? 467  VAL A O   1 
ATOM   3655 C CB  . VAL A 1 467 ? 26.499  24.419  16.260  1.00 149.99 ? 467  VAL A CB  1 
ATOM   3656 C CG1 . VAL A 1 467 ? 26.074  24.904  14.862  1.00 149.99 ? 467  VAL A CG1 1 
ATOM   3657 C CG2 . VAL A 1 467 ? 26.839  22.938  16.248  1.00 149.99 ? 467  VAL A CG2 1 
ATOM   3658 N N   . THR A 1 468 ? 27.105  25.028  19.055  1.00 149.99 ? 468  THR A N   1 
ATOM   3659 C CA  . THR A 1 468 ? 27.207  24.744  20.476  1.00 150.00 ? 468  THR A CA  1 
ATOM   3660 C C   . THR A 1 468 ? 26.398  23.529  20.943  1.00 150.00 ? 468  THR A C   1 
ATOM   3661 O O   . THR A 1 468 ? 25.188  23.426  20.700  1.00 150.00 ? 468  THR A O   1 
ATOM   3662 C CB  . THR A 1 468 ? 26.756  25.981  21.288  1.00 150.00 ? 468  THR A CB  1 
ATOM   3663 O OG1 . THR A 1 468 ? 25.574  26.543  20.688  1.00 150.00 ? 468  THR A OG1 1 
ATOM   3664 C CG2 . THR A 1 468 ? 27.876  27.028  21.335  1.00 145.45 ? 468  THR A CG2 1 
ATOM   3665 N N   . LEU A 1 469 ? 27.087  22.617  21.620  1.00 150.00 ? 469  LEU A N   1 
ATOM   3666 C CA  . LEU A 1 469 ? 26.475  21.408  22.159  1.00 150.00 ? 469  LEU A CA  1 
ATOM   3667 C C   . LEU A 1 469 ? 26.947  21.218  23.590  1.00 149.99 ? 469  LEU A C   1 
ATOM   3668 O O   . LEU A 1 469 ? 28.151  21.277  23.865  1.00 150.00 ? 469  LEU A O   1 
ATOM   3669 C CB  . LEU A 1 469 ? 26.893  20.166  21.367  1.00 150.00 ? 469  LEU A CB  1 
ATOM   3670 C CG  . LEU A 1 469 ? 26.240  19.686  20.068  1.00 150.00 ? 469  LEU A CG  1 
ATOM   3671 C CD1 . LEU A 1 469 ? 26.419  20.692  18.934  1.00 150.00 ? 469  LEU A CD1 1 
ATOM   3672 C CD2 . LEU A 1 469 ? 26.898  18.352  19.707  1.00 150.00 ? 469  LEU A CD2 1 
ATOM   3673 N N   . THR A 1 470 ? 25.998  20.993  24.495  1.00 150.00 ? 470  THR A N   1 
ATOM   3674 C CA  . THR A 1 470 ? 26.307  20.752  25.907  1.00 150.00 ? 470  THR A CA  1 
ATOM   3675 C C   . THR A 1 470 ? 25.777  19.357  26.298  1.00 150.00 ? 470  THR A C   1 
ATOM   3676 O O   . THR A 1 470 ? 24.762  18.894  25.755  1.00 150.00 ? 470  THR A O   1 
ATOM   3677 C CB  . THR A 1 470 ? 25.687  21.855  26.843  1.00 149.99 ? 470  THR A CB  1 
ATOM   3678 O OG1 . THR A 1 470 ? 24.517  22.420  26.232  1.00 150.00 ? 470  THR A OG1 1 
ATOM   3679 C CG2 . THR A 1 470 ? 26.708  22.963  27.128  1.00 144.21 ? 470  THR A CG2 1 
ATOM   3680 N N   . ASP A 1 471 ? 26.480  18.691  27.218  1.00 150.00 ? 471  ASP A N   1 
ATOM   3681 C CA  . ASP A 1 471 ? 26.106  17.349  27.683  1.00 148.66 ? 471  ASP A CA  1 
ATOM   3682 C C   . ASP A 1 471 ? 26.338  16.295  26.572  1.00 147.94 ? 471  ASP A C   1 
ATOM   3683 O O   . ASP A 1 471 ? 25.895  15.151  26.691  1.00 150.00 ? 471  ASP A O   1 
ATOM   3684 C CB  . ASP A 1 471 ? 24.623  17.327  28.146  1.00 144.93 ? 471  ASP A CB  1 
ATOM   3685 C CG  . ASP A 1 471 ? 24.359  18.182  29.417  1.00 131.08 ? 471  ASP A CG  1 
ATOM   3686 O OD1 . ASP A 1 471 ? 24.901  19.303  29.523  1.00 129.99 ? 471  ASP A OD1 1 
ATOM   3687 O OD2 . ASP A 1 471 ? 23.587  17.743  30.306  1.00 105.51 ? 471  ASP A OD2 1 
ATOM   3688 N N   . THR A 1 472 ? 27.049  16.683  25.510  1.00 144.22 ? 472  THR A N   1 
ATOM   3689 C CA  . THR A 1 472 ? 27.327  15.793  24.372  1.00 139.56 ? 472  THR A CA  1 
ATOM   3690 C C   . THR A 1 472 ? 28.577  14.936  24.528  1.00 133.09 ? 472  THR A C   1 
ATOM   3691 O O   . THR A 1 472 ? 29.641  15.440  24.879  1.00 134.28 ? 472  THR A O   1 
ATOM   3692 C CB  . THR A 1 472 ? 27.485  16.596  23.050  1.00 143.15 ? 472  THR A CB  1 
ATOM   3693 O OG1 . THR A 1 472 ? 27.789  15.698  21.974  1.00 138.65 ? 472  THR A OG1 1 
ATOM   3694 C CG2 . THR A 1 472 ? 28.612  17.623  23.174  1.00 142.79 ? 472  THR A CG2 1 
ATOM   3695 N N   . THR A 1 473 ? 28.450  13.642  24.256  1.00 125.09 ? 473  THR A N   1 
ATOM   3696 C CA  . THR A 1 473 ? 29.593  12.739  24.353  1.00 118.83 ? 473  THR A CA  1 
ATOM   3697 C C   . THR A 1 473 ? 30.486  12.968  23.146  1.00 117.37 ? 473  THR A C   1 
ATOM   3698 O O   . THR A 1 473 ? 30.095  13.655  22.203  1.00 118.18 ? 473  THR A O   1 
ATOM   3699 C CB  . THR A 1 473 ? 29.161  11.270  24.351  1.00 109.52 ? 473  THR A CB  1 
ATOM   3700 O OG1 . THR A 1 473 ? 27.751  11.195  24.146  1.00 108.73 ? 473  THR A OG1 1 
ATOM   3701 C CG2 . THR A 1 473 ? 29.503  10.612  25.664  1.00 103.15 ? 473  THR A CG2 1 
ATOM   3702 N N   . ASN A 1 474 ? 31.684  12.393  23.171  1.00 114.22 ? 474  ASN A N   1 
ATOM   3703 C CA  . ASN A 1 474 ? 32.612  12.559  22.057  1.00 113.35 ? 474  ASN A CA  1 
ATOM   3704 C C   . ASN A 1 474 ? 31.969  12.053  20.765  1.00 106.57 ? 474  ASN A C   1 
ATOM   3705 O O   . ASN A 1 474 ? 31.861  12.782  19.770  1.00 98.97  ? 474  ASN A O   1 
ATOM   3706 C CB  . ASN A 1 474 ? 33.929  11.790  22.309  1.00 114.24 ? 474  ASN A CB  1 
ATOM   3707 C CG  . ASN A 1 474 ? 34.950  12.583  23.156  1.00 108.98 ? 474  ASN A CG  1 
ATOM   3708 O OD1 . ASN A 1 474 ? 34.954  13.821  23.176  1.00 97.74  ? 474  ASN A OD1 1 
ATOM   3709 N ND2 . ASN A 1 474 ? 35.839  11.856  23.831  1.00 100.92 ? 474  ASN A ND2 1 
ATOM   3710 N N   . GLN A 1 475 ? 31.535  10.798  20.804  1.00 101.81 ? 475  GLN A N   1 
ATOM   3711 C CA  . GLN A 1 475 ? 30.917  10.145  19.658  1.00 103.06 ? 475  GLN A CA  1 
ATOM   3712 C C   . GLN A 1 475 ? 29.691  10.859  19.125  1.00 103.70 ? 475  GLN A C   1 
ATOM   3713 O O   . GLN A 1 475 ? 29.452  10.914  17.913  1.00 99.09  ? 475  GLN A O   1 
ATOM   3714 C CB  . GLN A 1 475 ? 30.509  8.731   20.035  1.00 105.61 ? 475  GLN A CB  1 
ATOM   3715 C CG  . GLN A 1 475 ? 31.646  7.840   20.449  1.00 118.28 ? 475  GLN A CG  1 
ATOM   3716 C CD  . GLN A 1 475 ? 31.195  6.401   20.650  1.00 125.53 ? 475  GLN A CD  1 
ATOM   3717 O OE1 . GLN A 1 475 ? 31.990  5.470   20.546  1.00 138.91 ? 475  GLN A OE1 1 
ATOM   3718 N NE2 . GLN A 1 475 ? 29.913  6.214   20.946  1.00 117.24 ? 475  GLN A NE2 1 
ATOM   3719 N N   . LYS A 1 476 ? 28.902  11.384  20.050  1.00 103.70 ? 476  LYS A N   1 
ATOM   3720 C CA  . LYS A 1 476 ? 27.670  12.074  19.710  1.00 102.40 ? 476  LYS A CA  1 
ATOM   3721 C C   . LYS A 1 476 ? 27.922  13.486  19.153  1.00 100.47 ? 476  LYS A C   1 
ATOM   3722 O O   . LYS A 1 476 ? 27.024  14.101  18.564  1.00 94.33  ? 476  LYS A O   1 
ATOM   3723 C CB  . LYS A 1 476 ? 26.782  12.122  20.959  1.00 103.70 ? 476  LYS A CB  1 
ATOM   3724 C CG  . LYS A 1 476 ? 25.288  11.974  20.692  1.00 106.30 ? 476  LYS A CG  1 
ATOM   3725 C CD  . LYS A 1 476 ? 24.644  13.297  20.313  1.00 107.67 ? 476  LYS A CD  1 
ATOM   3726 C CE  . LYS A 1 476 ? 24.571  14.231  21.506  1.00 108.66 ? 476  LYS A CE  1 
ATOM   3727 N NZ  . LYS A 1 476 ? 24.008  15.547  21.117  1.00 115.09 ? 476  LYS A NZ  1 
ATOM   3728 N N   . THR A 1 477 ? 29.141  13.992  19.338  1.00 101.06 ? 477  THR A N   1 
ATOM   3729 C CA  . THR A 1 477 ? 29.504  15.319  18.848  1.00 98.83  ? 477  THR A CA  1 
ATOM   3730 C C   . THR A 1 477 ? 29.741  15.229  17.359  1.00 98.56  ? 477  THR A C   1 
ATOM   3731 O O   . THR A 1 477 ? 29.351  16.110  16.597  1.00 98.23  ? 477  THR A O   1 
ATOM   3732 C CB  . THR A 1 477 ? 30.789  15.810  19.477  1.00 95.94  ? 477  THR A CB  1 
ATOM   3733 O OG1 . THR A 1 477 ? 30.677  15.739  20.901  1.00 104.16 ? 477  THR A OG1 1 
ATOM   3734 C CG2 . THR A 1 477 ? 31.049  17.234  19.064  1.00 91.89  ? 477  THR A CG2 1 
ATOM   3735 N N   . GLU A 1 478 ? 30.401  14.146  16.969  1.00 100.65 ? 478  GLU A N   1 
ATOM   3736 C CA  . GLU A 1 478 ? 30.709  13.860  15.576  1.00 100.60 ? 478  GLU A CA  1 
ATOM   3737 C C   . GLU A 1 478 ? 29.419  13.813  14.749  1.00 101.30 ? 478  GLU A C   1 
ATOM   3738 O O   . GLU A 1 478 ? 29.284  14.530  13.757  1.00 101.92 ? 478  GLU A O   1 
ATOM   3739 C CB  . GLU A 1 478 ? 31.447  12.521  15.492  1.00 102.82 ? 478  GLU A CB  1 
ATOM   3740 C CG  . GLU A 1 478 ? 32.740  12.490  16.310  1.00 115.30 ? 478  GLU A CG  1 
ATOM   3741 C CD  . GLU A 1 478 ? 33.382  11.103  16.393  1.00 127.16 ? 478  GLU A CD  1 
ATOM   3742 O OE1 . GLU A 1 478 ? 34.536  11.016  16.870  1.00 130.28 ? 478  GLU A OE1 1 
ATOM   3743 O OE2 . GLU A 1 478 ? 32.741  10.100  15.996  1.00 132.13 ? 478  GLU A OE2 1 
ATOM   3744 N N   . LEU A 1 479 ? 28.472  12.977  15.174  1.00 101.82 ? 479  LEU A N   1 
ATOM   3745 C CA  . LEU A 1 479 ? 27.184  12.819  14.488  1.00 94.60  ? 479  LEU A CA  1 
ATOM   3746 C C   . LEU A 1 479 ? 26.398  14.138  14.359  1.00 96.14  ? 479  LEU A C   1 
ATOM   3747 O O   . LEU A 1 479 ? 25.620  14.333  13.414  1.00 98.51  ? 479  LEU A O   1 
ATOM   3748 C CB  . LEU A 1 479 ? 26.342  11.762  15.220  1.00 80.16  ? 479  LEU A CB  1 
ATOM   3749 C CG  . LEU A 1 479 ? 26.957  10.355  15.277  1.00 70.12  ? 479  LEU A CG  1 
ATOM   3750 C CD1 . LEU A 1 479 ? 26.260  9.481   16.303  1.00 76.74  ? 479  LEU A CD1 1 
ATOM   3751 C CD2 . LEU A 1 479 ? 26.848  9.731   13.908  1.00 77.99  ? 479  LEU A CD2 1 
ATOM   3752 N N   . GLN A 1 480 ? 26.611  15.043  15.308  1.00 93.39  ? 480  GLN A N   1 
ATOM   3753 C CA  . GLN A 1 480 ? 25.932  16.334  15.299  1.00 91.80  ? 480  GLN A CA  1 
ATOM   3754 C C   . GLN A 1 480 ? 26.370  17.157  14.107  1.00 83.54  ? 480  GLN A C   1 
ATOM   3755 O O   . GLN A 1 480 ? 25.549  17.785  13.419  1.00 72.55  ? 480  GLN A O   1 
ATOM   3756 C CB  . GLN A 1 480 ? 26.250  17.100  16.581  1.00 101.94 ? 480  GLN A CB  1 
ATOM   3757 C CG  . GLN A 1 480 ? 25.063  17.230  17.531  1.00 118.07 ? 480  GLN A CG  1 
ATOM   3758 C CD  . GLN A 1 480 ? 23.937  18.110  16.973  1.00 118.26 ? 480  GLN A CD  1 
ATOM   3759 O OE1 . GLN A 1 480 ? 22.837  17.628  16.680  1.00 126.24 ? 480  GLN A OE1 1 
ATOM   3760 N NE2 . GLN A 1 480 ? 24.211  19.403  16.827  1.00 104.56 ? 480  GLN A NE2 1 
ATOM   3761 N N   . ALA A 1 481 ? 27.686  17.140  13.897  1.00 81.76  ? 481  ALA A N   1 
ATOM   3762 C CA  . ALA A 1 481 ? 28.347  17.852  12.808  1.00 79.74  ? 481  ALA A CA  1 
ATOM   3763 C C   . ALA A 1 481 ? 27.690  17.441  11.507  1.00 79.07  ? 481  ALA A C   1 
ATOM   3764 O O   . ALA A 1 481 ? 27.093  18.255  10.783  1.00 78.98  ? 481  ALA A O   1 
ATOM   3765 C CB  . ALA A 1 481 ? 29.838  17.492  12.777  1.00 70.23  ? 481  ALA A CB  1 
ATOM   3766 N N   . ILE A 1 482 ? 27.812  16.154  11.225  1.00 72.10  ? 482  ILE A N   1 
ATOM   3767 C CA  . ILE A 1 482 ? 27.237  15.584  10.036  1.00 67.43  ? 482  ILE A CA  1 
ATOM   3768 C C   . ILE A 1 482 ? 25.779  16.004  9.872   1.00 65.43  ? 482  ILE A C   1 
ATOM   3769 O O   . ILE A 1 482 ? 25.332  16.343  8.774   1.00 56.22  ? 482  ILE A O   1 
ATOM   3770 C CB  . ILE A 1 482 ? 27.334  14.085  10.104  1.00 67.01  ? 482  ILE A CB  1 
ATOM   3771 C CG1 . ILE A 1 482 ? 28.815  13.687  10.106  1.00 63.68  ? 482  ILE A CG1 1 
ATOM   3772 C CG2 . ILE A 1 482 ? 26.538  13.483  8.971   1.00 74.70  ? 482  ILE A CG2 1 
ATOM   3773 C CD1 . ILE A 1 482 ? 29.089  12.197  10.167  1.00 57.70  ? 482  ILE A CD1 1 
ATOM   3774 N N   . TYR A 1 483 ? 25.035  15.983  10.967  1.00 64.98  ? 483  TYR A N   1 
ATOM   3775 C CA  . TYR A 1 483 ? 23.653  16.379  10.875  1.00 68.42  ? 483  TYR A CA  1 
ATOM   3776 C C   . TYR A 1 483 ? 23.606  17.818  10.336  1.00 66.31  ? 483  TYR A C   1 
ATOM   3777 O O   . TYR A 1 483 ? 22.882  18.138  9.388   1.00 65.08  ? 483  TYR A O   1 
ATOM   3778 C CB  . TYR A 1 483 ? 22.985  16.276  12.246  1.00 72.58  ? 483  TYR A CB  1 
ATOM   3779 C CG  . TYR A 1 483 ? 21.513  16.624  12.195  1.00 85.48  ? 483  TYR A CG  1 
ATOM   3780 C CD1 . TYR A 1 483 ? 20.661  16.006  11.275  1.00 90.41  ? 483  TYR A CD1 1 
ATOM   3781 C CD2 . TYR A 1 483 ? 20.979  17.601  13.022  1.00 85.76  ? 483  TYR A CD2 1 
ATOM   3782 C CE1 . TYR A 1 483 ? 19.313  16.361  11.176  1.00 84.54  ? 483  TYR A CE1 1 
ATOM   3783 C CE2 . TYR A 1 483 ? 19.632  17.960  12.931  1.00 85.77  ? 483  TYR A CE2 1 
ATOM   3784 C CZ  . TYR A 1 483 ? 18.808  17.337  12.003  1.00 79.09  ? 483  TYR A CZ  1 
ATOM   3785 O OH  . TYR A 1 483 ? 17.487  17.699  11.884  1.00 69.26  ? 483  TYR A OH  1 
ATOM   3786 N N   . LEU A 1 484 ? 24.388  18.693  10.937  1.00 61.61  ? 484  LEU A N   1 
ATOM   3787 C CA  . LEU A 1 484 ? 24.405  20.059  10.475  1.00 64.38  ? 484  LEU A CA  1 
ATOM   3788 C C   . LEU A 1 484 ? 24.542  20.102  8.977   1.00 70.00  ? 484  LEU A C   1 
ATOM   3789 O O   . LEU A 1 484 ? 23.664  20.588  8.269   1.00 69.41  ? 484  LEU A O   1 
ATOM   3790 C CB  . LEU A 1 484 ? 25.566  20.779  11.102  1.00 63.55  ? 484  LEU A CB  1 
ATOM   3791 C CG  . LEU A 1 484 ? 25.075  21.414  12.380  1.00 77.16  ? 484  LEU A CG  1 
ATOM   3792 C CD1 . LEU A 1 484 ? 26.222  21.585  13.340  1.00 85.44  ? 484  LEU A CD1 1 
ATOM   3793 C CD2 . LEU A 1 484 ? 24.413  22.744  12.030  1.00 81.33  ? 484  LEU A CD2 1 
ATOM   3794 N N   . ALA A 1 485 ? 25.665  19.578  8.510   1.00 71.47  ? 485  ALA A N   1 
ATOM   3795 C CA  . ALA A 1 485 ? 25.973  19.529  7.089   1.00 64.47  ? 485  ALA A CA  1 
ATOM   3796 C C   . ALA A 1 485 ? 24.761  19.144  6.263   1.00 62.28  ? 485  ALA A C   1 
ATOM   3797 O O   . ALA A 1 485 ? 24.401  19.825  5.305   1.00 58.99  ? 485  ALA A O   1 
ATOM   3798 C CB  . ALA A 1 485 ? 27.081  18.532  6.845   1.00 54.70  ? 485  ALA A CB  1 
ATOM   3799 N N   . LEU A 1 486 ? 24.146  18.031  6.641   1.00 64.61  ? 486  LEU A N   1 
ATOM   3800 C CA  . LEU A 1 486 ? 22.975  17.529  5.941   1.00 67.69  ? 486  LEU A CA  1 
ATOM   3801 C C   . LEU A 1 486 ? 21.878  18.565  5.908   1.00 70.58  ? 486  LEU A C   1 
ATOM   3802 O O   . LEU A 1 486 ? 21.192  18.749  4.897   1.00 64.02  ? 486  LEU A O   1 
ATOM   3803 C CB  . LEU A 1 486 ? 22.457  16.272  6.635   1.00 62.97  ? 486  LEU A CB  1 
ATOM   3804 C CG  . LEU A 1 486 ? 23.279  15.019  6.343   1.00 57.08  ? 486  LEU A CG  1 
ATOM   3805 C CD1 . LEU A 1 486 ? 22.898  13.877  7.285   1.00 54.32  ? 486  LEU A CD1 1 
ATOM   3806 C CD2 . LEU A 1 486 ? 23.029  14.644  4.891   1.00 43.29  ? 486  LEU A CD2 1 
ATOM   3807 N N   . GLN A 1 487 ? 21.731  19.247  7.033   1.00 75.05  ? 487  GLN A N   1 
ATOM   3808 C CA  . GLN A 1 487 ? 20.700  20.247  7.186   1.00 84.13  ? 487  GLN A CA  1 
ATOM   3809 C C   . GLN A 1 487 ? 20.809  21.370  6.168   1.00 87.50  ? 487  GLN A C   1 
ATOM   3810 O O   . GLN A 1 487 ? 19.979  21.535  5.270   1.00 86.33  ? 487  GLN A O   1 
ATOM   3811 C CB  . GLN A 1 487 ? 20.794  20.824  8.588   1.00 87.39  ? 487  GLN A CB  1 
ATOM   3812 C CG  . GLN A 1 487 ? 19.501  21.343  9.130   1.00 99.00  ? 487  GLN A CG  1 
ATOM   3813 C CD  . GLN A 1 487 ? 19.108  20.581  10.359  1.00 106.64 ? 487  GLN A CD  1 
ATOM   3814 O OE1 . GLN A 1 487 ? 19.958  20.288  11.204  1.00 97.83  ? 487  GLN A OE1 1 
ATOM   3815 N NE2 . GLN A 1 487 ? 17.824  20.253  10.478  1.00 112.78 ? 487  GLN A NE2 1 
ATOM   3816 N N   . ASP A 1 488 ? 21.878  22.124  6.325   1.00 89.54  ? 488  ASP A N   1 
ATOM   3817 C CA  . ASP A 1 488 ? 22.162  23.288  5.519   1.00 88.66  ? 488  ASP A CA  1 
ATOM   3818 C C   . ASP A 1 488 ? 22.493  23.046  4.054   1.00 81.96  ? 488  ASP A C   1 
ATOM   3819 O O   . ASP A 1 488 ? 22.570  23.989  3.272   1.00 81.96  ? 488  ASP A O   1 
ATOM   3820 C CB  . ASP A 1 488 ? 23.297  24.039  6.211   1.00 94.54  ? 488  ASP A CB  1 
ATOM   3821 C CG  . ASP A 1 488 ? 23.068  24.156  7.718   1.00 101.64 ? 488  ASP A CG  1 
ATOM   3822 O OD1 . ASP A 1 488 ? 24.037  24.425  8.472   1.00 94.07  ? 488  ASP A OD1 1 
ATOM   3823 O OD2 . ASP A 1 488 ? 21.900  23.975  8.144   1.00 110.92 ? 488  ASP A OD2 1 
ATOM   3824 N N   . SER A 1 489 ? 22.663  21.793  3.669   1.00 75.09  ? 489  SER A N   1 
ATOM   3825 C CA  . SER A 1 489 ? 23.027  21.506  2.295   1.00 68.10  ? 489  SER A CA  1 
ATOM   3826 C C   . SER A 1 489 ? 21.848  21.320  1.366   1.00 66.69  ? 489  SER A C   1 
ATOM   3827 O O   . SER A 1 489 ? 20.705  21.273  1.813   1.00 75.37  ? 489  SER A O   1 
ATOM   3828 C CB  . SER A 1 489 ? 23.921  20.275  2.256   1.00 63.78  ? 489  SER A CB  1 
ATOM   3829 O OG  . SER A 1 489 ? 23.321  19.205  2.954   1.00 48.23  ? 489  SER A OG  1 
ATOM   3830 N N   . GLY A 1 490 ? 22.151  21.227  0.070   1.00 63.56  ? 490  GLY A N   1 
ATOM   3831 C CA  . GLY A 1 490 ? 21.144  21.043  -0.968  1.00 62.52  ? 490  GLY A CA  1 
ATOM   3832 C C   . GLY A 1 490 ? 20.897  19.572  -1.209  1.00 65.49  ? 490  GLY A C   1 
ATOM   3833 O O   . GLY A 1 490 ? 21.397  18.739  -0.461  1.00 73.25  ? 490  GLY A O   1 
ATOM   3834 N N   . LEU A 1 491 ? 20.151  19.233  -2.251  1.00 63.59  ? 491  LEU A N   1 
ATOM   3835 C CA  . LEU A 1 491 ? 19.840  17.829  -2.518  1.00 61.76  ? 491  LEU A CA  1 
ATOM   3836 C C   . LEU A 1 491 ? 20.990  16.931  -2.899  1.00 61.42  ? 491  LEU A C   1 
ATOM   3837 O O   . LEU A 1 491 ? 20.790  15.744  -3.134  1.00 64.48  ? 491  LEU A O   1 
ATOM   3838 C CB  . LEU A 1 491 ? 18.771  17.714  -3.595  1.00 65.59  ? 491  LEU A CB  1 
ATOM   3839 C CG  . LEU A 1 491 ? 17.336  17.931  -3.113  1.00 67.42  ? 491  LEU A CG  1 
ATOM   3840 C CD1 . LEU A 1 491 ? 17.221  19.227  -2.302  1.00 76.35  ? 491  LEU A CD1 1 
ATOM   3841 C CD2 . LEU A 1 491 ? 16.427  17.971  -4.318  1.00 64.73  ? 491  LEU A CD2 1 
ATOM   3842 N N   . GLU A 1 492 ? 22.188  17.489  -2.979  1.00 62.29  ? 492  GLU A N   1 
ATOM   3843 C CA  . GLU A 1 492 ? 23.363  16.695  -3.321  1.00 64.02  ? 492  GLU A CA  1 
ATOM   3844 C C   . GLU A 1 492 ? 24.547  17.168  -2.474  1.00 63.94  ? 492  GLU A C   1 
ATOM   3845 O O   . GLU A 1 492 ? 24.942  18.341  -2.531  1.00 68.68  ? 492  GLU A O   1 
ATOM   3846 C CB  . GLU A 1 492 ? 23.707  16.833  -4.824  1.00 65.92  ? 492  GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 492 ? 22.762  16.126  -5.802  1.00 73.83  ? 492  GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 492 ? 23.058  16.432  -7.289  1.00 83.41  ? 492  GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 492 ? 22.330  15.896  -8.157  1.00 84.54  ? 492  GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 492 ? 24.000  17.203  -7.595  1.00 81.42  ? 492  GLU A OE2 1 
ATOM   3851 N N   . VAL A 1 493 ? 25.116  16.277  -1.673  1.00 60.59  ? 493  VAL A N   1 
ATOM   3852 C CA  . VAL A 1 493 ? 26.257  16.692  -0.876  1.00 58.77  ? 493  VAL A CA  1 
ATOM   3853 C C   . VAL A 1 493 ? 27.342  15.695  -0.883  1.00 59.91  ? 493  VAL A C   1 
ATOM   3854 O O   . VAL A 1 493 ? 27.135  14.516  -1.158  1.00 63.60  ? 493  VAL A O   1 
ATOM   3855 C CB  . VAL A 1 493 ? 25.935  16.883  0.591   1.00 49.16  ? 493  VAL A CB  1 
ATOM   3856 C CG1 . VAL A 1 493 ? 25.910  18.335  0.915   1.00 43.86  ? 493  VAL A CG1 1 
ATOM   3857 C CG2 . VAL A 1 493 ? 24.630  16.216  0.910   1.00 54.14  ? 493  VAL A CG2 1 
ATOM   3858 N N   . ASN A 1 494 ? 28.519  16.200  -0.582  1.00 53.98  ? 494  ASN A N   1 
ATOM   3859 C CA  . ASN A 1 494 ? 29.671  15.356  -0.456  1.00 60.31  ? 494  ASN A CA  1 
ATOM   3860 C C   . ASN A 1 494 ? 30.026  15.727  0.954   1.00 59.87  ? 494  ASN A C   1 
ATOM   3861 O O   . ASN A 1 494 ? 29.976  16.903  1.317   1.00 60.19  ? 494  ASN A O   1 
ATOM   3862 C CB  . ASN A 1 494 ? 30.773  15.751  -1.435  1.00 63.54  ? 494  ASN A CB  1 
ATOM   3863 C CG  . ASN A 1 494 ? 30.536  15.209  -2.840  1.00 65.71  ? 494  ASN A CG  1 
ATOM   3864 O OD1 . ASN A 1 494 ? 29.972  14.127  -3.025  1.00 57.79  ? 494  ASN A OD1 1 
ATOM   3865 N ND2 . ASN A 1 494 ? 30.993  15.950  -3.837  1.00 70.64  ? 494  ASN A ND2 1 
ATOM   3866 N N   . ILE A 1 495 ? 30.330  14.734  1.771   1.00 60.59  ? 495  ILE A N   1 
ATOM   3867 C CA  . ILE A 1 495 ? 30.660  15.027  3.148   1.00 57.16  ? 495  ILE A CA  1 
ATOM   3868 C C   . ILE A 1 495 ? 31.878  14.258  3.565   1.00 57.79  ? 495  ILE A C   1 
ATOM   3869 O O   . ILE A 1 495 ? 31.925  13.028  3.457   1.00 56.96  ? 495  ILE A O   1 
ATOM   3870 C CB  . ILE A 1 495 ? 29.493  14.686  4.077   1.00 49.34  ? 495  ILE A CB  1 
ATOM   3871 C CG1 . ILE A 1 495 ? 28.282  15.538  3.698   1.00 50.20  ? 495  ILE A CG1 1 
ATOM   3872 C CG2 . ILE A 1 495 ? 29.873  14.957  5.502   1.00 48.02  ? 495  ILE A CG2 1 
ATOM   3873 C CD1 . ILE A 1 495 ? 27.036  15.208  4.470   1.00 49.90  ? 495  ILE A CD1 1 
ATOM   3874 N N   . VAL A 1 496 ? 32.865  15.011  4.037   1.00 56.93  ? 496  VAL A N   1 
ATOM   3875 C CA  . VAL A 1 496 ? 34.131  14.446  4.476   1.00 55.59  ? 496  VAL A CA  1 
ATOM   3876 C C   . VAL A 1 496 ? 34.222  14.508  5.975   1.00 55.40  ? 496  VAL A C   1 
ATOM   3877 O O   . VAL A 1 496 ? 33.987  15.550  6.570   1.00 52.39  ? 496  VAL A O   1 
ATOM   3878 C CB  . VAL A 1 496 ? 35.308  15.222  3.909   1.00 51.60  ? 496  VAL A CB  1 
ATOM   3879 C CG1 . VAL A 1 496 ? 36.586  14.534  4.269   1.00 46.01  ? 496  VAL A CG1 1 
ATOM   3880 C CG2 . VAL A 1 496 ? 35.174  15.322  2.421   1.00 59.09  ? 496  VAL A CG2 1 
ATOM   3881 N N   . THR A 1 497 ? 34.579  13.386  6.580   1.00 63.83  ? 497  THR A N   1 
ATOM   3882 C CA  . THR A 1 497 ? 34.689  13.312  8.026   1.00 75.31  ? 497  THR A CA  1 
ATOM   3883 C C   . THR A 1 497 ? 35.837  12.370  8.440   1.00 87.35  ? 497  THR A C   1 
ATOM   3884 O O   . THR A 1 497 ? 36.236  11.474  7.688   1.00 92.50  ? 497  THR A O   1 
ATOM   3885 C CB  . THR A 1 497 ? 33.353  12.835  8.627   1.00 75.35  ? 497  THR A CB  1 
ATOM   3886 O OG1 . THR A 1 497 ? 33.386  12.946  10.055  1.00 82.70  ? 497  THR A OG1 1 
ATOM   3887 C CG2 . THR A 1 497 ? 33.102  11.404  8.235   1.00 88.36  ? 497  THR A CG2 1 
ATOM   3888 N N   . ASP A 1 498 ? 36.364  12.597  9.640   1.00 93.80  ? 498  ASP A N   1 
ATOM   3889 C CA  . ASP A 1 498 ? 37.474  11.828  10.190  1.00 93.30  ? 498  ASP A CA  1 
ATOM   3890 C C   . ASP A 1 498 ? 36.953  10.811  11.189  1.00 92.29  ? 498  ASP A C   1 
ATOM   3891 O O   . ASP A 1 498 ? 37.713  10.004  11.717  1.00 96.52  ? 498  ASP A O   1 
ATOM   3892 C CB  . ASP A 1 498 ? 38.448  12.775  10.892  1.00 101.53 ? 498  ASP A CB  1 
ATOM   3893 C CG  . ASP A 1 498 ? 37.786  13.552  12.036  1.00 109.31 ? 498  ASP A CG  1 
ATOM   3894 O OD1 . ASP A 1 498 ? 36.585  13.893  11.931  1.00 104.36 ? 498  ASP A OD1 1 
ATOM   3895 O OD2 . ASP A 1 498 ? 38.471  13.837  13.039  1.00 121.17 ? 498  ASP A OD2 1 
ATOM   3896 N N   . SER A 1 499 ? 35.657  10.863  11.463  1.00 89.95  ? 499  SER A N   1 
ATOM   3897 C CA  . SER A 1 499 ? 35.061  9.922   12.394  1.00 93.75  ? 499  SER A CA  1 
ATOM   3898 C C   . SER A 1 499 ? 34.821  8.595   11.705  1.00 97.70  ? 499  SER A C   1 
ATOM   3899 O O   . SER A 1 499 ? 33.983  8.509   10.803  1.00 104.22 ? 499  SER A O   1 
ATOM   3900 C CB  . SER A 1 499 ? 33.720  10.441  12.919  1.00 94.93  ? 499  SER A CB  1 
ATOM   3901 O OG  . SER A 1 499 ? 33.008  9.415   13.615  1.00 92.41  ? 499  SER A OG  1 
ATOM   3902 N N   . GLN A 1 500 ? 35.550  7.563   12.121  1.00 95.51  ? 500  GLN A N   1 
ATOM   3903 C CA  . GLN A 1 500 ? 35.366  6.235   11.547  1.00 90.20  ? 500  GLN A CA  1 
ATOM   3904 C C   . GLN A 1 500 ? 34.061  5.680   12.100  1.00 83.63  ? 500  GLN A C   1 
ATOM   3905 O O   . GLN A 1 500 ? 33.365  4.912   11.431  1.00 69.49  ? 500  GLN A O   1 
ATOM   3906 C CB  . GLN A 1 500 ? 36.526  5.349   11.938  1.00 96.67  ? 500  GLN A CB  1 
ATOM   3907 C CG  . GLN A 1 500 ? 37.162  5.788   13.223  1.00 116.03 ? 500  GLN A CG  1 
ATOM   3908 C CD  . GLN A 1 500 ? 38.398  4.995   13.527  1.00 132.48 ? 500  GLN A CD  1 
ATOM   3909 O OE1 . GLN A 1 500 ? 39.044  4.459   12.619  1.00 134.05 ? 500  GLN A OE1 1 
ATOM   3910 N NE2 . GLN A 1 500 ? 38.751  4.919   14.806  1.00 140.56 ? 500  GLN A NE2 1 
ATOM   3911 N N   . TYR A 1 501 ? 33.741  6.098   13.328  1.00 84.58  ? 501  TYR A N   1 
ATOM   3912 C CA  . TYR A 1 501 ? 32.508  5.707   14.020  1.00 83.30  ? 501  TYR A CA  1 
ATOM   3913 C C   . TYR A 1 501 ? 31.290  6.023   13.141  1.00 75.58  ? 501  TYR A C   1 
ATOM   3914 O O   . TYR A 1 501 ? 30.611  5.123   12.621  1.00 67.34  ? 501  TYR A O   1 
ATOM   3915 C CB  . TYR A 1 501 ? 32.402  6.479   15.353  1.00 89.87  ? 501  TYR A CB  1 
ATOM   3916 C CG  . TYR A 1 501 ? 31.049  6.396   16.053  1.00 86.81  ? 501  TYR A CG  1 
ATOM   3917 C CD1 . TYR A 1 501 ? 30.522  5.164   16.476  1.00 81.57  ? 501  TYR A CD1 1 
ATOM   3918 C CD2 . TYR A 1 501 ? 30.312  7.557   16.315  1.00 81.62  ? 501  TYR A CD2 1 
ATOM   3919 C CE1 . TYR A 1 501 ? 29.300  5.097   17.146  1.00 89.75  ? 501  TYR A CE1 1 
ATOM   3920 C CE2 . TYR A 1 501 ? 29.090  7.501   16.983  1.00 93.14  ? 501  TYR A CE2 1 
ATOM   3921 C CZ  . TYR A 1 501 ? 28.590  6.271   17.398  1.00 96.82  ? 501  TYR A CZ  1 
ATOM   3922 O OH  . TYR A 1 501 ? 27.389  6.222   18.076  1.00 102.36 ? 501  TYR A OH  1 
ATOM   3923 N N   . ALA A 1 502 ? 31.031  7.320   12.995  1.00 69.78  ? 502  ALA A N   1 
ATOM   3924 C CA  . ALA A 1 502 ? 29.931  7.822   12.195  1.00 67.45  ? 502  ALA A CA  1 
ATOM   3925 C C   . ALA A 1 502 ? 29.884  7.138   10.824  1.00 69.59  ? 502  ALA A C   1 
ATOM   3926 O O   . ALA A 1 502 ? 28.846  6.602   10.411  1.00 72.22  ? 502  ALA A O   1 
ATOM   3927 C CB  . ALA A 1 502 ? 30.084  9.331   12.029  1.00 70.23  ? 502  ALA A CB  1 
ATOM   3928 N N   . LEU A 1 503 ? 31.016  7.168   10.124  1.00 67.24  ? 503  LEU A N   1 
ATOM   3929 C CA  . LEU A 1 503 ? 31.113  6.570   8.801   1.00 65.00  ? 503  LEU A CA  1 
ATOM   3930 C C   . LEU A 1 503 ? 30.464  5.201   8.863   1.00 65.79  ? 503  LEU A C   1 
ATOM   3931 O O   . LEU A 1 503 ? 29.519  4.899   8.115   1.00 58.64  ? 503  LEU A O   1 
ATOM   3932 C CB  . LEU A 1 503 ? 32.586  6.463   8.399   1.00 69.29  ? 503  LEU A CB  1 
ATOM   3933 C CG  . LEU A 1 503 ? 32.930  5.964   6.995   1.00 77.76  ? 503  LEU A CG  1 
ATOM   3934 C CD1 . LEU A 1 503 ? 34.311  6.414   6.604   1.00 88.16  ? 503  LEU A CD1 1 
ATOM   3935 C CD2 . LEU A 1 503 ? 32.858  4.463   6.965   1.00 84.19  ? 503  LEU A CD2 1 
ATOM   3936 N N   . GLY A 1 504 ? 30.969  4.397   9.794   1.00 66.39  ? 504  GLY A N   1 
ATOM   3937 C CA  . GLY A 1 504 ? 30.462  3.055   9.977   1.00 64.32  ? 504  GLY A CA  1 
ATOM   3938 C C   . GLY A 1 504 ? 28.962  3.050   10.128  1.00 65.50  ? 504  GLY A C   1 
ATOM   3939 O O   . GLY A 1 504 ? 28.255  2.408   9.337   1.00 70.80  ? 504  GLY A O   1 
ATOM   3940 N N   . ILE A 1 505 ? 28.479  3.767   11.142  1.00 62.56  ? 505  ILE A N   1 
ATOM   3941 C CA  . ILE A 1 505 ? 27.047  3.855   11.406  1.00 61.63  ? 505  ILE A CA  1 
ATOM   3942 C C   . ILE A 1 505 ? 26.240  4.117   10.128  1.00 64.45  ? 505  ILE A C   1 
ATOM   3943 O O   . ILE A 1 505 ? 25.346  3.343   9.760   1.00 62.66  ? 505  ILE A O   1 
ATOM   3944 C CB  . ILE A 1 505 ? 26.742  4.984   12.411  1.00 54.27  ? 505  ILE A CB  1 
ATOM   3945 C CG1 . ILE A 1 505 ? 27.147  4.565   13.823  1.00 57.12  ? 505  ILE A CG1 1 
ATOM   3946 C CG2 . ILE A 1 505 ? 25.279  5.327   12.364  1.00 50.45  ? 505  ILE A CG2 1 
ATOM   3947 C CD1 . ILE A 1 505 ? 26.647  5.501   14.907  1.00 58.75  ? 505  ILE A CD1 1 
ATOM   3948 N N   . ILE A 1 506 ? 26.579  5.210   9.453   1.00 61.75  ? 506  ILE A N   1 
ATOM   3949 C CA  . ILE A 1 506 ? 25.878  5.603   8.257   1.00 57.56  ? 506  ILE A CA  1 
ATOM   3950 C C   . ILE A 1 506 ? 26.102  4.713   7.078   1.00 60.60  ? 506  ILE A C   1 
ATOM   3951 O O   . ILE A 1 506 ? 25.179  4.484   6.297   1.00 68.32  ? 506  ILE A O   1 
ATOM   3952 C CB  . ILE A 1 506 ? 26.256  6.986   7.864   1.00 56.18  ? 506  ILE A CB  1 
ATOM   3953 C CG1 . ILE A 1 506 ? 25.934  7.922   9.021   1.00 49.77  ? 506  ILE A CG1 1 
ATOM   3954 C CG2 . ILE A 1 506 ? 25.518  7.371   6.598   1.00 61.18  ? 506  ILE A CG2 1 
ATOM   3955 C CD1 . ILE A 1 506 ? 26.132  9.367   8.705   1.00 56.57  ? 506  ILE A CD1 1 
ATOM   3956 N N   . GLN A 1 507 ? 27.324  4.225   6.927   1.00 59.34  ? 507  GLN A N   1 
ATOM   3957 C CA  . GLN A 1 507 ? 27.613  3.350   5.810   1.00 70.61  ? 507  GLN A CA  1 
ATOM   3958 C C   . GLN A 1 507 ? 26.810  2.057   5.894   1.00 77.78  ? 507  GLN A C   1 
ATOM   3959 O O   . GLN A 1 507 ? 26.624  1.366   4.889   1.00 78.37  ? 507  GLN A O   1 
ATOM   3960 C CB  . GLN A 1 507 ? 29.103  3.051   5.747   1.00 76.28  ? 507  GLN A CB  1 
ATOM   3961 C CG  . GLN A 1 507 ? 29.895  4.147   5.052   1.00 97.45  ? 507  GLN A CG  1 
ATOM   3962 C CD  . GLN A 1 507 ? 31.272  3.680   4.575   1.00 112.87 ? 507  GLN A CD  1 
ATOM   3963 O OE1 . GLN A 1 507 ? 31.965  4.393   3.843   1.00 115.82 ? 507  GLN A OE1 1 
ATOM   3964 N NE2 . GLN A 1 507 ? 31.675  2.484   4.997   1.00 121.10 ? 507  GLN A NE2 1 
ATOM   3965 N N   . ALA A 1 508 ? 26.337  1.736   7.097   1.00 83.24  ? 508  ALA A N   1 
ATOM   3966 C CA  . ALA A 1 508 ? 25.520  0.541   7.310   1.00 81.32  ? 508  ALA A CA  1 
ATOM   3967 C C   . ALA A 1 508 ? 24.089  0.850   6.848   1.00 77.02  ? 508  ALA A C   1 
ATOM   3968 O O   . ALA A 1 508 ? 23.214  -0.010  6.863   1.00 74.85  ? 508  ALA A O   1 
ATOM   3969 C CB  . ALA A 1 508 ? 25.531  0.152   8.777   1.00 79.62  ? 508  ALA A CB  1 
ATOM   3970 N N   . GLN A 1 509 ? 23.868  2.098   6.450   1.00 67.11  ? 509  GLN A N   1 
ATOM   3971 C CA  . GLN A 1 509 ? 22.578  2.541   5.951   1.00 55.93  ? 509  GLN A CA  1 
ATOM   3972 C C   . GLN A 1 509 ? 21.390  2.122   6.782   1.00 49.29  ? 509  GLN A C   1 
ATOM   3973 O O   . GLN A 1 509 ? 20.453  1.494   6.299   1.00 50.76  ? 509  GLN A O   1 
ATOM   3974 C CB  . GLN A 1 509 ? 22.406  2.053   4.529   1.00 52.34  ? 509  GLN A CB  1 
ATOM   3975 C CG  . GLN A 1 509 ? 23.537  2.507   3.668   1.00 59.36  ? 509  GLN A CG  1 
ATOM   3976 C CD  . GLN A 1 509 ? 23.302  2.185   2.235   1.00 78.57  ? 509  GLN A CD  1 
ATOM   3977 O OE1 . GLN A 1 509 ? 24.024  2.665   1.351   1.00 84.23  ? 509  GLN A OE1 1 
ATOM   3978 N NE2 . GLN A 1 509 ? 22.283  1.359   1.978   1.00 76.11  ? 509  GLN A NE2 1 
ATOM   3979 N N   . PRO A 1 510 ? 21.413  2.474   8.053   1.00 41.55  ? 510  PRO A N   1 
ATOM   3980 C CA  . PRO A 1 510 ? 20.318  2.128   8.950   1.00 43.44  ? 510  PRO A CA  1 
ATOM   3981 C C   . PRO A 1 510 ? 19.120  2.985   8.603   1.00 46.15  ? 510  PRO A C   1 
ATOM   3982 O O   . PRO A 1 510 ? 19.267  4.031   7.989   1.00 42.16  ? 510  PRO A O   1 
ATOM   3983 C CB  . PRO A 1 510 ? 20.871  2.511   10.305  1.00 52.74  ? 510  PRO A CB  1 
ATOM   3984 C CG  . PRO A 1 510 ? 21.650  3.767   9.959   1.00 46.58  ? 510  PRO A CG  1 
ATOM   3985 C CD  . PRO A 1 510 ? 22.404  3.329   8.724   1.00 35.90  ? 510  PRO A CD  1 
ATOM   3986 N N   . ASP A 1 511 ? 17.939  2.544   9.008   1.00 57.08  ? 511  ASP A N   1 
ATOM   3987 C CA  . ASP A 1 511 ? 16.731  3.319   8.771   1.00 66.40  ? 511  ASP A CA  1 
ATOM   3988 C C   . ASP A 1 511 ? 15.951  3.506   10.072  1.00 65.98  ? 511  ASP A C   1 
ATOM   3989 O O   . ASP A 1 511 ? 14.909  4.155   10.117  1.00 68.28  ? 511  ASP A O   1 
ATOM   3990 C CB  . ASP A 1 511 ? 15.848  2.661   7.700   1.00 72.65  ? 511  ASP A CB  1 
ATOM   3991 C CG  . ASP A 1 511 ? 15.774  1.156   7.828   1.00 88.26  ? 511  ASP A CG  1 
ATOM   3992 O OD1 . ASP A 1 511 ? 15.593  0.657   8.972   1.00 89.49  ? 511  ASP A OD1 1 
ATOM   3993 O OD2 . ASP A 1 511 ? 15.881  0.481   6.767   1.00 94.91  ? 511  ASP A OD2 1 
ATOM   3994 N N   . GLN A 1 512 ? 16.472  2.937   11.143  1.00 63.03  ? 512  GLN A N   1 
ATOM   3995 C CA  . GLN A 1 512 ? 15.825  3.060   12.427  1.00 67.55  ? 512  GLN A CA  1 
ATOM   3996 C C   . GLN A 1 512 ? 16.959  3.099   13.418  1.00 69.96  ? 512  GLN A C   1 
ATOM   3997 O O   . GLN A 1 512 ? 18.035  2.546   13.166  1.00 67.37  ? 512  GLN A O   1 
ATOM   3998 C CB  . GLN A 1 512 ? 14.895  1.863   12.679  1.00 71.97  ? 512  GLN A CB  1 
ATOM   3999 C CG  . GLN A 1 512 ? 15.578  0.503   12.708  1.00 85.31  ? 512  GLN A CG  1 
ATOM   4000 C CD  . GLN A 1 512 ? 14.590  -0.656  12.691  1.00 86.89  ? 512  GLN A CD  1 
ATOM   4001 O OE1 . GLN A 1 512 ? 14.054  -1.013  11.636  1.00 89.88  ? 512  GLN A OE1 1 
ATOM   4002 N NE2 . GLN A 1 512 ? 14.339  -1.244  13.864  1.00 69.36  ? 512  GLN A NE2 1 
ATOM   4003 N N   . SER A 1 513 ? 16.731  3.758   14.542  1.00 69.71  ? 513  SER A N   1 
ATOM   4004 C CA  . SER A 1 513 ? 17.772  3.867   15.532  1.00 75.04  ? 513  SER A CA  1 
ATOM   4005 C C   . SER A 1 513 ? 17.272  4.055   16.941  1.00 82.50  ? 513  SER A C   1 
ATOM   4006 O O   . SER A 1 513 ? 16.177  4.569   17.177  1.00 83.74  ? 513  SER A O   1 
ATOM   4007 C CB  . SER A 1 513 ? 18.679  5.036   15.181  1.00 75.76  ? 513  SER A CB  1 
ATOM   4008 O OG  . SER A 1 513 ? 19.532  5.346   16.266  1.00 79.35  ? 513  SER A OG  1 
ATOM   4009 N N   . GLU A 1 514 ? 18.095  3.624   17.882  1.00 89.46  ? 514  GLU A N   1 
ATOM   4010 C CA  . GLU A 1 514 ? 17.773  3.787   19.279  1.00 99.39  ? 514  GLU A CA  1 
ATOM   4011 C C   . GLU A 1 514 ? 18.034  5.264   19.566  1.00 100.08 ? 514  GLU A C   1 
ATOM   4012 O O   . GLU A 1 514 ? 17.363  5.874   20.396  1.00 98.10  ? 514  GLU A O   1 
ATOM   4013 C CB  . GLU A 1 514 ? 18.691  2.909   20.133  1.00 113.67 ? 514  GLU A CB  1 
ATOM   4014 C CG  . GLU A 1 514 ? 18.544  1.416   19.875  1.00 132.51 ? 514  GLU A CG  1 
ATOM   4015 C CD  . GLU A 1 514 ? 17.158  0.886   20.229  1.00 148.44 ? 514  GLU A CD  1 
ATOM   4016 O OE1 . GLU A 1 514 ? 16.918  -0.326  20.032  1.00 150.00 ? 514  GLU A OE1 1 
ATOM   4017 O OE2 . GLU A 1 514 ? 16.309  1.677   20.704  1.00 150.00 ? 514  GLU A OE2 1 
ATOM   4018 N N   . SER A 1 515 ? 19.010  5.828   18.850  1.00 101.88 ? 515  SER A N   1 
ATOM   4019 C CA  . SER A 1 515 ? 19.406  7.230   18.997  1.00 96.92  ? 515  SER A CA  1 
ATOM   4020 C C   . SER A 1 515 ? 18.539  8.174   18.204  1.00 88.70  ? 515  SER A C   1 
ATOM   4021 O O   . SER A 1 515 ? 18.214  7.911   17.051  1.00 84.92  ? 515  SER A O   1 
ATOM   4022 C CB  . SER A 1 515 ? 20.841  7.441   18.544  1.00 98.25  ? 515  SER A CB  1 
ATOM   4023 O OG  . SER A 1 515 ? 21.064  8.826   18.357  1.00 104.09 ? 515  SER A OG  1 
ATOM   4024 N N   . GLU A 1 516 ? 18.199  9.298   18.812  1.00 85.78  ? 516  GLU A N   1 
ATOM   4025 C CA  . GLU A 1 516 ? 17.348  10.253  18.137  1.00 93.41  ? 516  GLU A CA  1 
ATOM   4026 C C   . GLU A 1 516 ? 18.104  10.992  17.064  1.00 93.42  ? 516  GLU A C   1 
ATOM   4027 O O   . GLU A 1 516 ? 17.598  11.231  15.966  1.00 89.57  ? 516  GLU A O   1 
ATOM   4028 C CB  . GLU A 1 516 ? 16.798  11.273  19.122  1.00 102.65 ? 516  GLU A CB  1 
ATOM   4029 C CG  . GLU A 1 516 ? 15.729  12.166  18.502  1.00 125.69 ? 516  GLU A CG  1 
ATOM   4030 C CD  . GLU A 1 516 ? 15.834  13.616  18.949  1.00 144.58 ? 516  GLU A CD  1 
ATOM   4031 O OE1 . GLU A 1 516 ? 14.838  14.365  18.783  1.00 149.99 ? 516  GLU A OE1 1 
ATOM   4032 O OE2 . GLU A 1 516 ? 16.915  14.005  19.453  1.00 149.99 ? 516  GLU A OE2 1 
ATOM   4033 N N   . LEU A 1 517 ? 19.325  11.370  17.404  1.00 93.61  ? 517  LEU A N   1 
ATOM   4034 C CA  . LEU A 1 517 ? 20.161  12.116  16.482  1.00 87.42  ? 517  LEU A CA  1 
ATOM   4035 C C   . LEU A 1 517 ? 20.225  11.388  15.156  1.00 72.18  ? 517  LEU A C   1 
ATOM   4036 O O   . LEU A 1 517 ? 19.964  11.971  14.099  1.00 69.56  ? 517  LEU A O   1 
ATOM   4037 C CB  . LEU A 1 517 ? 21.573  12.262  17.048  1.00 95.25  ? 517  LEU A CB  1 
ATOM   4038 C CG  . LEU A 1 517 ? 22.240  13.621  16.803  1.00 93.53  ? 517  LEU A CG  1 
ATOM   4039 C CD1 . LEU A 1 517 ? 23.754  13.473  17.032  1.00 86.09  ? 517  LEU A CD1 1 
ATOM   4040 C CD2 . LEU A 1 517 ? 21.931  14.125  15.379  1.00 91.37  ? 517  LEU A CD2 1 
ATOM   4041 N N   . VAL A 1 518 ? 20.588  10.111  15.236  1.00 56.76  ? 518  VAL A N   1 
ATOM   4042 C CA  . VAL A 1 518 ? 20.695  9.258   14.068  1.00 53.53  ? 518  VAL A CA  1 
ATOM   4043 C C   . VAL A 1 518 ? 19.413  9.357   13.254  1.00 58.47  ? 518  VAL A C   1 
ATOM   4044 O O   . VAL A 1 518 ? 19.412  9.792   12.100  1.00 56.46  ? 518  VAL A O   1 
ATOM   4045 C CB  . VAL A 1 518 ? 20.928  7.804   14.488  1.00 53.50  ? 518  VAL A CB  1 
ATOM   4046 C CG1 . VAL A 1 518 ? 20.719  6.877   13.298  1.00 50.64  ? 518  VAL A CG1 1 
ATOM   4047 C CG2 . VAL A 1 518 ? 22.338  7.658   15.067  1.00 56.89  ? 518  VAL A CG2 1 
ATOM   4048 N N   . ASN A 1 519 ? 18.311  8.960   13.859  1.00 58.86  ? 519  ASN A N   1 
ATOM   4049 C CA  . ASN A 1 519 ? 17.052  9.043   13.163  1.00 61.49  ? 519  ASN A CA  1 
ATOM   4050 C C   . ASN A 1 519 ? 16.905  10.367  12.386  1.00 59.34  ? 519  ASN A C   1 
ATOM   4051 O O   . ASN A 1 519 ? 16.450  10.373  11.242  1.00 54.37  ? 519  ASN A O   1 
ATOM   4052 C CB  . ASN A 1 519 ? 15.924  8.831   14.176  1.00 61.00  ? 519  ASN A CB  1 
ATOM   4053 C CG  . ASN A 1 519 ? 15.686  7.354   14.468  1.00 67.16  ? 519  ASN A CG  1 
ATOM   4054 O OD1 . ASN A 1 519 ? 15.176  6.618   13.614  1.00 79.43  ? 519  ASN A OD1 1 
ATOM   4055 N ND2 . ASN A 1 519 ? 16.075  6.908   15.660  1.00 65.88  ? 519  ASN A ND2 1 
ATOM   4056 N N   . GLN A 1 520 ? 17.322  11.474  12.990  1.00 57.57  ? 520  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 520 ? 17.232  12.770  12.329  1.00 60.73  ? 520  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 520 ? 18.093  12.789  11.078  1.00 60.22  ? 520  GLN A C   1 
ATOM   4059 O O   . GLN A 1 520 ? 17.716  13.312  10.027  1.00 61.71  ? 520  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 520 ? 17.737  13.872  13.237  1.00 72.34  ? 520  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 520 ? 17.260  13.840  14.653  1.00 74.38  ? 520  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 520 ? 17.534  15.173  15.309  1.00 91.84  ? 520  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 520 ? 16.813  16.145  15.076  1.00 91.83  ? 520  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 520 ? 18.601  15.245  16.099  1.00 93.21  ? 520  GLN A NE2 1 
ATOM   4065 N N   . ILE A 1 521 ? 19.287  12.247  11.220  1.00 52.51  ? 521  ILE A N   1 
ATOM   4066 C CA  . ILE A 1 521 ? 20.200  12.186  10.108  1.00 52.17  ? 521  ILE A CA  1 
ATOM   4067 C C   . ILE A 1 521 ? 19.571  11.314  9.032   1.00 52.45  ? 521  ILE A C   1 
ATOM   4068 O O   . ILE A 1 521 ? 19.554  11.658  7.849   1.00 51.93  ? 521  ILE A O   1 
ATOM   4069 C CB  . ILE A 1 521 ? 21.528  11.576  10.555  1.00 43.76  ? 521  ILE A CB  1 
ATOM   4070 C CG1 . ILE A 1 521 ? 22.181  12.483  11.615  1.00 50.97  ? 521  ILE A CG1 1 
ATOM   4071 C CG2 . ILE A 1 521 ? 22.416  11.363  9.350   1.00 53.81  ? 521  ILE A CG2 1 
ATOM   4072 C CD1 . ILE A 1 521 ? 23.544  11.990  12.143  1.00 48.49  ? 521  ILE A CD1 1 
ATOM   4073 N N   . ILE A 1 522 ? 19.045  10.179  9.470   1.00 48.64  ? 522  ILE A N   1 
ATOM   4074 C CA  . ILE A 1 522 ? 18.413  9.246   8.571   1.00 46.63  ? 522  ILE A CA  1 
ATOM   4075 C C   . ILE A 1 522 ? 17.334  9.991   7.809   1.00 55.73  ? 522  ILE A C   1 
ATOM   4076 O O   . ILE A 1 522 ? 17.169  9.825   6.598   1.00 60.63  ? 522  ILE A O   1 
ATOM   4077 C CB  . ILE A 1 522 ? 17.762  8.073   9.332   1.00 35.99  ? 522  ILE A CB  1 
ATOM   4078 C CG1 . ILE A 1 522 ? 18.816  7.299   10.152  1.00 39.35  ? 522  ILE A CG1 1 
ATOM   4079 C CG2 . ILE A 1 522 ? 17.128  7.140   8.340   1.00 35.50  ? 522  ILE A CG2 1 
ATOM   4080 C CD1 . ILE A 1 522 ? 18.345  5.936   10.754  1.00 24.91  ? 522  ILE A CD1 1 
ATOM   4081 N N   . GLU A 1 523 ? 16.606  10.838  8.512   1.00 54.58  ? 523  GLU A N   1 
ATOM   4082 C CA  . GLU A 1 523 ? 15.549  11.569  7.853   1.00 56.68  ? 523  GLU A CA  1 
ATOM   4083 C C   . GLU A 1 523 ? 16.133  12.443  6.755   1.00 54.16  ? 523  GLU A C   1 
ATOM   4084 O O   . GLU A 1 523 ? 15.563  12.597  5.679   1.00 48.25  ? 523  GLU A O   1 
ATOM   4085 C CB  . GLU A 1 523 ? 14.801  12.421  8.871   1.00 66.86  ? 523  GLU A CB  1 
ATOM   4086 C CG  . GLU A 1 523 ? 13.293  12.506  8.623   1.00 82.83  ? 523  GLU A CG  1 
ATOM   4087 C CD  . GLU A 1 523 ? 12.565  11.179  8.865   1.00 96.28  ? 523  GLU A CD  1 
ATOM   4088 O OE1 . GLU A 1 523 ? 11.369  11.084  8.503   1.00 95.00  ? 523  GLU A OE1 1 
ATOM   4089 O OE2 . GLU A 1 523 ? 13.180  10.236  9.421   1.00 107.08 ? 523  GLU A OE2 1 
ATOM   4090 N N   . GLN A 1 524 ? 17.290  13.012  7.028   1.00 52.45  ? 524  GLN A N   1 
ATOM   4091 C CA  . GLN A 1 524 ? 17.929  13.875  6.058   1.00 54.04  ? 524  GLN A CA  1 
ATOM   4092 C C   . GLN A 1 524 ? 18.274  13.099  4.833   1.00 51.80  ? 524  GLN A C   1 
ATOM   4093 O O   . GLN A 1 524 ? 17.898  13.428  3.707   1.00 48.67  ? 524  GLN A O   1 
ATOM   4094 C CB  . GLN A 1 524 ? 19.203  14.438  6.659   1.00 61.37  ? 524  GLN A CB  1 
ATOM   4095 C CG  . GLN A 1 524 ? 18.919  15.458  7.720   1.00 87.57  ? 524  GLN A CG  1 
ATOM   4096 C CD  . GLN A 1 524 ? 18.224  16.653  7.126   1.00 107.20 ? 524  GLN A CD  1 
ATOM   4097 O OE1 . GLN A 1 524 ? 17.323  16.505  6.294   1.00 115.03 ? 524  GLN A OE1 1 
ATOM   4098 N NE2 . GLN A 1 524 ? 18.633  17.849  7.541   1.00 119.95 ? 524  GLN A NE2 1 
ATOM   4099 N N   . LEU A 1 525 ? 19.023  12.049  5.097   1.00 54.79  ? 525  LEU A N   1 
ATOM   4100 C CA  . LEU A 1 525 ? 19.506  11.158  4.077   1.00 57.22  ? 525  LEU A CA  1 
ATOM   4101 C C   . LEU A 1 525 ? 18.446  10.788  3.091   1.00 58.10  ? 525  LEU A C   1 
ATOM   4102 O O   . LEU A 1 525 ? 18.627  10.864  1.884   1.00 57.41  ? 525  LEU A O   1 
ATOM   4103 C CB  . LEU A 1 525 ? 20.033  9.891   4.730   1.00 48.75  ? 525  LEU A CB  1 
ATOM   4104 C CG  . LEU A 1 525 ? 21.310  10.124  5.528   1.00 42.71  ? 525  LEU A CG  1 
ATOM   4105 C CD1 . LEU A 1 525 ? 21.777  8.812   6.118   1.00 60.30  ? 525  LEU A CD1 1 
ATOM   4106 C CD2 . LEU A 1 525 ? 22.382  10.695  4.602   1.00 29.18  ? 525  LEU A CD2 1 
ATOM   4107 N N   . ILE A 1 526 ? 17.321  10.363  3.613   1.00 59.41  ? 526  ILE A N   1 
ATOM   4108 C CA  . ILE A 1 526 ? 16.282  9.954   2.725   1.00 56.90  ? 526  ILE A CA  1 
ATOM   4109 C C   . ILE A 1 526 ? 15.844  11.099  1.849   1.00 60.02  ? 526  ILE A C   1 
ATOM   4110 O O   . ILE A 1 526 ? 15.520  10.909  0.682   1.00 63.56  ? 526  ILE A O   1 
ATOM   4111 C CB  . ILE A 1 526 ? 15.110  9.444   3.502   1.00 49.55  ? 526  ILE A CB  1 
ATOM   4112 C CG1 . ILE A 1 526 ? 15.577  8.304   4.409   1.00 44.21  ? 526  ILE A CG1 1 
ATOM   4113 C CG2 . ILE A 1 526 ? 14.020  9.018   2.524   1.00 41.88  ? 526  ILE A CG2 1 
ATOM   4114 C CD1 . ILE A 1 526 ? 14.526  7.854   5.381   1.00 49.55  ? 526  ILE A CD1 1 
ATOM   4115 N N   . LYS A 1 527 ? 15.852  12.299  2.403   1.00 61.50  ? 527  LYS A N   1 
ATOM   4116 C CA  . LYS A 1 527 ? 15.410  13.432  1.630   1.00 65.18  ? 527  LYS A CA  1 
ATOM   4117 C C   . LYS A 1 527 ? 16.330  13.763  0.480   1.00 70.39  ? 527  LYS A C   1 
ATOM   4118 O O   . LYS A 1 527 ? 15.871  14.191  -0.578  1.00 76.28  ? 527  LYS A O   1 
ATOM   4119 C CB  . LYS A 1 527 ? 15.252  14.634  2.539   1.00 70.27  ? 527  LYS A CB  1 
ATOM   4120 C CG  . LYS A 1 527 ? 14.208  14.409  3.601   1.00 87.75  ? 527  LYS A CG  1 
ATOM   4121 C CD  . LYS A 1 527 ? 12.893  13.877  3.004   1.00 97.75  ? 527  LYS A CD  1 
ATOM   4122 C CE  . LYS A 1 527 ? 12.151  14.908  2.167   1.00 92.71  ? 527  LYS A CE  1 
ATOM   4123 N NZ  . LYS A 1 527 ? 10.688  14.629  2.155   1.00 86.31  ? 527  LYS A NZ  1 
ATOM   4124 N N   . LYS A 1 528 ? 17.626  13.560  0.668   1.00 64.34  ? 528  LYS A N   1 
ATOM   4125 C CA  . LYS A 1 528 ? 18.555  13.882  -0.400  1.00 56.29  ? 528  LYS A CA  1 
ATOM   4126 C C   . LYS A 1 528 ? 18.368  13.065  -1.667  1.00 58.17  ? 528  LYS A C   1 
ATOM   4127 O O   . LYS A 1 528 ? 17.680  12.031  -1.697  1.00 50.78  ? 528  LYS A O   1 
ATOM   4128 C CB  . LYS A 1 528 ? 19.988  13.715  0.066   1.00 46.11  ? 528  LYS A CB  1 
ATOM   4129 C CG  . LYS A 1 528 ? 20.314  14.438  1.359   1.00 56.32  ? 528  LYS A CG  1 
ATOM   4130 C CD  . LYS A 1 528 ? 20.503  15.952  1.197   1.00 55.76  ? 528  LYS A CD  1 
ATOM   4131 C CE  . LYS A 1 528 ? 20.968  16.558  2.533   1.00 57.09  ? 528  LYS A CE  1 
ATOM   4132 N NZ  . LYS A 1 528 ? 21.047  18.041  2.505   1.00 61.12  ? 528  LYS A NZ  1 
ATOM   4133 N N   . GLU A 1 529 ? 19.008  13.571  -2.716  1.00 61.90  ? 529  GLU A N   1 
ATOM   4134 C CA  . GLU A 1 529 ? 19.006  12.969  -4.038  1.00 64.50  ? 529  GLU A CA  1 
ATOM   4135 C C   . GLU A 1 529 ? 20.215  12.064  -4.142  1.00 66.52  ? 529  GLU A C   1 
ATOM   4136 O O   . GLU A 1 529 ? 20.111  10.920  -4.577  1.00 72.45  ? 529  GLU A O   1 
ATOM   4137 C CB  . GLU A 1 529 ? 19.125  14.057  -5.102  1.00 79.54  ? 529  GLU A CB  1 
ATOM   4138 C CG  . GLU A 1 529 ? 17.816  14.678  -5.516  1.00 103.80 ? 529  GLU A CG  1 
ATOM   4139 C CD  . GLU A 1 529 ? 16.891  13.668  -6.174  1.00 116.26 ? 529  GLU A CD  1 
ATOM   4140 O OE1 . GLU A 1 529 ? 15.784  14.064  -6.602  1.00 123.03 ? 529  GLU A OE1 1 
ATOM   4141 O OE2 . GLU A 1 529 ? 17.272  12.476  -6.257  1.00 121.69 ? 529  GLU A OE2 1 
ATOM   4142 N N   . LYS A 1 530 ? 21.367  12.601  -3.743  1.00 60.58  ? 530  LYS A N   1 
ATOM   4143 C CA  . LYS A 1 530 ? 22.629  11.879  -3.781  1.00 50.87  ? 530  LYS A CA  1 
ATOM   4144 C C   . LYS A 1 530 ? 23.495  12.337  -2.633  1.00 54.90  ? 530  LYS A C   1 
ATOM   4145 O O   . LYS A 1 530 ? 23.708  13.540  -2.446  1.00 56.95  ? 530  LYS A O   1 
ATOM   4146 C CB  . LYS A 1 530 ? 23.386  12.185  -5.070  1.00 51.24  ? 530  LYS A CB  1 
ATOM   4147 C CG  . LYS A 1 530 ? 22.746  11.673  -6.333  1.00 62.27  ? 530  LYS A CG  1 
ATOM   4148 C CD  . LYS A 1 530 ? 23.494  12.207  -7.534  1.00 64.86  ? 530  LYS A CD  1 
ATOM   4149 C CE  . LYS A 1 530 ? 22.687  12.025  -8.797  1.00 69.89  ? 530  LYS A CE  1 
ATOM   4150 N NZ  . LYS A 1 530 ? 23.128  12.971  -9.860  1.00 86.42  ? 530  LYS A NZ  1 
ATOM   4151 N N   . VAL A 1 531 ? 24.003  11.390  -1.859  1.00 57.64  ? 531  VAL A N   1 
ATOM   4152 C CA  . VAL A 1 531 ? 24.892  11.765  -0.769  1.00 55.77  ? 531  VAL A CA  1 
ATOM   4153 C C   . VAL A 1 531 ? 26.168  10.943  -0.785  1.00 51.59  ? 531  VAL A C   1 
ATOM   4154 O O   . VAL A 1 531 ? 26.148  9.718   -0.991  1.00 54.41  ? 531  VAL A O   1 
ATOM   4155 C CB  . VAL A 1 531 ? 24.223  11.623  0.612   1.00 57.15  ? 531  VAL A CB  1 
ATOM   4156 C CG1 . VAL A 1 531 ? 25.273  11.817  1.737   1.00 42.04  ? 531  VAL A CG1 1 
ATOM   4157 C CG2 . VAL A 1 531 ? 23.123  12.664  0.744   1.00 66.49  ? 531  VAL A CG2 1 
ATOM   4158 N N   . TYR A 1 532 ? 27.281  11.631  -0.575  1.00 43.31  ? 532  TYR A N   1 
ATOM   4159 C CA  . TYR A 1 532 ? 28.551  10.964  -0.552  1.00 46.35  ? 532  TYR A CA  1 
ATOM   4160 C C   . TYR A 1 532 ? 29.273  11.264  0.748   1.00 50.33  ? 532  TYR A C   1 
ATOM   4161 O O   . TYR A 1 532 ? 29.436  12.418  1.152   1.00 47.93  ? 532  TYR A O   1 
ATOM   4162 C CB  . TYR A 1 532 ? 29.389  11.399  -1.744  1.00 46.27  ? 532  TYR A CB  1 
ATOM   4163 C CG  . TYR A 1 532 ? 30.703  10.679  -1.818  1.00 53.40  ? 532  TYR A CG  1 
ATOM   4164 C CD1 . TYR A 1 532 ? 30.786  9.345   -2.253  1.00 48.97  ? 532  TYR A CD1 1 
ATOM   4165 C CD2 . TYR A 1 532 ? 31.874  11.316  -1.426  1.00 54.55  ? 532  TYR A CD2 1 
ATOM   4166 C CE1 . TYR A 1 532 ? 32.025  8.664   -2.295  1.00 43.15  ? 532  TYR A CE1 1 
ATOM   4167 C CE2 . TYR A 1 532 ? 33.115  10.645  -1.461  1.00 52.74  ? 532  TYR A CE2 1 
ATOM   4168 C CZ  . TYR A 1 532 ? 33.181  9.325   -1.894  1.00 53.38  ? 532  TYR A CZ  1 
ATOM   4169 O OH  . TYR A 1 532 ? 34.405  8.690   -1.894  1.00 73.18  ? 532  TYR A OH  1 
ATOM   4170 N N   . LEU A 1 533 ? 29.684  10.193  1.408   1.00 56.73  ? 533  LEU A N   1 
ATOM   4171 C CA  . LEU A 1 533 ? 30.403  10.300  2.659   1.00 57.39  ? 533  LEU A CA  1 
ATOM   4172 C C   . LEU A 1 533 ? 31.795  9.725   2.507   1.00 59.55  ? 533  LEU A C   1 
ATOM   4173 O O   . LEU A 1 533 ? 31.979  8.645   1.951   1.00 60.89  ? 533  LEU A O   1 
ATOM   4174 C CB  . LEU A 1 533 ? 29.658  9.550   3.747   1.00 45.29  ? 533  LEU A CB  1 
ATOM   4175 C CG  . LEU A 1 533 ? 28.979  10.479  4.736   1.00 52.30  ? 533  LEU A CG  1 
ATOM   4176 C CD1 . LEU A 1 533 ? 27.915  9.717   5.457   1.00 66.75  ? 533  LEU A CD1 1 
ATOM   4177 C CD2 . LEU A 1 533 ? 30.002  11.038  5.695   1.00 36.41  ? 533  LEU A CD2 1 
ATOM   4178 N N   . ALA A 1 534 ? 32.782  10.455  2.995   1.00 60.59  ? 534  ALA A N   1 
ATOM   4179 C CA  . ALA A 1 534 ? 34.151  9.984   2.907   1.00 64.77  ? 534  ALA A CA  1 
ATOM   4180 C C   . ALA A 1 534 ? 34.856  10.175  4.236   1.00 62.88  ? 534  ALA A C   1 
ATOM   4181 O O   . ALA A 1 534 ? 34.434  10.966  5.077   1.00 57.02  ? 534  ALA A O   1 
ATOM   4182 C CB  . ALA A 1 534 ? 34.880  10.728  1.817   1.00 69.84  ? 534  ALA A CB  1 
ATOM   4183 N N   . TRP A 1 535 ? 35.941  9.452   4.424   1.00 59.60  ? 535  TRP A N   1 
ATOM   4184 C CA  . TRP A 1 535 ? 36.673  9.572   5.662   1.00 66.48  ? 535  TRP A CA  1 
ATOM   4185 C C   . TRP A 1 535 ? 38.118  9.998   5.405   1.00 67.98  ? 535  TRP A C   1 
ATOM   4186 O O   . TRP A 1 535 ? 38.680  9.694   4.357   1.00 71.69  ? 535  TRP A O   1 
ATOM   4187 C CB  . TRP A 1 535 ? 36.649  8.222   6.377   1.00 74.73  ? 535  TRP A CB  1 
ATOM   4188 C CG  . TRP A 1 535 ? 37.557  8.099   7.586   1.00 83.72  ? 535  TRP A CG  1 
ATOM   4189 C CD1 . TRP A 1 535 ? 37.256  8.407   8.888   1.00 82.70  ? 535  TRP A CD1 1 
ATOM   4190 C CD2 . TRP A 1 535 ? 38.918  7.644   7.588   1.00 86.67  ? 535  TRP A CD2 1 
ATOM   4191 N NE1 . TRP A 1 535 ? 38.347  8.169   9.696   1.00 80.14  ? 535  TRP A NE1 1 
ATOM   4192 C CE2 . TRP A 1 535 ? 39.379  7.703   8.926   1.00 81.08  ? 535  TRP A CE2 1 
ATOM   4193 C CE3 . TRP A 1 535 ? 39.794  7.194   6.587   1.00 87.44  ? 535  TRP A CE3 1 
ATOM   4194 C CZ2 . TRP A 1 535 ? 40.674  7.331   9.286   1.00 76.80  ? 535  TRP A CZ2 1 
ATOM   4195 C CZ3 . TRP A 1 535 ? 41.083  6.824   6.944   1.00 81.87  ? 535  TRP A CZ3 1 
ATOM   4196 C CH2 . TRP A 1 535 ? 41.511  6.895   8.285   1.00 83.40  ? 535  TRP A CH2 1 
ATOM   4197 N N   . VAL A 1 536 ? 38.703  10.738  6.343   1.00 66.72  ? 536  VAL A N   1 
ATOM   4198 C CA  . VAL A 1 536 ? 40.104  11.121  6.244   1.00 65.16  ? 536  VAL A CA  1 
ATOM   4199 C C   . VAL A 1 536 ? 40.645  11.160  7.654   1.00 73.35  ? 536  VAL A C   1 
ATOM   4200 O O   . VAL A 1 536 ? 39.948  11.551  8.600   1.00 60.95  ? 536  VAL A O   1 
ATOM   4201 C CB  . VAL A 1 536 ? 40.360  12.494  5.572   1.00 56.16  ? 536  VAL A CB  1 
ATOM   4202 C CG1 . VAL A 1 536 ? 39.658  12.540  4.244   1.00 62.22  ? 536  VAL A CG1 1 
ATOM   4203 C CG2 . VAL A 1 536 ? 39.959  13.644  6.493   1.00 40.07  ? 536  VAL A CG2 1 
ATOM   4204 N N   . PRO A 1 537 ? 41.902  10.725  7.811   1.00 84.53  ? 537  PRO A N   1 
ATOM   4205 C CA  . PRO A 1 537 ? 42.656  10.656  9.067   1.00 83.82  ? 537  PRO A CA  1 
ATOM   4206 C C   . PRO A 1 537 ? 42.541  11.920  9.909   1.00 77.38  ? 537  PRO A C   1 
ATOM   4207 O O   . PRO A 1 537 ? 42.169  12.974  9.398   1.00 75.92  ? 537  PRO A O   1 
ATOM   4208 C CB  . PRO A 1 537 ? 44.082  10.399  8.587   1.00 93.03  ? 537  PRO A CB  1 
ATOM   4209 C CG  . PRO A 1 537 ? 43.860  9.526   7.354   1.00 92.44  ? 537  PRO A CG  1 
ATOM   4210 C CD  . PRO A 1 537 ? 42.720  10.254  6.673   1.00 93.20  ? 537  PRO A CD  1 
ATOM   4211 N N   . THR B 2 7   ? 46.207  -52.082 24.369  1.00 85.61  ? 7    THR B N   1 
ATOM   4212 C CA  . THR B 2 7   ? 45.811  -50.675 24.298  1.00 82.45  ? 7    THR B CA  1 
ATOM   4213 C C   . THR B 2 7   ? 46.758  -49.824 25.102  1.00 84.77  ? 7    THR B C   1 
ATOM   4214 O O   . THR B 2 7   ? 47.230  -50.215 26.167  1.00 85.25  ? 7    THR B O   1 
ATOM   4215 C CB  . THR B 2 7   ? 44.407  -50.396 24.894  1.00 78.62  ? 7    THR B CB  1 
ATOM   4216 O OG1 . THR B 2 7   ? 44.509  -50.267 26.325  1.00 73.21  ? 7    THR B OG1 1 
ATOM   4217 C CG2 . THR B 2 7   ? 43.422  -51.521 24.527  1.00 76.46  ? 7    THR B CG2 1 
ATOM   4218 N N   . VAL B 2 8   ? 47.005  -48.631 24.599  1.00 89.42  ? 8    VAL B N   1 
ATOM   4219 C CA  . VAL B 2 8   ? 47.889  -47.709 25.276  1.00 87.68  ? 8    VAL B CA  1 
ATOM   4220 C C   . VAL B 2 8   ? 47.061  -46.807 26.179  1.00 91.90  ? 8    VAL B C   1 
ATOM   4221 O O   . VAL B 2 8   ? 46.008  -46.308 25.766  1.00 92.09  ? 8    VAL B O   1 
ATOM   4222 C CB  . VAL B 2 8   ? 48.652  -46.866 24.240  1.00 80.84  ? 8    VAL B CB  1 
ATOM   4223 C CG1 . VAL B 2 8   ? 47.911  -46.938 22.900  1.00 73.03  ? 8    VAL B CG1 1 
ATOM   4224 C CG2 . VAL B 2 8   ? 48.780  -45.420 24.712  1.00 67.34  ? 8    VAL B CG2 1 
ATOM   4225 N N   . PRO B 2 9   ? 47.507  -46.613 27.437  1.00 93.95  ? 9    PRO B N   1 
ATOM   4226 C CA  . PRO B 2 9   ? 46.772  -45.749 28.362  1.00 92.35  ? 9    PRO B CA  1 
ATOM   4227 C C   . PRO B 2 9   ? 46.886  -44.308 27.889  1.00 97.73  ? 9    PRO B C   1 
ATOM   4228 O O   . PRO B 2 9   ? 47.951  -43.871 27.439  1.00 101.26 ? 9    PRO B O   1 
ATOM   4229 C CB  . PRO B 2 9   ? 47.499  -45.955 29.685  1.00 78.49  ? 9    PRO B CB  1 
ATOM   4230 C CG  . PRO B 2 9   ? 48.905  -46.188 29.253  1.00 78.91  ? 9    PRO B CG  1 
ATOM   4231 C CD  . PRO B 2 9   ? 48.708  -47.160 28.096  1.00 89.77  ? 9    PRO B CD  1 
ATOM   4232 N N   . VAL B 2 10  ? 45.784  -43.577 27.988  1.00 94.04  ? 10   VAL B N   1 
ATOM   4233 C CA  . VAL B 2 10  ? 45.758  -42.184 27.577  1.00 81.86  ? 10   VAL B CA  1 
ATOM   4234 C C   . VAL B 2 10  ? 45.079  -41.483 28.704  1.00 75.34  ? 10   VAL B C   1 
ATOM   4235 O O   . VAL B 2 10  ? 44.247  -42.076 29.377  1.00 76.48  ? 10   VAL B O   1 
ATOM   4236 C CB  . VAL B 2 10  ? 44.889  -41.959 26.339  1.00 84.01  ? 10   VAL B CB  1 
ATOM   4237 C CG1 . VAL B 2 10  ? 45.377  -40.725 25.591  1.00 86.31  ? 10   VAL B CG1 1 
ATOM   4238 C CG2 . VAL B 2 10  ? 44.894  -43.201 25.453  1.00 85.34  ? 10   VAL B CG2 1 
ATOM   4239 N N   . LYS B 2 11  ? 45.411  -40.222 28.910  1.00 72.86  ? 11   LYS B N   1 
ATOM   4240 C CA  . LYS B 2 11  ? 44.778  -39.477 29.980  1.00 74.66  ? 11   LYS B CA  1 
ATOM   4241 C C   . LYS B 2 11  ? 44.527  -38.015 29.669  1.00 71.04  ? 11   LYS B C   1 
ATOM   4242 O O   . LYS B 2 11  ? 45.137  -37.430 28.777  1.00 74.59  ? 11   LYS B O   1 
ATOM   4243 C CB  . LYS B 2 11  ? 45.598  -39.601 31.258  1.00 79.46  ? 11   LYS B CB  1 
ATOM   4244 C CG  . LYS B 2 11  ? 45.173  -40.775 32.096  1.00 95.39  ? 11   LYS B CG  1 
ATOM   4245 C CD  . LYS B 2 11  ? 45.982  -40.875 33.362  1.00 107.99 ? 11   LYS B CD  1 
ATOM   4246 C CE  . LYS B 2 11  ? 47.375  -41.348 33.045  1.00 117.61 ? 11   LYS B CE  1 
ATOM   4247 N NZ  . LYS B 2 11  ? 47.315  -42.632 32.288  1.00 125.18 ? 11   LYS B NZ  1 
ATOM   4248 N N   . LEU B 2 12  ? 43.606  -37.422 30.404  1.00 67.49  ? 12   LEU B N   1 
ATOM   4249 C CA  . LEU B 2 12  ? 43.315  -36.022 30.185  1.00 70.46  ? 12   LEU B CA  1 
ATOM   4250 C C   . LEU B 2 12  ? 44.459  -35.252 30.836  1.00 75.01  ? 12   LEU B C   1 
ATOM   4251 O O   . LEU B 2 12  ? 45.238  -35.831 31.596  1.00 77.61  ? 12   LEU B O   1 
ATOM   4252 C CB  . LEU B 2 12  ? 41.978  -35.663 30.846  1.00 62.22  ? 12   LEU B CB  1 
ATOM   4253 C CG  . LEU B 2 12  ? 40.745  -36.438 30.350  1.00 53.92  ? 12   LEU B CG  1 
ATOM   4254 C CD1 . LEU B 2 12  ? 39.530  -36.112 31.205  1.00 47.80  ? 12   LEU B CD1 1 
ATOM   4255 C CD2 . LEU B 2 12  ? 40.474  -36.084 28.904  1.00 52.38  ? 12   LEU B CD2 1 
ATOM   4256 N N   . LYS B 2 13  ? 44.580  -33.967 30.514  1.00 79.30  ? 13   LYS B N   1 
ATOM   4257 C CA  . LYS B 2 13  ? 45.606  -33.124 31.129  1.00 80.67  ? 13   LYS B CA  1 
ATOM   4258 C C   . LYS B 2 13  ? 45.240  -33.061 32.628  1.00 84.53  ? 13   LYS B C   1 
ATOM   4259 O O   . LYS B 2 13  ? 44.056  -33.004 32.989  1.00 78.67  ? 13   LYS B O   1 
ATOM   4260 C CB  . LYS B 2 13  ? 45.584  -31.702 30.540  1.00 80.20  ? 13   LYS B CB  1 
ATOM   4261 C CG  . LYS B 2 13  ? 46.137  -31.528 29.122  1.00 80.48  ? 13   LYS B CG  1 
ATOM   4262 C CD  . LYS B 2 13  ? 45.980  -30.056 28.677  1.00 85.98  ? 13   LYS B CD  1 
ATOM   4263 C CE  . LYS B 2 13  ? 46.784  -29.689 27.401  1.00 97.51  ? 13   LYS B CE  1 
ATOM   4264 N NZ  . LYS B 2 13  ? 46.322  -30.311 26.107  1.00 97.31  ? 13   LYS B NZ  1 
ATOM   4265 N N   . PRO B 2 14  ? 46.254  -33.047 33.513  1.00 89.68  ? 14   PRO B N   1 
ATOM   4266 C CA  . PRO B 2 14  ? 46.090  -32.998 34.976  1.00 91.11  ? 14   PRO B CA  1 
ATOM   4267 C C   . PRO B 2 14  ? 44.916  -32.165 35.502  1.00 89.99  ? 14   PRO B C   1 
ATOM   4268 O O   . PRO B 2 14  ? 44.790  -30.985 35.177  1.00 83.15  ? 14   PRO B O   1 
ATOM   4269 C CB  . PRO B 2 14  ? 47.434  -32.439 35.455  1.00 91.27  ? 14   PRO B CB  1 
ATOM   4270 C CG  . PRO B 2 14  ? 48.397  -32.984 34.461  1.00 88.26  ? 14   PRO B CG  1 
ATOM   4271 C CD  . PRO B 2 14  ? 47.663  -32.806 33.139  1.00 90.29  ? 14   PRO B CD  1 
ATOM   4272 N N   . GLY B 2 15  ? 44.064  -32.789 36.316  1.00 93.82  ? 15   GLY B N   1 
ATOM   4273 C CA  . GLY B 2 15  ? 42.934  -32.087 36.913  1.00 90.75  ? 15   GLY B CA  1 
ATOM   4274 C C   . GLY B 2 15  ? 41.693  -31.838 36.072  1.00 89.21  ? 15   GLY B C   1 
ATOM   4275 O O   . GLY B 2 15  ? 40.622  -31.560 36.635  1.00 88.94  ? 15   GLY B O   1 
ATOM   4276 N N   . MET B 2 16  ? 41.832  -31.940 34.744  1.00 84.24  ? 16   MET B N   1 
ATOM   4277 C CA  . MET B 2 16  ? 40.726  -31.716 33.806  1.00 71.27  ? 16   MET B CA  1 
ATOM   4278 C C   . MET B 2 16  ? 39.736  -32.860 33.707  1.00 70.51  ? 16   MET B C   1 
ATOM   4279 O O   . MET B 2 16  ? 40.070  -34.037 33.903  1.00 76.28  ? 16   MET B O   1 
ATOM   4280 C CB  . MET B 2 16  ? 41.245  -31.444 32.402  1.00 60.77  ? 16   MET B CB  1 
ATOM   4281 C CG  . MET B 2 16  ? 42.310  -30.407 32.346  1.00 63.23  ? 16   MET B CG  1 
ATOM   4282 S SD  . MET B 2 16  ? 42.521  -29.783 30.689  1.00 76.06  ? 16   MET B SD  1 
ATOM   4283 C CE  . MET B 2 16  ? 42.760  -28.045 31.069  1.00 74.32  ? 16   MET B CE  1 
ATOM   4284 N N   . ASP B 2 17  ? 38.505  -32.496 33.380  1.00 63.67  ? 17   ASP B N   1 
ATOM   4285 C CA  . ASP B 2 17  ? 37.455  -33.475 33.236  1.00 61.58  ? 17   ASP B CA  1 
ATOM   4286 C C   . ASP B 2 17  ? 37.139  -33.599 31.754  1.00 61.70  ? 17   ASP B C   1 
ATOM   4287 O O   . ASP B 2 17  ? 37.725  -32.902 30.913  1.00 51.16  ? 17   ASP B O   1 
ATOM   4288 C CB  . ASP B 2 17  ? 36.206  -33.030 34.013  1.00 61.64  ? 17   ASP B CB  1 
ATOM   4289 C CG  . ASP B 2 17  ? 35.167  -34.151 34.156  1.00 70.34  ? 17   ASP B CG  1 
ATOM   4290 O OD1 . ASP B 2 17  ? 35.450  -35.281 33.718  1.00 76.67  ? 17   ASP B OD1 1 
ATOM   4291 O OD2 . ASP B 2 17  ? 34.069  -33.912 34.708  1.00 70.50  ? 17   ASP B OD2 1 
ATOM   4292 N N   . GLY B 2 18  ? 36.219  -34.506 31.452  1.00 63.64  ? 18   GLY B N   1 
ATOM   4293 C CA  . GLY B 2 18  ? 35.794  -34.722 30.091  1.00 62.96  ? 18   GLY B CA  1 
ATOM   4294 C C   . GLY B 2 18  ? 34.798  -33.653 29.667  1.00 69.25  ? 18   GLY B C   1 
ATOM   4295 O O   . GLY B 2 18  ? 34.209  -32.946 30.506  1.00 71.83  ? 18   GLY B O   1 
ATOM   4296 N N   . PRO B 2 19  ? 34.580  -33.525 28.347  1.00 67.65  ? 19   PRO B N   1 
ATOM   4297 C CA  . PRO B 2 19  ? 33.666  -32.554 27.749  1.00 58.04  ? 19   PRO B CA  1 
ATOM   4298 C C   . PRO B 2 19  ? 32.182  -32.832 27.935  1.00 51.52  ? 19   PRO B C   1 
ATOM   4299 O O   . PRO B 2 19  ? 31.715  -33.975 27.931  1.00 51.56  ? 19   PRO B O   1 
ATOM   4300 C CB  . PRO B 2 19  ? 34.074  -32.581 26.290  1.00 58.11  ? 19   PRO B CB  1 
ATOM   4301 C CG  . PRO B 2 19  ? 34.348  -34.055 26.085  1.00 65.45  ? 19   PRO B CG  1 
ATOM   4302 C CD  . PRO B 2 19  ? 35.204  -34.357 27.297  1.00 67.82  ? 19   PRO B CD  1 
ATOM   4303 N N   . LYS B 2 20  ? 31.451  -31.741 28.058  1.00 48.98  ? 20   LYS B N   1 
ATOM   4304 C CA  . LYS B 2 20  ? 30.020  -31.789 28.251  1.00 50.23  ? 20   LYS B CA  1 
ATOM   4305 C C   . LYS B 2 20  ? 29.409  -30.690 27.363  1.00 45.34  ? 20   LYS B C   1 
ATOM   4306 O O   . LYS B 2 20  ? 28.740  -29.770 27.849  1.00 40.41  ? 20   LYS B O   1 
ATOM   4307 C CB  . LYS B 2 20  ? 29.757  -31.559 29.750  1.00 57.09  ? 20   LYS B CB  1 
ATOM   4308 C CG  . LYS B 2 20  ? 30.490  -32.590 30.683  1.00 57.05  ? 20   LYS B CG  1 
ATOM   4309 C CD  . LYS B 2 20  ? 30.650  -32.103 32.139  1.00 58.42  ? 20   LYS B CD  1 
ATOM   4310 C CE  . LYS B 2 20  ? 29.886  -32.955 33.175  1.00 67.78  ? 20   LYS B CE  1 
ATOM   4311 N NZ  . LYS B 2 20  ? 28.460  -32.530 33.428  1.00 77.95  ? 20   LYS B NZ  1 
ATOM   4312 N N   . VAL B 2 21  ? 29.654  -30.798 26.055  1.00 39.19  ? 21   VAL B N   1 
ATOM   4313 C CA  . VAL B 2 21  ? 29.179  -29.796 25.101  1.00 34.74  ? 21   VAL B CA  1 
ATOM   4314 C C   . VAL B 2 21  ? 27.807  -30.132 24.547  1.00 40.13  ? 21   VAL B C   1 
ATOM   4315 O O   . VAL B 2 21  ? 27.520  -31.306 24.285  1.00 46.32  ? 21   VAL B O   1 
ATOM   4316 C CB  . VAL B 2 21  ? 30.154  -29.663 23.932  1.00 30.77  ? 21   VAL B CB  1 
ATOM   4317 C CG1 . VAL B 2 21  ? 29.690  -28.563 23.013  1.00 47.15  ? 21   VAL B CG1 1 
ATOM   4318 C CG2 . VAL B 2 21  ? 31.545  -29.373 24.451  1.00 19.30  ? 21   VAL B CG2 1 
ATOM   4319 N N   . LYS B 2 22  ? 26.959  -29.119 24.359  1.00 48.23  ? 22   LYS B N   1 
ATOM   4320 C CA  . LYS B 2 22  ? 25.621  -29.378 23.836  1.00 53.41  ? 22   LYS B CA  1 
ATOM   4321 C C   . LYS B 2 22  ? 25.655  -29.712 22.367  1.00 50.75  ? 22   LYS B C   1 
ATOM   4322 O O   . LYS B 2 22  ? 26.541  -29.286 21.633  1.00 50.31  ? 22   LYS B O   1 
ATOM   4323 C CB  . LYS B 2 22  ? 24.706  -28.184 24.060  1.00 68.13  ? 22   LYS B CB  1 
ATOM   4324 C CG  . LYS B 2 22  ? 24.361  -27.974 25.517  1.00 86.81  ? 22   LYS B CG  1 
ATOM   4325 C CD  . LYS B 2 22  ? 23.700  -26.624 25.741  1.00 99.76  ? 22   LYS B CD  1 
ATOM   4326 C CE  . LYS B 2 22  ? 23.625  -26.302 27.228  1.00 99.83  ? 22   LYS B CE  1 
ATOM   4327 N NZ  . LYS B 2 22  ? 23.241  -24.883 27.469  1.00 102.94 ? 22   LYS B NZ  1 
ATOM   4328 N N   . GLN B 2 23  ? 24.664  -30.474 21.947  1.00 39.87  ? 23   GLN B N   1 
ATOM   4329 C CA  . GLN B 2 23  ? 24.569  -30.896 20.571  1.00 33.13  ? 23   GLN B CA  1 
ATOM   4330 C C   . GLN B 2 23  ? 23.696  -29.958 19.736  1.00 45.08  ? 23   GLN B C   1 
ATOM   4331 O O   . GLN B 2 23  ? 22.482  -29.833 19.985  1.00 41.43  ? 23   GLN B O   1 
ATOM   4332 C CB  . GLN B 2 23  ? 24.002  -32.311 20.535  1.00 33.79  ? 23   GLN B CB  1 
ATOM   4333 C CG  . GLN B 2 23  ? 23.603  -32.844 19.156  1.00 50.15  ? 23   GLN B CG  1 
ATOM   4334 C CD  . GLN B 2 23  ? 24.766  -32.936 18.200  1.00 58.25  ? 23   GLN B CD  1 
ATOM   4335 O OE1 . GLN B 2 23  ? 25.808  -33.535 18.518  1.00 56.89  ? 23   GLN B OE1 1 
ATOM   4336 N NE2 . GLN B 2 23  ? 24.596  -32.349 17.012  1.00 51.14  ? 23   GLN B NE2 1 
ATOM   4337 N N   . TRP B 2 24  ? 24.301  -29.301 18.742  1.00 47.47  ? 24   TRP B N   1 
ATOM   4338 C CA  . TRP B 2 24  ? 23.517  -28.420 17.907  1.00 49.43  ? 24   TRP B CA  1 
ATOM   4339 C C   . TRP B 2 24  ? 22.499  -29.298 17.173  1.00 52.43  ? 24   TRP B C   1 
ATOM   4340 O O   . TRP B 2 24  ? 22.817  -30.403 16.699  1.00 45.61  ? 24   TRP B O   1 
ATOM   4341 C CB  . TRP B 2 24  ? 24.405  -27.633 16.935  1.00 59.93  ? 24   TRP B CB  1 
ATOM   4342 C CG  . TRP B 2 24  ? 23.684  -26.445 16.281  1.00 90.57  ? 24   TRP B CG  1 
ATOM   4343 C CD1 . TRP B 2 24  ? 22.878  -26.487 15.170  1.00 96.11  ? 24   TRP B CD1 1 
ATOM   4344 C CD2 . TRP B 2 24  ? 23.667  -25.069 16.731  1.00 100.91 ? 24   TRP B CD2 1 
ATOM   4345 N NE1 . TRP B 2 24  ? 22.364  -25.235 14.903  1.00 101.69 ? 24   TRP B NE1 1 
ATOM   4346 C CE2 . TRP B 2 24  ? 22.828  -24.347 15.839  1.00 105.53 ? 24   TRP B CE2 1 
ATOM   4347 C CE3 . TRP B 2 24  ? 24.276  -24.379 17.795  1.00 96.53  ? 24   TRP B CE3 1 
ATOM   4348 C CZ2 . TRP B 2 24  ? 22.583  -22.967 15.979  1.00 108.58 ? 24   TRP B CZ2 1 
ATOM   4349 C CZ3 . TRP B 2 24  ? 24.031  -23.003 17.932  1.00 106.24 ? 24   TRP B CZ3 1 
ATOM   4350 C CH2 . TRP B 2 24  ? 23.191  -22.316 17.025  1.00 112.56 ? 24   TRP B CH2 1 
ATOM   4351 N N   . PRO B 2 25  ? 21.236  -28.829 17.121  1.00 58.84  ? 25   PRO B N   1 
ATOM   4352 C CA  . PRO B 2 25  ? 20.107  -29.502 16.477  1.00 59.13  ? 25   PRO B CA  1 
ATOM   4353 C C   . PRO B 2 25  ? 20.473  -29.812 15.046  1.00 56.91  ? 25   PRO B C   1 
ATOM   4354 O O   . PRO B 2 25  ? 21.168  -29.030 14.387  1.00 51.51  ? 25   PRO B O   1 
ATOM   4355 C CB  . PRO B 2 25  ? 18.990  -28.460 16.535  1.00 54.20  ? 25   PRO B CB  1 
ATOM   4356 C CG  . PRO B 2 25  ? 19.350  -27.607 17.666  1.00 47.35  ? 25   PRO B CG  1 
ATOM   4357 C CD  . PRO B 2 25  ? 20.837  -27.476 17.540  1.00 55.52  ? 25   PRO B CD  1 
ATOM   4358 N N   . LEU B 2 26  ? 19.988  -30.941 14.557  1.00 55.63  ? 26   LEU B N   1 
ATOM   4359 C CA  . LEU B 2 26  ? 20.299  -31.327 13.196  1.00 48.68  ? 26   LEU B CA  1 
ATOM   4360 C C   . LEU B 2 26  ? 19.049  -31.543 12.349  1.00 52.93  ? 26   LEU B C   1 
ATOM   4361 O O   . LEU B 2 26  ? 17.934  -31.709 12.880  1.00 54.43  ? 26   LEU B O   1 
ATOM   4362 C CB  . LEU B 2 26  ? 21.161  -32.596 13.217  1.00 31.98  ? 26   LEU B CB  1 
ATOM   4363 C CG  . LEU B 2 26  ? 22.507  -32.469 13.965  1.00 35.22  ? 26   LEU B CG  1 
ATOM   4364 C CD1 . LEU B 2 26  ? 23.282  -33.754 13.803  1.00 25.77  ? 26   LEU B CD1 1 
ATOM   4365 C CD2 . LEU B 2 26  ? 23.360  -31.339 13.410  1.00 33.13  ? 26   LEU B CD2 1 
ATOM   4366 N N   . THR B 2 27  ? 19.251  -31.522 11.029  1.00 57.62  ? 27   THR B N   1 
ATOM   4367 C CA  . THR B 2 27  ? 18.179  -31.745 10.069  1.00 48.24  ? 27   THR B CA  1 
ATOM   4368 C C   . THR B 2 27  ? 17.964  -33.246 9.915   1.00 45.75  ? 27   THR B C   1 
ATOM   4369 O O   . THR B 2 27  ? 18.906  -34.061 9.918   1.00 43.81  ? 27   THR B O   1 
ATOM   4370 C CB  . THR B 2 27  ? 18.509  -31.140 8.690   1.00 51.71  ? 27   THR B CB  1 
ATOM   4371 O OG1 . THR B 2 27  ? 19.474  -31.953 8.003   1.00 53.79  ? 27   THR B OG1 1 
ATOM   4372 C CG2 . THR B 2 27  ? 19.056  -29.738 8.872   1.00 42.10  ? 27   THR B CG2 1 
ATOM   4373 N N   . GLU B 2 28  ? 16.696  -33.600 9.813   1.00 43.11  ? 28   GLU B N   1 
ATOM   4374 C CA  . GLU B 2 28  ? 16.300  -34.973 9.657   1.00 44.35  ? 28   GLU B CA  1 
ATOM   4375 C C   . GLU B 2 28  ? 17.234  -35.690 8.706   1.00 49.33  ? 28   GLU B C   1 
ATOM   4376 O O   . GLU B 2 28  ? 17.631  -36.820 8.959   1.00 43.37  ? 28   GLU B O   1 
ATOM   4377 C CB  . GLU B 2 28  ? 14.897  -35.009 9.110   1.00 37.70  ? 28   GLU B CB  1 
ATOM   4378 C CG  . GLU B 2 28  ? 14.348  -36.389 8.924   1.00 61.40  ? 28   GLU B CG  1 
ATOM   4379 C CD  . GLU B 2 28  ? 12.867  -36.362 8.531   1.00 96.68  ? 28   GLU B CD  1 
ATOM   4380 O OE1 . GLU B 2 28  ? 12.259  -37.453 8.384   1.00 103.22 ? 28   GLU B OE1 1 
ATOM   4381 O OE2 . GLU B 2 28  ? 12.310  -35.244 8.370   1.00 109.52 ? 28   GLU B OE2 1 
ATOM   4382 N N   . GLU B 2 29  ? 17.582  -35.021 7.610   1.00 56.15  ? 29   GLU B N   1 
ATOM   4383 C CA  . GLU B 2 29  ? 18.470  -35.615 6.620   1.00 53.31  ? 29   GLU B CA  1 
ATOM   4384 C C   . GLU B 2 29  ? 19.749  -36.060 7.293   1.00 53.29  ? 29   GLU B C   1 
ATOM   4385 O O   . GLU B 2 29  ? 20.077  -37.244 7.326   1.00 53.37  ? 29   GLU B O   1 
ATOM   4386 C CB  . GLU B 2 29  ? 18.821  -34.613 5.524   1.00 60.55  ? 29   GLU B CB  1 
ATOM   4387 C CG  . GLU B 2 29  ? 19.470  -35.270 4.303   1.00 78.14  ? 29   GLU B CG  1 
ATOM   4388 C CD  . GLU B 2 29  ? 20.024  -34.270 3.296   1.00 88.41  ? 29   GLU B CD  1 
ATOM   4389 O OE1 . GLU B 2 29  ? 20.090  -34.620 2.094   1.00 83.63  ? 29   GLU B OE1 1 
ATOM   4390 O OE2 . GLU B 2 29  ? 20.404  -33.147 3.712   1.00 89.43  ? 29   GLU B OE2 1 
ATOM   4391 N N   . LYS B 2 30  ? 20.473  -35.090 7.830   1.00 58.64  ? 30   LYS B N   1 
ATOM   4392 C CA  . LYS B 2 30  ? 21.727  -35.374 8.503   1.00 56.03  ? 30   LYS B CA  1 
ATOM   4393 C C   . LYS B 2 30  ? 21.534  -36.448 9.571   1.00 52.30  ? 30   LYS B C   1 
ATOM   4394 O O   . LYS B 2 30  ? 22.364  -37.345 9.722   1.00 47.08  ? 30   LYS B O   1 
ATOM   4395 C CB  . LYS B 2 30  ? 22.270  -34.106 9.168   1.00 50.83  ? 30   LYS B CB  1 
ATOM   4396 C CG  . LYS B 2 30  ? 22.346  -32.899 8.274   1.00 51.91  ? 30   LYS B CG  1 
ATOM   4397 C CD  . LYS B 2 30  ? 23.376  -33.116 7.211   1.00 56.64  ? 30   LYS B CD  1 
ATOM   4398 C CE  . LYS B 2 30  ? 23.800  -31.796 6.610   1.00 61.62  ? 30   LYS B CE  1 
ATOM   4399 N NZ  . LYS B 2 30  ? 25.028  -31.975 5.781   1.00 63.44  ? 30   LYS B NZ  1 
ATOM   4400 N N   . ILE B 2 31  ? 20.440  -36.375 10.314  1.00 43.16  ? 31   ILE B N   1 
ATOM   4401 C CA  . ILE B 2 31  ? 20.263  -37.349 11.369  1.00 40.12  ? 31   ILE B CA  1 
ATOM   4402 C C   . ILE B 2 31  ? 20.183  -38.801 10.911  1.00 44.02  ? 31   ILE B C   1 
ATOM   4403 O O   . ILE B 2 31  ? 20.900  -39.658 11.417  1.00 43.51  ? 31   ILE B O   1 
ATOM   4404 C CB  . ILE B 2 31  ? 19.044  -36.997 12.200  1.00 37.22  ? 31   ILE B CB  1 
ATOM   4405 C CG1 . ILE B 2 31  ? 19.331  -35.746 13.022  1.00 36.00  ? 31   ILE B CG1 1 
ATOM   4406 C CG2 . ILE B 2 31  ? 18.669  -38.154 13.084  1.00 18.71  ? 31   ILE B CG2 1 
ATOM   4407 C CD1 . ILE B 2 31  ? 18.085  -35.193 13.665  1.00 54.43  ? 31   ILE B CD1 1 
ATOM   4408 N N   . LYS B 2 32  ? 19.315  -39.079 9.952   1.00 48.93  ? 32   LYS B N   1 
ATOM   4409 C CA  . LYS B 2 32  ? 19.149  -40.437 9.451   1.00 46.68  ? 32   LYS B CA  1 
ATOM   4410 C C   . LYS B 2 32  ? 20.450  -40.983 8.900   1.00 42.40  ? 32   LYS B C   1 
ATOM   4411 O O   . LYS B 2 32  ? 20.745  -42.172 9.026   1.00 41.66  ? 32   LYS B O   1 
ATOM   4412 C CB  . LYS B 2 32  ? 18.082  -40.434 8.384   1.00 51.94  ? 32   LYS B CB  1 
ATOM   4413 C CG  . LYS B 2 32  ? 16.814  -39.777 8.882   1.00 68.39  ? 32   LYS B CG  1 
ATOM   4414 C CD  . LYS B 2 32  ? 15.758  -39.755 7.816   1.00 91.79  ? 32   LYS B CD  1 
ATOM   4415 C CE  . LYS B 2 32  ? 14.402  -39.465 8.412   1.00 104.19 ? 32   LYS B CE  1 
ATOM   4416 N NZ  . LYS B 2 32  ? 13.312  -39.520 7.391   1.00 109.66 ? 32   LYS B NZ  1 
ATOM   4417 N N   . ALA B 2 33  ? 21.226  -40.101 8.286   1.00 39.35  ? 33   ALA B N   1 
ATOM   4418 C CA  . ALA B 2 33  ? 22.518  -40.477 7.735   1.00 47.59  ? 33   ALA B CA  1 
ATOM   4419 C C   . ALA B 2 33  ? 23.379  -41.021 8.865   1.00 53.39  ? 33   ALA B C   1 
ATOM   4420 O O   . ALA B 2 33  ? 23.998  -42.077 8.736   1.00 52.73  ? 33   ALA B O   1 
ATOM   4421 C CB  . ALA B 2 33  ? 23.188  -39.260 7.118   1.00 48.45  ? 33   ALA B CB  1 
ATOM   4422 N N   . LEU B 2 34  ? 23.403  -40.275 9.970   1.00 58.86  ? 34   LEU B N   1 
ATOM   4423 C CA  . LEU B 2 34  ? 24.170  -40.635 11.156  1.00 53.23  ? 34   LEU B CA  1 
ATOM   4424 C C   . LEU B 2 34  ? 23.665  -41.922 11.771  1.00 53.59  ? 34   LEU B C   1 
ATOM   4425 O O   . LEU B 2 34  ? 24.463  -42.756 12.216  1.00 52.21  ? 34   LEU B O   1 
ATOM   4426 C CB  . LEU B 2 34  ? 24.108  -39.526 12.200  1.00 35.38  ? 34   LEU B CB  1 
ATOM   4427 C CG  . LEU B 2 34  ? 25.064  -38.384 11.904  1.00 37.54  ? 34   LEU B CG  1 
ATOM   4428 C CD1 . LEU B 2 34  ? 24.981  -37.316 12.969  1.00 48.09  ? 34   LEU B CD1 1 
ATOM   4429 C CD2 . LEU B 2 34  ? 26.463  -38.936 11.869  1.00 33.53  ? 34   LEU B CD2 1 
ATOM   4430 N N   . VAL B 2 35  ? 22.343  -42.085 11.804  1.00 51.98  ? 35   VAL B N   1 
ATOM   4431 C CA  . VAL B 2 35  ? 21.758  -43.302 12.357  1.00 52.42  ? 35   VAL B CA  1 
ATOM   4432 C C   . VAL B 2 35  ? 22.268  -44.475 11.530  1.00 58.53  ? 35   VAL B C   1 
ATOM   4433 O O   . VAL B 2 35  ? 22.890  -45.398 12.051  1.00 62.01  ? 35   VAL B O   1 
ATOM   4434 C CB  . VAL B 2 35  ? 20.252  -43.268 12.274  1.00 45.38  ? 35   VAL B CB  1 
ATOM   4435 C CG1 . VAL B 2 35  ? 19.676  -44.304 13.194  1.00 47.81  ? 35   VAL B CG1 1 
ATOM   4436 C CG2 . VAL B 2 35  ? 19.766  -41.888 12.627  1.00 38.24  ? 35   VAL B CG2 1 
ATOM   4437 N N   . GLU B 2 36  ? 22.010  -44.421 10.231  1.00 63.17  ? 36   GLU B N   1 
ATOM   4438 C CA  . GLU B 2 36  ? 22.476  -45.455 9.330   1.00 60.74  ? 36   GLU B CA  1 
ATOM   4439 C C   . GLU B 2 36  ? 23.955  -45.755 9.637   1.00 50.66  ? 36   GLU B C   1 
ATOM   4440 O O   . GLU B 2 36  ? 24.322  -46.891 9.950   1.00 54.30  ? 36   GLU B O   1 
ATOM   4441 C CB  . GLU B 2 36  ? 22.298  -44.961 7.897   1.00 76.23  ? 36   GLU B CB  1 
ATOM   4442 C CG  . GLU B 2 36  ? 22.983  -45.783 6.822   1.00 96.71  ? 36   GLU B CG  1 
ATOM   4443 C CD  . GLU B 2 36  ? 22.460  -45.452 5.426   1.00 114.02 ? 36   GLU B CD  1 
ATOM   4444 O OE1 . GLU B 2 36  ? 22.196  -44.255 5.147   1.00 108.36 ? 36   GLU B OE1 1 
ATOM   4445 O OE2 . GLU B 2 36  ? 22.317  -46.392 4.609   1.00 126.60 ? 36   GLU B OE2 1 
ATOM   4446 N N   . ILE B 2 37  ? 24.793  -44.729 9.578   1.00 31.61  ? 37   ILE B N   1 
ATOM   4447 C CA  . ILE B 2 37  ? 26.214  -44.901 9.842   1.00 34.04  ? 37   ILE B CA  1 
ATOM   4448 C C   . ILE B 2 37  ? 26.564  -45.555 11.186  1.00 48.99  ? 37   ILE B C   1 
ATOM   4449 O O   . ILE B 2 37  ? 27.242  -46.592 11.262  1.00 50.02  ? 37   ILE B O   1 
ATOM   4450 C CB  . ILE B 2 37  ? 26.940  -43.536 9.814   1.00 40.74  ? 37   ILE B CB  1 
ATOM   4451 C CG1 . ILE B 2 37  ? 26.849  -42.914 8.416   1.00 34.01  ? 37   ILE B CG1 1 
ATOM   4452 C CG2 . ILE B 2 37  ? 28.400  -43.695 10.329  1.00 37.80  ? 37   ILE B CG2 1 
ATOM   4453 C CD1 . ILE B 2 37  ? 27.574  -41.565 8.294   1.00 49.39  ? 37   ILE B CD1 1 
ATOM   4454 N N   . CYS B 2 38  ? 26.117  -44.914 12.253  1.00 58.71  ? 38   CYS B N   1 
ATOM   4455 C CA  . CYS B 2 38  ? 26.430  -45.401 13.577  1.00 61.02  ? 38   CYS B CA  1 
ATOM   4456 C C   . CYS B 2 38  ? 25.941  -46.793 13.832  1.00 55.47  ? 38   CYS B C   1 
ATOM   4457 O O   . CYS B 2 38  ? 26.659  -47.578 14.459  1.00 55.53  ? 38   CYS B O   1 
ATOM   4458 C CB  . CYS B 2 38  ? 25.911  -44.433 14.644  1.00 66.55  ? 38   CYS B CB  1 
ATOM   4459 S SG  . CYS B 2 38  ? 26.956  -42.913 14.750  1.00 73.16  ? 38   CYS B SG  1 
ATOM   4460 N N   . THR B 2 39  ? 24.749  -47.109 13.324  1.00 51.21  ? 39   THR B N   1 
ATOM   4461 C CA  . THR B 2 39  ? 24.177  -48.440 13.516  1.00 58.57  ? 39   THR B CA  1 
ATOM   4462 C C   . THR B 2 39  ? 25.121  -49.519 13.002  1.00 61.80  ? 39   THR B C   1 
ATOM   4463 O O   . THR B 2 39  ? 25.134  -50.630 13.544  1.00 58.96  ? 39   THR B O   1 
ATOM   4464 C CB  . THR B 2 39  ? 22.814  -48.615 12.807  1.00 57.75  ? 39   THR B CB  1 
ATOM   4465 O OG1 . THR B 2 39  ? 21.954  -47.516 13.119  1.00 70.98  ? 39   THR B OG1 1 
ATOM   4466 C CG2 . THR B 2 39  ? 22.136  -49.893 13.284  1.00 53.11  ? 39   THR B CG2 1 
ATOM   4467 N N   . GLU B 2 40  ? 25.905  -49.200 11.969  1.00 65.60  ? 40   GLU B N   1 
ATOM   4468 C CA  . GLU B 2 40  ? 26.850  -50.170 11.429  1.00 75.33  ? 40   GLU B CA  1 
ATOM   4469 C C   . GLU B 2 40  ? 28.189  -50.108 12.145  1.00 73.95  ? 40   GLU B C   1 
ATOM   4470 O O   . GLU B 2 40  ? 28.966  -51.060 12.101  1.00 78.50  ? 40   GLU B O   1 
ATOM   4471 C CB  . GLU B 2 40  ? 27.082  -49.956 9.937   1.00 93.38  ? 40   GLU B CB  1 
ATOM   4472 C CG  . GLU B 2 40  ? 28.101  -50.941 9.341   1.00 106.54 ? 40   GLU B CG  1 
ATOM   4473 C CD  . GLU B 2 40  ? 27.517  -52.317 9.050   1.00 111.83 ? 40   GLU B CD  1 
ATOM   4474 O OE1 . GLU B 2 40  ? 26.842  -52.889 9.933   1.00 119.05 ? 40   GLU B OE1 1 
ATOM   4475 O OE2 . GLU B 2 40  ? 27.744  -52.827 7.931   1.00 117.69 ? 40   GLU B OE2 1 
ATOM   4476 N N   . MET B 2 41  ? 28.467  -48.984 12.790  1.00 69.52  ? 41   MET B N   1 
ATOM   4477 C CA  . MET B 2 41  ? 29.707  -48.856 13.534  1.00 64.12  ? 41   MET B CA  1 
ATOM   4478 C C   . MET B 2 41  ? 29.618  -49.690 14.807  1.00 62.85  ? 41   MET B C   1 
ATOM   4479 O O   . MET B 2 41  ? 30.635  -50.138 15.358  1.00 51.51  ? 41   MET B O   1 
ATOM   4480 C CB  . MET B 2 41  ? 29.943  -47.409 13.900  1.00 59.20  ? 41   MET B CB  1 
ATOM   4481 C CG  . MET B 2 41  ? 30.458  -46.592 12.769  1.00 59.83  ? 41   MET B CG  1 
ATOM   4482 S SD  . MET B 2 41  ? 31.175  -45.104 13.449  1.00 79.69  ? 41   MET B SD  1 
ATOM   4483 C CE  . MET B 2 41  ? 32.824  -45.715 13.985  1.00 56.64  ? 41   MET B CE  1 
ATOM   4484 N N   . GLU B 2 42  ? 28.379  -49.876 15.261  1.00 62.48  ? 42   GLU B N   1 
ATOM   4485 C CA  . GLU B 2 42  ? 28.061  -50.659 16.458  1.00 63.64  ? 42   GLU B CA  1 
ATOM   4486 C C   . GLU B 2 42  ? 28.184  -52.133 16.109  1.00 66.09  ? 42   GLU B C   1 
ATOM   4487 O O   . GLU B 2 42  ? 28.867  -52.896 16.805  1.00 56.61  ? 42   GLU B O   1 
ATOM   4488 C CB  . GLU B 2 42  ? 26.623  -50.385 16.922  1.00 59.53  ? 42   GLU B CB  1 
ATOM   4489 C CG  . GLU B 2 42  ? 26.303  -50.954 18.314  1.00 74.51  ? 42   GLU B CG  1 
ATOM   4490 C CD  . GLU B 2 42  ? 24.871  -50.649 18.810  1.00 80.35  ? 42   GLU B CD  1 
ATOM   4491 O OE1 . GLU B 2 42  ? 24.569  -50.927 20.005  1.00 76.90  ? 42   GLU B OE1 1 
ATOM   4492 O OE2 . GLU B 2 42  ? 24.052  -50.138 18.008  1.00 82.64  ? 42   GLU B OE2 1 
ATOM   4493 N N   . LYS B 2 43  ? 27.500  -52.522 15.030  1.00 71.86  ? 43   LYS B N   1 
ATOM   4494 C CA  . LYS B 2 43  ? 27.530  -53.897 14.554  1.00 70.59  ? 43   LYS B CA  1 
ATOM   4495 C C   . LYS B 2 43  ? 28.973  -54.317 14.417  1.00 59.61  ? 43   LYS B C   1 
ATOM   4496 O O   . LYS B 2 43  ? 29.307  -55.454 14.699  1.00 63.76  ? 43   LYS B O   1 
ATOM   4497 C CB  . LYS B 2 43  ? 26.814  -54.041 13.201  1.00 79.58  ? 43   LYS B CB  1 
ATOM   4498 C CG  . LYS B 2 43  ? 25.279  -54.081 13.309  1.00 88.04  ? 43   LYS B CG  1 
ATOM   4499 C CD  . LYS B 2 43  ? 24.592  -54.145 11.943  1.00 85.00  ? 43   LYS B CD  1 
ATOM   4500 C CE  . LYS B 2 43  ? 23.087  -53.904 12.080  1.00 82.26  ? 43   LYS B CE  1 
ATOM   4501 N NZ  . LYS B 2 43  ? 22.406  -53.744 10.755  1.00 81.86  ? 43   LYS B NZ  1 
ATOM   4502 N N   . GLU B 2 44  ? 29.831  -53.397 13.999  1.00 54.67  ? 44   GLU B N   1 
ATOM   4503 C CA  . GLU B 2 44  ? 31.244  -53.706 13.860  1.00 63.72  ? 44   GLU B CA  1 
ATOM   4504 C C   . GLU B 2 44  ? 32.004  -53.433 15.160  1.00 65.42  ? 44   GLU B C   1 
ATOM   4505 O O   . GLU B 2 44  ? 33.240  -53.381 15.170  1.00 65.06  ? 44   GLU B O   1 
ATOM   4506 C CB  . GLU B 2 44  ? 31.833  -52.887 12.726  1.00 66.94  ? 44   GLU B CB  1 
ATOM   4507 C CG  . GLU B 2 44  ? 31.010  -52.971 11.461  1.00 80.32  ? 44   GLU B CG  1 
ATOM   4508 C CD  . GLU B 2 44  ? 31.598  -52.141 10.348  1.00 91.71  ? 44   GLU B CD  1 
ATOM   4509 O OE1 . GLU B 2 44  ? 32.530  -51.360 10.631  1.00 96.35  ? 44   GLU B OE1 1 
ATOM   4510 O OE2 . GLU B 2 44  ? 31.132  -52.259 9.197   1.00 92.49  ? 44   GLU B OE2 1 
ATOM   4511 N N   . GLY B 2 45  ? 31.246  -53.256 16.244  1.00 64.00  ? 45   GLY B N   1 
ATOM   4512 C CA  . GLY B 2 45  ? 31.807  -53.002 17.562  1.00 67.70  ? 45   GLY B CA  1 
ATOM   4513 C C   . GLY B 2 45  ? 32.790  -51.847 17.682  1.00 68.36  ? 45   GLY B C   1 
ATOM   4514 O O   . GLY B 2 45  ? 33.652  -51.842 18.565  1.00 61.27  ? 45   GLY B O   1 
ATOM   4515 N N   . LYS B 2 46  ? 32.684  -50.864 16.798  1.00 68.23  ? 46   LYS B N   1 
ATOM   4516 C CA  . LYS B 2 46  ? 33.596  -49.733 16.869  1.00 70.35  ? 46   LYS B CA  1 
ATOM   4517 C C   . LYS B 2 46  ? 33.140  -48.817 18.013  1.00 69.16  ? 46   LYS B C   1 
ATOM   4518 O O   . LYS B 2 46  ? 33.959  -48.282 18.778  1.00 56.02  ? 46   LYS B O   1 
ATOM   4519 C CB  . LYS B 2 46  ? 33.559  -48.969 15.556  1.00 71.39  ? 46   LYS B CB  1 
ATOM   4520 C CG  . LYS B 2 46  ? 33.661  -49.846 14.350  1.00 86.09  ? 46   LYS B CG  1 
ATOM   4521 C CD  . LYS B 2 46  ? 35.063  -50.373 14.186  1.00 101.30 ? 46   LYS B CD  1 
ATOM   4522 C CE  . LYS B 2 46  ? 35.222  -50.974 12.807  1.00 111.22 ? 46   LYS B CE  1 
ATOM   4523 N NZ  . LYS B 2 46  ? 34.757  -50.005 11.775  1.00 106.83 ? 46   LYS B NZ  1 
ATOM   4524 N N   . ILE B 2 47  ? 31.821  -48.642 18.103  1.00 65.92  ? 47   ILE B N   1 
ATOM   4525 C CA  . ILE B 2 47  ? 31.200  -47.803 19.122  1.00 57.83  ? 47   ILE B CA  1 
ATOM   4526 C C   . ILE B 2 47  ? 30.231  -48.686 19.875  1.00 62.91  ? 47   ILE B C   1 
ATOM   4527 O O   . ILE B 2 47  ? 29.889  -49.785 19.410  1.00 58.88  ? 47   ILE B O   1 
ATOM   4528 C CB  . ILE B 2 47  ? 30.365  -46.644 18.509  1.00 52.71  ? 47   ILE B CB  1 
ATOM   4529 C CG1 . ILE B 2 47  ? 29.273  -47.226 17.599  1.00 35.18  ? 47   ILE B CG1 1 
ATOM   4530 C CG2 . ILE B 2 47  ? 31.267  -45.673 17.746  1.00 45.19  ? 47   ILE B CG2 1 
ATOM   4531 C CD1 . ILE B 2 47  ? 28.384  -46.167 16.940  1.00 50.39  ? 47   ILE B CD1 1 
ATOM   4532 N N   . SER B 2 48  ? 29.787  -48.184 21.030  1.00 67.13  ? 48   SER B N   1 
ATOM   4533 C CA  . SER B 2 48  ? 28.833  -48.888 21.888  1.00 62.02  ? 48   SER B CA  1 
ATOM   4534 C C   . SER B 2 48  ? 27.856  -47.898 22.504  1.00 54.63  ? 48   SER B C   1 
ATOM   4535 O O   . SER B 2 48  ? 28.244  -46.769 22.849  1.00 53.22  ? 48   SER B O   1 
ATOM   4536 C CB  . SER B 2 48  ? 29.560  -49.651 23.001  1.00 55.58  ? 48   SER B CB  1 
ATOM   4537 O OG  . SER B 2 48  ? 30.196  -50.812 22.489  1.00 55.34  ? 48   SER B OG  1 
ATOM   4538 N N   . LYS B 2 49  ? 26.589  -48.312 22.609  1.00 44.43  ? 49   LYS B N   1 
ATOM   4539 C CA  . LYS B 2 49  ? 25.571  -47.455 23.204  1.00 41.30  ? 49   LYS B CA  1 
ATOM   4540 C C   . LYS B 2 49  ? 25.981  -47.271 24.646  1.00 47.85  ? 49   LYS B C   1 
ATOM   4541 O O   . LYS B 2 49  ? 26.527  -48.182 25.262  1.00 48.82  ? 49   LYS B O   1 
ATOM   4542 C CB  . LYS B 2 49  ? 24.178  -48.092 23.152  1.00 33.10  ? 49   LYS B CB  1 
ATOM   4543 C CG  . LYS B 2 49  ? 23.517  -48.030 21.793  1.00 45.50  ? 49   LYS B CG  1 
ATOM   4544 C CD  . LYS B 2 49  ? 22.034  -48.253 21.919  1.00 54.08  ? 49   LYS B CD  1 
ATOM   4545 C CE  . LYS B 2 49  ? 21.329  -48.261 20.558  1.00 62.89  ? 49   LYS B CE  1 
ATOM   4546 N NZ  . LYS B 2 49  ? 21.344  -49.593 19.873  1.00 72.58  ? 49   LYS B NZ  1 
ATOM   4547 N N   . ILE B 2 50  ? 25.735  -46.087 25.188  1.00 56.87  ? 50   ILE B N   1 
ATOM   4548 C CA  . ILE B 2 50  ? 26.109  -45.843 26.569  1.00 58.15  ? 50   ILE B CA  1 
ATOM   4549 C C   . ILE B 2 50  ? 24.923  -45.460 27.432  1.00 61.59  ? 50   ILE B C   1 
ATOM   4550 O O   . ILE B 2 50  ? 23.889  -45.061 26.912  1.00 61.09  ? 50   ILE B O   1 
ATOM   4551 C CB  . ILE B 2 50  ? 27.204  -44.759 26.664  1.00 59.48  ? 50   ILE B CB  1 
ATOM   4552 C CG1 . ILE B 2 50  ? 26.704  -43.427 26.085  1.00 32.44  ? 50   ILE B CG1 1 
ATOM   4553 C CG2 . ILE B 2 50  ? 28.473  -45.269 25.967  1.00 52.57  ? 50   ILE B CG2 1 
ATOM   4554 C CD1 . ILE B 2 50  ? 27.721  -42.294 26.270  1.00 30.39  ? 50   ILE B CD1 1 
ATOM   4555 N N   . GLY B 2 51  ? 25.076  -45.601 28.751  1.00 68.41  ? 51   GLY B N   1 
ATOM   4556 C CA  . GLY B 2 51  ? 23.991  -45.285 29.666  1.00 64.51  ? 51   GLY B CA  1 
ATOM   4557 C C   . GLY B 2 51  ? 24.075  -43.912 30.304  1.00 61.26  ? 51   GLY B C   1 
ATOM   4558 O O   . GLY B 2 51  ? 25.049  -43.169 30.086  1.00 59.14  ? 51   GLY B O   1 
ATOM   4559 N N   . PRO B 2 52  ? 23.060  -43.547 31.115  1.00 60.75  ? 52   PRO B N   1 
ATOM   4560 C CA  . PRO B 2 52  ? 22.941  -42.261 31.833  1.00 56.63  ? 52   PRO B CA  1 
ATOM   4561 C C   . PRO B 2 52  ? 24.083  -41.967 32.818  1.00 47.84  ? 52   PRO B C   1 
ATOM   4562 O O   . PRO B 2 52  ? 24.282  -40.829 33.226  1.00 48.41  ? 52   PRO B O   1 
ATOM   4563 C CB  . PRO B 2 52  ? 21.590  -42.382 32.531  1.00 55.90  ? 52   PRO B CB  1 
ATOM   4564 C CG  . PRO B 2 52  ? 21.485  -43.873 32.790  1.00 57.08  ? 52   PRO B CG  1 
ATOM   4565 C CD  . PRO B 2 52  ? 21.959  -44.459 31.477  1.00 56.98  ? 52   PRO B CD  1 
ATOM   4566 N N   . GLU B 2 53  ? 24.827  -42.994 33.199  1.00 46.72  ? 53   GLU B N   1 
ATOM   4567 C CA  . GLU B 2 53  ? 25.936  -42.801 34.107  1.00 50.88  ? 53   GLU B CA  1 
ATOM   4568 C C   . GLU B 2 53  ? 27.072  -42.076 33.374  1.00 55.05  ? 53   GLU B C   1 
ATOM   4569 O O   . GLU B 2 53  ? 28.091  -41.723 33.967  1.00 50.57  ? 53   GLU B O   1 
ATOM   4570 C CB  . GLU B 2 53  ? 26.422  -44.150 34.634  1.00 57.95  ? 53   GLU B CB  1 
ATOM   4571 C CG  . GLU B 2 53  ? 27.224  -44.981 33.633  1.00 67.67  ? 53   GLU B CG  1 
ATOM   4572 C CD  . GLU B 2 53  ? 26.356  -45.752 32.663  1.00 68.86  ? 53   GLU B CD  1 
ATOM   4573 O OE1 . GLU B 2 53  ? 25.132  -45.510 32.651  1.00 72.00  ? 53   GLU B OE1 1 
ATOM   4574 O OE2 . GLU B 2 53  ? 26.904  -46.596 31.912  1.00 72.13  ? 53   GLU B OE2 1 
ATOM   4575 N N   . ASN B 2 54  ? 26.931  -41.898 32.069  1.00 58.60  ? 54   ASN B N   1 
ATOM   4576 C CA  . ASN B 2 54  ? 27.956  -41.153 31.359  1.00 57.45  ? 54   ASN B CA  1 
ATOM   4577 C C   . ASN B 2 54  ? 27.341  -39.788 31.149  1.00 56.51  ? 54   ASN B C   1 
ATOM   4578 O O   . ASN B 2 54  ? 26.301  -39.667 30.496  1.00 62.87  ? 54   ASN B O   1 
ATOM   4579 C CB  . ASN B 2 54  ? 28.298  -41.742 29.998  1.00 53.23  ? 54   ASN B CB  1 
ATOM   4580 C CG  . ASN B 2 54  ? 29.507  -41.055 29.379  1.00 55.93  ? 54   ASN B CG  1 
ATOM   4581 O OD1 . ASN B 2 54  ? 29.735  -39.863 29.611  1.00 65.08  ? 54   ASN B OD1 1 
ATOM   4582 N ND2 . ASN B 2 54  ? 30.288  -41.798 28.595  1.00 53.41  ? 54   ASN B ND2 1 
ATOM   4583 N N   . PRO B 2 55  ? 27.971  -38.744 31.705  1.00 48.71  ? 55   PRO B N   1 
ATOM   4584 C CA  . PRO B 2 55  ? 27.519  -37.358 31.614  1.00 50.64  ? 55   PRO B CA  1 
ATOM   4585 C C   . PRO B 2 55  ? 28.210  -36.552 30.515  1.00 50.62  ? 55   PRO B C   1 
ATOM   4586 O O   . PRO B 2 55  ? 27.835  -35.403 30.270  1.00 51.91  ? 55   PRO B O   1 
ATOM   4587 C CB  . PRO B 2 55  ? 27.882  -36.821 32.974  1.00 43.41  ? 55   PRO B CB  1 
ATOM   4588 C CG  . PRO B 2 55  ? 29.278  -37.378 33.087  1.00 34.49  ? 55   PRO B CG  1 
ATOM   4589 C CD  . PRO B 2 55  ? 29.086  -38.840 32.663  1.00 39.94  ? 55   PRO B CD  1 
ATOM   4590 N N   . TYR B 2 56  ? 29.217  -37.134 29.869  1.00 46.07  ? 56   TYR B N   1 
ATOM   4591 C CA  . TYR B 2 56  ? 29.952  -36.434 28.816  1.00 44.92  ? 56   TYR B CA  1 
ATOM   4592 C C   . TYR B 2 56  ? 29.265  -36.317 27.470  1.00 44.38  ? 56   TYR B C   1 
ATOM   4593 O O   . TYR B 2 56  ? 28.338  -37.077 27.171  1.00 38.25  ? 56   TYR B O   1 
ATOM   4594 C CB  . TYR B 2 56  ? 31.285  -37.118 28.613  1.00 35.19  ? 56   TYR B CB  1 
ATOM   4595 C CG  . TYR B 2 56  ? 32.045  -37.097 29.879  1.00 49.08  ? 56   TYR B CG  1 
ATOM   4596 C CD1 . TYR B 2 56  ? 32.337  -35.885 30.500  1.00 58.28  ? 56   TYR B CD1 1 
ATOM   4597 C CD2 . TYR B 2 56  ? 32.441  -38.273 30.487  1.00 55.27  ? 56   TYR B CD2 1 
ATOM   4598 C CE1 . TYR B 2 56  ? 33.005  -35.850 31.696  1.00 70.07  ? 56   TYR B CE1 1 
ATOM   4599 C CE2 . TYR B 2 56  ? 33.111  -38.250 31.685  1.00 67.92  ? 56   TYR B CE2 1 
ATOM   4600 C CZ  . TYR B 2 56  ? 33.389  -37.037 32.283  1.00 72.14  ? 56   TYR B CZ  1 
ATOM   4601 O OH  . TYR B 2 56  ? 34.049  -37.010 33.474  1.00 63.36  ? 56   TYR B OH  1 
ATOM   4602 N N   . ASN B 2 57  ? 29.713  -35.345 26.674  1.00 39.72  ? 57   ASN B N   1 
ATOM   4603 C CA  . ASN B 2 57  ? 29.180  -35.193 25.339  1.00 40.74  ? 57   ASN B CA  1 
ATOM   4604 C C   . ASN B 2 57  ? 29.946  -34.277 24.428  1.00 43.84  ? 57   ASN B C   1 
ATOM   4605 O O   . ASN B 2 57  ? 30.509  -33.251 24.830  1.00 29.95  ? 57   ASN B O   1 
ATOM   4606 C CB  . ASN B 2 57  ? 27.712  -34.773 25.339  1.00 32.55  ? 57   ASN B CB  1 
ATOM   4607 C CG  . ASN B 2 57  ? 27.017  -35.112 24.016  1.00 35.81  ? 57   ASN B CG  1 
ATOM   4608 O OD1 . ASN B 2 57  ? 26.848  -34.255 23.144  1.00 40.80  ? 57   ASN B OD1 1 
ATOM   4609 N ND2 . ASN B 2 57  ? 26.640  -36.379 23.855  1.00 29.03  ? 57   ASN B ND2 1 
ATOM   4610 N N   . THR B 2 58  ? 29.915  -34.704 23.171  1.00 50.10  ? 58   THR B N   1 
ATOM   4611 C CA  . THR B 2 58  ? 30.545  -34.052 22.043  1.00 46.01  ? 58   THR B CA  1 
ATOM   4612 C C   . THR B 2 58  ? 29.545  -34.023 20.884  1.00 40.95  ? 58   THR B C   1 
ATOM   4613 O O   . THR B 2 58  ? 28.747  -34.953 20.704  1.00 39.32  ? 58   THR B O   1 
ATOM   4614 C CB  . THR B 2 58  ? 31.784  -34.830 21.637  1.00 48.65  ? 58   THR B CB  1 
ATOM   4615 O OG1 . THR B 2 58  ? 32.633  -34.968 22.788  1.00 60.07  ? 58   THR B OG1 1 
ATOM   4616 C CG2 . THR B 2 58  ? 32.534  -34.120 20.508  1.00 49.09  ? 58   THR B CG2 1 
ATOM   4617 N N   . PRO B 2 59  ? 29.555  -32.931 20.106  1.00 43.77  ? 59   PRO B N   1 
ATOM   4618 C CA  . PRO B 2 59  ? 28.689  -32.688 18.943  1.00 44.93  ? 59   PRO B CA  1 
ATOM   4619 C C   . PRO B 2 59  ? 29.103  -33.491 17.711  1.00 40.00  ? 59   PRO B C   1 
ATOM   4620 O O   . PRO B 2 59  ? 30.287  -33.542 17.352  1.00 33.29  ? 59   PRO B O   1 
ATOM   4621 C CB  . PRO B 2 59  ? 28.862  -31.192 18.681  1.00 39.62  ? 59   PRO B CB  1 
ATOM   4622 C CG  . PRO B 2 59  ? 29.389  -30.649 20.002  1.00 33.18  ? 59   PRO B CG  1 
ATOM   4623 C CD  . PRO B 2 59  ? 30.332  -31.721 20.416  1.00 35.69  ? 59   PRO B CD  1 
ATOM   4624 N N   . VAL B 2 60  ? 28.131  -34.112 17.060  1.00 38.62  ? 60   VAL B N   1 
ATOM   4625 C CA  . VAL B 2 60  ? 28.431  -34.876 15.859  1.00 48.00  ? 60   VAL B CA  1 
ATOM   4626 C C   . VAL B 2 60  ? 27.726  -34.253 14.683  1.00 47.87  ? 60   VAL B C   1 
ATOM   4627 O O   . VAL B 2 60  ? 26.691  -33.615 14.849  1.00 53.01  ? 60   VAL B O   1 
ATOM   4628 C CB  . VAL B 2 60  ? 27.976  -36.338 15.961  1.00 49.24  ? 60   VAL B CB  1 
ATOM   4629 C CG1 . VAL B 2 60  ? 29.109  -37.178 16.462  1.00 55.49  ? 60   VAL B CG1 1 
ATOM   4630 C CG2 . VAL B 2 60  ? 26.773  -36.453 16.885  1.00 37.88  ? 60   VAL B CG2 1 
ATOM   4631 N N   . PHE B 2 61  ? 28.298  -34.422 13.499  1.00 47.42  ? 61   PHE B N   1 
ATOM   4632 C CA  . PHE B 2 61  ? 27.686  -33.893 12.289  1.00 45.18  ? 61   PHE B CA  1 
ATOM   4633 C C   . PHE B 2 61  ? 27.935  -34.830 11.123  1.00 43.37  ? 61   PHE B C   1 
ATOM   4634 O O   . PHE B 2 61  ? 28.907  -35.590 11.115  1.00 43.85  ? 61   PHE B O   1 
ATOM   4635 C CB  . PHE B 2 61  ? 28.262  -32.528 11.914  1.00 43.01  ? 61   PHE B CB  1 
ATOM   4636 C CG  . PHE B 2 61  ? 28.255  -31.519 13.031  1.00 46.61  ? 61   PHE B CG  1 
ATOM   4637 C CD1 . PHE B 2 61  ? 29.416  -31.263 13.757  1.00 46.67  ? 61   PHE B CD1 1 
ATOM   4638 C CD2 . PHE B 2 61  ? 27.097  -30.785 13.330  1.00 56.54  ? 61   PHE B CD2 1 
ATOM   4639 C CE1 . PHE B 2 61  ? 29.435  -30.282 14.767  1.00 40.63  ? 61   PHE B CE1 1 
ATOM   4640 C CE2 . PHE B 2 61  ? 27.098  -29.803 14.335  1.00 47.58  ? 61   PHE B CE2 1 
ATOM   4641 C CZ  . PHE B 2 61  ? 28.276  -29.549 15.054  1.00 29.69  ? 61   PHE B CZ  1 
ATOM   4642 N N   . ALA B 2 62  ? 27.052  -34.763 10.136  1.00 46.43  ? 62   ALA B N   1 
ATOM   4643 C CA  . ALA B 2 62  ? 27.188  -35.564 8.927   1.00 42.23  ? 62   ALA B CA  1 
ATOM   4644 C C   . ALA B 2 62  ? 27.581  -34.589 7.829   1.00 47.14  ? 62   ALA B C   1 
ATOM   4645 O O   . ALA B 2 62  ? 26.972  -33.518 7.693   1.00 43.25  ? 62   ALA B O   1 
ATOM   4646 C CB  . ALA B 2 62  ? 25.872  -36.219 8.579   1.00 28.69  ? 62   ALA B CB  1 
ATOM   4647 N N   . ILE B 2 63  ? 28.627  -34.920 7.079   1.00 59.55  ? 63   ILE B N   1 
ATOM   4648 C CA  . ILE B 2 63  ? 29.035  -34.067 5.970   1.00 70.03  ? 63   ILE B CA  1 
ATOM   4649 C C   . ILE B 2 63  ? 29.053  -34.978 4.769   1.00 78.75  ? 63   ILE B C   1 
ATOM   4650 O O   . ILE B 2 63  ? 28.983  -36.199 4.921   1.00 81.70  ? 63   ILE B O   1 
ATOM   4651 C CB  . ILE B 2 63  ? 30.433  -33.443 6.167   1.00 66.51  ? 63   ILE B CB  1 
ATOM   4652 C CG1 . ILE B 2 63  ? 31.462  -34.534 6.451   1.00 71.09  ? 63   ILE B CG1 1 
ATOM   4653 C CG2 . ILE B 2 63  ? 30.399  -32.424 7.295   1.00 62.37  ? 63   ILE B CG2 1 
ATOM   4654 C CD1 . ILE B 2 63  ? 32.862  -33.987 6.714   1.00 67.98  ? 63   ILE B CD1 1 
ATOM   4655 N N   . LYS B 2 64  ? 29.126  -34.388 3.582   1.00 87.18  ? 64   LYS B N   1 
ATOM   4656 C CA  . LYS B 2 64  ? 29.139  -35.158 2.344   1.00 95.85  ? 64   LYS B CA  1 
ATOM   4657 C C   . LYS B 2 64  ? 30.531  -35.255 1.734   1.00 98.20  ? 64   LYS B C   1 
ATOM   4658 O O   . LYS B 2 64  ? 31.366  -34.359 1.916   1.00 91.51  ? 64   LYS B O   1 
ATOM   4659 C CB  . LYS B 2 64  ? 28.203  -34.517 1.334   1.00 105.44 ? 64   LYS B CB  1 
ATOM   4660 C CG  . LYS B 2 64  ? 28.360  -33.002 1.278   1.00 121.73 ? 64   LYS B CG  1 
ATOM   4661 C CD  . LYS B 2 64  ? 28.535  -32.482 -0.150  1.00 131.97 ? 64   LYS B CD  1 
ATOM   4662 C CE  . LYS B 2 64  ? 28.458  -30.949 -0.209  1.00 137.93 ? 64   LYS B CE  1 
ATOM   4663 N NZ  . LYS B 2 64  ? 27.105  -30.412 0.143   1.00 146.33 ? 64   LYS B NZ  1 
ATOM   4664 N N   . LYS B 2 65  ? 30.761  -36.354 1.018   1.00 101.49 ? 65   LYS B N   1 
ATOM   4665 C CA  . LYS B 2 65  ? 32.027  -36.605 0.346   1.00 108.83 ? 65   LYS B CA  1 
ATOM   4666 C C   . LYS B 2 65  ? 31.880  -35.995 -1.061  1.00 120.46 ? 65   LYS B C   1 
ATOM   4667 O O   . LYS B 2 65  ? 30.792  -36.038 -1.644  1.00 119.23 ? 65   LYS B O   1 
ATOM   4668 C CB  . LYS B 2 65  ? 32.283  -38.121 0.263   1.00 106.70 ? 65   LYS B CB  1 
ATOM   4669 C CG  . LYS B 2 65  ? 32.282  -38.888 1.608   1.00 108.16 ? 65   LYS B CG  1 
ATOM   4670 C CD  . LYS B 2 65  ? 32.557  -40.396 1.393   1.00 108.70 ? 65   LYS B CD  1 
ATOM   4671 C CE  . LYS B 2 65  ? 32.495  -41.240 2.684   1.00 108.68 ? 65   LYS B CE  1 
ATOM   4672 N NZ  . LYS B 2 65  ? 33.698  -41.166 3.575   1.00 106.17 ? 65   LYS B NZ  1 
ATOM   4673 N N   . LYS B 2 66  ? 32.962  -35.418 -1.592  1.00 132.10 ? 66   LYS B N   1 
ATOM   4674 C CA  . LYS B 2 66  ? 32.959  -34.772 -2.920  1.00 140.07 ? 66   LYS B CA  1 
ATOM   4675 C C   . LYS B 2 66  ? 32.904  -35.828 -4.038  1.00 143.70 ? 66   LYS B C   1 
ATOM   4676 O O   . LYS B 2 66  ? 33.604  -36.847 -3.975  1.00 142.31 ? 66   LYS B O   1 
ATOM   4677 C CB  . LYS B 2 66  ? 34.216  -33.871 -3.071  1.00 145.96 ? 66   LYS B CB  1 
ATOM   4678 C CG  . LYS B 2 66  ? 34.186  -32.762 -4.174  1.00 142.79 ? 66   LYS B CG  1 
ATOM   4679 C CD  . LYS B 2 66  ? 33.127  -31.676 -3.920  1.00 129.08 ? 66   LYS B CD  1 
ATOM   4680 C CE  . LYS B 2 66  ? 33.690  -30.257 -4.019  1.00 116.24 ? 66   LYS B CE  1 
ATOM   4681 N NZ  . LYS B 2 66  ? 32.622  -29.228 -3.800  1.00 101.81 ? 66   LYS B NZ  1 
ATOM   4682 N N   . ASP B 2 67  ? 32.074  -35.566 -5.053  1.00 146.29 ? 67   ASP B N   1 
ATOM   4683 C CA  . ASP B 2 67  ? 31.863  -36.469 -6.195  1.00 144.85 ? 67   ASP B CA  1 
ATOM   4684 C C   . ASP B 2 67  ? 31.899  -37.919 -5.719  1.00 138.11 ? 67   ASP B C   1 
ATOM   4685 O O   . ASP B 2 67  ? 32.415  -38.821 -6.388  1.00 143.09 ? 67   ASP B O   1 
ATOM   4686 C CB  . ASP B 2 67  ? 32.900  -36.242 -7.313  1.00 149.99 ? 67   ASP B CB  1 
ATOM   4687 C CG  . ASP B 2 67  ? 32.389  -36.696 -8.685  1.00 150.00 ? 67   ASP B CG  1 
ATOM   4688 O OD1 . ASP B 2 67  ? 31.402  -36.106 -9.172  1.00 149.99 ? 67   ASP B OD1 1 
ATOM   4689 O OD2 . ASP B 2 67  ? 32.964  -37.640 -9.274  1.00 150.00 ? 67   ASP B OD2 1 
ATOM   4690 N N   . SER B 2 68  ? 31.362  -38.112 -4.524  1.00 123.28 ? 68   SER B N   1 
ATOM   4691 C CA  . SER B 2 68  ? 31.253  -39.414 -3.914  1.00 108.91 ? 68   SER B CA  1 
ATOM   4692 C C   . SER B 2 68  ? 29.831  -39.362 -3.406  1.00 100.34 ? 68   SER B C   1 
ATOM   4693 O O   . SER B 2 68  ? 29.291  -38.279 -3.169  1.00 93.79  ? 68   SER B O   1 
ATOM   4694 C CB  . SER B 2 68  ? 32.234  -39.570 -2.765  1.00 109.92 ? 68   SER B CB  1 
ATOM   4695 O OG  . SER B 2 68  ? 32.093  -40.850 -2.179  1.00 112.91 ? 68   SER B OG  1 
ATOM   4696 N N   . THR B 2 69  ? 29.216  -40.519 -3.232  1.00 96.86  ? 69   THR B N   1 
ATOM   4697 C CA  . THR B 2 69  ? 27.826  -40.547 -2.814  1.00 96.31  ? 69   THR B CA  1 
ATOM   4698 C C   . THR B 2 69  ? 27.581  -40.966 -1.377  1.00 94.71  ? 69   THR B C   1 
ATOM   4699 O O   . THR B 2 69  ? 26.504  -41.436 -1.034  1.00 89.37  ? 69   THR B O   1 
ATOM   4700 C CB  . THR B 2 69  ? 27.031  -41.488 -3.723  1.00 103.68 ? 69   THR B CB  1 
ATOM   4701 O OG1 . THR B 2 69  ? 25.632  -41.283 -3.502  1.00 115.11 ? 69   THR B OG1 1 
ATOM   4702 C CG2 . THR B 2 69  ? 27.402  -42.957 -3.440  1.00 91.93  ? 69   THR B CG2 1 
ATOM   4703 N N   . LYS B 2 70  ? 28.562  -40.782 -0.516  1.00 97.09  ? 70   LYS B N   1 
ATOM   4704 C CA  . LYS B 2 70  ? 28.372  -41.209 0.852   1.00 95.36  ? 70   LYS B CA  1 
ATOM   4705 C C   . LYS B 2 70  ? 28.529  -40.067 1.841   1.00 91.16  ? 70   LYS B C   1 
ATOM   4706 O O   . LYS B 2 70  ? 29.131  -39.032 1.531   1.00 90.27  ? 70   LYS B O   1 
ATOM   4707 C CB  . LYS B 2 70  ? 29.378  -42.317 1.171   1.00 97.25  ? 70   LYS B CB  1 
ATOM   4708 C CG  . LYS B 2 70  ? 29.739  -43.172 -0.042  1.00 102.22 ? 70   LYS B CG  1 
ATOM   4709 C CD  . LYS B 2 70  ? 31.058  -43.915 0.154   1.00 95.84  ? 70   LYS B CD  1 
ATOM   4710 C CE  . LYS B 2 70  ? 31.611  -44.472 -1.170  1.00 99.36  ? 70   LYS B CE  1 
ATOM   4711 N NZ  . LYS B 2 70  ? 30.767  -45.513 -1.827  1.00 93.17  ? 70   LYS B NZ  1 
ATOM   4712 N N   . TRP B 2 71  ? 27.966  -40.263 3.030   1.00 85.86  ? 71   TRP B N   1 
ATOM   4713 C CA  . TRP B 2 71  ? 28.072  -39.281 4.096   1.00 77.22  ? 71   TRP B CA  1 
ATOM   4714 C C   . TRP B 2 71  ? 29.205  -39.679 5.004   1.00 71.80  ? 71   TRP B C   1 
ATOM   4715 O O   . TRP B 2 71  ? 29.407  -40.869 5.276   1.00 65.93  ? 71   TRP B O   1 
ATOM   4716 C CB  . TRP B 2 71  ? 26.840  -39.243 4.964   1.00 72.29  ? 71   TRP B CB  1 
ATOM   4717 C CG  . TRP B 2 71  ? 25.623  -38.772 4.298   1.00 74.77  ? 71   TRP B CG  1 
ATOM   4718 C CD1 . TRP B 2 71  ? 24.618  -39.547 3.785   1.00 68.91  ? 71   TRP B CD1 1 
ATOM   4719 C CD2 . TRP B 2 71  ? 25.198  -37.407 4.158   1.00 81.60  ? 71   TRP B CD2 1 
ATOM   4720 N NE1 . TRP B 2 71  ? 23.579  -38.749 3.346   1.00 75.91  ? 71   TRP B NE1 1 
ATOM   4721 C CE2 . TRP B 2 71  ? 23.907  -37.432 3.560   1.00 80.98  ? 71   TRP B CE2 1 
ATOM   4722 C CE3 . TRP B 2 71  ? 25.778  -36.164 4.482   1.00 84.58  ? 71   TRP B CE3 1 
ATOM   4723 C CZ2 . TRP B 2 71  ? 23.180  -36.256 3.277   1.00 83.72  ? 71   TRP B CZ2 1 
ATOM   4724 C CZ3 . TRP B 2 71  ? 25.055  -34.988 4.202   1.00 84.90  ? 71   TRP B CZ3 1 
ATOM   4725 C CH2 . TRP B 2 71  ? 23.767  -35.048 3.603   1.00 87.45  ? 71   TRP B CH2 1 
ATOM   4726 N N   . ARG B 2 72  ? 29.931  -38.673 5.473   1.00 66.69  ? 72   ARG B N   1 
ATOM   4727 C CA  . ARG B 2 72  ? 31.026  -38.901 6.380   1.00 61.19  ? 72   ARG B CA  1 
ATOM   4728 C C   . ARG B 2 72  ? 30.493  -38.440 7.707   1.00 60.33  ? 72   ARG B C   1 
ATOM   4729 O O   . ARG B 2 72  ? 29.683  -37.512 7.764   1.00 59.19  ? 72   ARG B O   1 
ATOM   4730 C CB  . ARG B 2 72  ? 32.253  -38.060 6.012   1.00 66.07  ? 72   ARG B CB  1 
ATOM   4731 C CG  . ARG B 2 72  ? 33.563  -38.848 6.100   1.00 87.00  ? 72   ARG B CG  1 
ATOM   4732 C CD  . ARG B 2 72  ? 34.819  -37.983 6.255   1.00 89.17  ? 72   ARG B CD  1 
ATOM   4733 N NE  . ARG B 2 72  ? 35.111  -37.707 7.663   1.00 104.56 ? 72   ARG B NE  1 
ATOM   4734 C CZ  . ARG B 2 72  ? 36.236  -38.044 8.302   1.00 113.39 ? 72   ARG B CZ  1 
ATOM   4735 N NH1 . ARG B 2 72  ? 37.220  -38.685 7.675   1.00 113.85 ? 72   ARG B NH1 1 
ATOM   4736 N NH2 . ARG B 2 72  ? 36.383  -37.735 9.588   1.00 112.89 ? 72   ARG B NH2 1 
ATOM   4737 N N   . LYS B 2 73  ? 30.906  -39.113 8.771   1.00 59.40  ? 73   LYS B N   1 
ATOM   4738 C CA  . LYS B 2 73  ? 30.487  -38.692 10.089  1.00 57.66  ? 73   LYS B CA  1 
ATOM   4739 C C   . LYS B 2 73  ? 31.622  -37.871 10.651  1.00 56.33  ? 73   LYS B C   1 
ATOM   4740 O O   . LYS B 2 73  ? 32.767  -38.327 10.724  1.00 55.22  ? 73   LYS B O   1 
ATOM   4741 C CB  . LYS B 2 73  ? 30.216  -39.858 11.027  1.00 50.77  ? 73   LYS B CB  1 
ATOM   4742 C CG  . LYS B 2 73  ? 29.700  -39.370 12.356  1.00 43.65  ? 73   LYS B CG  1 
ATOM   4743 C CD  . LYS B 2 73  ? 29.397  -40.497 13.294  1.00 55.82  ? 73   LYS B CD  1 
ATOM   4744 C CE  . LYS B 2 73  ? 30.672  -41.096 13.841  1.00 64.52  ? 73   LYS B CE  1 
ATOM   4745 N NZ  . LYS B 2 73  ? 30.362  -41.976 14.999  1.00 68.82  ? 73   LYS B NZ  1 
ATOM   4746 N N   . LEU B 2 74  ? 31.296  -36.641 11.023  1.00 56.90  ? 74   LEU B N   1 
ATOM   4747 C CA  . LEU B 2 74  ? 32.274  -35.736 11.592  1.00 55.39  ? 74   LEU B CA  1 
ATOM   4748 C C   . LEU B 2 74  ? 31.910  -35.511 13.051  1.00 53.95  ? 74   LEU B C   1 
ATOM   4749 O O   . LEU B 2 74  ? 30.763  -35.168 13.380  1.00 50.76  ? 74   LEU B O   1 
ATOM   4750 C CB  . LEU B 2 74  ? 32.277  -34.403 10.847  1.00 57.21  ? 74   LEU B CB  1 
ATOM   4751 C CG  . LEU B 2 74  ? 33.352  -33.386 11.286  1.00 63.09  ? 74   LEU B CG  1 
ATOM   4752 C CD1 . LEU B 2 74  ? 34.753  -33.856 10.880  1.00 65.71  ? 74   LEU B CD1 1 
ATOM   4753 C CD2 . LEU B 2 74  ? 33.060  -32.022 10.633  1.00 73.42  ? 74   LEU B CD2 1 
ATOM   4754 N N   . VAL B 2 75  ? 32.906  -35.723 13.912  1.00 59.06  ? 75   VAL B N   1 
ATOM   4755 C CA  . VAL B 2 75  ? 32.761  -35.569 15.361  1.00 56.92  ? 75   VAL B CA  1 
ATOM   4756 C C   . VAL B 2 75  ? 33.605  -34.382 15.853  1.00 51.27  ? 75   VAL B C   1 
ATOM   4757 O O   . VAL B 2 75  ? 34.834  -34.418 15.770  1.00 47.03  ? 75   VAL B O   1 
ATOM   4758 C CB  . VAL B 2 75  ? 33.227  -36.845 16.087  1.00 49.01  ? 75   VAL B CB  1 
ATOM   4759 C CG1 . VAL B 2 75  ? 33.018  -36.689 17.545  1.00 40.51  ? 75   VAL B CG1 1 
ATOM   4760 C CG2 . VAL B 2 75  ? 32.461  -38.045 15.584  1.00 52.31  ? 75   VAL B CG2 1 
ATOM   4761 N N   . ASP B 2 76  ? 32.961  -33.335 16.369  1.00 49.42  ? 76   ASP B N   1 
ATOM   4762 C CA  . ASP B 2 76  ? 33.714  -32.169 16.837  1.00 57.53  ? 76   ASP B CA  1 
ATOM   4763 C C   . ASP B 2 76  ? 34.492  -32.426 18.126  1.00 58.86  ? 76   ASP B C   1 
ATOM   4764 O O   . ASP B 2 76  ? 34.069  -32.032 19.210  1.00 63.18  ? 76   ASP B O   1 
ATOM   4765 C CB  . ASP B 2 76  ? 32.780  -30.980 17.043  1.00 62.66  ? 76   ASP B CB  1 
ATOM   4766 C CG  . ASP B 2 76  ? 33.533  -29.694 17.348  1.00 55.05  ? 76   ASP B CG  1 
ATOM   4767 O OD1 . ASP B 2 76  ? 32.867  -28.711 17.718  1.00 56.85  ? 76   ASP B OD1 1 
ATOM   4768 O OD2 . ASP B 2 76  ? 34.779  -29.660 17.220  1.00 51.47  ? 76   ASP B OD2 1 
ATOM   4769 N N   . PHE B 2 77  ? 35.647  -33.063 17.997  1.00 59.74  ? 77   PHE B N   1 
ATOM   4770 C CA  . PHE B 2 77  ? 36.475  -33.389 19.152  1.00 60.07  ? 77   PHE B CA  1 
ATOM   4771 C C   . PHE B 2 77  ? 37.362  -32.254 19.605  1.00 58.48  ? 77   PHE B C   1 
ATOM   4772 O O   . PHE B 2 77  ? 38.361  -32.464 20.308  1.00 57.83  ? 77   PHE B O   1 
ATOM   4773 C CB  . PHE B 2 77  ? 37.354  -34.587 18.837  1.00 66.70  ? 77   PHE B CB  1 
ATOM   4774 C CG  . PHE B 2 77  ? 36.627  -35.900 18.878  1.00 71.90  ? 77   PHE B CG  1 
ATOM   4775 C CD1 . PHE B 2 77  ? 36.711  -36.797 17.801  1.00 72.95  ? 77   PHE B CD1 1 
ATOM   4776 C CD2 . PHE B 2 77  ? 35.898  -36.269 20.011  1.00 74.63  ? 77   PHE B CD2 1 
ATOM   4777 C CE1 . PHE B 2 77  ? 36.081  -38.058 17.847  1.00 73.39  ? 77   PHE B CE1 1 
ATOM   4778 C CE2 . PHE B 2 77  ? 35.264  -37.524 20.076  1.00 78.27  ? 77   PHE B CE2 1 
ATOM   4779 C CZ  . PHE B 2 77  ? 35.358  -38.426 18.985  1.00 74.41  ? 77   PHE B CZ  1 
ATOM   4780 N N   . ARG B 2 78  ? 36.991  -31.049 19.209  1.00 59.53  ? 78   ARG B N   1 
ATOM   4781 C CA  . ARG B 2 78  ? 37.774  -29.881 19.562  1.00 62.59  ? 78   ARG B CA  1 
ATOM   4782 C C   . ARG B 2 78  ? 38.022  -29.699 21.067  1.00 55.39  ? 78   ARG B C   1 
ATOM   4783 O O   . ARG B 2 78  ? 39.172  -29.591 21.522  1.00 53.41  ? 78   ARG B O   1 
ATOM   4784 C CB  . ARG B 2 78  ? 37.107  -28.630 18.968  1.00 72.78  ? 78   ARG B CB  1 
ATOM   4785 C CG  . ARG B 2 78  ? 37.681  -28.189 17.617  1.00 67.97  ? 78   ARG B CG  1 
ATOM   4786 C CD  . ARG B 2 78  ? 37.025  -26.919 17.167  1.00 62.87  ? 78   ARG B CD  1 
ATOM   4787 N NE  . ARG B 2 78  ? 35.697  -27.200 16.652  1.00 62.58  ? 78   ARG B NE  1 
ATOM   4788 C CZ  . ARG B 2 78  ? 34.765  -26.278 16.482  1.00 57.17  ? 78   ARG B CZ  1 
ATOM   4789 N NH1 . ARG B 2 78  ? 35.008  -25.015 16.799  1.00 55.64  ? 78   ARG B NH1 1 
ATOM   4790 N NH2 . ARG B 2 78  ? 33.604  -26.619 15.963  1.00 61.26  ? 78   ARG B NH2 1 
ATOM   4791 N N   . GLU B 2 79  ? 36.944  -29.665 21.834  1.00 58.06  ? 79   GLU B N   1 
ATOM   4792 C CA  . GLU B 2 79  ? 37.073  -29.478 23.265  1.00 62.36  ? 79   GLU B CA  1 
ATOM   4793 C C   . GLU B 2 79  ? 37.946  -30.582 23.857  1.00 61.67  ? 79   GLU B C   1 
ATOM   4794 O O   . GLU B 2 79  ? 38.920  -30.318 24.573  1.00 56.87  ? 79   GLU B O   1 
ATOM   4795 C CB  . GLU B 2 79  ? 35.682  -29.481 23.897  1.00 66.50  ? 79   GLU B CB  1 
ATOM   4796 C CG  . GLU B 2 79  ? 35.660  -28.969 25.321  1.00 77.60  ? 79   GLU B CG  1 
ATOM   4797 C CD  . GLU B 2 79  ? 36.445  -27.697 25.471  1.00 76.60  ? 79   GLU B CD  1 
ATOM   4798 O OE1 . GLU B 2 79  ? 36.431  -26.904 24.509  1.00 68.01  ? 79   GLU B OE1 1 
ATOM   4799 O OE2 . GLU B 2 79  ? 37.065  -27.492 26.540  1.00 87.59  ? 79   GLU B OE2 1 
ATOM   4800 N N   . LEU B 2 80  ? 37.597  -31.820 23.528  1.00 61.66  ? 80   LEU B N   1 
ATOM   4801 C CA  . LEU B 2 80  ? 38.334  -32.965 24.028  1.00 62.80  ? 80   LEU B CA  1 
ATOM   4802 C C   . LEU B 2 80  ? 39.816  -32.817 23.718  1.00 66.64  ? 80   LEU B C   1 
ATOM   4803 O O   . LEU B 2 80  ? 40.649  -32.804 24.624  1.00 68.86  ? 80   LEU B O   1 
ATOM   4804 C CB  . LEU B 2 80  ? 37.798  -34.266 23.403  1.00 58.22  ? 80   LEU B CB  1 
ATOM   4805 C CG  . LEU B 2 80  ? 38.419  -35.591 23.895  1.00 54.13  ? 80   LEU B CG  1 
ATOM   4806 C CD1 . LEU B 2 80  ? 38.187  -35.765 25.385  1.00 41.34  ? 80   LEU B CD1 1 
ATOM   4807 C CD2 . LEU B 2 80  ? 37.805  -36.752 23.149  1.00 45.66  ? 80   LEU B CD2 1 
ATOM   4808 N N   . ASN B 2 81  ? 40.134  -32.705 22.432  1.00 64.61  ? 81   ASN B N   1 
ATOM   4809 C CA  . ASN B 2 81  ? 41.512  -32.573 22.005  1.00 56.87  ? 81   ASN B CA  1 
ATOM   4810 C C   . ASN B 2 81  ? 42.270  -31.536 22.846  1.00 63.41  ? 81   ASN B C   1 
ATOM   4811 O O   . ASN B 2 81  ? 43.479  -31.668 23.079  1.00 68.31  ? 81   ASN B O   1 
ATOM   4812 C CB  . ASN B 2 81  ? 41.557  -32.215 20.516  1.00 56.03  ? 81   ASN B CB  1 
ATOM   4813 C CG  . ASN B 2 81  ? 41.084  -33.355 19.625  1.00 58.78  ? 81   ASN B CG  1 
ATOM   4814 O OD1 . ASN B 2 81  ? 40.834  -34.453 20.097  1.00 65.24  ? 81   ASN B OD1 1 
ATOM   4815 N ND2 . ASN B 2 81  ? 40.970  -33.096 18.330  1.00 60.29  ? 81   ASN B ND2 1 
ATOM   4816 N N   . LYS B 2 82  ? 41.561  -30.519 23.324  1.00 62.24  ? 82   LYS B N   1 
ATOM   4817 C CA  . LYS B 2 82  ? 42.196  -29.498 24.135  1.00 61.13  ? 82   LYS B CA  1 
ATOM   4818 C C   . LYS B 2 82  ? 42.528  -29.989 25.533  1.00 65.41  ? 82   LYS B C   1 
ATOM   4819 O O   . LYS B 2 82  ? 43.471  -29.524 26.155  1.00 71.57  ? 82   LYS B O   1 
ATOM   4820 C CB  . LYS B 2 82  ? 41.301  -28.272 24.214  1.00 60.91  ? 82   LYS B CB  1 
ATOM   4821 C CG  . LYS B 2 82  ? 41.819  -27.156 23.346  1.00 72.03  ? 82   LYS B CG  1 
ATOM   4822 C CD  . LYS B 2 82  ? 40.969  -25.931 23.454  1.00 85.87  ? 82   LYS B CD  1 
ATOM   4823 C CE  . LYS B 2 82  ? 39.628  -26.159 22.814  1.00 94.17  ? 82   LYS B CE  1 
ATOM   4824 N NZ  . LYS B 2 82  ? 38.850  -24.897 22.846  1.00 105.14 ? 82   LYS B NZ  1 
ATOM   4825 N N   . ARG B 2 83  ? 41.754  -30.946 26.020  1.00 71.68  ? 83   ARG B N   1 
ATOM   4826 C CA  . ARG B 2 83  ? 41.961  -31.495 27.355  1.00 73.44  ? 83   ARG B CA  1 
ATOM   4827 C C   . ARG B 2 83  ? 42.741  -32.824 27.367  1.00 76.66  ? 83   ARG B C   1 
ATOM   4828 O O   . ARG B 2 83  ? 43.011  -33.399 28.430  1.00 73.35  ? 83   ARG B O   1 
ATOM   4829 C CB  . ARG B 2 83  ? 40.605  -31.692 28.023  1.00 71.63  ? 83   ARG B CB  1 
ATOM   4830 C CG  . ARG B 2 83  ? 39.717  -30.496 27.890  1.00 70.78  ? 83   ARG B CG  1 
ATOM   4831 C CD  . ARG B 2 83  ? 38.420  -30.695 28.637  1.00 68.62  ? 83   ARG B CD  1 
ATOM   4832 N NE  . ARG B 2 83  ? 37.543  -29.552 28.411  1.00 63.70  ? 83   ARG B NE  1 
ATOM   4833 C CZ  . ARG B 2 83  ? 36.428  -29.313 29.087  1.00 58.09  ? 83   ARG B CZ  1 
ATOM   4834 N NH1 . ARG B 2 83  ? 36.039  -30.149 30.049  1.00 64.61  ? 83   ARG B NH1 1 
ATOM   4835 N NH2 . ARG B 2 83  ? 35.716  -28.228 28.803  1.00 56.39  ? 83   ARG B NH2 1 
ATOM   4836 N N   . THR B 2 84  ? 43.093  -33.326 26.189  1.00 82.68  ? 84   THR B N   1 
ATOM   4837 C CA  . THR B 2 84  ? 43.841  -34.576 26.119  1.00 81.17  ? 84   THR B CA  1 
ATOM   4838 C C   . THR B 2 84  ? 45.336  -34.295 26.291  1.00 88.80  ? 84   THR B C   1 
ATOM   4839 O O   . THR B 2 84  ? 45.887  -33.376 25.675  1.00 93.15  ? 84   THR B O   1 
ATOM   4840 C CB  . THR B 2 84  ? 43.590  -35.324 24.762  1.00 69.60  ? 84   THR B CB  1 
ATOM   4841 O OG1 . THR B 2 84  ? 42.238  -35.808 24.720  1.00 55.58  ? 84   THR B OG1 1 
ATOM   4842 C CG2 . THR B 2 84  ? 44.539  -36.509 24.602  1.00 59.59  ? 84   THR B CG2 1 
ATOM   4843 N N   . GLN B 2 85  ? 45.966  -35.075 27.163  1.00 90.87  ? 85   GLN B N   1 
ATOM   4844 C CA  . GLN B 2 85  ? 47.401  -34.983 27.435  1.00 92.47  ? 85   GLN B CA  1 
ATOM   4845 C C   . GLN B 2 85  ? 48.189  -34.752 26.126  1.00 91.58  ? 85   GLN B C   1 
ATOM   4846 O O   . GLN B 2 85  ? 47.822  -35.292 25.063  1.00 81.93  ? 85   GLN B O   1 
ATOM   4847 C CB  . GLN B 2 85  ? 47.874  -36.309 28.051  1.00 103.70 ? 85   GLN B CB  1 
ATOM   4848 C CG  . GLN B 2 85  ? 47.718  -37.489 27.042  1.00 118.19 ? 85   GLN B CG  1 
ATOM   4849 C CD  . GLN B 2 85  ? 48.326  -38.823 27.490  1.00 114.54 ? 85   GLN B CD  1 
ATOM   4850 O OE1 . GLN B 2 85  ? 47.732  -39.570 28.281  1.00 105.42 ? 85   GLN B OE1 1 
ATOM   4851 N NE2 . GLN B 2 85  ? 49.516  -39.127 26.969  1.00 114.60 ? 85   GLN B NE2 1 
ATOM   4852 N N   . ASP B 2 86  ? 49.263  -33.962 26.196  1.00 95.47  ? 86   ASP B N   1 
ATOM   4853 C CA  . ASP B 2 86  ? 50.098  -33.737 25.011  1.00 97.80  ? 86   ASP B CA  1 
ATOM   4854 C C   . ASP B 2 86  ? 50.922  -35.023 24.893  1.00 99.72  ? 86   ASP B C   1 
ATOM   4855 O O   . ASP B 2 86  ? 51.168  -35.696 25.898  1.00 100.55 ? 86   ASP B O   1 
ATOM   4856 C CB  . ASP B 2 86  ? 51.047  -32.541 25.194  1.00 96.80  ? 86   ASP B CB  1 
ATOM   4857 C CG  . ASP B 2 86  ? 50.371  -31.339 25.841  1.00 99.09  ? 86   ASP B CG  1 
ATOM   4858 O OD1 . ASP B 2 86  ? 50.357  -31.274 27.093  1.00 100.15 ? 86   ASP B OD1 1 
ATOM   4859 O OD2 . ASP B 2 86  ? 49.849  -30.464 25.106  1.00 96.94  ? 86   ASP B OD2 1 
ATOM   4860 N N   . PHE B 2 87  ? 51.358  -35.377 23.690  1.00 100.23 ? 87   PHE B N   1 
ATOM   4861 C CA  . PHE B 2 87  ? 52.126  -36.609 23.537  1.00 102.82 ? 87   PHE B CA  1 
ATOM   4862 C C   . PHE B 2 87  ? 53.648  -36.436 23.369  1.00 101.20 ? 87   PHE B C   1 
ATOM   4863 O O   . PHE B 2 87  ? 54.184  -36.397 22.260  1.00 96.46  ? 87   PHE B O   1 
ATOM   4864 C CB  . PHE B 2 87  ? 51.522  -37.437 22.395  1.00 105.82 ? 87   PHE B CB  1 
ATOM   4865 C CG  . PHE B 2 87  ? 50.131  -37.933 22.687  1.00 108.46 ? 87   PHE B CG  1 
ATOM   4866 C CD1 . PHE B 2 87  ? 49.022  -37.113 22.509  1.00 113.44 ? 87   PHE B CD1 1 
ATOM   4867 C CD2 . PHE B 2 87  ? 49.936  -39.206 23.197  1.00 110.33 ? 87   PHE B CD2 1 
ATOM   4868 C CE1 . PHE B 2 87  ? 47.738  -37.562 22.841  1.00 113.97 ? 87   PHE B CE1 1 
ATOM   4869 C CE2 . PHE B 2 87  ? 48.660  -39.662 23.531  1.00 108.58 ? 87   PHE B CE2 1 
ATOM   4870 C CZ  . PHE B 2 87  ? 47.561  -38.840 23.354  1.00 109.12 ? 87   PHE B CZ  1 
ATOM   4871 N N   . PRO B 2 95  ? 57.382  -33.904 13.536  1.00 145.64 ? 95   PRO B N   1 
ATOM   4872 C CA  . PRO B 2 95  ? 57.640  -32.469 13.370  1.00 147.72 ? 95   PRO B CA  1 
ATOM   4873 C C   . PRO B 2 95  ? 56.962  -31.876 12.146  1.00 146.16 ? 95   PRO B C   1 
ATOM   4874 O O   . PRO B 2 95  ? 55.738  -31.905 12.046  1.00 149.99 ? 95   PRO B O   1 
ATOM   4875 C CB  . PRO B 2 95  ? 59.156  -32.407 13.290  1.00 149.93 ? 95   PRO B CB  1 
ATOM   4876 C CG  . PRO B 2 95  ? 59.543  -33.442 14.291  1.00 149.99 ? 95   PRO B CG  1 
ATOM   4877 C CD  . PRO B 2 95  ? 58.603  -34.603 13.970  1.00 147.33 ? 95   PRO B CD  1 
ATOM   4878 N N   . HIS B 2 96  ? 57.739  -31.340 11.211  1.00 139.16 ? 96   HIS B N   1 
ATOM   4879 C CA  . HIS B 2 96  ? 57.128  -30.754 10.028  1.00 132.09 ? 96   HIS B CA  1 
ATOM   4880 C C   . HIS B 2 96  ? 58.109  -30.425 8.903   1.00 130.92 ? 96   HIS B C   1 
ATOM   4881 O O   . HIS B 2 96  ? 59.043  -29.648 9.103   1.00 133.72 ? 96   HIS B O   1 
ATOM   4882 C CB  . HIS B 2 96  ? 56.373  -29.488 10.432  1.00 125.17 ? 96   HIS B CB  1 
ATOM   4883 C CG  . HIS B 2 96  ? 55.611  -28.859 9.311   1.00 122.85 ? 96   HIS B CG  1 
ATOM   4884 N ND1 . HIS B 2 96  ? 54.559  -29.489 8.680   1.00 122.66 ? 96   HIS B ND1 1 
ATOM   4885 C CD2 . HIS B 2 96  ? 55.758  -27.662 8.694   1.00 122.46 ? 96   HIS B CD2 1 
ATOM   4886 C CE1 . HIS B 2 96  ? 54.093  -28.708 7.723   1.00 126.09 ? 96   HIS B CE1 1 
ATOM   4887 N NE2 . HIS B 2 96  ? 54.802  -27.593 7.710   1.00 127.00 ? 96   HIS B NE2 1 
ATOM   4888 N N   . PRO B 2 97  ? 57.902  -31.013 7.701   1.00 128.67 ? 97   PRO B N   1 
ATOM   4889 C CA  . PRO B 2 97  ? 58.743  -30.808 6.501   1.00 126.43 ? 97   PRO B CA  1 
ATOM   4890 C C   . PRO B 2 97  ? 58.579  -29.444 5.827   1.00 119.05 ? 97   PRO B C   1 
ATOM   4891 O O   . PRO B 2 97  ? 57.599  -29.182 5.111   1.00 112.65 ? 97   PRO B O   1 
ATOM   4892 C CB  . PRO B 2 97  ? 58.330  -31.951 5.572   1.00 130.31 ? 97   PRO B CB  1 
ATOM   4893 C CG  . PRO B 2 97  ? 56.881  -32.164 5.944   1.00 132.88 ? 97   PRO B CG  1 
ATOM   4894 C CD  . PRO B 2 97  ? 56.905  -32.077 7.466   1.00 127.90 ? 97   PRO B CD  1 
ATOM   4895 N N   . ALA B 2 98  ? 59.555  -28.578 6.067   1.00 116.29 ? 98   ALA B N   1 
ATOM   4896 C CA  . ALA B 2 98  ? 59.528  -27.251 5.496   1.00 113.99 ? 98   ALA B CA  1 
ATOM   4897 C C   . ALA B 2 98  ? 59.749  -27.415 4.003   1.00 118.13 ? 98   ALA B C   1 
ATOM   4898 O O   . ALA B 2 98  ? 59.764  -26.436 3.258   1.00 123.21 ? 98   ALA B O   1 
ATOM   4899 C CB  . ALA B 2 98  ? 60.623  -26.380 6.120   1.00 105.49 ? 98   ALA B CB  1 
ATOM   4900 N N   . GLY B 2 99  ? 59.914  -28.664 3.570   1.00 118.98 ? 99   GLY B N   1 
ATOM   4901 C CA  . GLY B 2 99  ? 60.123  -28.931 2.159   1.00 120.62 ? 99   GLY B CA  1 
ATOM   4902 C C   . GLY B 2 99  ? 58.802  -29.103 1.434   1.00 120.00 ? 99   GLY B C   1 
ATOM   4903 O O   . GLY B 2 99  ? 58.702  -28.894 0.214   1.00 117.70 ? 99   GLY B O   1 
ATOM   4904 N N   . LEU B 2 100 ? 57.778  -29.472 2.197   1.00 118.24 ? 100  LEU B N   1 
ATOM   4905 C CA  . LEU B 2 100 ? 56.465  -29.685 1.626   1.00 113.84 ? 100  LEU B CA  1 
ATOM   4906 C C   . LEU B 2 100 ? 55.925  -28.434 0.933   1.00 112.25 ? 100  LEU B C   1 
ATOM   4907 O O   . LEU B 2 100 ? 55.466  -28.510 -0.211  1.00 115.09 ? 100  LEU B O   1 
ATOM   4908 C CB  . LEU B 2 100 ? 55.491  -30.155 2.708   1.00 109.88 ? 100  LEU B CB  1 
ATOM   4909 C CG  . LEU B 2 100 ? 54.222  -30.852 2.190   1.00 112.19 ? 100  LEU B CG  1 
ATOM   4910 C CD1 . LEU B 2 100 ? 54.574  -32.089 1.355   1.00 102.57 ? 100  LEU B CD1 1 
ATOM   4911 C CD2 . LEU B 2 100 ? 53.353  -31.240 3.377   1.00 113.81 ? 100  LEU B CD2 1 
ATOM   4912 N N   . LYS B 2 101 ? 55.995  -27.285 1.603   1.00 105.05 ? 101  LYS B N   1 
ATOM   4913 C CA  . LYS B 2 101 ? 55.480  -26.046 1.015   1.00 106.21 ? 101  LYS B CA  1 
ATOM   4914 C C   . LYS B 2 101 ? 56.132  -25.641 -0.317  1.00 109.09 ? 101  LYS B C   1 
ATOM   4915 O O   . LYS B 2 101 ? 55.603  -24.805 -1.060  1.00 108.89 ? 101  LYS B O   1 
ATOM   4916 C CB  . LYS B 2 101 ? 55.591  -24.900 2.027   1.00 98.56  ? 101  LYS B CB  1 
ATOM   4917 C CG  . LYS B 2 101 ? 56.992  -24.589 2.472   1.00 95.16  ? 101  LYS B CG  1 
ATOM   4918 C CD  . LYS B 2 101 ? 57.083  -24.539 3.986   1.00 91.44  ? 101  LYS B CD  1 
ATOM   4919 C CE  . LYS B 2 101 ? 58.412  -23.930 4.437   1.00 98.31  ? 101  LYS B CE  1 
ATOM   4920 N NZ  . LYS B 2 101 ? 58.552  -22.490 4.037   1.00 103.83 ? 101  LYS B NZ  1 
ATOM   4921 N N   . LYS B 2 102 ? 57.270  -26.250 -0.625  1.00 111.60 ? 102  LYS B N   1 
ATOM   4922 C CA  . LYS B 2 102 ? 57.972  -25.942 -1.857  1.00 114.52 ? 102  LYS B CA  1 
ATOM   4923 C C   . LYS B 2 102 ? 57.646  -26.974 -2.920  1.00 113.47 ? 102  LYS B C   1 
ATOM   4924 O O   . LYS B 2 102 ? 57.851  -26.735 -4.106  1.00 121.87 ? 102  LYS B O   1 
ATOM   4925 C CB  . LYS B 2 102 ? 59.475  -25.930 -1.619  1.00 119.94 ? 102  LYS B CB  1 
ATOM   4926 C CG  . LYS B 2 102 ? 59.924  -25.125 -0.416  1.00 121.96 ? 102  LYS B CG  1 
ATOM   4927 C CD  . LYS B 2 102 ? 61.435  -25.191 -0.283  1.00 137.07 ? 102  LYS B CD  1 
ATOM   4928 C CE  . LYS B 2 102 ? 61.932  -26.640 -0.316  1.00 148.67 ? 102  LYS B CE  1 
ATOM   4929 N NZ  . LYS B 2 102 ? 63.427  -26.750 -0.331  1.00 149.99 ? 102  LYS B NZ  1 
ATOM   4930 N N   . LYS B 2 103 ? 57.161  -28.132 -2.494  1.00 103.30 ? 103  LYS B N   1 
ATOM   4931 C CA  . LYS B 2 103 ? 56.803  -29.174 -3.440  1.00 96.66  ? 103  LYS B CA  1 
ATOM   4932 C C   . LYS B 2 103 ? 55.870  -28.545 -4.484  1.00 104.92 ? 103  LYS B C   1 
ATOM   4933 O O   . LYS B 2 103 ? 55.145  -27.586 -4.186  1.00 107.47 ? 103  LYS B O   1 
ATOM   4934 C CB  . LYS B 2 103 ? 56.091  -30.305 -2.711  1.00 84.87  ? 103  LYS B CB  1 
ATOM   4935 C CG  . LYS B 2 103 ? 56.681  -31.659 -2.948  1.00 68.91  ? 103  LYS B CG  1 
ATOM   4936 C CD  . LYS B 2 103 ? 58.089  -31.758 -2.416  1.00 70.07  ? 103  LYS B CD  1 
ATOM   4937 C CE  . LYS B 2 103 ? 58.572  -33.200 -2.533  1.00 86.88  ? 103  LYS B CE  1 
ATOM   4938 N NZ  . LYS B 2 103 ? 60.055  -33.365 -2.587  1.00 79.06  ? 103  LYS B NZ  1 
ATOM   4939 N N   . LYS B 2 104 ? 55.896  -29.073 -5.706  1.00 106.47 ? 104  LYS B N   1 
ATOM   4940 C CA  . LYS B 2 104 ? 55.060  -28.544 -6.781  1.00 105.63 ? 104  LYS B CA  1 
ATOM   4941 C C   . LYS B 2 104 ? 53.627  -29.034 -6.643  1.00 103.22 ? 104  LYS B C   1 
ATOM   4942 O O   . LYS B 2 104 ? 52.665  -28.259 -6.739  1.00 96.38  ? 104  LYS B O   1 
ATOM   4943 C CB  . LYS B 2 104 ? 55.647  -28.964 -8.125  1.00 113.87 ? 104  LYS B CB  1 
ATOM   4944 C CG  . LYS B 2 104 ? 57.007  -28.331 -8.379  1.00 128.84 ? 104  LYS B CG  1 
ATOM   4945 C CD  . LYS B 2 104 ? 57.710  -28.918 -9.592  1.00 138.35 ? 104  LYS B CD  1 
ATOM   4946 C CE  . LYS B 2 104 ? 59.064  -28.248 -9.824  1.00 144.20 ? 104  LYS B CE  1 
ATOM   4947 N NZ  . LYS B 2 104 ? 58.929  -26.800 -10.159 1.00 150.00 ? 104  LYS B NZ  1 
ATOM   4948 N N   . SER B 2 105 ? 53.504  -30.333 -6.399  1.00 105.68 ? 105  SER B N   1 
ATOM   4949 C CA  . SER B 2 105 ? 52.207  -30.966 -6.230  1.00 108.41 ? 105  SER B CA  1 
ATOM   4950 C C   . SER B 2 105 ? 52.112  -31.697 -4.890  1.00 105.93 ? 105  SER B C   1 
ATOM   4951 O O   . SER B 2 105 ? 53.105  -32.235 -4.390  1.00 102.78 ? 105  SER B O   1 
ATOM   4952 C CB  . SER B 2 105 ? 51.945  -31.969 -7.366  1.00 116.47 ? 105  SER B CB  1 
ATOM   4953 O OG  . SER B 2 105 ? 51.684  -31.322 -8.604  1.00 121.66 ? 105  SER B OG  1 
ATOM   4954 N N   . VAL B 2 106 ? 50.905  -31.693 -4.323  1.00 106.30 ? 106  VAL B N   1 
ATOM   4955 C CA  . VAL B 2 106 ? 50.591  -32.366 -3.062  1.00 93.81  ? 106  VAL B CA  1 
ATOM   4956 C C   . VAL B 2 106 ? 49.194  -32.925 -3.223  1.00 89.16  ? 106  VAL B C   1 
ATOM   4957 O O   . VAL B 2 106 ? 48.325  -32.296 -3.814  1.00 91.16  ? 106  VAL B O   1 
ATOM   4958 C CB  . VAL B 2 106 ? 50.532  -31.400 -1.849  1.00 81.71  ? 106  VAL B CB  1 
ATOM   4959 C CG1 . VAL B 2 106 ? 50.318  -32.215 -0.556  1.00 73.25  ? 106  VAL B CG1 1 
ATOM   4960 C CG2 . VAL B 2 106 ? 51.804  -30.528 -1.784  1.00 68.00  ? 106  VAL B CG2 1 
ATOM   4961 N N   . THR B 2 107 ? 48.972  -34.118 -2.721  1.00 85.88  ? 107  THR B N   1 
ATOM   4962 C CA  . THR B 2 107 ? 47.644  -34.663 -2.802  1.00 89.16  ? 107  THR B CA  1 
ATOM   4963 C C   . THR B 2 107 ? 47.318  -34.997 -1.366  1.00 92.37  ? 107  THR B C   1 
ATOM   4964 O O   . THR B 2 107 ? 48.212  -35.360 -0.599  1.00 92.00  ? 107  THR B O   1 
ATOM   4965 C CB  . THR B 2 107 ? 47.597  -35.907 -3.688  1.00 90.75  ? 107  THR B CB  1 
ATOM   4966 O OG1 . THR B 2 107 ? 47.739  -35.514 -5.059  1.00 89.17  ? 107  THR B OG1 1 
ATOM   4967 C CG2 . THR B 2 107 ? 46.270  -36.624 -3.520  1.00 92.35  ? 107  THR B CG2 1 
ATOM   4968 N N   . VAL B 2 108 ? 46.054  -34.832 -0.986  1.00 93.72  ? 108  VAL B N   1 
ATOM   4969 C CA  . VAL B 2 108 ? 45.647  -35.125 0.380   1.00 89.04  ? 108  VAL B CA  1 
ATOM   4970 C C   . VAL B 2 108 ? 44.727  -36.324 0.419   1.00 86.73  ? 108  VAL B C   1 
ATOM   4971 O O   . VAL B 2 108 ? 43.739  -36.392 -0.321  1.00 79.67  ? 108  VAL B O   1 
ATOM   4972 C CB  . VAL B 2 108 ? 44.925  -33.939 1.038   1.00 85.37  ? 108  VAL B CB  1 
ATOM   4973 C CG1 . VAL B 2 108 ? 44.520  -34.321 2.454   1.00 84.81  ? 108  VAL B CG1 1 
ATOM   4974 C CG2 . VAL B 2 108 ? 45.839  -32.705 1.055   1.00 91.29  ? 108  VAL B CG2 1 
ATOM   4975 N N   . LEU B 2 109 ? 45.062  -37.266 1.294   1.00 88.59  ? 109  LEU B N   1 
ATOM   4976 C CA  . LEU B 2 109 ? 44.287  -38.481 1.437   1.00 90.94  ? 109  LEU B CA  1 
ATOM   4977 C C   . LEU B 2 109 ? 43.627  -38.549 2.796   1.00 91.06  ? 109  LEU B C   1 
ATOM   4978 O O   . LEU B 2 109 ? 44.062  -37.882 3.739   1.00 86.77  ? 109  LEU B O   1 
ATOM   4979 C CB  . LEU B 2 109 ? 45.193  -39.698 1.252   1.00 92.41  ? 109  LEU B CB  1 
ATOM   4980 C CG  . LEU B 2 109 ? 45.623  -40.054 -0.177  1.00 96.43  ? 109  LEU B CG  1 
ATOM   4981 C CD1 . LEU B 2 109 ? 46.415  -38.923 -0.784  1.00 108.41 ? 109  LEU B CD1 1 
ATOM   4982 C CD2 . LEU B 2 109 ? 46.468  -41.308 -0.161  1.00 94.93  ? 109  LEU B CD2 1 
ATOM   4983 N N   . ASP B 2 110 ? 42.563  -39.342 2.891   1.00 90.75  ? 110  ASP B N   1 
ATOM   4984 C CA  . ASP B 2 110 ? 41.885  -39.511 4.165   1.00 91.93  ? 110  ASP B CA  1 
ATOM   4985 C C   . ASP B 2 110 ? 42.173  -40.909 4.694   1.00 89.74  ? 110  ASP B C   1 
ATOM   4986 O O   . ASP B 2 110 ? 41.558  -41.895 4.285   1.00 80.44  ? 110  ASP B O   1 
ATOM   4987 C CB  . ASP B 2 110 ? 40.378  -39.320 4.039   1.00 91.11  ? 110  ASP B CB  1 
ATOM   4988 C CG  . ASP B 2 110 ? 39.675  -39.340 5.402   1.00 89.06  ? 110  ASP B CG  1 
ATOM   4989 O OD1 . ASP B 2 110 ? 38.534  -39.856 5.472   1.00 79.55  ? 110  ASP B OD1 1 
ATOM   4990 O OD2 . ASP B 2 110 ? 40.255  -38.836 6.399   1.00 78.27  ? 110  ASP B OD2 1 
ATOM   4991 N N   . VAL B 2 111 ? 43.130  -40.971 5.608   1.00 91.03  ? 111  VAL B N   1 
ATOM   4992 C CA  . VAL B 2 111 ? 43.557  -42.212 6.232   1.00 84.91  ? 111  VAL B CA  1 
ATOM   4993 C C   . VAL B 2 111 ? 42.771  -42.398 7.523   1.00 87.34  ? 111  VAL B C   1 
ATOM   4994 O O   . VAL B 2 111 ? 43.239  -43.028 8.465   1.00 87.52  ? 111  VAL B O   1 
ATOM   4995 C CB  . VAL B 2 111 ? 45.067  -42.146 6.560   1.00 80.83  ? 111  VAL B CB  1 
ATOM   4996 C CG1 . VAL B 2 111 ? 45.864  -41.970 5.282   1.00 73.41  ? 111  VAL B CG1 1 
ATOM   4997 C CG2 . VAL B 2 111 ? 45.356  -40.975 7.491   1.00 77.71  ? 111  VAL B CG2 1 
ATOM   4998 N N   . GLY B 2 112 ? 41.568  -41.841 7.551   1.00 85.66  ? 112  GLY B N   1 
ATOM   4999 C CA  . GLY B 2 112 ? 40.742  -41.920 8.738   1.00 74.56  ? 112  GLY B CA  1 
ATOM   5000 C C   . GLY B 2 112 ? 40.343  -43.312 9.172   1.00 69.98  ? 112  GLY B C   1 
ATOM   5001 O O   . GLY B 2 112 ? 40.342  -43.608 10.364  1.00 67.55  ? 112  GLY B O   1 
ATOM   5002 N N   . ASP B 2 113 ? 40.015  -44.176 8.221   1.00 69.83  ? 113  ASP B N   1 
ATOM   5003 C CA  . ASP B 2 113 ? 39.575  -45.522 8.563   1.00 75.37  ? 113  ASP B CA  1 
ATOM   5004 C C   . ASP B 2 113 ? 40.645  -46.429 9.135   1.00 72.72  ? 113  ASP B C   1 
ATOM   5005 O O   . ASP B 2 113 ? 40.354  -47.506 9.662   1.00 72.00  ? 113  ASP B O   1 
ATOM   5006 C CB  . ASP B 2 113 ? 38.931  -46.163 7.349   1.00 86.75  ? 113  ASP B CB  1 
ATOM   5007 C CG  . ASP B 2 113 ? 37.668  -45.453 6.947   1.00 101.38 ? 113  ASP B CG  1 
ATOM   5008 O OD1 . ASP B 2 113 ? 37.498  -45.140 5.750   1.00 102.05 ? 113  ASP B OD1 1 
ATOM   5009 O OD2 . ASP B 2 113 ? 36.844  -45.198 7.846   1.00 111.03 ? 113  ASP B OD2 1 
ATOM   5010 N N   . ALA B 2 114 ? 41.885  -45.983 9.053   1.00 71.08  ? 114  ALA B N   1 
ATOM   5011 C CA  . ALA B 2 114 ? 42.987  -46.768 9.582   1.00 80.81  ? 114  ALA B CA  1 
ATOM   5012 C C   . ALA B 2 114 ? 42.871  -46.956 11.093  1.00 83.92  ? 114  ALA B C   1 
ATOM   5013 O O   . ALA B 2 114 ? 43.168  -48.023 11.638  1.00 83.43  ? 114  ALA B O   1 
ATOM   5014 C CB  . ALA B 2 114 ? 44.288  -46.082 9.256   1.00 83.94  ? 114  ALA B CB  1 
ATOM   5015 N N   . TYR B 2 115 ? 42.439  -45.891 11.754  1.00 83.86  ? 115  TYR B N   1 
ATOM   5016 C CA  . TYR B 2 115 ? 42.297  -45.863 13.202  1.00 81.72  ? 115  TYR B CA  1 
ATOM   5017 C C   . TYR B 2 115 ? 41.342  -46.897 13.780  1.00 79.98  ? 115  TYR B C   1 
ATOM   5018 O O   . TYR B 2 115 ? 41.488  -47.308 14.935  1.00 68.70  ? 115  TYR B O   1 
ATOM   5019 C CB  . TYR B 2 115 ? 41.826  -44.472 13.635  1.00 79.91  ? 115  TYR B CB  1 
ATOM   5020 C CG  . TYR B 2 115 ? 42.741  -43.356 13.194  1.00 83.44  ? 115  TYR B CG  1 
ATOM   5021 C CD1 . TYR B 2 115 ? 44.096  -43.373 13.533  1.00 91.88  ? 115  TYR B CD1 1 
ATOM   5022 C CD2 . TYR B 2 115 ? 42.257  -42.266 12.470  1.00 85.09  ? 115  TYR B CD2 1 
ATOM   5023 C CE1 . TYR B 2 115 ? 44.958  -42.330 13.169  1.00 90.51  ? 115  TYR B CE1 1 
ATOM   5024 C CE2 . TYR B 2 115 ? 43.113  -41.208 12.099  1.00 94.08  ? 115  TYR B CE2 1 
ATOM   5025 C CZ  . TYR B 2 115 ? 44.466  -41.253 12.457  1.00 91.83  ? 115  TYR B CZ  1 
ATOM   5026 O OH  . TYR B 2 115 ? 45.330  -40.235 12.116  1.00 88.27  ? 115  TYR B OH  1 
ATOM   5027 N N   . PHE B 2 116 ? 40.377  -47.325 12.972  1.00 83.65  ? 116  PHE B N   1 
ATOM   5028 C CA  . PHE B 2 116 ? 39.360  -48.245 13.449  1.00 89.85  ? 116  PHE B CA  1 
ATOM   5029 C C   . PHE B 2 116 ? 39.756  -49.679 13.723  1.00 91.36  ? 116  PHE B C   1 
ATOM   5030 O O   . PHE B 2 116 ? 38.922  -50.480 14.151  1.00 94.42  ? 116  PHE B O   1 
ATOM   5031 C CB  . PHE B 2 116 ? 38.140  -48.184 12.523  1.00 98.55  ? 116  PHE B CB  1 
ATOM   5032 C CG  . PHE B 2 116 ? 37.440  -46.825 12.524  1.00 112.99 ? 116  PHE B CG  1 
ATOM   5033 C CD1 . PHE B 2 116 ? 37.768  -45.838 13.468  1.00 111.66 ? 116  PHE B CD1 1 
ATOM   5034 C CD2 . PHE B 2 116 ? 36.450  -46.532 11.585  1.00 119.62 ? 116  PHE B CD2 1 
ATOM   5035 C CE1 . PHE B 2 116 ? 37.120  -44.583 13.473  1.00 109.82 ? 116  PHE B CE1 1 
ATOM   5036 C CE2 . PHE B 2 116 ? 35.797  -45.279 11.584  1.00 122.09 ? 116  PHE B CE2 1 
ATOM   5037 C CZ  . PHE B 2 116 ? 36.135  -44.306 12.529  1.00 117.63 ? 116  PHE B CZ  1 
ATOM   5038 N N   . SER B 2 117 ? 41.024  -50.005 13.506  1.00 90.46  ? 117  SER B N   1 
ATOM   5039 C CA  . SER B 2 117 ? 41.498  -51.355 13.772  1.00 82.66  ? 117  SER B CA  1 
ATOM   5040 C C   . SER B 2 117 ? 42.222  -51.369 15.117  1.00 83.60  ? 117  SER B C   1 
ATOM   5041 O O   . SER B 2 117 ? 42.596  -52.419 15.613  1.00 93.70  ? 117  SER B O   1 
ATOM   5042 C CB  . SER B 2 117 ? 42.443  -51.810 12.663  1.00 74.79  ? 117  SER B CB  1 
ATOM   5043 O OG  . SER B 2 117 ? 43.599  -50.995 12.625  1.00 79.22  ? 117  SER B OG  1 
ATOM   5044 N N   . VAL B 2 118 ? 42.402  -50.193 15.706  1.00 81.88  ? 118  VAL B N   1 
ATOM   5045 C CA  . VAL B 2 118 ? 43.094  -50.054 16.989  1.00 75.25  ? 118  VAL B CA  1 
ATOM   5046 C C   . VAL B 2 118 ? 42.139  -49.721 18.130  1.00 76.81  ? 118  VAL B C   1 
ATOM   5047 O O   . VAL B 2 118 ? 41.469  -48.688 18.095  1.00 80.37  ? 118  VAL B O   1 
ATOM   5048 C CB  . VAL B 2 118 ? 44.135  -48.906 16.944  1.00 67.64  ? 118  VAL B CB  1 
ATOM   5049 C CG1 . VAL B 2 118 ? 44.881  -48.813 18.277  1.00 67.06  ? 118  VAL B CG1 1 
ATOM   5050 C CG2 . VAL B 2 118 ? 45.087  -49.112 15.782  1.00 61.71  ? 118  VAL B CG2 1 
ATOM   5051 N N   . PRO B 2 119 ? 42.078  -50.575 19.168  1.00 72.91  ? 119  PRO B N   1 
ATOM   5052 C CA  . PRO B 2 119 ? 41.192  -50.331 20.309  1.00 72.20  ? 119  PRO B CA  1 
ATOM   5053 C C   . PRO B 2 119 ? 41.685  -49.151 21.154  1.00 76.77  ? 119  PRO B C   1 
ATOM   5054 O O   . PRO B 2 119 ? 42.892  -48.853 21.190  1.00 78.46  ? 119  PRO B O   1 
ATOM   5055 C CB  . PRO B 2 119 ? 41.257  -51.642 21.076  1.00 60.98  ? 119  PRO B CB  1 
ATOM   5056 C CG  . PRO B 2 119 ? 42.663  -52.008 20.902  1.00 75.17  ? 119  PRO B CG  1 
ATOM   5057 C CD  . PRO B 2 119 ? 42.864  -51.794 19.401  1.00 74.70  ? 119  PRO B CD  1 
ATOM   5058 N N   . LEU B 2 120 ? 40.737  -48.498 21.832  1.00 72.14  ? 120  LEU B N   1 
ATOM   5059 C CA  . LEU B 2 120 ? 41.006  -47.335 22.678  1.00 59.56  ? 120  LEU B CA  1 
ATOM   5060 C C   . LEU B 2 120 ? 41.007  -47.718 24.152  1.00 61.41  ? 120  LEU B C   1 
ATOM   5061 O O   . LEU B 2 120 ? 40.125  -48.467 24.598  1.00 60.84  ? 120  LEU B O   1 
ATOM   5062 C CB  . LEU B 2 120 ? 39.933  -46.259 22.447  1.00 51.07  ? 120  LEU B CB  1 
ATOM   5063 C CG  . LEU B 2 120 ? 39.976  -45.070 23.422  1.00 49.91  ? 120  LEU B CG  1 
ATOM   5064 C CD1 . LEU B 2 120 ? 41.066  -44.126 22.950  1.00 42.30  ? 120  LEU B CD1 1 
ATOM   5065 C CD2 . LEU B 2 120 ? 38.618  -44.340 23.522  1.00 23.95  ? 120  LEU B CD2 1 
ATOM   5066 N N   . ASP B 2 121 ? 41.993  -47.209 24.899  1.00 60.78  ? 121  ASP B N   1 
ATOM   5067 C CA  . ASP B 2 121 ? 42.087  -47.480 26.328  1.00 59.88  ? 121  ASP B CA  1 
ATOM   5068 C C   . ASP B 2 121 ? 40.681  -47.409 26.948  1.00 63.02  ? 121  ASP B C   1 
ATOM   5069 O O   . ASP B 2 121 ? 40.022  -46.369 26.908  1.00 69.61  ? 121  ASP B O   1 
ATOM   5070 C CB  . ASP B 2 121 ? 43.018  -46.461 26.977  1.00 65.78  ? 121  ASP B CB  1 
ATOM   5071 C CG  . ASP B 2 121 ? 43.058  -46.578 28.498  1.00 78.73  ? 121  ASP B CG  1 
ATOM   5072 O OD1 . ASP B 2 121 ? 42.267  -47.354 29.083  1.00 72.58  ? 121  ASP B OD1 1 
ATOM   5073 O OD2 . ASP B 2 121 ? 43.887  -45.872 29.113  1.00 79.85  ? 121  ASP B OD2 1 
ATOM   5074 N N   . GLU B 2 122 ? 40.233  -48.534 27.504  1.00 66.73  ? 122  GLU B N   1 
ATOM   5075 C CA  . GLU B 2 122 ? 38.906  -48.671 28.124  1.00 71.67  ? 122  GLU B CA  1 
ATOM   5076 C C   . GLU B 2 122 ? 38.537  -47.575 29.117  1.00 64.98  ? 122  GLU B C   1 
ATOM   5077 O O   . GLU B 2 122 ? 37.365  -47.239 29.284  1.00 52.88  ? 122  GLU B O   1 
ATOM   5078 C CB  . GLU B 2 122 ? 38.780  -50.031 28.838  1.00 89.96  ? 122  GLU B CB  1 
ATOM   5079 C CG  . GLU B 2 122 ? 38.803  -51.297 27.930  1.00 119.61 ? 122  GLU B CG  1 
ATOM   5080 C CD  . GLU B 2 122 ? 40.217  -51.805 27.533  1.00 136.06 ? 122  GLU B CD  1 
ATOM   5081 O OE1 . GLU B 2 122 ? 40.300  -52.834 26.815  1.00 130.67 ? 122  GLU B OE1 1 
ATOM   5082 O OE2 . GLU B 2 122 ? 41.239  -51.192 27.930  1.00 144.25 ? 122  GLU B OE2 1 
ATOM   5083 N N   . ASP B 2 123 ? 39.530  -47.012 29.783  1.00 65.86  ? 123  ASP B N   1 
ATOM   5084 C CA  . ASP B 2 123 ? 39.210  -45.986 30.737  1.00 70.50  ? 123  ASP B CA  1 
ATOM   5085 C C   . ASP B 2 123 ? 39.091  -44.601 30.171  1.00 66.60  ? 123  ASP B C   1 
ATOM   5086 O O   . ASP B 2 123 ? 38.736  -43.677 30.897  1.00 68.68  ? 123  ASP B O   1 
ATOM   5087 C CB  . ASP B 2 123 ? 40.203  -45.975 31.882  1.00 89.31  ? 123  ASP B CB  1 
ATOM   5088 C CG  . ASP B 2 123 ? 39.522  -46.206 33.206  1.00 120.17 ? 123  ASP B CG  1 
ATOM   5089 O OD1 . ASP B 2 123 ? 39.247  -47.380 33.530  1.00 132.42 ? 123  ASP B OD1 1 
ATOM   5090 O OD2 . ASP B 2 123 ? 39.226  -45.217 33.909  1.00 132.44 ? 123  ASP B OD2 1 
ATOM   5091 N N   . PHE B 2 124 ? 39.385  -44.439 28.888  1.00 64.65  ? 124  PHE B N   1 
ATOM   5092 C CA  . PHE B 2 124 ? 39.270  -43.119 28.276  1.00 60.15  ? 124  PHE B CA  1 
ATOM   5093 C C   . PHE B 2 124 ? 37.944  -43.024 27.536  1.00 52.01  ? 124  PHE B C   1 
ATOM   5094 O O   . PHE B 2 124 ? 37.324  -41.957 27.462  1.00 52.76  ? 124  PHE B O   1 
ATOM   5095 C CB  . PHE B 2 124 ? 40.407  -42.871 27.295  1.00 61.17  ? 124  PHE B CB  1 
ATOM   5096 C CG  . PHE B 2 124 ? 40.559  -41.427 26.917  1.00 78.04  ? 124  PHE B CG  1 
ATOM   5097 C CD1 . PHE B 2 124 ? 41.116  -40.516 27.816  1.00 81.19  ? 124  PHE B CD1 1 
ATOM   5098 C CD2 . PHE B 2 124 ? 40.141  -40.966 25.662  1.00 79.80  ? 124  PHE B CD2 1 
ATOM   5099 C CE1 . PHE B 2 124 ? 41.263  -39.151 27.470  1.00 78.53  ? 124  PHE B CE1 1 
ATOM   5100 C CE2 . PHE B 2 124 ? 40.277  -39.602 25.294  1.00 67.10  ? 124  PHE B CE2 1 
ATOM   5101 C CZ  . PHE B 2 124 ? 40.840  -38.697 26.201  1.00 74.05  ? 124  PHE B CZ  1 
ATOM   5102 N N   . ARG B 2 125 ? 37.518  -44.167 27.015  1.00 44.77  ? 125  ARG B N   1 
ATOM   5103 C CA  . ARG B 2 125 ? 36.285  -44.294 26.252  1.00 50.31  ? 125  ARG B CA  1 
ATOM   5104 C C   . ARG B 2 125 ? 35.128  -43.378 26.579  1.00 51.24  ? 125  ARG B C   1 
ATOM   5105 O O   . ARG B 2 125 ? 34.588  -42.725 25.684  1.00 45.24  ? 125  ARG B O   1 
ATOM   5106 C CB  . ARG B 2 125 ? 35.801  -45.736 26.313  1.00 42.01  ? 125  ARG B CB  1 
ATOM   5107 C CG  . ARG B 2 125 ? 36.835  -46.675 25.753  1.00 40.57  ? 125  ARG B CG  1 
ATOM   5108 C CD  . ARG B 2 125 ? 36.253  -48.028 25.393  1.00 50.96  ? 125  ARG B CD  1 
ATOM   5109 N NE  . ARG B 2 125 ? 37.332  -48.912 24.973  1.00 57.41  ? 125  ARG B NE  1 
ATOM   5110 C CZ  . ARG B 2 125 ? 37.179  -50.185 24.647  1.00 52.66  ? 125  ARG B CZ  1 
ATOM   5111 N NH1 . ARG B 2 125 ? 35.972  -50.748 24.681  1.00 60.07  ? 125  ARG B NH1 1 
ATOM   5112 N NH2 . ARG B 2 125 ? 38.248  -50.894 24.322  1.00 46.61  ? 125  ARG B NH2 1 
ATOM   5113 N N   . LYS B 2 126 ? 34.741  -43.341 27.851  1.00 58.19  ? 126  LYS B N   1 
ATOM   5114 C CA  . LYS B 2 126 ? 33.609  -42.516 28.289  1.00 55.50  ? 126  LYS B CA  1 
ATOM   5115 C C   . LYS B 2 126 ? 33.687  -41.075 27.826  1.00 52.50  ? 126  LYS B C   1 
ATOM   5116 O O   . LYS B 2 126 ? 32.658  -40.417 27.670  1.00 43.71  ? 126  LYS B O   1 
ATOM   5117 C CB  . LYS B 2 126 ? 33.469  -42.538 29.816  1.00 58.38  ? 126  LYS B CB  1 
ATOM   5118 C CG  . LYS B 2 126 ? 34.687  -42.072 30.620  1.00 59.26  ? 126  LYS B CG  1 
ATOM   5119 C CD  . LYS B 2 126 ? 34.345  -42.136 32.116  1.00 76.80  ? 126  LYS B CD  1 
ATOM   5120 C CE  . LYS B 2 126 ? 35.536  -41.849 33.034  1.00 81.53  ? 126  LYS B CE  1 
ATOM   5121 N NZ  . LYS B 2 126 ? 36.598  -42.895 32.927  1.00 90.50  ? 126  LYS B NZ  1 
ATOM   5122 N N   . TYR B 2 127 ? 34.908  -40.594 27.618  1.00 49.90  ? 127  TYR B N   1 
ATOM   5123 C CA  . TYR B 2 127 ? 35.133  -39.233 27.172  1.00 46.04  ? 127  TYR B CA  1 
ATOM   5124 C C   . TYR B 2 127 ? 34.730  -38.963 25.718  1.00 54.39  ? 127  TYR B C   1 
ATOM   5125 O O   . TYR B 2 127 ? 34.513  -37.817 25.319  1.00 62.09  ? 127  TYR B O   1 
ATOM   5126 C CB  . TYR B 2 127 ? 36.593  -38.895 27.359  1.00 36.57  ? 127  TYR B CB  1 
ATOM   5127 C CG  . TYR B 2 127 ? 37.021  -38.941 28.787  1.00 53.89  ? 127  TYR B CG  1 
ATOM   5128 C CD1 . TYR B 2 127 ? 36.244  -38.346 29.787  1.00 56.38  ? 127  TYR B CD1 1 
ATOM   5129 C CD2 . TYR B 2 127 ? 38.227  -39.525 29.141  1.00 63.12  ? 127  TYR B CD2 1 
ATOM   5130 C CE1 . TYR B 2 127 ? 36.665  -38.331 31.098  1.00 58.60  ? 127  TYR B CE1 1 
ATOM   5131 C CE2 . TYR B 2 127 ? 38.661  -39.516 30.449  1.00 64.61  ? 127  TYR B CE2 1 
ATOM   5132 C CZ  . TYR B 2 127 ? 37.880  -38.917 31.423  1.00 65.52  ? 127  TYR B CZ  1 
ATOM   5133 O OH  . TYR B 2 127 ? 38.336  -38.892 32.722  1.00 74.60  ? 127  TYR B OH  1 
ATOM   5134 N N   . THR B 2 128 ? 34.634  -40.015 24.923  1.00 48.05  ? 128  THR B N   1 
ATOM   5135 C CA  . THR B 2 128 ? 34.247  -39.855 23.538  1.00 44.09  ? 128  THR B CA  1 
ATOM   5136 C C   . THR B 2 128 ? 32.726  -39.939 23.388  1.00 45.15  ? 128  THR B C   1 
ATOM   5137 O O   . THR B 2 128 ? 32.205  -40.158 22.306  1.00 42.08  ? 128  THR B O   1 
ATOM   5138 C CB  . THR B 2 128 ? 34.892  -40.949 22.675  1.00 40.73  ? 128  THR B CB  1 
ATOM   5139 O OG1 . THR B 2 128 ? 34.273  -42.210 22.947  1.00 46.50  ? 128  THR B OG1 1 
ATOM   5140 C CG2 . THR B 2 128 ? 36.358  -41.064 22.997  1.00 28.58  ? 128  THR B CG2 1 
ATOM   5141 N N   . ALA B 2 129 ? 31.994  -39.757 24.468  1.00 40.46  ? 129  ALA B N   1 
ATOM   5142 C CA  . ALA B 2 129 ? 30.566  -39.886 24.331  1.00 41.42  ? 129  ALA B CA  1 
ATOM   5143 C C   . ALA B 2 129 ? 30.033  -38.806 23.473  1.00 44.12  ? 129  ALA B C   1 
ATOM   5144 O O   . ALA B 2 129 ? 30.439  -37.650 23.596  1.00 42.37  ? 129  ALA B O   1 
ATOM   5145 C CB  . ALA B 2 129 ? 29.887  -39.836 25.665  1.00 35.79  ? 129  ALA B CB  1 
ATOM   5146 N N   . PHE B 2 130 ? 29.115  -39.205 22.605  1.00 39.96  ? 130  PHE B N   1 
ATOM   5147 C CA  . PHE B 2 130 ? 28.457  -38.280 21.720  1.00 38.28  ? 130  PHE B CA  1 
ATOM   5148 C C   . PHE B 2 130 ? 27.026  -38.705 21.598  1.00 35.98  ? 130  PHE B C   1 
ATOM   5149 O O   . PHE B 2 130 ? 26.656  -39.817 21.965  1.00 35.15  ? 130  PHE B O   1 
ATOM   5150 C CB  . PHE B 2 130 ? 29.143  -38.258 20.366  1.00 43.92  ? 130  PHE B CB  1 
ATOM   5151 C CG  . PHE B 2 130 ? 29.035  -39.544 19.595  1.00 45.12  ? 130  PHE B CG  1 
ATOM   5152 C CD1 . PHE B 2 130 ? 27.898  -39.837 18.822  1.00 38.16  ? 130  PHE B CD1 1 
ATOM   5153 C CD2 . PHE B 2 130 ? 30.087  -40.437 19.585  1.00 39.45  ? 130  PHE B CD2 1 
ATOM   5154 C CE1 . PHE B 2 130 ? 27.835  -41.015 18.045  1.00 30.63  ? 130  PHE B CE1 1 
ATOM   5155 C CE2 . PHE B 2 130 ? 30.026  -41.602 18.818  1.00 42.38  ? 130  PHE B CE2 1 
ATOM   5156 C CZ  . PHE B 2 130 ? 28.897  -41.892 18.045  1.00 37.88  ? 130  PHE B CZ  1 
ATOM   5157 N N   . THR B 2 131 ? 26.213  -37.817 21.065  1.00 43.97  ? 131  THR B N   1 
ATOM   5158 C CA  . THR B 2 131 ? 24.808  -38.117 20.965  1.00 42.45  ? 131  THR B CA  1 
ATOM   5159 C C   . THR B 2 131 ? 24.207  -37.842 19.611  1.00 44.46  ? 131  THR B C   1 
ATOM   5160 O O   . THR B 2 131 ? 24.634  -36.932 18.917  1.00 51.65  ? 131  THR B O   1 
ATOM   5161 C CB  . THR B 2 131 ? 24.059  -37.288 21.974  1.00 35.34  ? 131  THR B CB  1 
ATOM   5162 O OG1 . THR B 2 131 ? 24.621  -37.534 23.270  1.00 57.03  ? 131  THR B OG1 1 
ATOM   5163 C CG2 . THR B 2 131 ? 22.565  -37.632 21.949  1.00 14.99  ? 131  THR B CG2 1 
ATOM   5164 N N   . ILE B 2 132 ? 23.212  -38.636 19.240  1.00 40.01  ? 132  ILE B N   1 
ATOM   5165 C CA  . ILE B 2 132 ? 22.519  -38.440 17.982  1.00 41.35  ? 132  ILE B CA  1 
ATOM   5166 C C   . ILE B 2 132 ? 21.163  -37.931 18.412  1.00 43.70  ? 132  ILE B C   1 
ATOM   5167 O O   . ILE B 2 132 ? 20.419  -38.649 19.080  1.00 46.13  ? 132  ILE B O   1 
ATOM   5168 C CB  . ILE B 2 132 ? 22.313  -39.744 17.244  1.00 43.57  ? 132  ILE B CB  1 
ATOM   5169 C CG1 . ILE B 2 132 ? 23.655  -40.327 16.817  1.00 33.19  ? 132  ILE B CG1 1 
ATOM   5170 C CG2 . ILE B 2 132 ? 21.444  -39.499 16.036  1.00 26.72  ? 132  ILE B CG2 1 
ATOM   5171 C CD1 . ILE B 2 132 ? 23.494  -41.581 16.014  1.00 47.30  ? 132  ILE B CD1 1 
ATOM   5172 N N   . PRO B 2 133 ? 20.807  -36.703 18.019  1.00 38.30  ? 133  PRO B N   1 
ATOM   5173 C CA  . PRO B 2 133 ? 19.523  -36.150 18.420  1.00 34.51  ? 133  PRO B CA  1 
ATOM   5174 C C   . PRO B 2 133 ? 18.350  -36.676 17.655  1.00 41.61  ? 133  PRO B C   1 
ATOM   5175 O O   . PRO B 2 133 ? 18.503  -37.396 16.673  1.00 43.15  ? 133  PRO B O   1 
ATOM   5176 C CB  . PRO B 2 133 ? 19.718  -34.660 18.197  1.00 43.28  ? 133  PRO B CB  1 
ATOM   5177 C CG  . PRO B 2 133 ? 20.485  -34.652 16.921  1.00 51.37  ? 133  PRO B CG  1 
ATOM   5178 C CD  . PRO B 2 133 ? 21.525  -35.753 17.153  1.00 49.84  ? 133  PRO B CD  1 
ATOM   5179 N N   . SER B 2 134 ? 17.169  -36.304 18.141  1.00 42.01  ? 134  SER B N   1 
ATOM   5180 C CA  . SER B 2 134 ? 15.915  -36.683 17.517  1.00 46.61  ? 134  SER B CA  1 
ATOM   5181 C C   . SER B 2 134 ? 15.210  -35.371 17.174  1.00 47.70  ? 134  SER B C   1 
ATOM   5182 O O   . SER B 2 134 ? 15.462  -34.309 17.770  1.00 49.43  ? 134  SER B O   1 
ATOM   5183 C CB  . SER B 2 134 ? 15.042  -37.500 18.477  1.00 34.32  ? 134  SER B CB  1 
ATOM   5184 O OG  . SER B 2 134 ? 14.483  -36.653 19.469  1.00 51.30  ? 134  SER B OG  1 
ATOM   5185 N N   . ILE B 2 135 ? 14.308  -35.452 16.218  1.00 42.65  ? 135  ILE B N   1 
ATOM   5186 C CA  . ILE B 2 135 ? 13.614  -34.265 15.810  1.00 40.18  ? 135  ILE B CA  1 
ATOM   5187 C C   . ILE B 2 135 ? 12.533  -33.911 16.780  1.00 35.41  ? 135  ILE B C   1 
ATOM   5188 O O   . ILE B 2 135 ? 11.748  -34.752 17.181  1.00 37.52  ? 135  ILE B O   1 
ATOM   5189 C CB  . ILE B 2 135 ? 13.057  -34.433 14.389  1.00 41.87  ? 135  ILE B CB  1 
ATOM   5190 C CG1 . ILE B 2 135 ? 14.250  -34.422 13.417  1.00 36.21  ? 135  ILE B CG1 1 
ATOM   5191 C CG2 . ILE B 2 135 ? 11.989  -33.349 14.093  1.00 23.85  ? 135  ILE B CG2 1 
ATOM   5192 C CD1 . ILE B 2 135 ? 13.898  -34.719 12.003  1.00 44.51  ? 135  ILE B CD1 1 
ATOM   5193 N N   . ASN B 2 136 ? 12.541  -32.643 17.163  1.00 33.55  ? 136  ASN B N   1 
ATOM   5194 C CA  . ASN B 2 136 ? 11.580  -32.087 18.087  1.00 33.80  ? 136  ASN B CA  1 
ATOM   5195 C C   . ASN B 2 136 ? 11.589  -32.776 19.461  1.00 40.13  ? 136  ASN B C   1 
ATOM   5196 O O   . ASN B 2 136 ? 10.628  -32.701 20.225  1.00 30.63  ? 136  ASN B O   1 
ATOM   5197 C CB  . ASN B 2 136 ? 10.196  -32.128 17.450  1.00 13.78  ? 136  ASN B CB  1 
ATOM   5198 C CG  . ASN B 2 136 ? 9.219   -31.222 18.168  1.00 47.37  ? 136  ASN B CG  1 
ATOM   5199 O OD1 . ASN B 2 136 ? 9.630   -30.277 18.851  1.00 64.24  ? 136  ASN B OD1 1 
ATOM   5200 N ND2 . ASN B 2 136 ? 7.926   -31.490 18.016  1.00 39.41  ? 136  ASN B ND2 1 
ATOM   5201 N N   . ASN B 2 137 ? 12.697  -33.441 19.772  1.00 44.14  ? 137  ASN B N   1 
ATOM   5202 C CA  . ASN B 2 137 ? 12.826  -34.112 21.059  1.00 48.80  ? 137  ASN B CA  1 
ATOM   5203 C C   . ASN B 2 137 ? 11.765  -35.127 21.329  1.00 53.15  ? 137  ASN B C   1 
ATOM   5204 O O   . ASN B 2 137 ? 11.393  -35.352 22.491  1.00 57.71  ? 137  ASN B O   1 
ATOM   5205 C CB  . ASN B 2 137 ? 12.756  -33.113 22.183  1.00 46.07  ? 137  ASN B CB  1 
ATOM   5206 C CG  . ASN B 2 137 ? 13.914  -32.234 22.194  1.00 56.54  ? 137  ASN B CG  1 
ATOM   5207 O OD1 . ASN B 2 137 ? 15.050  -32.707 22.251  1.00 73.84  ? 137  ASN B OD1 1 
ATOM   5208 N ND2 . ASN B 2 137 ? 13.667  -30.935 22.122  1.00 63.75  ? 137  ASN B ND2 1 
ATOM   5209 N N   . GLU B 2 138 ? 11.271  -35.741 20.272  1.00 48.29  ? 138  GLU B N   1 
ATOM   5210 C CA  . GLU B 2 138 ? 10.238  -36.734 20.428  1.00 49.35  ? 138  GLU B CA  1 
ATOM   5211 C C   . GLU B 2 138 ? 10.795  -38.077 20.980  1.00 48.75  ? 138  GLU B C   1 
ATOM   5212 O O   . GLU B 2 138 ? 10.046  -38.933 21.483  1.00 51.43  ? 138  GLU B O   1 
ATOM   5213 C CB  . GLU B 2 138 ? 9.524   -36.869 19.088  1.00 69.78  ? 138  GLU B CB  1 
ATOM   5214 C CG  . GLU B 2 138 ? 9.170   -35.471 18.477  1.00 97.36  ? 138  GLU B CG  1 
ATOM   5215 C CD  . GLU B 2 138 ? 8.118   -35.487 17.326  1.00 114.72 ? 138  GLU B CD  1 
ATOM   5216 O OE1 . GLU B 2 138 ? 7.963   -34.438 16.647  1.00 122.71 ? 138  GLU B OE1 1 
ATOM   5217 O OE2 . GLU B 2 138 ? 7.439   -36.523 17.108  1.00 121.08 ? 138  GLU B OE2 1 
ATOM   5218 N N   . THR B 2 139 ? 12.112  -38.253 20.922  1.00 42.81  ? 139  THR B N   1 
ATOM   5219 C CA  . THR B 2 139 ? 12.728  -39.462 21.469  1.00 41.77  ? 139  THR B CA  1 
ATOM   5220 C C   . THR B 2 139 ? 13.962  -39.027 22.233  1.00 47.97  ? 139  THR B C   1 
ATOM   5221 O O   . THR B 2 139 ? 14.606  -38.037 21.913  1.00 46.16  ? 139  THR B O   1 
ATOM   5222 C CB  . THR B 2 139 ? 13.132  -40.454 20.380  1.00 41.71  ? 139  THR B CB  1 
ATOM   5223 O OG1 . THR B 2 139 ? 14.228  -39.933 19.616  1.00 60.08  ? 139  THR B OG1 1 
ATOM   5224 C CG2 . THR B 2 139 ? 11.971  -40.682 19.453  1.00 42.46  ? 139  THR B CG2 1 
ATOM   5225 N N   . PRO B 2 140 ? 14.312  -39.768 23.262  1.00 59.68  ? 140  PRO B N   1 
ATOM   5226 C CA  . PRO B 2 140 ? 15.479  -39.427 24.066  1.00 67.25  ? 140  PRO B CA  1 
ATOM   5227 C C   . PRO B 2 140 ? 16.711  -38.991 23.260  1.00 74.33  ? 140  PRO B C   1 
ATOM   5228 O O   . PRO B 2 140 ? 17.243  -37.893 23.475  1.00 81.90  ? 140  PRO B O   1 
ATOM   5229 C CB  . PRO B 2 140 ? 15.723  -40.709 24.854  1.00 66.44  ? 140  PRO B CB  1 
ATOM   5230 C CG  . PRO B 2 140 ? 14.359  -41.299 24.975  1.00 65.92  ? 140  PRO B CG  1 
ATOM   5231 C CD  . PRO B 2 140 ? 13.816  -41.110 23.592  1.00 64.05  ? 140  PRO B CD  1 
ATOM   5232 N N   . GLY B 2 141 ? 17.158  -39.847 22.341  1.00 65.62  ? 141  GLY B N   1 
ATOM   5233 C CA  . GLY B 2 141 ? 18.342  -39.538 21.552  1.00 62.06  ? 141  GLY B CA  1 
ATOM   5234 C C   . GLY B 2 141 ? 19.423  -40.595 21.732  1.00 61.67  ? 141  GLY B C   1 
ATOM   5235 O O   . GLY B 2 141 ? 19.864  -40.857 22.846  1.00 66.16  ? 141  GLY B O   1 
ATOM   5236 N N   . ILE B 2 142 ? 19.875  -41.201 20.642  1.00 61.96  ? 142  ILE B N   1 
ATOM   5237 C CA  . ILE B 2 142 ? 20.874  -42.244 20.757  1.00 51.60  ? 142  ILE B CA  1 
ATOM   5238 C C   . ILE B 2 142 ? 22.223  -41.791 21.237  1.00 45.53  ? 142  ILE B C   1 
ATOM   5239 O O   . ILE B 2 142 ? 22.814  -40.847 20.710  1.00 40.68  ? 142  ILE B O   1 
ATOM   5240 C CB  . ILE B 2 142 ? 21.094  -42.963 19.457  1.00 50.57  ? 142  ILE B CB  1 
ATOM   5241 C CG1 . ILE B 2 142 ? 19.772  -43.525 18.948  1.00 47.11  ? 142  ILE B CG1 1 
ATOM   5242 C CG2 . ILE B 2 142 ? 22.091  -44.062 19.662  1.00 62.40  ? 142  ILE B CG2 1 
ATOM   5243 C CD1 . ILE B 2 142 ? 18.958  -42.499 18.198  1.00 36.34  ? 142  ILE B CD1 1 
ATOM   5244 N N   . ARG B 2 143 ? 22.723  -42.535 22.214  1.00 41.76  ? 143  ARG B N   1 
ATOM   5245 C CA  . ARG B 2 143 ? 23.999  -42.242 22.826  1.00 39.15  ? 143  ARG B CA  1 
ATOM   5246 C C   . ARG B 2 143 ? 25.032  -43.342 22.698  1.00 35.53  ? 143  ARG B C   1 
ATOM   5247 O O   . ARG B 2 143 ? 24.727  -44.523 22.903  1.00 30.37  ? 143  ARG B O   1 
ATOM   5248 C CB  . ARG B 2 143 ? 23.758  -41.947 24.286  1.00 47.05  ? 143  ARG B CB  1 
ATOM   5249 C CG  . ARG B 2 143 ? 22.878  -40.743 24.482  1.00 41.13  ? 143  ARG B CG  1 
ATOM   5250 C CD  . ARG B 2 143 ? 23.744  -39.579 24.858  1.00 47.87  ? 143  ARG B CD  1 
ATOM   5251 N NE  . ARG B 2 143 ? 24.394  -39.822 26.145  1.00 59.22  ? 143  ARG B NE  1 
ATOM   5252 C CZ  . ARG B 2 143 ? 25.399  -39.090 26.612  1.00 57.65  ? 143  ARG B CZ  1 
ATOM   5253 N NH1 . ARG B 2 143 ? 25.853  -38.075 25.876  1.00 51.66  ? 143  ARG B NH1 1 
ATOM   5254 N NH2 . ARG B 2 143 ? 25.948  -39.376 27.796  1.00 57.06  ? 143  ARG B NH2 1 
ATOM   5255 N N   . TYR B 2 144 ? 26.262  -42.926 22.390  1.00 32.20  ? 144  TYR B N   1 
ATOM   5256 C CA  . TYR B 2 144 ? 27.389  -43.840 22.207  1.00 38.17  ? 144  TYR B CA  1 
ATOM   5257 C C   . TYR B 2 144 ? 28.716  -43.293 22.647  1.00 43.34  ? 144  TYR B C   1 
ATOM   5258 O O   . TYR B 2 144 ? 28.904  -42.079 22.813  1.00 43.15  ? 144  TYR B O   1 
ATOM   5259 C CB  . TYR B 2 144 ? 27.662  -44.130 20.745  1.00 44.30  ? 144  TYR B CB  1 
ATOM   5260 C CG  . TYR B 2 144 ? 26.554  -44.705 19.956  1.00 53.51  ? 144  TYR B CG  1 
ATOM   5261 C CD1 . TYR B 2 144 ? 26.271  -46.061 20.017  1.00 56.32  ? 144  TYR B CD1 1 
ATOM   5262 C CD2 . TYR B 2 144 ? 25.844  -43.908 19.059  1.00 52.95  ? 144  TYR B CD2 1 
ATOM   5263 C CE1 . TYR B 2 144 ? 25.308  -46.617 19.184  1.00 75.26  ? 144  TYR B CE1 1 
ATOM   5264 C CE2 . TYR B 2 144 ? 24.885  -44.449 18.224  1.00 72.09  ? 144  TYR B CE2 1 
ATOM   5265 C CZ  . TYR B 2 144 ? 24.620  -45.804 18.284  1.00 82.25  ? 144  TYR B CZ  1 
ATOM   5266 O OH  . TYR B 2 144 ? 23.694  -46.350 17.421  1.00 97.15  ? 144  TYR B OH  1 
ATOM   5267 N N   . GLN B 2 145 ? 29.657  -44.230 22.729  1.00 39.91  ? 145  GLN B N   1 
ATOM   5268 C CA  . GLN B 2 145 ? 31.037  -43.919 23.018  1.00 42.42  ? 145  GLN B CA  1 
ATOM   5269 C C   . GLN B 2 145 ? 31.812  -44.870 22.148  1.00 48.23  ? 145  GLN B C   1 
ATOM   5270 O O   . GLN B 2 145 ? 31.325  -45.949 21.795  1.00 47.80  ? 145  GLN B O   1 
ATOM   5271 C CB  . GLN B 2 145 ? 31.402  -44.139 24.471  1.00 42.20  ? 145  GLN B CB  1 
ATOM   5272 C CG  . GLN B 2 145 ? 31.452  -45.561 24.891  1.00 49.67  ? 145  GLN B CG  1 
ATOM   5273 C CD  . GLN B 2 145 ? 31.896  -45.682 26.327  1.00 49.50  ? 145  GLN B CD  1 
ATOM   5274 O OE1 . GLN B 2 145 ? 31.407  -44.961 27.195  1.00 53.81  ? 145  GLN B OE1 1 
ATOM   5275 N NE2 . GLN B 2 145 ? 32.822  -46.591 26.589  1.00 51.75  ? 145  GLN B NE2 1 
ATOM   5276 N N   . TYR B 2 146 ? 33.008  -44.433 21.780  1.00 55.66  ? 146  TYR B N   1 
ATOM   5277 C CA  . TYR B 2 146 ? 33.905  -45.199 20.928  1.00 65.90  ? 146  TYR B CA  1 
ATOM   5278 C C   . TYR B 2 146 ? 34.605  -46.298 21.726  1.00 72.44  ? 146  TYR B C   1 
ATOM   5279 O O   . TYR B 2 146 ? 34.785  -46.174 22.947  1.00 74.06  ? 146  TYR B O   1 
ATOM   5280 C CB  . TYR B 2 146 ? 34.971  -44.270 20.304  1.00 70.64  ? 146  TYR B CB  1 
ATOM   5281 C CG  . TYR B 2 146 ? 34.554  -43.547 19.035  1.00 78.89  ? 146  TYR B CG  1 
ATOM   5282 C CD1 . TYR B 2 146 ? 33.748  -42.405 19.075  1.00 83.03  ? 146  TYR B CD1 1 
ATOM   5283 C CD2 . TYR B 2 146 ? 34.958  -44.019 17.789  1.00 84.82  ? 146  TYR B CD2 1 
ATOM   5284 C CE1 . TYR B 2 146 ? 33.356  -41.753 17.891  1.00 91.01  ? 146  TYR B CE1 1 
ATOM   5285 C CE2 . TYR B 2 146 ? 34.572  -43.380 16.602  1.00 95.07  ? 146  TYR B CE2 1 
ATOM   5286 C CZ  . TYR B 2 146 ? 33.775  -42.251 16.653  1.00 98.66  ? 146  TYR B CZ  1 
ATOM   5287 O OH  . TYR B 2 146 ? 33.418  -41.639 15.462  1.00 102.33 ? 146  TYR B OH  1 
ATOM   5288 N N   . ASN B 2 147 ? 34.994  -47.365 21.023  1.00 72.47  ? 147  ASN B N   1 
ATOM   5289 C CA  . ASN B 2 147 ? 35.714  -48.497 21.613  1.00 62.50  ? 147  ASN B CA  1 
ATOM   5290 C C   . ASN B 2 147 ? 37.100  -48.535 20.966  1.00 61.24  ? 147  ASN B C   1 
ATOM   5291 O O   . ASN B 2 147 ? 38.062  -49.021 21.566  1.00 58.63  ? 147  ASN B O   1 
ATOM   5292 C CB  . ASN B 2 147 ? 34.988  -49.809 21.319  1.00 69.00  ? 147  ASN B CB  1 
ATOM   5293 C CG  . ASN B 2 147 ? 33.621  -49.886 21.981  1.00 73.45  ? 147  ASN B CG  1 
ATOM   5294 O OD1 . ASN B 2 147 ? 32.623  -50.263 21.340  1.00 77.78  ? 147  ASN B OD1 1 
ATOM   5295 N ND2 . ASN B 2 147 ? 33.566  -49.544 23.273  1.00 69.25  ? 147  ASN B ND2 1 
ATOM   5296 N N   . VAL B 2 148 ? 37.169  -48.007 19.738  1.00 61.46  ? 148  VAL B N   1 
ATOM   5297 C CA  . VAL B 2 148 ? 38.390  -47.936 18.923  1.00 58.75  ? 148  VAL B CA  1 
ATOM   5298 C C   . VAL B 2 148 ? 38.844  -46.472 18.835  1.00 58.73  ? 148  VAL B C   1 
ATOM   5299 O O   . VAL B 2 148 ? 38.112  -45.585 19.243  1.00 68.48  ? 148  VAL B O   1 
ATOM   5300 C CB  . VAL B 2 148 ? 38.089  -48.416 17.505  1.00 58.64  ? 148  VAL B CB  1 
ATOM   5301 C CG1 . VAL B 2 148 ? 37.412  -49.781 17.541  1.00 53.43  ? 148  VAL B CG1 1 
ATOM   5302 C CG2 . VAL B 2 148 ? 37.174  -47.417 16.830  1.00 62.91  ? 148  VAL B CG2 1 
ATOM   5303 N N   . LEU B 2 149 ? 40.040  -46.207 18.315  1.00 57.93  ? 149  LEU B N   1 
ATOM   5304 C CA  . LEU B 2 149 ? 40.489  -44.817 18.186  1.00 61.84  ? 149  LEU B CA  1 
ATOM   5305 C C   . LEU B 2 149 ? 39.484  -44.079 17.262  1.00 67.65  ? 149  LEU B C   1 
ATOM   5306 O O   . LEU B 2 149 ? 39.129  -44.590 16.197  1.00 63.20  ? 149  LEU B O   1 
ATOM   5307 C CB  . LEU B 2 149 ? 41.892  -44.776 17.566  1.00 58.82  ? 149  LEU B CB  1 
ATOM   5308 C CG  . LEU B 2 149 ? 43.027  -45.560 18.237  1.00 51.74  ? 149  LEU B CG  1 
ATOM   5309 C CD1 . LEU B 2 149 ? 44.297  -45.394 17.439  1.00 61.23  ? 149  LEU B CD1 1 
ATOM   5310 C CD2 . LEU B 2 149 ? 43.262  -45.050 19.628  1.00 49.52  ? 149  LEU B CD2 1 
ATOM   5311 N N   . PRO B 2 150 ? 38.994  -42.882 17.664  1.00 73.39  ? 150  PRO B N   1 
ATOM   5312 C CA  . PRO B 2 150 ? 38.040  -42.161 16.807  1.00 70.82  ? 150  PRO B CA  1 
ATOM   5313 C C   . PRO B 2 150 ? 38.696  -41.134 15.875  1.00 70.02  ? 150  PRO B C   1 
ATOM   5314 O O   . PRO B 2 150 ? 39.683  -40.474 16.237  1.00 55.38  ? 150  PRO B O   1 
ATOM   5315 C CB  . PRO B 2 150 ? 37.104  -41.501 17.819  1.00 56.53  ? 150  PRO B CB  1 
ATOM   5316 C CG  . PRO B 2 150 ? 38.051  -41.066 18.855  1.00 56.50  ? 150  PRO B CG  1 
ATOM   5317 C CD  . PRO B 2 150 ? 39.039  -42.258 19.001  1.00 68.88  ? 150  PRO B CD  1 
ATOM   5318 N N   . GLN B 2 151 ? 38.132  -41.015 14.673  1.00 76.87  ? 151  GLN B N   1 
ATOM   5319 C CA  . GLN B 2 151 ? 38.623  -40.072 13.669  1.00 74.19  ? 151  GLN B CA  1 
ATOM   5320 C C   . GLN B 2 151 ? 38.444  -38.658 14.229  1.00 69.34  ? 151  GLN B C   1 
ATOM   5321 O O   . GLN B 2 151 ? 37.381  -38.334 14.749  1.00 70.41  ? 151  GLN B O   1 
ATOM   5322 C CB  . GLN B 2 151 ? 37.811  -40.219 12.371  1.00 79.47  ? 151  GLN B CB  1 
ATOM   5323 C CG  . GLN B 2 151 ? 38.036  -41.515 11.583  1.00 89.70  ? 151  GLN B CG  1 
ATOM   5324 C CD  . GLN B 2 151 ? 37.003  -41.725 10.470  1.00 89.45  ? 151  GLN B CD  1 
ATOM   5325 O OE1 . GLN B 2 151 ? 37.297  -42.324 9.431   1.00 80.30  ? 151  GLN B OE1 1 
ATOM   5326 N NE2 . GLN B 2 151 ? 35.785  -41.244 10.696  1.00 94.10  ? 151  GLN B NE2 1 
ATOM   5327 N N   . GLY B 2 152 ? 39.475  -37.826 14.149  1.00 63.32  ? 152  GLY B N   1 
ATOM   5328 C CA  . GLY B 2 152 ? 39.330  -36.471 14.649  1.00 61.33  ? 152  GLY B CA  1 
ATOM   5329 C C   . GLY B 2 152 ? 39.906  -36.197 16.023  1.00 57.79  ? 152  GLY B C   1 
ATOM   5330 O O   . GLY B 2 152 ? 40.054  -35.030 16.428  1.00 49.10  ? 152  GLY B O   1 
ATOM   5331 N N   . TRP B 2 153 ? 40.233  -37.268 16.741  1.00 61.37  ? 153  TRP B N   1 
ATOM   5332 C CA  . TRP B 2 153 ? 40.808  -37.141 18.077  1.00 61.50  ? 153  TRP B CA  1 
ATOM   5333 C C   . TRP B 2 153 ? 42.303  -36.960 17.977  1.00 62.13  ? 153  TRP B C   1 
ATOM   5334 O O   . TRP B 2 153 ? 42.967  -37.715 17.266  1.00 70.95  ? 153  TRP B O   1 
ATOM   5335 C CB  . TRP B 2 153 ? 40.519  -38.387 18.900  1.00 59.06  ? 153  TRP B CB  1 
ATOM   5336 C CG  . TRP B 2 153 ? 41.124  -38.333 20.274  1.00 67.99  ? 153  TRP B CG  1 
ATOM   5337 C CD1 . TRP B 2 153 ? 41.080  -37.287 21.169  1.00 71.54  ? 153  TRP B CD1 1 
ATOM   5338 C CD2 . TRP B 2 153 ? 41.840  -39.381 20.923  1.00 72.86  ? 153  TRP B CD2 1 
ATOM   5339 N NE1 . TRP B 2 153 ? 41.729  -37.630 22.340  1.00 68.14  ? 153  TRP B NE1 1 
ATOM   5340 C CE2 . TRP B 2 153 ? 42.206  -38.907 22.214  1.00 68.15  ? 153  TRP B CE2 1 
ATOM   5341 C CE3 . TRP B 2 153 ? 42.209  -40.676 20.543  1.00 64.48  ? 153  TRP B CE3 1 
ATOM   5342 C CZ2 . TRP B 2 153 ? 42.924  -39.685 23.115  1.00 61.17  ? 153  TRP B CZ2 1 
ATOM   5343 C CZ3 . TRP B 2 153 ? 42.917  -41.444 21.438  1.00 62.27  ? 153  TRP B CZ3 1 
ATOM   5344 C CH2 . TRP B 2 153 ? 43.271  -40.947 22.712  1.00 63.05  ? 153  TRP B CH2 1 
ATOM   5345 N N   . LYS B 2 154 ? 42.845  -35.980 18.689  1.00 52.84  ? 154  LYS B N   1 
ATOM   5346 C CA  . LYS B 2 154 ? 44.278  -35.770 18.595  1.00 60.24  ? 154  LYS B CA  1 
ATOM   5347 C C   . LYS B 2 154 ? 45.094  -36.990 19.053  1.00 72.08  ? 154  LYS B C   1 
ATOM   5348 O O   . LYS B 2 154 ? 46.249  -37.152 18.660  1.00 83.57  ? 154  LYS B O   1 
ATOM   5349 C CB  . LYS B 2 154 ? 44.704  -34.514 19.368  1.00 53.58  ? 154  LYS B CB  1 
ATOM   5350 C CG  . LYS B 2 154 ? 45.306  -34.752 20.750  1.00 54.17  ? 154  LYS B CG  1 
ATOM   5351 C CD  . LYS B 2 154 ? 46.103  -33.520 21.184  1.00 67.23  ? 154  LYS B CD  1 
ATOM   5352 C CE  . LYS B 2 154 ? 46.468  -33.553 22.663  1.00 74.62  ? 154  LYS B CE  1 
ATOM   5353 N NZ  . LYS B 2 154 ? 47.267  -32.352 23.065  1.00 78.95  ? 154  LYS B NZ  1 
ATOM   5354 N N   . GLY B 2 155 ? 44.501  -37.863 19.858  1.00 72.50  ? 155  GLY B N   1 
ATOM   5355 C CA  . GLY B 2 155 ? 45.241  -39.025 20.323  1.00 65.27  ? 155  GLY B CA  1 
ATOM   5356 C C   . GLY B 2 155 ? 45.432  -40.098 19.267  1.00 61.27  ? 155  GLY B C   1 
ATOM   5357 O O   . GLY B 2 155 ? 46.479  -40.745 19.218  1.00 61.07  ? 155  GLY B O   1 
ATOM   5358 N N   . SER B 2 156 ? 44.435  -40.267 18.404  1.00 56.18  ? 156  SER B N   1 
ATOM   5359 C CA  . SER B 2 156 ? 44.475  -41.305 17.377  1.00 62.19  ? 156  SER B CA  1 
ATOM   5360 C C   . SER B 2 156 ? 45.693  -41.387 16.442  1.00 68.80  ? 156  SER B C   1 
ATOM   5361 O O   . SER B 2 156 ? 46.170  -42.479 16.145  1.00 70.71  ? 156  SER B O   1 
ATOM   5362 C CB  . SER B 2 156 ? 43.194  -41.241 16.546  1.00 61.30  ? 156  SER B CB  1 
ATOM   5363 O OG  . SER B 2 156 ? 42.059  -41.180 17.393  1.00 65.37  ? 156  SER B OG  1 
ATOM   5364 N N   . PRO B 2 157 ? 46.210  -40.246 15.961  1.00 74.32  ? 157  PRO B N   1 
ATOM   5365 C CA  . PRO B 2 157 ? 47.371  -40.314 15.060  1.00 76.29  ? 157  PRO B CA  1 
ATOM   5366 C C   . PRO B 2 157 ? 48.635  -40.699 15.808  1.00 73.51  ? 157  PRO B C   1 
ATOM   5367 O O   . PRO B 2 157 ? 49.452  -41.494 15.333  1.00 70.93  ? 157  PRO B O   1 
ATOM   5368 C CB  . PRO B 2 157 ? 47.470  -38.892 14.500  1.00 76.84  ? 157  PRO B CB  1 
ATOM   5369 C CG  . PRO B 2 157 ? 46.088  -38.324 14.691  1.00 78.53  ? 157  PRO B CG  1 
ATOM   5370 C CD  . PRO B 2 157 ? 45.693  -38.872 16.041  1.00 78.50  ? 157  PRO B CD  1 
ATOM   5371 N N   . ALA B 2 158 ? 48.779  -40.094 16.980  1.00 71.03  ? 158  ALA B N   1 
ATOM   5372 C CA  . ALA B 2 158 ? 49.918  -40.325 17.840  1.00 72.31  ? 158  ALA B CA  1 
ATOM   5373 C C   . ALA B 2 158 ? 49.928  -41.795 18.197  1.00 77.75  ? 158  ALA B C   1 
ATOM   5374 O O   . ALA B 2 158 ? 50.919  -42.485 17.989  1.00 88.99  ? 158  ALA B O   1 
ATOM   5375 C CB  . ALA B 2 158 ? 49.806  -39.467 19.104  1.00 64.33  ? 158  ALA B CB  1 
ATOM   5376 N N   . ILE B 2 159 ? 48.811  -42.279 18.719  1.00 73.91  ? 159  ILE B N   1 
ATOM   5377 C CA  . ILE B 2 159 ? 48.712  -43.674 19.102  1.00 72.94  ? 159  ILE B CA  1 
ATOM   5378 C C   . ILE B 2 159 ? 48.921  -44.594 17.892  1.00 78.19  ? 159  ILE B C   1 
ATOM   5379 O O   . ILE B 2 159 ? 49.397  -45.717 18.021  1.00 86.72  ? 159  ILE B O   1 
ATOM   5380 C CB  . ILE B 2 159 ? 47.333  -43.933 19.815  1.00 70.99  ? 159  ILE B CB  1 
ATOM   5381 C CG1 . ILE B 2 159 ? 47.410  -43.377 21.246  1.00 64.90  ? 159  ILE B CG1 1 
ATOM   5382 C CG2 . ILE B 2 159 ? 46.929  -45.432 19.787  1.00 46.78  ? 159  ILE B CG2 1 
ATOM   5383 C CD1 . ILE B 2 159 ? 46.220  -43.719 22.111  1.00 78.24  ? 159  ILE B CD1 1 
ATOM   5384 N N   . PHE B 2 160 ? 48.620  -44.105 16.703  1.00 74.40  ? 160  PHE B N   1 
ATOM   5385 C CA  . PHE B 2 160 ? 48.761  -44.946 15.533  1.00 73.88  ? 160  PHE B CA  1 
ATOM   5386 C C   . PHE B 2 160 ? 50.065  -44.667 14.826  1.00 75.49  ? 160  PHE B C   1 
ATOM   5387 O O   . PHE B 2 160 ? 50.437  -45.371 13.895  1.00 77.65  ? 160  PHE B O   1 
ATOM   5388 C CB  . PHE B 2 160 ? 47.576  -44.687 14.619  1.00 76.72  ? 160  PHE B CB  1 
ATOM   5389 C CG  . PHE B 2 160 ? 47.407  -45.689 13.511  1.00 89.55  ? 160  PHE B CG  1 
ATOM   5390 C CD1 . PHE B 2 160 ? 48.104  -45.548 12.313  1.00 92.60  ? 160  PHE B CD1 1 
ATOM   5391 C CD2 . PHE B 2 160 ? 46.457  -46.715 13.622  1.00 89.29  ? 160  PHE B CD2 1 
ATOM   5392 C CE1 . PHE B 2 160 ? 47.848  -46.401 11.240  1.00 92.75  ? 160  PHE B CE1 1 
ATOM   5393 C CE2 . PHE B 2 160 ? 46.190  -47.578 12.554  1.00 88.36  ? 160  PHE B CE2 1 
ATOM   5394 C CZ  . PHE B 2 160 ? 46.885  -47.418 11.361  1.00 94.88  ? 160  PHE B CZ  1 
ATOM   5395 N N   . GLN B 2 161 ? 50.771  -43.648 15.288  1.00 76.15  ? 161  GLN B N   1 
ATOM   5396 C CA  . GLN B 2 161 ? 52.034  -43.280 14.673  1.00 84.53  ? 161  GLN B CA  1 
ATOM   5397 C C   . GLN B 2 161 ? 52.884  -44.492 14.305  1.00 89.86  ? 161  GLN B C   1 
ATOM   5398 O O   . GLN B 2 161 ? 53.105  -44.778 13.127  1.00 95.88  ? 161  GLN B O   1 
ATOM   5399 C CB  . GLN B 2 161 ? 52.837  -42.374 15.603  1.00 92.39  ? 161  GLN B CB  1 
ATOM   5400 C CG  . GLN B 2 161 ? 54.054  -41.780 14.926  1.00 95.91  ? 161  GLN B CG  1 
ATOM   5401 C CD  . GLN B 2 161 ? 53.666  -41.010 13.692  1.00 100.15 ? 161  GLN B CD  1 
ATOM   5402 O OE1 . GLN B 2 161 ? 53.520  -39.786 13.731  1.00 108.27 ? 161  GLN B OE1 1 
ATOM   5403 N NE2 . GLN B 2 161 ? 53.464  -41.724 12.588  1.00 101.15 ? 161  GLN B NE2 1 
ATOM   5404 N N   . SER B 2 162 ? 53.363  -45.202 15.317  1.00 86.33  ? 162  SER B N   1 
ATOM   5405 C CA  . SER B 2 162 ? 54.200  -46.364 15.086  1.00 85.37  ? 162  SER B CA  1 
ATOM   5406 C C   . SER B 2 162 ? 53.707  -47.196 13.914  1.00 84.32  ? 162  SER B C   1 
ATOM   5407 O O   . SER B 2 162 ? 54.341  -47.247 12.852  1.00 81.20  ? 162  SER B O   1 
ATOM   5408 C CB  . SER B 2 162 ? 54.236  -47.220 16.346  1.00 82.40  ? 162  SER B CB  1 
ATOM   5409 O OG  . SER B 2 162 ? 54.611  -46.428 17.454  1.00 71.01  ? 162  SER B OG  1 
ATOM   5410 N N   . SER B 2 163 ? 52.557  -47.828 14.112  1.00 80.53  ? 163  SER B N   1 
ATOM   5411 C CA  . SER B 2 163 ? 51.984  -48.687 13.097  1.00 84.25  ? 163  SER B CA  1 
ATOM   5412 C C   . SER B 2 163 ? 51.995  -48.035 11.729  1.00 84.97  ? 163  SER B C   1 
ATOM   5413 O O   . SER B 2 163 ? 51.983  -48.715 10.713  1.00 78.98  ? 163  SER B O   1 
ATOM   5414 C CB  . SER B 2 163 ? 50.561  -49.065 13.482  1.00 80.91  ? 163  SER B CB  1 
ATOM   5415 O OG  . SER B 2 163 ? 50.122  -50.159 12.700  1.00 84.40  ? 163  SER B OG  1 
ATOM   5416 N N   . MET B 2 164 ? 52.042  -46.709 11.720  1.00 91.94  ? 164  MET B N   1 
ATOM   5417 C CA  . MET B 2 164 ? 52.033  -45.932 10.487  1.00 95.79  ? 164  MET B CA  1 
ATOM   5418 C C   . MET B 2 164 ? 53.399  -45.891 9.847   1.00 95.35  ? 164  MET B C   1 
ATOM   5419 O O   . MET B 2 164 ? 53.560  -46.238 8.677   1.00 85.38  ? 164  MET B O   1 
ATOM   5420 C CB  . MET B 2 164 ? 51.555  -44.501 10.781  1.00 96.83  ? 164  MET B CB  1 
ATOM   5421 C CG  . MET B 2 164 ? 51.456  -43.582 9.576   1.00 89.94  ? 164  MET B CG  1 
ATOM   5422 S SD  . MET B 2 164 ? 50.345  -44.221 8.290   1.00 99.01  ? 164  MET B SD  1 
ATOM   5423 C CE  . MET B 2 164 ? 48.706  -43.632 8.833   1.00 98.84  ? 164  MET B CE  1 
ATOM   5424 N N   . THR B 2 165 ? 54.389  -45.466 10.620  1.00 105.83 ? 165  THR B N   1 
ATOM   5425 C CA  . THR B 2 165 ? 55.741  -45.372 10.095  1.00 115.12 ? 165  THR B CA  1 
ATOM   5426 C C   . THR B 2 165 ? 56.126  -46.695 9.466   1.00 124.08 ? 165  THR B C   1 
ATOM   5427 O O   . THR B 2 165 ? 56.728  -46.730 8.389   1.00 127.03 ? 165  THR B O   1 
ATOM   5428 C CB  . THR B 2 165 ? 56.781  -45.036 11.186  1.00 104.22 ? 165  THR B CB  1 
ATOM   5429 O OG1 . THR B 2 165 ? 56.365  -43.869 11.907  1.00 105.92 ? 165  THR B OG1 1 
ATOM   5430 C CG2 . THR B 2 165 ? 58.143  -44.751 10.540  1.00 86.66  ? 165  THR B CG2 1 
ATOM   5431 N N   . LYS B 2 166 ? 55.772  -47.784 10.137  1.00 128.42 ? 166  LYS B N   1 
ATOM   5432 C CA  . LYS B 2 166 ? 56.103  -49.095 9.611   1.00 134.74 ? 166  LYS B CA  1 
ATOM   5433 C C   . LYS B 2 166 ? 55.579  -49.285 8.193   1.00 137.62 ? 166  LYS B C   1 
ATOM   5434 O O   . LYS B 2 166 ? 56.361  -49.319 7.240   1.00 142.49 ? 166  LYS B O   1 
ATOM   5435 C CB  . LYS B 2 166 ? 55.580  -50.194 10.542  1.00 132.47 ? 166  LYS B CB  1 
ATOM   5436 C CG  . LYS B 2 166 ? 56.685  -50.883 11.361  1.00 128.24 ? 166  LYS B CG  1 
ATOM   5437 C CD  . LYS B 2 166 ? 57.668  -49.882 12.000  1.00 121.00 ? 166  LYS B CD  1 
ATOM   5438 C CE  . LYS B 2 166 ? 58.805  -49.493 11.045  1.00 116.09 ? 166  LYS B CE  1 
ATOM   5439 N NZ  . LYS B 2 166 ? 59.726  -48.452 11.597  1.00 114.72 ? 166  LYS B NZ  1 
ATOM   5440 N N   . ILE B 2 167 ? 54.267  -49.384 8.037   1.00 135.63 ? 167  ILE B N   1 
ATOM   5441 C CA  . ILE B 2 167 ? 53.709  -49.582 6.707   1.00 130.50 ? 167  ILE B CA  1 
ATOM   5442 C C   . ILE B 2 167 ? 54.114  -48.476 5.706   1.00 125.68 ? 167  ILE B C   1 
ATOM   5443 O O   . ILE B 2 167 ? 53.901  -48.604 4.498   1.00 122.63 ? 167  ILE B O   1 
ATOM   5444 C CB  . ILE B 2 167 ? 52.154  -49.785 6.811   1.00 125.70 ? 167  ILE B CB  1 
ATOM   5445 C CG1 . ILE B 2 167 ? 51.429  -49.176 5.615   1.00 127.78 ? 167  ILE B CG1 1 
ATOM   5446 C CG2 . ILE B 2 167 ? 51.647  -49.233 8.124   1.00 117.23 ? 167  ILE B CG2 1 
ATOM   5447 C CD1 . ILE B 2 167 ? 49.927  -49.419 5.632   1.00 129.83 ? 167  ILE B CD1 1 
ATOM   5448 N N   . LEU B 2 168 ? 54.752  -47.420 6.204   1.00 123.20 ? 168  LEU B N   1 
ATOM   5449 C CA  . LEU B 2 168 ? 55.183  -46.315 5.349   1.00 126.07 ? 168  LEU B CA  1 
ATOM   5450 C C   . LEU B 2 168 ? 56.691  -46.249 5.043   1.00 133.13 ? 168  LEU B C   1 
ATOM   5451 O O   . LEU B 2 168 ? 57.108  -45.495 4.160   1.00 138.54 ? 168  LEU B O   1 
ATOM   5452 C CB  . LEU B 2 168 ? 54.716  -44.979 5.960   1.00 118.42 ? 168  LEU B CB  1 
ATOM   5453 C CG  . LEU B 2 168 ? 55.505  -43.680 5.699   1.00 107.88 ? 168  LEU B CG  1 
ATOM   5454 C CD1 . LEU B 2 168 ? 54.613  -42.479 5.943   1.00 86.36  ? 168  LEU B CD1 1 
ATOM   5455 C CD2 . LEU B 2 168 ? 56.741  -43.616 6.603   1.00 108.57 ? 168  LEU B CD2 1 
ATOM   5456 N N   . GLU B 2 169 ? 57.511  -47.025 5.751   1.00 133.90 ? 169  GLU B N   1 
ATOM   5457 C CA  . GLU B 2 169 ? 58.961  -46.992 5.520   1.00 130.00 ? 169  GLU B CA  1 
ATOM   5458 C C   . GLU B 2 169 ? 59.406  -47.504 4.142   1.00 121.60 ? 169  GLU B C   1 
ATOM   5459 O O   . GLU B 2 169 ? 60.441  -47.064 3.624   1.00 118.33 ? 169  GLU B O   1 
ATOM   5460 C CB  . GLU B 2 169 ? 59.706  -47.752 6.629   1.00 137.52 ? 169  GLU B CB  1 
ATOM   5461 C CG  . GLU B 2 169 ? 59.606  -49.270 6.573   1.00 144.78 ? 169  GLU B CG  1 
ATOM   5462 C CD  . GLU B 2 169 ? 60.239  -49.929 7.786   1.00 148.73 ? 169  GLU B CD  1 
ATOM   5463 O OE1 . GLU B 2 169 ? 61.407  -49.605 8.099   1.00 148.67 ? 169  GLU B OE1 1 
ATOM   5464 O OE2 . GLU B 2 169 ? 59.568  -50.771 8.423   1.00 146.66 ? 169  GLU B OE2 1 
ATOM   5465 N N   . PRO B 2 170 ? 58.639  -48.437 3.532   1.00 116.19 ? 170  PRO B N   1 
ATOM   5466 C CA  . PRO B 2 170 ? 59.026  -48.947 2.209   1.00 114.87 ? 170  PRO B CA  1 
ATOM   5467 C C   . PRO B 2 170 ? 58.944  -47.867 1.118   1.00 114.64 ? 170  PRO B C   1 
ATOM   5468 O O   . PRO B 2 170 ? 59.925  -47.576 0.428   1.00 113.18 ? 170  PRO B O   1 
ATOM   5469 C CB  . PRO B 2 170 ? 58.035  -50.097 1.977   1.00 109.73 ? 170  PRO B CB  1 
ATOM   5470 C CG  . PRO B 2 170 ? 56.821  -49.669 2.745   1.00 106.31 ? 170  PRO B CG  1 
ATOM   5471 C CD  . PRO B 2 170 ? 57.433  -49.137 4.022   1.00 109.53 ? 170  PRO B CD  1 
ATOM   5472 N N   . PHE B 2 171 ? 57.761  -47.282 0.978   1.00 114.86 ? 171  PHE B N   1 
ATOM   5473 C CA  . PHE B 2 171 ? 57.512  -46.235 -0.002  1.00 112.05 ? 171  PHE B CA  1 
ATOM   5474 C C   . PHE B 2 171 ? 58.435  -45.033 0.269   1.00 106.60 ? 171  PHE B C   1 
ATOM   5475 O O   . PHE B 2 171 ? 58.874  -44.357 -0.663  1.00 102.27 ? 171  PHE B O   1 
ATOM   5476 C CB  . PHE B 2 171 ? 56.048  -45.805 0.105   1.00 118.67 ? 171  PHE B CB  1 
ATOM   5477 C CG  . PHE B 2 171 ? 55.359  -45.580 -1.222  1.00 120.31 ? 171  PHE B CG  1 
ATOM   5478 C CD1 . PHE B 2 171 ? 54.551  -46.570 -1.780  1.00 116.17 ? 171  PHE B CD1 1 
ATOM   5479 C CD2 . PHE B 2 171 ? 55.438  -44.343 -1.866  1.00 121.98 ? 171  PHE B CD2 1 
ATOM   5480 C CE1 . PHE B 2 171 ? 53.817  -46.330 -2.957  1.00 111.54 ? 171  PHE B CE1 1 
ATOM   5481 C CE2 . PHE B 2 171 ? 54.710  -44.094 -3.041  1.00 117.60 ? 171  PHE B CE2 1 
ATOM   5482 C CZ  . PHE B 2 171 ? 53.895  -45.093 -3.584  1.00 112.96 ? 171  PHE B CZ  1 
ATOM   5483 N N   . ARG B 2 172 ? 58.728  -44.780 1.545   1.00 107.11 ? 172  ARG B N   1 
ATOM   5484 C CA  . ARG B 2 172 ? 59.582  -43.660 1.943   1.00 111.67 ? 172  ARG B CA  1 
ATOM   5485 C C   . ARG B 2 172 ? 61.032  -43.769 1.519   1.00 115.31 ? 172  ARG B C   1 
ATOM   5486 O O   . ARG B 2 172 ? 61.752  -42.764 1.489   1.00 110.01 ? 172  ARG B O   1 
ATOM   5487 C CB  . ARG B 2 172 ? 59.524  -43.440 3.452   1.00 110.51 ? 172  ARG B CB  1 
ATOM   5488 C CG  . ARG B 2 172 ? 58.471  -42.442 3.832   1.00 112.19 ? 172  ARG B CG  1 
ATOM   5489 C CD  . ARG B 2 172 ? 58.779  -41.813 5.147   1.00 112.36 ? 172  ARG B CD  1 
ATOM   5490 N NE  . ARG B 2 172 ? 57.914  -40.669 5.368   1.00 111.09 ? 172  ARG B NE  1 
ATOM   5491 C CZ  . ARG B 2 172 ? 57.994  -39.887 6.430   1.00 116.74 ? 172  ARG B CZ  1 
ATOM   5492 N NH1 . ARG B 2 172 ? 58.900  -40.137 7.367   1.00 121.34 ? 172  ARG B NH1 1 
ATOM   5493 N NH2 . ARG B 2 172 ? 57.188  -38.846 6.540   1.00 118.67 ? 172  ARG B NH2 1 
ATOM   5494 N N   . LYS B 2 173 ? 61.467  -44.991 1.227   1.00 122.48 ? 173  LYS B N   1 
ATOM   5495 C CA  . LYS B 2 173 ? 62.825  -45.219 0.756   1.00 121.64 ? 173  LYS B CA  1 
ATOM   5496 C C   . LYS B 2 173 ? 62.789  -45.744 -0.685  1.00 121.61 ? 173  LYS B C   1 
ATOM   5497 O O   . LYS B 2 173 ? 63.769  -45.631 -1.418  1.00 121.86 ? 173  LYS B O   1 
ATOM   5498 C CB  . LYS B 2 173 ? 63.588  -46.177 1.682   1.00 116.26 ? 173  LYS B CB  1 
ATOM   5499 C CG  . LYS B 2 173 ? 64.241  -45.465 2.864   1.00 111.65 ? 173  LYS B CG  1 
ATOM   5500 C CD  . LYS B 2 173 ? 65.412  -46.247 3.443   1.00 117.44 ? 173  LYS B CD  1 
ATOM   5501 C CE  . LYS B 2 173 ? 64.958  -47.472 4.221   1.00 123.82 ? 173  LYS B CE  1 
ATOM   5502 N NZ  . LYS B 2 173 ? 64.309  -48.497 3.360   1.00 130.28 ? 173  LYS B NZ  1 
ATOM   5503 N N   . GLN B 2 174 ? 61.649  -46.294 -1.098  1.00 120.76 ? 174  GLN B N   1 
ATOM   5504 C CA  . GLN B 2 174 ? 61.500  -46.798 -2.460  1.00 115.60 ? 174  GLN B CA  1 
ATOM   5505 C C   . GLN B 2 174 ? 61.022  -45.650 -3.343  1.00 110.26 ? 174  GLN B C   1 
ATOM   5506 O O   . GLN B 2 174 ? 60.855  -45.801 -4.549  1.00 114.43 ? 174  GLN B O   1 
ATOM   5507 C CB  . GLN B 2 174 ? 60.486  -47.949 -2.508  1.00 116.37 ? 174  GLN B CB  1 
ATOM   5508 C CG  . GLN B 2 174 ? 60.421  -48.680 -3.852  1.00 126.64 ? 174  GLN B CG  1 
ATOM   5509 C CD  . GLN B 2 174 ? 61.786  -49.185 -4.328  1.00 138.97 ? 174  GLN B CD  1 
ATOM   5510 O OE1 . GLN B 2 174 ? 62.487  -49.890 -3.603  1.00 144.91 ? 174  GLN B OE1 1 
ATOM   5511 N NE2 . GLN B 2 174 ? 62.160  -48.827 -5.553  1.00 138.40 ? 174  GLN B NE2 1 
ATOM   5512 N N   . ASN B 2 175 ? 60.806  -44.498 -2.724  1.00 101.77 ? 175  ASN B N   1 
ATOM   5513 C CA  . ASN B 2 175 ? 60.351  -43.309 -3.430  1.00 95.33  ? 175  ASN B CA  1 
ATOM   5514 C C   . ASN B 2 175 ? 60.627  -42.073 -2.596  1.00 99.37  ? 175  ASN B C   1 
ATOM   5515 O O   . ASN B 2 175 ? 59.748  -41.230 -2.439  1.00 102.92 ? 175  ASN B O   1 
ATOM   5516 C CB  . ASN B 2 175 ? 58.848  -43.378 -3.687  1.00 86.46  ? 175  ASN B CB  1 
ATOM   5517 C CG  . ASN B 2 175 ? 58.518  -43.930 -5.041  1.00 95.39  ? 175  ASN B CG  1 
ATOM   5518 O OD1 . ASN B 2 175 ? 58.140  -45.089 -5.174  1.00 105.13 ? 175  ASN B OD1 1 
ATOM   5519 N ND2 . ASN B 2 175 ? 58.665  -43.103 -6.063  1.00 86.34  ? 175  ASN B ND2 1 
ATOM   5520 N N   . PRO B 2 176 ? 61.848  -41.931 -2.062  1.00 102.45 ? 176  PRO B N   1 
ATOM   5521 C CA  . PRO B 2 176 ? 62.129  -40.747 -1.241  1.00 108.00 ? 176  PRO B CA  1 
ATOM   5522 C C   . PRO B 2 176 ? 62.129  -39.388 -1.949  1.00 113.19 ? 176  PRO B C   1 
ATOM   5523 O O   . PRO B 2 176 ? 62.623  -38.401 -1.399  1.00 112.81 ? 176  PRO B O   1 
ATOM   5524 C CB  . PRO B 2 176 ? 63.479  -41.071 -0.599  1.00 111.00 ? 176  PRO B CB  1 
ATOM   5525 C CG  . PRO B 2 176 ? 63.565  -42.566 -0.674  1.00 109.07 ? 176  PRO B CG  1 
ATOM   5526 C CD  . PRO B 2 176 ? 62.964  -42.885 -2.011  1.00 102.11 ? 176  PRO B CD  1 
ATOM   5527 N N   . ASP B 2 177 ? 61.599  -39.335 -3.169  1.00 116.13 ? 177  ASP B N   1 
ATOM   5528 C CA  . ASP B 2 177 ? 61.507  -38.065 -3.897  1.00 115.86 ? 177  ASP B CA  1 
ATOM   5529 C C   . ASP B 2 177 ? 60.177  -37.438 -3.480  1.00 116.44 ? 177  ASP B C   1 
ATOM   5530 O O   . ASP B 2 177 ? 59.893  -36.258 -3.730  1.00 112.20 ? 177  ASP B O   1 
ATOM   5531 C CB  . ASP B 2 177 ? 61.573  -38.283 -5.427  1.00 116.00 ? 177  ASP B CB  1 
ATOM   5532 C CG  . ASP B 2 177 ? 60.761  -39.491 -5.913  1.00 116.41 ? 177  ASP B CG  1 
ATOM   5533 O OD1 . ASP B 2 177 ? 60.770  -40.554 -5.246  1.00 116.23 ? 177  ASP B OD1 1 
ATOM   5534 O OD2 . ASP B 2 177 ? 60.135  -39.380 -6.994  1.00 116.91 ? 177  ASP B OD2 1 
ATOM   5535 N N   . ILE B 2 178 ? 59.392  -38.275 -2.807  1.00 116.04 ? 178  ILE B N   1 
ATOM   5536 C CA  . ILE B 2 178 ? 58.083  -37.942 -2.280  1.00 108.50 ? 178  ILE B CA  1 
ATOM   5537 C C   . ILE B 2 178 ? 58.198  -37.578 -0.794  1.00 108.32 ? 178  ILE B C   1 
ATOM   5538 O O   . ILE B 2 178 ? 58.957  -38.201 -0.045  1.00 108.24 ? 178  ILE B O   1 
ATOM   5539 C CB  . ILE B 2 178 ? 57.118  -39.157 -2.435  1.00 97.84  ? 178  ILE B CB  1 
ATOM   5540 C CG1 . ILE B 2 178 ? 56.294  -39.011 -3.703  1.00 83.65  ? 178  ILE B CG1 1 
ATOM   5541 C CG2 . ILE B 2 178 ? 56.221  -39.295 -1.223  1.00 105.60 ? 178  ILE B CG2 1 
ATOM   5542 C CD1 . ILE B 2 178 ? 57.057  -39.303 -4.933  1.00 84.35  ? 178  ILE B CD1 1 
ATOM   5543 N N   . VAL B 2 179 ? 57.455  -36.555 -0.385  1.00 107.01 ? 179  VAL B N   1 
ATOM   5544 C CA  . VAL B 2 179 ? 57.414  -36.129 1.011   1.00 104.93 ? 179  VAL B CA  1 
ATOM   5545 C C   . VAL B 2 179 ? 56.015  -36.495 1.519   1.00 106.03 ? 179  VAL B C   1 
ATOM   5546 O O   . VAL B 2 179 ? 55.012  -36.239 0.851   1.00 110.08 ? 179  VAL B O   1 
ATOM   5547 C CB  . VAL B 2 179 ? 57.636  -34.594 1.166   1.00 98.93  ? 179  VAL B CB  1 
ATOM   5548 C CG1 . VAL B 2 179 ? 57.260  -34.146 2.575   1.00 87.56  ? 179  VAL B CG1 1 
ATOM   5549 C CG2 . VAL B 2 179 ? 59.097  -34.243 0.885   1.00 99.30  ? 179  VAL B CG2 1 
ATOM   5550 N N   . ILE B 2 180 ? 55.945  -37.114 2.688   1.00 102.03 ? 180  ILE B N   1 
ATOM   5551 C CA  . ILE B 2 180 ? 54.655  -37.487 3.226   1.00 96.05  ? 180  ILE B CA  1 
ATOM   5552 C C   . ILE B 2 180 ? 54.448  -36.979 4.636   1.00 98.28  ? 180  ILE B C   1 
ATOM   5553 O O   . ILE B 2 180 ? 55.236  -37.278 5.534   1.00 100.51 ? 180  ILE B O   1 
ATOM   5554 C CB  . ILE B 2 180 ? 54.478  -38.989 3.205   1.00 88.52  ? 180  ILE B CB  1 
ATOM   5555 C CG1 . ILE B 2 180 ? 54.385  -39.456 1.759   1.00 77.51  ? 180  ILE B CG1 1 
ATOM   5556 C CG2 . ILE B 2 180 ? 53.238  -39.371 3.986   1.00 88.67  ? 180  ILE B CG2 1 
ATOM   5557 C CD1 . ILE B 2 180 ? 54.121  -40.915 1.624   1.00 78.98  ? 180  ILE B CD1 1 
ATOM   5558 N N   . TYR B 2 181 ? 53.377  -36.207 4.810   1.00 95.14  ? 181  TYR B N   1 
ATOM   5559 C CA  . TYR B 2 181 ? 53.027  -35.623 6.098   1.00 88.94  ? 181  TYR B CA  1 
ATOM   5560 C C   . TYR B 2 181 ? 51.623  -36.009 6.469   1.00 82.22  ? 181  TYR B C   1 
ATOM   5561 O O   . TYR B 2 181 ? 50.713  -35.975 5.647   1.00 78.85  ? 181  TYR B O   1 
ATOM   5562 C CB  . TYR B 2 181 ? 53.127  -34.097 6.048   1.00 92.65  ? 181  TYR B CB  1 
ATOM   5563 C CG  . TYR B 2 181 ? 52.744  -33.378 7.333   1.00 94.81  ? 181  TYR B CG  1 
ATOM   5564 C CD1 . TYR B 2 181 ? 51.500  -32.752 7.465   1.00 89.33  ? 181  TYR B CD1 1 
ATOM   5565 C CD2 . TYR B 2 181 ? 53.648  -33.275 8.395   1.00 96.11  ? 181  TYR B CD2 1 
ATOM   5566 C CE1 . TYR B 2 181 ? 51.173  -32.037 8.621   1.00 83.37  ? 181  TYR B CE1 1 
ATOM   5567 C CE2 . TYR B 2 181 ? 53.329  -32.565 9.550   1.00 90.84  ? 181  TYR B CE2 1 
ATOM   5568 C CZ  . TYR B 2 181 ? 52.096  -31.948 9.655   1.00 83.12  ? 181  TYR B CZ  1 
ATOM   5569 O OH  . TYR B 2 181 ? 51.805  -31.226 10.787  1.00 82.17  ? 181  TYR B OH  1 
ATOM   5570 N N   . GLN B 2 182 ? 51.461  -36.371 7.729   1.00 83.50  ? 182  GLN B N   1 
ATOM   5571 C CA  . GLN B 2 182 ? 50.169  -36.767 8.244   1.00 86.73  ? 182  GLN B CA  1 
ATOM   5572 C C   . GLN B 2 182 ? 49.695  -35.778 9.304   1.00 87.91  ? 182  GLN B C   1 
ATOM   5573 O O   . GLN B 2 182 ? 50.448  -35.448 10.237  1.00 91.77  ? 182  GLN B O   1 
ATOM   5574 C CB  . GLN B 2 182 ? 50.253  -38.182 8.841   1.00 87.64  ? 182  GLN B CB  1 
ATOM   5575 C CG  . GLN B 2 182 ? 49.200  -38.486 9.903   1.00 87.46  ? 182  GLN B CG  1 
ATOM   5576 C CD  . GLN B 2 182 ? 49.160  -39.947 10.294  1.00 87.21  ? 182  GLN B CD  1 
ATOM   5577 O OE1 . GLN B 2 182 ? 50.126  -40.497 10.841  1.00 84.31  ? 182  GLN B OE1 1 
ATOM   5578 N NE2 . GLN B 2 182 ? 48.032  -40.591 10.010  1.00 84.04  ? 182  GLN B NE2 1 
ATOM   5579 N N   . TYR B 2 183 ? 48.463  -35.291 9.131   1.00 77.74  ? 183  TYR B N   1 
ATOM   5580 C CA  . TYR B 2 183 ? 47.847  -34.384 10.087  1.00 66.63  ? 183  TYR B CA  1 
ATOM   5581 C C   . TYR B 2 183 ? 46.456  -34.929 10.359  1.00 63.74  ? 183  TYR B C   1 
ATOM   5582 O O   . TYR B 2 183 ? 45.614  -34.965 9.455   1.00 65.58  ? 183  TYR B O   1 
ATOM   5583 C CB  . TYR B 2 183 ? 47.759  -32.967 9.541   1.00 59.87  ? 183  TYR B CB  1 
ATOM   5584 C CG  . TYR B 2 183 ? 47.201  -32.000 10.566  1.00 65.44  ? 183  TYR B CG  1 
ATOM   5585 C CD1 . TYR B 2 183 ? 45.825  -31.847 10.745  1.00 68.50  ? 183  TYR B CD1 1 
ATOM   5586 C CD2 . TYR B 2 183 ? 48.051  -31.258 11.379  1.00 66.95  ? 183  TYR B CD2 1 
ATOM   5587 C CE1 . TYR B 2 183 ? 45.310  -30.972 11.717  1.00 63.91  ? 183  TYR B CE1 1 
ATOM   5588 C CE2 . TYR B 2 183 ? 47.550  -30.384 12.348  1.00 74.66  ? 183  TYR B CE2 1 
ATOM   5589 C CZ  . TYR B 2 183 ? 46.181  -30.243 12.519  1.00 69.89  ? 183  TYR B CZ  1 
ATOM   5590 O OH  . TYR B 2 183 ? 45.708  -29.394 13.511  1.00 72.61  ? 183  TYR B OH  1 
ATOM   5591 N N   . MET B 2 184 ? 46.227  -35.354 11.604  1.00 59.32  ? 184  MET B N   1 
ATOM   5592 C CA  . MET B 2 184 ? 44.953  -35.947 12.007  1.00 59.89  ? 184  MET B CA  1 
ATOM   5593 C C   . MET B 2 184 ? 44.600  -37.023 10.977  1.00 62.07  ? 184  MET B C   1 
ATOM   5594 O O   . MET B 2 184 ? 45.460  -37.813 10.599  1.00 65.31  ? 184  MET B O   1 
ATOM   5595 C CB  . MET B 2 184 ? 43.853  -34.885 12.074  1.00 73.73  ? 184  MET B CB  1 
ATOM   5596 C CG  . MET B 2 184 ? 44.201  -33.698 12.977  1.00 89.04  ? 184  MET B CG  1 
ATOM   5597 S SD  . MET B 2 184 ? 44.390  -34.115 14.729  1.00 89.74  ? 184  MET B SD  1 
ATOM   5598 C CE  . MET B 2 184 ? 43.027  -33.139 15.444  1.00 80.88  ? 184  MET B CE  1 
ATOM   5599 N N   . ASP B 2 185 ? 43.360  -37.053 10.502  1.00 68.12  ? 185  ASP B N   1 
ATOM   5600 C CA  . ASP B 2 185 ? 42.963  -38.075 9.520   1.00 73.08  ? 185  ASP B CA  1 
ATOM   5601 C C   . ASP B 2 185 ? 43.547  -37.886 8.118   1.00 74.68  ? 185  ASP B C   1 
ATOM   5602 O O   . ASP B 2 185 ? 43.217  -38.656 7.209   1.00 68.82  ? 185  ASP B O   1 
ATOM   5603 C CB  . ASP B 2 185 ? 41.439  -38.120 9.352   1.00 71.67  ? 185  ASP B CB  1 
ATOM   5604 C CG  . ASP B 2 185 ? 40.701  -38.165 10.660  1.00 68.95  ? 185  ASP B CG  1 
ATOM   5605 O OD1 . ASP B 2 185 ? 39.493  -38.464 10.593  1.00 64.41  ? 185  ASP B OD1 1 
ATOM   5606 O OD2 . ASP B 2 185 ? 41.310  -37.897 11.730  1.00 70.09  ? 185  ASP B OD2 1 
ATOM   5607 N N   . ASP B 2 186 ? 44.396  -36.877 7.928   1.00 79.43  ? 186  ASP B N   1 
ATOM   5608 C CA  . ASP B 2 186 ? 44.936  -36.612 6.597   1.00 79.39  ? 186  ASP B CA  1 
ATOM   5609 C C   . ASP B 2 186 ? 46.403  -36.905 6.324   1.00 81.19  ? 186  ASP B C   1 
ATOM   5610 O O   . ASP B 2 186 ? 47.276  -36.730 7.178   1.00 79.87  ? 186  ASP B O   1 
ATOM   5611 C CB  . ASP B 2 186 ? 44.672  -35.159 6.203   1.00 72.86  ? 186  ASP B CB  1 
ATOM   5612 C CG  . ASP B 2 186 ? 43.225  -34.764 6.363   1.00 80.06  ? 186  ASP B CG  1 
ATOM   5613 O OD1 . ASP B 2 186 ? 42.329  -35.496 5.881   1.00 89.06  ? 186  ASP B OD1 1 
ATOM   5614 O OD2 . ASP B 2 186 ? 42.984  -33.705 6.972   1.00 92.14  ? 186  ASP B OD2 1 
ATOM   5615 N N   . LEU B 2 187 ? 46.650  -37.308 5.083   1.00 86.04  ? 187  LEU B N   1 
ATOM   5616 C CA  . LEU B 2 187 ? 47.979  -37.623 4.600   1.00 84.66  ? 187  LEU B CA  1 
ATOM   5617 C C   . LEU B 2 187 ? 48.282  -36.664 3.451   1.00 77.93  ? 187  LEU B C   1 
ATOM   5618 O O   . LEU B 2 187 ? 47.597  -36.689 2.432   1.00 72.00  ? 187  LEU B O   1 
ATOM   5619 C CB  . LEU B 2 187 ? 47.993  -39.066 4.104   1.00 92.01  ? 187  LEU B CB  1 
ATOM   5620 C CG  . LEU B 2 187 ? 49.225  -39.910 4.427   1.00 96.94  ? 187  LEU B CG  1 
ATOM   5621 C CD1 . LEU B 2 187 ? 49.696  -39.670 5.871   1.00 99.06  ? 187  LEU B CD1 1 
ATOM   5622 C CD2 . LEU B 2 187 ? 48.862  -41.375 4.199   1.00 91.10  ? 187  LEU B CD2 1 
ATOM   5623 N N   . TYR B 2 188 ? 49.288  -35.812 3.634   1.00 76.41  ? 188  TYR B N   1 
ATOM   5624 C CA  . TYR B 2 188 ? 49.690  -34.854 2.611   1.00 79.96  ? 188  TYR B CA  1 
ATOM   5625 C C   . TYR B 2 188 ? 50.917  -35.342 1.855   1.00 85.43  ? 188  TYR B C   1 
ATOM   5626 O O   . TYR B 2 188 ? 52.041  -35.240 2.338   1.00 83.94  ? 188  TYR B O   1 
ATOM   5627 C CB  . TYR B 2 188 ? 49.992  -33.521 3.249   1.00 76.99  ? 188  TYR B CB  1 
ATOM   5628 C CG  . TYR B 2 188 ? 48.806  -32.941 3.950   1.00 91.13  ? 188  TYR B CG  1 
ATOM   5629 C CD1 . TYR B 2 188 ? 48.340  -33.488 5.139   1.00 96.96  ? 188  TYR B CD1 1 
ATOM   5630 C CD2 . TYR B 2 188 ? 48.151  -31.829 3.431   1.00 101.15 ? 188  TYR B CD2 1 
ATOM   5631 C CE1 . TYR B 2 188 ? 47.244  -32.931 5.801   1.00 110.10 ? 188  TYR B CE1 1 
ATOM   5632 C CE2 . TYR B 2 188 ? 47.057  -31.265 4.077   1.00 103.50 ? 188  TYR B CE2 1 
ATOM   5633 C CZ  . TYR B 2 188 ? 46.606  -31.815 5.262   1.00 109.19 ? 188  TYR B CZ  1 
ATOM   5634 O OH  . TYR B 2 188 ? 45.525  -31.239 5.901   1.00 103.23 ? 188  TYR B OH  1 
ATOM   5635 N N   . VAL B 2 189 ? 50.678  -35.843 0.649   1.00 89.95  ? 189  VAL B N   1 
ATOM   5636 C CA  . VAL B 2 189 ? 51.709  -36.407 -0.209  1.00 90.74  ? 189  VAL B CA  1 
ATOM   5637 C C   . VAL B 2 189 ? 52.281  -35.485 -1.274  1.00 99.26  ? 189  VAL B C   1 
ATOM   5638 O O   . VAL B 2 189 ? 51.664  -35.302 -2.328  1.00 97.06  ? 189  VAL B O   1 
ATOM   5639 C CB  . VAL B 2 189 ? 51.162  -37.614 -0.930  1.00 85.56  ? 189  VAL B CB  1 
ATOM   5640 C CG1 . VAL B 2 189 ? 52.252  -38.234 -1.767  1.00 86.63  ? 189  VAL B CG1 1 
ATOM   5641 C CG2 . VAL B 2 189 ? 50.586  -38.592 0.080   1.00 82.44  ? 189  VAL B CG2 1 
ATOM   5642 N N   . GLY B 2 190 ? 53.479  -34.958 -1.020  1.00 109.23 ? 190  GLY B N   1 
ATOM   5643 C CA  . GLY B 2 190 ? 54.127  -34.046 -1.960  1.00 116.82 ? 190  GLY B CA  1 
ATOM   5644 C C   . GLY B 2 190 ? 55.188  -34.589 -2.918  1.00 120.07 ? 190  GLY B C   1 
ATOM   5645 O O   . GLY B 2 190 ? 55.842  -35.599 -2.642  1.00 122.19 ? 190  GLY B O   1 
ATOM   5646 N N   . SER B 2 191 ? 55.358  -33.899 -4.050  1.00 121.42 ? 191  SER B N   1 
ATOM   5647 C CA  . SER B 2 191 ? 56.332  -34.276 -5.084  1.00 117.48 ? 191  SER B CA  1 
ATOM   5648 C C   . SER B 2 191 ? 56.565  -33.132 -6.066  1.00 113.22 ? 191  SER B C   1 
ATOM   5649 O O   . SER B 2 191 ? 55.923  -32.084 -5.995  1.00 113.05 ? 191  SER B O   1 
ATOM   5650 C CB  . SER B 2 191 ? 55.845  -35.494 -5.882  1.00 116.69 ? 191  SER B CB  1 
ATOM   5651 O OG  . SER B 2 191 ? 54.860  -35.131 -6.845  1.00 108.80 ? 191  SER B OG  1 
ATOM   5652 N N   . ASP B 2 192 ? 57.490  -33.338 -6.989  1.00 106.15 ? 192  ASP B N   1 
ATOM   5653 C CA  . ASP B 2 192 ? 57.757  -32.319 -7.976  1.00 106.03 ? 192  ASP B CA  1 
ATOM   5654 C C   . ASP B 2 192 ? 57.517  -32.894 -9.350  1.00 108.45 ? 192  ASP B C   1 
ATOM   5655 O O   . ASP B 2 192 ? 57.679  -32.215 -10.360 1.00 110.47 ? 192  ASP B O   1 
ATOM   5656 C CB  . ASP B 2 192 ? 59.185  -31.815 -7.858  1.00 102.70 ? 192  ASP B CB  1 
ATOM   5657 C CG  . ASP B 2 192 ? 59.407  -31.030 -6.597  1.00 97.97  ? 192  ASP B CG  1 
ATOM   5658 O OD1 . ASP B 2 192 ? 60.085  -31.554 -5.698  1.00 107.64 ? 192  ASP B OD1 1 
ATOM   5659 O OD2 . ASP B 2 192 ? 58.892  -29.898 -6.499  1.00 87.32  ? 192  ASP B OD2 1 
ATOM   5660 N N   . LEU B 2 193 ? 57.124  -34.156 -9.386  1.00 105.00 ? 193  LEU B N   1 
ATOM   5661 C CA  . LEU B 2 193 ? 56.845  -34.812 -10.650 1.00 108.26 ? 193  LEU B CA  1 
ATOM   5662 C C   . LEU B 2 193 ? 55.852  -34.027 -11.501 1.00 110.57 ? 193  LEU B C   1 
ATOM   5663 O O   . LEU B 2 193 ? 55.336  -32.988 -11.085 1.00 104.18 ? 193  LEU B O   1 
ATOM   5664 C CB  . LEU B 2 193 ? 56.261  -36.196 -10.399 1.00 112.37 ? 193  LEU B CB  1 
ATOM   5665 C CG  . LEU B 2 193 ? 57.202  -37.280 -9.889  1.00 120.64 ? 193  LEU B CG  1 
ATOM   5666 C CD1 . LEU B 2 193 ? 58.005  -36.771 -8.681  1.00 118.39 ? 193  LEU B CD1 1 
ATOM   5667 C CD2 . LEU B 2 193 ? 56.364  -38.522 -9.555  1.00 118.07 ? 193  LEU B CD2 1 
ATOM   5668 N N   . GLU B 2 194 ? 55.600  -34.546 -12.700 1.00 119.84 ? 194  GLU B N   1 
ATOM   5669 C CA  . GLU B 2 194 ? 54.638  -33.965 -13.627 1.00 129.88 ? 194  GLU B CA  1 
ATOM   5670 C C   . GLU B 2 194 ? 53.273  -34.449 -13.124 1.00 133.65 ? 194  GLU B C   1 
ATOM   5671 O O   . GLU B 2 194 ? 53.149  -35.581 -12.641 1.00 134.50 ? 194  GLU B O   1 
ATOM   5672 C CB  . GLU B 2 194 ? 54.904  -34.469 -15.051 1.00 136.64 ? 194  GLU B CB  1 
ATOM   5673 C CG  . GLU B 2 194 ? 53.810  -34.145 -16.072 1.00 146.99 ? 194  GLU B CG  1 
ATOM   5674 C CD  . GLU B 2 194 ? 53.546  -32.654 -16.225 1.00 149.99 ? 194  GLU B CD  1 
ATOM   5675 O OE1 . GLU B 2 194 ? 54.516  -31.897 -16.454 1.00 149.67 ? 194  GLU B OE1 1 
ATOM   5676 O OE2 . GLU B 2 194 ? 52.365  -32.245 -16.128 1.00 150.00 ? 194  GLU B OE2 1 
ATOM   5677 N N   . ILE B 2 195 ? 52.260  -33.593 -13.241 1.00 134.15 ? 195  ILE B N   1 
ATOM   5678 C CA  . ILE B 2 195 ? 50.915  -33.901 -12.758 1.00 133.08 ? 195  ILE B CA  1 
ATOM   5679 C C   . ILE B 2 195 ? 50.338  -35.254 -13.189 1.00 135.41 ? 195  ILE B C   1 
ATOM   5680 O O   . ILE B 2 195 ? 49.361  -35.734 -12.604 1.00 138.06 ? 195  ILE B O   1 
ATOM   5681 C CB  . ILE B 2 195 ? 49.922  -32.761 -13.124 1.00 126.75 ? 195  ILE B CB  1 
ATOM   5682 C CG1 . ILE B 2 195 ? 48.769  -32.772 -12.126 1.00 123.95 ? 195  ILE B CG1 1 
ATOM   5683 C CG2 . ILE B 2 195 ? 49.439  -32.900 -14.559 1.00 117.54 ? 195  ILE B CG2 1 
ATOM   5684 C CD1 . ILE B 2 195 ? 49.265  -32.708 -10.702 1.00 118.75 ? 195  ILE B CD1 1 
ATOM   5685 N N   . GLY B 2 196 ? 50.945  -35.866 -14.202 1.00 131.79 ? 196  GLY B N   1 
ATOM   5686 C CA  . GLY B 2 196 ? 50.487  -37.164 -14.662 1.00 125.40 ? 196  GLY B CA  1 
ATOM   5687 C C   . GLY B 2 196 ? 51.214  -38.244 -13.883 1.00 124.52 ? 196  GLY B C   1 
ATOM   5688 O O   . GLY B 2 196 ? 50.621  -39.249 -13.484 1.00 122.66 ? 196  GLY B O   1 
ATOM   5689 N N   . GLN B 2 197 ? 52.509  -38.025 -13.667 1.00 126.37 ? 197  GLN B N   1 
ATOM   5690 C CA  . GLN B 2 197 ? 53.360  -38.957 -12.928 1.00 128.75 ? 197  GLN B CA  1 
ATOM   5691 C C   . GLN B 2 197 ? 52.912  -38.994 -11.486 1.00 124.09 ? 197  GLN B C   1 
ATOM   5692 O O   . GLN B 2 197 ? 52.953  -40.027 -10.817 1.00 121.22 ? 197  GLN B O   1 
ATOM   5693 C CB  . GLN B 2 197 ? 54.818  -38.500 -12.985 1.00 139.90 ? 197  GLN B CB  1 
ATOM   5694 C CG  . GLN B 2 197 ? 55.506  -38.777 -14.310 1.00 149.21 ? 197  GLN B CG  1 
ATOM   5695 C CD  . GLN B 2 197 ? 55.379  -40.235 -14.719 1.00 149.99 ? 197  GLN B CD  1 
ATOM   5696 O OE1 . GLN B 2 197 ? 55.535  -41.138 -13.893 1.00 149.99 ? 197  GLN B OE1 1 
ATOM   5697 N NE2 . GLN B 2 197 ? 55.099  -40.472 -15.999 1.00 149.98 ? 197  GLN B NE2 1 
ATOM   5698 N N   . HIS B 2 198 ? 52.491  -37.830 -11.025 1.00 119.63 ? 198  HIS B N   1 
ATOM   5699 C CA  . HIS B 2 198 ? 52.010  -37.648 -9.677  1.00 112.60 ? 198  HIS B CA  1 
ATOM   5700 C C   . HIS B 2 198 ? 50.794  -38.535 -9.407  1.00 103.00 ? 198  HIS B C   1 
ATOM   5701 O O   . HIS B 2 198 ? 50.844  -39.430 -8.565  1.00 97.43  ? 198  HIS B O   1 
ATOM   5702 C CB  . HIS B 2 198 ? 51.640  -36.181 -9.489  1.00 117.13 ? 198  HIS B CB  1 
ATOM   5703 C CG  . HIS B 2 198 ? 51.161  -35.851 -8.115  1.00 126.89 ? 198  HIS B CG  1 
ATOM   5704 N ND1 . HIS B 2 198 ? 51.995  -35.852 -7.018  1.00 130.90 ? 198  HIS B ND1 1 
ATOM   5705 C CD2 . HIS B 2 198 ? 49.931  -35.522 -7.655  1.00 133.56 ? 198  HIS B CD2 1 
ATOM   5706 C CE1 . HIS B 2 198 ? 51.298  -35.537 -5.940  1.00 138.52 ? 198  HIS B CE1 1 
ATOM   5707 N NE2 . HIS B 2 198 ? 50.043  -35.332 -6.299  1.00 140.87 ? 198  HIS B NE2 1 
ATOM   5708 N N   . ARG B 2 199 ? 49.710  -38.281 -10.135 1.00 99.85  ? 199  ARG B N   1 
ATOM   5709 C CA  . ARG B 2 199 ? 48.458  -39.019 -9.977  1.00 100.44 ? 199  ARG B CA  1 
ATOM   5710 C C   . ARG B 2 199 ? 48.616  -40.518 -10.020 1.00 99.72  ? 199  ARG B C   1 
ATOM   5711 O O   . ARG B 2 199 ? 47.772  -41.257 -9.512  1.00 92.09  ? 199  ARG B O   1 
ATOM   5712 C CB  . ARG B 2 199 ? 47.470  -38.622 -11.060 1.00 106.77 ? 199  ARG B CB  1 
ATOM   5713 C CG  . ARG B 2 199 ? 47.127  -37.144 -11.104 1.00 114.10 ? 199  ARG B CG  1 
ATOM   5714 C CD  . ARG B 2 199 ? 46.070  -36.920 -12.176 1.00 122.73 ? 199  ARG B CD  1 
ATOM   5715 N NE  . ARG B 2 199 ? 45.711  -35.519 -12.383 1.00 122.26 ? 199  ARG B NE  1 
ATOM   5716 C CZ  . ARG B 2 199 ? 44.545  -34.983 -12.033 1.00 118.51 ? 199  ARG B CZ  1 
ATOM   5717 N NH1 . ARG B 2 199 ? 43.607  -35.721 -11.445 1.00 117.90 ? 199  ARG B NH1 1 
ATOM   5718 N NH2 . ARG B 2 199 ? 44.307  -33.707 -12.298 1.00 108.92 ? 199  ARG B NH2 1 
ATOM   5719 N N   . THR B 2 200 ? 49.690  -40.959 -10.656 1.00 107.42 ? 200  THR B N   1 
ATOM   5720 C CA  . THR B 2 200 ? 49.967  -42.373 -10.769 1.00 115.49 ? 200  THR B CA  1 
ATOM   5721 C C   . THR B 2 200 ? 50.626  -42.869 -9.486  1.00 120.40 ? 200  THR B C   1 
ATOM   5722 O O   . THR B 2 200 ? 50.120  -43.785 -8.839  1.00 123.18 ? 200  THR B O   1 
ATOM   5723 C CB  . THR B 2 200 ? 50.888  -42.650 -11.961 1.00 115.05 ? 200  THR B CB  1 
ATOM   5724 O OG1 . THR B 2 200 ? 50.284  -42.139 -13.157 1.00 100.54 ? 200  THR B OG1 1 
ATOM   5725 C CG2 . THR B 2 200 ? 51.116  -44.143 -12.113 1.00 121.57 ? 200  THR B CG2 1 
ATOM   5726 N N   . LYS B 2 201 ? 51.745  -42.255 -9.115  1.00 120.13 ? 201  LYS B N   1 
ATOM   5727 C CA  . LYS B 2 201 ? 52.463  -42.641 -7.900  1.00 120.07 ? 201  LYS B CA  1 
ATOM   5728 C C   . LYS B 2 201 ? 51.510  -42.552 -6.694  1.00 120.73 ? 201  LYS B C   1 
ATOM   5729 O O   . LYS B 2 201 ? 51.657  -43.280 -5.706  1.00 119.75 ? 201  LYS B O   1 
ATOM   5730 C CB  . LYS B 2 201 ? 53.689  -41.727 -7.706  1.00 118.33 ? 201  LYS B CB  1 
ATOM   5731 C CG  . LYS B 2 201 ? 54.676  -42.120 -6.567  1.00 119.36 ? 201  LYS B CG  1 
ATOM   5732 C CD  . LYS B 2 201 ? 55.837  -43.060 -6.991  1.00 111.40 ? 201  LYS B CD  1 
ATOM   5733 C CE  . LYS B 2 201 ? 55.384  -44.514 -7.189  1.00 104.85 ? 201  LYS B CE  1 
ATOM   5734 N NZ  . LYS B 2 201 ? 56.498  -45.487 -7.407  1.00 84.41  ? 201  LYS B NZ  1 
ATOM   5735 N N   . ILE B 2 202 ? 50.526  -41.662 -6.789  1.00 119.82 ? 202  ILE B N   1 
ATOM   5736 C CA  . ILE B 2 202 ? 49.548  -41.491 -5.725  1.00 116.99 ? 202  ILE B CA  1 
ATOM   5737 C C   . ILE B 2 202 ? 48.669  -42.735 -5.660  1.00 119.31 ? 202  ILE B C   1 
ATOM   5738 O O   . ILE B 2 202 ? 48.507  -43.340 -4.601  1.00 123.87 ? 202  ILE B O   1 
ATOM   5739 C CB  . ILE B 2 202 ? 48.665  -40.241 -5.976  1.00 109.63 ? 202  ILE B CB  1 
ATOM   5740 C CG1 . ILE B 2 202 ? 49.458  -38.961 -5.676  1.00 102.08 ? 202  ILE B CG1 1 
ATOM   5741 C CG2 . ILE B 2 202 ? 47.418  -40.301 -5.119  1.00 111.42 ? 202  ILE B CG2 1 
ATOM   5742 C CD1 . ILE B 2 202 ? 49.818  -38.744 -4.195  1.00 83.31  ? 202  ILE B CD1 1 
ATOM   5743 N N   . GLU B 2 203 ? 48.110  -43.117 -6.803  1.00 119.13 ? 203  GLU B N   1 
ATOM   5744 C CA  . GLU B 2 203 ? 47.252  -44.292 -6.874  1.00 121.48 ? 203  GLU B CA  1 
ATOM   5745 C C   . GLU B 2 203 ? 47.946  -45.538 -6.320  1.00 126.70 ? 203  GLU B C   1 
ATOM   5746 O O   . GLU B 2 203 ? 47.314  -46.343 -5.635  1.00 129.48 ? 203  GLU B O   1 
ATOM   5747 C CB  . GLU B 2 203 ? 46.831  -44.540 -8.322  1.00 119.59 ? 203  GLU B CB  1 
ATOM   5748 C CG  . GLU B 2 203 ? 45.920  -45.739 -8.509  1.00 121.02 ? 203  GLU B CG  1 
ATOM   5749 C CD  . GLU B 2 203 ? 44.492  -45.464 -8.100  1.00 129.96 ? 203  GLU B CD  1 
ATOM   5750 O OE1 . GLU B 2 203 ? 43.870  -44.564 -8.705  1.00 145.88 ? 203  GLU B OE1 1 
ATOM   5751 O OE2 . GLU B 2 203 ? 43.992  -46.146 -7.180  1.00 128.13 ? 203  GLU B OE2 1 
ATOM   5752 N N   . GLU B 2 204 ? 49.239  -45.693 -6.618  1.00 129.38 ? 204  GLU B N   1 
ATOM   5753 C CA  . GLU B 2 204 ? 50.017  -46.848 -6.146  1.00 129.77 ? 204  GLU B CA  1 
ATOM   5754 C C   . GLU B 2 204 ? 50.071  -46.880 -4.628  1.00 123.84 ? 204  GLU B C   1 
ATOM   5755 O O   . GLU B 2 204 ? 49.790  -47.914 -4.020  1.00 122.37 ? 204  GLU B O   1 
ATOM   5756 C CB  . GLU B 2 204 ? 51.452  -46.835 -6.716  1.00 140.00 ? 204  GLU B CB  1 
ATOM   5757 C CG  . GLU B 2 204 ? 51.561  -47.321 -8.176  1.00 150.00 ? 204  GLU B CG  1 
ATOM   5758 C CD  . GLU B 2 204 ? 52.993  -47.318 -8.744  1.00 150.00 ? 204  GLU B CD  1 
ATOM   5759 O OE1 . GLU B 2 204 ? 53.139  -47.569 -9.962  1.00 150.00 ? 204  GLU B OE1 1 
ATOM   5760 O OE2 . GLU B 2 204 ? 53.968  -47.076 -7.991  1.00 150.00 ? 204  GLU B OE2 1 
ATOM   5761 N N   . LEU B 2 205 ? 50.426  -45.751 -4.017  1.00 116.98 ? 205  LEU B N   1 
ATOM   5762 C CA  . LEU B 2 205 ? 50.483  -45.679 -2.562  1.00 105.11 ? 205  LEU B CA  1 
ATOM   5763 C C   . LEU B 2 205 ? 49.141  -46.165 -2.034  1.00 96.33  ? 205  LEU B C   1 
ATOM   5764 O O   . LEU B 2 205 ? 49.077  -46.797 -0.989  1.00 88.06  ? 205  LEU B O   1 
ATOM   5765 C CB  . LEU B 2 205 ? 50.723  -44.243 -2.083  1.00 94.33  ? 205  LEU B CB  1 
ATOM   5766 C CG  . LEU B 2 205 ? 51.511  -44.124 -0.769  1.00 85.47  ? 205  LEU B CG  1 
ATOM   5767 C CD1 . LEU B 2 205 ? 51.416  -42.710 -0.229  1.00 60.91  ? 205  LEU B CD1 1 
ATOM   5768 C CD2 . LEU B 2 205 ? 50.982  -45.107 0.253   1.00 83.51  ? 205  LEU B CD2 1 
ATOM   5769 N N   . ARG B 2 206 ? 48.075  -45.871 -2.773  1.00 96.53  ? 206  ARG B N   1 
ATOM   5770 C CA  . ARG B 2 206 ? 46.737  -46.292 -2.386  1.00 100.97 ? 206  ARG B CA  1 
ATOM   5771 C C   . ARG B 2 206 ? 46.606  -47.800 -2.225  1.00 111.88 ? 206  ARG B C   1 
ATOM   5772 O O   . ARG B 2 206 ? 45.967  -48.272 -1.285  1.00 113.43 ? 206  ARG B O   1 
ATOM   5773 C CB  . ARG B 2 206 ? 45.720  -45.810 -3.401  1.00 87.94  ? 206  ARG B CB  1 
ATOM   5774 C CG  . ARG B 2 206 ? 45.617  -44.342 -3.422  1.00 87.13  ? 206  ARG B CG  1 
ATOM   5775 C CD  . ARG B 2 206 ? 44.298  -43.957 -3.983  1.00 104.55 ? 206  ARG B CD  1 
ATOM   5776 N NE  . ARG B 2 206 ? 43.740  -42.865 -3.214  1.00 121.55 ? 206  ARG B NE  1 
ATOM   5777 C CZ  . ARG B 2 206 ? 42.503  -42.414 -3.355  1.00 135.18 ? 206  ARG B CZ  1 
ATOM   5778 N NH1 . ARG B 2 206 ? 41.684  -42.957 -4.243  1.00 130.06 ? 206  ARG B NH1 1 
ATOM   5779 N NH2 . ARG B 2 206 ? 42.088  -41.415 -2.603  1.00 150.00 ? 206  ARG B NH2 1 
ATOM   5780 N N   . GLN B 2 207 ? 47.189  -48.565 -3.143  1.00 116.54 ? 207  GLN B N   1 
ATOM   5781 C CA  . GLN B 2 207 ? 47.117  -50.014 -3.025  1.00 115.62 ? 207  GLN B CA  1 
ATOM   5782 C C   . GLN B 2 207 ? 48.227  -50.510 -2.105  1.00 117.36 ? 207  GLN B C   1 
ATOM   5783 O O   . GLN B 2 207 ? 48.070  -51.529 -1.432  1.00 115.32 ? 207  GLN B O   1 
ATOM   5784 C CB  . GLN B 2 207 ? 47.242  -50.681 -4.390  1.00 114.71 ? 207  GLN B CB  1 
ATOM   5785 C CG  . GLN B 2 207 ? 46.103  -50.367 -5.324  1.00 123.12 ? 207  GLN B CG  1 
ATOM   5786 C CD  . GLN B 2 207 ? 46.168  -48.951 -5.853  1.00 127.67 ? 207  GLN B CD  1 
ATOM   5787 O OE1 . GLN B 2 207 ? 45.429  -48.063 -5.411  1.00 120.13 ? 207  GLN B OE1 1 
ATOM   5788 N NE2 . GLN B 2 207 ? 47.067  -48.728 -6.804  1.00 133.09 ? 207  GLN B NE2 1 
ATOM   5789 N N   . HIS B 2 208 ? 49.345  -49.783 -2.075  1.00 121.16 ? 208  HIS B N   1 
ATOM   5790 C CA  . HIS B 2 208 ? 50.484  -50.143 -1.224  1.00 123.57 ? 208  HIS B CA  1 
ATOM   5791 C C   . HIS B 2 208 ? 50.052  -50.016 0.223   1.00 128.57 ? 208  HIS B C   1 
ATOM   5792 O O   . HIS B 2 208 ? 50.715  -50.510 1.130   1.00 127.74 ? 208  HIS B O   1 
ATOM   5793 C CB  . HIS B 2 208 ? 51.677  -49.222 -1.510  1.00 118.52 ? 208  HIS B CB  1 
ATOM   5794 C CG  . HIS B 2 208 ? 52.844  -49.418 -0.587  1.00 124.51 ? 208  HIS B CG  1 
ATOM   5795 N ND1 . HIS B 2 208 ? 52.893  -48.869 0.676   1.00 124.67 ? 208  HIS B ND1 1 
ATOM   5796 C CD2 . HIS B 2 208 ? 54.021  -50.067 -0.759  1.00 128.39 ? 208  HIS B CD2 1 
ATOM   5797 C CE1 . HIS B 2 208 ? 54.051  -49.165 1.240   1.00 122.70 ? 208  HIS B CE1 1 
ATOM   5798 N NE2 . HIS B 2 208 ? 54.754  -49.892 0.391   1.00 124.03 ? 208  HIS B NE2 1 
ATOM   5799 N N   . LEU B 2 209 ? 48.927  -49.338 0.417   1.00 132.10 ? 209  LEU B N   1 
ATOM   5800 C CA  . LEU B 2 209 ? 48.349  -49.141 1.734   1.00 129.92 ? 209  LEU B CA  1 
ATOM   5801 C C   . LEU B 2 209 ? 47.280  -50.209 1.884   1.00 131.44 ? 209  LEU B C   1 
ATOM   5802 O O   . LEU B 2 209 ? 46.916  -50.598 2.989   1.00 137.18 ? 209  LEU B O   1 
ATOM   5803 C CB  . LEU B 2 209 ? 47.742  -47.738 1.844   1.00 125.80 ? 209  LEU B CB  1 
ATOM   5804 C CG  . LEU B 2 209 ? 48.765  -46.603 1.990   1.00 120.32 ? 209  LEU B CG  1 
ATOM   5805 C CD1 . LEU B 2 209 ? 48.090  -45.243 1.915   1.00 120.23 ? 209  LEU B CD1 1 
ATOM   5806 C CD2 . LEU B 2 209 ? 49.490  -46.760 3.311   1.00 116.73 ? 209  LEU B CD2 1 
ATOM   5807 N N   . LEU B 2 210 ? 46.778  -50.685 0.756   1.00 129.87 ? 210  LEU B N   1 
ATOM   5808 C CA  . LEU B 2 210 ? 45.781  -51.734 0.786   1.00 129.41 ? 210  LEU B CA  1 
ATOM   5809 C C   . LEU B 2 210 ? 46.491  -53.027 1.142   1.00 129.75 ? 210  LEU B C   1 
ATOM   5810 O O   . LEU B 2 210 ? 45.933  -53.881 1.832   1.00 119.91 ? 210  LEU B O   1 
ATOM   5811 C CB  . LEU B 2 210 ? 45.103  -51.855 -0.571  1.00 129.80 ? 210  LEU B CB  1 
ATOM   5812 C CG  . LEU B 2 210 ? 43.868  -50.970 -0.695  1.00 126.27 ? 210  LEU B CG  1 
ATOM   5813 C CD1 . LEU B 2 210 ? 43.318  -51.059 -2.110  1.00 126.00 ? 210  LEU B CD1 1 
ATOM   5814 C CD2 . LEU B 2 210 ? 42.827  -51.419 0.337   1.00 122.26 ? 210  LEU B CD2 1 
ATOM   5815 N N   . ARG B 2 211 ? 47.729  -53.157 0.667   1.00 136.56 ? 211  ARG B N   1 
ATOM   5816 C CA  . ARG B 2 211 ? 48.544  -54.333 0.946   1.00 141.93 ? 211  ARG B CA  1 
ATOM   5817 C C   . ARG B 2 211 ? 48.628  -54.491 2.455   1.00 143.45 ? 211  ARG B C   1 
ATOM   5818 O O   . ARG B 2 211 ? 48.389  -55.570 2.996   1.00 146.68 ? 211  ARG B O   1 
ATOM   5819 C CB  . ARG B 2 211 ? 49.959  -54.167 0.361   1.00 140.76 ? 211  ARG B CB  1 
ATOM   5820 C CG  . ARG B 2 211 ? 51.019  -55.142 0.915   1.00 141.29 ? 211  ARG B CG  1 
ATOM   5821 C CD  . ARG B 2 211 ? 50.660  -56.605 0.683   1.00 142.48 ? 211  ARG B CD  1 
ATOM   5822 N NE  . ARG B 2 211 ? 50.629  -56.947 -0.737  1.00 145.11 ? 211  ARG B NE  1 
ATOM   5823 C CZ  . ARG B 2 211 ? 50.019  -58.019 -1.231  1.00 150.00 ? 211  ARG B CZ  1 
ATOM   5824 N NH1 . ARG B 2 211 ? 49.389  -58.854 -0.419  1.00 150.00 ? 211  ARG B NH1 1 
ATOM   5825 N NH2 . ARG B 2 211 ? 50.032  -58.253 -2.535  1.00 150.00 ? 211  ARG B NH2 1 
ATOM   5826 N N   . TRP B 2 212 ? 48.949  -53.389 3.124   1.00 141.85 ? 212  TRP B N   1 
ATOM   5827 C CA  . TRP B 2 212 ? 49.095  -53.348 4.576   1.00 141.03 ? 212  TRP B CA  1 
ATOM   5828 C C   . TRP B 2 212 ? 47.845  -52.804 5.311   1.00 138.84 ? 212  TRP B C   1 
ATOM   5829 O O   . TRP B 2 212 ? 47.847  -52.675 6.537   1.00 138.55 ? 212  TRP B O   1 
ATOM   5830 C CB  . TRP B 2 212 ? 50.316  -52.482 4.922   1.00 144.84 ? 212  TRP B CB  1 
ATOM   5831 C CG  . TRP B 2 212 ? 51.707  -53.106 4.704   1.00 150.00 ? 212  TRP B CG  1 
ATOM   5832 C CD1 . TRP B 2 212 ? 52.417  -53.850 5.613   1.00 150.00 ? 212  TRP B CD1 1 
ATOM   5833 C CD2 . TRP B 2 212 ? 52.595  -52.916 3.572   1.00 150.00 ? 212  TRP B CD2 1 
ATOM   5834 N NE1 . TRP B 2 212 ? 53.682  -54.117 5.131   1.00 150.00 ? 212  TRP B NE1 1 
ATOM   5835 C CE2 . TRP B 2 212 ? 53.820  -53.558 3.885   1.00 150.00 ? 212  TRP B CE2 1 
ATOM   5836 C CE3 . TRP B 2 212 ? 52.476  -52.267 2.332   1.00 150.00 ? 212  TRP B CE3 1 
ATOM   5837 C CZ2 . TRP B 2 212 ? 54.921  -53.563 2.999   1.00 147.24 ? 212  TRP B CZ2 1 
ATOM   5838 C CZ3 . TRP B 2 212 ? 53.576  -52.280 1.453   1.00 145.82 ? 212  TRP B CZ3 1 
ATOM   5839 C CH2 . TRP B 2 212 ? 54.777  -52.921 1.796   1.00 138.26 ? 212  TRP B CH2 1 
ATOM   5840 N N   . GLY B 2 213 ? 46.790  -52.499 4.554   1.00 135.61 ? 213  GLY B N   1 
ATOM   5841 C CA  . GLY B 2 213 ? 45.546  -51.966 5.105   1.00 128.38 ? 213  GLY B CA  1 
ATOM   5842 C C   . GLY B 2 213 ? 45.298  -52.094 6.596   1.00 122.53 ? 213  GLY B C   1 
ATOM   5843 O O   . GLY B 2 213 ? 44.970  -51.112 7.259   1.00 116.98 ? 213  GLY B O   1 
ATOM   5844 N N   . PRO B 2 225 ? 40.798  -46.221 -0.725  1.00 115.77 ? 225  PRO B N   1 
ATOM   5845 C CA  . PRO B 2 225 ? 41.415  -45.318 0.252   1.00 114.37 ? 225  PRO B CA  1 
ATOM   5846 C C   . PRO B 2 225 ? 41.638  -43.872 -0.243  1.00 118.37 ? 225  PRO B C   1 
ATOM   5847 O O   . PRO B 2 225 ? 42.743  -43.472 -0.614  1.00 124.40 ? 225  PRO B O   1 
ATOM   5848 C CB  . PRO B 2 225 ? 42.665  -46.077 0.619   1.00 111.42 ? 225  PRO B CB  1 
ATOM   5849 C CG  . PRO B 2 225 ? 42.030  -47.454 0.825   1.00 120.11 ? 225  PRO B CG  1 
ATOM   5850 C CD  . PRO B 2 225 ? 41.122  -47.619 -0.389  1.00 114.21 ? 225  PRO B CD  1 
ATOM   5851 N N   . PRO B 2 226 ? 40.552  -43.070 -0.175  1.00 118.00 ? 226  PRO B N   1 
ATOM   5852 C CA  . PRO B 2 226 ? 39.994  -41.735 -0.440  1.00 114.14 ? 226  PRO B CA  1 
ATOM   5853 C C   . PRO B 2 226 ? 40.856  -40.599 -0.780  1.00 112.07 ? 226  PRO B C   1 
ATOM   5854 O O   . PRO B 2 226 ? 41.966  -40.528 -0.288  1.00 113.19 ? 226  PRO B O   1 
ATOM   5855 C CB  . PRO B 2 226 ? 39.368  -41.329 0.874   1.00 114.50 ? 226  PRO B CB  1 
ATOM   5856 C CG  . PRO B 2 226 ? 38.956  -42.512 1.437   1.00 117.37 ? 226  PRO B CG  1 
ATOM   5857 C CD  . PRO B 2 226 ? 40.086  -43.459 1.171   1.00 117.42 ? 226  PRO B CD  1 
ATOM   5858 N N   . PHE B 2 227 ? 40.467  -39.700 -1.654  1.00 108.89 ? 227  PHE B N   1 
ATOM   5859 C CA  . PHE B 2 227 ? 41.374  -38.575 -1.502  1.00 107.70 ? 227  PHE B CA  1 
ATOM   5860 C C   . PHE B 2 227 ? 40.457  -37.464 -1.144  1.00 102.20 ? 227  PHE B C   1 
ATOM   5861 O O   . PHE B 2 227 ? 39.289  -37.454 -1.519  1.00 93.20  ? 227  PHE B O   1 
ATOM   5862 C CB  . PHE B 2 227 ? 42.233  -38.105 -2.687  1.00 108.05 ? 227  PHE B CB  1 
ATOM   5863 C CG  . PHE B 2 227 ? 42.170  -38.942 -3.894  1.00 106.62 ? 227  PHE B CG  1 
ATOM   5864 C CD1 . PHE B 2 227 ? 43.241  -39.766 -4.248  1.00 100.27 ? 227  PHE B CD1 1 
ATOM   5865 C CD2 . PHE B 2 227 ? 41.087  -38.836 -4.746  1.00 106.71 ? 227  PHE B CD2 1 
ATOM   5866 C CE1 . PHE B 2 227 ? 43.230  -40.473 -5.451  1.00 97.94  ? 227  PHE B CE1 1 
ATOM   5867 C CE2 . PHE B 2 227 ? 41.063  -39.531 -5.952  1.00 108.53 ? 227  PHE B CE2 1 
ATOM   5868 C CZ  . PHE B 2 227 ? 42.136  -40.353 -6.310  1.00 104.76 ? 227  PHE B CZ  1 
ATOM   5869 N N   . LEU B 2 228 ? 40.975  -36.546 -0.363  1.00 103.17 ? 228  LEU B N   1 
ATOM   5870 C CA  . LEU B 2 228 ? 40.188  -35.415 -0.036  1.00 101.70 ? 228  LEU B CA  1 
ATOM   5871 C C   . LEU B 2 228 ? 40.487  -34.456 -1.171  1.00 106.20 ? 228  LEU B C   1 
ATOM   5872 O O   . LEU B 2 228 ? 41.367  -34.708 -2.001  1.00 109.32 ? 228  LEU B O   1 
ATOM   5873 C CB  . LEU B 2 228 ? 40.594  -34.876 1.329   1.00 96.20  ? 228  LEU B CB  1 
ATOM   5874 C CG  . LEU B 2 228 ? 39.620  -35.456 2.342   1.00 97.04  ? 228  LEU B CG  1 
ATOM   5875 C CD1 . LEU B 2 228 ? 39.869  -34.889 3.729   1.00 98.22  ? 228  LEU B CD1 1 
ATOM   5876 C CD2 . LEU B 2 228 ? 38.208  -35.105 1.870   1.00 98.25  ? 228  LEU B CD2 1 
ATOM   5877 N N   . TRP B 2 229 ? 39.701  -33.398 -1.247  1.00 106.09 ? 229  TRP B N   1 
ATOM   5878 C CA  . TRP B 2 229 ? 39.875  -32.378 -2.258  1.00 109.10 ? 229  TRP B CA  1 
ATOM   5879 C C   . TRP B 2 229 ? 39.787  -32.746 -3.721  1.00 113.18 ? 229  TRP B C   1 
ATOM   5880 O O   . TRP B 2 229 ? 40.585  -32.303 -4.552  1.00 121.44 ? 229  TRP B O   1 
ATOM   5881 C CB  . TRP B 2 229 ? 41.148  -31.608 -1.941  1.00 113.24 ? 229  TRP B CB  1 
ATOM   5882 C CG  . TRP B 2 229 ? 41.022  -31.101 -0.554  1.00 107.35 ? 229  TRP B CG  1 
ATOM   5883 C CD1 . TRP B 2 229 ? 41.919  -31.231 0.460   1.00 104.24 ? 229  TRP B CD1 1 
ATOM   5884 C CD2 . TRP B 2 229 ? 39.859  -30.505 0.013   1.00 107.05 ? 229  TRP B CD2 1 
ATOM   5885 N NE1 . TRP B 2 229 ? 41.380  -30.763 1.632   1.00 102.22 ? 229  TRP B NE1 1 
ATOM   5886 C CE2 . TRP B 2 229 ? 40.113  -30.312 1.383   1.00 105.20 ? 229  TRP B CE2 1 
ATOM   5887 C CE3 . TRP B 2 229 ? 38.619  -30.117 -0.507  1.00 110.25 ? 229  TRP B CE3 1 
ATOM   5888 C CZ2 . TRP B 2 229 ? 39.176  -29.750 2.243   1.00 110.58 ? 229  TRP B CZ2 1 
ATOM   5889 C CZ3 . TRP B 2 229 ? 37.688  -29.558 0.340   1.00 114.42 ? 229  TRP B CZ3 1 
ATOM   5890 C CH2 . TRP B 2 229 ? 37.968  -29.380 1.704   1.00 117.90 ? 229  TRP B CH2 1 
ATOM   5891 N N   . MET B 2 230 ? 38.782  -33.554 -4.026  1.00 110.41 ? 230  MET B N   1 
ATOM   5892 C CA  . MET B 2 230 ? 38.502  -33.939 -5.398  1.00 115.08 ? 230  MET B CA  1 
ATOM   5893 C C   . MET B 2 230 ? 39.617  -34.651 -6.134  1.00 115.86 ? 230  MET B C   1 
ATOM   5894 O O   . MET B 2 230 ? 39.752  -34.516 -7.356  1.00 117.79 ? 230  MET B O   1 
ATOM   5895 C CB  . MET B 2 230 ? 38.112  -32.695 -6.186  1.00 121.69 ? 230  MET B CB  1 
ATOM   5896 C CG  . MET B 2 230 ? 36.626  -32.552 -6.348  1.00 125.16 ? 230  MET B CG  1 
ATOM   5897 S SD  . MET B 2 230 ? 35.987  -34.090 -7.040  1.00 118.47 ? 230  MET B SD  1 
ATOM   5898 C CE  . MET B 2 230 ? 34.755  -33.495 -8.138  1.00 118.70 ? 230  MET B CE  1 
ATOM   5899 N N   . GLY B 2 231 ? 40.400  -35.432 -5.407  1.00 113.42 ? 231  GLY B N   1 
ATOM   5900 C CA  . GLY B 2 231 ? 41.494  -36.115 -6.056  1.00 111.08 ? 231  GLY B CA  1 
ATOM   5901 C C   . GLY B 2 231 ? 42.369  -35.052 -6.683  1.00 114.80 ? 231  GLY B C   1 
ATOM   5902 O O   . GLY B 2 231 ? 42.944  -35.258 -7.765  1.00 116.01 ? 231  GLY B O   1 
ATOM   5903 N N   . TYR B 2 232 ? 42.463  -33.908 -5.997  1.00 115.17 ? 232  TYR B N   1 
ATOM   5904 C CA  . TYR B 2 232 ? 43.261  -32.790 -6.486  1.00 113.08 ? 232  TYR B CA  1 
ATOM   5905 C C   . TYR B 2 232 ? 44.500  -32.392 -5.739  1.00 106.46 ? 232  TYR B C   1 
ATOM   5906 O O   . TYR B 2 232 ? 44.639  -32.607 -4.532  1.00 100.92 ? 232  TYR B O   1 
ATOM   5907 C CB  . TYR B 2 232 ? 42.397  -31.553 -6.712  1.00 116.34 ? 232  TYR B CB  1 
ATOM   5908 C CG  . TYR B 2 232 ? 41.991  -31.446 -8.160  1.00 131.37 ? 232  TYR B CG  1 
ATOM   5909 C CD1 . TYR B 2 232 ? 40.730  -30.983 -8.520  1.00 126.34 ? 232  TYR B CD1 1 
ATOM   5910 C CD2 . TYR B 2 232 ? 42.859  -31.871 -9.176  1.00 141.65 ? 232  TYR B CD2 1 
ATOM   5911 C CE1 . TYR B 2 232 ? 40.334  -30.952 -9.851  1.00 128.83 ? 232  TYR B CE1 1 
ATOM   5912 C CE2 . TYR B 2 232 ? 42.475  -31.844 -10.508 1.00 142.32 ? 232  TYR B CE2 1 
ATOM   5913 C CZ  . TYR B 2 232 ? 41.211  -31.387 -10.838 1.00 138.61 ? 232  TYR B CZ  1 
ATOM   5914 O OH  . TYR B 2 232 ? 40.822  -31.378 -12.154 1.00 143.56 ? 232  TYR B OH  1 
ATOM   5915 N N   . GLU B 2 233 ? 45.393  -31.788 -6.516  1.00 102.55 ? 233  GLU B N   1 
ATOM   5916 C CA  . GLU B 2 233 ? 46.692  -31.354 -6.058  1.00 96.96  ? 233  GLU B CA  1 
ATOM   5917 C C   . GLU B 2 233 ? 46.735  -29.915 -5.639  1.00 87.10  ? 233  GLU B C   1 
ATOM   5918 O O   . GLU B 2 233 ? 46.236  -29.034 -6.327  1.00 88.11  ? 233  GLU B O   1 
ATOM   5919 C CB  . GLU B 2 233 ? 47.745  -31.541 -7.158  1.00 96.27  ? 233  GLU B CB  1 
ATOM   5920 C CG  . GLU B 2 233 ? 47.857  -32.946 -7.748  1.00 104.33 ? 233  GLU B CG  1 
ATOM   5921 C CD  . GLU B 2 233 ? 46.929  -33.177 -8.934  1.00 109.97 ? 233  GLU B CD  1 
ATOM   5922 O OE1 . GLU B 2 233 ? 46.809  -32.266 -9.788  1.00 116.86 ? 233  GLU B OE1 1 
ATOM   5923 O OE2 . GLU B 2 233 ? 46.337  -34.275 -9.020  1.00 103.23 ? 233  GLU B OE2 1 
ATOM   5924 N N   . LEU B 2 234 ? 47.327  -29.678 -4.486  1.00 81.60  ? 234  LEU B N   1 
ATOM   5925 C CA  . LEU B 2 234 ? 47.498  -28.324 -4.056  1.00 82.11  ? 234  LEU B CA  1 
ATOM   5926 C C   . LEU B 2 234 ? 48.751  -28.025 -4.830  1.00 81.10  ? 234  LEU B C   1 
ATOM   5927 O O   . LEU B 2 234 ? 49.541  -28.923 -5.110  1.00 81.24  ? 234  LEU B O   1 
ATOM   5928 C CB  . LEU B 2 234 ? 47.812  -28.243 -2.573  1.00 88.92  ? 234  LEU B CB  1 
ATOM   5929 C CG  . LEU B 2 234 ? 46.667  -28.405 -1.584  1.00 91.33  ? 234  LEU B CG  1 
ATOM   5930 C CD1 . LEU B 2 234 ? 45.999  -29.767 -1.741  1.00 90.90  ? 234  LEU B CD1 1 
ATOM   5931 C CD2 . LEU B 2 234 ? 47.237  -28.228 -0.186  1.00 98.71  ? 234  LEU B CD2 1 
ATOM   5932 N N   . HIS B 2 235 ? 48.933  -26.777 -5.205  1.00 80.11  ? 235  HIS B N   1 
ATOM   5933 C CA  . HIS B 2 235 ? 50.129  -26.417 -5.922  1.00 76.92  ? 235  HIS B CA  1 
ATOM   5934 C C   . HIS B 2 235 ? 50.647  -25.297 -5.069  1.00 71.63  ? 235  HIS B C   1 
ATOM   5935 O O   . HIS B 2 235 ? 50.490  -24.129 -5.391  1.00 67.47  ? 235  HIS B O   1 
ATOM   5936 C CB  . HIS B 2 235 ? 49.773  -25.967 -7.335  1.00 80.94  ? 235  HIS B CB  1 
ATOM   5937 C CG  . HIS B 2 235 ? 49.100  -27.036 -8.142  1.00 83.13  ? 235  HIS B CG  1 
ATOM   5938 N ND1 . HIS B 2 235 ? 49.695  -28.252 -8.403  1.00 89.14  ? 235  HIS B ND1 1 
ATOM   5939 C CD2 . HIS B 2 235 ? 47.866  -27.093 -8.702  1.00 88.74  ? 235  HIS B CD2 1 
ATOM   5940 C CE1 . HIS B 2 235 ? 48.857  -29.014 -9.085  1.00 94.14  ? 235  HIS B CE1 1 
ATOM   5941 N NE2 . HIS B 2 235 ? 47.740  -28.335 -9.279  1.00 98.17  ? 235  HIS B NE2 1 
ATOM   5942 N N   . PRO B 2 236 ? 51.240  -25.657 -3.922  1.00 76.19  ? 236  PRO B N   1 
ATOM   5943 C CA  . PRO B 2 236 ? 51.814  -24.740 -2.929  1.00 77.96  ? 236  PRO B CA  1 
ATOM   5944 C C   . PRO B 2 236 ? 52.964  -23.936 -3.497  1.00 83.14  ? 236  PRO B C   1 
ATOM   5945 O O   . PRO B 2 236 ? 53.254  -22.831 -3.043  1.00 71.65  ? 236  PRO B O   1 
ATOM   5946 C CB  . PRO B 2 236 ? 52.247  -25.675 -1.810  1.00 67.05  ? 236  PRO B CB  1 
ATOM   5947 C CG  . PRO B 2 236 ? 52.613  -26.922 -2.549  1.00 74.96  ? 236  PRO B CG  1 
ATOM   5948 C CD  . PRO B 2 236 ? 51.497  -27.059 -3.548  1.00 74.58  ? 236  PRO B CD  1 
ATOM   5949 N N   . ASP B 2 237 ? 53.616  -24.519 -4.496  1.00 98.41  ? 237  ASP B N   1 
ATOM   5950 C CA  . ASP B 2 237 ? 54.725  -23.879 -5.182  1.00 109.16 ? 237  ASP B CA  1 
ATOM   5951 C C   . ASP B 2 237 ? 54.204  -22.570 -5.738  1.00 111.56 ? 237  ASP B C   1 
ATOM   5952 O O   . ASP B 2 237 ? 54.965  -21.624 -5.948  1.00 111.95 ? 237  ASP B O   1 
ATOM   5953 C CB  . ASP B 2 237 ? 55.200  -24.750 -6.353  1.00 121.35 ? 237  ASP B CB  1 
ATOM   5954 C CG  . ASP B 2 237 ? 54.083  -25.039 -7.370  1.00 131.38 ? 237  ASP B CG  1 
ATOM   5955 O OD1 . ASP B 2 237 ? 53.128  -25.777 -7.030  1.00 131.73 ? 237  ASP B OD1 1 
ATOM   5956 O OD2 . ASP B 2 237 ? 54.161  -24.524 -8.510  1.00 128.93 ? 237  ASP B OD2 1 
ATOM   5957 N N   . LYS B 2 238 ? 52.894  -22.534 -5.971  1.00 112.77 ? 238  LYS B N   1 
ATOM   5958 C CA  . LYS B 2 238 ? 52.248  -21.367 -6.543  1.00 112.57 ? 238  LYS B CA  1 
ATOM   5959 C C   . LYS B 2 238 ? 51.465  -20.519 -5.551  1.00 108.14 ? 238  LYS B C   1 
ATOM   5960 O O   . LYS B 2 238 ? 50.498  -19.866 -5.933  1.00 110.87 ? 238  LYS B O   1 
ATOM   5961 C CB  . LYS B 2 238 ? 51.335  -21.798 -7.704  1.00 118.21 ? 238  LYS B CB  1 
ATOM   5962 C CG  . LYS B 2 238 ? 52.041  -22.633 -8.797  1.00 122.14 ? 238  LYS B CG  1 
ATOM   5963 C CD  . LYS B 2 238 ? 51.116  -22.965 -9.980  1.00 122.62 ? 238  LYS B CD  1 
ATOM   5964 C CE  . LYS B 2 238 ? 51.711  -24.050 -10.867 1.00 116.39 ? 238  LYS B CE  1 
ATOM   5965 N NZ  . LYS B 2 238 ? 51.961  -25.295 -10.084 1.00 110.27 ? 238  LYS B NZ  1 
ATOM   5966 N N   . TRP B 2 239 ? 51.868  -20.527 -4.282  1.00 104.49 ? 239  TRP B N   1 
ATOM   5967 C CA  . TRP B 2 239 ? 51.182  -19.701 -3.293  1.00 106.61 ? 239  TRP B CA  1 
ATOM   5968 C C   . TRP B 2 239 ? 52.024  -18.485 -3.003  1.00 110.34 ? 239  TRP B C   1 
ATOM   5969 O O   . TRP B 2 239 ? 53.185  -18.600 -2.615  1.00 102.89 ? 239  TRP B O   1 
ATOM   5970 C CB  . TRP B 2 239 ? 50.922  -20.449 -1.988  1.00 99.10  ? 239  TRP B CB  1 
ATOM   5971 C CG  . TRP B 2 239 ? 49.989  -21.587 -2.141  1.00 101.88 ? 239  TRP B CG  1 
ATOM   5972 C CD1 . TRP B 2 239 ? 49.159  -21.841 -3.195  1.00 108.66 ? 239  TRP B CD1 1 
ATOM   5973 C CD2 . TRP B 2 239 ? 49.837  -22.673 -1.242  1.00 95.42  ? 239  TRP B CD2 1 
ATOM   5974 N NE1 . TRP B 2 239 ? 48.507  -23.032 -3.011  1.00 102.46 ? 239  TRP B NE1 1 
ATOM   5975 C CE2 . TRP B 2 239 ? 48.905  -23.566 -1.816  1.00 94.98  ? 239  TRP B CE2 1 
ATOM   5976 C CE3 . TRP B 2 239 ? 50.400  -22.986 -0.004  1.00 87.87  ? 239  TRP B CE3 1 
ATOM   5977 C CZ2 . TRP B 2 239 ? 48.527  -24.755 -1.193  1.00 76.03  ? 239  TRP B CZ2 1 
ATOM   5978 C CZ3 . TRP B 2 239 ? 50.025  -24.165 0.615   1.00 82.69  ? 239  TRP B CZ3 1 
ATOM   5979 C CH2 . TRP B 2 239 ? 49.096  -25.038 0.017   1.00 72.89  ? 239  TRP B CH2 1 
ATOM   5980 N N   . THR B 2 240 ? 51.423  -17.318 -3.200  1.00 122.11 ? 240  THR B N   1 
ATOM   5981 C CA  . THR B 2 240 ? 52.109  -16.055 -2.975  1.00 128.39 ? 240  THR B CA  1 
ATOM   5982 C C   . THR B 2 240 ? 51.350  -15.108 -2.038  1.00 127.83 ? 240  THR B C   1 
ATOM   5983 O O   . THR B 2 240 ? 50.177  -15.329 -1.707  1.00 130.82 ? 240  THR B O   1 
ATOM   5984 C CB  . THR B 2 240 ? 52.405  -15.330 -4.337  1.00 128.66 ? 240  THR B CB  1 
ATOM   5985 O OG1 . THR B 2 240 ? 51.277  -15.446 -5.220  1.00 123.66 ? 240  THR B OG1 1 
ATOM   5986 C CG2 . THR B 2 240 ? 53.634  -15.937 -5.005  1.00 124.90 ? 240  THR B CG2 1 
ATOM   5987 N N   . VAL B 2 241 ? 52.049  -14.062 -1.605  1.00 119.30 ? 241  VAL B N   1 
ATOM   5988 C CA  . VAL B 2 241 ? 51.495  -13.051 -0.720  1.00 110.86 ? 241  VAL B CA  1 
ATOM   5989 C C   . VAL B 2 241 ? 50.812  -11.935 -1.523  1.00 116.30 ? 241  VAL B C   1 
ATOM   5990 O O   . VAL B 2 241 ? 51.362  -11.441 -2.506  1.00 116.53 ? 241  VAL B O   1 
ATOM   5991 C CB  . VAL B 2 241 ? 52.620  -12.463 0.176   1.00 87.67  ? 241  VAL B CB  1 
ATOM   5992 C CG1 . VAL B 2 241 ? 52.251  -11.086 0.694   1.00 81.05  ? 241  VAL B CG1 1 
ATOM   5993 C CG2 . VAL B 2 241 ? 52.868  -13.397 1.328   1.00 67.05  ? 241  VAL B CG2 1 
ATOM   5994 N N   . GLN B 2 242 ? 49.594  -11.574 -1.120  1.00 120.25 ? 242  GLN B N   1 
ATOM   5995 C CA  . GLN B 2 242 ? 48.842  -10.493 -1.760  1.00 119.98 ? 242  GLN B CA  1 
ATOM   5996 C C   . GLN B 2 242 ? 49.389  -9.168  -1.192  1.00 119.29 ? 242  GLN B C   1 
ATOM   5997 O O   . GLN B 2 242 ? 48.967  -8.708  -0.131  1.00 123.62 ? 242  GLN B O   1 
ATOM   5998 C CB  . GLN B 2 242 ? 47.342  -10.634 -1.446  1.00 120.82 ? 242  GLN B CB  1 
ATOM   5999 C CG  . GLN B 2 242 ? 46.530  -9.348  -1.621  1.00 129.00 ? 242  GLN B CG  1 
ATOM   6000 C CD  . GLN B 2 242 ? 46.494  -8.855  -3.055  1.00 132.81 ? 242  GLN B CD  1 
ATOM   6001 O OE1 . GLN B 2 242 ? 46.156  -7.696  -3.324  1.00 128.08 ? 242  GLN B OE1 1 
ATOM   6002 N NE2 . GLN B 2 242 ? 46.831  -9.737  -3.987  1.00 134.79 ? 242  GLN B NE2 1 
ATOM   6003 N N   . PRO B 2 243 ? 50.339  -8.536  -1.900  1.00 112.68 ? 243  PRO B N   1 
ATOM   6004 C CA  . PRO B 2 243 ? 50.907  -7.275  -1.413  1.00 102.27 ? 243  PRO B CA  1 
ATOM   6005 C C   . PRO B 2 243 ? 49.829  -6.214  -1.343  1.00 95.10  ? 243  PRO B C   1 
ATOM   6006 O O   . PRO B 2 243 ? 48.764  -6.352  -1.953  1.00 98.57  ? 243  PRO B O   1 
ATOM   6007 C CB  . PRO B 2 243 ? 51.943  -6.942  -2.469  1.00 99.95  ? 243  PRO B CB  1 
ATOM   6008 C CG  . PRO B 2 243 ? 51.233  -7.384  -3.729  1.00 110.95 ? 243  PRO B CG  1 
ATOM   6009 C CD  . PRO B 2 243 ? 50.657  -8.735  -3.328  1.00 115.01 ? 243  PRO B CD  1 
ATOM   6010 N N   . ILE B 2 244 ? 50.089  -5.158  -0.591  1.00 86.00  ? 244  ILE B N   1 
ATOM   6011 C CA  . ILE B 2 244 ? 49.115  -4.092  -0.515  1.00 81.59  ? 244  ILE B CA  1 
ATOM   6012 C C   . ILE B 2 244 ? 49.293  -3.340  -1.804  1.00 78.82  ? 244  ILE B C   1 
ATOM   6013 O O   . ILE B 2 244 ? 50.423  -3.104  -2.219  1.00 73.65  ? 244  ILE B O   1 
ATOM   6014 C CB  . ILE B 2 244 ? 49.392  -3.183  0.659   1.00 81.68  ? 244  ILE B CB  1 
ATOM   6015 C CG1 . ILE B 2 244 ? 48.883  -3.869  1.928   1.00 85.53  ? 244  ILE B CG1 1 
ATOM   6016 C CG2 . ILE B 2 244 ? 48.746  -1.824  0.428   1.00 73.88  ? 244  ILE B CG2 1 
ATOM   6017 C CD1 . ILE B 2 244 ? 49.355  -3.233  3.199   1.00 89.24  ? 244  ILE B CD1 1 
ATOM   6018 N N   . VAL B 2 245 ? 48.189  -2.987  -2.450  1.00 85.20  ? 245  VAL B N   1 
ATOM   6019 C CA  . VAL B 2 245 ? 48.270  -2.283  -3.725  1.00 93.31  ? 245  VAL B CA  1 
ATOM   6020 C C   . VAL B 2 245 ? 47.746  -0.874  -3.719  1.00 91.69  ? 245  VAL B C   1 
ATOM   6021 O O   . VAL B 2 245 ? 46.908  -0.513  -2.899  1.00 94.68  ? 245  VAL B O   1 
ATOM   6022 C CB  . VAL B 2 245 ? 47.542  -3.044  -4.859  1.00 100.41 ? 245  VAL B CB  1 
ATOM   6023 C CG1 . VAL B 2 245 ? 48.474  -4.090  -5.448  1.00 101.04 ? 245  VAL B CG1 1 
ATOM   6024 C CG2 . VAL B 2 245 ? 46.266  -3.701  -4.328  1.00 101.53 ? 245  VAL B CG2 1 
ATOM   6025 N N   . LEU B 2 246 ? 48.247  -0.088  -4.665  1.00 91.39  ? 246  LEU B N   1 
ATOM   6026 C CA  . LEU B 2 246 ? 47.852  1.302   -4.791  1.00 92.38  ? 246  LEU B CA  1 
ATOM   6027 C C   . LEU B 2 246 ? 47.251  1.542   -6.158  1.00 84.72  ? 246  LEU B C   1 
ATOM   6028 O O   . LEU B 2 246 ? 47.716  0.994   -7.153  1.00 76.59  ? 246  LEU B O   1 
ATOM   6029 C CB  . LEU B 2 246 ? 49.061  2.215   -4.583  1.00 96.66  ? 246  LEU B CB  1 
ATOM   6030 C CG  . LEU B 2 246 ? 49.768  2.118   -3.222  1.00 89.53  ? 246  LEU B CG  1 
ATOM   6031 C CD1 . LEU B 2 246 ? 51.086  2.902   -3.270  1.00 90.92  ? 246  LEU B CD1 1 
ATOM   6032 C CD2 . LEU B 2 246 ? 48.855  2.642   -2.116  1.00 84.97  ? 246  LEU B CD2 1 
ATOM   6033 N N   . PRO B 2 247 ? 46.199  2.370   -6.219  1.00 86.82  ? 247  PRO B N   1 
ATOM   6034 C CA  . PRO B 2 247 ? 45.537  2.673   -7.484  1.00 84.33  ? 247  PRO B CA  1 
ATOM   6035 C C   . PRO B 2 247 ? 46.490  3.402   -8.390  1.00 78.78  ? 247  PRO B C   1 
ATOM   6036 O O   . PRO B 2 247 ? 47.075  4.405   -8.004  1.00 67.78  ? 247  PRO B O   1 
ATOM   6037 C CB  . PRO B 2 247 ? 44.379  3.581   -7.072  1.00 90.99  ? 247  PRO B CB  1 
ATOM   6038 C CG  . PRO B 2 247 ? 44.171  3.283   -5.603  1.00 92.71  ? 247  PRO B CG  1 
ATOM   6039 C CD  . PRO B 2 247 ? 45.580  3.124   -5.114  1.00 92.43  ? 247  PRO B CD  1 
ATOM   6040 N N   . GLU B 2 248 ? 46.676  2.882   -9.586  1.00 82.01  ? 248  GLU B N   1 
ATOM   6041 C CA  . GLU B 2 248 ? 47.530  3.573   -10.514 1.00 85.79  ? 248  GLU B CA  1 
ATOM   6042 C C   . GLU B 2 248 ? 46.445  4.274   -11.296 1.00 87.36  ? 248  GLU B C   1 
ATOM   6043 O O   . GLU B 2 248 ? 45.448  3.638   -11.632 1.00 87.67  ? 248  GLU B O   1 
ATOM   6044 C CB  . GLU B 2 248 ? 48.292  2.587   -11.406 1.00 87.30  ? 248  GLU B CB  1 
ATOM   6045 C CG  . GLU B 2 248 ? 49.481  3.224   -12.123 1.00 99.24  ? 248  GLU B CG  1 
ATOM   6046 C CD  . GLU B 2 248 ? 50.823  2.770   -11.574 1.00 105.81 ? 248  GLU B CD  1 
ATOM   6047 O OE1 . GLU B 2 248 ? 51.818  3.521   -11.718 1.00 92.94  ? 248  GLU B OE1 1 
ATOM   6048 O OE2 . GLU B 2 248 ? 50.880  1.653   -11.013 1.00 111.07 ? 248  GLU B OE2 1 
ATOM   6049 N N   . LYS B 2 249 ? 46.579  5.577   -11.531 1.00 90.71  ? 249  LYS B N   1 
ATOM   6050 C CA  . LYS B 2 249 ? 45.553  6.269   -12.309 1.00 94.73  ? 249  LYS B CA  1 
ATOM   6051 C C   . LYS B 2 249 ? 45.964  7.527   -13.059 1.00 94.93  ? 249  LYS B C   1 
ATOM   6052 O O   . LYS B 2 249 ? 46.880  8.245   -12.665 1.00 95.01  ? 249  LYS B O   1 
ATOM   6053 C CB  . LYS B 2 249 ? 44.316  6.572   -11.461 1.00 94.87  ? 249  LYS B CB  1 
ATOM   6054 C CG  . LYS B 2 249 ? 44.540  7.408   -10.229 1.00 88.06  ? 249  LYS B CG  1 
ATOM   6055 C CD  . LYS B 2 249 ? 43.245  8.119   -9.841  1.00 93.44  ? 249  LYS B CD  1 
ATOM   6056 C CE  . LYS B 2 249 ? 41.991  7.239   -10.028 1.00 94.31  ? 249  LYS B CE  1 
ATOM   6057 N NZ  . LYS B 2 249 ? 42.014  5.954   -9.264  1.00 89.05  ? 249  LYS B NZ  1 
ATOM   6058 N N   . ASP B 2 250 ? 45.243  7.765   -14.152 1.00 95.18  ? 250  ASP B N   1 
ATOM   6059 C CA  . ASP B 2 250 ? 45.447  8.883   -15.068 1.00 92.73  ? 250  ASP B CA  1 
ATOM   6060 C C   . ASP B 2 250 ? 45.471  10.247  -14.388 1.00 85.04  ? 250  ASP B C   1 
ATOM   6061 O O   . ASP B 2 250 ? 46.517  10.891  -14.294 1.00 75.39  ? 250  ASP B O   1 
ATOM   6062 C CB  . ASP B 2 250 ? 44.349  8.838   -16.127 1.00 101.97 ? 250  ASP B CB  1 
ATOM   6063 C CG  . ASP B 2 250 ? 44.865  9.135   -17.505 1.00 116.80 ? 250  ASP B CG  1 
ATOM   6064 O OD1 . ASP B 2 250 ? 44.826  10.321  -17.896 1.00 130.88 ? 250  ASP B OD1 1 
ATOM   6065 O OD2 . ASP B 2 250 ? 45.319  8.186   -18.186 1.00 116.88 ? 250  ASP B OD2 1 
ATOM   6066 N N   . SER B 2 251 ? 44.310  10.698  -13.932 1.00 88.91  ? 251  SER B N   1 
ATOM   6067 C CA  . SER B 2 251 ? 44.216  11.977  -13.240 1.00 91.36  ? 251  SER B CA  1 
ATOM   6068 C C   . SER B 2 251 ? 43.824  11.695  -11.798 1.00 88.56  ? 251  SER B C   1 
ATOM   6069 O O   . SER B 2 251 ? 43.102  10.730  -11.510 1.00 91.87  ? 251  SER B O   1 
ATOM   6070 C CB  . SER B 2 251 ? 43.170  12.878  -13.902 1.00 95.25  ? 251  SER B CB  1 
ATOM   6071 O OG  . SER B 2 251 ? 43.573  13.254  -15.207 1.00 95.20  ? 251  SER B OG  1 
ATOM   6072 N N   . TRP B 2 252 ? 44.304  12.530  -10.890 1.00 79.76  ? 252  TRP B N   1 
ATOM   6073 C CA  . TRP B 2 252 ? 43.995  12.331  -9.486  1.00 79.61  ? 252  TRP B CA  1 
ATOM   6074 C C   . TRP B 2 252 ? 43.137  13.444  -8.902  1.00 78.66  ? 252  TRP B C   1 
ATOM   6075 O O   . TRP B 2 252 ? 43.570  14.594  -8.845  1.00 74.93  ? 252  TRP B O   1 
ATOM   6076 C CB  . TRP B 2 252 ? 45.286  12.206  -8.669  1.00 84.29  ? 252  TRP B CB  1 
ATOM   6077 C CG  . TRP B 2 252 ? 46.101  10.972  -8.983  1.00 93.03  ? 252  TRP B CG  1 
ATOM   6078 C CD1 . TRP B 2 252 ? 46.867  10.764  -10.086 1.00 100.28 ? 252  TRP B CD1 1 
ATOM   6079 C CD2 . TRP B 2 252 ? 46.193  9.766   -8.198  1.00 98.35  ? 252  TRP B CD2 1 
ATOM   6080 N NE1 . TRP B 2 252 ? 47.430  9.510   -10.045 1.00 103.41 ? 252  TRP B NE1 1 
ATOM   6081 C CE2 . TRP B 2 252 ? 47.032  8.877   -8.898  1.00 98.46  ? 252  TRP B CE2 1 
ATOM   6082 C CE3 . TRP B 2 252 ? 45.647  9.355   -6.973  1.00 98.37  ? 252  TRP B CE3 1 
ATOM   6083 C CZ2 . TRP B 2 252 ? 47.339  7.599   -8.420  1.00 96.58  ? 252  TRP B CZ2 1 
ATOM   6084 C CZ3 . TRP B 2 252 ? 45.955  8.080   -6.497  1.00 97.44  ? 252  TRP B CZ3 1 
ATOM   6085 C CH2 . TRP B 2 252 ? 46.793  7.220   -7.222  1.00 95.25  ? 252  TRP B CH2 1 
ATOM   6086 N N   . THR B 2 253 ? 41.928  13.093  -8.459  1.00 78.19  ? 253  THR B N   1 
ATOM   6087 C CA  . THR B 2 253 ? 41.001  14.055  -7.850  1.00 71.09  ? 253  THR B CA  1 
ATOM   6088 C C   . THR B 2 253 ? 41.313  14.196  -6.359  1.00 66.64  ? 253  THR B C   1 
ATOM   6089 O O   . THR B 2 253 ? 42.099  13.434  -5.809  1.00 69.84  ? 253  THR B O   1 
ATOM   6090 C CB  . THR B 2 253 ? 39.544  13.590  -7.985  1.00 66.79  ? 253  THR B CB  1 
ATOM   6091 O OG1 . THR B 2 253 ? 39.232  12.676  -6.926  1.00 55.83  ? 253  THR B OG1 1 
ATOM   6092 C CG2 . THR B 2 253 ? 39.340  12.887  -9.324  1.00 65.69  ? 253  THR B CG2 1 
ATOM   6093 N N   . VAL B 2 254 ? 40.698  15.166  -5.701  1.00 60.96  ? 254  VAL B N   1 
ATOM   6094 C CA  . VAL B 2 254 ? 40.945  15.369  -4.280  1.00 63.74  ? 254  VAL B CA  1 
ATOM   6095 C C   . VAL B 2 254 ? 40.569  14.117  -3.489  1.00 60.04  ? 254  VAL B C   1 
ATOM   6096 O O   . VAL B 2 254 ? 41.290  13.697  -2.591  1.00 63.03  ? 254  VAL B O   1 
ATOM   6097 C CB  . VAL B 2 254 ? 40.129  16.567  -3.740  1.00 77.93  ? 254  VAL B CB  1 
ATOM   6098 C CG1 . VAL B 2 254 ? 40.390  16.749  -2.257  1.00 76.48  ? 254  VAL B CG1 1 
ATOM   6099 C CG2 . VAL B 2 254 ? 40.493  17.829  -4.496  1.00 86.42  ? 254  VAL B CG2 1 
ATOM   6100 N N   . ASN B 2 255 ? 39.425  13.534  -3.825  1.00 53.74  ? 255  ASN B N   1 
ATOM   6101 C CA  . ASN B 2 255 ? 38.941  12.333  -3.171  1.00 49.22  ? 255  ASN B CA  1 
ATOM   6102 C C   . ASN B 2 255 ? 40.006  11.248  -3.263  1.00 57.05  ? 255  ASN B C   1 
ATOM   6103 O O   . ASN B 2 255 ? 40.458  10.722  -2.245  1.00 64.65  ? 255  ASN B O   1 
ATOM   6104 C CB  . ASN B 2 255 ? 37.679  11.850  -3.875  1.00 48.93  ? 255  ASN B CB  1 
ATOM   6105 C CG  . ASN B 2 255 ? 37.038  10.664  -3.184  1.00 52.93  ? 255  ASN B CG  1 
ATOM   6106 O OD1 . ASN B 2 255 ? 36.462  9.793   -3.832  1.00 58.02  ? 255  ASN B OD1 1 
ATOM   6107 N ND2 . ASN B 2 255 ? 37.118  10.633  -1.860  1.00 48.27  ? 255  ASN B ND2 1 
ATOM   6108 N N   . ASP B 2 256 ? 40.375  10.918  -4.505  1.00 57.67  ? 256  ASP B N   1 
ATOM   6109 C CA  . ASP B 2 256 ? 41.396  9.912   -4.838  1.00 51.29  ? 256  ASP B CA  1 
ATOM   6110 C C   . ASP B 2 256 ? 42.567  9.988   -3.874  1.00 51.94  ? 256  ASP B C   1 
ATOM   6111 O O   . ASP B 2 256 ? 42.972  8.997   -3.253  1.00 51.03  ? 256  ASP B O   1 
ATOM   6112 C CB  . ASP B 2 256 ? 41.932  10.158  -6.254  1.00 40.41  ? 256  ASP B CB  1 
ATOM   6113 C CG  . ASP B 2 256 ? 40.918  9.830   -7.331  1.00 69.07  ? 256  ASP B CG  1 
ATOM   6114 O OD1 . ASP B 2 256 ? 40.981  10.412  -8.442  1.00 66.36  ? 256  ASP B OD1 1 
ATOM   6115 O OD2 . ASP B 2 256 ? 40.059  8.970   -7.067  1.00 79.28  ? 256  ASP B OD2 1 
ATOM   6116 N N   . ILE B 2 257 ? 43.103  11.194  -3.769  1.00 48.03  ? 257  ILE B N   1 
ATOM   6117 C CA  . ILE B 2 257 ? 44.231  11.469  -2.916  1.00 54.58  ? 257  ILE B CA  1 
ATOM   6118 C C   . ILE B 2 257 ? 43.907  11.229  -1.454  1.00 59.54  ? 257  ILE B C   1 
ATOM   6119 O O   . ILE B 2 257 ? 44.712  10.637  -0.734  1.00 64.82  ? 257  ILE B O   1 
ATOM   6120 C CB  . ILE B 2 257 ? 44.687  12.912  -3.110  1.00 63.74  ? 257  ILE B CB  1 
ATOM   6121 C CG1 . ILE B 2 257 ? 44.962  13.147  -4.593  1.00 71.75  ? 257  ILE B CG1 1 
ATOM   6122 C CG2 . ILE B 2 257 ? 45.950  13.190  -2.285  1.00 57.19  ? 257  ILE B CG2 1 
ATOM   6123 C CD1 . ILE B 2 257 ? 45.383  14.555  -4.907  1.00 88.26  ? 257  ILE B CD1 1 
ATOM   6124 N N   . GLN B 2 258 ? 42.740  11.685  -1.007  1.00 57.55  ? 258  GLN B N   1 
ATOM   6125 C CA  . GLN B 2 258 ? 42.370  11.479  0.385   1.00 56.79  ? 258  GLN B CA  1 
ATOM   6126 C C   . GLN B 2 258 ? 42.363  9.996   0.689   1.00 59.44  ? 258  GLN B C   1 
ATOM   6127 O O   . GLN B 2 258 ? 42.881  9.560   1.721   1.00 61.91  ? 258  GLN B O   1 
ATOM   6128 C CB  . GLN B 2 258 ? 41.008  12.055  0.665   1.00 53.80  ? 258  GLN B CB  1 
ATOM   6129 C CG  . GLN B 2 258 ? 40.957  13.515  0.434   1.00 59.94  ? 258  GLN B CG  1 
ATOM   6130 C CD  . GLN B 2 258 ? 39.613  14.045  0.777   1.00 70.38  ? 258  GLN B CD  1 
ATOM   6131 O OE1 . GLN B 2 258 ? 38.592  13.469  0.384   1.00 67.08  ? 258  GLN B OE1 1 
ATOM   6132 N NE2 . GLN B 2 258 ? 39.583  15.145  1.520   1.00 71.18  ? 258  GLN B NE2 1 
ATOM   6133 N N   . LYS B 2 259 ? 41.771  9.214   -0.203  1.00 52.40  ? 259  LYS B N   1 
ATOM   6134 C CA  . LYS B 2 259 ? 41.760  7.780   0.009   1.00 55.32  ? 259  LYS B CA  1 
ATOM   6135 C C   . LYS B 2 259 ? 43.214  7.300   0.041   1.00 53.44  ? 259  LYS B C   1 
ATOM   6136 O O   . LYS B 2 259 ? 43.628  6.510   0.893   1.00 43.44  ? 259  LYS B O   1 
ATOM   6137 C CB  . LYS B 2 259 ? 40.987  7.099   -1.114  1.00 60.73  ? 259  LYS B CB  1 
ATOM   6138 C CG  . LYS B 2 259 ? 39.498  7.397   -1.082  1.00 68.62  ? 259  LYS B CG  1 
ATOM   6139 C CD  . LYS B 2 259 ? 38.740  6.290   -1.778  1.00 83.32  ? 259  LYS B CD  1 
ATOM   6140 C CE  . LYS B 2 259 ? 37.519  5.897   -0.972  1.00 100.06 ? 259  LYS B CE  1 
ATOM   6141 N NZ  . LYS B 2 259 ? 37.183  4.460   -1.191  1.00 113.08 ? 259  LYS B NZ  1 
ATOM   6142 N N   . LEU B 2 260 ? 43.995  7.812   -0.891  1.00 55.45  ? 260  LEU B N   1 
ATOM   6143 C CA  . LEU B 2 260 ? 45.393  7.454   -0.970  1.00 56.96  ? 260  LEU B CA  1 
ATOM   6144 C C   . LEU B 2 260 ? 46.112  7.659   0.364   1.00 56.49  ? 260  LEU B C   1 
ATOM   6145 O O   . LEU B 2 260 ? 46.669  6.722   0.926   1.00 60.54  ? 260  LEU B O   1 
ATOM   6146 C CB  . LEU B 2 260 ? 46.062  8.293   -2.047  1.00 58.48  ? 260  LEU B CB  1 
ATOM   6147 C CG  . LEU B 2 260 ? 47.508  7.919   -2.354  1.00 57.16  ? 260  LEU B CG  1 
ATOM   6148 C CD1 . LEU B 2 260 ? 47.580  6.466   -2.848  1.00 39.88  ? 260  LEU B CD1 1 
ATOM   6149 C CD2 . LEU B 2 260 ? 48.047  8.892   -3.389  1.00 54.34  ? 260  LEU B CD2 1 
ATOM   6150 N N   . VAL B 2 261 ? 46.103  8.890   0.858   1.00 57.15  ? 261  VAL B N   1 
ATOM   6151 C CA  . VAL B 2 261 ? 46.756  9.207   2.122   1.00 66.57  ? 261  VAL B CA  1 
ATOM   6152 C C   . VAL B 2 261 ? 46.288  8.268   3.239   1.00 65.59  ? 261  VAL B C   1 
ATOM   6153 O O   . VAL B 2 261 ? 47.102  7.700   3.971   1.00 60.50  ? 261  VAL B O   1 
ATOM   6154 C CB  . VAL B 2 261 ? 46.479  10.682  2.538   1.00 73.71  ? 261  VAL B CB  1 
ATOM   6155 C CG1 . VAL B 2 261 ? 46.960  10.920  3.952   1.00 82.18  ? 261  VAL B CG1 1 
ATOM   6156 C CG2 . VAL B 2 261 ? 47.186  11.646  1.583   1.00 77.43  ? 261  VAL B CG2 1 
ATOM   6157 N N   . GLY B 2 262 ? 44.973  8.108   3.355   1.00 66.68  ? 262  GLY B N   1 
ATOM   6158 C CA  . GLY B 2 262 ? 44.417  7.245   4.377   1.00 62.10  ? 262  GLY B CA  1 
ATOM   6159 C C   . GLY B 2 262 ? 45.011  5.857   4.296   1.00 62.99  ? 262  GLY B C   1 
ATOM   6160 O O   . GLY B 2 262 ? 45.544  5.344   5.283   1.00 68.28  ? 262  GLY B O   1 
ATOM   6161 N N   . LYS B 2 263 ? 44.928  5.241   3.122   1.00 65.74  ? 263  LYS B N   1 
ATOM   6162 C CA  . LYS B 2 263 ? 45.477  3.903   2.963   1.00 70.85  ? 263  LYS B CA  1 
ATOM   6163 C C   . LYS B 2 263 ? 46.926  3.895   3.427   1.00 71.69  ? 263  LYS B C   1 
ATOM   6164 O O   . LYS B 2 263 ? 47.321  3.081   4.259   1.00 68.13  ? 263  LYS B O   1 
ATOM   6165 C CB  . LYS B 2 263 ? 45.392  3.455   1.501   1.00 71.54  ? 263  LYS B CB  1 
ATOM   6166 C CG  . LYS B 2 263 ? 45.688  1.956   1.312   1.00 78.87  ? 263  LYS B CG  1 
ATOM   6167 C CD  . LYS B 2 263 ? 44.937  1.322   0.105   1.00 86.02  ? 263  LYS B CD  1 
ATOM   6168 C CE  . LYS B 2 263 ? 45.074  -0.218  0.110   1.00 88.78  ? 263  LYS B CE  1 
ATOM   6169 N NZ  . LYS B 2 263 ? 44.281  -0.967  -0.923  1.00 79.60  ? 263  LYS B NZ  1 
ATOM   6170 N N   . LEU B 2 264 ? 47.708  4.823   2.893   1.00 73.62  ? 264  LEU B N   1 
ATOM   6171 C CA  . LEU B 2 264 ? 49.110  4.932   3.250   1.00 75.28  ? 264  LEU B CA  1 
ATOM   6172 C C   . LEU B 2 264 ? 49.299  4.981   4.753   1.00 82.12  ? 264  LEU B C   1 
ATOM   6173 O O   . LEU B 2 264 ? 50.027  4.171   5.315   1.00 88.82  ? 264  LEU B O   1 
ATOM   6174 C CB  . LEU B 2 264 ? 49.715  6.177   2.616   1.00 69.68  ? 264  LEU B CB  1 
ATOM   6175 C CG  . LEU B 2 264 ? 49.737  6.127   1.091   1.00 64.73  ? 264  LEU B CG  1 
ATOM   6176 C CD1 . LEU B 2 264 ? 50.173  7.469   0.531   1.00 64.21  ? 264  LEU B CD1 1 
ATOM   6177 C CD2 . LEU B 2 264 ? 50.668  5.022   0.648   1.00 51.65  ? 264  LEU B CD2 1 
ATOM   6178 N N   . ASN B 2 265 ? 48.640  5.927   5.409   1.00 84.63  ? 265  ASN B N   1 
ATOM   6179 C CA  . ASN B 2 265 ? 48.767  6.049   6.848   1.00 83.00  ? 265  ASN B CA  1 
ATOM   6180 C C   . ASN B 2 265 ? 48.633  4.735   7.557   1.00 79.71  ? 265  ASN B C   1 
ATOM   6181 O O   . ASN B 2 265 ? 49.466  4.376   8.379   1.00 88.07  ? 265  ASN B O   1 
ATOM   6182 C CB  . ASN B 2 265 ? 47.746  7.023   7.389   1.00 86.25  ? 265  ASN B CB  1 
ATOM   6183 C CG  . ASN B 2 265 ? 48.334  8.383   7.580   1.00 105.46 ? 265  ASN B CG  1 
ATOM   6184 O OD1 . ASN B 2 265 ? 48.819  8.999   6.628   1.00 112.22 ? 265  ASN B OD1 1 
ATOM   6185 N ND2 . ASN B 2 265 ? 48.328  8.860   8.819   1.00 114.63 ? 265  ASN B ND2 1 
ATOM   6186 N N   . TRP B 2 266 ? 47.568  4.019   7.259   1.00 71.85  ? 266  TRP B N   1 
ATOM   6187 C CA  . TRP B 2 266 ? 47.384  2.728   7.871   1.00 75.10  ? 266  TRP B CA  1 
ATOM   6188 C C   . TRP B 2 266 ? 48.669  1.955   7.585   1.00 77.04  ? 266  TRP B C   1 
ATOM   6189 O O   . TRP B 2 266 ? 49.446  1.663   8.493   1.00 75.08  ? 266  TRP B O   1 
ATOM   6190 C CB  . TRP B 2 266 ? 46.187  2.044   7.232   1.00 87.00  ? 266  TRP B CB  1 
ATOM   6191 C CG  . TRP B 2 266 ? 46.089  0.569   7.473   1.00 110.22 ? 266  TRP B CG  1 
ATOM   6192 C CD1 . TRP B 2 266 ? 45.708  -0.053  8.632   1.00 112.85 ? 266  TRP B CD1 1 
ATOM   6193 C CD2 . TRP B 2 266 ? 46.287  -0.478  6.498   1.00 120.89 ? 266  TRP B CD2 1 
ATOM   6194 N NE1 . TRP B 2 266 ? 45.643  -1.419  8.434   1.00 124.50 ? 266  TRP B NE1 1 
ATOM   6195 C CE2 . TRP B 2 266 ? 45.994  -1.708  7.138   1.00 122.59 ? 266  TRP B CE2 1 
ATOM   6196 C CE3 . TRP B 2 266 ? 46.681  -0.494  5.145   1.00 113.05 ? 266  TRP B CE3 1 
ATOM   6197 C CZ2 . TRP B 2 266 ? 46.080  -2.946  6.470   1.00 113.21 ? 266  TRP B CZ2 1 
ATOM   6198 C CZ3 . TRP B 2 266 ? 46.766  -1.724  4.482   1.00 106.58 ? 266  TRP B CZ3 1 
ATOM   6199 C CH2 . TRP B 2 266 ? 46.466  -2.932  5.149   1.00 111.97 ? 266  TRP B CH2 1 
ATOM   6200 N N   . ALA B 2 267 ? 48.903  1.671   6.307   1.00 78.60  ? 267  ALA B N   1 
ATOM   6201 C CA  . ALA B 2 267 ? 50.076  0.920   5.856   1.00 75.97  ? 267  ALA B CA  1 
ATOM   6202 C C   . ALA B 2 267 ? 51.416  1.398   6.422   1.00 82.78  ? 267  ALA B C   1 
ATOM   6203 O O   . ALA B 2 267 ? 52.398  0.652   6.412   1.00 86.34  ? 267  ALA B O   1 
ATOM   6204 C CB  . ALA B 2 267 ? 50.135  0.924   4.330   1.00 59.02  ? 267  ALA B CB  1 
ATOM   6205 N N   . SER B 2 268 ? 51.461  2.633   6.911   1.00 83.51  ? 268  SER B N   1 
ATOM   6206 C CA  . SER B 2 268 ? 52.695  3.187   7.461   1.00 87.76  ? 268  SER B CA  1 
ATOM   6207 C C   . SER B 2 268 ? 53.054  2.516   8.785   1.00 94.29  ? 268  SER B C   1 
ATOM   6208 O O   . SER B 2 268 ? 54.231  2.442   9.170   1.00 87.23  ? 268  SER B O   1 
ATOM   6209 C CB  . SER B 2 268 ? 52.533  4.685   7.689   1.00 87.36  ? 268  SER B CB  1 
ATOM   6210 O OG  . SER B 2 268 ? 51.639  4.928   8.765   1.00 88.34  ? 268  SER B OG  1 
ATOM   6211 N N   . GLN B 2 269 ? 52.034  2.035   9.489   1.00 104.00 ? 269  GLN B N   1 
ATOM   6212 C CA  . GLN B 2 269 ? 52.275  1.380   10.762  1.00 111.44 ? 269  GLN B CA  1 
ATOM   6213 C C   . GLN B 2 269 ? 53.036  0.076   10.557  1.00 107.84 ? 269  GLN B C   1 
ATOM   6214 O O   . GLN B 2 269 ? 53.699  -0.408  11.468  1.00 104.90 ? 269  GLN B O   1 
ATOM   6215 C CB  . GLN B 2 269 ? 50.957  1.154   11.520  1.00 117.15 ? 269  GLN B CB  1 
ATOM   6216 C CG  . GLN B 2 269 ? 49.927  0.260   10.861  1.00 117.86 ? 269  GLN B CG  1 
ATOM   6217 C CD  . GLN B 2 269 ? 48.515  0.589   11.336  1.00 126.51 ? 269  GLN B CD  1 
ATOM   6218 O OE1 . GLN B 2 269 ? 47.567  -0.157  11.088  1.00 138.11 ? 269  GLN B OE1 1 
ATOM   6219 N NE2 . GLN B 2 269 ? 48.371  1.723   12.011  1.00 118.69 ? 269  GLN B NE2 1 
ATOM   6220 N N   . ILE B 2 270 ? 52.951  -0.480  9.352   1.00 107.30 ? 270  ILE B N   1 
ATOM   6221 C CA  . ILE B 2 270 ? 53.672  -1.709  9.026   1.00 106.59 ? 270  ILE B CA  1 
ATOM   6222 C C   . ILE B 2 270 ? 55.024  -1.302  8.409   1.00 105.25 ? 270  ILE B C   1 
ATOM   6223 O O   . ILE B 2 270 ? 56.092  -1.682  8.898   1.00 109.96 ? 270  ILE B O   1 
ATOM   6224 C CB  . ILE B 2 270 ? 52.865  -2.601  8.025   1.00 109.60 ? 270  ILE B CB  1 
ATOM   6225 C CG1 . ILE B 2 270 ? 51.560  -3.086  8.677   1.00 111.19 ? 270  ILE B CG1 1 
ATOM   6226 C CG2 . ILE B 2 270 ? 53.703  -3.804  7.585   1.00 108.46 ? 270  ILE B CG2 1 
ATOM   6227 C CD1 . ILE B 2 270 ? 50.708  -4.013  7.778   1.00 106.00 ? 270  ILE B CD1 1 
ATOM   6228 N N   . TYR B 2 271 ? 54.974  -0.513  7.343   1.00 100.19 ? 271  TYR B N   1 
ATOM   6229 C CA  . TYR B 2 271 ? 56.190  -0.044  6.689   1.00 94.91  ? 271  TYR B CA  1 
ATOM   6230 C C   . TYR B 2 271 ? 56.378  1.419   7.106   1.00 95.02  ? 271  TYR B C   1 
ATOM   6231 O O   . TYR B 2 271 ? 55.725  2.319   6.564   1.00 94.94  ? 271  TYR B O   1 
ATOM   6232 C CB  . TYR B 2 271 ? 56.040  -0.117  5.169   1.00 91.69  ? 271  TYR B CB  1 
ATOM   6233 C CG  . TYR B 2 271 ? 55.714  -1.482  4.579   1.00 88.27  ? 271  TYR B CG  1 
ATOM   6234 C CD1 . TYR B 2 271 ? 56.723  -2.361  4.183   1.00 86.07  ? 271  TYR B CD1 1 
ATOM   6235 C CD2 . TYR B 2 271 ? 54.393  -1.867  4.351   1.00 85.71  ? 271  TYR B CD2 1 
ATOM   6236 C CE1 . TYR B 2 271 ? 56.423  -3.588  3.564   1.00 83.58  ? 271  TYR B CE1 1 
ATOM   6237 C CE2 . TYR B 2 271 ? 54.085  -3.091  3.732   1.00 80.34  ? 271  TYR B CE2 1 
ATOM   6238 C CZ  . TYR B 2 271 ? 55.107  -3.939  3.341   1.00 83.99  ? 271  TYR B CZ  1 
ATOM   6239 O OH  . TYR B 2 271 ? 54.813  -5.124  2.711   1.00 91.29  ? 271  TYR B OH  1 
ATOM   6240 N N   . PRO B 2 272 ? 57.264  1.675   8.082   1.00 88.76  ? 272  PRO B N   1 
ATOM   6241 C CA  . PRO B 2 272 ? 57.517  3.038   8.557   1.00 86.41  ? 272  PRO B CA  1 
ATOM   6242 C C   . PRO B 2 272 ? 58.234  3.943   7.549   1.00 84.08  ? 272  PRO B C   1 
ATOM   6243 O O   . PRO B 2 272 ? 58.312  5.163   7.729   1.00 76.50  ? 272  PRO B O   1 
ATOM   6244 C CB  . PRO B 2 272 ? 58.333  2.805   9.824   1.00 86.15  ? 272  PRO B CB  1 
ATOM   6245 C CG  . PRO B 2 272 ? 59.098  1.576   9.493   1.00 81.72  ? 272  PRO B CG  1 
ATOM   6246 C CD  . PRO B 2 272 ? 58.053  0.700   8.852   1.00 80.77  ? 272  PRO B CD  1 
ATOM   6247 N N   . GLY B 2 273 ? 58.749  3.348   6.481   1.00 84.77  ? 273  GLY B N   1 
ATOM   6248 C CA  . GLY B 2 273 ? 59.445  4.142   5.485   1.00 94.72  ? 273  GLY B CA  1 
ATOM   6249 C C   . GLY B 2 273 ? 58.519  4.956   4.601   1.00 101.68 ? 273  GLY B C   1 
ATOM   6250 O O   . GLY B 2 273 ? 58.966  5.771   3.784   1.00 105.99 ? 273  GLY B O   1 
ATOM   6251 N N   . ILE B 2 274 ? 57.219  4.745   4.769   1.00 102.30 ? 274  ILE B N   1 
ATOM   6252 C CA  . ILE B 2 274 ? 56.229  5.444   3.965   1.00 99.41  ? 274  ILE B CA  1 
ATOM   6253 C C   . ILE B 2 274 ? 55.959  6.883   4.417   1.00 101.97 ? 274  ILE B C   1 
ATOM   6254 O O   . ILE B 2 274 ? 55.620  7.137   5.575   1.00 106.78 ? 274  ILE B O   1 
ATOM   6255 C CB  . ILE B 2 274 ? 54.920  4.630   3.933   1.00 94.61  ? 274  ILE B CB  1 
ATOM   6256 C CG1 . ILE B 2 274 ? 55.162  3.333   3.153   1.00 87.15  ? 274  ILE B CG1 1 
ATOM   6257 C CG2 . ILE B 2 274 ? 53.800  5.450   3.308   1.00 100.59 ? 274  ILE B CG2 1 
ATOM   6258 C CD1 . ILE B 2 274 ? 53.960  2.413   3.055   1.00 85.93  ? 274  ILE B CD1 1 
ATOM   6259 N N   . LYS B 2 275 ? 56.123  7.822   3.488   1.00 100.99 ? 275  LYS B N   1 
ATOM   6260 C CA  . LYS B 2 275 ? 55.898  9.235   3.771   1.00 98.49  ? 275  LYS B CA  1 
ATOM   6261 C C   . LYS B 2 275 ? 54.717  9.722   2.940   1.00 97.25  ? 275  LYS B C   1 
ATOM   6262 O O   . LYS B 2 275 ? 54.562  9.317   1.787   1.00 96.63  ? 275  LYS B O   1 
ATOM   6263 C CB  . LYS B 2 275 ? 57.155  10.047  3.436   1.00 94.27  ? 275  LYS B CB  1 
ATOM   6264 C CG  . LYS B 2 275 ? 58.427  9.482   4.064   1.00 94.15  ? 275  LYS B CG  1 
ATOM   6265 C CD  . LYS B 2 275 ? 59.546  10.505  4.108   1.00 94.01  ? 275  LYS B CD  1 
ATOM   6266 C CE  . LYS B 2 275 ? 60.885  9.877   4.504   1.00 98.60  ? 275  LYS B CE  1 
ATOM   6267 N NZ  . LYS B 2 275 ? 60.899  9.197   5.836   1.00 101.84 ? 275  LYS B NZ  1 
ATOM   6268 N N   . VAL B 2 276 ? 53.882  10.573  3.533   1.00 98.95  ? 276  VAL B N   1 
ATOM   6269 C CA  . VAL B 2 276 ? 52.706  11.126  2.852   1.00 99.43  ? 276  VAL B CA  1 
ATOM   6270 C C   . VAL B 2 276 ? 52.806  12.647  2.802   1.00 98.58  ? 276  VAL B C   1 
ATOM   6271 O O   . VAL B 2 276 ? 51.974  13.326  2.192   1.00 97.17  ? 276  VAL B O   1 
ATOM   6272 C CB  . VAL B 2 276 ? 51.389  10.735  3.583   1.00 94.39  ? 276  VAL B CB  1 
ATOM   6273 C CG1 . VAL B 2 276 ? 50.219  11.533  3.039   1.00 90.09  ? 276  VAL B CG1 1 
ATOM   6274 C CG2 . VAL B 2 276 ? 51.112  9.265   3.402   1.00 90.72  ? 276  VAL B CG2 1 
ATOM   6275 N N   . ARG B 2 277 ? 53.846  13.171  3.443   1.00 95.03  ? 277  ARG B N   1 
ATOM   6276 C CA  . ARG B 2 277 ? 54.059  14.605  3.498   1.00 94.23  ? 277  ARG B CA  1 
ATOM   6277 C C   . ARG B 2 277 ? 53.628  15.332  2.232   1.00 95.41  ? 277  ARG B C   1 
ATOM   6278 O O   . ARG B 2 277 ? 52.728  16.171  2.272   1.00 103.24 ? 277  ARG B O   1 
ATOM   6279 C CB  . ARG B 2 277 ? 55.528  14.919  3.803   1.00 98.99  ? 277  ARG B CB  1 
ATOM   6280 C CG  . ARG B 2 277 ? 56.525  14.187  2.926   1.00 112.43 ? 277  ARG B CG  1 
ATOM   6281 C CD  . ARG B 2 277 ? 57.933  14.744  3.088   1.00 120.43 ? 277  ARG B CD  1 
ATOM   6282 N NE  . ARG B 2 277 ? 58.922  13.683  3.247   1.00 118.90 ? 277  ARG B NE  1 
ATOM   6283 C CZ  . ARG B 2 277 ? 60.116  13.687  2.670   1.00 112.10 ? 277  ARG B CZ  1 
ATOM   6284 N NH1 . ARG B 2 277 ? 60.469  14.693  1.886   1.00 115.48 ? 277  ARG B NH1 1 
ATOM   6285 N NH2 . ARG B 2 277 ? 60.960  12.693  2.888   1.00 114.96 ? 277  ARG B NH2 1 
ATOM   6286 N N   . GLN B 2 278 ? 54.244  15.002  1.104   1.00 90.46  ? 278  GLN B N   1 
ATOM   6287 C CA  . GLN B 2 278 ? 53.912  15.692  -0.136  1.00 90.88  ? 278  GLN B CA  1 
ATOM   6288 C C   . GLN B 2 278 ? 52.466  15.478  -0.585  1.00 81.18  ? 278  GLN B C   1 
ATOM   6289 O O   . GLN B 2 278 ? 51.808  16.410  -1.059  1.00 78.97  ? 278  GLN B O   1 
ATOM   6290 C CB  . GLN B 2 278 ? 54.890  15.283  -1.247  1.00 103.40 ? 278  GLN B CB  1 
ATOM   6291 C CG  . GLN B 2 278 ? 56.380  15.414  -0.856  1.00 114.51 ? 278  GLN B CG  1 
ATOM   6292 C CD  . GLN B 2 278 ? 56.931  16.841  -0.909  1.00 112.27 ? 278  GLN B CD  1 
ATOM   6293 O OE1 . GLN B 2 278 ? 57.854  17.181  -0.160  1.00 113.29 ? 278  GLN B OE1 1 
ATOM   6294 N NE2 . GLN B 2 278 ? 56.392  17.668  -1.811  1.00 111.66 ? 278  GLN B NE2 1 
ATOM   6295 N N   . LEU B 2 279 ? 51.959  14.264  -0.428  1.00 75.80  ? 279  LEU B N   1 
ATOM   6296 C CA  . LEU B 2 279 ? 50.590  14.001  -0.843  1.00 74.96  ? 279  LEU B CA  1 
ATOM   6297 C C   . LEU B 2 279 ? 49.641  14.890  -0.069  1.00 78.25  ? 279  LEU B C   1 
ATOM   6298 O O   . LEU B 2 279 ? 48.783  15.572  -0.641  1.00 67.63  ? 279  LEU B O   1 
ATOM   6299 C CB  . LEU B 2 279 ? 50.247  12.523  -0.631  1.00 64.33  ? 279  LEU B CB  1 
ATOM   6300 C CG  . LEU B 2 279 ? 50.882  11.628  -1.707  1.00 53.45  ? 279  LEU B CG  1 
ATOM   6301 C CD1 . LEU B 2 279 ? 50.981  10.212  -1.192  1.00 45.21  ? 279  LEU B CD1 1 
ATOM   6302 C CD2 . LEU B 2 279 ? 50.076  11.694  -3.017  1.00 42.96  ? 279  LEU B CD2 1 
ATOM   6303 N N   . CYS B 2 280 ? 49.824  14.894  1.242   1.00 85.91  ? 280  CYS B N   1 
ATOM   6304 C CA  . CYS B 2 280 ? 48.988  15.691  2.113   1.00 87.18  ? 280  CYS B CA  1 
ATOM   6305 C C   . CYS B 2 280 ? 48.976  17.155  1.722   1.00 88.84  ? 280  CYS B C   1 
ATOM   6306 O O   . CYS B 2 280 ? 47.993  17.866  1.958   1.00 89.73  ? 280  CYS B O   1 
ATOM   6307 C CB  . CYS B 2 280 ? 49.458  15.545  3.556   1.00 80.86  ? 280  CYS B CB  1 
ATOM   6308 S SG  . CYS B 2 280 ? 48.459  14.386  4.493   1.00 91.66  ? 280  CYS B SG  1 
ATOM   6309 N N   . LYS B 2 281 ? 50.062  17.605  1.108   1.00 90.58  ? 281  LYS B N   1 
ATOM   6310 C CA  . LYS B 2 281 ? 50.164  18.997  0.713   1.00 92.13  ? 281  LYS B CA  1 
ATOM   6311 C C   . LYS B 2 281 ? 49.270  19.355  -0.458  1.00 83.70  ? 281  LYS B C   1 
ATOM   6312 O O   . LYS B 2 281 ? 48.809  20.482  -0.572  1.00 84.48  ? 281  LYS B O   1 
ATOM   6313 C CB  . LYS B 2 281 ? 51.621  19.344  0.411   1.00 106.73 ? 281  LYS B CB  1 
ATOM   6314 C CG  . LYS B 2 281 ? 52.521  19.309  1.661   1.00 124.57 ? 281  LYS B CG  1 
ATOM   6315 C CD  . LYS B 2 281 ? 53.914  19.932  1.426   1.00 133.87 ? 281  LYS B CD  1 
ATOM   6316 C CE  . LYS B 2 281 ? 54.680  20.120  2.744   1.00 138.85 ? 281  LYS B CE  1 
ATOM   6317 N NZ  . LYS B 2 281 ? 55.960  20.879  2.589   1.00 141.81 ? 281  LYS B NZ  1 
ATOM   6318 N N   . LEU B 2 282 ? 49.006  18.398  -1.328  1.00 79.53  ? 282  LEU B N   1 
ATOM   6319 C CA  . LEU B 2 282 ? 48.141  18.687  -2.457  1.00 87.53  ? 282  LEU B CA  1 
ATOM   6320 C C   . LEU B 2 282 ? 46.736  18.809  -1.925  1.00 87.88  ? 282  LEU B C   1 
ATOM   6321 O O   . LEU B 2 282 ? 45.812  19.138  -2.659  1.00 84.86  ? 282  LEU B O   1 
ATOM   6322 C CB  . LEU B 2 282 ? 48.170  17.546  -3.467  1.00 93.41  ? 282  LEU B CB  1 
ATOM   6323 C CG  . LEU B 2 282 ? 49.517  17.148  -4.068  1.00 98.46  ? 282  LEU B CG  1 
ATOM   6324 C CD1 . LEU B 2 282 ? 49.343  15.895  -4.907  1.00 91.28  ? 282  LEU B CD1 1 
ATOM   6325 C CD2 . LEU B 2 282 ? 50.066  18.281  -4.917  1.00 98.91  ? 282  LEU B CD2 1 
ATOM   6326 N N   . LEU B 2 283 ? 46.594  18.537  -0.635  1.00 93.51  ? 283  LEU B N   1 
ATOM   6327 C CA  . LEU B 2 283 ? 45.301  18.552  0.029   1.00 101.73 ? 283  LEU B CA  1 
ATOM   6328 C C   . LEU B 2 283 ? 44.980  19.767  0.889   1.00 112.04 ? 283  LEU B C   1 
ATOM   6329 O O   . LEU B 2 283 ? 43.890  19.864  1.462   1.00 119.02 ? 283  LEU B O   1 
ATOM   6330 C CB  . LEU B 2 283 ? 45.161  17.282  0.872   1.00 101.75 ? 283  LEU B CB  1 
ATOM   6331 C CG  . LEU B 2 283 ? 44.424  16.074  0.268   1.00 94.51  ? 283  LEU B CG  1 
ATOM   6332 C CD1 . LEU B 2 283 ? 44.540  16.053  -1.249  1.00 82.91  ? 283  LEU B CD1 1 
ATOM   6333 C CD2 . LEU B 2 283 ? 44.984  14.801  0.883   1.00 93.32  ? 283  LEU B CD2 1 
ATOM   6334 N N   . ARG B 2 284 ? 45.917  20.693  1.003   1.00 116.59 ? 284  ARG B N   1 
ATOM   6335 C CA  . ARG B 2 284 ? 45.643  21.882  1.790   1.00 118.03 ? 284  ARG B CA  1 
ATOM   6336 C C   . ARG B 2 284 ? 44.503  22.646  1.133   1.00 117.62 ? 284  ARG B C   1 
ATOM   6337 O O   . ARG B 2 284 ? 44.311  22.590  -0.086  1.00 117.65 ? 284  ARG B O   1 
ATOM   6338 C CB  . ARG B 2 284 ? 46.874  22.762  1.862   1.00 120.52 ? 284  ARG B CB  1 
ATOM   6339 C CG  . ARG B 2 284 ? 47.988  22.188  2.693   1.00 121.93 ? 284  ARG B CG  1 
ATOM   6340 C CD  . ARG B 2 284 ? 49.168  23.108  2.580   1.00 132.73 ? 284  ARG B CD  1 
ATOM   6341 N NE  . ARG B 2 284 ? 48.775  24.486  2.864   1.00 150.00 ? 284  ARG B NE  1 
ATOM   6342 C CZ  . ARG B 2 284 ? 49.149  25.539  2.140   1.00 150.00 ? 284  ARG B CZ  1 
ATOM   6343 N NH1 . ARG B 2 284 ? 49.929  25.374  1.075   1.00 150.00 ? 284  ARG B NH1 1 
ATOM   6344 N NH2 . ARG B 2 284 ? 48.745  26.759  2.486   1.00 149.99 ? 284  ARG B NH2 1 
ATOM   6345 N N   . GLY B 2 285 ? 43.752  23.375  1.940   1.00 114.20 ? 285  GLY B N   1 
ATOM   6346 C CA  . GLY B 2 285 ? 42.636  24.099  1.389   1.00 109.55 ? 285  GLY B CA  1 
ATOM   6347 C C   . GLY B 2 285 ? 41.450  23.166  1.450   1.00 106.03 ? 285  GLY B C   1 
ATOM   6348 O O   . GLY B 2 285 ? 41.575  21.942  1.576   1.00 108.80 ? 285  GLY B O   1 
ATOM   6349 N N   . THR B 2 286 ? 40.278  23.751  1.365   1.00 92.65  ? 286  THR B N   1 
ATOM   6350 C CA  . THR B 2 286 ? 39.080  22.969  1.425   1.00 79.74  ? 286  THR B CA  1 
ATOM   6351 C C   . THR B 2 286 ? 38.509  22.955  0.027   1.00 71.34  ? 286  THR B C   1 
ATOM   6352 O O   . THR B 2 286 ? 37.570  23.680  -0.305  1.00 71.46  ? 286  THR B O   1 
ATOM   6353 C CB  . THR B 2 286 ? 38.160  23.602  2.434   1.00 79.73  ? 286  THR B CB  1 
ATOM   6354 O OG1 . THR B 2 286 ? 38.565  24.960  2.640   1.00 83.92  ? 286  THR B OG1 1 
ATOM   6355 C CG2 . THR B 2 286 ? 38.281  22.879  3.752   1.00 79.35  ? 286  THR B CG2 1 
ATOM   6356 N N   . LYS B 2 287 ? 39.105  22.108  -0.798  1.00 67.66  ? 287  LYS B N   1 
ATOM   6357 C CA  . LYS B 2 287 ? 38.711  22.002  -2.189  1.00 71.88  ? 287  LYS B CA  1 
ATOM   6358 C C   . LYS B 2 287 ? 37.607  21.012  -2.422  1.00 70.12  ? 287  LYS B C   1 
ATOM   6359 O O   . LYS B 2 287 ? 37.326  20.158  -1.587  1.00 70.18  ? 287  LYS B O   1 
ATOM   6360 C CB  . LYS B 2 287 ? 39.898  21.579  -3.044  1.00 86.20  ? 287  LYS B CB  1 
ATOM   6361 C CG  . LYS B 2 287 ? 41.217  22.255  -2.683  1.00 102.37 ? 287  LYS B CG  1 
ATOM   6362 C CD  . LYS B 2 287 ? 42.191  22.226  -3.867  1.00 98.84  ? 287  LYS B CD  1 
ATOM   6363 C CE  . LYS B 2 287 ? 43.527  22.868  -3.533  1.00 80.89  ? 287  LYS B CE  1 
ATOM   6364 N NZ  . LYS B 2 287 ? 44.244  22.055  -2.535  1.00 72.61  ? 287  LYS B NZ  1 
ATOM   6365 N N   . ALA B 2 288 ? 36.993  21.119  -3.590  1.00 74.52  ? 288  ALA B N   1 
ATOM   6366 C CA  . ALA B 2 288 ? 35.933  20.201  -3.940  1.00 77.13  ? 288  ALA B CA  1 
ATOM   6367 C C   . ALA B 2 288 ? 36.570  18.836  -4.080  1.00 75.05  ? 288  ALA B C   1 
ATOM   6368 O O   . ALA B 2 288 ? 37.709  18.696  -4.521  1.00 71.30  ? 288  ALA B O   1 
ATOM   6369 C CB  . ALA B 2 288 ? 35.275  20.607  -5.241  1.00 84.77  ? 288  ALA B CB  1 
ATOM   6370 N N   . LEU B 2 289 ? 35.815  17.831  -3.681  1.00 78.66  ? 289  LEU B N   1 
ATOM   6371 C CA  . LEU B 2 289 ? 36.261  16.458  -3.742  1.00 80.22  ? 289  LEU B CA  1 
ATOM   6372 C C   . LEU B 2 289 ? 36.648  16.050  -5.146  1.00 83.21  ? 289  LEU B C   1 
ATOM   6373 O O   . LEU B 2 289 ? 37.707  15.461  -5.361  1.00 89.18  ? 289  LEU B O   1 
ATOM   6374 C CB  . LEU B 2 289 ? 35.142  15.535  -3.260  1.00 77.62  ? 289  LEU B CB  1 
ATOM   6375 C CG  . LEU B 2 289 ? 35.442  14.703  -2.019  1.00 70.79  ? 289  LEU B CG  1 
ATOM   6376 C CD1 . LEU B 2 289 ? 36.006  15.605  -0.917  1.00 61.26  ? 289  LEU B CD1 1 
ATOM   6377 C CD2 . LEU B 2 289 ? 34.159  13.990  -1.597  1.00 68.32  ? 289  LEU B CD2 1 
ATOM   6378 N N   . THR B 2 290 ? 35.784  16.370  -6.101  1.00 82.53  ? 290  THR B N   1 
ATOM   6379 C CA  . THR B 2 290 ? 36.012  15.982  -7.480  1.00 78.74  ? 290  THR B CA  1 
ATOM   6380 C C   . THR B 2 290 ? 37.056  16.800  -8.242  1.00 76.14  ? 290  THR B C   1 
ATOM   6381 O O   . THR B 2 290 ? 37.491  16.416  -9.335  1.00 76.36  ? 290  THR B O   1 
ATOM   6382 C CB  . THR B 2 290 ? 34.670  15.943  -8.227  1.00 75.68  ? 290  THR B CB  1 
ATOM   6383 O OG1 . THR B 2 290 ? 33.833  17.013  -7.762  1.00 76.90  ? 290  THR B OG1 1 
ATOM   6384 C CG2 . THR B 2 290 ? 33.973  14.600  -7.972  1.00 55.42  ? 290  THR B CG2 1 
ATOM   6385 N N   . GLU B 2 291 ? 37.490  17.903  -7.651  1.00 71.50  ? 291  GLU B N   1 
ATOM   6386 C CA  . GLU B 2 291 ? 38.494  18.738  -8.288  1.00 79.62  ? 291  GLU B CA  1 
ATOM   6387 C C   . GLU B 2 291 ? 39.744  17.907  -8.592  1.00 84.54  ? 291  GLU B C   1 
ATOM   6388 O O   . GLU B 2 291 ? 40.302  17.286  -7.688  1.00 91.43  ? 291  GLU B O   1 
ATOM   6389 C CB  . GLU B 2 291 ? 38.850  19.882  -7.350  1.00 81.25  ? 291  GLU B CB  1 
ATOM   6390 C CG  . GLU B 2 291 ? 39.710  20.955  -7.949  1.00 90.09  ? 291  GLU B CG  1 
ATOM   6391 C CD  . GLU B 2 291 ? 39.990  22.030  -6.934  1.00 100.53 ? 291  GLU B CD  1 
ATOM   6392 O OE1 . GLU B 2 291 ? 39.014  22.575  -6.367  1.00 106.95 ? 291  GLU B OE1 1 
ATOM   6393 O OE2 . GLU B 2 291 ? 41.180  22.321  -6.693  1.00 98.11  ? 291  GLU B OE2 1 
ATOM   6394 N N   . VAL B 2 292 ? 40.175  17.882  -9.855  1.00 85.65  ? 292  VAL B N   1 
ATOM   6395 C CA  . VAL B 2 292 ? 41.377  17.129  -10.241 1.00 82.43  ? 292  VAL B CA  1 
ATOM   6396 C C   . VAL B 2 292 ? 42.643  17.882  -9.765  1.00 83.86  ? 292  VAL B C   1 
ATOM   6397 O O   . VAL B 2 292 ? 42.685  19.119  -9.755  1.00 79.51  ? 292  VAL B O   1 
ATOM   6398 C CB  . VAL B 2 292 ? 41.437  16.887  -11.796 1.00 64.32  ? 292  VAL B CB  1 
ATOM   6399 C CG1 . VAL B 2 292 ? 42.729  16.182  -12.171 1.00 60.30  ? 292  VAL B CG1 1 
ATOM   6400 C CG2 . VAL B 2 292 ? 40.252  16.044  -12.246 1.00 56.19  ? 292  VAL B CG2 1 
ATOM   6401 N N   . ILE B 2 293 ? 43.661  17.130  -9.353  1.00 86.03  ? 293  ILE B N   1 
ATOM   6402 C CA  . ILE B 2 293 ? 44.900  17.720  -8.863  1.00 86.20  ? 293  ILE B CA  1 
ATOM   6403 C C   . ILE B 2 293 ? 46.127  17.185  -9.594  1.00 95.12  ? 293  ILE B C   1 
ATOM   6404 O O   . ILE B 2 293 ? 46.535  16.036  -9.381  1.00 91.18  ? 293  ILE B O   1 
ATOM   6405 C CB  . ILE B 2 293 ? 45.108  17.424  -7.353  1.00 78.24  ? 293  ILE B CB  1 
ATOM   6406 C CG1 . ILE B 2 293 ? 43.952  17.995  -6.521  1.00 68.66  ? 293  ILE B CG1 1 
ATOM   6407 C CG2 . ILE B 2 293 ? 46.460  17.989  -6.893  1.00 83.85  ? 293  ILE B CG2 1 
ATOM   6408 C CD1 . ILE B 2 293 ? 44.151  19.420  -6.056  1.00 56.16  ? 293  ILE B CD1 1 
ATOM   6409 N N   . PRO B 2 294 ? 46.711  17.984  -10.505 1.00 105.79 ? 294  PRO B N   1 
ATOM   6410 C CA  . PRO B 2 294 ? 47.892  17.395  -11.139 1.00 103.87 ? 294  PRO B CA  1 
ATOM   6411 C C   . PRO B 2 294 ? 48.895  17.377  -9.991  1.00 101.67 ? 294  PRO B C   1 
ATOM   6412 O O   . PRO B 2 294 ? 49.011  18.355  -9.240  1.00 94.25  ? 294  PRO B O   1 
ATOM   6413 C CB  . PRO B 2 294 ? 48.245  18.403  -12.231 1.00 98.71  ? 294  PRO B CB  1 
ATOM   6414 C CG  . PRO B 2 294 ? 46.897  18.973  -12.600 1.00 98.92  ? 294  PRO B CG  1 
ATOM   6415 C CD  . PRO B 2 294 ? 46.261  19.183  -11.236 1.00 108.62 ? 294  PRO B CD  1 
ATOM   6416 N N   . LEU B 2 295 ? 49.582  16.255  -9.842  1.00 104.07 ? 295  LEU B N   1 
ATOM   6417 C CA  . LEU B 2 295 ? 50.549  16.063  -8.768  1.00 105.66 ? 295  LEU B CA  1 
ATOM   6418 C C   . LEU B 2 295 ? 51.900  16.693  -9.079  1.00 110.40 ? 295  LEU B C   1 
ATOM   6419 O O   . LEU B 2 295 ? 52.320  16.711  -10.234 1.00 116.13 ? 295  LEU B O   1 
ATOM   6420 C CB  . LEU B 2 295 ? 50.771  14.572  -8.548  1.00 102.13 ? 295  LEU B CB  1 
ATOM   6421 C CG  . LEU B 2 295 ? 49.657  13.560  -8.836  1.00 97.95  ? 295  LEU B CG  1 
ATOM   6422 C CD1 . LEU B 2 295 ? 49.111  13.698  -10.264 1.00 95.95  ? 295  LEU B CD1 1 
ATOM   6423 C CD2 . LEU B 2 295 ? 50.235  12.164  -8.630  1.00 88.46  ? 295  LEU B CD2 1 
ATOM   6424 N N   . THR B 2 296 ? 52.593  17.178  -8.051  1.00 109.98 ? 296  THR B N   1 
ATOM   6425 C CA  . THR B 2 296 ? 53.916  17.775  -8.239  1.00 116.21 ? 296  THR B CA  1 
ATOM   6426 C C   . THR B 2 296 ? 55.022  16.721  -8.438  1.00 116.02 ? 296  THR B C   1 
ATOM   6427 O O   . THR B 2 296 ? 54.748  15.521  -8.518  1.00 118.80 ? 296  THR B O   1 
ATOM   6428 C CB  . THR B 2 296 ? 54.297  18.664  -7.049  1.00 122.22 ? 296  THR B CB  1 
ATOM   6429 O OG1 . THR B 2 296 ? 54.184  17.910  -5.835  1.00 121.03 ? 296  THR B OG1 1 
ATOM   6430 C CG2 . THR B 2 296 ? 53.394  19.888  -6.998  1.00 128.86 ? 296  THR B CG2 1 
ATOM   6431 N N   . GLU B 2 297 ? 56.273  17.170  -8.514  1.00 108.54 ? 297  GLU B N   1 
ATOM   6432 C CA  . GLU B 2 297 ? 57.384  16.256  -8.726  1.00 96.67  ? 297  GLU B CA  1 
ATOM   6433 C C   . GLU B 2 297 ? 57.725  15.495  -7.467  1.00 86.11  ? 297  GLU B C   1 
ATOM   6434 O O   . GLU B 2 297 ? 57.964  14.289  -7.499  1.00 73.91  ? 297  GLU B O   1 
ATOM   6435 C CB  . GLU B 2 297 ? 58.614  17.023  -9.205  1.00 103.79 ? 297  GLU B CB  1 
ATOM   6436 C CG  . GLU B 2 297 ? 59.657  16.109  -9.793  1.00 110.41 ? 297  GLU B CG  1 
ATOM   6437 C CD  . GLU B 2 297 ? 59.069  15.212  -10.867 1.00 116.58 ? 297  GLU B CD  1 
ATOM   6438 O OE1 . GLU B 2 297 ? 58.754  15.727  -11.960 1.00 113.59 ? 297  GLU B OE1 1 
ATOM   6439 O OE2 . GLU B 2 297 ? 58.910  13.997  -10.613 1.00 119.42 ? 297  GLU B OE2 1 
ATOM   6440 N N   . GLU B 2 298 ? 57.757  16.219  -6.357  1.00 91.23  ? 298  GLU B N   1 
ATOM   6441 C CA  . GLU B 2 298 ? 58.069  15.621  -5.073  1.00 102.04 ? 298  GLU B CA  1 
ATOM   6442 C C   . GLU B 2 298 ? 57.001  14.614  -4.730  1.00 106.04 ? 298  GLU B C   1 
ATOM   6443 O O   . GLU B 2 298 ? 57.290  13.519  -4.244  1.00 110.47 ? 298  GLU B O   1 
ATOM   6444 C CB  . GLU B 2 298 ? 58.117  16.678  -3.972  1.00 112.58 ? 298  GLU B CB  1 
ATOM   6445 C CG  . GLU B 2 298 ? 59.270  17.650  -4.072  1.00 129.25 ? 298  GLU B CG  1 
ATOM   6446 C CD  . GLU B 2 298 ? 58.950  18.853  -4.928  1.00 143.97 ? 298  GLU B CD  1 
ATOM   6447 O OE1 . GLU B 2 298 ? 58.694  18.683  -6.141  1.00 147.37 ? 298  GLU B OE1 1 
ATOM   6448 O OE2 . GLU B 2 298 ? 58.952  19.974  -4.376  1.00 150.00 ? 298  GLU B OE2 1 
ATOM   6449 N N   . ALA B 2 299 ? 55.758  15.002  -4.973  1.00 106.38 ? 299  ALA B N   1 
ATOM   6450 C CA  . ALA B 2 299 ? 54.643  14.120  -4.694  1.00 107.31 ? 299  ALA B CA  1 
ATOM   6451 C C   . ALA B 2 299 ? 54.868  12.840  -5.485  1.00 107.65 ? 299  ALA B C   1 
ATOM   6452 O O   . ALA B 2 299 ? 54.967  11.747  -4.915  1.00 111.09 ? 299  ALA B O   1 
ATOM   6453 C CB  . ALA B 2 299 ? 53.340  14.780  -5.113  1.00 114.53 ? 299  ALA B CB  1 
ATOM   6454 N N   . GLU B 2 300 ? 54.976  12.993  -6.802  1.00 102.35 ? 300  GLU B N   1 
ATOM   6455 C CA  . GLU B 2 300 ? 55.187  11.860  -7.686  1.00 97.05  ? 300  GLU B CA  1 
ATOM   6456 C C   . GLU B 2 300 ? 56.303  10.934  -7.224  1.00 89.68  ? 300  GLU B C   1 
ATOM   6457 O O   . GLU B 2 300 ? 56.172  9.718   -7.287  1.00 85.01  ? 300  GLU B O   1 
ATOM   6458 C CB  . GLU B 2 300 ? 55.451  12.353  -9.106  1.00 107.51 ? 300  GLU B CB  1 
ATOM   6459 C CG  . GLU B 2 300 ? 54.226  12.215  -9.988  1.00 126.44 ? 300  GLU B CG  1 
ATOM   6460 C CD  . GLU B 2 300 ? 53.798  10.759  -10.150 1.00 145.47 ? 300  GLU B CD  1 
ATOM   6461 O OE1 . GLU B 2 300 ? 52.654  10.505  -10.599 1.00 149.99 ? 300  GLU B OE1 1 
ATOM   6462 O OE2 . GLU B 2 300 ? 54.616  9.866   -9.834  1.00 149.99 ? 300  GLU B OE2 1 
ATOM   6463 N N   . LEU B 2 301 ? 57.402  11.501  -6.756  1.00 88.42  ? 301  LEU B N   1 
ATOM   6464 C CA  . LEU B 2 301 ? 58.490  10.671  -6.279  1.00 87.88  ? 301  LEU B CA  1 
ATOM   6465 C C   . LEU B 2 301 ? 58.165  9.996   -4.935  1.00 82.86  ? 301  LEU B C   1 
ATOM   6466 O O   . LEU B 2 301 ? 58.582  8.865   -4.679  1.00 82.79  ? 301  LEU B O   1 
ATOM   6467 C CB  . LEU B 2 301 ? 59.751  11.504  -6.131  1.00 97.20  ? 301  LEU B CB  1 
ATOM   6468 C CG  . LEU B 2 301 ? 60.743  10.828  -5.181  1.00 106.05 ? 301  LEU B CG  1 
ATOM   6469 C CD1 . LEU B 2 301 ? 61.249  9.510   -5.790  1.00 100.04 ? 301  LEU B CD1 1 
ATOM   6470 C CD2 . LEU B 2 301 ? 61.890  11.782  -4.894  1.00 113.20 ? 301  LEU B CD2 1 
ATOM   6471 N N   . GLU B 2 302 ? 57.443  10.693  -4.069  1.00 77.52  ? 302  GLU B N   1 
ATOM   6472 C CA  . GLU B 2 302 ? 57.086  10.119  -2.783  1.00 76.33  ? 302  GLU B CA  1 
ATOM   6473 C C   . GLU B 2 302 ? 56.215  8.887   -2.989  1.00 70.24  ? 302  GLU B C   1 
ATOM   6474 O O   . GLU B 2 302 ? 56.374  7.873   -2.316  1.00 64.37  ? 302  GLU B O   1 
ATOM   6475 C CB  . GLU B 2 302 ? 56.335  11.141  -1.944  1.00 85.34  ? 302  GLU B CB  1 
ATOM   6476 C CG  . GLU B 2 302 ? 55.666  10.547  -0.710  1.00 98.56  ? 302  GLU B CG  1 
ATOM   6477 C CD  . GLU B 2 302 ? 54.911  11.587  0.114   1.00 106.03 ? 302  GLU B CD  1 
ATOM   6478 O OE1 . GLU B 2 302 ? 55.548  12.286  0.935   1.00 114.57 ? 302  GLU B OE1 1 
ATOM   6479 O OE2 . GLU B 2 302 ? 53.678  11.713  -0.064  1.00 101.98 ? 302  GLU B OE2 1 
ATOM   6480 N N   . LEU B 2 303 ? 55.289  8.984   -3.929  1.00 70.19  ? 303  LEU B N   1 
ATOM   6481 C CA  . LEU B 2 303 ? 54.394  7.873   -4.249  1.00 69.85  ? 303  LEU B CA  1 
ATOM   6482 C C   . LEU B 2 303 ? 55.209  6.674   -4.785  1.00 70.27  ? 303  LEU B C   1 
ATOM   6483 O O   . LEU B 2 303 ? 55.030  5.522   -4.368  1.00 61.19  ? 303  LEU B O   1 
ATOM   6484 C CB  . LEU B 2 303 ? 53.394  8.339   -5.311  1.00 62.17  ? 303  LEU B CB  1 
ATOM   6485 C CG  . LEU B 2 303 ? 51.964  7.801   -5.252  1.00 60.71  ? 303  LEU B CG  1 
ATOM   6486 C CD1 . LEU B 2 303 ? 51.141  8.378   -6.408  1.00 69.72  ? 303  LEU B CD1 1 
ATOM   6487 C CD2 . LEU B 2 303 ? 51.988  6.286   -5.311  1.00 52.25  ? 303  LEU B CD2 1 
ATOM   6488 N N   . ALA B 2 304 ? 56.104  6.982   -5.721  1.00 74.81  ? 304  ALA B N   1 
ATOM   6489 C CA  . ALA B 2 304 ? 56.986  6.009   -6.359  1.00 65.42  ? 304  ALA B CA  1 
ATOM   6490 C C   . ALA B 2 304 ? 57.679  5.171   -5.310  1.00 56.05  ? 304  ALA B C   1 
ATOM   6491 O O   . ALA B 2 304 ? 57.704  3.951   -5.400  1.00 51.20  ? 304  ALA B O   1 
ATOM   6492 C CB  . ALA B 2 304 ? 58.024  6.735   -7.215  1.00 61.51  ? 304  ALA B CB  1 
ATOM   6493 N N   . GLU B 2 305 ? 58.248  5.835   -4.314  1.00 56.80  ? 305  GLU B N   1 
ATOM   6494 C CA  . GLU B 2 305 ? 58.922  5.125   -3.237  1.00 60.44  ? 305  GLU B CA  1 
ATOM   6495 C C   . GLU B 2 305 ? 57.972  4.242   -2.447  1.00 51.51  ? 305  GLU B C   1 
ATOM   6496 O O   . GLU B 2 305 ? 58.221  3.051   -2.267  1.00 43.07  ? 305  GLU B O   1 
ATOM   6497 C CB  . GLU B 2 305 ? 59.578  6.108   -2.281  1.00 69.63  ? 305  GLU B CB  1 
ATOM   6498 C CG  . GLU B 2 305 ? 60.845  6.717   -2.812  1.00 80.73  ? 305  GLU B CG  1 
ATOM   6499 C CD  . GLU B 2 305 ? 61.524  7.563   -1.769  1.00 93.16  ? 305  GLU B CD  1 
ATOM   6500 O OE1 . GLU B 2 305 ? 61.341  7.267   -0.563  1.00 93.43  ? 305  GLU B OE1 1 
ATOM   6501 O OE2 . GLU B 2 305 ? 62.244  8.512   -2.153  1.00 101.32 ? 305  GLU B OE2 1 
ATOM   6502 N N   . ASN B 2 306 ? 56.883  4.841   -1.977  1.00 48.23  ? 306  ASN B N   1 
ATOM   6503 C CA  . ASN B 2 306 ? 55.908  4.115   -1.190  1.00 48.02  ? 306  ASN B CA  1 
ATOM   6504 C C   . ASN B 2 306 ? 55.430  2.939   -1.978  1.00 51.65  ? 306  ASN B C   1 
ATOM   6505 O O   . ASN B 2 306 ? 55.250  1.848   -1.450  1.00 51.24  ? 306  ASN B O   1 
ATOM   6506 C CB  . ASN B 2 306 ? 54.730  5.011   -0.851  1.00 46.52  ? 306  ASN B CB  1 
ATOM   6507 C CG  . ASN B 2 306 ? 55.143  6.222   -0.051  1.00 61.26  ? 306  ASN B CG  1 
ATOM   6508 O OD1 . ASN B 2 306 ? 55.921  6.108   0.889   1.00 75.08  ? 306  ASN B OD1 1 
ATOM   6509 N ND2 . ASN B 2 306 ? 54.621  7.390   -0.413  1.00 64.89  ? 306  ASN B ND2 1 
ATOM   6510 N N   . ARG B 2 307 ? 55.235  3.171   -3.260  1.00 51.44  ? 307  ARG B N   1 
ATOM   6511 C CA  . ARG B 2 307 ? 54.768  2.121   -4.123  1.00 52.64  ? 307  ARG B CA  1 
ATOM   6512 C C   . ARG B 2 307 ? 55.815  1.034   -4.142  1.00 47.57  ? 307  ARG B C   1 
ATOM   6513 O O   . ARG B 2 307 ? 55.479  -0.147  -4.152  1.00 44.36  ? 307  ARG B O   1 
ATOM   6514 C CB  . ARG B 2 307 ? 54.534  2.666   -5.529  1.00 65.86  ? 307  ARG B CB  1 
ATOM   6515 C CG  . ARG B 2 307 ? 53.484  1.893   -6.308  1.00 69.32  ? 307  ARG B CG  1 
ATOM   6516 C CD  . ARG B 2 307 ? 53.326  2.426   -7.716  1.00 79.54  ? 307  ARG B CD  1 
ATOM   6517 N NE  . ARG B 2 307 ? 52.506  3.633   -7.787  1.00 85.53  ? 307  ARG B NE  1 
ATOM   6518 C CZ  . ARG B 2 307 ? 51.179  3.648   -7.684  1.00 85.27  ? 307  ARG B CZ  1 
ATOM   6519 N NH1 . ARG B 2 307 ? 50.504  2.516   -7.499  1.00 87.88  ? 307  ARG B NH1 1 
ATOM   6520 N NH2 . ARG B 2 307 ? 50.522  4.797   -7.787  1.00 74.91  ? 307  ARG B NH2 1 
ATOM   6521 N N   . GLU B 2 308 ? 57.084  1.442   -4.132  1.00 49.90  ? 308  GLU B N   1 
ATOM   6522 C CA  . GLU B 2 308 ? 58.207  0.497   -4.141  1.00 63.78  ? 308  GLU B CA  1 
ATOM   6523 C C   . GLU B 2 308 ? 58.292  -0.289  -2.849  1.00 70.44  ? 308  GLU B C   1 
ATOM   6524 O O   . GLU B 2 308 ? 58.562  -1.497  -2.844  1.00 72.52  ? 308  GLU B O   1 
ATOM   6525 C CB  . GLU B 2 308 ? 59.535  1.223   -4.332  1.00 69.43  ? 308  GLU B CB  1 
ATOM   6526 C CG  . GLU B 2 308 ? 60.005  1.344   -5.778  1.00 86.71  ? 308  GLU B CG  1 
ATOM   6527 C CD  . GLU B 2 308 ? 60.248  -0.005  -6.440  1.00 92.37  ? 308  GLU B CD  1 
ATOM   6528 O OE1 . GLU B 2 308 ? 59.459  -0.384  -7.332  1.00 79.02  ? 308  GLU B OE1 1 
ATOM   6529 O OE2 . GLU B 2 308 ? 61.228  -0.686  -6.066  1.00 102.46 ? 308  GLU B OE2 1 
ATOM   6530 N N   . ILE B 2 309 ? 58.079  0.425   -1.752  1.00 70.12  ? 309  ILE B N   1 
ATOM   6531 C CA  . ILE B 2 309 ? 58.113  -0.159  -0.416  1.00 72.60  ? 309  ILE B CA  1 
ATOM   6532 C C   . ILE B 2 309 ? 57.069  -1.262  -0.232  1.00 76.74  ? 309  ILE B C   1 
ATOM   6533 O O   . ILE B 2 309 ? 57.307  -2.284  0.431   1.00 74.00  ? 309  ILE B O   1 
ATOM   6534 C CB  . ILE B 2 309 ? 57.825  0.906   0.637   1.00 63.65  ? 309  ILE B CB  1 
ATOM   6535 C CG1 . ILE B 2 309 ? 58.897  1.990   0.575   1.00 48.80  ? 309  ILE B CG1 1 
ATOM   6536 C CG2 . ILE B 2 309 ? 57.746  0.259   2.017   1.00 64.85  ? 309  ILE B CG2 1 
ATOM   6537 C CD1 . ILE B 2 309 ? 58.507  3.296   1.305   1.00 45.81  ? 309  ILE B CD1 1 
ATOM   6538 N N   . LEU B 2 310 ? 55.898  -1.048  -0.808  1.00 79.98  ? 310  LEU B N   1 
ATOM   6539 C CA  . LEU B 2 310 ? 54.840  -2.023  -0.665  1.00 78.00  ? 310  LEU B CA  1 
ATOM   6540 C C   . LEU B 2 310 ? 54.989  -3.229  -1.579  1.00 78.77  ? 310  LEU B C   1 
ATOM   6541 O O   . LEU B 2 310 ? 54.235  -4.202  -1.454  1.00 80.90  ? 310  LEU B O   1 
ATOM   6542 C CB  . LEU B 2 310 ? 53.507  -1.340  -0.908  1.00 68.95  ? 310  LEU B CB  1 
ATOM   6543 C CG  . LEU B 2 310 ? 53.347  -0.097  -0.034  1.00 62.37  ? 310  LEU B CG  1 
ATOM   6544 C CD1 . LEU B 2 310 ? 52.005  0.518   -0.343  1.00 75.94  ? 310  LEU B CD1 1 
ATOM   6545 C CD2 . LEU B 2 310 ? 53.428  -0.449  1.432   1.00 61.81  ? 310  LEU B CD2 1 
ATOM   6546 N N   . LYS B 2 311 ? 55.967  -3.176  -2.480  1.00 75.23  ? 311  LYS B N   1 
ATOM   6547 C CA  . LYS B 2 311 ? 56.167  -4.271  -3.411  1.00 73.61  ? 311  LYS B CA  1 
ATOM   6548 C C   . LYS B 2 311 ? 56.487  -5.603  -2.777  1.00 80.80  ? 311  LYS B C   1 
ATOM   6549 O O   . LYS B 2 311 ? 56.548  -6.612  -3.478  1.00 83.65  ? 311  LYS B O   1 
ATOM   6550 C CB  . LYS B 2 311 ? 57.239  -3.926  -4.433  1.00 57.75  ? 311  LYS B CB  1 
ATOM   6551 C CG  . LYS B 2 311 ? 56.706  -3.110  -5.597  1.00 65.71  ? 311  LYS B CG  1 
ATOM   6552 C CD  . LYS B 2 311 ? 57.676  -3.132  -6.782  1.00 88.63  ? 311  LYS B CD  1 
ATOM   6553 C CE  . LYS B 2 311 ? 57.085  -2.489  -8.044  1.00 93.93  ? 311  LYS B CE  1 
ATOM   6554 N NZ  . LYS B 2 311 ? 56.672  -1.071  -7.822  1.00 99.64  ? 311  LYS B NZ  1 
ATOM   6555 N N   . GLU B 2 312 ? 56.676  -5.620  -1.461  1.00 85.80  ? 312  GLU B N   1 
ATOM   6556 C CA  . GLU B 2 312 ? 56.981  -6.871  -0.778  1.00 88.55  ? 312  GLU B CA  1 
ATOM   6557 C C   . GLU B 2 312 ? 56.634  -6.932  0.688   1.00 87.30  ? 312  GLU B C   1 
ATOM   6558 O O   . GLU B 2 312 ? 56.501  -5.896  1.354   1.00 80.35  ? 312  GLU B O   1 
ATOM   6559 C CB  . GLU B 2 312 ? 58.459  -7.215  -0.925  1.00 93.47  ? 312  GLU B CB  1 
ATOM   6560 C CG  . GLU B 2 312 ? 58.737  -8.001  -2.161  1.00 113.60 ? 312  GLU B CG  1 
ATOM   6561 C CD  . GLU B 2 312 ? 60.129  -7.780  -2.643  1.00 128.96 ? 312  GLU B CD  1 
ATOM   6562 O OE1 . GLU B 2 312 ? 60.418  -8.158  -3.805  1.00 139.07 ? 312  GLU B OE1 1 
ATOM   6563 O OE2 . GLU B 2 312 ? 60.926  -7.223  -1.850  1.00 135.11 ? 312  GLU B OE2 1 
ATOM   6564 N N   . PRO B 2 313 ? 56.488  -8.166  1.211   1.00 86.88  ? 313  PRO B N   1 
ATOM   6565 C CA  . PRO B 2 313 ? 56.163  -8.365  2.618   1.00 81.75  ? 313  PRO B CA  1 
ATOM   6566 C C   . PRO B 2 313 ? 57.184  -7.604  3.454   1.00 77.34  ? 313  PRO B C   1 
ATOM   6567 O O   . PRO B 2 313 ? 58.338  -7.428  3.052   1.00 74.43  ? 313  PRO B O   1 
ATOM   6568 C CB  . PRO B 2 313 ? 56.272  -9.883  2.778   1.00 82.80  ? 313  PRO B CB  1 
ATOM   6569 C CG  . PRO B 2 313 ? 55.807  -10.390 1.442   1.00 77.69  ? 313  PRO B CG  1 
ATOM   6570 C CD  . PRO B 2 313 ? 56.559  -9.464  0.507   1.00 87.28  ? 313  PRO B CD  1 
ATOM   6571 N N   . VAL B 2 314 ? 56.754  -7.133  4.609   1.00 74.99  ? 314  VAL B N   1 
ATOM   6572 C CA  . VAL B 2 314 ? 57.648  -6.401  5.468   1.00 80.86  ? 314  VAL B CA  1 
ATOM   6573 C C   . VAL B 2 314 ? 58.705  -7.386  5.990   1.00 90.86  ? 314  VAL B C   1 
ATOM   6574 O O   . VAL B 2 314 ? 58.405  -8.558  6.229   1.00 92.95  ? 314  VAL B O   1 
ATOM   6575 C CB  . VAL B 2 314 ? 56.858  -5.780  6.618   1.00 76.20  ? 314  VAL B CB  1 
ATOM   6576 C CG1 . VAL B 2 314 ? 56.387  -6.873  7.559   1.00 82.59  ? 314  VAL B CG1 1 
ATOM   6577 C CG2 . VAL B 2 314 ? 57.696  -4.739  7.327   1.00 77.25  ? 314  VAL B CG2 1 
ATOM   6578 N N   . HIS B 2 315 ? 59.941  -6.909  6.137   1.00 97.31  ? 315  HIS B N   1 
ATOM   6579 C CA  . HIS B 2 315 ? 61.058  -7.724  6.624   1.00 97.22  ? 315  HIS B CA  1 
ATOM   6580 C C   . HIS B 2 315 ? 60.945  -8.007  8.111   1.00 101.08 ? 315  HIS B C   1 
ATOM   6581 O O   . HIS B 2 315 ? 60.487  -7.156  8.869   1.00 99.80  ? 315  HIS B O   1 
ATOM   6582 C CB  . HIS B 2 315 ? 62.377  -6.993  6.424   1.00 89.23  ? 315  HIS B CB  1 
ATOM   6583 C CG  . HIS B 2 315 ? 62.671  -6.641  5.006   1.00 81.32  ? 315  HIS B CG  1 
ATOM   6584 N ND1 . HIS B 2 315 ? 63.634  -5.720  4.658   1.00 81.18  ? 315  HIS B ND1 1 
ATOM   6585 C CD2 . HIS B 2 315 ? 62.144  -7.092  3.845   1.00 84.15  ? 315  HIS B CD2 1 
ATOM   6586 C CE1 . HIS B 2 315 ? 63.688  -5.617  3.343   1.00 84.90  ? 315  HIS B CE1 1 
ATOM   6587 N NE2 . HIS B 2 315 ? 62.794  -6.440  2.825   1.00 85.67  ? 315  HIS B NE2 1 
ATOM   6588 N N   . GLY B 2 316 ? 61.377  -9.194  8.528   1.00 103.81 ? 316  GLY B N   1 
ATOM   6589 C CA  . GLY B 2 316 ? 61.348  -9.515  9.943   1.00 110.97 ? 316  GLY B CA  1 
ATOM   6590 C C   . GLY B 2 316 ? 60.314  -10.466 10.527  1.00 117.97 ? 316  GLY B C   1 
ATOM   6591 O O   . GLY B 2 316 ? 60.554  -11.039 11.589  1.00 124.52 ? 316  GLY B O   1 
ATOM   6592 N N   . VAL B 2 317 ? 59.170  -10.648 9.876   1.00 117.65 ? 317  VAL B N   1 
ATOM   6593 C CA  . VAL B 2 317 ? 58.151  -11.547 10.426  1.00 113.35 ? 317  VAL B CA  1 
ATOM   6594 C C   . VAL B 2 317 ? 58.522  -13.028 10.353  1.00 107.80 ? 317  VAL B C   1 
ATOM   6595 O O   . VAL B 2 317 ? 58.728  -13.589 9.263   1.00 102.31 ? 317  VAL B O   1 
ATOM   6596 C CB  . VAL B 2 317 ? 56.775  -11.360 9.733   1.00 114.05 ? 317  VAL B CB  1 
ATOM   6597 C CG1 . VAL B 2 317 ? 56.260  -9.951  9.960   1.00 112.72 ? 317  VAL B CG1 1 
ATOM   6598 C CG2 . VAL B 2 317 ? 56.889  -11.663 8.253   1.00 116.40 ? 317  VAL B CG2 1 
ATOM   6599 N N   . TYR B 2 318 ? 58.592  -13.657 11.526  1.00 102.62 ? 318  TYR B N   1 
ATOM   6600 C CA  . TYR B 2 318 ? 58.936  -15.066 11.604  1.00 101.45 ? 318  TYR B CA  1 
ATOM   6601 C C   . TYR B 2 318 ? 57.910  -15.895 12.387  1.00 91.62  ? 318  TYR B C   1 
ATOM   6602 O O   . TYR B 2 318 ? 57.302  -15.421 13.355  1.00 86.86  ? 318  TYR B O   1 
ATOM   6603 C CB  . TYR B 2 318 ? 60.339  -15.208 12.198  1.00 109.25 ? 318  TYR B CB  1 
ATOM   6604 C CG  . TYR B 2 318 ? 61.426  -14.643 11.294  1.00 120.77 ? 318  TYR B CG  1 
ATOM   6605 C CD1 . TYR B 2 318 ? 61.968  -15.398 10.247  1.00 128.74 ? 318  TYR B CD1 1 
ATOM   6606 C CD2 . TYR B 2 318 ? 61.877  -13.337 11.456  1.00 121.10 ? 318  TYR B CD2 1 
ATOM   6607 C CE1 . TYR B 2 318 ? 62.937  -14.855 9.383   1.00 130.49 ? 318  TYR B CE1 1 
ATOM   6608 C CE2 . TYR B 2 318 ? 62.837  -12.784 10.598  1.00 126.56 ? 318  TYR B CE2 1 
ATOM   6609 C CZ  . TYR B 2 318 ? 63.363  -13.544 9.565   1.00 130.29 ? 318  TYR B CZ  1 
ATOM   6610 O OH  . TYR B 2 318 ? 64.305  -12.988 8.719   1.00 133.58 ? 318  TYR B OH  1 
ATOM   6611 N N   . TYR B 2 319 ? 57.724  -17.135 11.940  1.00 81.97  ? 319  TYR B N   1 
ATOM   6612 C CA  . TYR B 2 319 ? 56.779  -18.055 12.543  1.00 72.80  ? 319  TYR B CA  1 
ATOM   6613 C C   . TYR B 2 319 ? 57.188  -18.638 13.874  1.00 70.65  ? 319  TYR B C   1 
ATOM   6614 O O   . TYR B 2 319 ? 58.034  -19.523 13.956  1.00 67.92  ? 319  TYR B O   1 
ATOM   6615 C CB  . TYR B 2 319 ? 56.485  -19.207 11.601  1.00 68.42  ? 319  TYR B CB  1 
ATOM   6616 C CG  . TYR B 2 319 ? 55.710  -20.311 12.276  1.00 74.26  ? 319  TYR B CG  1 
ATOM   6617 C CD1 . TYR B 2 319 ? 56.301  -21.555 12.529  1.00 73.70  ? 319  TYR B CD1 1 
ATOM   6618 C CD2 . TYR B 2 319 ? 54.385  -20.109 12.676  1.00 77.89  ? 319  TYR B CD2 1 
ATOM   6619 C CE1 . TYR B 2 319 ? 55.588  -22.576 13.167  1.00 78.20  ? 319  TYR B CE1 1 
ATOM   6620 C CE2 . TYR B 2 319 ? 53.665  -21.123 13.313  1.00 84.75  ? 319  TYR B CE2 1 
ATOM   6621 C CZ  . TYR B 2 319 ? 54.274  -22.351 13.556  1.00 81.51  ? 319  TYR B CZ  1 
ATOM   6622 O OH  . TYR B 2 319 ? 53.573  -23.338 14.209  1.00 85.27  ? 319  TYR B OH  1 
ATOM   6623 N N   . ASP B 2 320 ? 56.539  -18.154 14.913  1.00 65.05  ? 320  ASP B N   1 
ATOM   6624 C CA  . ASP B 2 320 ? 56.791  -18.614 16.254  1.00 68.61  ? 320  ASP B CA  1 
ATOM   6625 C C   . ASP B 2 320 ? 55.909  -19.852 16.465  1.00 70.94  ? 320  ASP B C   1 
ATOM   6626 O O   . ASP B 2 320 ? 54.689  -19.758 16.421  1.00 74.79  ? 320  ASP B O   1 
ATOM   6627 C CB  . ASP B 2 320 ? 56.408  -17.486 17.205  1.00 69.48  ? 320  ASP B CB  1 
ATOM   6628 C CG  . ASP B 2 320 ? 56.701  -17.810 18.633  1.00 76.05  ? 320  ASP B CG  1 
ATOM   6629 O OD1 . ASP B 2 320 ? 56.769  -19.017 18.971  1.00 72.43  ? 320  ASP B OD1 1 
ATOM   6630 O OD2 . ASP B 2 320 ? 56.848  -16.846 19.414  1.00 81.25  ? 320  ASP B OD2 1 
ATOM   6631 N N   . PRO B 2 321 ? 56.510  -21.032 16.673  1.00 71.29  ? 321  PRO B N   1 
ATOM   6632 C CA  . PRO B 2 321 ? 55.673  -22.224 16.874  1.00 73.24  ? 321  PRO B CA  1 
ATOM   6633 C C   . PRO B 2 321 ? 54.995  -22.278 18.241  1.00 76.96  ? 321  PRO B C   1 
ATOM   6634 O O   . PRO B 2 321 ? 54.094  -23.088 18.467  1.00 74.49  ? 321  PRO B O   1 
ATOM   6635 C CB  . PRO B 2 321 ? 56.654  -23.373 16.675  1.00 66.46  ? 321  PRO B CB  1 
ATOM   6636 C CG  . PRO B 2 321 ? 57.646  -22.795 15.744  1.00 70.88  ? 321  PRO B CG  1 
ATOM   6637 C CD  . PRO B 2 321 ? 57.878  -21.426 16.325  1.00 66.19  ? 321  PRO B CD  1 
ATOM   6638 N N   . SER B 2 322 ? 55.433  -21.414 19.150  1.00 79.09  ? 322  SER B N   1 
ATOM   6639 C CA  . SER B 2 322 ? 54.854  -21.363 20.487  1.00 77.71  ? 322  SER B CA  1 
ATOM   6640 C C   . SER B 2 322 ? 53.632  -20.457 20.542  1.00 82.92  ? 322  SER B C   1 
ATOM   6641 O O   . SER B 2 322 ? 53.055  -20.290 21.613  1.00 86.14  ? 322  SER B O   1 
ATOM   6642 C CB  . SER B 2 322 ? 55.855  -20.816 21.491  1.00 80.43  ? 322  SER B CB  1 
ATOM   6643 O OG  . SER B 2 322 ? 55.647  -19.420 21.669  1.00 69.06  ? 322  SER B OG  1 
ATOM   6644 N N   . LYS B 2 323 ? 53.253  -19.847 19.415  1.00 89.25  ? 323  LYS B N   1 
ATOM   6645 C CA  . LYS B 2 323 ? 52.090  -18.954 19.392  1.00 91.10  ? 323  LYS B CA  1 
ATOM   6646 C C   . LYS B 2 323 ? 50.928  -19.432 18.543  1.00 90.14  ? 323  LYS B C   1 
ATOM   6647 O O   . LYS B 2 323 ? 51.062  -20.326 17.698  1.00 82.41  ? 323  LYS B O   1 
ATOM   6648 C CB  . LYS B 2 323 ? 52.480  -17.547 18.934  1.00 88.82  ? 323  LYS B CB  1 
ATOM   6649 C CG  . LYS B 2 323 ? 53.460  -16.857 19.855  1.00 96.75  ? 323  LYS B CG  1 
ATOM   6650 C CD  . LYS B 2 323 ? 53.015  -16.950 21.307  1.00 104.61 ? 323  LYS B CD  1 
ATOM   6651 C CE  . LYS B 2 323 ? 51.618  -16.376 21.503  1.00 107.30 ? 323  LYS B CE  1 
ATOM   6652 N NZ  . LYS B 2 323 ? 51.286  -16.271 22.949  1.00 118.92 ? 323  LYS B NZ  1 
ATOM   6653 N N   . ASP B 2 324 ? 49.777  -18.818 18.787  1.00 90.83  ? 324  ASP B N   1 
ATOM   6654 C CA  . ASP B 2 324 ? 48.577  -19.160 18.058  1.00 85.44  ? 324  ASP B CA  1 
ATOM   6655 C C   . ASP B 2 324 ? 48.661  -18.582 16.661  1.00 76.17  ? 324  ASP B C   1 
ATOM   6656 O O   . ASP B 2 324 ? 49.176  -17.477 16.457  1.00 70.58  ? 324  ASP B O   1 
ATOM   6657 C CB  . ASP B 2 324 ? 47.345  -18.611 18.783  1.00 87.23  ? 324  ASP B CB  1 
ATOM   6658 C CG  . ASP B 2 324 ? 47.036  -19.371 20.065  1.00 88.52  ? 324  ASP B CG  1 
ATOM   6659 O OD1 . ASP B 2 324 ? 46.291  -18.848 20.924  1.00 83.20  ? 324  ASP B OD1 1 
ATOM   6660 O OD2 . ASP B 2 324 ? 47.535  -20.504 20.210  1.00 94.14  ? 324  ASP B OD2 1 
ATOM   6661 N N   . LEU B 2 325 ? 48.162  -19.356 15.707  1.00 70.01  ? 325  LEU B N   1 
ATOM   6662 C CA  . LEU B 2 325 ? 48.129  -18.962 14.312  1.00 68.53  ? 325  LEU B CA  1 
ATOM   6663 C C   . LEU B 2 325 ? 46.711  -18.435 14.077  1.00 69.29  ? 325  LEU B C   1 
ATOM   6664 O O   . LEU B 2 325 ? 45.749  -19.211 14.112  1.00 70.43  ? 325  LEU B O   1 
ATOM   6665 C CB  . LEU B 2 325 ? 48.387  -20.195 13.455  1.00 73.85  ? 325  LEU B CB  1 
ATOM   6666 C CG  . LEU B 2 325 ? 49.182  -20.089 12.150  1.00 74.00  ? 325  LEU B CG  1 
ATOM   6667 C CD1 . LEU B 2 325 ? 50.492  -19.324 12.387  1.00 67.90  ? 325  LEU B CD1 1 
ATOM   6668 C CD2 . LEU B 2 325 ? 49.452  -21.507 11.618  1.00 69.79  ? 325  LEU B CD2 1 
ATOM   6669 N N   . ILE B 2 326 ? 46.579  -17.124 13.859  1.00 69.09  ? 326  ILE B N   1 
ATOM   6670 C CA  . ILE B 2 326 ? 45.266  -16.504 13.642  1.00 64.91  ? 326  ILE B CA  1 
ATOM   6671 C C   . ILE B 2 326 ? 44.969  -16.203 12.174  1.00 64.98  ? 326  ILE B C   1 
ATOM   6672 O O   . ILE B 2 326 ? 45.873  -15.831 11.413  1.00 62.89  ? 326  ILE B O   1 
ATOM   6673 C CB  . ILE B 2 326 ? 45.140  -15.191 14.408  1.00 50.96  ? 326  ILE B CB  1 
ATOM   6674 C CG1 . ILE B 2 326 ? 45.522  -15.410 15.859  1.00 59.11  ? 326  ILE B CG1 1 
ATOM   6675 C CG2 . ILE B 2 326 ? 43.710  -14.683 14.330  1.00 62.81  ? 326  ILE B CG2 1 
ATOM   6676 C CD1 . ILE B 2 326 ? 45.694  -14.126 16.632  1.00 77.20  ? 326  ILE B CD1 1 
ATOM   6677 N N   . ALA B 2 327 ? 43.694  -16.356 11.798  1.00 60.54  ? 327  ALA B N   1 
ATOM   6678 C CA  . ALA B 2 327 ? 43.233  -16.106 10.429  1.00 60.33  ? 327  ALA B CA  1 
ATOM   6679 C C   . ALA B 2 327 ? 41.921  -15.292 10.365  1.00 63.00  ? 327  ALA B C   1 
ATOM   6680 O O   . ALA B 2 327 ? 40.864  -15.776 10.795  1.00 66.24  ? 327  ALA B O   1 
ATOM   6681 C CB  . ALA B 2 327 ? 43.067  -17.449 9.669   1.00 48.30  ? 327  ALA B CB  1 
ATOM   6682 N N   . GLU B 2 328 ? 42.012  -14.063 9.830   1.00 63.17  ? 328  GLU B N   1 
ATOM   6683 C CA  . GLU B 2 328 ? 40.864  -13.157 9.657   1.00 62.39  ? 328  GLU B CA  1 
ATOM   6684 C C   . GLU B 2 328 ? 40.441  -13.111 8.212   1.00 61.39  ? 328  GLU B C   1 
ATOM   6685 O O   . GLU B 2 328 ? 41.276  -13.113 7.295   1.00 51.76  ? 328  GLU B O   1 
ATOM   6686 C CB  . GLU B 2 328 ? 41.197  -11.714 9.982   1.00 66.11  ? 328  GLU B CB  1 
ATOM   6687 C CG  . GLU B 2 328 ? 41.634  -11.420 11.355  1.00 83.01  ? 328  GLU B CG  1 
ATOM   6688 C CD  . GLU B 2 328 ? 41.378  -9.978  11.661  1.00 91.06  ? 328  GLU B CD  1 
ATOM   6689 O OE1 . GLU B 2 328 ? 42.013  -9.429  12.584  1.00 100.14 ? 328  GLU B OE1 1 
ATOM   6690 O OE2 . GLU B 2 328 ? 40.519  -9.396  10.966  1.00 92.95  ? 328  GLU B OE2 1 
ATOM   6691 N N   . ILE B 2 329 ? 39.144  -13.018 7.995   1.00 61.83  ? 329  ILE B N   1 
ATOM   6692 C CA  . ILE B 2 329 ? 38.701  -12.918 6.630   1.00 69.32  ? 329  ILE B CA  1 
ATOM   6693 C C   . ILE B 2 329 ? 37.858  -11.667 6.504   1.00 78.21  ? 329  ILE B C   1 
ATOM   6694 O O   . ILE B 2 329 ? 37.295  -11.177 7.492   1.00 77.13  ? 329  ILE B O   1 
ATOM   6695 C CB  . ILE B 2 329 ? 37.884  -14.151 6.197   1.00 66.59  ? 329  ILE B CB  1 
ATOM   6696 C CG1 . ILE B 2 329 ? 38.653  -15.425 6.549   1.00 61.23  ? 329  ILE B CG1 1 
ATOM   6697 C CG2 . ILE B 2 329 ? 37.637  -14.109 4.682   1.00 57.14  ? 329  ILE B CG2 1 
ATOM   6698 C CD1 . ILE B 2 329 ? 38.062  -16.705 5.961   1.00 49.88  ? 329  ILE B CD1 1 
ATOM   6699 N N   . GLN B 2 330 ? 37.820  -11.126 5.290   1.00 86.13  ? 330  GLN B N   1 
ATOM   6700 C CA  . GLN B 2 330 ? 37.012  -9.953  4.993   1.00 87.37  ? 330  GLN B CA  1 
ATOM   6701 C C   . GLN B 2 330 ? 36.234  -10.229 3.697   1.00 91.70  ? 330  GLN B C   1 
ATOM   6702 O O   . GLN B 2 330 ? 36.732  -10.893 2.766   1.00 78.72  ? 330  GLN B O   1 
ATOM   6703 C CB  . GLN B 2 330 ? 37.883  -8.704  4.819   1.00 79.01  ? 330  GLN B CB  1 
ATOM   6704 C CG  . GLN B 2 330 ? 38.741  -8.326  6.019   1.00 72.23  ? 330  GLN B CG  1 
ATOM   6705 C CD  . GLN B 2 330 ? 40.077  -9.042  6.034   1.00 66.56  ? 330  GLN B CD  1 
ATOM   6706 O OE1 . GLN B 2 330 ? 40.648  -9.337  4.984   1.00 63.60  ? 330  GLN B OE1 1 
ATOM   6707 N NE2 . GLN B 2 330 ? 40.594  -9.304  7.229   1.00 61.97  ? 330  GLN B NE2 1 
ATOM   6708 N N   . LYS B 2 331 ? 34.993  -9.754  3.657   1.00 100.71 ? 331  LYS B N   1 
ATOM   6709 C CA  . LYS B 2 331 ? 34.182  -9.928  2.463   1.00 101.94 ? 331  LYS B CA  1 
ATOM   6710 C C   . LYS B 2 331 ? 34.426  -8.673  1.624   1.00 100.39 ? 331  LYS B C   1 
ATOM   6711 O O   . LYS B 2 331 ? 34.307  -7.535  2.113   1.00 94.72  ? 331  LYS B O   1 
ATOM   6712 C CB  . LYS B 2 331 ? 32.697  -10.062 2.822   1.00 104.93 ? 331  LYS B CB  1 
ATOM   6713 C CG  . LYS B 2 331 ? 31.776  -10.293 1.617   1.00 102.15 ? 331  LYS B CG  1 
ATOM   6714 C CD  . LYS B 2 331 ? 30.302  -10.156 2.013   1.00 98.43  ? 331  LYS B CD  1 
ATOM   6715 C CE  . LYS B 2 331 ? 29.375  -10.225 0.805   1.00 90.07  ? 331  LYS B CE  1 
ATOM   6716 N NZ  . LYS B 2 331 ? 27.951  -10.105 1.225   1.00 86.28  ? 331  LYS B NZ  1 
ATOM   6717 N N   . GLN B 2 332 ? 34.818  -8.889  0.375   1.00 101.32 ? 332  GLN B N   1 
ATOM   6718 C CA  . GLN B 2 332 ? 35.091  -7.788  -0.531  1.00 98.72  ? 332  GLN B CA  1 
ATOM   6719 C C   . GLN B 2 332 ? 33.848  -7.566  -1.375  1.00 102.18 ? 332  GLN B C   1 
ATOM   6720 O O   . GLN B 2 332 ? 33.364  -6.440  -1.503  1.00 99.98  ? 332  GLN B O   1 
ATOM   6721 C CB  . GLN B 2 332 ? 36.279  -8.141  -1.421  1.00 86.99  ? 332  GLN B CB  1 
ATOM   6722 C CG  . GLN B 2 332 ? 37.580  -8.318  -0.668  1.00 80.36  ? 332  GLN B CG  1 
ATOM   6723 C CD  . GLN B 2 332 ? 38.077  -7.021  -0.040  1.00 86.36  ? 332  GLN B CD  1 
ATOM   6724 O OE1 . GLN B 2 332 ? 38.268  -6.014  -0.723  1.00 80.15  ? 332  GLN B OE1 1 
ATOM   6725 N NE2 . GLN B 2 332 ? 38.298  -7.047  1.271   1.00 99.75  ? 332  GLN B NE2 1 
ATOM   6726 N N   . GLY B 2 333 ? 33.337  -8.664  -1.933  1.00 107.26 ? 333  GLY B N   1 
ATOM   6727 C CA  . GLY B 2 333 ? 32.149  -8.615  -2.764  1.00 111.11 ? 333  GLY B CA  1 
ATOM   6728 C C   . GLY B 2 333 ? 32.323  -9.410  -4.046  1.00 116.68 ? 333  GLY B C   1 
ATOM   6729 O O   . GLY B 2 333 ? 33.394  -9.963  -4.301  1.00 119.29 ? 333  GLY B O   1 
ATOM   6730 N N   . GLN B 2 334 ? 31.262  -9.465  -4.848  1.00 117.74 ? 334  GLN B N   1 
ATOM   6731 C CA  . GLN B 2 334 ? 31.256  -10.173 -6.132  1.00 117.18 ? 334  GLN B CA  1 
ATOM   6732 C C   . GLN B 2 334 ? 31.799  -11.592 -6.009  1.00 110.39 ? 334  GLN B C   1 
ATOM   6733 O O   . GLN B 2 334 ? 32.203  -12.203 -7.006  1.00 108.54 ? 334  GLN B O   1 
ATOM   6734 C CB  . GLN B 2 334 ? 32.082  -9.399  -7.174  1.00 128.65 ? 334  GLN B CB  1 
ATOM   6735 C CG  . GLN B 2 334 ? 31.989  -7.872  -7.059  1.00 135.42 ? 334  GLN B CG  1 
ATOM   6736 C CD  . GLN B 2 334 ? 30.558  -7.344  -7.062  1.00 136.10 ? 334  GLN B CD  1 
ATOM   6737 O OE1 . GLN B 2 334 ? 30.234  -6.424  -6.313  1.00 137.27 ? 334  GLN B OE1 1 
ATOM   6738 N NE2 . GLN B 2 334 ? 29.704  -7.914  -7.911  1.00 134.50 ? 334  GLN B NE2 1 
ATOM   6739 N N   . GLY B 2 335 ? 31.795  -12.113 -4.786  1.00 101.64 ? 335  GLY B N   1 
ATOM   6740 C CA  . GLY B 2 335 ? 32.306  -13.449 -4.552  1.00 94.63  ? 335  GLY B CA  1 
ATOM   6741 C C   . GLY B 2 335 ? 33.802  -13.422 -4.273  1.00 92.33  ? 335  GLY B C   1 
ATOM   6742 O O   . GLY B 2 335 ? 34.504  -14.413 -4.493  1.00 86.86  ? 335  GLY B O   1 
ATOM   6743 N N   . GLN B 2 336 ? 34.289  -12.284 -3.781  1.00 91.00  ? 336  GLN B N   1 
ATOM   6744 C CA  . GLN B 2 336 ? 35.708  -12.119 -3.482  1.00 92.45  ? 336  GLN B CA  1 
ATOM   6745 C C   . GLN B 2 336 ? 35.994  -11.847 -2.006  1.00 87.97  ? 336  GLN B C   1 
ATOM   6746 O O   . GLN B 2 336 ? 35.323  -11.032 -1.359  1.00 81.93  ? 336  GLN B O   1 
ATOM   6747 C CB  . GLN B 2 336 ? 36.289  -10.993 -4.337  1.00 99.87  ? 336  GLN B CB  1 
ATOM   6748 C CG  . GLN B 2 336 ? 36.515  -11.370 -5.795  1.00 105.26 ? 336  GLN B CG  1 
ATOM   6749 C CD  . GLN B 2 336 ? 36.503  -10.159 -6.715  1.00 106.88 ? 336  GLN B CD  1 
ATOM   6750 O OE1 . GLN B 2 336 ? 37.101  -10.175 -7.799  1.00 114.23 ? 336  GLN B OE1 1 
ATOM   6751 N NE2 . GLN B 2 336 ? 35.806  -9.105  -6.294  1.00 96.06  ? 336  GLN B NE2 1 
ATOM   6752 N N   . TRP B 2 337 ? 37.016  -12.526 -1.490  1.00 86.47  ? 337  TRP B N   1 
ATOM   6753 C CA  . TRP B 2 337 ? 37.389  -12.390 -0.094  1.00 83.13  ? 337  TRP B CA  1 
ATOM   6754 C C   . TRP B 2 337 ? 38.868  -12.205 0.112   1.00 78.74  ? 337  TRP B C   1 
ATOM   6755 O O   . TRP B 2 337 ? 39.683  -12.561 -0.737  1.00 81.03  ? 337  TRP B O   1 
ATOM   6756 C CB  . TRP B 2 337 ? 36.966  -13.621 0.673   1.00 83.87  ? 337  TRP B CB  1 
ATOM   6757 C CG  . TRP B 2 337 ? 35.563  -14.030 0.405   1.00 86.67  ? 337  TRP B CG  1 
ATOM   6758 C CD1 . TRP B 2 337 ? 35.075  -14.664 -0.714  1.00 69.98  ? 337  TRP B CD1 1 
ATOM   6759 C CD2 . TRP B 2 337 ? 34.463  -13.906 1.310   1.00 87.84  ? 337  TRP B CD2 1 
ATOM   6760 N NE1 . TRP B 2 337 ? 33.732  -14.953 -0.548  1.00 61.92  ? 337  TRP B NE1 1 
ATOM   6761 C CE2 . TRP B 2 337 ? 33.334  -14.501 0.684   1.00 75.95  ? 337  TRP B CE2 1 
ATOM   6762 C CE3 . TRP B 2 337 ? 34.321  -13.353 2.594   1.00 85.67  ? 337  TRP B CE3 1 
ATOM   6763 C CZ2 . TRP B 2 337 ? 32.086  -14.559 1.300   1.00 80.06  ? 337  TRP B CZ2 1 
ATOM   6764 C CZ3 . TRP B 2 337 ? 33.080  -13.409 3.208   1.00 82.01  ? 337  TRP B CZ3 1 
ATOM   6765 C CH2 . TRP B 2 337 ? 31.977  -14.010 2.559   1.00 92.33  ? 337  TRP B CH2 1 
ATOM   6766 N N   . THR B 2 338 ? 39.206  -11.665 1.270   1.00 74.40  ? 338  THR B N   1 
ATOM   6767 C CA  . THR B 2 338 ? 40.589  -11.433 1.601   1.00 77.11  ? 338  THR B CA  1 
ATOM   6768 C C   . THR B 2 338 ? 40.882  -11.922 2.993   1.00 78.80  ? 338  THR B C   1 
ATOM   6769 O O   . THR B 2 338 ? 40.147  -11.650 3.940   1.00 80.40  ? 338  THR B O   1 
ATOM   6770 C CB  . THR B 2 338 ? 40.945  -9.948  1.517   1.00 73.33  ? 338  THR B CB  1 
ATOM   6771 O OG1 . THR B 2 338 ? 40.101  -9.199  2.400   1.00 68.89  ? 338  THR B OG1 1 
ATOM   6772 C CG2 . THR B 2 338 ? 40.779  -9.455  0.090   1.00 65.45  ? 338  THR B CG2 1 
ATOM   6773 N N   . TYR B 2 339 ? 41.975  -12.651 3.112   1.00 75.69  ? 339  TYR B N   1 
ATOM   6774 C CA  . TYR B 2 339 ? 42.351  -13.169 4.396   1.00 74.97  ? 339  TYR B CA  1 
ATOM   6775 C C   . TYR B 2 339 ? 43.773  -12.824 4.701   1.00 79.10  ? 339  TYR B C   1 
ATOM   6776 O O   . TYR B 2 339 ? 44.539  -12.467 3.812   1.00 82.63  ? 339  TYR B O   1 
ATOM   6777 C CB  . TYR B 2 339 ? 42.196  -14.672 4.417   1.00 72.97  ? 339  TYR B CB  1 
ATOM   6778 C CG  . TYR B 2 339 ? 43.059  -15.422 3.424   1.00 75.83  ? 339  TYR B CG  1 
ATOM   6779 C CD1 . TYR B 2 339 ? 42.500  -15.964 2.256   1.00 76.26  ? 339  TYR B CD1 1 
ATOM   6780 C CD2 . TYR B 2 339 ? 44.405  -15.700 3.704   1.00 69.59  ? 339  TYR B CD2 1 
ATOM   6781 C CE1 . TYR B 2 339 ? 43.248  -16.778 1.399   1.00 68.90  ? 339  TYR B CE1 1 
ATOM   6782 C CE2 . TYR B 2 339 ? 45.171  -16.520 2.846   1.00 69.78  ? 339  TYR B CE2 1 
ATOM   6783 C CZ  . TYR B 2 339 ? 44.579  -17.056 1.697   1.00 68.89  ? 339  TYR B CZ  1 
ATOM   6784 O OH  . TYR B 2 339 ? 45.305  -17.870 0.850   1.00 75.79  ? 339  TYR B OH  1 
ATOM   6785 N N   . GLN B 2 340 ? 44.116  -12.934 5.974   1.00 79.90  ? 340  GLN B N   1 
ATOM   6786 C CA  . GLN B 2 340 ? 45.463  -12.659 6.425   1.00 81.76  ? 340  GLN B CA  1 
ATOM   6787 C C   . GLN B 2 340 ? 45.760  -13.557 7.616   1.00 84.55  ? 340  GLN B C   1 
ATOM   6788 O O   . GLN B 2 340 ? 45.023  -13.536 8.604   1.00 88.11  ? 340  GLN B O   1 
ATOM   6789 C CB  . GLN B 2 340 ? 45.616  -11.201 6.866   1.00 81.86  ? 340  GLN B CB  1 
ATOM   6790 C CG  . GLN B 2 340 ? 45.111  -10.148 5.896   1.00 77.68  ? 340  GLN B CG  1 
ATOM   6791 C CD  . GLN B 2 340 ? 43.686  -9.773  6.181   1.00 75.42  ? 340  GLN B CD  1 
ATOM   6792 O OE1 . GLN B 2 340 ? 43.280  -9.673  7.349   1.00 61.31  ? 340  GLN B OE1 1 
ATOM   6793 N NE2 . GLN B 2 340 ? 42.913  -9.549  5.125   1.00 73.35  ? 340  GLN B NE2 1 
ATOM   6794 N N   . ILE B 2 341 ? 46.840  -14.332 7.515   1.00 85.01  ? 341  ILE B N   1 
ATOM   6795 C CA  . ILE B 2 341 ? 47.282  -15.238 8.574   1.00 73.75  ? 341  ILE B CA  1 
ATOM   6796 C C   . ILE B 2 341 ? 48.447  -14.605 9.322   1.00 74.39  ? 341  ILE B C   1 
ATOM   6797 O O   . ILE B 2 341 ? 49.457  -14.248 8.705   1.00 72.28  ? 341  ILE B O   1 
ATOM   6798 C CB  . ILE B 2 341 ? 47.780  -16.554 7.999   1.00 58.31  ? 341  ILE B CB  1 
ATOM   6799 C CG1 . ILE B 2 341 ? 46.666  -17.220 7.195   1.00 58.52  ? 341  ILE B CG1 1 
ATOM   6800 C CG2 . ILE B 2 341 ? 48.239  -17.447 9.114   1.00 50.50  ? 341  ILE B CG2 1 
ATOM   6801 C CD1 . ILE B 2 341 ? 47.112  -18.457 6.448   1.00 53.92  ? 341  ILE B CD1 1 
ATOM   6802 N N   . TYR B 2 342 ? 48.314  -14.469 10.641  1.00 77.25  ? 342  TYR B N   1 
ATOM   6803 C CA  . TYR B 2 342 ? 49.383  -13.876 11.447  1.00 78.74  ? 342  TYR B CA  1 
ATOM   6804 C C   . TYR B 2 342 ? 49.391  -14.424 12.882  1.00 84.70  ? 342  TYR B C   1 
ATOM   6805 O O   . TYR B 2 342 ? 48.564  -15.277 13.235  1.00 87.65  ? 342  TYR B O   1 
ATOM   6806 C CB  . TYR B 2 342 ? 49.207  -12.358 11.473  1.00 61.34  ? 342  TYR B CB  1 
ATOM   6807 C CG  . TYR B 2 342 ? 47.935  -11.951 12.148  1.00 60.16  ? 342  TYR B CG  1 
ATOM   6808 C CD1 . TYR B 2 342 ? 47.931  -11.583 13.500  1.00 58.78  ? 342  TYR B CD1 1 
ATOM   6809 C CD2 . TYR B 2 342 ? 46.722  -11.966 11.452  1.00 60.99  ? 342  TYR B CD2 1 
ATOM   6810 C CE1 . TYR B 2 342 ? 46.746  -11.236 14.156  1.00 65.17  ? 342  TYR B CE1 1 
ATOM   6811 C CE2 . TYR B 2 342 ? 45.522  -11.618 12.092  1.00 71.37  ? 342  TYR B CE2 1 
ATOM   6812 C CZ  . TYR B 2 342 ? 45.541  -11.251 13.453  1.00 73.98  ? 342  TYR B CZ  1 
ATOM   6813 O OH  . TYR B 2 342 ? 44.371  -10.898 14.116  1.00 71.36  ? 342  TYR B OH  1 
ATOM   6814 N N   . GLN B 2 343 ? 50.341  -13.949 13.691  1.00 85.37  ? 343  GLN B N   1 
ATOM   6815 C CA  . GLN B 2 343 ? 50.434  -14.347 15.092  1.00 83.57  ? 343  GLN B CA  1 
ATOM   6816 C C   . GLN B 2 343 ? 50.372  -13.068 15.920  1.00 89.05  ? 343  GLN B C   1 
ATOM   6817 O O   . GLN B 2 343 ? 49.862  -13.049 17.040  1.00 88.07  ? 343  GLN B O   1 
ATOM   6818 C CB  . GLN B 2 343 ? 51.742  -15.078 15.365  1.00 82.13  ? 343  GLN B CB  1 
ATOM   6819 C CG  . GLN B 2 343 ? 51.923  -16.350 14.556  1.00 86.64  ? 343  GLN B CG  1 
ATOM   6820 C CD  . GLN B 2 343 ? 53.135  -17.173 15.003  1.00 93.85  ? 343  GLN B CD  1 
ATOM   6821 O OE1 . GLN B 2 343 ? 54.246  -16.649 15.160  1.00 102.73 ? 343  GLN B OE1 1 
ATOM   6822 N NE2 . GLN B 2 343 ? 52.926  -18.470 15.195  1.00 98.38  ? 343  GLN B NE2 1 
ATOM   6823 N N   . GLU B 2 344 ? 50.886  -11.989 15.344  1.00 97.43  ? 344  GLU B N   1 
ATOM   6824 C CA  . GLU B 2 344 ? 50.890  -10.693 16.006  1.00 100.46 ? 344  GLU B CA  1 
ATOM   6825 C C   . GLU B 2 344 ? 50.355  -9.676  15.022  1.00 99.48  ? 344  GLU B C   1 
ATOM   6826 O O   . GLU B 2 344 ? 50.811  -9.599  13.883  1.00 100.91 ? 344  GLU B O   1 
ATOM   6827 C CB  . GLU B 2 344 ? 52.302  -10.316 16.393  1.00 107.79 ? 344  GLU B CB  1 
ATOM   6828 C CG  . GLU B 2 344 ? 52.385  -9.314  17.496  1.00 123.43 ? 344  GLU B CG  1 
ATOM   6829 C CD  . GLU B 2 344 ? 53.820  -8.964  17.796  1.00 142.07 ? 344  GLU B CD  1 
ATOM   6830 O OE1 . GLU B 2 344 ? 54.659  -9.893  17.842  1.00 149.50 ? 344  GLU B OE1 1 
ATOM   6831 O OE2 . GLU B 2 344 ? 54.112  -7.766  17.987  1.00 147.21 ? 344  GLU B OE2 1 
ATOM   6832 N N   . PRO B 2 345 ? 49.385  -8.869  15.452  1.00 100.25 ? 345  PRO B N   1 
ATOM   6833 C CA  . PRO B 2 345 ? 48.793  -7.857  14.578  1.00 99.95  ? 345  PRO B CA  1 
ATOM   6834 C C   . PRO B 2 345 ? 49.791  -7.131  13.683  1.00 97.17  ? 345  PRO B C   1 
ATOM   6835 O O   . PRO B 2 345 ? 50.909  -6.800  14.098  1.00 85.55  ? 345  PRO B O   1 
ATOM   6836 C CB  . PRO B 2 345 ? 48.100  -6.919  15.562  1.00 99.19  ? 345  PRO B CB  1 
ATOM   6837 C CG  . PRO B 2 345 ? 47.655  -7.857  16.622  1.00 103.05 ? 345  PRO B CG  1 
ATOM   6838 C CD  . PRO B 2 345 ? 48.881  -8.732  16.826  1.00 102.00 ? 345  PRO B CD  1 
ATOM   6839 N N   . PHE B 2 346 ? 49.371  -6.916  12.440  1.00 98.15  ? 346  PHE B N   1 
ATOM   6840 C CA  . PHE B 2 346 ? 50.174  -6.201  11.463  1.00 100.92 ? 346  PHE B CA  1 
ATOM   6841 C C   . PHE B 2 346 ? 51.319  -7.031  10.919  1.00 94.42  ? 346  PHE B C   1 
ATOM   6842 O O   . PHE B 2 346 ? 51.803  -6.781  9.819   1.00 97.65  ? 346  PHE B O   1 
ATOM   6843 C CB  . PHE B 2 346 ? 50.710  -4.907  12.095  1.00 114.81 ? 346  PHE B CB  1 
ATOM   6844 C CG  . PHE B 2 346 ? 49.628  -4.011  12.660  1.00 130.81 ? 346  PHE B CG  1 
ATOM   6845 C CD1 . PHE B 2 346 ? 49.893  -3.164  13.738  1.00 131.30 ? 346  PHE B CD1 1 
ATOM   6846 C CD2 . PHE B 2 346 ? 48.340  -4.017  12.113  1.00 138.85 ? 346  PHE B CD2 1 
ATOM   6847 C CE1 . PHE B 2 346 ? 48.893  -2.339  14.265  1.00 135.28 ? 346  PHE B CE1 1 
ATOM   6848 C CE2 . PHE B 2 346 ? 47.332  -3.195  12.630  1.00 141.72 ? 346  PHE B CE2 1 
ATOM   6849 C CZ  . PHE B 2 346 ? 47.610  -2.355  13.709  1.00 142.03 ? 346  PHE B CZ  1 
ATOM   6850 N N   . LYS B 2 347 ? 51.744  -8.024  11.685  1.00 83.83  ? 347  LYS B N   1 
ATOM   6851 C CA  . LYS B 2 347 ? 52.848  -8.869  11.267  1.00 73.91  ? 347  LYS B CA  1 
ATOM   6852 C C   . LYS B 2 347 ? 52.329  -10.148 10.632  1.00 63.93  ? 347  LYS B C   1 
ATOM   6853 O O   . LYS B 2 347 ? 52.303  -11.201 11.253  1.00 63.54  ? 347  LYS B O   1 
ATOM   6854 C CB  . LYS B 2 347 ? 53.733  -9.165  12.476  1.00 79.11  ? 347  LYS B CB  1 
ATOM   6855 C CG  . LYS B 2 347 ? 54.116  -7.895  13.246  1.00 76.32  ? 347  LYS B CG  1 
ATOM   6856 C CD  . LYS B 2 347 ? 55.301  -8.117  14.171  1.00 74.22  ? 347  LYS B CD  1 
ATOM   6857 C CE  . LYS B 2 347 ? 55.623  -6.855  14.934  1.00 82.10  ? 347  LYS B CE  1 
ATOM   6858 N NZ  . LYS B 2 347 ? 56.747  -7.082  15.866  1.00 91.06  ? 347  LYS B NZ  1 
ATOM   6859 N N   . ASN B 2 348 ? 51.930  -10.036 9.374   1.00 63.93  ? 348  ASN B N   1 
ATOM   6860 C CA  . ASN B 2 348 ? 51.355  -11.149 8.619   1.00 76.34  ? 348  ASN B CA  1 
ATOM   6861 C C   . ASN B 2 348 ? 52.305  -12.215 8.074   1.00 76.00  ? 348  ASN B C   1 
ATOM   6862 O O   . ASN B 2 348 ? 53.296  -11.917 7.416   1.00 79.43  ? 348  ASN B O   1 
ATOM   6863 C CB  . ASN B 2 348 ? 50.537  -10.603 7.444   1.00 84.23  ? 348  ASN B CB  1 
ATOM   6864 C CG  . ASN B 2 348 ? 49.369  -9.724  7.882   1.00 87.80  ? 348  ASN B CG  1 
ATOM   6865 O OD1 . ASN B 2 348 ? 49.275  -9.294  9.041   1.00 93.31  ? 348  ASN B OD1 1 
ATOM   6866 N ND2 . ASN B 2 348 ? 48.475  -9.439  6.935   1.00 84.63  ? 348  ASN B ND2 1 
ATOM   6867 N N   . LEU B 2 349 ? 51.969  -13.468 8.332   1.00 72.95  ? 349  LEU B N   1 
ATOM   6868 C CA  . LEU B 2 349 ? 52.769  -14.581 7.855   1.00 76.21  ? 349  LEU B CA  1 
ATOM   6869 C C   . LEU B 2 349 ? 52.326  -14.915 6.453   1.00 77.89  ? 349  LEU B C   1 
ATOM   6870 O O   . LEU B 2 349 ? 53.002  -15.642 5.722   1.00 80.26  ? 349  LEU B O   1 
ATOM   6871 C CB  . LEU B 2 349 ? 52.544  -15.807 8.725   1.00 84.94  ? 349  LEU B CB  1 
ATOM   6872 C CG  . LEU B 2 349 ? 53.250  -15.832 10.069  1.00 87.70  ? 349  LEU B CG  1 
ATOM   6873 C CD1 . LEU B 2 349 ? 52.790  -17.057 10.878  1.00 74.25  ? 349  LEU B CD1 1 
ATOM   6874 C CD2 . LEU B 2 349 ? 54.759  -15.864 9.805   1.00 99.96  ? 349  LEU B CD2 1 
ATOM   6875 N N   . LYS B 2 350 ? 51.159  -14.409 6.093   1.00 80.25  ? 350  LYS B N   1 
ATOM   6876 C CA  . LYS B 2 350 ? 50.612  -14.654 4.774   1.00 82.63  ? 350  LYS B CA  1 
ATOM   6877 C C   . LYS B 2 350 ? 49.332  -13.891 4.564   1.00 81.34  ? 350  LYS B C   1 
ATOM   6878 O O   . LYS B 2 350 ? 48.570  -13.648 5.496   1.00 84.59  ? 350  LYS B O   1 
ATOM   6879 C CB  . LYS B 2 350 ? 50.329  -16.143 4.543   1.00 85.93  ? 350  LYS B CB  1 
ATOM   6880 C CG  . LYS B 2 350 ? 49.422  -16.383 3.335   1.00 90.72  ? 350  LYS B CG  1 
ATOM   6881 C CD  . LYS B 2 350 ? 49.593  -17.756 2.708   1.00 107.88 ? 350  LYS B CD  1 
ATOM   6882 C CE  . LYS B 2 350 ? 48.879  -17.801 1.353   1.00 125.34 ? 350  LYS B CE  1 
ATOM   6883 N NZ  . LYS B 2 350 ? 49.115  -19.072 0.596   1.00 139.74 ? 350  LYS B NZ  1 
ATOM   6884 N N   . THR B 2 351 ? 49.117  -13.508 3.316   1.00 81.12  ? 351  THR B N   1 
ATOM   6885 C CA  . THR B 2 351 ? 47.924  -12.793 2.921   1.00 78.88  ? 351  THR B CA  1 
ATOM   6886 C C   . THR B 2 351 ? 47.480  -13.436 1.603   1.00 78.05  ? 351  THR B C   1 
ATOM   6887 O O   . THR B 2 351 ? 48.302  -13.898 0.798   1.00 72.63  ? 351  THR B O   1 
ATOM   6888 C CB  . THR B 2 351 ? 48.200  -11.273 2.747   1.00 75.98  ? 351  THR B CB  1 
ATOM   6889 O OG1 . THR B 2 351 ? 49.410  -11.086 2.000   1.00 81.90  ? 351  THR B OG1 1 
ATOM   6890 C CG2 . THR B 2 351 ? 48.328  -10.582 4.120   1.00 68.05  ? 351  THR B CG2 1 
ATOM   6891 N N   . GLY B 2 352 ? 46.171  -13.497 1.400   1.00 80.50  ? 352  GLY B N   1 
ATOM   6892 C CA  . GLY B 2 352 ? 45.672  -14.118 0.197   1.00 76.54  ? 352  GLY B CA  1 
ATOM   6893 C C   . GLY B 2 352 ? 44.381  -13.536 -0.324  1.00 73.61  ? 352  GLY B C   1 
ATOM   6894 O O   . GLY B 2 352 ? 43.877  -12.503 0.136   1.00 66.17  ? 352  GLY B O   1 
ATOM   6895 N N   . LYS B 2 353 ? 43.840  -14.248 -1.299  1.00 78.48  ? 353  LYS B N   1 
ATOM   6896 C CA  . LYS B 2 353 ? 42.625  -13.849 -1.976  1.00 84.88  ? 353  LYS B CA  1 
ATOM   6897 C C   . LYS B 2 353 ? 41.844  -15.132 -2.249  1.00 85.16  ? 353  LYS B C   1 
ATOM   6898 O O   . LYS B 2 353 ? 42.424  -16.206 -2.436  1.00 81.40  ? 353  LYS B O   1 
ATOM   6899 C CB  . LYS B 2 353 ? 42.995  -13.169 -3.314  1.00 88.71  ? 353  LYS B CB  1 
ATOM   6900 C CG  . LYS B 2 353 ? 42.063  -12.060 -3.775  1.00 93.93  ? 353  LYS B CG  1 
ATOM   6901 C CD  . LYS B 2 353 ? 42.291  -10.770 -2.993  1.00 98.00  ? 353  LYS B CD  1 
ATOM   6902 C CE  . LYS B 2 353 ? 43.247  -9.814  -3.707  1.00 103.66 ? 353  LYS B CE  1 
ATOM   6903 N NZ  . LYS B 2 353 ? 42.620  -9.124  -4.879  1.00 110.26 ? 353  LYS B NZ  1 
ATOM   6904 N N   . TYR B 2 354 ? 40.526  -15.017 -2.246  1.00 87.34  ? 354  TYR B N   1 
ATOM   6905 C CA  . TYR B 2 354 ? 39.678  -16.149 -2.556  1.00 87.02  ? 354  TYR B CA  1 
ATOM   6906 C C   . TYR B 2 354 ? 38.462  -15.601 -3.302  1.00 88.68  ? 354  TYR B C   1 
ATOM   6907 O O   . TYR B 2 354 ? 37.829  -14.638 -2.864  1.00 85.67  ? 354  TYR B O   1 
ATOM   6908 C CB  . TYR B 2 354 ? 39.235  -16.888 -1.296  1.00 81.84  ? 354  TYR B CB  1 
ATOM   6909 C CG  . TYR B 2 354 ? 38.315  -18.038 -1.628  1.00 86.65  ? 354  TYR B CG  1 
ATOM   6910 C CD1 . TYR B 2 354 ? 38.819  -19.299 -1.972  1.00 81.73  ? 354  TYR B CD1 1 
ATOM   6911 C CD2 . TYR B 2 354 ? 36.936  -17.846 -1.689  1.00 93.59  ? 354  TYR B CD2 1 
ATOM   6912 C CE1 . TYR B 2 354 ? 37.962  -20.341 -2.376  1.00 69.89  ? 354  TYR B CE1 1 
ATOM   6913 C CE2 . TYR B 2 354 ? 36.070  -18.877 -2.092  1.00 88.11  ? 354  TYR B CE2 1 
ATOM   6914 C CZ  . TYR B 2 354 ? 36.586  -20.117 -2.436  1.00 79.26  ? 354  TYR B CZ  1 
ATOM   6915 O OH  . TYR B 2 354 ? 35.714  -21.101 -2.859  1.00 84.28  ? 354  TYR B OH  1 
ATOM   6916 N N   . ALA B 2 355 ? 38.154  -16.208 -4.441  1.00 90.51  ? 355  ALA B N   1 
ATOM   6917 C CA  . ALA B 2 355 ? 37.027  -15.782 -5.252  1.00 95.28  ? 355  ALA B CA  1 
ATOM   6918 C C   . ALA B 2 355 ? 36.273  -16.993 -5.838  1.00 110.65 ? 355  ALA B C   1 
ATOM   6919 O O   . ALA B 2 355 ? 36.830  -17.788 -6.607  1.00 111.40 ? 355  ALA B O   1 
ATOM   6920 C CB  . ALA B 2 355 ? 37.519  -14.850 -6.360  1.00 78.33  ? 355  ALA B CB  1 
ATOM   6921 N N   . ARG B 2 356 ? 35.002  -17.112 -5.447  1.00 120.43 ? 356  ARG B N   1 
ATOM   6922 C CA  . ARG B 2 356 ? 34.086  -18.185 -5.855  1.00 123.96 ? 356  ARG B CA  1 
ATOM   6923 C C   . ARG B 2 356 ? 34.658  -19.362 -6.642  1.00 125.86 ? 356  ARG B C   1 
ATOM   6924 O O   . ARG B 2 356 ? 34.104  -20.468 -6.608  1.00 125.68 ? 356  ARG B O   1 
ATOM   6925 C CB  . ARG B 2 356 ? 32.904  -17.588 -6.624  1.00 126.48 ? 356  ARG B CB  1 
ATOM   6926 C CG  . ARG B 2 356 ? 33.266  -16.742 -7.838  1.00 131.84 ? 356  ARG B CG  1 
ATOM   6927 C CD  . ARG B 2 356 ? 31.990  -16.217 -8.503  1.00 143.93 ? 356  ARG B CD  1 
ATOM   6928 N NE  . ARG B 2 356 ? 31.241  -15.289 -7.648  1.00 150.00 ? 356  ARG B NE  1 
ATOM   6929 C CZ  . ARG B 2 356 ? 29.917  -15.312 -7.468  1.00 150.00 ? 356  ARG B CZ  1 
ATOM   6930 N NH1 . ARG B 2 356 ? 29.161  -16.220 -8.074  1.00 144.46 ? 356  ARG B NH1 1 
ATOM   6931 N NH2 . ARG B 2 356 ? 29.342  -14.420 -6.673  1.00 150.00 ? 356  ARG B NH2 1 
ATOM   6932 N N   . THR B 2 362 ? 26.635  -19.897 -6.286  1.00 92.07  ? 362  THR B N   1 
ATOM   6933 C CA  . THR B 2 362 ? 26.960  -19.982 -4.859  1.00 90.90  ? 362  THR B CA  1 
ATOM   6934 C C   . THR B 2 362 ? 26.354  -18.854 -4.003  1.00 89.69  ? 362  THR B C   1 
ATOM   6935 O O   . THR B 2 362 ? 25.647  -17.959 -4.503  1.00 94.84  ? 362  THR B O   1 
ATOM   6936 C CB  . THR B 2 362 ? 28.509  -19.985 -4.595  1.00 82.39  ? 362  THR B CB  1 
ATOM   6937 O OG1 . THR B 2 362 ? 29.100  -18.812 -5.162  1.00 83.75  ? 362  THR B OG1 1 
ATOM   6938 C CG2 . THR B 2 362 ? 29.166  -21.222 -5.180  1.00 74.96  ? 362  THR B CG2 1 
ATOM   6939 N N   . ASN B 2 363 ? 26.664  -18.916 -2.709  1.00 76.46  ? 363  ASN B N   1 
ATOM   6940 C CA  . ASN B 2 363 ? 26.191  -17.959 -1.722  1.00 60.48  ? 363  ASN B CA  1 
ATOM   6941 C C   . ASN B 2 363 ? 27.334  -17.636 -0.773  1.00 49.89  ? 363  ASN B C   1 
ATOM   6942 O O   . ASN B 2 363 ? 28.331  -18.353 -0.736  1.00 45.16  ? 363  ASN B O   1 
ATOM   6943 C CB  . ASN B 2 363 ? 25.019  -18.565 -0.943  1.00 65.20  ? 363  ASN B CB  1 
ATOM   6944 C CG  . ASN B 2 363 ? 25.398  -19.842 -0.202  1.00 59.42  ? 363  ASN B CG  1 
ATOM   6945 O OD1 . ASN B 2 363 ? 26.176  -19.805 0.750   1.00 50.79  ? 363  ASN B OD1 1 
ATOM   6946 N ND2 . ASN B 2 363 ? 24.851  -20.977 -0.640  1.00 48.16  ? 363  ASN B ND2 1 
ATOM   6947 N N   . ASP B 2 364 ? 27.183  -16.561 -0.004  1.00 52.91  ? 364  ASP B N   1 
ATOM   6948 C CA  . ASP B 2 364 ? 28.209  -16.119 0.950   1.00 57.86  ? 364  ASP B CA  1 
ATOM   6949 C C   . ASP B 2 364 ? 28.780  -17.208 1.845   1.00 59.13  ? 364  ASP B C   1 
ATOM   6950 O O   . ASP B 2 364 ? 29.993  -17.415 1.921   1.00 60.91  ? 364  ASP B O   1 
ATOM   6951 C CB  . ASP B 2 364 ? 27.660  -15.027 1.863   1.00 62.48  ? 364  ASP B CB  1 
ATOM   6952 C CG  . ASP B 2 364 ? 27.562  -13.697 1.183   1.00 80.67  ? 364  ASP B CG  1 
ATOM   6953 O OD1 . ASP B 2 364 ? 27.149  -12.741 1.868   1.00 83.77  ? 364  ASP B OD1 1 
ATOM   6954 O OD2 . ASP B 2 364 ? 27.897  -13.603 -0.022  1.00 89.45  ? 364  ASP B OD2 1 
ATOM   6955 N N   . VAL B 2 365 ? 27.894  -17.878 2.557   1.00 54.78  ? 365  VAL B N   1 
ATOM   6956 C CA  . VAL B 2 365 ? 28.311  -18.932 3.448   1.00 54.89  ? 365  VAL B CA  1 
ATOM   6957 C C   . VAL B 2 365 ? 29.146  -19.969 2.699   1.00 54.95  ? 365  VAL B C   1 
ATOM   6958 O O   . VAL B 2 365 ? 30.329  -20.147 2.998   1.00 55.04  ? 365  VAL B O   1 
ATOM   6959 C CB  . VAL B 2 365 ? 27.074  -19.577 4.097   1.00 51.10  ? 365  VAL B CB  1 
ATOM   6960 C CG1 . VAL B 2 365 ? 27.411  -20.921 4.691   1.00 52.23  ? 365  VAL B CG1 1 
ATOM   6961 C CG2 . VAL B 2 365 ? 26.550  -18.648 5.173   1.00 54.14  ? 365  VAL B CG2 1 
ATOM   6962 N N   . LYS B 2 366 ? 28.540  -20.634 1.719   1.00 52.50  ? 366  LYS B N   1 
ATOM   6963 C CA  . LYS B 2 366 ? 29.254  -21.645 0.962   1.00 54.56  ? 366  LYS B CA  1 
ATOM   6964 C C   . LYS B 2 366 ? 30.649  -21.152 0.718   1.00 55.58  ? 366  LYS B C   1 
ATOM   6965 O O   . LYS B 2 366 ? 31.615  -21.779 1.113   1.00 58.79  ? 366  LYS B O   1 
ATOM   6966 C CB  . LYS B 2 366 ? 28.578  -21.927 -0.379  1.00 63.62  ? 366  LYS B CB  1 
ATOM   6967 C CG  . LYS B 2 366 ? 29.384  -22.877 -1.268  1.00 59.37  ? 366  LYS B CG  1 
ATOM   6968 C CD  . LYS B 2 366 ? 28.480  -23.703 -2.173  1.00 78.93  ? 366  LYS B CD  1 
ATOM   6969 C CE  . LYS B 2 366 ? 29.269  -24.723 -3.001  1.00 93.19  ? 366  LYS B CE  1 
ATOM   6970 N NZ  . LYS B 2 366 ? 28.375  -25.732 -3.674  1.00 105.70 ? 366  LYS B NZ  1 
ATOM   6971 N N   . GLN B 2 367 ? 30.753  -20.008 0.073   1.00 55.37  ? 367  GLN B N   1 
ATOM   6972 C CA  . GLN B 2 367 ? 32.059  -19.451 -0.206  1.00 60.16  ? 367  GLN B CA  1 
ATOM   6973 C C   . GLN B 2 367 ? 32.936  -19.346 1.038   1.00 55.00  ? 367  GLN B C   1 
ATOM   6974 O O   . GLN B 2 367 ? 34.101  -19.743 1.033   1.00 53.37  ? 367  GLN B O   1 
ATOM   6975 C CB  . GLN B 2 367 ? 31.888  -18.079 -0.828  1.00 62.98  ? 367  GLN B CB  1 
ATOM   6976 C CG  . GLN B 2 367 ? 31.278  -18.128 -2.202  1.00 63.02  ? 367  GLN B CG  1 
ATOM   6977 C CD  . GLN B 2 367 ? 30.991  -16.745 -2.719  1.00 67.81  ? 367  GLN B CD  1 
ATOM   6978 O OE1 . GLN B 2 367 ? 31.585  -15.764 -2.256  1.00 66.05  ? 367  GLN B OE1 1 
ATOM   6979 N NE2 . GLN B 2 367 ? 30.087  -16.648 -3.685  1.00 71.83  ? 367  GLN B NE2 1 
ATOM   6980 N N   . LEU B 2 368 ? 32.365  -18.807 2.102   1.00 51.87  ? 368  LEU B N   1 
ATOM   6981 C CA  . LEU B 2 368 ? 33.100  -18.635 3.335   1.00 50.10  ? 368  LEU B CA  1 
ATOM   6982 C C   . LEU B 2 368 ? 33.696  -19.927 3.839   1.00 48.03  ? 368  LEU B C   1 
ATOM   6983 O O   . LEU B 2 368 ? 34.862  -19.980 4.219   1.00 45.94  ? 368  LEU B O   1 
ATOM   6984 C CB  . LEU B 2 368 ? 32.191  -18.087 4.414   1.00 40.47  ? 368  LEU B CB  1 
ATOM   6985 C CG  . LEU B 2 368 ? 32.933  -17.034 5.230   1.00 47.07  ? 368  LEU B CG  1 
ATOM   6986 C CD1 . LEU B 2 368 ? 32.309  -16.938 6.609   1.00 50.91  ? 368  LEU B CD1 1 
ATOM   6987 C CD2 . LEU B 2 368 ? 34.391  -17.392 5.355   1.00 41.04  ? 368  LEU B CD2 1 
ATOM   6988 N N   . THR B 2 369 ? 32.882  -20.970 3.863   1.00 47.95  ? 369  THR B N   1 
ATOM   6989 C CA  . THR B 2 369 ? 33.360  -22.255 4.340   1.00 48.48  ? 369  THR B CA  1 
ATOM   6990 C C   . THR B 2 369 ? 34.525  -22.703 3.469   1.00 54.57  ? 369  THR B C   1 
ATOM   6991 O O   . THR B 2 369 ? 35.592  -23.051 3.974   1.00 61.30  ? 369  THR B O   1 
ATOM   6992 C CB  . THR B 2 369 ? 32.236  -23.340 4.324   1.00 43.97  ? 369  THR B CB  1 
ATOM   6993 O OG1 . THR B 2 369 ? 31.911  -23.691 2.976   1.00 59.01  ? 369  THR B OG1 1 
ATOM   6994 C CG2 . THR B 2 369 ? 30.987  -22.825 5.000   1.00 33.12  ? 369  THR B CG2 1 
ATOM   6995 N N   . GLU B 2 370 ? 34.321  -22.661 2.157   1.00 56.74  ? 370  GLU B N   1 
ATOM   6996 C CA  . GLU B 2 370 ? 35.340  -23.071 1.202   1.00 52.98  ? 370  GLU B CA  1 
ATOM   6997 C C   . GLU B 2 370 ? 36.653  -22.329 1.419   1.00 49.84  ? 370  GLU B C   1 
ATOM   6998 O O   . GLU B 2 370 ? 37.743  -22.877 1.212   1.00 52.02  ? 370  GLU B O   1 
ATOM   6999 C CB  . GLU B 2 370 ? 34.836  -22.857 -0.226  1.00 57.19  ? 370  GLU B CB  1 
ATOM   7000 C CG  . GLU B 2 370 ? 33.563  -23.646 -0.530  1.00 75.77  ? 370  GLU B CG  1 
ATOM   7001 C CD  . GLU B 2 370 ? 33.014  -23.392 -1.926  1.00 87.77  ? 370  GLU B CD  1 
ATOM   7002 O OE1 . GLU B 2 370 ? 33.349  -22.339 -2.517  1.00 99.12  ? 370  GLU B OE1 1 
ATOM   7003 O OE2 . GLU B 2 370 ? 32.229  -24.236 -2.423  1.00 89.44  ? 370  GLU B OE2 1 
ATOM   7004 N N   . ALA B 2 371 ? 36.551  -21.083 1.844   1.00 43.36  ? 371  ALA B N   1 
ATOM   7005 C CA  . ALA B 2 371 ? 37.738  -20.292 2.092   1.00 41.56  ? 371  ALA B CA  1 
ATOM   7006 C C   . ALA B 2 371 ? 38.417  -20.809 3.354   1.00 44.09  ? 371  ALA B C   1 
ATOM   7007 O O   . ALA B 2 371 ? 39.629  -21.045 3.387   1.00 45.36  ? 371  ALA B O   1 
ATOM   7008 C CB  . ALA B 2 371 ? 37.349  -18.850 2.266   1.00 45.28  ? 371  ALA B CB  1 
ATOM   7009 N N   . VAL B 2 372 ? 37.621  -20.982 4.397   1.00 50.31  ? 372  VAL B N   1 
ATOM   7010 C CA  . VAL B 2 372 ? 38.142  -21.479 5.662   1.00 56.18  ? 372  VAL B CA  1 
ATOM   7011 C C   . VAL B 2 372 ? 38.918  -22.780 5.462   1.00 56.77  ? 372  VAL B C   1 
ATOM   7012 O O   . VAL B 2 372 ? 40.077  -22.903 5.878   1.00 50.64  ? 372  VAL B O   1 
ATOM   7013 C CB  . VAL B 2 372 ? 37.004  -21.748 6.653   1.00 49.89  ? 372  VAL B CB  1 
ATOM   7014 C CG1 . VAL B 2 372 ? 37.569  -22.351 7.925   1.00 53.88  ? 372  VAL B CG1 1 
ATOM   7015 C CG2 . VAL B 2 372 ? 36.265  -20.458 6.948   1.00 46.85  ? 372  VAL B CG2 1 
ATOM   7016 N N   . GLN B 2 373 ? 38.261  -23.748 4.827   1.00 55.95  ? 373  GLN B N   1 
ATOM   7017 C CA  . GLN B 2 373 ? 38.879  -25.038 4.573   1.00 55.74  ? 373  GLN B CA  1 
ATOM   7018 C C   . GLN B 2 373 ? 40.165  -24.810 3.788   1.00 64.73  ? 373  GLN B C   1 
ATOM   7019 O O   . GLN B 2 373 ? 41.218  -25.349 4.120   1.00 71.46  ? 373  GLN B O   1 
ATOM   7020 C CB  . GLN B 2 373 ? 37.923  -25.960 3.787   1.00 39.07  ? 373  GLN B CB  1 
ATOM   7021 C CG  . GLN B 2 373 ? 36.609  -26.281 4.520   1.00 40.28  ? 373  GLN B CG  1 
ATOM   7022 C CD  . GLN B 2 373 ? 35.714  -27.311 3.813   1.00 45.47  ? 373  GLN B CD  1 
ATOM   7023 O OE1 . GLN B 2 373 ? 35.857  -28.530 3.991   1.00 49.94  ? 373  GLN B OE1 1 
ATOM   7024 N NE2 . GLN B 2 373 ? 34.783  -26.815 3.009   1.00 61.82  ? 373  GLN B NE2 1 
ATOM   7025 N N   . LYS B 2 374 ? 40.082  -23.998 2.747   1.00 70.19  ? 374  LYS B N   1 
ATOM   7026 C CA  . LYS B 2 374 ? 41.256  -23.728 1.941   1.00 73.19  ? 374  LYS B CA  1 
ATOM   7027 C C   . LYS B 2 374 ? 42.382  -23.177 2.810   1.00 62.83  ? 374  LYS B C   1 
ATOM   7028 O O   . LYS B 2 374 ? 43.500  -23.700 2.818   1.00 56.55  ? 374  LYS B O   1 
ATOM   7029 C CB  . LYS B 2 374 ? 40.920  -22.712 0.852   1.00 90.54  ? 374  LYS B CB  1 
ATOM   7030 C CG  . LYS B 2 374 ? 42.138  -22.281 0.034   1.00 117.08 ? 374  LYS B CG  1 
ATOM   7031 C CD  . LYS B 2 374 ? 42.047  -20.820 -0.420  1.00 126.85 ? 374  LYS B CD  1 
ATOM   7032 C CE  . LYS B 2 374 ? 43.268  -20.405 -1.246  1.00 127.75 ? 374  LYS B CE  1 
ATOM   7033 N NZ  . LYS B 2 374 ? 43.264  -18.948 -1.574  1.00 125.77 ? 374  LYS B NZ  1 
ATOM   7034 N N   . ILE B 2 375 ? 42.067  -22.116 3.542   1.00 55.34  ? 375  ILE B N   1 
ATOM   7035 C CA  . ILE B 2 375 ? 43.051  -21.450 4.393   1.00 60.47  ? 375  ILE B CA  1 
ATOM   7036 C C   . ILE B 2 375 ? 43.625  -22.325 5.470   1.00 55.02  ? 375  ILE B C   1 
ATOM   7037 O O   . ILE B 2 375 ? 44.739  -22.104 5.933   1.00 54.87  ? 375  ILE B O   1 
ATOM   7038 C CB  . ILE B 2 375 ? 42.453  -20.238 5.101   1.00 67.78  ? 375  ILE B CB  1 
ATOM   7039 C CG1 . ILE B 2 375 ? 41.871  -19.279 4.051   1.00 60.83  ? 375  ILE B CG1 1 
ATOM   7040 C CG2 . ILE B 2 375 ? 43.529  -19.597 6.035   1.00 60.90  ? 375  ILE B CG2 1 
ATOM   7041 C CD1 . ILE B 2 375 ? 41.125  -18.101 4.630   1.00 60.72  ? 375  ILE B CD1 1 
ATOM   7042 N N   . THR B 2 376 ? 42.838  -23.291 5.899   1.00 54.43  ? 376  THR B N   1 
ATOM   7043 C CA  . THR B 2 376 ? 43.284  -24.197 6.933   1.00 58.69  ? 376  THR B CA  1 
ATOM   7044 C C   . THR B 2 376 ? 44.317  -25.136 6.319   1.00 54.39  ? 376  THR B C   1 
ATOM   7045 O O   . THR B 2 376 ? 45.430  -25.253 6.824   1.00 57.51  ? 376  THR B O   1 
ATOM   7046 C CB  . THR B 2 376 ? 42.081  -24.985 7.500   1.00 64.95  ? 376  THR B CB  1 
ATOM   7047 O OG1 . THR B 2 376 ? 41.115  -24.055 8.021   1.00 76.36  ? 376  THR B OG1 1 
ATOM   7048 C CG2 . THR B 2 376 ? 42.526  -25.942 8.598   1.00 59.38  ? 376  THR B CG2 1 
ATOM   7049 N N   . THR B 2 377 ? 43.949  -25.782 5.215   1.00 52.27  ? 377  THR B N   1 
ATOM   7050 C CA  . THR B 2 377 ? 44.837  -26.703 4.524   1.00 50.88  ? 377  THR B CA  1 
ATOM   7051 C C   . THR B 2 377 ? 46.194  -26.039 4.311   1.00 59.32  ? 377  THR B C   1 
ATOM   7052 O O   . THR B 2 377 ? 47.236  -26.644 4.566   1.00 68.13  ? 377  THR B O   1 
ATOM   7053 C CB  . THR B 2 377 ? 44.240  -27.132 3.165   1.00 50.79  ? 377  THR B CB  1 
ATOM   7054 O OG1 . THR B 2 377 ? 43.020  -27.854 3.385   1.00 69.33  ? 377  THR B OG1 1 
ATOM   7055 C CG2 . THR B 2 377 ? 45.188  -28.048 2.430   1.00 41.91  ? 377  THR B CG2 1 
ATOM   7056 N N   . GLU B 2 378 ? 46.198  -24.795 3.847   1.00 64.26  ? 378  GLU B N   1 
ATOM   7057 C CA  . GLU B 2 378 ? 47.470  -24.107 3.660   1.00 68.97  ? 378  GLU B CA  1 
ATOM   7058 C C   . GLU B 2 378 ? 48.221  -24.063 4.990   1.00 68.34  ? 378  GLU B C   1 
ATOM   7059 O O   . GLU B 2 378 ? 49.372  -24.474 5.048   1.00 72.27  ? 378  GLU B O   1 
ATOM   7060 C CB  . GLU B 2 378 ? 47.270  -22.684 3.132   1.00 74.97  ? 378  GLU B CB  1 
ATOM   7061 C CG  . GLU B 2 378 ? 46.595  -22.617 1.769   1.00 88.45  ? 378  GLU B CG  1 
ATOM   7062 C CD  . GLU B 2 378 ? 46.713  -21.246 1.149   1.00 96.47  ? 378  GLU B CD  1 
ATOM   7063 O OE1 . GLU B 2 378 ? 46.944  -20.294 1.923   1.00 104.97 ? 378  GLU B OE1 1 
ATOM   7064 O OE2 . GLU B 2 378 ? 46.571  -21.117 -0.092  1.00 92.95  ? 378  GLU B OE2 1 
ATOM   7065 N N   . SER B 2 379 ? 47.578  -23.581 6.056   1.00 66.37  ? 379  SER B N   1 
ATOM   7066 C CA  . SER B 2 379 ? 48.225  -23.514 7.372   1.00 66.83  ? 379  SER B CA  1 
ATOM   7067 C C   . SER B 2 379 ? 48.865  -24.836 7.759   1.00 71.10  ? 379  SER B C   1 
ATOM   7068 O O   . SER B 2 379 ? 49.993  -24.864 8.253   1.00 76.92  ? 379  SER B O   1 
ATOM   7069 C CB  . SER B 2 379 ? 47.231  -23.128 8.463   1.00 60.36  ? 379  SER B CB  1 
ATOM   7070 O OG  . SER B 2 379 ? 46.954  -21.749 8.427   1.00 78.97  ? 379  SER B OG  1 
ATOM   7071 N N   . ILE B 2 380 ? 48.133  -25.927 7.558   1.00 66.30  ? 380  ILE B N   1 
ATOM   7072 C CA  . ILE B 2 380 ? 48.650  -27.250 7.872   1.00 63.40  ? 380  ILE B CA  1 
ATOM   7073 C C   . ILE B 2 380 ? 49.906  -27.458 7.052   1.00 66.44  ? 380  ILE B C   1 
ATOM   7074 O O   . ILE B 2 380 ? 50.993  -27.604 7.589   1.00 67.40  ? 380  ILE B O   1 
ATOM   7075 C CB  . ILE B 2 380 ? 47.639  -28.356 7.505   1.00 62.73  ? 380  ILE B CB  1 
ATOM   7076 C CG1 . ILE B 2 380 ? 46.583  -28.459 8.600   1.00 61.38  ? 380  ILE B CG1 1 
ATOM   7077 C CG2 . ILE B 2 380 ? 48.359  -29.704 7.279   1.00 60.40  ? 380  ILE B CG2 1 
ATOM   7078 C CD1 . ILE B 2 380 ? 45.504  -29.497 8.295   1.00 71.25  ? 380  ILE B CD1 1 
ATOM   7079 N N   . VAL B 2 381 ? 49.750  -27.459 5.738   1.00 64.05  ? 381  VAL B N   1 
ATOM   7080 C CA  . VAL B 2 381 ? 50.889  -27.656 4.871   1.00 60.34  ? 381  VAL B CA  1 
ATOM   7081 C C   . VAL B 2 381 ? 52.093  -26.777 5.237   1.00 54.64  ? 381  VAL B C   1 
ATOM   7082 O O   . VAL B 2 381 ? 53.183  -27.286 5.415   1.00 58.03  ? 381  VAL B O   1 
ATOM   7083 C CB  . VAL B 2 381 ? 50.481  -27.450 3.393   1.00 61.75  ? 381  VAL B CB  1 
ATOM   7084 C CG1 . VAL B 2 381 ? 51.719  -27.389 2.503   1.00 53.79  ? 381  VAL B CG1 1 
ATOM   7085 C CG2 . VAL B 2 381 ? 49.584  -28.609 2.955   1.00 55.44  ? 381  VAL B CG2 1 
ATOM   7086 N N   . ILE B 2 382 ? 51.898  -25.475 5.391   1.00 57.24  ? 382  ILE B N   1 
ATOM   7087 C CA  . ILE B 2 382 ? 53.011  -24.575 5.703   1.00 62.28  ? 382  ILE B CA  1 
ATOM   7088 C C   . ILE B 2 382 ? 53.597  -24.643 7.108   1.00 60.80  ? 382  ILE B C   1 
ATOM   7089 O O   . ILE B 2 382 ? 54.809  -24.643 7.286   1.00 65.28  ? 382  ILE B O   1 
ATOM   7090 C CB  . ILE B 2 382 ? 52.628  -23.111 5.436   1.00 66.76  ? 382  ILE B CB  1 
ATOM   7091 C CG1 . ILE B 2 382 ? 52.205  -22.937 3.964   1.00 69.41  ? 382  ILE B CG1 1 
ATOM   7092 C CG2 . ILE B 2 382 ? 53.806  -22.222 5.794   1.00 52.83  ? 382  ILE B CG2 1 
ATOM   7093 C CD1 . ILE B 2 382 ? 51.411  -21.646 3.654   1.00 70.32  ? 382  ILE B CD1 1 
ATOM   7094 N N   . TRP B 2 383 ? 52.742  -24.682 8.109   1.00 57.48  ? 383  TRP B N   1 
ATOM   7095 C CA  . TRP B 2 383 ? 53.226  -24.734 9.473   1.00 62.14  ? 383  TRP B CA  1 
ATOM   7096 C C   . TRP B 2 383 ? 52.715  -25.944 10.229  1.00 69.21  ? 383  TRP B C   1 
ATOM   7097 O O   . TRP B 2 383 ? 52.861  -26.024 11.440  1.00 70.29  ? 383  TRP B O   1 
ATOM   7098 C CB  . TRP B 2 383 ? 52.788  -23.494 10.206  1.00 54.83  ? 383  TRP B CB  1 
ATOM   7099 C CG  . TRP B 2 383 ? 53.118  -22.280 9.480   1.00 66.54  ? 383  TRP B CG  1 
ATOM   7100 C CD1 . TRP B 2 383 ? 54.306  -21.628 9.495   1.00 63.63  ? 383  TRP B CD1 1 
ATOM   7101 C CD2 . TRP B 2 383 ? 52.222  -21.481 8.688   1.00 89.14  ? 383  TRP B CD2 1 
ATOM   7102 N NE1 . TRP B 2 383 ? 54.213  -20.453 8.775   1.00 79.98  ? 383  TRP B NE1 1 
ATOM   7103 C CE2 . TRP B 2 383 ? 52.944  -20.338 8.268   1.00 90.48  ? 383  TRP B CE2 1 
ATOM   7104 C CE3 . TRP B 2 383 ? 50.878  -21.617 8.297   1.00 95.88  ? 383  TRP B CE3 1 
ATOM   7105 C CZ2 . TRP B 2 383 ? 52.368  -19.325 7.477   1.00 91.26  ? 383  TRP B CZ2 1 
ATOM   7106 C CZ3 . TRP B 2 383 ? 50.302  -20.610 7.509   1.00 98.38  ? 383  TRP B CZ3 1 
ATOM   7107 C CH2 . TRP B 2 383 ? 51.052  -19.478 7.110   1.00 95.33  ? 383  TRP B CH2 1 
ATOM   7108 N N   . GLY B 2 384 ? 52.094  -26.874 9.522   1.00 74.09  ? 384  GLY B N   1 
ATOM   7109 C CA  . GLY B 2 384 ? 51.576  -28.064 10.171  1.00 74.28  ? 384  GLY B CA  1 
ATOM   7110 C C   . GLY B 2 384 ? 50.639  -27.811 11.338  1.00 77.33  ? 384  GLY B C   1 
ATOM   7111 O O   . GLY B 2 384 ? 50.556  -28.647 12.228  1.00 77.33  ? 384  GLY B O   1 
ATOM   7112 N N   . LYS B 2 385 ? 49.943  -26.673 11.345  1.00 85.48  ? 385  LYS B N   1 
ATOM   7113 C CA  . LYS B 2 385 ? 48.993  -26.329 12.421  1.00 86.56  ? 385  LYS B CA  1 
ATOM   7114 C C   . LYS B 2 385 ? 47.758  -25.587 11.864  1.00 87.46  ? 385  LYS B C   1 
ATOM   7115 O O   . LYS B 2 385 ? 47.853  -24.931 10.819  1.00 92.40  ? 385  LYS B O   1 
ATOM   7116 C CB  . LYS B 2 385 ? 49.668  -25.439 13.486  1.00 74.71  ? 385  LYS B CB  1 
ATOM   7117 C CG  . LYS B 2 385 ? 48.743  -25.081 14.652  1.00 69.88  ? 385  LYS B CG  1 
ATOM   7118 C CD  . LYS B 2 385 ? 49.170  -23.809 15.370  1.00 77.78  ? 385  LYS B CD  1 
ATOM   7119 C CE  . LYS B 2 385 ? 50.541  -23.940 16.027  1.00 79.25  ? 385  LYS B CE  1 
ATOM   7120 N NZ  . LYS B 2 385 ? 50.922  -22.687 16.758  1.00 68.75  ? 385  LYS B NZ  1 
ATOM   7121 N N   . THR B 2 386 ? 46.607  -25.693 12.541  1.00 81.47  ? 386  THR B N   1 
ATOM   7122 C CA  . THR B 2 386 ? 45.412  -24.982 12.084  1.00 72.75  ? 386  THR B CA  1 
ATOM   7123 C C   . THR B 2 386 ? 45.326  -23.639 12.796  1.00 70.07  ? 386  THR B C   1 
ATOM   7124 O O   . THR B 2 386 ? 45.722  -23.502 13.977  1.00 58.51  ? 386  THR B O   1 
ATOM   7125 C CB  . THR B 2 386 ? 44.098  -25.740 12.345  1.00 66.47  ? 386  THR B CB  1 
ATOM   7126 O OG1 . THR B 2 386 ? 43.820  -25.751 13.747  1.00 69.05  ? 386  THR B OG1 1 
ATOM   7127 C CG2 . THR B 2 386 ? 44.190  -27.149 11.815  1.00 55.47  ? 386  THR B CG2 1 
ATOM   7128 N N   . PRO B 2 387 ? 44.800  -22.625 12.078  1.00 65.93  ? 387  PRO B N   1 
ATOM   7129 C CA  . PRO B 2 387 ? 44.642  -21.262 12.578  1.00 59.11  ? 387  PRO B CA  1 
ATOM   7130 C C   . PRO B 2 387 ? 43.399  -21.103 13.405  1.00 60.85  ? 387  PRO B C   1 
ATOM   7131 O O   . PRO B 2 387 ? 42.544  -21.986 13.448  1.00 64.23  ? 387  PRO B O   1 
ATOM   7132 C CB  . PRO B 2 387 ? 44.562  -20.416 11.301  1.00 55.46  ? 387  PRO B CB  1 
ATOM   7133 C CG  . PRO B 2 387 ? 44.777  -21.399 10.149  1.00 60.14  ? 387  PRO B CG  1 
ATOM   7134 C CD  . PRO B 2 387 ? 44.318  -22.710 10.689  1.00 58.83  ? 387  PRO B CD  1 
ATOM   7135 N N   . LYS B 2 388 ? 43.312  -19.960 14.063  1.00 63.64  ? 388  LYS B N   1 
ATOM   7136 C CA  . LYS B 2 388 ? 42.154  -19.626 14.870  1.00 71.26  ? 388  LYS B CA  1 
ATOM   7137 C C   . LYS B 2 388 ? 41.449  -18.534 14.045  1.00 71.35  ? 388  LYS B C   1 
ATOM   7138 O O   . LYS B 2 388 ? 41.872  -17.369 14.067  1.00 79.72  ? 388  LYS B O   1 
ATOM   7139 C CB  . LYS B 2 388 ? 42.610  -19.078 16.237  1.00 78.29  ? 388  LYS B CB  1 
ATOM   7140 C CG  . LYS B 2 388 ? 41.534  -19.068 17.341  1.00 100.34 ? 388  LYS B CG  1 
ATOM   7141 C CD  . LYS B 2 388 ? 40.243  -18.333 16.911  1.00 115.45 ? 388  LYS B CD  1 
ATOM   7142 C CE  . LYS B 2 388 ? 39.228  -18.176 18.055  1.00 118.27 ? 388  LYS B CE  1 
ATOM   7143 N NZ  . LYS B 2 388 ? 38.752  -19.462 18.654  1.00 109.56 ? 388  LYS B NZ  1 
ATOM   7144 N N   . PHE B 2 389 ? 40.393  -18.902 13.312  1.00 60.48  ? 389  PHE B N   1 
ATOM   7145 C CA  . PHE B 2 389 ? 39.679  -17.929 12.478  1.00 58.63  ? 389  PHE B CA  1 
ATOM   7146 C C   . PHE B 2 389 ? 38.823  -16.865 13.174  1.00 59.92  ? 389  PHE B C   1 
ATOM   7147 O O   . PHE B 2 389 ? 38.296  -17.049 14.278  1.00 55.36  ? 389  PHE B O   1 
ATOM   7148 C CB  . PHE B 2 389 ? 38.771  -18.639 11.480  1.00 58.77  ? 389  PHE B CB  1 
ATOM   7149 C CG  . PHE B 2 389 ? 39.494  -19.451 10.454  1.00 65.98  ? 389  PHE B CG  1 
ATOM   7150 C CD1 . PHE B 2 389 ? 40.323  -20.496 10.831  1.00 55.62  ? 389  PHE B CD1 1 
ATOM   7151 C CD2 . PHE B 2 389 ? 39.281  -19.218 9.101   1.00 71.37  ? 389  PHE B CD2 1 
ATOM   7152 C CE1 . PHE B 2 389 ? 40.924  -21.304 9.875   1.00 58.07  ? 389  PHE B CE1 1 
ATOM   7153 C CE2 . PHE B 2 389 ? 39.876  -20.018 8.136   1.00 67.79  ? 389  PHE B CE2 1 
ATOM   7154 C CZ  . PHE B 2 389 ? 40.700  -21.068 8.523   1.00 66.57  ? 389  PHE B CZ  1 
ATOM   7155 N N   . LYS B 2 390 ? 38.713  -15.734 12.495  1.00 64.97  ? 390  LYS B N   1 
ATOM   7156 C CA  . LYS B 2 390 ? 37.873  -14.634 12.932  1.00 65.67  ? 390  LYS B CA  1 
ATOM   7157 C C   . LYS B 2 390 ? 36.960  -14.507 11.734  1.00 72.42  ? 390  LYS B C   1 
ATOM   7158 O O   . LYS B 2 390 ? 37.411  -14.213 10.612  1.00 67.05  ? 390  LYS B O   1 
ATOM   7159 C CB  . LYS B 2 390 ? 38.663  -13.361 13.124  1.00 55.78  ? 390  LYS B CB  1 
ATOM   7160 C CG  . LYS B 2 390 ? 39.424  -13.365 14.395  1.00 63.13  ? 390  LYS B CG  1 
ATOM   7161 C CD  . LYS B 2 390 ? 40.120  -12.049 14.577  1.00 85.20  ? 390  LYS B CD  1 
ATOM   7162 C CE  . LYS B 2 390 ? 40.889  -12.026 15.882  1.00 92.42  ? 390  LYS B CE  1 
ATOM   7163 N NZ  . LYS B 2 390 ? 39.976  -12.230 17.042  1.00 89.65  ? 390  LYS B NZ  1 
ATOM   7164 N N   . LEU B 2 391 ? 35.676  -14.755 11.984  1.00 77.70  ? 391  LEU B N   1 
ATOM   7165 C CA  . LEU B 2 391 ? 34.660  -14.745 10.942  1.00 71.99  ? 391  LEU B CA  1 
ATOM   7166 C C   . LEU B 2 391 ? 33.625  -13.600 10.934  1.00 68.39  ? 391  LEU B C   1 
ATOM   7167 O O   . LEU B 2 391 ? 33.109  -13.170 11.991  1.00 56.62  ? 391  LEU B O   1 
ATOM   7168 C CB  . LEU B 2 391 ? 33.931  -16.098 10.953  1.00 63.14  ? 391  LEU B CB  1 
ATOM   7169 C CG  . LEU B 2 391 ? 34.775  -17.387 11.019  1.00 65.76  ? 391  LEU B CG  1 
ATOM   7170 C CD1 . LEU B 2 391 ? 33.852  -18.583 10.697  1.00 78.12  ? 391  LEU B CD1 1 
ATOM   7171 C CD2 . LEU B 2 391 ? 35.964  -17.347 10.038  1.00 56.54  ? 391  LEU B CD2 1 
ATOM   7172 N N   . PRO B 2 392 ? 33.322  -13.091 9.716   1.00 69.32  ? 392  PRO B N   1 
ATOM   7173 C CA  . PRO B 2 392 ? 32.371  -12.011 9.438   1.00 67.57  ? 392  PRO B CA  1 
ATOM   7174 C C   . PRO B 2 392 ? 30.992  -12.622 9.158   1.00 69.84  ? 392  PRO B C   1 
ATOM   7175 O O   . PRO B 2 392 ? 30.481  -12.568 8.036   1.00 68.19  ? 392  PRO B O   1 
ATOM   7176 C CB  . PRO B 2 392 ? 32.974  -11.351 8.206   1.00 65.06  ? 392  PRO B CB  1 
ATOM   7177 C CG  . PRO B 2 392 ? 33.438  -12.542 7.423   1.00 61.52  ? 392  PRO B CG  1 
ATOM   7178 C CD  . PRO B 2 392 ? 34.085  -13.425 8.493   1.00 66.91  ? 392  PRO B CD  1 
ATOM   7179 N N   . ILE B 2 393 ? 30.397  -13.208 10.191  1.00 73.36  ? 393  ILE B N   1 
ATOM   7180 C CA  . ILE B 2 393 ? 29.102  -13.849 10.049  1.00 68.98  ? 393  ILE B CA  1 
ATOM   7181 C C   . ILE B 2 393 ? 28.501  -13.986 11.436  1.00 68.08  ? 393  ILE B C   1 
ATOM   7182 O O   . ILE B 2 393 ? 29.196  -13.802 12.439  1.00 69.16  ? 393  ILE B O   1 
ATOM   7183 C CB  . ILE B 2 393 ? 29.272  -15.253 9.390   1.00 63.89  ? 393  ILE B CB  1 
ATOM   7184 C CG1 . ILE B 2 393 ? 27.908  -15.887 9.098   1.00 70.93  ? 393  ILE B CG1 1 
ATOM   7185 C CG2 . ILE B 2 393 ? 30.093  -16.162 10.297  1.00 57.81  ? 393  ILE B CG2 1 
ATOM   7186 C CD1 . ILE B 2 393 ? 27.994  -17.220 8.341   1.00 62.06  ? 393  ILE B CD1 1 
ATOM   7187 N N   . GLN B 2 394 ? 27.208  -14.266 11.495  1.00 65.44  ? 394  GLN B N   1 
ATOM   7188 C CA  . GLN B 2 394 ? 26.558  -14.453 12.774  1.00 65.39  ? 394  GLN B CA  1 
ATOM   7189 C C   . GLN B 2 394 ? 26.575  -15.933 13.111  1.00 58.47  ? 394  GLN B C   1 
ATOM   7190 O O   . GLN B 2 394 ? 26.315  -16.799 12.260  1.00 52.27  ? 394  GLN B O   1 
ATOM   7191 C CB  . GLN B 2 394 ? 25.118  -13.988 12.720  1.00 77.96  ? 394  GLN B CB  1 
ATOM   7192 C CG  . GLN B 2 394 ? 24.875  -12.565 13.135  1.00 87.14  ? 394  GLN B CG  1 
ATOM   7193 C CD  . GLN B 2 394 ? 23.401  -12.220 12.996  1.00 105.88 ? 394  GLN B CD  1 
ATOM   7194 O OE1 . GLN B 2 394 ? 22.535  -13.110 13.027  1.00 109.64 ? 394  GLN B OE1 1 
ATOM   7195 N NE2 . GLN B 2 394 ? 23.102  -10.932 12.846  1.00 116.77 ? 394  GLN B NE2 1 
ATOM   7196 N N   . LYS B 2 395 ? 26.873  -16.206 14.370  1.00 52.67  ? 395  LYS B N   1 
ATOM   7197 C CA  . LYS B 2 395 ? 26.939  -17.564 14.864  1.00 45.51  ? 395  LYS B CA  1 
ATOM   7198 C C   . LYS B 2 395 ? 25.771  -18.423 14.397  1.00 37.54  ? 395  LYS B C   1 
ATOM   7199 O O   . LYS B 2 395 ? 25.972  -19.442 13.763  1.00 33.32  ? 395  LYS B O   1 
ATOM   7200 C CB  . LYS B 2 395 ? 26.994  -17.534 16.397  1.00 57.03  ? 395  LYS B CB  1 
ATOM   7201 C CG  . LYS B 2 395 ? 27.103  -18.909 17.071  1.00 62.21  ? 395  LYS B CG  1 
ATOM   7202 C CD  . LYS B 2 395 ? 28.269  -18.962 18.061  1.00 57.00  ? 395  LYS B CD  1 
ATOM   7203 C CE  . LYS B 2 395 ? 28.396  -20.325 18.703  1.00 62.69  ? 395  LYS B CE  1 
ATOM   7204 N NZ  . LYS B 2 395 ? 27.177  -20.647 19.510  1.00 83.25  ? 395  LYS B NZ  1 
ATOM   7205 N N   . GLU B 2 396 ? 24.553  -18.005 14.715  1.00 42.56  ? 396  GLU B N   1 
ATOM   7206 C CA  . GLU B 2 396 ? 23.358  -18.757 14.347  1.00 46.95  ? 396  GLU B CA  1 
ATOM   7207 C C   . GLU B 2 396 ? 23.365  -19.134 12.883  1.00 40.37  ? 396  GLU B C   1 
ATOM   7208 O O   . GLU B 2 396 ? 23.054  -20.264 12.532  1.00 38.33  ? 396  GLU B O   1 
ATOM   7209 C CB  . GLU B 2 396 ? 22.077  -17.953 14.639  1.00 64.57  ? 396  GLU B CB  1 
ATOM   7210 C CG  . GLU B 2 396 ? 21.748  -17.730 16.128  1.00 82.83  ? 396  GLU B CG  1 
ATOM   7211 C CD  . GLU B 2 396 ? 22.427  -16.496 16.735  1.00 93.63  ? 396  GLU B CD  1 
ATOM   7212 O OE1 . GLU B 2 396 ? 23.232  -15.847 16.020  1.00 92.94  ? 396  GLU B OE1 1 
ATOM   7213 O OE2 . GLU B 2 396 ? 22.149  -16.182 17.926  1.00 96.80  ? 396  GLU B OE2 1 
ATOM   7214 N N   . THR B 2 397 ? 23.710  -18.186 12.024  1.00 32.32  ? 397  THR B N   1 
ATOM   7215 C CA  . THR B 2 397 ? 23.735  -18.476 10.601  1.00 41.70  ? 397  THR B CA  1 
ATOM   7216 C C   . THR B 2 397 ? 24.792  -19.488 10.290  1.00 43.11  ? 397  THR B C   1 
ATOM   7217 O O   . THR B 2 397 ? 24.593  -20.423 9.512   1.00 48.73  ? 397  THR B O   1 
ATOM   7218 C CB  . THR B 2 397 ? 24.090  -17.267 9.781   1.00 45.98  ? 397  THR B CB  1 
ATOM   7219 O OG1 . THR B 2 397 ? 23.260  -16.183 10.181  1.00 63.26  ? 397  THR B OG1 1 
ATOM   7220 C CG2 . THR B 2 397 ? 23.862  -17.550 8.308   1.00 35.16  ? 397  THR B CG2 1 
ATOM   7221 N N   . TRP B 2 398 ? 25.947  -19.273 10.884  1.00 33.56  ? 398  TRP B N   1 
ATOM   7222 C CA  . TRP B 2 398 ? 27.035  -20.178 10.635  1.00 41.44  ? 398  TRP B CA  1 
ATOM   7223 C C   . TRP B 2 398 ? 26.697  -21.577 11.107  1.00 43.55  ? 398  TRP B C   1 
ATOM   7224 O O   . TRP B 2 398 ? 26.762  -22.545 10.342  1.00 48.93  ? 398  TRP B O   1 
ATOM   7225 C CB  . TRP B 2 398 ? 28.295  -19.663 11.313  1.00 48.18  ? 398  TRP B CB  1 
ATOM   7226 C CG  . TRP B 2 398 ? 29.471  -20.553 11.121  1.00 57.27  ? 398  TRP B CG  1 
ATOM   7227 C CD1 . TRP B 2 398 ? 29.976  -21.444 12.019  1.00 70.52  ? 398  TRP B CD1 1 
ATOM   7228 C CD2 . TRP B 2 398 ? 30.304  -20.632 9.967   1.00 54.11  ? 398  TRP B CD2 1 
ATOM   7229 N NE1 . TRP B 2 398 ? 31.076  -22.071 11.499  1.00 66.52  ? 398  TRP B NE1 1 
ATOM   7230 C CE2 . TRP B 2 398 ? 31.301  -21.590 10.238  1.00 62.01  ? 398  TRP B CE2 1 
ATOM   7231 C CE3 . TRP B 2 398 ? 30.308  -19.987 8.727   1.00 61.48  ? 398  TRP B CE3 1 
ATOM   7232 C CZ2 . TRP B 2 398 ? 32.296  -21.920 9.311   1.00 63.96  ? 398  TRP B CZ2 1 
ATOM   7233 C CZ3 . TRP B 2 398 ? 31.302  -20.320 7.799   1.00 70.79  ? 398  TRP B CZ3 1 
ATOM   7234 C CH2 . TRP B 2 398 ? 32.281  -21.277 8.101   1.00 56.53  ? 398  TRP B CH2 1 
ATOM   7235 N N   . GLU B 2 399 ? 26.299  -21.679 12.364  1.00 51.02  ? 399  GLU B N   1 
ATOM   7236 C CA  . GLU B 2 399 ? 25.966  -22.975 12.955  1.00 54.80  ? 399  GLU B CA  1 
ATOM   7237 C C   . GLU B 2 399 ? 24.961  -23.743 12.100  1.00 48.40  ? 399  GLU B C   1 
ATOM   7238 O O   . GLU B 2 399 ? 24.960  -24.989 12.042  1.00 43.25  ? 399  GLU B O   1 
ATOM   7239 C CB  . GLU B 2 399 ? 25.412  -22.763 14.374  1.00 48.98  ? 399  GLU B CB  1 
ATOM   7240 C CG  . GLU B 2 399 ? 26.414  -22.123 15.312  1.00 61.63  ? 399  GLU B CG  1 
ATOM   7241 C CD  . GLU B 2 399 ? 27.684  -22.934 15.396  1.00 76.23  ? 399  GLU B CD  1 
ATOM   7242 O OE1 . GLU B 2 399 ? 28.706  -22.403 15.884  1.00 85.54  ? 399  GLU B OE1 1 
ATOM   7243 O OE2 . GLU B 2 399 ? 27.651  -24.113 14.973  1.00 77.77  ? 399  GLU B OE2 1 
ATOM   7244 N N   . THR B 2 400 ? 24.131  -22.966 11.417  1.00 45.92  ? 400  THR B N   1 
ATOM   7245 C CA  . THR B 2 400 ? 23.070  -23.482 10.577  1.00 49.00  ? 400  THR B CA  1 
ATOM   7246 C C   . THR B 2 400 ? 23.495  -24.060 9.235   1.00 50.46  ? 400  THR B C   1 
ATOM   7247 O O   . THR B 2 400 ? 22.986  -25.095 8.804   1.00 43.32  ? 400  THR B O   1 
ATOM   7248 C CB  . THR B 2 400 ? 22.030  -22.371 10.323  1.00 47.29  ? 400  THR B CB  1 
ATOM   7249 O OG1 . THR B 2 400 ? 21.401  -22.001 11.567  1.00 45.46  ? 400  THR B OG1 1 
ATOM   7250 C CG2 . THR B 2 400 ? 20.993  -22.835 9.305   1.00 42.95  ? 400  THR B CG2 1 
ATOM   7251 N N   . TRP B 2 401 ? 24.442  -23.416 8.578   1.00 49.18  ? 401  TRP B N   1 
ATOM   7252 C CA  . TRP B 2 401 ? 24.803  -23.895 7.272   1.00 54.62  ? 401  TRP B CA  1 
ATOM   7253 C C   . TRP B 2 401 ? 26.161  -24.500 7.038   1.00 54.15  ? 401  TRP B C   1 
ATOM   7254 O O   . TRP B 2 401 ? 26.318  -25.332 6.150   1.00 58.85  ? 401  TRP B O   1 
ATOM   7255 C CB  . TRP B 2 401 ? 24.594  -22.776 6.274   1.00 62.20  ? 401  TRP B CB  1 
ATOM   7256 C CG  . TRP B 2 401 ? 23.210  -22.292 6.263   1.00 69.89  ? 401  TRP B CG  1 
ATOM   7257 C CD1 . TRP B 2 401 ? 22.732  -21.131 6.803   1.00 71.04  ? 401  TRP B CD1 1 
ATOM   7258 C CD2 . TRP B 2 401 ? 22.096  -22.957 5.688   1.00 75.80  ? 401  TRP B CD2 1 
ATOM   7259 N NE1 . TRP B 2 401 ? 21.376  -21.033 6.592   1.00 70.69  ? 401  TRP B NE1 1 
ATOM   7260 C CE2 . TRP B 2 401 ? 20.964  -22.146 5.909   1.00 76.40  ? 401  TRP B CE2 1 
ATOM   7261 C CE3 . TRP B 2 401 ? 21.940  -24.166 5.006   1.00 78.76  ? 401  TRP B CE3 1 
ATOM   7262 C CZ2 . TRP B 2 401 ? 19.699  -22.509 5.472   1.00 81.85  ? 401  TRP B CZ2 1 
ATOM   7263 C CZ3 . TRP B 2 401 ? 20.679  -24.529 4.573   1.00 78.11  ? 401  TRP B CZ3 1 
ATOM   7264 C CH2 . TRP B 2 401 ? 19.575  -23.703 4.807   1.00 86.22  ? 401  TRP B CH2 1 
ATOM   7265 N N   . TRP B 2 402 ? 27.157  -24.109 7.807   1.00 47.57  ? 402  TRP B N   1 
ATOM   7266 C CA  . TRP B 2 402 ? 28.479  -24.652 7.534   1.00 49.05  ? 402  TRP B CA  1 
ATOM   7267 C C   . TRP B 2 402 ? 28.544  -26.153 7.195   1.00 49.83  ? 402  TRP B C   1 
ATOM   7268 O O   . TRP B 2 402 ? 29.146  -26.530 6.190   1.00 51.23  ? 402  TRP B O   1 
ATOM   7269 C CB  . TRP B 2 402 ? 29.451  -24.315 8.681   1.00 53.98  ? 402  TRP B CB  1 
ATOM   7270 C CG  . TRP B 2 402 ? 29.376  -25.191 9.883   1.00 58.03  ? 402  TRP B CG  1 
ATOM   7271 C CD1 . TRP B 2 402 ? 28.429  -25.166 10.860  1.00 69.51  ? 402  TRP B CD1 1 
ATOM   7272 C CD2 . TRP B 2 402 ? 30.301  -26.228 10.242  1.00 67.27  ? 402  TRP B CD2 1 
ATOM   7273 N NE1 . TRP B 2 402 ? 28.705  -26.125 11.811  1.00 78.48  ? 402  TRP B NE1 1 
ATOM   7274 C CE2 . TRP B 2 402 ? 29.849  -26.791 11.453  1.00 73.27  ? 402  TRP B CE2 1 
ATOM   7275 C CE3 . TRP B 2 402 ? 31.469  -26.740 9.653   1.00 59.40  ? 402  TRP B CE3 1 
ATOM   7276 C CZ2 . TRP B 2 402 ? 30.524  -27.840 12.089  1.00 66.90  ? 402  TRP B CZ2 1 
ATOM   7277 C CZ3 . TRP B 2 402 ? 32.144  -27.791 10.290  1.00 44.08  ? 402  TRP B CZ3 1 
ATOM   7278 C CH2 . TRP B 2 402 ? 31.665  -28.324 11.493  1.00 55.13  ? 402  TRP B CH2 1 
ATOM   7279 N N   . THR B 2 403 ? 27.912  -27.004 7.995   1.00 50.73  ? 403  THR B N   1 
ATOM   7280 C CA  . THR B 2 403 ? 27.984  -28.438 7.737   1.00 55.91  ? 403  THR B CA  1 
ATOM   7281 C C   . THR B 2 403 ? 27.549  -28.871 6.355   1.00 61.16  ? 403  THR B C   1 
ATOM   7282 O O   . THR B 2 403 ? 27.840  -29.990 5.926   1.00 64.47  ? 403  THR B O   1 
ATOM   7283 C CB  . THR B 2 403 ? 27.165  -29.221 8.750   1.00 57.42  ? 403  THR B CB  1 
ATOM   7284 O OG1 . THR B 2 403 ? 25.831  -28.699 8.800   1.00 62.00  ? 403  THR B OG1 1 
ATOM   7285 C CG2 . THR B 2 403 ? 27.814  -29.121 10.114  1.00 63.93  ? 403  THR B CG2 1 
ATOM   7286 N N   . GLU B 2 404 ? 26.854  -27.983 5.658   1.00 70.01  ? 404  GLU B N   1 
ATOM   7287 C CA  . GLU B 2 404 ? 26.351  -28.287 4.320   1.00 74.06  ? 404  GLU B CA  1 
ATOM   7288 C C   . GLU B 2 404 ? 27.431  -28.299 3.263   1.00 72.63  ? 404  GLU B C   1 
ATOM   7289 O O   . GLU B 2 404 ? 27.399  -29.100 2.334   1.00 76.99  ? 404  GLU B O   1 
ATOM   7290 C CB  . GLU B 2 404 ? 25.272  -27.280 3.898   1.00 69.77  ? 404  GLU B CB  1 
ATOM   7291 C CG  . GLU B 2 404 ? 23.945  -27.379 4.676   1.00 89.00  ? 404  GLU B CG  1 
ATOM   7292 C CD  . GLU B 2 404 ? 23.222  -28.732 4.526   1.00 98.86  ? 404  GLU B CD  1 
ATOM   7293 O OE1 . GLU B 2 404 ? 23.043  -29.194 3.368   1.00 103.20 ? 404  GLU B OE1 1 
ATOM   7294 O OE2 . GLU B 2 404 ? 22.822  -29.324 5.568   1.00 99.17  ? 404  GLU B OE2 1 
ATOM   7295 N N   . TYR B 2 405 ? 28.395  -27.407 3.409   1.00 75.16  ? 405  TYR B N   1 
ATOM   7296 C CA  . TYR B 2 405 ? 29.461  -27.303 2.430   1.00 78.96  ? 405  TYR B CA  1 
ATOM   7297 C C   . TYR B 2 405 ? 30.793  -27.816 2.950   1.00 79.67  ? 405  TYR B C   1 
ATOM   7298 O O   . TYR B 2 405 ? 31.769  -27.871 2.207   1.00 81.80  ? 405  TYR B O   1 
ATOM   7299 C CB  . TYR B 2 405 ? 29.597  -25.843 1.998   1.00 80.80  ? 405  TYR B CB  1 
ATOM   7300 C CG  . TYR B 2 405 ? 28.261  -25.165 1.726   1.00 82.18  ? 405  TYR B CG  1 
ATOM   7301 C CD1 . TYR B 2 405 ? 27.820  -24.103 2.525   1.00 72.78  ? 405  TYR B CD1 1 
ATOM   7302 C CD2 . TYR B 2 405 ? 27.441  -25.581 0.669   1.00 77.59  ? 405  TYR B CD2 1 
ATOM   7303 C CE1 . TYR B 2 405 ? 26.601  -23.467 2.281   1.00 78.01  ? 405  TYR B CE1 1 
ATOM   7304 C CE2 . TYR B 2 405 ? 26.215  -24.952 0.415   1.00 78.85  ? 405  TYR B CE2 1 
ATOM   7305 C CZ  . TYR B 2 405 ? 25.801  -23.891 1.227   1.00 87.84  ? 405  TYR B CZ  1 
ATOM   7306 O OH  . TYR B 2 405 ? 24.597  -23.250 0.993   1.00 98.62  ? 405  TYR B OH  1 
ATOM   7307 N N   . TRP B 2 406 ? 30.834  -28.200 4.220   1.00 78.26  ? 406  TRP B N   1 
ATOM   7308 C CA  . TRP B 2 406 ? 32.072  -28.687 4.799   1.00 66.23  ? 406  TRP B CA  1 
ATOM   7309 C C   . TRP B 2 406 ? 32.389  -30.075 4.306   1.00 61.73  ? 406  TRP B C   1 
ATOM   7310 O O   . TRP B 2 406 ? 31.486  -30.920 4.155   1.00 57.12  ? 406  TRP B O   1 
ATOM   7311 C CB  . TRP B 2 406 ? 31.977  -28.709 6.311   1.00 63.52  ? 406  TRP B CB  1 
ATOM   7312 C CG  . TRP B 2 406 ? 33.306  -28.819 6.988   1.00 60.58  ? 406  TRP B CG  1 
ATOM   7313 C CD1 . TRP B 2 406 ? 33.885  -29.947 7.505   1.00 60.92  ? 406  TRP B CD1 1 
ATOM   7314 C CD2 . TRP B 2 406 ? 34.191  -27.739 7.293   1.00 52.64  ? 406  TRP B CD2 1 
ATOM   7315 N NE1 . TRP B 2 406 ? 35.077  -29.627 8.127   1.00 52.58  ? 406  TRP B NE1 1 
ATOM   7316 C CE2 . TRP B 2 406 ? 35.286  -28.278 8.009   1.00 52.03  ? 406  TRP B CE2 1 
ATOM   7317 C CE3 . TRP B 2 406 ? 34.164  -26.369 7.034   1.00 54.34  ? 406  TRP B CE3 1 
ATOM   7318 C CZ2 . TRP B 2 406 ? 36.343  -27.487 8.471   1.00 63.19  ? 406  TRP B CZ2 1 
ATOM   7319 C CZ3 . TRP B 2 406 ? 35.211  -25.583 7.492   1.00 60.04  ? 406  TRP B CZ3 1 
ATOM   7320 C CH2 . TRP B 2 406 ? 36.288  -26.145 8.204   1.00 64.24  ? 406  TRP B CH2 1 
ATOM   7321 N N   . GLN B 2 407 ? 33.679  -30.298 4.060   1.00 56.98  ? 407  GLN B N   1 
ATOM   7322 C CA  . GLN B 2 407 ? 34.152  -31.582 3.590   1.00 58.03  ? 407  GLN B CA  1 
ATOM   7323 C C   . GLN B 2 407 ? 35.435  -32.029 4.271   1.00 63.33  ? 407  GLN B C   1 
ATOM   7324 O O   . GLN B 2 407 ? 35.766  -33.215 4.249   1.00 68.04  ? 407  GLN B O   1 
ATOM   7325 C CB  . GLN B 2 407 ? 34.353  -31.538 2.090   1.00 62.94  ? 407  GLN B CB  1 
ATOM   7326 C CG  . GLN B 2 407 ? 33.077  -31.295 1.325   1.00 84.23  ? 407  GLN B CG  1 
ATOM   7327 C CD  . GLN B 2 407 ? 33.192  -31.708 -0.140  1.00 110.23 ? 407  GLN B CD  1 
ATOM   7328 O OE1 . GLN B 2 407 ? 34.170  -31.371 -0.834  1.00 110.75 ? 407  GLN B OE1 1 
ATOM   7329 N NE2 . GLN B 2 407 ? 32.183  -32.437 -0.624  1.00 123.60 ? 407  GLN B NE2 1 
ATOM   7330 N N   . ALA B 2 408 ? 36.159  -31.093 4.879   1.00 66.21  ? 408  ALA B N   1 
ATOM   7331 C CA  . ALA B 2 408 ? 37.407  -31.430 5.577   1.00 69.15  ? 408  ALA B CA  1 
ATOM   7332 C C   . ALA B 2 408 ? 37.125  -32.396 6.711   1.00 70.19  ? 408  ALA B C   1 
ATOM   7333 O O   . ALA B 2 408 ? 35.997  -32.488 7.180   1.00 76.74  ? 408  ALA B O   1 
ATOM   7334 C CB  . ALA B 2 408 ? 38.058  -30.176 6.143   1.00 70.43  ? 408  ALA B CB  1 
ATOM   7335 N N   . THR B 2 409 ? 38.151  -33.107 7.162   1.00 68.07  ? 409  THR B N   1 
ATOM   7336 C CA  . THR B 2 409 ? 37.970  -34.052 8.259   1.00 62.07  ? 409  THR B CA  1 
ATOM   7337 C C   . THR B 2 409 ? 38.289  -33.418 9.607   1.00 54.10  ? 409  THR B C   1 
ATOM   7338 O O   . THR B 2 409 ? 38.051  -34.029 10.643  1.00 57.83  ? 409  THR B O   1 
ATOM   7339 C CB  . THR B 2 409 ? 38.846  -35.317 8.089   1.00 60.44  ? 409  THR B CB  1 
ATOM   7340 O OG1 . THR B 2 409 ? 40.238  -34.961 8.131   1.00 48.45  ? 409  THR B OG1 1 
ATOM   7341 C CG2 . THR B 2 409 ? 38.516  -36.000 6.766   1.00 50.17  ? 409  THR B CG2 1 
ATOM   7342 N N   . TRP B 2 410 ? 38.835  -32.204 9.597   1.00 48.36  ? 410  TRP B N   1 
ATOM   7343 C CA  . TRP B 2 410 ? 39.151  -31.533 10.853  1.00 60.63  ? 410  TRP B CA  1 
ATOM   7344 C C   . TRP B 2 410 ? 38.269  -30.317 11.006  1.00 59.53  ? 410  TRP B C   1 
ATOM   7345 O O   . TRP B 2 410 ? 37.521  -29.966 10.087  1.00 58.94  ? 410  TRP B O   1 
ATOM   7346 C CB  . TRP B 2 410 ? 40.613  -31.119 10.898  1.00 66.13  ? 410  TRP B CB  1 
ATOM   7347 C CG  . TRP B 2 410 ? 41.154  -30.903 9.557   1.00 69.84  ? 410  TRP B CG  1 
ATOM   7348 C CD1 . TRP B 2 410 ? 42.065  -31.677 8.911   1.00 76.45  ? 410  TRP B CD1 1 
ATOM   7349 C CD2 . TRP B 2 410 ? 40.803  -29.854 8.658   1.00 72.12  ? 410  TRP B CD2 1 
ATOM   7350 N NE1 . TRP B 2 410 ? 42.311  -31.173 7.658   1.00 83.03  ? 410  TRP B NE1 1 
ATOM   7351 C CE2 . TRP B 2 410 ? 41.546  -30.053 7.475   1.00 77.47  ? 410  TRP B CE2 1 
ATOM   7352 C CE3 . TRP B 2 410 ? 39.934  -28.761 8.735   1.00 68.36  ? 410  TRP B CE3 1 
ATOM   7353 C CZ2 . TRP B 2 410 ? 41.447  -29.200 6.374   1.00 72.66  ? 410  TRP B CZ2 1 
ATOM   7354 C CZ3 . TRP B 2 410 ? 39.836  -27.912 7.640   1.00 59.44  ? 410  TRP B CZ3 1 
ATOM   7355 C CH2 . TRP B 2 410 ? 40.590  -28.139 6.475   1.00 62.75  ? 410  TRP B CH2 1 
ATOM   7356 N N   . ILE B 2 411 ? 38.349  -29.687 12.175  1.00 53.92  ? 411  ILE B N   1 
ATOM   7357 C CA  . ILE B 2 411 ? 37.543  -28.505 12.466  1.00 52.01  ? 411  ILE B CA  1 
ATOM   7358 C C   . ILE B 2 411 ? 38.399  -27.456 13.145  1.00 52.46  ? 411  ILE B C   1 
ATOM   7359 O O   . ILE B 2 411 ? 38.873  -27.637 14.265  1.00 51.63  ? 411  ILE B O   1 
ATOM   7360 C CB  . ILE B 2 411 ? 36.334  -28.823 13.404  1.00 53.34  ? 411  ILE B CB  1 
ATOM   7361 C CG1 . ILE B 2 411 ? 35.391  -29.823 12.727  1.00 60.93  ? 411  ILE B CG1 1 
ATOM   7362 C CG2 . ILE B 2 411 ? 35.564  -27.535 13.749  1.00 44.29  ? 411  ILE B CG2 1 
ATOM   7363 C CD1 . ILE B 2 411 ? 34.178  -30.207 13.581  1.00 48.14  ? 411  ILE B CD1 1 
ATOM   7364 N N   . PRO B 2 412 ? 38.617  -26.338 12.461  1.00 54.89  ? 412  PRO B N   1 
ATOM   7365 C CA  . PRO B 2 412 ? 39.431  -25.262 13.039  1.00 58.35  ? 412  PRO B CA  1 
ATOM   7366 C C   . PRO B 2 412 ? 38.657  -24.634 14.178  1.00 58.34  ? 412  PRO B C   1 
ATOM   7367 O O   . PRO B 2 412 ? 37.483  -24.945 14.375  1.00 59.10  ? 412  PRO B O   1 
ATOM   7368 C CB  . PRO B 2 412 ? 39.593  -24.288 11.879  1.00 56.41  ? 412  PRO B CB  1 
ATOM   7369 C CG  . PRO B 2 412 ? 38.277  -24.479 11.105  1.00 52.54  ? 412  PRO B CG  1 
ATOM   7370 C CD  . PRO B 2 412 ? 38.085  -25.978 11.131  1.00 45.54  ? 412  PRO B CD  1 
ATOM   7371 N N   . GLU B 2 413 ? 39.309  -23.769 14.940  1.00 57.37  ? 413  GLU B N   1 
ATOM   7372 C CA  . GLU B 2 413 ? 38.605  -23.094 16.014  1.00 60.07  ? 413  GLU B CA  1 
ATOM   7373 C C   . GLU B 2 413 ? 38.107  -21.827 15.363  1.00 56.39  ? 413  GLU B C   1 
ATOM   7374 O O   . GLU B 2 413 ? 38.561  -21.469 14.287  1.00 52.53  ? 413  GLU B O   1 
ATOM   7375 C CB  . GLU B 2 413 ? 39.546  -22.752 17.171  1.00 72.56  ? 413  GLU B CB  1 
ATOM   7376 C CG  . GLU B 2 413 ? 39.518  -23.748 18.326  1.00 94.87  ? 413  GLU B CG  1 
ATOM   7377 C CD  . GLU B 2 413 ? 40.178  -23.195 19.603  1.00 120.57 ? 413  GLU B CD  1 
ATOM   7378 O OE1 . GLU B 2 413 ? 41.425  -23.221 19.707  1.00 134.31 ? 413  GLU B OE1 1 
ATOM   7379 O OE2 . GLU B 2 413 ? 39.448  -22.721 20.505  1.00 127.23 ? 413  GLU B OE2 1 
ATOM   7380 N N   . TRP B 2 414 ? 37.181  -21.139 16.004  1.00 63.94  ? 414  TRP B N   1 
ATOM   7381 C CA  . TRP B 2 414 ? 36.683  -19.926 15.404  1.00 65.27  ? 414  TRP B CA  1 
ATOM   7382 C C   . TRP B 2 414 ? 35.844  -19.083 16.336  1.00 69.97  ? 414  TRP B C   1 
ATOM   7383 O O   . TRP B 2 414 ? 35.237  -19.597 17.275  1.00 74.58  ? 414  TRP B O   1 
ATOM   7384 C CB  . TRP B 2 414 ? 35.865  -20.270 14.159  1.00 60.53  ? 414  TRP B CB  1 
ATOM   7385 C CG  . TRP B 2 414 ? 34.761  -21.257 14.387  1.00 58.14  ? 414  TRP B CG  1 
ATOM   7386 C CD1 . TRP B 2 414 ? 33.832  -21.224 15.379  1.00 61.68  ? 414  TRP B CD1 1 
ATOM   7387 C CD2 . TRP B 2 414 ? 34.404  -22.364 13.542  1.00 56.34  ? 414  TRP B CD2 1 
ATOM   7388 N NE1 . TRP B 2 414 ? 32.912  -22.233 15.207  1.00 58.89  ? 414  TRP B NE1 1 
ATOM   7389 C CE2 . TRP B 2 414 ? 33.238  -22.949 14.086  1.00 52.95  ? 414  TRP B CE2 1 
ATOM   7390 C CE3 . TRP B 2 414 ? 34.952  -22.915 12.377  1.00 65.61  ? 414  TRP B CE3 1 
ATOM   7391 C CZ2 . TRP B 2 414 ? 32.604  -24.058 13.502  1.00 57.59  ? 414  TRP B CZ2 1 
ATOM   7392 C CZ3 . TRP B 2 414 ? 34.322  -24.023 11.794  1.00 64.23  ? 414  TRP B CZ3 1 
ATOM   7393 C CH2 . TRP B 2 414 ? 33.158  -24.579 12.363  1.00 57.16  ? 414  TRP B CH2 1 
ATOM   7394 N N   . GLU B 2 415 ? 35.840  -17.780 16.073  1.00 74.73  ? 415  GLU B N   1 
ATOM   7395 C CA  . GLU B 2 415 ? 35.037  -16.825 16.833  1.00 78.56  ? 415  GLU B CA  1 
ATOM   7396 C C   . GLU B 2 415 ? 34.340  -15.918 15.810  1.00 70.63  ? 415  GLU B C   1 
ATOM   7397 O O   . GLU B 2 415 ? 34.722  -15.909 14.640  1.00 68.60  ? 415  GLU B O   1 
ATOM   7398 C CB  . GLU B 2 415 ? 35.910  -16.001 17.781  1.00 90.19  ? 415  GLU B CB  1 
ATOM   7399 C CG  . GLU B 2 415 ? 36.968  -15.137 17.105  1.00 106.81 ? 415  GLU B CG  1 
ATOM   7400 C CD  . GLU B 2 415 ? 37.525  -14.075 18.052  1.00 112.94 ? 415  GLU B CD  1 
ATOM   7401 O OE1 . GLU B 2 415 ? 38.754  -14.071 18.282  1.00 113.74 ? 415  GLU B OE1 1 
ATOM   7402 O OE2 . GLU B 2 415 ? 36.728  -13.250 18.566  1.00 108.65 ? 415  GLU B OE2 1 
ATOM   7403 N N   . PHE B 2 416 ? 33.331  -15.157 16.226  1.00 67.99  ? 416  PHE B N   1 
ATOM   7404 C CA  . PHE B 2 416 ? 32.619  -14.302 15.273  1.00 73.36  ? 416  PHE B CA  1 
ATOM   7405 C C   . PHE B 2 416 ? 32.755  -12.780 15.508  1.00 75.22  ? 416  PHE B C   1 
ATOM   7406 O O   . PHE B 2 416 ? 32.518  -12.253 16.613  1.00 68.47  ? 416  PHE B O   1 
ATOM   7407 C CB  . PHE B 2 416 ? 31.160  -14.759 15.224  1.00 78.10  ? 416  PHE B CB  1 
ATOM   7408 C CG  . PHE B 2 416 ? 31.003  -16.272 15.104  1.00 72.88  ? 416  PHE B CG  1 
ATOM   7409 C CD1 . PHE B 2 416 ? 30.812  -17.065 16.232  1.00 64.30  ? 416  PHE B CD1 1 
ATOM   7410 C CD2 . PHE B 2 416 ? 31.074  -16.905 13.854  1.00 82.91  ? 416  PHE B CD2 1 
ATOM   7411 C CE1 . PHE B 2 416 ? 30.692  -18.468 16.116  1.00 60.41  ? 416  PHE B CE1 1 
ATOM   7412 C CE2 . PHE B 2 416 ? 30.957  -18.311 13.731  1.00 66.88  ? 416  PHE B CE2 1 
ATOM   7413 C CZ  . PHE B 2 416 ? 30.766  -19.085 14.863  1.00 59.03  ? 416  PHE B CZ  1 
ATOM   7414 N N   . VAL B 2 417 ? 33.121  -12.069 14.447  1.00 78.76  ? 417  VAL B N   1 
ATOM   7415 C CA  . VAL B 2 417 ? 33.373  -10.647 14.579  1.00 91.32  ? 417  VAL B CA  1 
ATOM   7416 C C   . VAL B 2 417 ? 32.575  -9.701  13.703  1.00 105.78 ? 417  VAL B C   1 
ATOM   7417 O O   . VAL B 2 417 ? 31.745  -10.131 12.891  1.00 107.67 ? 417  VAL B O   1 
ATOM   7418 C CB  . VAL B 2 417 ? 34.860  -10.377 14.327  1.00 90.43  ? 417  VAL B CB  1 
ATOM   7419 C CG1 . VAL B 2 417 ? 35.698  -11.185 15.289  1.00 89.90  ? 417  VAL B CG1 1 
ATOM   7420 C CG2 . VAL B 2 417 ? 35.223  -10.770 12.902  1.00 88.73  ? 417  VAL B CG2 1 
ATOM   7421 N N   . ASN B 2 418 ? 32.857  -8.405  13.892  1.00 116.02 ? 418  ASN B N   1 
ATOM   7422 C CA  . ASN B 2 418 ? 32.232  -7.302  13.154  1.00 120.01 ? 418  ASN B CA  1 
ATOM   7423 C C   . ASN B 2 418 ? 33.289  -6.485  12.402  1.00 121.79 ? 418  ASN B C   1 
ATOM   7424 O O   . ASN B 2 418 ? 33.775  -5.465  12.899  1.00 116.31 ? 418  ASN B O   1 
ATOM   7425 C CB  . ASN B 2 418 ? 31.456  -6.380  14.108  1.00 118.33 ? 418  ASN B CB  1 
ATOM   7426 C CG  . ASN B 2 418 ? 30.278  -7.088  14.796  1.00 110.65 ? 418  ASN B CG  1 
ATOM   7427 O OD1 . ASN B 2 418 ? 29.344  -7.561  14.137  1.00 88.87  ? 418  ASN B OD1 1 
ATOM   7428 N ND2 . ASN B 2 418 ? 30.324  -7.156  16.129  1.00 109.64 ? 418  ASN B ND2 1 
ATOM   7429 N N   . THR B 2 419 ? 33.629  -6.957  11.202  1.00 129.15 ? 419  THR B N   1 
ATOM   7430 C CA  . THR B 2 419 ? 34.622  -6.326  10.330  1.00 134.13 ? 419  THR B CA  1 
ATOM   7431 C C   . THR B 2 419 ? 34.408  -4.824  10.183  1.00 138.65 ? 419  THR B C   1 
ATOM   7432 O O   . THR B 2 419 ? 33.280  -4.364  9.988   1.00 134.34 ? 419  THR B O   1 
ATOM   7433 C CB  . THR B 2 419 ? 34.623  -6.973  8.878   1.00 131.69 ? 419  THR B CB  1 
ATOM   7434 O OG1 . THR B 2 419 ? 35.424  -8.164  8.870   1.00 122.97 ? 419  THR B OG1 1 
ATOM   7435 C CG2 . THR B 2 419 ? 35.183  -6.001  7.826   1.00 131.89 ? 419  THR B CG2 1 
ATOM   7436 N N   . PRO B 2 420 ? 35.494  -4.040  10.324  1.00 145.23 ? 420  PRO B N   1 
ATOM   7437 C CA  . PRO B 2 420 ? 35.480  -2.574  10.197  1.00 148.81 ? 420  PRO B CA  1 
ATOM   7438 C C   . PRO B 2 420 ? 35.518  -2.208  8.701   1.00 149.99 ? 420  PRO B C   1 
ATOM   7439 O O   . PRO B 2 420 ? 36.346  -2.736  7.949   1.00 149.99 ? 420  PRO B O   1 
ATOM   7440 C CB  . PRO B 2 420 ? 36.759  -2.145  10.922  1.00 146.07 ? 420  PRO B CB  1 
ATOM   7441 C CG  . PRO B 2 420 ? 36.962  -3.239  11.928  1.00 146.32 ? 420  PRO B CG  1 
ATOM   7442 C CD  . PRO B 2 420 ? 36.670  -4.470  11.101  1.00 145.28 ? 420  PRO B CD  1 
ATOM   7443 N N   . PRO B 2 421 ? 34.618  -1.307  8.251   1.00 149.98 ? 421  PRO B N   1 
ATOM   7444 C CA  . PRO B 2 421 ? 34.547  -0.874  6.845   1.00 149.99 ? 421  PRO B CA  1 
ATOM   7445 C C   . PRO B 2 421 ? 35.876  -0.384  6.266   1.00 149.06 ? 421  PRO B C   1 
ATOM   7446 O O   . PRO B 2 421 ? 36.090  -0.450  5.051   1.00 145.26 ? 421  PRO B O   1 
ATOM   7447 C CB  . PRO B 2 421 ? 33.493  0.233   6.876   1.00 149.99 ? 421  PRO B CB  1 
ATOM   7448 C CG  . PRO B 2 421 ? 32.576  -0.218  7.979   1.00 149.99 ? 421  PRO B CG  1 
ATOM   7449 C CD  . PRO B 2 421 ? 33.555  -0.663  9.048   1.00 149.99 ? 421  PRO B CD  1 
ATOM   7450 N N   . LEU B 2 422 ? 36.756  0.105   7.143   1.00 148.35 ? 422  LEU B N   1 
ATOM   7451 C CA  . LEU B 2 422 ? 38.068  0.611   6.747   1.00 145.12 ? 422  LEU B CA  1 
ATOM   7452 C C   . LEU B 2 422 ? 39.053  -0.502  6.388   1.00 143.84 ? 422  LEU B C   1 
ATOM   7453 O O   . LEU B 2 422 ? 39.835  -0.354  5.446   1.00 140.91 ? 422  LEU B O   1 
ATOM   7454 C CB  . LEU B 2 422 ? 38.662  1.488   7.859   1.00 143.69 ? 422  LEU B CB  1 
ATOM   7455 C CG  . LEU B 2 422 ? 38.078  2.899   8.008   1.00 141.83 ? 422  LEU B CG  1 
ATOM   7456 C CD1 . LEU B 2 422 ? 38.703  3.611   9.205   1.00 135.38 ? 422  LEU B CD1 1 
ATOM   7457 C CD2 . LEU B 2 422 ? 38.329  3.683   6.724   1.00 138.62 ? 422  LEU B CD2 1 
ATOM   7458 N N   . VAL B 2 423 ? 39.017  -1.612  7.126   1.00 142.19 ? 423  VAL B N   1 
ATOM   7459 C CA  . VAL B 2 423 ? 39.921  -2.725  6.845   1.00 137.65 ? 423  VAL B CA  1 
ATOM   7460 C C   . VAL B 2 423 ? 39.625  -3.392  5.501   1.00 139.36 ? 423  VAL B C   1 
ATOM   7461 O O   . VAL B 2 423 ? 40.551  -3.737  4.776   1.00 140.35 ? 423  VAL B O   1 
ATOM   7462 C CB  . VAL B 2 423 ? 39.869  -3.804  7.935   1.00 132.04 ? 423  VAL B CB  1 
ATOM   7463 C CG1 . VAL B 2 423 ? 38.567  -4.587  7.845   1.00 128.04 ? 423  VAL B CG1 1 
ATOM   7464 C CG2 . VAL B 2 423 ? 41.062  -4.735  7.779   1.00 127.65 ? 423  VAL B CG2 1 
ATOM   7465 N N   . LYS B 2 424 ? 38.345  -3.594  5.182   1.00 139.24 ? 424  LYS B N   1 
ATOM   7466 C CA  . LYS B 2 424 ? 37.954  -4.194  3.902   1.00 136.83 ? 424  LYS B CA  1 
ATOM   7467 C C   . LYS B 2 424 ? 38.518  -3.293  2.796   1.00 142.17 ? 424  LYS B C   1 
ATOM   7468 O O   . LYS B 2 424 ? 39.044  -3.772  1.790   1.00 144.58 ? 424  LYS B O   1 
ATOM   7469 C CB  . LYS B 2 424 ? 36.418  -4.259  3.787   1.00 128.44 ? 424  LYS B CB  1 
ATOM   7470 C CG  . LYS B 2 424 ? 35.874  -4.697  2.411   1.00 119.57 ? 424  LYS B CG  1 
ATOM   7471 C CD  . LYS B 2 424 ? 34.715  -3.795  1.945   1.00 111.27 ? 424  LYS B CD  1 
ATOM   7472 C CE  . LYS B 2 424 ? 34.034  -4.299  0.668   1.00 101.07 ? 424  LYS B CE  1 
ATOM   7473 N NZ  . LYS B 2 424 ? 34.918  -4.347  -0.531  1.00 94.43  ? 424  LYS B NZ  1 
ATOM   7474 N N   . LEU B 2 425 ? 38.406  -1.983  3.018   1.00 144.43 ? 425  LEU B N   1 
ATOM   7475 C CA  . LEU B 2 425 ? 38.870  -0.937  2.102   1.00 142.63 ? 425  LEU B CA  1 
ATOM   7476 C C   . LEU B 2 425 ? 40.370  -1.046  1.834   1.00 143.79 ? 425  LEU B C   1 
ATOM   7477 O O   . LEU B 2 425 ? 40.832  -0.910  0.698   1.00 144.31 ? 425  LEU B O   1 
ATOM   7478 C CB  . LEU B 2 425 ? 38.552  0.438   2.720   1.00 135.84 ? 425  LEU B CB  1 
ATOM   7479 C CG  . LEU B 2 425 ? 38.728  1.788   2.010   1.00 135.75 ? 425  LEU B CG  1 
ATOM   7480 C CD1 . LEU B 2 425 ? 38.101  2.860   2.884   1.00 130.21 ? 425  LEU B CD1 1 
ATOM   7481 C CD2 . LEU B 2 425 ? 40.193  2.114   1.753   1.00 135.00 ? 425  LEU B CD2 1 
ATOM   7482 N N   . TRP B 2 426 ? 41.121  -1.313  2.895   1.00 141.97 ? 426  TRP B N   1 
ATOM   7483 C CA  . TRP B 2 426 ? 42.568  -1.403  2.811   1.00 141.56 ? 426  TRP B CA  1 
ATOM   7484 C C   . TRP B 2 426 ? 43.164  -2.710  2.240   1.00 139.39 ? 426  TRP B C   1 
ATOM   7485 O O   . TRP B 2 426 ? 44.385  -2.902  2.236   1.00 139.47 ? 426  TRP B O   1 
ATOM   7486 C CB  . TRP B 2 426 ? 43.141  -1.058  4.198   1.00 142.84 ? 426  TRP B CB  1 
ATOM   7487 C CG  . TRP B 2 426 ? 42.806  0.387   4.620   1.00 148.23 ? 426  TRP B CG  1 
ATOM   7488 C CD1 . TRP B 2 426 ? 42.571  1.450   3.781   1.00 146.47 ? 426  TRP B CD1 1 
ATOM   7489 C CD2 . TRP B 2 426 ? 42.767  0.927   5.957   1.00 147.64 ? 426  TRP B CD2 1 
ATOM   7490 N NE1 . TRP B 2 426 ? 42.397  2.605   4.505   1.00 143.19 ? 426  TRP B NE1 1 
ATOM   7491 C CE2 . TRP B 2 426 ? 42.513  2.316   5.840   1.00 145.65 ? 426  TRP B CE2 1 
ATOM   7492 C CE3 . TRP B 2 426 ? 42.924  0.376   7.239   1.00 141.90 ? 426  TRP B CE3 1 
ATOM   7493 C CZ2 . TRP B 2 426 ? 42.417  3.158   6.954   1.00 144.35 ? 426  TRP B CZ2 1 
ATOM   7494 C CZ3 . TRP B 2 426 ? 42.830  1.221   8.350   1.00 137.38 ? 426  TRP B CZ3 1 
ATOM   7495 C CH2 . TRP B 2 426 ? 42.579  2.593   8.195   1.00 142.25 ? 426  TRP B CH2 1 
ATOM   7496 N N   . TYR B 2 427 ? 42.302  -3.594  1.736   1.00 135.59 ? 427  TYR B N   1 
ATOM   7497 C CA  . TYR B 2 427 ? 42.741  -4.864  1.144   1.00 128.40 ? 427  TYR B CA  1 
ATOM   7498 C C   . TYR B 2 427 ? 42.134  -5.074  -0.252  1.00 123.25 ? 427  TYR B C   1 
ATOM   7499 O O   . TYR B 2 427 ? 41.083  -4.514  -0.590  1.00 117.16 ? 427  TYR B O   1 
ATOM   7500 C CB  . TYR B 2 427 ? 42.386  -6.063  2.059   1.00 129.01 ? 427  TYR B CB  1 
ATOM   7501 C CG  . TYR B 2 427 ? 43.270  -6.212  3.294   1.00 121.74 ? 427  TYR B CG  1 
ATOM   7502 C CD1 . TYR B 2 427 ? 44.635  -6.485  3.168   1.00 108.91 ? 427  TYR B CD1 1 
ATOM   7503 C CD2 . TYR B 2 427 ? 42.750  -6.022  4.583   1.00 117.25 ? 427  TYR B CD2 1 
ATOM   7504 C CE1 . TYR B 2 427 ? 45.456  -6.555  4.281   1.00 102.90 ? 427  TYR B CE1 1 
ATOM   7505 C CE2 . TYR B 2 427 ? 43.567  -6.089  5.705   1.00 108.36 ? 427  TYR B CE2 1 
ATOM   7506 C CZ  . TYR B 2 427 ? 44.916  -6.351  5.543   1.00 108.62 ? 427  TYR B CZ  1 
ATOM   7507 O OH  . TYR B 2 427 ? 45.736  -6.375  6.638   1.00 113.71 ? 427  TYR B OH  1 
ATOM   7508 N N   . GLN B 2 428 ? 42.822  -5.890  -1.047  1.00 123.74 ? 428  GLN B N   1 
ATOM   7509 C CA  . GLN B 2 428 ? 42.447  -6.231  -2.423  1.00 125.25 ? 428  GLN B CA  1 
ATOM   7510 C C   . GLN B 2 428 ? 42.789  -5.113  -3.409  1.00 122.16 ? 428  GLN B C   1 
ATOM   7511 O O   . GLN B 2 428 ? 42.111  -5.014  -4.461  1.00 118.04 ? 428  GLN B O   1 
ATOM   7512 C CB  . GLN B 2 428 ? 40.951  -6.570  -2.533  1.00 127.52 ? 428  GLN B CB  1 
ATOM   7513 C CG  . GLN B 2 428 ? 40.607  -7.307  -3.838  1.00 126.58 ? 428  GLN B CG  1 
ATOM   7514 C CD  . GLN B 2 428 ? 39.156  -7.754  -3.928  1.00 125.54 ? 428  GLN B CD  1 
ATOM   7515 O OE1 . GLN B 2 428 ? 38.827  -8.687  -4.663  1.00 114.42 ? 428  GLN B OE1 1 
ATOM   7516 N NE2 . GLN B 2 428 ? 38.281  -7.080  -3.194  1.00 137.91 ? 428  GLN B NE2 1 
HETATM 7517 P P   . PO4 C 3 .   ? 10.627  -43.854 48.474  1.00 149.94 ? 1300 PO4 A P   1 
HETATM 7518 O O1  . PO4 C 3 .   ? 10.825  -43.558 49.929  1.00 149.99 ? 1300 PO4 A O1  1 
HETATM 7519 O O2  . PO4 C 3 .   ? 9.531   -44.857 48.316  1.00 149.97 ? 1300 PO4 A O2  1 
HETATM 7520 O O3  . PO4 C 3 .   ? 10.260  -42.600 47.757  1.00 149.99 ? 1300 PO4 A O3  1 
HETATM 7521 O O4  . PO4 C 3 .   ? 11.890  -44.402 47.891  1.00 149.99 ? 1300 PO4 A O4  1 
HETATM 7522 P P   . PO4 D 3 .   ? 1.370   -1.000  16.830  1.00 146.18 ? 1301 PO4 A P   1 
HETATM 7523 O O1  . PO4 D 3 .   ? 0.068   -0.520  16.297  1.00 130.83 ? 1301 PO4 A O1  1 
HETATM 7524 O O2  . PO4 D 3 .   ? 1.833   -2.177  16.046  1.00 142.35 ? 1301 PO4 A O2  1 
HETATM 7525 O O3  . PO4 D 3 .   ? 2.374   0.084   16.710  1.00 141.77 ? 1301 PO4 A O3  1 
HETATM 7526 O O4  . PO4 D 3 .   ? 1.205   -1.387  18.264  1.00 140.82 ? 1301 PO4 A O4  1 
HETATM 7527 N N1  . NVP E 4 .   ? 1.682   -37.483 21.071  1.00 46.86  ? 999  NVP A N1  1 
HETATM 7528 C CA  . NVP E 4 .   ? 2.287   -38.675 20.469  1.00 55.49  ? 999  NVP A CA  1 
HETATM 7529 C CB  . NVP E 4 .   ? 2.686   -39.761 21.407  1.00 62.98  ? 999  NVP A CB  1 
HETATM 7530 C CC  . NVP E 4 .   ? 1.484   -39.922 20.540  1.00 71.96  ? 999  NVP A CC  1 
HETATM 7531 N N3  . NVP E 4 .   ? 3.879   -36.624 21.393  1.00 77.74  ? 999  NVP A N3  1 
HETATM 7532 C C4  . NVP E 4 .   ? 4.763   -35.939 22.172  1.00 73.98  ? 999  NVP A C4  1 
HETATM 7533 C C5  . NVP E 4 .   ? 4.372   -35.277 23.354  1.00 58.58  ? 999  NVP A C5  1 
HETATM 7534 C C6  . NVP E 4 .   ? 3.033   -35.316 23.732  1.00 60.75  ? 999  NVP A C6  1 
HETATM 7535 C CD  . NVP E 4 .   ? 2.591   -34.635 25.000  1.00 55.96  ? 999  NVP A CD  1 
HETATM 7536 C C2  . NVP E 4 .   ? 2.582   -36.664 21.778  1.00 67.84  ? 999  NVP A C2  1 
HETATM 7537 C C7  . NVP E 4 .   ? 2.115   -36.004 22.927  1.00 64.97  ? 999  NVP A C7  1 
HETATM 7538 N N8  . NVP E 4 .   ? 0.713   -35.931 23.215  1.00 54.71  ? 999  NVP A N8  1 
HETATM 7539 C C9  . NVP E 4 .   ? -0.369  -35.914 22.427  1.00 59.27  ? 999  NVP A C9  1 
HETATM 7540 O OE  . NVP E 4 .   ? -1.496  -35.759 22.913  1.00 67.65  ? 999  NVP A OE  1 
HETATM 7541 C C10 . NVP E 4 .   ? -0.228  -35.997 20.891  1.00 48.11  ? 999  NVP A C10 1 
HETATM 7542 C C15 . NVP E 4 .   ? 0.767   -36.805 20.264  1.00 46.59  ? 999  NVP A C15 1 
HETATM 7543 C C11 . NVP E 4 .   ? -1.160  -35.341 20.080  1.00 46.50  ? 999  NVP A C11 1 
HETATM 7544 C C12 . NVP E 4 .   ? -1.090  -35.503 18.676  1.00 62.08  ? 999  NVP A C12 1 
HETATM 7545 C C13 . NVP E 4 .   ? -0.064  -36.331 18.132  1.00 64.55  ? 999  NVP A C13 1 
HETATM 7546 N N14 . NVP E 4 .   ? 0.846   -36.966 18.920  1.00 52.65  ? 999  NVP A N14 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  ?   ?   ?   A . n 
A 1 64  LYS 64  64  ?   ?   ?   A . n 
A 1 65  LYS 65  65  ?   ?   ?   A . n 
A 1 66  LYS 66  66  ?   ?   ?   A . n 
A 1 67  ASP 67  67  ?   ?   ?   A . n 
A 1 68  SER 68  68  ?   ?   ?   A . n 
A 1 69  THR 69  69  ?   ?   ?   A . n 
A 1 70  LYS 70  70  ?   ?   ?   A . n 
A 1 71  TRP 71  71  ?   ?   ?   A . n 
A 1 72  ARG 72  72  ?   ?   ?   A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLN 258 258 258 GLN GLN A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 CSD 280 280 280 CSD CSD A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 ?   ?   ?   A . n 
A 1 445 ALA 445 445 ?   ?   ?   A . n 
A 1 446 ALA 446 446 ?   ?   ?   A . n 
A 1 447 ASN 447 447 ?   ?   ?   A . n 
A 1 448 ARG 448 448 ?   ?   ?   A . n 
A 1 449 GLU 449 449 ?   ?   ?   A . n 
A 1 450 THR 450 450 ?   ?   ?   A . n 
A 1 451 LYS 451 451 ?   ?   ?   A . n 
A 1 452 LEU 452 452 ?   ?   ?   A . n 
A 1 453 GLY 453 453 ?   ?   ?   A . n 
A 1 454 LYS 454 454 ?   ?   ?   A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 ARG 461 461 461 ARG ARG A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 TYR 483 483 483 TYR TYR A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 ?   ?   ?   A . n 
A 1 539 HIS 539 539 ?   ?   ?   A . n 
A 1 540 LYS 540 540 ?   ?   ?   A . n 
A 1 541 GLY 541 541 ?   ?   ?   A . n 
A 1 542 ILE 542 542 ?   ?   ?   A . n 
A 1 543 GLY 543 543 ?   ?   ?   A . n 
A 1 544 GLY 544 544 ?   ?   ?   A . n 
A 1 545 ASN 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 GLN 547 547 ?   ?   ?   A . n 
A 1 548 VAL 548 548 ?   ?   ?   A . n 
A 1 549 ASP 549 549 ?   ?   ?   A . n 
A 1 550 LYS 550 550 ?   ?   ?   A . n 
A 1 551 LEU 551 551 ?   ?   ?   A . n 
A 1 552 VAL 552 552 ?   ?   ?   A . n 
A 1 553 SER 553 553 ?   ?   ?   A . n 
A 1 554 ALA 554 554 ?   ?   ?   A . n 
A 1 555 GLY 555 555 ?   ?   ?   A . n 
A 1 556 ILE 556 556 ?   ?   ?   A . n 
A 1 557 ARG 557 557 ?   ?   ?   A . n 
A 1 558 LYS 558 558 ?   ?   ?   A . n 
A 1 559 VAL 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   ?   ?   ?   B . n 
B 2 6   GLU 6   6   ?   ?   ?   B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  87  PHE PHE B . n 
B 2 88  TRP 88  88  ?   ?   ?   B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  ?   ?   ?   B . n 
B 2 94  ILE 94  94  ?   ?   ?   B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 ?   ?   ?   B . n 
B 2 215 TYR 215 215 ?   ?   ?   B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 225 PRO PRO B . n 
B 2 226 PRO 226 226 226 PRO PRO B . n 
B 2 227 PHE 227 227 227 PHE PHE B . n 
B 2 228 LEU 228 228 228 LEU LEU B . n 
B 2 229 TRP 229 229 229 TRP TRP B . n 
B 2 230 MET 230 230 230 MET MET B . n 
B 2 231 GLY 231 231 231 GLY GLY B . n 
B 2 232 TYR 232 232 232 TYR TYR B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 CYS 280 280 280 CYS CYS B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 ?   ?   ?   B . n 
B 2 358 ARG 358 358 ?   ?   ?   B . n 
B 2 359 GLY 359 359 ?   ?   ?   B . n 
B 2 360 ALA 360 360 ?   ?   ?   B . n 
B 2 361 HIS 361 361 ?   ?   ?   B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 ?   ?   ?   B . n 
B 2 430 GLU 430 430 ?   ?   ?   B . n 
B 2 431 LYS 431 431 ?   ?   ?   B . n 
B 2 432 GLU 432 432 ?   ?   ?   B . n 
B 2 433 PRO 433 433 ?   ?   ?   B . n 
B 2 434 ILE 434 434 ?   ?   ?   B . n 
B 2 435 VAL 435 435 ?   ?   ?   B . n 
B 2 436 GLY 436 436 ?   ?   ?   B . n 
B 2 437 ALA 437 437 ?   ?   ?   B . n 
B 2 438 GLU 438 438 ?   ?   ?   B . n 
B 2 439 THR 439 439 ?   ?   ?   B . n 
B 2 440 PHE 440 440 ?   ?   ?   B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    CSD 
_pdbx_struct_mod_residue.label_seq_id     280 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     CSD 
_pdbx_struct_mod_residue.auth_seq_id      280 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          3-SULFINOALANINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5810  ? 
1 MORE         -43   ? 
1 'SSA (A^2)'  43330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-10-30 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
X-PLOR    'model building' .   ? 3 
CNS       refinement       1.0 ? 4 
X-PLOR    phasing          .   ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    277 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O3 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   PO4 
_pdbx_validate_close_contact.auth_seq_id_2    1301 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A THR 58  ? ? N A PRO 59  ? ? CA A PRO 59  ? ? 129.41 119.30 10.11  1.50 Y 
2 1 C A GLU 224 ? ? N A PRO 225 ? ? CA A PRO 225 ? ? 128.36 119.30 9.06   1.50 Y 
3 1 C A ASP 320 ? ? N A PRO 321 ? ? CA A PRO 321 ? ? 128.96 119.30 9.66   1.50 Y 
4 1 C A THR 419 ? ? N A PRO 420 ? ? CA A PRO 420 ? ? 109.44 119.30 -9.86  1.50 Y 
5 1 C B PRO 225 ? ? N B PRO 226 ? ? CA B PRO 226 ? ? 146.53 119.30 27.23  1.50 Y 
6 1 C B PRO 225 ? ? N B PRO 226 ? ? CD B PRO 226 ? ? 98.23  128.40 -30.17 2.10 Y 
7 1 C B PRO 226 ? ? N B PHE 227 ? ? CA B PHE 227 ? ? 106.00 121.70 -15.70 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 6   ? ? -56.12  170.79  
2  1 LYS A 20  ? ? -114.97 73.21   
3  1 LEU A 26  ? ? -98.35  -152.33 
4  1 PRO A 52  ? ? -57.66  28.35   
5  1 GLN A 85  ? ? -42.57  159.33  
6  1 GLU A 89  ? ? -36.37  129.99  
7  1 VAL A 90  ? ? -68.82  35.05   
8  1 GLN A 91  ? ? 33.16   108.26  
9  1 PRO A 119 ? ? -62.49  -177.14 
10 1 THR A 139 ? ? -96.60  -153.28 
11 1 PRO A 140 ? ? -60.24  -156.26 
12 1 ILE A 142 ? ? -33.90  127.41  
13 1 VAL A 148 ? ? -122.10 -153.89 
14 1 LYS A 154 ? ? -49.54  -71.04  
15 1 PHE A 160 ? ? -59.62  -70.36  
16 1 PRO A 170 ? ? -52.85  -76.10  
17 1 MET A 184 ? ? 58.43   -128.21 
18 1 LEU A 187 ? ? -160.22 105.39  
19 1 ILE A 195 ? ? -28.31  -44.43  
20 1 GLN A 222 ? ? -46.46  155.41  
21 1 MET A 230 ? ? 33.97   53.47   
22 1 PRO A 243 ? ? -31.96  148.25  
23 1 TRP A 266 ? ? -32.87  -36.69  
24 1 ILE A 270 ? ? -138.79 -47.57  
25 1 PRO A 321 ? ? -37.27  -26.87  
26 1 PRO A 345 ? ? -37.94  125.47  
27 1 PHE A 346 ? ? 58.37   -3.84   
28 1 TRP A 398 ? ? -54.54  -72.59  
29 1 TRP A 402 ? ? -40.33  -75.04  
30 1 THR A 403 ? ? -29.73  -35.29  
31 1 PRO A 412 ? ? -55.85  -153.01 
32 1 TYR A 501 ? ? -54.03  -70.08  
33 1 PRO B 14  ? ? -35.60  125.36  
34 1 ASP B 67  ? ? 36.75   36.35   
35 1 ILE B 167 ? ? -57.15  -8.46   
36 1 ASN B 175 ? ? -161.40 48.17   
37 1 PRO B 176 ? ? -66.50  14.19   
38 1 MET B 184 ? ? 49.31   -133.83 
39 1 LEU B 193 ? ? -53.18  177.10  
40 1 ILE B 195 ? ? -49.60  -16.03  
41 1 PRO B 226 ? ? -12.24  143.21  
42 1 ASP B 250 ? ? -52.91  -71.58  
43 1 ALA B 267 ? ? -48.53  -19.73  
44 1 THR B 286 ? ? -107.66 78.79   
45 1 GLN B 334 ? ? 49.50   20.13   
46 1 PHE B 346 ? ? 75.16   -23.82  
47 1 LYS B 350 ? ? -175.63 148.21  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 1   ? A PRO 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A ILE 63  ? A ILE 63  
5  1 Y 1 A LYS 64  ? A LYS 64  
6  1 Y 1 A LYS 65  ? A LYS 65  
7  1 Y 1 A LYS 66  ? A LYS 66  
8  1 Y 1 A ASP 67  ? A ASP 67  
9  1 Y 1 A SER 68  ? A SER 68  
10 1 Y 1 A THR 69  ? A THR 69  
11 1 Y 1 A LYS 70  ? A LYS 70  
12 1 Y 1 A TRP 71  ? A TRP 71  
13 1 Y 1 A ARG 72  ? A ARG 72  
14 1 Y 1 A GLY 444 ? A GLY 444 
15 1 Y 1 A ALA 445 ? A ALA 445 
16 1 Y 1 A ALA 446 ? A ALA 446 
17 1 Y 1 A ASN 447 ? A ASN 447 
18 1 Y 1 A ARG 448 ? A ARG 448 
19 1 Y 1 A GLU 449 ? A GLU 449 
20 1 Y 1 A THR 450 ? A THR 450 
21 1 Y 1 A LYS 451 ? A LYS 451 
22 1 Y 1 A LEU 452 ? A LEU 452 
23 1 Y 1 A GLY 453 ? A GLY 453 
24 1 Y 1 A LYS 454 ? A LYS 454 
25 1 Y 1 A ALA 538 ? A ALA 538 
26 1 Y 1 A HIS 539 ? A HIS 539 
27 1 Y 1 A LYS 540 ? A LYS 540 
28 1 Y 1 A GLY 541 ? A GLY 541 
29 1 Y 1 A ILE 542 ? A ILE 542 
30 1 Y 1 A GLY 543 ? A GLY 543 
31 1 Y 1 A GLY 544 ? A GLY 544 
32 1 Y 1 A ASN 545 ? A ASN 545 
33 1 Y 1 A GLU 546 ? A GLU 546 
34 1 Y 1 A GLN 547 ? A GLN 547 
35 1 Y 1 A VAL 548 ? A VAL 548 
36 1 Y 1 A ASP 549 ? A ASP 549 
37 1 Y 1 A LYS 550 ? A LYS 550 
38 1 Y 1 A LEU 551 ? A LEU 551 
39 1 Y 1 A VAL 552 ? A VAL 552 
40 1 Y 1 A SER 553 ? A SER 553 
41 1 Y 1 A ALA 554 ? A ALA 554 
42 1 Y 1 A GLY 555 ? A GLY 555 
43 1 Y 1 A ILE 556 ? A ILE 556 
44 1 Y 1 A ARG 557 ? A ARG 557 
45 1 Y 1 A LYS 558 ? A LYS 558 
46 1 Y 1 A VAL 559 ? A VAL 559 
47 1 Y 1 A LEU 560 ? A LEU 560 
48 1 Y 1 B PRO 1   ? B PRO 1   
49 1 Y 1 B ILE 2   ? B ILE 2   
50 1 Y 1 B SER 3   ? B SER 3   
51 1 Y 1 B PRO 4   ? B PRO 4   
52 1 Y 1 B ILE 5   ? B ILE 5   
53 1 Y 1 B GLU 6   ? B GLU 6   
54 1 Y 1 B TRP 88  ? B TRP 88  
55 1 Y 1 B GLU 89  ? B GLU 89  
56 1 Y 1 B VAL 90  ? B VAL 90  
57 1 Y 1 B GLN 91  ? B GLN 91  
58 1 Y 1 B LEU 92  ? B LEU 92  
59 1 Y 1 B GLY 93  ? B GLY 93  
60 1 Y 1 B ILE 94  ? B ILE 94  
61 1 Y 1 B LEU 214 ? B LEU 214 
62 1 Y 1 B TYR 215 ? B TYR 215 
63 1 Y 1 B THR 216 ? B THR 216 
64 1 Y 1 B PRO 217 ? B PRO 217 
65 1 Y 1 B ASP 218 ? B ASP 218 
66 1 Y 1 B LYS 219 ? B LYS 219 
67 1 Y 1 B LYS 220 ? B LYS 220 
68 1 Y 1 B HIS 221 ? B HIS 221 
69 1 Y 1 B GLN 222 ? B GLN 222 
70 1 Y 1 B LYS 223 ? B LYS 223 
71 1 Y 1 B GLU 224 ? B GLU 224 
72 1 Y 1 B MET 357 ? B MET 357 
73 1 Y 1 B ARG 358 ? B ARG 358 
74 1 Y 1 B GLY 359 ? B GLY 359 
75 1 Y 1 B ALA 360 ? B ALA 360 
76 1 Y 1 B HIS 361 ? B HIS 361 
77 1 Y 1 B LEU 429 ? B LEU 429 
78 1 Y 1 B GLU 430 ? B GLU 430 
79 1 Y 1 B LYS 431 ? B LYS 431 
80 1 Y 1 B GLU 432 ? B GLU 432 
81 1 Y 1 B PRO 433 ? B PRO 433 
82 1 Y 1 B ILE 434 ? B ILE 434 
83 1 Y 1 B VAL 435 ? B VAL 435 
84 1 Y 1 B GLY 436 ? B GLY 436 
85 1 Y 1 B ALA 437 ? B ALA 437 
86 1 Y 1 B GLU 438 ? B GLU 438 
87 1 Y 1 B THR 439 ? B THR 439 
88 1 Y 1 B PHE 440 ? B PHE 440 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHATE ION'                                                                      PO4 
4 "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" NVP 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PO4 1 1300 1300 PO4 PO4 A . 
D 3 PO4 1 1301 1301 PO4 PO4 A . 
E 4 NVP 1 999  999  NVP NVP A . 
#